3V4UL

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
total genus 58
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL01
2KL6A 4ZFFB 4RFNB 3BIAX 1OWRM 1NCUA 3V52L 2H8PA 4CVUA 1U8IA 1FL3B 4KK6C 1CICC 1HHHB 3NZ8B 5KOMC 4O02L 4JB9H 3WNOA 1RFDH 2D0HA 1I1YA 3SDXA 4QRPB 3GSVA 3MR9B 5TFSH 1KEML 3MRRA 3DVNA 1MAMH 3TO4B 1F4WL 4IMKC 3WUWG 1Q9WA 4Q6IA 4NM4L 2D7OA 4LLVA 4PJIA 1MI5E 1QBML 4B41A 5I71B 1QP1A 1XGYH 4IIQB 1A4JB 5EOTB 3WHE0 4Q0XH 4M43L 2X42A 1P53A 2P46B 4G9FD 2BOCB 4UQ3B 4FQXC 3ARSA 2W0FB 3QI9D 1I4FA 4N0RA 5D1ZD 4Y2DA 5KVDL 4M61B 4Z7WF 4GRMB 4YEFA 4HDIB 3BPCA 5JW3L 3UTTE 4DZ8A 3MZGB 2EIBA 3HZVB 5GRJL 2ARWA 3VXRA 4YDIL 3B43A 1I3GL 2OMBA 4P2RD 3VH8B 3X14B 1VGEH 3V6OC 5IK3A 1CYGA 4NRZB 5FYJU 3V5HB 3LRSB 1JK8B 5DK3A 3C5ZB 3DO7B 2WBJD 3MRKA 5C07A 1TCMA 2V5MA 3QYCA 3GMRB 5SWZD 1FNSL 2VAJA 2IALA 1EEZB 5JORA 4WO4B 1C7TA 1BLNA 3QJFB 1AI1L 1FBIH 4FFVD 4TULH 4JFFD 5E6YA 3FO1A 1S3KH 2D7TH 3B9AA 4KQ3L 1N4XH 1Y6NR 4JFQA 2HT3C 5DQDH 1XR8B 2XA8H 4HJGA 4HUWB 1B4JH 2M26A 3ARFC 4PJGF 2MJWA 5T1DL 2B20A 4NRXA 2ICEA 2D3VA 2XKUA 3RDTD 4HAFA 5DR5L 2MOVA 4KI5D 1PZUB 4GMTL 3PHQB 1PZ5B 3D2UA 1UT9A 2IWGA 2I26N 3O3UN 5E2TL 4HUKB 1D5XB 3MJ9L 3BI9X 2AJSL 1U8HB 4LEOB 3WFEH 4LMQI 2XN9E 5C7XH 3CC5B 3V5KB 3WKMH 4CKVX 1FORH 3NFSL 2YOCA 5KZCB 1E4KA 4M8QB 3HTLX 3EFDL 3EO0B 1KGCE 5GHWH 3HUJF 5TF0A 3I6LD 2E9WA 1KB5H 2ZG3A 1AY1L 1BQLH 4Q6YA 5E6IB 2QSQA 2W9LA 1KT2A 4K3DL 5JDSB 1LK2A 4NZTH 5DEFB 1NUGA 3KWWA 5L7XL 1X7QA 4HWEH 5ANME 4NOFA 5LJYH 1ODAA 2YD7A 1JNNL 3VD5A 3NBNA 1JCKA 1R3LA 5IHZA 1I1FA 3SEPA 5F6HJ 3GHBL 5EOCL 2J8UB 1CR9H 3LKQA 1EMTL 4F2MA 4HKZB 4JHWL 2A2QT 4MJ5A 5JPMA 1CD1A 3HB3C 2VLKA 3PE9A 1X6LA 2R4RL 4LFHD 3P0VH 2JJUA 5TDOA 1CFVH 2Z4QB 4UDUB 2UUDH 3B5HA 1MJ8H 4MAUH 3T2NL 2XZQL 2G75A 3HS0A 1IGCH 2E6PA 3GHEH 1MCOH 5CCKH 2QJDA 4DJMA 3NTCL 3R4DA 4I13B 4RMQA 1IGTB 1FG9C 5T3ZD 4RGOH 5E2WH 3WL9A 3NH7H 4OLEA 5GJTL 3J8F7 5JOFA 4WTZA 3HAEB 4M8VA 1KF9B 5IFJA 1T89C 3BN9D 5FM5O 5E8NA 3TIDB 2E8YA 3K4DA 5DURB 3WE6A 4NQCB 3V7MA 4GSDL 4JREC 4X4YB 1PQZB 3G6JF 4ODHH 3O3AB 2EDJA 5ADOL 5T3XE 1AFVL 5EUOF 3WN5B 2Z31C 2DMCA 1YMMB 5BRZE 5GGUB 4WFEE 4KPHL 4UOJA 3P0GB 1NL0H 5CMAA 2DQGL 3BZEB 4N8CH 1JTOA 2V7NA 4N0CC 2X4QB 2M2DA 5F7DB 2GK0A 2ITDA 3BRFA 2FJGA 1ZT4A 3O4OB 4N90D 3B9KC 3CX5J 4Z7QE 1JNLL 5AG9A 3H3KA 3V0WL 4K7PX 5H94B 4OGYL 3D85D 1RZ8A 3PWUB 2ADJA 2LQRA 2VLRE 4X5XB 4PJHE 2WQ8A 3GJEB 4CADB 1PG7H 3P4MB 1CICA 2KQNA 5JMOC 4F15B 1UWEL 3DUUB 1EPFA 1CE6A 2F54D 1CDGA 5E8OA 2E6JA 2DQJH 3VD9A 5DMIH 2Y7QB 4QHNA 5IG7A 3G5YA 3CX2A 2FD6H 4IMKA 3QDGE 1FV1B 4RA0C 1SYVA 4YHLH 4LHUA 1IGYB 2Y6SC 1HZHL 5GS1C 3QCVL 4ZYKB 1YYMH 3HNVH 4OAWA 3TJHD 1WWAX 2AKRA 4FQXA 3G6DL 4ZG1A 2DI9A 1T22A 1R3KA 3HC4L 1V3MA 3QDAA 2HTLC 1U0QA 2VXUH 5E8PA 5C0JA 5JXEC 2AXHA 4X6CA 4IS6A 4P23B 1T6WA 1S9XA 3LKNA 4YDKL 3VFNB 1Q0XL 4WI5A 5DUBA 1ADQH 1KJ3H 3MLSL 4FP8L 1KJ2H 1OTSD 3MNZA 3QDMD 4IDLA 3V6OA 3ZYJA 1HSBB 2FJFA 4MB5A 2BCKB 4JHAH 4L4VB 1F90H 1ZA3A 3EGSA 2HMIC 2R23B 3QUZA 4P5KB 3WIFA 1Z5LA 2Y23A 1FNHA 3CAFA 4Y4KB 1N6QL 3SQBA 3GFUA 1I1AC 3QA3B 5BS0E 1YEFL 1MH5B 1KIRB 4WDIA 1MLBA 4IRSD 3DYPA 4X99A 1AGBB 1A3QA 1LDPL 2YA1A 2VERN 3C9NA 3S36H 3O4LD 1KB9J 4DGYL 3V4PL 2E3VA 2R0ZL 1I85C 2AW2A 4NNYA 3ZTNH 3IJHA 3ARFA 1CFSB 2GJZB 1OP3K 1HWHB 1CDBA 2VISA 4PJBF 1YJDC 4OCWL 3OXRA 3DV4B 4M48H 1P4LA 3BP6B 4JKKA 2NZIA 2GTWB 1OSZA 1PYWB 4JDZA 1OM3H 4YQXL 3O2DL 1NPUA 4ZSOA 5J89A 4PJ9C 3U0WL 3ZHLA 5GSVA 4FQPA 5ITBH 3CZJA 1WFTA 5IMOB 4KTYA 4O58H 1ZMYA 2ZPKL 5GGSB 1HI6A 4PJFE 1KIQB 3GMOA 2CIKB 3EYVB 3LQAC 3WXWL 1CGTA 4JN2B 1AO7A 3CFEA 3CGTA 3DRQB 3FQTA 4CVXA 2PF6A 1AGCB 2KH2B 1RUKH 1BBDL 2JE8A 2XWTA 4NO2B 1BJ8A 4G3YL 5ISZE 4Z76B 5IVNA 3B83A 2CLZA 5MERA 1CGXA 4YPGA 3MRIB 1OP3H 1IAIL 4M5ZL 5FOJA 3U2SA 2UZXB 4QRTA 4LASL 1G9MH 5HDQL 3SOBH 4GAYB 4HSQA 2VITA 4JPWH 4ODSL 3GI8H 3DUSB 3GSNH 5EA0H 5CGMA 4UNTA 3AAZB 4K8RC 4I3RH 1MJUH 1OAXL 4XRCB 5TH2A 3P9WB 4NQSA 3PG2A 1QRNA 3MV8A 1SJHA 4N0UA 5CUSL 4N0FA 2DWEA 2OR8A 1MJJB 1BFOA 3I50H 2DQIL 5IHUH 5C0FA 2VABA 1S7WB 3E3QE 4TRPL 1TVHA 5FDYA 3F5WB 3HA0A 1U8JA 1GGTA 3QEHB 4R4BB 1D5MA 1VCAA 1WICA 4FQ2H 5LCVL 2V5TA 3QBTB 3WIHL 1L7TH 5ICXA 3ZZ1A 5E5UB 3QXVA 4CDHA 2VC2H 4OCNC 4OFYD 3FQRA 1TQCC 3WDIA 5ADPL 3L5WB 4XP1H 4Y2DD 1T89A 2VDNL 1F2QA 2OZ4H 4QRPE 1HYRC 3ARQA 4LSTH 2IADA 3C6SB 2LV4A 4HBCL 5FAAA 3MUHL 5EPMA 2D03L 1RAMA 4JANB 5BW7C 1DQQA 2GJ6A 2Z31A 3AB0B 4R96A 3C8HA 1BGXH 1WEJL 1YN6B 2BNRB 1YECL 2AJ3B 4G8FA 4Y16A 3MO1B 2FX8H 1KOAA 2AABL 1M71B 3C6LD 5TGBB 2FO4B 5ICZA 3B9KA 2DS4A 1QQDA 2JB6B 3RGVD 5MI0C 3ZHKA 4F7TA 2BVUA 3GKZA 3OF6A 3QWRA 4P4RB 3ILQC 4NZDA 4UIKL 3DETC 2HFFB 4KJQC 3T65B 1RJZB 3UAJD 3HE7B 2V5SA 5GGSY 4O2CB 5DHVB 1ZANH 4RGND 3QIBB 1NC2A 5J6HB 4EQ3A 3BGFC 5KJRL 1V8HA 3RX7A 4DN4L 1AJ7H 3MCKB 4CN6A 2V7HA 2EO1A 1K8IB 5ALCH 5JW5A 4KKBD 4AY0A 1NMAH 4OLWL 2ENYA 3QIWB 4XAKD 3HE6A 5CP7B 1MHEA 5GS1A 4P57A 2A6IB 4PYHA 5FDWA 3B2UD 4IHOA 4PV9B 4U49A 3UMTA 4NQDD 3AMKA 1Q9KB 1X9QA 4NQTA 5H2BA 1AP2B 43C9B 4UOW1 1F6FB 5JXEA 1F00I 1PW3A 1I8MB 2HLFD 4AEIH 2PCPB 1M1SA 4HHAB 5MEQB 2IQAA 1JRHI 2MMXA 1DEDA 4RWHA 1WLHA 4M9PA 1WK0A 3ROLB 1J8HB 3BT2H 4AMKL 1CQKA 5EU4A 3V4VL 4GG6A 4OZFB 3ECBA 3BEVB 2J2ZA 4JB9L 1J5OL 3MC0A 3ULUC 1CGUA 2WQRA 1OW0A 1U3YA 4KRMB 2VLKD 3DSFL 4QRQA 4PJ7A 5TQ2H 1LILA 1I1AA 2J88H 1A64A 5TFSL 5EU3B 1ZT7A 1XIWC 3ZHDA 5B4MD 1QFUL 4KAQH 3WFBH 3T0EC 3UTSA 5ELIA 4IOIA 1BZ9A 2HVJB 4WEMB 1A7RL 2XACC 2PUQT 2Y36H 2YPKA 4ZTOL 4GKNB 3H0TA 1MCJA 3E8UL 3W9EA 3O45A 5JLZB 5I66B 3P77A 3IS0X 1H5BB 1I85A 4PJIF 2Q3ZA 1IAOA 3OAZK 2J8UE 2AV7A 2Q8BL 3NIGE 4WWKD 2BDNH 5IV2A 1VB9A 1Q9LB 3O9WB 5GSRB 2D31A 5I1DB 2X4RB 3F12A 3EO1B 4FQIH 3EOAA 1SBSH 4JY4A 1IZKA 2VAAB 2O61B 1E27B 1RK1A 4UQ2B 4PJ9A 3FCTA 5D6CB 1MCPL 3VI4E 1YUHB 4K3JL 4JG0L 1OGAA 4ODWA 1LO3L 5KAQG 2YKLH 4KJYB 3PV6A 2Q6WB 3VFMB 1U8MB 1KJVA 1KENH 4H8WC 3A6BL 1F13A 2HRPH 1EO8L 1FBIL 1VKXA 2BMKA 4NQCE 4ZUWA 1S3KL 3MJ6A 4Z0XA 2A77L 5T5FH 2JJWA 2NXZD 5I1JH 5DQDL 1U95B 4EIGB 2R4SH 1YMME 4LF3A 5HGHB 3DMMC 3IFOB 4KK6D 2ZUUA 1CCZA 1HILB 1RZFH 3V7AG 2FB4H 1MHPL 4OD2A 4MWFA 2NY3C 4E42A 2IMMA 4LPVA 3REVA 5IMMB 2A6KA 4JM4L 2BVPB 4IEFB 4XXDB 1YN7B 3GBNH 3NCBB 1KXTB 5SWQA 5B39B 3MACH 4HX1B 4BFBD 2C1OB 5C7XL 5J13C 4O2FB 4MJ2A 4FQXD 1FORL 1XCQB 4UU9A 5E4EC 1YQVH 2WP3O 3PGCB 2EH8L 4H0IA 3DTXB 1RULH 1QFOA 5GHWL 4NSKB 3RNQA 2H32B 1Y6MR 3LH2H 1A8JH 4HFWA 2XOTA 1M7XA 1NDGB 3KDMA 1YC7A 1MWAH 4HIXL 3ARBA 3TFKD 3MMEA 5I0DA 1A7QH 1F11A 3PUCA 12E8H 4OLVL 2IBGA 5H35B 2BFVL 4YAQA 3V0AC 3DNKA 5BW7A 3QEGH 4IDJH 1JYWA 5B38B 4LLWB 2QADB 3HMXA 1G9NC 2VDKL 4KUCD 1KCRL 1CR9L 2VE6B 3EOTL 3KS0J 3QUZD 3U36A 1GZPA 3P0VL 4I0PB 1M7DB 4Y1AB 3QXUA 4JRXE 4Z7UF 3UYOD 3HR6A 1BECA 1MJ8L 2FHBA 4MD5B 3CH1A 3BIKA 4NKOB 3RWJA 3VGAB 3VXUA 1BOGB 1UH2A 3BGAA 2X89D 3RU8H 3ZE0E 4D9QE 3ZDXE 5E2WL 2FL5A 3NH7L 4H5SB 4L4VE 4LCUA 3ARFD 2VLJA 4ZMAT 1FVDB 1JGDB 3KXFD 3NAAH 3Q5TA 3LD8B 2H2PD 1T0NB 1Z0NA 3WEXA 4AIZA 4TOYH 3OKYA 1EEQA 2A6JA 1MCBA 2AV1B 4LPYA 2HLAA 3BAEL 4A6YH 4ODHL 3L3HA 3BX7C 4ZAKB 4ALAH 1YMHA 1L7IL 4MXQC 3VFWB 1A6ZB 3R1GH 4YWGH 4HD9A 3MGOB 5FV1L 3Q3GB 4N8CL 4RZCB 1U8LA 1G7JB 1P4IL 4ZO7A 4MD0B 1U2HA 1MLCB 1KCUH 5MENA 5EBLA 1AO7D 2CKBB 5FKPA 4O51B 1FJ1B 5FHBH 1U6AH 4M02A 1IE5A 4POYA 4JDVA 2ZUYA 3WFDH 5B3NA 4G7YH 4APQB 4P5TC 3OPZH 3I75A 1JGEA 4F58H 3SGDH 1I8IA 1ORQB 2YC1A 1UZ8B 4JFXB 5E9DE 2ICES 3IFLH 3OKEB 4YDLC 1PG7L 4I48A 1IARB 1DUYA 1ZKAA 1B88A 2ED8A 1TCRB 3MUJA 5I8EA 5I1IH 2FHFA 4J3XA 3EOBB 2CGRH 5D1QB 1QRND 3MV8D 2F19H 5DMIL 2FD6L 1XIWA 5HD8C 4GG8B 2N56A 2VDOL 4YHLL 5I74B 5TDNA 3T0EA 4HJJH 1I7ZB 4YLQT 2ZSVA 1BOYA 3HNVL 5K9JL 4NUGL 3E2HC 3RWEB 4GXUM 3DX7B 1DLFH 3L3KA 4F80A 5HPMA 3N1MC 1AXIB 4DN3H 2J12B 5BJTB 4M93C 1WWCA 2H9GB 1QLRA 3BUYB 4YXLH 5D2LB 1NAML 3PDDA 4Z7QF 1ADQL 4I77H 5B21A 1PBYA 1KJ2L 5FYLH 1HXYA 3G08A 2Q8AH 5ETUB 3LSOA 4MQXC 2YPVL 2E7MA 2GJ6D 5F9WC 1F90L 5HBBA 3VJ6B 3HI1A 1AR1D 4PRDA 4UUJA 1J86A 4Y16D 2LABA 4GUPA 5I73B 3WD5H 3ALWA 4R7NA 1A02N 1J1XL 4O5LH 3TZVC 3MXWL 5EU6D 3HKFA 2W0LA 2A9MH 3QNZB 3KPMA 4U1GC 4WFGD 4OUUA 5EG6C 4CW1B 4HXBL 4FFYH 1JHLH 1IM9D 4RIRA 3RVXC 1WF5A 1A2YB 2H1PL 4P9HL 1RIHH 3TBSB 2EE2A 5KBNC 4OCMC 4JGJA 2BNRE 2R9HD 3QI9B 4Z7NE 4YDJA 4UV7H 5D1ZB 4OF3A 4WW2B 4R8WH 5L0QC 3ULSB 2FEDD 1JHTB 3TBYB 1DBBH 1IVLA 4G7VH 2Y07L 5IMKB 1GSMA 3HI5H 1RZKC 5C0BA 5I30H 4R9HA 5D2NC 3H9SD 2F74A 2LAGB 4PRIB 1CXIA 4ORZC 3QUYC 3ZT6A 4G8IB 4P2RB 3UYPA 2VSDA 4PS4H 3HE6D 1JBJA 2J5LC 3IU4L 4DKEH 1A7NL 3W0WB 3WJLC 1ZSDB 1XH3B 1SEQL 4BSWA 4CDGC 1VFAA 3WO3B 4ZUSB 5SWZB 1LE9A 4R0LA 1LMKA 1QSZA 2HTLD 2X1QA 4YK4B 1G84A 5FUZL 1G9ML 4Q97A 3SOBL 2Z93B 1YY8B 5JXAL 3T2QA 5GRUL 4CVZB 4NZUL 3HRPA 1X5XA 4LMQE 1PKQB 4BH8B 2R15A 4FTVA 4YHIB 4AIXA 4M3KB 3I50L 5IHUL 3CIQA 4PGEA 4WU7A 3G6AA 5F7NC 3RDTB 1U8NA 4BFEA 1I1AD 1YY9D 5J1AB 3KPRA 1RJCA 1I8KA 4GJTB 5D96B 1CE1H 3MLWH 2OI9C 2BJMH 3VW3H 4LIQH 4FQ2L 3UTSD 1JE6A 1L7TL 1YPZE 2NXYC 3S5LG 1J8HE 3L3OA 3I9GL 4L3AA 3NGBB 2VC2L 4N9GB 4D9RD 1K4DB 3L6FA 2AK4E 1B0GB 3JSSA 5F89A 2D4DA 1RK0B 2VUYA 3T4AA 5BMFL 4BSVB 4TNVK 5M7QA 4HC1L 2CR3A 3PL6C 4L8BB 4PJEE 2CXGA 1HIMH 3PQYD 5ESQA 1EAPA 1T1ZA 1QBAA 1MIML 2ZCHL 4LL9A 1YZZA 1NSNH 4PJ9D 3RVVC 1FYTA 1CGYA 3T8XA 2PW2B 4GKZB 3A6CH 5FECA 2X7LB 4KU1A 5D5MF 3S36X 5E8EB 1ROWA 2ILLA 2GUOB 4EI6A 3D0LB 5BZDA 4OI9A 3RWFB 5CJBA 4JLRA 5C08A 4P5TA 1RIUH 4R97B 3MV7D 3OJMB 5I1EL 4WI9A 1A3RH 5HYJE 1JZ3A 1R3JB 4KK9D 1Q0YH 3B2VH 3TCLA 4C55A 1IGJB 4ONHA 4KHTH 4WI4A 2E5EA 4K8RD 1CWVA 3ZYOA 1YNTA 1H3PH 4F37F 3PABB 2C7UA 1UWXK 2I07B 1PVHA 4X6FB 5GRZA 1AJ7L 1XGPB 3FL7A 3T0WA 3T1FA 1KPUB 2ICWA 5L2KA 5FIEA 3ZKQD 5E00B 5ESAA 1V7MH 5ALCL 5T1MB 4NN7B 3LKPB 2P44B 4LPCA 3RNKB 4LVOC 4BFGA 2DQDH 4DKDC 3BHBA 3ROOA 3AREB 3BGMB 4M7KL 1ZV5A 5E70A 1KG0A 2F9BT 4HZLA 5IQ9B 4BZYA 4MZ3A 5AWNH 1SHMA 1T21B 3LQAH 1DQDL 2R0KL 4M9OA 4N1HB 3OMZA 1CLZH 3SE9H 3N85H 1OLLA 5F9JA 3RAJL 5FO9B 4WHYH 4AEIL 2MHAB 2Y25A 5J6GB 3ARBD 4GAGH 3D85B 3JWOH 2XRAL 3IXAA 5KSAC 3LEVH 1PSKH 1M6OA 5DJCB 3OKLB 2IBZX 3C09B 4HK0A 4AT6B 4CNIA 3DVIA 1FN4B 3BPOC 1AXTH 3S7GA 3CUPA 3LEYH 5JO5A 4S1SH 5GJSL 1PX4A 1UEYA 4GG6F 1LDSA 3JZ7A 1GIGL 3TZVA 4JM2C 4P3DA 4NHCH 3F7PC 5DD6A 2BC4A 4KAQL 3CVIH 4HEPG 3QWQB 4RGMB 1S7QB 4PJ7F 3GSXA 5ENWB 4FMFA 4TNVF 2X05A 4GW1A 4JZJC 4KJQD 1Z3GH 3JBG7 2XV6B 2DBLL 5FA3A 5FFLA 2VLJD 4PBVC 5I6XC 1QRKA 3W39B 1LEGB 3ARRA 1K3ZA 2YK1L 3C2AH 4FQIL 4Y1AE 1SBSL 5F3HA 3M1BB 1KTLB 1OGTB 3Q5YA 1CXFA 5D2NA 1CFQA 1EH9A 3BKCH 4MMXC 2VDQH 2ADFH 3QUYA 3QDMB 5FYJE 2EXWD 5HDBE 4Z9KB 3MV11 3ME0A 5IBUB 1KPRB 2WNGA 1TXKA 3WJLA 1XFPA 3L3IB 1IBGH 3KR3L 3HMXH 3HCVA 4JFEA 2CQVA 3CNKA 3D18A 2O5ZL 1RSFA 2X1XR 3VMOA 1V5JA 1BHGA 1VACB 3RY6C 2WP3T 4KVCH 1P9MC 3WLWD 5T5NF 5KSBB 1BQHA 2BERA 5T5FL 3U4AA 2XPGA 3DSNA 3RUGB 2P7TA 1C12A 1GCFA 4XBGA 1UXSA 2PO6D 3LEXB 2AAVA 3O4LB 4MD4A 4OZ4B 3HNTL 1U91A 3VWKC 4G8GD 2FB4L 4PTUA 4Q9BA 3CFBA 4UNVA 2CDEA 2IPTH 1XZ0B 1UXWB 3PDOA 4X6EA 4IRJD 3IRPX 3K7UA 5E1HB 2XWBA 5CD5C 4HS3A 5D70L 3GBNL 1R24B 3BPNC 3MACL 4D0BB 3SGEH 2FYYB 3VFGL 1JYNA 4YHKH 2DB8A 2XY1A 4P2QE 1LQSR 4OF6A 3B5GA 2W65A 3DYMA 3U4EA 4FQHA 4NP4H 5EIVA 1MEXL 2IAMD 5IW1A 3VFVB 3GUTB 1FNAA 3D87B 3FFCE 4K7PL 3UTTA 4DCQB 3H42L 3PL6A 5ID1A 3FB5A 4WUKH 1BREA 1A7QL 4YFDB 3JXAA 1MVFA 2NNAB 3GBMH 2V2TB 4YH6A 1UCBL 3BH8A 4KDWA 3MRPA 4HG4K 4IDJL 5I9QC 1U3HD 1TZGH 4UIMB 3P4LA 2NPLX 5HVHC 4TTDC 4PJ8D 1FFPB 3G9AB 4PRHB 2DN7A 1R5WB 4YIQA 1OWWA 2PKDA 1JPGB 5J12C 1NDMB 1II4E 3ULUH 3OAUH 3JV4A 5EORH 1C5BL 1IEHA 5CKAA 2NW3A 3MLZH 3OX8B 4W4OC 4X6DA 4X8JB 1XF1A 3RU8L 3GJFB 1QD0A 5F6IC 5C0EA 1B0RB 1G7QB 3BP5B 4F7EB 4O4YH 3BP7A 4FFWD 1ETZB 2VDLL 1CLCA 3FB6A 4KXZH 1QR1A 2C3WA 3NAAL 2XKSA 1EJ6A 3NZHL 4HIEA 1FVEB 1HOCA 3ARGB 3EZ8A 4Q7DA 4E0RB 1BD2A 3RA7H 3D3VB 5I18H 4E41B 4DAGH 5FO7A 4Z7OF 3IDXH 4ALAL 4MB3A 1ED3A 1KNOB 4YWGL 4AENB 3KNBB 4MHHG 4LPXA 8FABA 2XN9A 4LFHG 4R6UA 5I1CH 2VXTH 3VRJB 3GSUA 5FHBL 3IT8D 2IFGA 4JR9L 4RNRA 3GK8L 5B8CB 3C6LB 1X3DA 3KPLA 3C60C 1S5IH 3D5OF 1JN6B 3WIIH 1X4XA 2Y06H 1JWMB 5DXWA 4MB4A 3GGWA 1YYLH 4H8WH 3RGVB 1M7IA 1IAKB 5K59E 5ANMA 4PRIE 4DTGL 3MJ8A 5JOPE 3DHJA 3TH2T 3OG4B 1D9KB 5KSAA 3ORJA 2HYMA 5F44A 2B5IB 4JFDD 3HZKA 4FTVD 5INCA 1VFBB 5ALBL 3B6SB 1TPXB 4V2BA 3W0WE 5I1IL 2DWDB 2CMRH 4Z7VF 4U0RC 1C7SA 2NY5C 2IH3B 2CGRL 2X2YA 1MREH 1R3IL 3O6KL 2F19L 2V6HA 1FRGH 5SWZE 3E3QC 3ZSSA 2AXGB 4WJ5A 1P69B 4LNRB 4JM2A 3O41A 1IAII 3KPTA 1BBJA 2CDFA 2B4CC 4HJJL 5DDHA 5EOQH 2VWEC 4RFNC 3O2WH 4IRZH 4XNMB 5T1LA 1P4BL 4DVBB 4F3FB 1PKQE 4JZJA 2GSIA 3EFFB 2K3TA 1PD6A 4DN3L 1DJSA 3AU1A 3MUGA 3UP1A 5EO0B 4I5BA 5HHOD 4XCEB 1WSST 1RJYB 1WITA 3BE1L 2BOBB 3G5XB 3KG5A 4NQDB 3TO4C 3WO4B 3IAQA 4YXLL 5E94B 4HV8B 5I71C 4ONFL 2BX5A 2Q8AL 4IIQC 2LTQB 4U6YB 4P9MH 5BRZA 1FYTD 5CJOH 1NBVH 2EDDA 1DUZB 2JTDA 1JGLH 4AK1A 1KC5H 3OKMB 1CDCA 3MLXL 1MOEA 4JAMB 1JMXA 5GS3A 3S4SG 5IIEA 5DRXA 4GRLB 4LVHB 1UC6A 4OKVA 4O5LL 1IC1A 3I6LE 2H3NB 4OLZH 5FA4B 3RY6A 1OPGL 5CEZD 1P9MA 4FFYL 1JHLL 1RUMH 2EDWA 4P5TD 2KBGA 1QSED 2BSTB 3CXHK 3GNMH 3MV9D 4PGBB 5LWYH 5FO8B 2VLRA 1MFEL 4PJHA 4ODUA 1GJIA 5HTSA 4LKXB 1C5CL 4L5FH 3C5ZC 2KUTA 2KZWA 4KQ4L 3WSQH 3QSKB 3TIEB 1BZ7B 1MIEH 4PJXE 4EN3D 5C9JB 3VWKA 5J8OA 1VESA 1GOHA 1RU9H 4HGMA 4R8WL 4WO4C 4WWKB 1DE4A 1KN2L 4YHNB 1DBBL 1AGEB 2Q20A 4U6HA 3OAYH 3QDGA 4HMDA 4FXGB 3PP4L 4NM8L 1T1XA 1S7UB 2ICCA 4OZGE 4DKEL 4GBXD 4MNHB 5T3ZE 2AJYL 4Q58C 4BZ2L 4LKCA 2RHEA 4BH7A 3KYAA 5E8DH 4HUXB 5JW4M 5HY9B 4DGIL 1T7ZA 3H9HB 2LVCA 4FXKB 1BX2B 3KYKH 3O3DA 2P8PA 4K07A 4D8PA 3LKRA 4MJID 1BWWA 5BQ7B 3X3FH 1HCFX 4TVPE 1DDHA 3D0VA 3WBDA 1JF1B 2EDFA 5K9OA 4YHPB 1J0HA 2NXZB 5DUPH 1QOKA 3V0VA 5GGTL 4OCXL 4QOKE 5HGDB 3F7YB 4LEXH 1A1OA 2IQ9H 1EUTA 4P3CL 1UYWH 4MNQE 5IOPB 3MFFB 5BS0A 4PGJA 3ZYZA 5D1XD 5FV2A 5E6IC 4MDIA 1CE1L 3TZVD 3MLWL 4X4ME 1N6UA 2DIBA 3UJJL 3VW3L 3KAAA 4LSUH 4WUUD 1MRDL 4PIRF 4W4OA 5KS9A 3CFJA 2JCCB 3RL2A 3JTSB 3UTOA 4UT9H 1QBLH 1XCTA 2VH5H 3LN5B 4R2GD 5BO1H 2XZCH 1T2QH 3BMWA 1P84K 4PGDB 3RHWK 2XG5A 1AXSB 3MUY1 3SDDD 4P2OD 3HPJA 5F3BB 2FO1A 3OJDB 4M5YL 1QSFD 1N64L 5DHXB 1I3RA 4GW4B 3IXTB 1RZJC 2IPUK 4PJFA 2E7LC 2QEJA 3A6CL 2EEAA 4WU5B 1I9JH 2QBWA 4B7IA 4P5MA 4O2EA 4JFYA 1Z2KA 5CD3B 3C60A 2XTLA 4LP5A 2PN5A 2PW1B 32C2B 4U1LA 4OV5A 4HXAH 1DQJA 1RIUL 2CK2A 2DQFA 3D25B 4NT6A 2I25N 4K71B 2F5BH 5F9OL 1MELA 1RUQL 5TJWK 3VG9B 3UTPE 3WN5C 2XQBH 4XVSL 4H26B 2HA1A 1QFPA 3QDME 2V17H 4XPBL 2ARJA 3FO9B 3L7FA 3B2VL 3LN4A 5D7LA 4YXHH 4KHTL 1T83A 4CL7A 3PV7A 3EKCA 3O4OC 4KHXL 1Y0LA 3KXFB 1CBVL 4GW5A 4K7PY 1YJDL 2RFXB 4ZTPL 1S7RB 3GMLA 4JQIH 5T1KD 3M17A 3U83A 2IMNA 4ELMF 3QDHA 1MI5D 3KLHC 4RAHA 4ZFFA 4G6FD 4FZEL 2DQDL 1RZKH 3CSPA 2NXYD 1FL3A 1HHHA 3NZ8A 3QUMH 4F15C 4PV8B 1WAAE 5IEHB 5DGRA 4MA7H 4Z8FH 1MCCA 3WJJC 1J1OL 4ELKA 4QRPA 1MJ7L 3MR9A 1FDLH 3SE9L 4Y88A 3TO4A 3AUVA 5HGAB 3UO1H 3PL6D 1IQDB 4L8CB 4GAGL 4LCYB 5EZLB 5DD1H 2GCYB 4IIQA 1A4JA 3LEVL 5EOTA 3RVTC 3UTZB 1IZJA 3DXAD 3KYNB 3BKYH 4UQ3A 2BOCA 4U1NB 2W0FA 2I9TB 5K9QG 5IFHH 4BFIB 4M7LL 5CINL 4TUKH 2D9QB 1MFDH 1CG9B 1AXTL 3KLSA 4M61A 4GRMA 4Y5VB 4RWYL 4HDIA 4S1SL 4PB0H 4HIJB 3NACL 4K8RL 4YE4L 2Z8SA 2EEDA 1QHPA 5IVXE 4P23C 4NHCL 3Q6FB 4HGWB 4C57C 4BA8A 3HZVA 3U0PB 4J12A 4PRPE 2QQNH 1CVRA 3ILPB 3VH8A 3X14A 4ODBD 4NRZA 3V5HA 3LRSA 3NIFE 1KTKE 4HKBB 3O11B 1JK8A 5CSGA 3JWDH 1Z3GL 3U0TB 3C5ZA 3F6IA 3DO7A 4X9BA 4PP1D 3S37H 3GMRA 4Y4KC 2WUBH 5FKAB 1A6WH 4PRHE 1EEZA 1W0WB 4WO4A 4ODVL 2R56H 5JZ7C 1OAQH 3QJFA 5IB3B 1KELL 2APXA 1T2JA 4RFEB 4M62L 1QR4A 3D69B 3D39D 1PFCA 4UAOB 3IETB 4RRPA 2IPKB 1U41A 4PJCB 2AK1H 1XR8A 5BZWB 1X5IA 3OB8A 4PJ5D 4HUWA 4S1QH 1T6VN 2GEEA 4QCIB 5C8JB 4KTDH 4F7MB 4P48A 3ARUA 1XF5B 4KK8C 1KGCD 1ZWIB 2X09A 1G6RB 2XYCA 1W72H 3D3VE 5DD3L 3PHQA 4E41E 5EU6B 3G5VB 1PZ5A 4KVCL 4Y4FD 1KYOJ 5C0ND 2OXHA 2L4OA 1UM5L 5D72H 1IM9B 1QLEL 4QRSB 4WTZG 1D5XA 5KSAD 4LPWA 4CJ0A 5C6TL 1U8HA 4OLYL 4FS0A 4LEOA 2P24B 1OAYH 1ZLSH 1GYAA 3CC5A 5HVGB 3V5KA 3VGFA 4NDMB 1TZIB 3CDGB 5JNYB 3EO0A 1F8TH 2IPTL 2J7LA 4ZUUB 5DHYB 5E6IA 4MHHI 4HT1H 5JDSA 2QSTA 2DTMH 5DEFA 4M6OH 1KLGB 3BDYH 4JZNB 2B39A 3H9SB 2MCG1 1BVZA 4CVWA 5ILTL 4N0YH 5F1IB 4ZXBD 4XMLH 2J8UA 4NP4L 4Y4HB 4HKZA 1ZLUK 3STBA 3A67H 1ZE3C 3AS3A 1J0JA 4V1DD 3Q6GL 2Z4QA 4UDUA 4YO0B 3SPVB 1G0YR 4EUPA 2LFGA 1WBYB 1E28B 1UKQA 3F58H 5T3XD 4LLUB 4GFTB 5DK2B 5KVEH 4LU5L 1IGTA 1MCSA 1BM3L 2Y72A 4WFED 1TZGL 2R0LH 5BRZD 2B8OT 3MBED 1MCFA 5E7FA 1HHKB 3RWGB 3HAEA 2C4FU 3WDHA 5IESH 5IQ7L 3TIDA 3I6KB 1DANT 3PWPB 3ULUL 4XAWL 3HNSH 4LHUG 4NQCA 1IEBB 4M7LT 4X4YA 1PQZA 3O3AA 7FABL 4FXLA 4PPTA 1MFBH 3C8DA 3WN5A 5DRNB 3AB0C 3KYOB 1YMMA 2VLRD 4X7FC 5GGUA 4O4YL 1ZLWK 3CDYA 3BZEA 2EIDA 3MRMB 2X4QA 4PLJC 5F7DA 3OGCB 3GBLA 1F6LL 2MQCA 1G6VK 2A1WL 5EN2B 5DD0H 3P9MB 5BCAA 4QRUB 4H25A 1A14H 4HK3J 3NFNB 4PJAE 3QDGD 5H94A 3PQYB 3OSKA 4GRWH 3PWUA 4X5XA 1QFWH 3HE7C 5TF1L 4NPYB 3MUZ1 3P4MA 4CADA 1CF8L 5I1CL 3S34L 4AQ1B 3QIBC 3DUUA 1I1RA 5TE4H 1Y6KR 4OCLC 2FEEL 5E0QA 3WJJA 3RI5K 3MLRH 4EJ1C 4XGZB 3H6JA 2Y06L 2Y7QA 1NC4D 2E7CA 1E4WH 4H8WL 3TBTB 1K9TA 3U4BL 1FV1A 1IGYA 3QIWC 4JO3H 4K3EH 2I24N 4ZYKA 3ETBF 3MV7B 5HGBB 4CU8A 2MKLC 4OKDA 3JV6B 2DLGA 3KJ6H 3QZWB 4N5EC 3VI3E 4JO1L 1FRGL 5BS0D 1UWGH 1MPAL 5DZLA 4P23A 5FEBA 3RRQA 2DKUA 3N1PC 1JJUA 3VFNA 2DJ4A 4KY1L 3V7AE 1IMHC 4IRZL 2I9LB 1FPTH 4PJGB 1HSBA 3EDJA 3S3JA 3PGFH 2BCKA 4L4VA 2R23A 4P5KA 1LP9E 3SQOH 3QHZL 4Y4KA 1H3XA 3EDFA 3FT4B 2G5RA 4C54A 3QA3A 3KLDA 4X83A 1MH5A 3MRBB 5CZVL 1PKOA 1PY4A 1R0AL 1AGBA 3QJHB 1IGIL 4NFCA 2OL3B 3ZSTA 3X3GH 5CJOL 2XFXB 2V5YA 2JCCE 1I9EA 1JI1A 2P45B 2QQKH 4X0KB 4GRWF 2DDQH 5D9SB 5K59F 3OG6B 1KC5L 1H5BC 2VXQH 4MQ7B 2MCPH 4YUEL 1JYVA 3HUJB 1CFSA 2GJZA 3FFDB 4I2XE 1JNHB 1G9NL 3O9WC 2YN5A 3EDEA 1T66C 2F58H 5ISZD 3DV4A 3P40A 3BP6A 1YEHL 2NYYC 1LO2L 2GTWA 1PYWA 1J1PH 3IYLW 4OLZL 5AYUL 3S97C 5LWYL 5IMOA 2DYPB 5EU5B 5GGSA 2WBKA 4L5FL 1KIQA 5EWIH 2XZAH 2CIKA 3EYVA 3WSQL 4JN2A 5AYQA 1TDQA 5HYIA 3PWVB 3K1DA 3DRQA 5GGQH 4ORGB 1AGCA 5B3JE 1BFTA 4NO2A 4POZC 4Z76A 2VN7A 5D71H 3QDJB 2W91A 3MRIA 4EDWL 2J4WL 3MA9H 1EZVY 2WLYA 4N8VB 4JCLA 5IBLC 3RI5F 3UPRB 2PYFB 4GAYA 4P4KB 2BRRH 4PJDF 4WGWB 3QCTL 4LSPH 3DUSA 1FQ9C 3AAZA 2EDTA 4QHLB 5JQ6L 4MZ2A 3HG1B 3JV5A 4XRCA 1D5IH 2HT2D 1AE6L 2EDYA 1DCLA 4OF0A 1MJJA 2JELL 3P2TA 3KYKL 4QRPD 4XVUC 3QNXB 3T77B 1S7WA 2AJZB 2CRIA 2EZ0D 3F5WA 3X3FL 4YHZH 3V9FA 3QEHA 4L4TE 4R4BA 2O5YL 4HG4J 4TPRH 5EC1B 3ZE2E 4FA8A 4KRLB 4XTRC 4AEEA 1SY6H 2DJUA 3C2SA 2PO6B 1EHLH 4LEXL 5HHPB 2IQ9L 2V2WB 3C5SB 3L5WA 4HH9B 4G8GB 1UYWL 3ARDD 3IDNA 3B8SA 3VXNB 4HLJA 1B90A 5TQ0L 2CJUH 4IRJB 1L9MA 3C6SA 5C09A 3EZJB 2VIRB 4QTIH 4ZNEE 4G6JH 4R26H 3I3BA 4JANA 4HPYH 4MSWB 3STZB 2VXSH 2QADC 2B4CH 1FGVH 2YD2A 3LMJH 1YN6A 2BNRA 2AJ3A 3C5ZD 4XC3H 3MO1A 5BO1L 4BQCA 5KS9F 2DQEH 4I3SL 1T2QL 4WI2A 4OD1L 1M71A 5TGBA 2FO4A 2IAMB 4I0PC 2JB6A 4XWGL 3DI2B 4DK3A 5IW6A 2UWEB 3CVHH 5K9QI 4ONGH 3K81A 3VGAC 1MCEA 3BWUC 4P4RA 5LGHH 2P5ED 2HFFA 3Q48A 4XMPL 5F1OB 3T65A 1RJZA 3VA6A 5C0RH 4Q9QH 3HE7A 4OLXL 5F7YC 1U3HB 4DUVA 3NCJH 4O2CA 5DHVA 4O9HH 1I9JL 2E7HA 3QIBA 4PJ8B 3LD8C 5I19H 2VNCA 5J6HA 2C3VB 4NC0B 4U1JB 5IROC 3MCKA 3U1SH 5EU7E 1HH6B 2HWZL 4BSJA 1K8IA 4ZAKC 2F5BL 2XA3A 1UENA 4JY6B 4LSQH 4EEEA 4PUBH 4LQ1A 4P3WA 1O7VA 3QIWA 5IJKC 3BKMH 3EYSL 5CP7A 2V17L 2F5AL 4YXHL 2A6IA 4HIIB 3S8WA 4KZDL 1UVQB 1I8LA 3NABH 4PV9A 4XPFL 1RI8A 1SM3L 3L5XH 3WS6A 1MQKL 1Q9KA 2UZIH 1AP2A 43C9A 3MODH 2FZ3B 4H88H 4APQC 4JFHD 3C8KB 4JQIL 4M7ZB 5EU6E 3TA3D 1I8MA 2PCPA 4HHAA 3N06B 5MEQA 4PLNC 4EVNB 5F97E 1JUFB 2IH1A 1ZHKB 3INUH 3ROLA 1LK3H 1J8HA 2X4SB 3OWEA 4D3CH 3TVMC 1H8SA 1FIGH 1FFNB 3MGAA 4PJBB 5T5NG 4EXKA 1CVSC 2NY2D 1KPVB 3BEVA 5BOZG 1LWRA 1WIPA 2DBJA 5D1QC 2QTEA 2RR3A 5FOBB 4OGZA 2WINB 5EU3A 5DJDB 1BJMA 2VTFA 4PRAB 1UEMA 3EJZC 5L6YH 4S10A 1T80A 5EDXA 2HVJA 3V79C 3H9SE 1G7IB 2AJXH 2NY4D 3QEUB 4GKNA 4NO5B 4NC2B 5C71A 3LS5L 3PP3K 4MA1B 5JLZA 2H2SC 5I66A 4WNQB 4JFDB 4X4XB 1H5BA 4TUKL 1MFDL 2AJUH 4X80H 3FOLB 3ULVE 5ACMA 1Q9LA 3O9WA 5GSRA 2GITB 5I1DA 3CFIC 4GH7B 4L8SC 2A73B 2X4RA 2FIRT 4KRPB 3EO1A 1MHHB 1OD7A 2VAAA 1P7QB 1D5ZB 2O61A 3CXHJ 1E27A 2ED7A 2QQNL 5LQBL 3LIZH 3DRTB 3F7VB 5KTEL 1X5FA 3NA4A 1XF2B 5D6CA 1TVBB 1FVCB 1YUHA 4OIAA 1YMMD 2P8MB 1KN4H 1K5NB 4FMKA 2EIZB 4KJYA 4DFHA 5EUKB 5I73C 2Q6WA 2WUBL 1A6WL 1U8MA 3KPSD 3VFMA 5HHOB 3K0WA 3IAGC 1DN2A 5L9DL 1H8OA 4D9LL 2PTTB 3PWPE 4Z5RB 5I1GH 4LBEB 1Q72L 3O6ML 3L1OL 3NA9H 4LSVL 4M1CD 5EBMB 4EUPH 3KLHD 2AK1L 1U95A 1ZHLB 5HGHA 4HF5L 1CFNB 3IFOA 4S1QL 1I9RH 1MFCL 2EDRA 1VSCA 1U42A 4KTDL 4GMSH 1HILA 1NGXB 3QI9C 5D1ZC 5IP4A 1ZVHA 2CKNA 2ICWJ 5FGRA 3ALPA 5D93B 5J4MA 5IMMA 4OD3L 4UINH 2GTZB 4K2UH 2BVPA 3FHAA 3RIAK 4LLAA 4XXDA 1YN7A 5D72L 4HWBA 1SVCP 5B39A 1QSEB 3MV9B 4HX1A 1UH4A 3GMMB 2C1OA 3NCCB 1JGVH 5F7HA 1E6OH 2DQTH 4O2FA 4Z7WE 4NGHH 1XCQA 3CSBA 3QCUL 4NFBA 3PGCA 3IFPB 3DTXA 3OB0H 4EN3B 3O3EB 4NSKA 2H32A 5EBWB 4XNZB 4PBWD 4JFOB 3UYRH 1GZQB 4JRXD 3M07A 4HT1L 4YK4C 3ZE1F 4FFVC 1NDGA 4P23D 3MBXL 3FAWA 3CCHB 5H35A 2J6EA 1A7PH 1H3WM 4NCDA 3SGDI 1J9CT 3JTTB 4D9QD 3MV7E 3GSNB 5B38A 3DVFA 4LLWA 4NYLB 4XMLL 4GBXB 4DOHB 3FKUS 3V52H 2ZCLH 2VE6A 3CU1A 1P84J 5TE7H 4O02H 1NCWH 3OKNB 1A3LL 1M7DA 1DN0B 4I0PA 3RDTC 5L88L 4KKAD 4Y1AA 5JZ7D 1N8ZB 4NRYB 5D96C 5JIIA 5DZOA 4MJIB 4MD5A 2CRYA 1KSRA 1KEMH 3F58L 5EIIB 4DQOL 1F4WH 1CL7L 4NKOA 5HYSB 3QULB 2ZZUT 4NM4H 3MRQB 1CGWA 5C2BL 5IVZB 5KG9B 4PJGE 1QBMH 2R0LL 3NGBC 1DANU 1XF3B 1CFTB 2Q86B 4H5SA 5SV4A 5ABDE 1J12A 2XIDA 4OBRA 3SKUD 1FVDA 1JGDA 4AEFA 5IESL 1T0NA 3FQUB 5KVDH 1QFWM 2A74B 3OXSB 4M1DH 2NY7L 5D1XB 2AV1A 2ZNWA 5IROA 1UM4L 3FTGB 3BVNB 4ZAKA 3VFWA 1A6ZA 4WUUB 5A3ID 4TQEH 4YDIH 5IJKA 4HUMB 5E9DD 3MGOA 5LGJB 1E4JA 1VADA 3Q3GA 4RZCA 4MD0A 1SQ2N 1MLCA 4XCCL 3V8CA 3FJTA 2CKBA 1NEZB 3HUJE 4O51A 4R2GB 5A1AA 1FJ1A 4OGAD 5DD0L 3CZFB 5E7BA 4QF1B 4DKAA 2I5YL 1IT9L 1FNSH 4APQA 5GGRB 3SE8H 2FWOB 2BK8A 3SDDB 4P2OB 4R97C 1AI1H 3K8LA 4Y19D 3R06B 2AQ3A 4MXVF 1ORQA 1QSFB 1UZ8A 1S7TB 3NVQA 4JFXA 5LAXB 4KQ3H 3SDAD 1EEYB 3OKEA 4WW1B 3MYZA 4Q2ZB 3LRGA 1TCRA 3VXSD 3EOBA 5B22A 3MLRL 5D1QA 1QNZL 4RX4D 2YD9A 3ZKND 3QDJE 5I1HL 1G7LB 5DR5H 4GG8A 4HJ0C 4NN7C 3EUUA 4GMTH 4QXGL 1I7ZA 1C5DB 4MA3B 1A9EB 3AREC 3MGTB 3RWEA 4X5WB 1S9VB 5E2TH 4QXWA 3CK0L 2AJSH 5GRWA 1W0VB 3HG1E 1IFHL 5BJTA 1F4YL 3NFSH 3P11H 2H9GA 4BUHA 3EFDH 3G6JE 3BUYA 2IALB 4BKLB 2ARJQ 3E6FB 5EUOE 2Q76B 3NPZB 1AY1H 5D2LA 4ETYA 5T1KB 4RBPK 4ZS6D 4K3DH 1MY5A 2VR5A 2EICA 1NQBA 1H3TA 1MI5B 2ZUQB 5ETUA 4G6FB 5L7XH 3D9AL 2WSKA 3C09C 3UDWC 1NGWB 3VJ6A 3QUKB 3VGDA 1JNNH 4I0CC 2BNRD 3HZMB 3SQOL 3TJEL 3VXPB 1BFVL 1T0MB 4KKCD 3GHBH 3VD7A 5EOCH 1X5YA 1EMTH 1EK3A 4JHWH 1AHWB 4LCCC 4L8DB 4NNXB 4P46D 4NRXB 2YSSB 3QNZA 2FSEB 1B4RA 5F7WC 1PEWA 3T2OA 3U6RB 4QT5B 4CW1A 4RGMC 4P9HC 5DD5H 5F1SA 1A2YA 3OZ9L 5KAQF 2QQKL 2DDQL 1UM6H 1LD9B 3TBSA 3DXAB 5C0GB 1QG3A 3NTCH 5DJ6B 3HE7D 3ARYA 5JHLL 3QI9A 5D1ZA 5GJTH 4WW2A 1H3UA 4NKMB 3ULSA 2V2XB 5JA8B 4MYWB 1JHTA 3TBYA 4UOW0 1DBML 1XGQB 2DRUA 5IMKA 1KCLA 2NY6B 5DRWB 4W81A 4WV1C 1ZLVH 1P2CB 4PRIA 4XVTH 3M8OL 4G8IA 4P2RA 1OTSC 5ADOH 1AFVH 5CJXA 5I1KL 4GAJL 2ZNXA 2UV3A 3W0WA 1ZSDA 4KPHH 1KACB 1XH3A 3LKOB 2MQ3A 5GGQL 2DQGH 5CJ8A 2CRZA 3BPLB 4Z7UB 4KMQA 1EV2E 4ZUSA 3MRHB 5SWZA 1VPOH 1AIFB 5IGXH 1Q9OB 1F5WA 2Z93A 3V0WH 1YY8A 2X9YA 3D39B 2WWKO 4CVZA 4OGYH 2K7QA 4QRRD 1PAMA 4LSPL 1J8HD 3I02B 4BH8A 1PKQA 2YD4A 3TF7C 2WIIB 3GKWH 4PJ5B 2AK4D 3PIQB 4YHIA 5INDB 1UWEH 5DHVH 3KPQB 5GS2H 4ZO9A 4G5ZL 3RDTA 5SX5K 3V5DB 5J1AA 1U9KA 5DJ8B 2V9RA 3RBSA 4NNPL 2DKMA 2RCSL 4Y4FB 1X5LA 5J3HC 1WC7B 5DQ9B 3BQUB 3EIFA 1NCDH 3NCEB 1UB5B 1U8KB 4N9GA 1EHLL 1K4DA 3QCVH 4PJBE 1I7UB 1LVEA 1QZ1A 1B0GA 3L3GB 4U1MB 1IKFL 1YEEH 3L95B 2OJZL 5F7LB 3G6DH 1RK0A 3CSYA 2GK0B 4BSVA 2H41A 1OT1A 3MOQA 1J05B 1MHCB 2NY5L 4L8BA 5ESVB 2RQ8A 1MWAB 4I18B 5FYKH 4MCZB 5HI5D 5SX5H 3SE3C 3OR6B 4YDKH 3WNPA 3U9UB 1HEZB 3VU2A 4TUOB 2PW2A 3MLSH 2B4CL 5HYJD 4FP8H 1FGVL 4BK4A 3LMJL 4OUOA 3DROB 4GKZA 3VRIB 4ZXBB 1J8KA 2X7LA 4JY5H 2GYSA 2DQEL 1F97A 2KZ1B 5E8EA 2GUOA 1TTUA 5EO1B 1OAZH 5CWSB 3CU7A 3D0LA 1WUNT 4POZD 3TP4A 3TNMB 5DMGD 4V1DB 2YD5A 1IC5H 1BVKB 1JVKA 3RWFA 4B0MM 3UJTH 4L3CB 1VGKB 1GGIL 4MDJA 5C0RL 1LDPH 1R3JA 2VUOA 1QEWB 3MBEB 4ZQKB 2NR6D 1IGJA 4DGYH 2R0ZH 3ARGC 3PABA 4C83B 4Y2DC 2I07A 3O2VH 1PDKA 1XGPA 2CIIB 3U1SL 1DEEB 1KPUA 1KUMA 5D7SH 4A6YB 2R69H 5E00A 2EYRB 2FNBA 1F4XL 5T1MA 3BDBA 4LSQL 3LKPA 4PUBL 3Q1SL 5CLWA 4MMZC 4KFZC 3RNKA 3QQNA 3LQZB 4KV5F 3O2DH 3WS3B 3BKML 3S35H 1C1EL 1RY7B 4RCAA 3U0WH 2XKNB 3S96B 3AREA 3BGMA 1BVLB 3SKJH 4LNVA 1NFIB 2ZPKH 1ZHNB 5IQ9A 2PYEB 3NABL 1VFUA 3L5XL 1T21A 3C6LC 3CFCH 4X7CC 4HH8A 2EE3A 1A21A 3OTTA 4H88L 1MF2L 4G3YH 2VKWA 5FO9A 4X4MA 2MHAA 1I7TB 1J0KA 3RGVC 2XTJB 1IAIH 5J6GA 1EXUB 4LSDA 1TTGA 1LK3L 2AXFB 3D85A 4D3CL 1CXEA 1QSEE 2B5IC 3MRGB 5DJCA 3OKLA 4M6ML 3UAJC 3UDWA 4ODSH 3N1QC 2QADD 1TPXC 4AT6A 4KK5C 1BF8A 4RGNC 2BRQA 2F8VA 1FN4A 4HS6B 2OM5A 4OV6F 4XNQB 4QHUB 4I0PD 1BQHG 4Y1AD 1YNLL 4PB9L 4P2CG 2DQIH 2FGWL 1NC4B 4YZFF 4V2CB 4KKBC 3FO0H 4EOWH 2KPNA 1S7QA 5ENWA 5A2JH 3LB6D 3P4NB 5FYJD 5LCVH 3SGEI 3WIHH 1LEIA 4DOHE 3W11D 2AJUL 3B2UC 2DF3A 3UZEA 4YFLF 5ADPH 5HDOA 3W39A 1FNLA 1LEGA 3O6LL 3WO4C 3QP3A 4WGVB 1ZVSB 2VDNH 3GMPB 5DJ2B 2H32H 4TUJB 3M1BA 1KTLA 1OGTA 3VXQB 4MJIE 1SJEB 4ZAKD 2LTQC 4H0HB 1T1WB 4NBZB 3QDMA 2D03H 2EDKA 4U4BA 5DUMH 1KPRA 2YUVA 2X41A 1QYGL 3S88L 1WEJH 3L3IA 3QXTA 1YECH 3ZDYF 2OTWB 4GRLC 4LVHC 2AABH 1JZ7A 2UY6A 4OFDA 1J0IA 3T4YB 4W4NA 1VACA 4NC1E 5B4MC 1N3NB 5TPWH 5KSBA 2HTKD 1N59B 2UVEA 3RUGA 3QQ4B 1YEGH 3DYOA 2R1WB 4P2QD 1I9RL 3UBXB 3LEXA 1HK6A 1UZ6F 1WAAA 4UIKH 3O4LA 1RZJL 4OZ4A 5D6DC 1N2RB 5BVJB 1NCNA 4KXZI 5BV7B 4WWKC 1QSVA 1XZ0A 5ISZB 3FFCD 1ITCA 1UXWA 1Q94B 3VCLB 4W70A 4G9DB 3BMVA 3PDGA 2BY1A 4MS8C 4PG2C 5GZOD 3O6FB 4PLKD 3TGXA 2CSPA 3GSOB 1R24A 1J0ZA 4PY7B 4D0BA 4JREB 2FYYA 3BH9B 5D5MB 4PJIE 3F6LA 3DIFB 3MLUL 1T1YB 3IKCB 3VD3A 1E6OL 5C6PB 4NGHL 2CR6A 3EYOB 1WV7T 2ADIB 2ZUXA 2WUCL 2R39A 3VFVA 3GUTA 3V6FB 3GO1L 2EXYD 4DCQA 2WLZA 4GS7B 4RAVB 4OZHF 4OZIF 1NEUA 3TH3T 2V2TA 2NNAA 3SE3A 3TNNB 1A7PL 3IDIB 2OS7A 2NXZC 2E9BA 4UIMA 5J9PB 1FP5A 2NCMA 43CAB 2ZCLL 4AMKH 4PYGA 3SGJC 3ARPA 5TE7L 4PG9B 3V4VH 1NBZB 1FFPA 4PRHA 5DEGB 1NCWL 1R5WA 1J5OH 4KROB 5CJQL 5C07E 3V8OA 1JPGA 1NC2B 1NDMA 1JNJA 3TO2B 3TYFB 2BSED 3DSFH 1FH5L 1O0VA 1TIUA 1FL6B 5GZND 3OX8A 4X8JA 1QFUH 1ONQB 3UTQB 3KPNB 3GJFA 5I8CB 2IFFL 2BHYA 1A7RH 1B0RA 1G7QA 2BVOB 3BP5A 4ZTOH 4F7EA 5F88B 1H8NA 3GI9L 1JPFB 1ETZA 3E8UH 3FAXA 1HHJB 3BD5A 4OFYA 4L9LB 3C08L 2DI7A 1FVEA 3ARGA 4PRBB 1PLGH 4E0RA 4P49A 3FN9A 4M1DL 3ARDB 2X5PA 2Q8BH 4E41A 1NLBH 2O5XH 2DI8A 2VJXA 1J87A 2GT9B 3TFKC 1KNOA 4PRID 4TQEL 4FQQB 5JOPD 4AENA 3KNBA 3HLAB 1P7KB 1QPPA 5SWSB 2APTA 3CSGA 4NWTH 2ERJB 5JOEA 4JN1L 1MCPH 3H7BB 3DXAE 1YEDB 4K3JH 5LGKA 4JG0H 3VRJA 3W0WD 4FZ8H 1GVIA 1LO3H 3QUZC 5B8CA 3C6LA 4MJ6B 3QO1B 1K2DB 1JN6A 4HWZB 5A16B 3FOMB 1JWMA 3A6BH 3SE8L 1EO8H 3RGVA 1TQBB 4K71C 2ZG1A 3MX0A 1IAKA 3BN3B 3VG9C 3NIDF 4K9EL 1D9KA 2A77H 15C8L 2P5EB 1VFBA 3B6SA 1UKSA 2DWDA 5E5MB 1FZOB 4Y89A 3MRJB 2P49B 2IH3A 4Z7UE 1BQUA 2H2PC 2K9UA 1MHPH 1BIHA 2AXGA 4LNRA 2X4OB 2OK0H 5J1TC 1WZKA 4JM4H 3Q2CA 4DVRL 2YR3A 5KW9L 3D39E 5CLTA 4XNMA 1FZMA 4F3FA 2NLJB 4DVBA 3EFFA 4PJ5E 4AYFA 5EO0A 4J6RL 5E95B 4XCEA 3P11L 3AFLA 1RJYA 3V6ZB 2EH8H 2BOBA 2UUDK 3G5XA 4JJ5B 4NQDA 2ZCKL 3RWCB 3OR7B 5E94A 4HV8A 3TA3B 2W9DH 1GXEA 5CGTA 3FZUD 4HIXH 2FLRT 4U6YA 4Z0XB 2VLME 2IEPA 4NZJA 2D2OA 2X1OA 1QA9B 4OLVH 1BJ1H 1DUZA 2BFVH 5D2LF 1UG9A 1WWBX 1A7OL 3OKMA 2NY2B 4JAMA 1ES0A 2VDKH 1KCRH 4Y5VC 3UROR 3EOTH 4GRLA 25C8L 2AERT 4ZPVB 2GFBB 3B5TA 3MRFB 2H3NA 3QNYB 5FA4A 2R2HB 4IJ3B 1GHFH 1IQWL 2BSTA 4OCSH 4PGBA 5DD5L 5EC2B 3FQNB 2ICWI 3QG7L 5FO8A 5EZIL 3EYUL 5C0CB 2NY4B 1UM6L 4LKXA 3HR5B 1VEMA 1FFQA 3P30H 4WRLA 3TIEA 1BZ7A 5D6DA 5C9JA 5D7IF 2WWKT 3O3BB 4MLIA 1IGFL 4WWKA 3AS2A 1KTDB 4YHNA 1AGEA 5EU7C 1NFDF 2XY2A 5HHXL 1CD0A 5DF0A 1GAFL 1F45A 4V1DE 4PG2A 1JZ6A 4FXGA 4HJ0D 3BAEH 4TVPD 4XVTL 1S7UA 4UAOC 4XP6L 5HI4D 1Z9SA 1L7IH 3NFPB 2EEBA 3ARED 4MNHA 4J3UA 3WXVH 5KSUB 1AR1C 4QOKD 4Y16C 1P4IH 1WFOA 3LHPL 4HUXA 5HY9A 1WFUA 4YHML 3KJ4B 3KPSB 4MNQD 1VPOL 3V2AR 2BSSA 3H9HA 1Q1JL 4FXKA 5IGXL 1BX2A 1F6AB 4ZDHB 2BVEA 2XQYG 2DIJA 5BQ7A 2B1HL 1JPTH 1LHZA 1JF1A 3W2DL 3T0AA 4YHPA 1UGNA 4M6NL 1ND0B 1CDIA 4GXUN 3GKWL 5CEXB 4QYOB 3SGKC 5HGDA 3F7YA 5EFIB 2R9HC 3SGJA 2PYEE 3QQ9D 2NY1B 4W68A 2Z9TA 4D0DB 5IOPA 3MFFA 2G60L 1EVUA 4ZUTB 3V6BR 2FEDC 2Z8VC 1R3HB 1CDJA 2XTJE 2ZP0T 4BQ9A 2F8OA 4XVJL 1KCKA 2VDOH 5CHNB 3PWJB 1G0DA 1NCDL 1ZGLM 2JCCA 3UJIL 4KI5F 3JTSA 4KH2A 3QQ3B 1MCIA 3HE6C 5C0AD 5D7KE 3ZDZF 3LN5A 3IJYB 4NUGH 1YA5A 5K9JH 1YEEL 3GMNB 1FHGA 5GS0D 2FX9L 4PGDA 3RPIB 1AXSA 4JRXB 5FYKL 1W2KT 5F3BA 3OJDA 3UC0L 3DWTA 4GW4A 2OR9H 3UTPD 4NQXB 1CU4H 1NAMH 3DO3A 3IXTA 1QLFB 4Z7VB 3RFZC 2EDOA 3HC3H 1S78D 1A1MB 5AAMA 4JY5L 2YPVH 4WU5A 1WJ3A 1FNGB 1PX3A 1OAZL 2Y1VA 3MJGX 1OW0C 5CD3A 1IC5L 4LAJH 1YY9C 2PW1A 32C2A 3C87A 3VFSA 1J1XH 2R1YB 3UJTL 3D25A 3MXWH 4KJWD 2R8SL 2Z8WC 5FYLE 2L7JA 5EH1A 4H26A 1DBKL 4HXBH 2HJLB 2X89A 4MXWL 4XB7A 3ALXA 3FO9A 4YX2L 1FNFA 2H1PH 2JK5B 2YUZA 4PLOB 4P9HH 5E56A 3WNKA 1IAIM 1KJMB 3FMGL 2R2CA 3L3KB 4MCYB 4J3VA 3VMNA 1S7SB 5ACZB 3KXFA 3O2VL 3QWOB 5FGSA 5LXGH 5D7SL 4GO6B 2R69L 3VH8G 5E08H 3MRNB 5IKCB 2RFXA 1G7MB 3EDDA 1S7RA 3SHSA 3FO2B 2Y07H 3S35L 4JJHA 1I9IL 5JUEH 1WTGT 5J3HD 5E9DB 3N9GL 5EOCJ 3SKJL 1KXVC 2BY0A 5BXFB 2GAZB 5DJXB 4PV8A 5IEHA 3GRWA 2AJVL 3VDBA 5E1AB 3IU4H 1JZ4A 5L2JB 1A7NH 3CFCL 2HRLA 1SEQH 3ARTA 2CRMA 4LLMB 4WHDA 5HGAA 4J23A 2N4IA 4EDXB 1JFQH 1IQDA 1EGJA 4PRPD 3VRLF 4L8CA 5EZLA 4LCYA 5FUZH 4ZNEA 5DFWH 4Y19B 1KEGL 2R2EB 2GCYA 1MCWM 1YNKL 3UTZA 3SDAB 1ZEAL 5D5ME 3KYNA 5JXAH 4U1NA 5GRUH 4MQTB 4C58B 2I9TA 1EBAA 1HHGB 1V3KA 4KK9C 4NZUH 4BFIA 3DMMB 4BJLA 1CG9A 5AUMB 2D7NA 2BSRB 4Y5VA 4OJFL 1LNUB 4PRHD 3VXSB 4HIJA 4OQTA 2B0SH 2CLRB 3BP4B 1NCCH 3Q6FA 4F7PB 4HGWA 2OYPA 1ZS8A 3JUYA 3U0PA 3FO0L 4LVNB 1FAKT 4EOWL 3AROA 1XR9B 3ILPA 4PRNB 2X9WA 6FABH 4ZFOB 4HKBA 3O11A 2WANA 4HWBL 5FUOH 1CDHA 3U0TA 2ZSWB 4RMSA 5GRVL 3I9GH 2HH0L 1NCBL 5FKAA 1A4KB 4HUUB 3B9VA 1INEH 1W0WA 3ARGD 3VFUB 1OL0A 5IB3A 1LO4H 3D3VD 2YWYA 5DMJB 5BMFH 4E41D 4RFEA 1ZTXH 4TSCH 4WCYH 4HC1H 3PWNB 3D69A 4LIQE 1OP5H 3S98A 3ARBC 1RD6A 3REWB 1A9BB 3IETA 2IPKA 1MIMH 2ZCHH 4PJCA 1U36A 4UMGA 4GKOA 1JF6A 5DUML 5BZWA 1N0XH 5IBTL 1NGZB 2J6EL 3X13B 4QCIA 5C8JA 2ZWLT 2ORBL 4F7MA 5D8JL 3PHOB 1XF5A 5KSVB 4YBQD 3NCMA 4OCYH 4NUJB 4EUPG 2DOCA 3L7EB 2OSLB 1ZWIA 1G6RA 2LU3A 1T5WB 5AZEH 1WQVT 3AY4C 3ZTJH 4P46B 1RUAL 5EU6A 4H1LB 3G5VA 1I7RB 4HLZH 2WMPA 1MCWW 1XF4B 5TPWL 1VHPA 4LGSB 2FECL 5FB8B 3DUHA 3LPGA 1IM9A 3CXDL 1YEGL 4QRSA 5CSZB 5FM5M 1D9KD 3ZT5A 5SWSE 5GGTA 5FYJL 1R6VA 2P24A 5I1EH 3SGKA 3GJFH 2VZ3A 5KSBF 3TBWB 2LU4A 3GZKA 5DJZB 4KK5D 4NDMA 1TZIA 3CDGA 2DD8H 3RUGF 5JNYA 4GG6E 1R5IB 4ZUUA 2DQUL 5DHYA 5F89B 3MSPA 1F2XK 1F3JB 4PJ7E 5DWUH 1P5UA 4JZOB 4OGXL 1KLGA 4JZNA 3UX9B 3H9SA 4U33A 1WBZB 2OR7A 4OQ1A 3FN0H 5F1IA 5F8RC 2EXWC 1T7XA 3T2PA 2NW2B 3TT1L 2P5EE 2YPLD 4Q9RL 1QFWI 3FB7B 2C9AA 2ENSA 3MREB 4M7KH 3C5JB 4Y4HA 4MAYD 3RIFF 5MP6L 2CKBL 3D1MC 5SV3A 4U6TA 2VN4A 5EZOH 1DQDH 4YO0A 3SPVA 2R0KH 4BQBA 5DK0B 3HN3A 5IHBA 1CGSL 5GPRA 1WBYA 1FC1A 1E28A 3RAJH 4XP5L 3WLWC 4LLUA 1KLUB 5DK2A 4J4PD 1YPZB 2FBOJ 3WCYA 4QRRB 5CZXD 3IS1X 2XRAH 2PO6C 1HHKA 3RWGA 1A0QL 2AK4B 2WWMC 1L0QA 1DQTA 1TLKA 2P43B 3BD4A 4ERSL 4GRLD 1IC4L 3I6KA 3QH3B 3PWPA 4ELMB 1IEBA 4IRJC 5GJSH 4PJEB 5HI3D 4XH2B 1GIGH 4XPGL 4JFHE 1N6VA 1T04B 1D6VH 4LP4A 1H15B 3O0RL 3AMLA 5DRNA 3SDXF 2R29H 3KYOA 4F8TA 2VR9A 3H3PL 2XWJB 1YEIL 2JIXD 1ITBB 5DI8B 3MRMA 3ROOB 3OGCA 1DBAL 1Z9MA 3E2HB 1UB6B 1VDGA 1PLGL 5EN2A 2DBLH 2IAMC 3P9MA 1P5VA 1MSPA 3EOYG 1FLRL 4MQSB 5AEAA 1FZJB 1NLBL 3NFNA 4OBSA 2O5XL 3PNWB 4RQQB 3V95A 2YK1H 2DM7A 3PQYA 4MS8D 1QO3B 4FG6C 4D2NA 1JPSL 5I1AB 4K3HA 5K9KB 2PR4H 3KVQA 5C0CE 1DBJH 4NWTL 4NPYA 1U3HC 4H20L 1BFSA 4Z77B 5HYJB 4FZ8L 1F58L 4PJ8C 3VGBA 1P7HL 3KR3H 4XGZA 1RHFA 3PXHA 1MAJA 1HXMB 4JFPB 3TBTA 2O5ZH 1QUNA 1CLOH 1U92B 3FB8B 4YBHA 4TTGA 1NCTA 2EE9A 3QEQB 2YS4A 3MV7A 4YPJA 5HGBA 5CBEB 4JG1L 3JV6A 4FFWC 3QZWA 4G8EB 5MEPB 1Z9LA 3HPLB 3HNTH 4QNPF 1LEKB 4PR5B 3KPSE 1V3JA 2N7BA 3DVGB 2OK0L 2N1KA 4M7ZC 4WVRA 1FO0B 4K94C 1LO0L 2W60B 1N5YL 1XMWA 3EDKA 5D70H 4BQ6A 2XNAB 2I9LA 4PJGA 3X17A 1EUUA 4DW2H 3G04B 3QUMB 3B4NA 4XHJD 3VFGH 3VXUE 2HJKB 2MPAH 1F3DJ 3KPOB 4X98B 2CO6B 4HAGA 4LRNL 3ESVF 3FT4A 3OQ3B 4Z7OE 1MEXH 4JO2L 1CLYH 4R0LC 3HFML 3MRBA 3VD4A 4K7PH 3H42H 3BEWB 2W9DL 4RAUB 2CUHA 3QJHA 3BISA 4HFUH 2X9XA 4NCC2 3MRLB 4G6MH 2OL3A 5EB9A 5I8KL 2XFXA 4MA1C 1UCBH 4X0KA 1Z0MA 5D9SA 4MQ7A 2EYTB 1OQXA 1MNUL 1QPXA 2XT1B 3HUJA 2E9IA 3T3MF 3X12B 3FFDA 1JNHA 1SVZA 2YBRB 5MENE 3IFNL 1C16B 2QR0B 1YDPB 4KRPC 1WBXA 1A47A 4JKPH 3AY4A 3ZO0A 1MFAH 1GHFL 4QY8B 1TNNA 1URLA 5IB4B 1C5BH 4OCSL 2DYPA 3BYYA 5EU5A 4Z7VE 4S1DC 2OTPA 1GGBL 3P30L 4QWWD 3PWVA 3WNLA 4HUVA 4ORGA 4UILL 2VDLH 3TCXA 5E5RB 1C08B 3IJSB 3QDJA 1RZIB 3NZHH 4LGRB 3X11B 3H9ZA 2EO9A 1CDUA 4CGTA 4L4TD 4N8VA 2E27L 3UPRA 2PYFA 4R7DB 4P4KA 1FZKB 4Z0BL 3OKDB 3T0EE 4G6AC 3FT3B 4HQQL 3SJVD 3WXVL 4JPIB 4QHLA 4CMMB 3BWAB 3LS4H 3HG1A 5GGVL 4CUCA 2NZ9D 1JPST 2A83B 1ACZA 2GW5A 4JR9H 1W72B 5HHMB 3GK8H 5D93C 3QNXA 3T77A 2AJZA 4UTBH 1JPTL 1RPQA 3VXMD 4KMTH 4OT1L 1UACL 2F15A 2M1KA 5EC1A 4JKMA 3GSRB 1FFRA 2JJTC 1A6PA 1IL1B 4DTGH 4KJPD 4P2QB 2PO6A 1E4XH 1J11A 5HHPA 2V2WA 3C5SA 5T3ZL 4EN3C 2WK2A 4HH9A 4G8GA 5ALBH 4CU7A 1XAUA 4K23L 1RMFH 4LDOB 4XNZC 5CAYB 3VXNA 3O6KH 1R3IH 3FFCB 4LLQB 2VL5B 3OGOE 4EBQL 4XNYL 4IRJA 1EEUA 3N1GC 2VIRA 1OHQA 3MOAL 2AP2A 2P8LB 3LAFA 4Y19E 2C1PB 4MSWA 3STZA 4DEPB 3SY0B 4LVOB 3U46B 2BHZA 4GBXC 1P4BH 5GRYA 2Z91B 3CMOL 3TWCL 2IAMA 3VXSE 1PG7W 4GLRI 1IAMA 3BE1H 3BZFB 1L0YA 2UWEA 2OQJB 5FHAH 5TDPB 2OR9L 1CU4L 4EI5D 3BKJH 4ZPTB 4ONFH 3HC3L 4EQ2A 2JB5H 3EYFB 1U3HA 4X6CF 1JHKL 1D6EB 3WUWB 1CQYA 1MCNA 4PJ8A 1HINL 1Y18B 4WFHE 2VQTA 2BVTA 3MLXH 1AD9B 2C3VA 2EDEA 4U1JA 3Q5OA 1AKJB 5D1XC 3QAZB 4NC1C 4UB0H 1HH6A 3B3IA 3QXWA 1TJGL 4KUCF 1GOFA 4JY6A 4XCFH 3VFPB 2Y5EA 4HIHB 2WM0A 2DQCL 3ZKXC 1FC2D 1OPGH 3RTQD 5EZJB 5DJYB 1N26A 4JDTH 3ARWA 1MFEH 2W0KA 2YD1A 4HIIA 1W0YT 5JIKA 1C5CH 4R2GC 2HFEB 1UVQA 5JW4N 4NZRL 4KQ4H 5CJ5A 2DKSA 5LXGL 2OCFD 2UZYB 3BZ4B 4LPUA 4ZD3H 4G6KL 5GS0L 2FZ3A 5E08L 4C56B 1KN2H 2VQ1B 3C8KA 3SDDC 4KUZL 1BJ1J 4P2OC 4EVNA 1JUFA 4GRWB 2IF7A 1ZHKA 5JUEL 3PP4H 2X4SA 3PJSB 4NM8H 4XPTL 4F37K 3LKSB 1EFXD 1FFNA 4PJBA 4AL8L 5DVNA 1FGNL 1KPVA 4WY7L 2AJYH 4P99A 4DK6A 4BZ2H 4Y4HD 1PG7X 3ULVD 5FOBA 1P6AB 2W9EL 4Z78B 2WINA 5GIRB 1CS6A 5DJDA 4DGIH 1EA9C 3IDMB 4PRAA 1JFQL 3BUTA 1G7IA 4NO5A 3QEUA 1DFBH 1SEBB 1Q8MA 1KYOK 1OB1B 4DGVL 5J0BA 4F8QA 4WNQA 4JFDA 4X4XA 1JWUB 3QPXH 5JR1H 1NCAL 3UEZA 5GGTH 3FOLA 4OCXH 5C86A 1C8PA 2D0FA 2B0SL 1BAFL 1D5BB 5IMLB 2GITA 4LGPB 3VWKB 5KN5B 4P3CH 2DLIA 3HC0B 4IBLT 1NCCL 1VEOA 4BK5A 3PWPD 1FG2B 1MHHA 5B39G 3KYMB 2HT4D 2Y4SA 5I8OH 1P7QA 1D5ZA 4OLUL 4PJDB 4RFOL 4UT6H 2VZSA 3DRTA 3F7VA 3UJJH 1IC7L 6FABL 1XF2A 2ZUQC 3ES6B 3TN0B 1MRDH 4CMHB 2EYSB 1TVBA 1FVCA 1AR2A 5FUOL 2P8MA 2CH8A 3BPNB 4QRRE 3VWJB 3STLB 4HUNB 1K5NA 2EIZA 5EUKA 2D7MA 1INEL 5D7JD 5HHOA 3CFDB 4NKQB 1AHWC 5JHDD 1LO4L 1GH7A 2BVYA 2PTTA 3FRUB 4RISL 1ZTXL 5EBGA 2G5BB 4TSCL 1LGVA 4WCYL 3RP1A 4ELME 4ZFGL 5FYKU 4Z5RA 4LBEA 2WAHA 5L2KE 3MLTB 3RQ3A 5DYOB 5C6WH 3RVWD 5EBMA 1WTLA 3LQMA 3K2UL 1KCSL 4M5YH 1P6FA 1N64H 1ZHLA 4XMKL 1JP5A 1N0XL 4WEBH 1CFNA 3ZYIA 2YHGA 1NGXA 4DUXA 5HGGS 4JFZL 4PJXB 4OCYL 4HK3N 5CILH 1T7YA 5CIPA 4PJCF 1NMBH 3SDCD 5AZEL 4XCNB 4U6XB 2GTZA 5DRZB 1BZQK 3MLVH 4U2ZA 3B9DA 4NBYB 5F9OH 1QSEA 3MV9A 1RUQH 3IDJB 3GMMA 2JJTA 2B1AL 3QB7C 3QUXD 4XVSH 3OJ2C 3OJVC 4OZGB 4XPBH 4PP1C 1UADC 3IFPA 3BPLC 3QIUD 4EN3A 2DD8L 1A6TB 3O3EA 5EBWA 3FRPA 3BSZL 4KHXH 1J0YA 4LARL 4UV4L 4JFOA 5IHLB 1GZQA 4WFFE 3P9LB 5DWUL 5FK9B 1CBVH 1YJDH 3LZFL 5KVGL 4ZTPH 3CCHA 3FN0L 3JTTA 3QEQE 1VA9A 3GSNA 4FZEH 4NYLA 4GBXA 2HVKB 4QOKB 3BFOA 3O8XD 4XPHH 1H0DB 4CRPA 4Q9CA 4MNQB 3OKNA 5EZOL 1DN0A 1J1OH 3O81A 2FGZA 2KDGA 1N8ZA 3VXOB 4NRYA 1MJ7H 1QTYT 4MJIA 4TNWF 2F53B 4UDTB 5EIIA 4POUB 4Y4FC 5HYSA 3QULA 5C0NC 3LY6A 4OV5B 3BQUC 3MRQA 5IVZA 5KG9A 5D2NE 4PREB 1XF3A 1CFTA 1RURL 2Q86A 1NMCC 3PWLB 4D0CB 2FX7H 4M7LH 3M45A 3AVEA 5CINH 3FQUA 1X44A 3DGGB 2OZ4A 3NPSB 5EULV 4NO0D 4AEHL 2A74A 2ID5A 3OXSA 4RWYH 1MVUB 5D1XA 3U48A 4YE4H 3NACH 4K8RH 4I18C 5IUSA 3FTGA 4KGJA 3G5ZB 3BVNA 1F4AA 1HYSC 4Y5XB 1D6VL 2BY2A 5IEKB 4WUUA 2ESVD 2IANB 2R29L 4PD4K 2DYPD 4ETQB 3CFKB 5LGJA 2FH8A 4ZXBC 5C0AB 2EKJA 1BF2A 1NEZA 5GGVY 3CZFA 2DMKA 3QHFL 4QF1A 4G42B 4XX1G 3QDJD 3MA7B 4ELKB 4ODVH 3CVHB 5GGRA 2FWOA 3SDDA 1KELH 4P2OA 5E4IA 1FL5B 3R06A 4M62H 1QSFA 2PXYB 1TTFA 1S7TA 5LAXA 5DC9B 2PR4L 3I84A 4P4KD 4L4JA 1EEYA 1DBJL 1L6XA 4WW1A 3MBEC 2OL3H 4Q2ZA 4U0QB 5ITFB 4FNLH 3HG1D 1S7VB 1SMOA 3GSWB 5F7EL 1X5HA 4OSUH 2OMNA 4L9DA 4M4RA 3LDBB 1G7LA 5I15H 3RKDC 1CLOL 5DD3H 5CEYB 4DFIA 1F42A 3JUZA 4QHKJ 1C5DA 5C1MB 4MA3A 4WEUD 1A9EA 3MGTA 1UM5H 5A2FA 4X5WA 2H26B 4KZEL 2VYRE 1QLEH 1S9VA 4NKIL 5I17B 2BZDA 3W5NA 5C6TH 2K1MA 1W0VA 4OLYH 2FJHB 1JI2A 3EO9H 2WWMD 5MHSE 2WW8A 3MQIA 3TV3H 1FAIH 1A6VL 5JTWA 2QSVA 5HHME 1XGTB 4BKLA 1KIPB 3E6FA 2XTJC 2Q76A 3SKNB 5T1KA 1EJOL 3FQXB 4L3EB 1MI5A 1U8OB 5H37H 4DW2L 2OJEB 4JPKL 4X6DE 5ILTH 1NGWA 4M7JL 3QUKA 2MPAL 3E6HB 3P73B 3GEWB 2C4XA 2R0WH 3VDCA 3HZMA 4OIBA 3VXPA 1KCVL 1T0MA 4G43B 5C2UB 2EDXA 1AHWA 1CLYL 3TLRA 4L8DA 5IR1B 4NNXA 2YSSA 1AGDB 1ORSB 2FSEA 5CGYD 5IVXB 3T3PF 3Q6GH 1BD2E 3U6RA 4QT5A 1B6DA 4HFUL 1XGRB 4PRPB 4G6ML 3LCYA 4FG6D 1U8QB 1LD9A 3DXAA 4LU5H 5C0GA 5DJ6A 3ZKMC 1BM3H 2Q3AA 1T20B 5I76B 2VZTA 4JQVC 4OI7A 3DJ9A 4OCRL 2NY0D 2MWCA 1MRFL 4NKMA 2E8ZA 2V2XA 4S2SB 2EDLA 4JKPL 3QFJD 1XGQA 2FLBT 5IQ7H 1CN4A 2A6DB 1MFAL 5DRWA 4XAWH 4GOSA 1P2CA 1T03H 2EKSB 1ZK9A 1H3VA 7FABH 9CGTA 4JVPA 2FIKB 2CD0A 6CGTA 1RUPL 3AM8C 4QHMB 3LKOA 1FE8L 3I2CL 2IBBA 4X7SL 4Z7UA 3BXNB 4L1DA 1G1YA 3MRHA 1AIFA 2A1WH 2DM4A 3OBAA 1Q9OA 4X7EC 3IVKB 4EUPB 1SJXA 3D39A 2BNUB 2J8HA 2OX5A 4OI8A 3TPUB 3I02A 2WIIA 4PJ5A 4EZMA 2AI0L 3PIQA 3LS4L 5TF1H 5INDA 1CF8H 3S34H 4YFLI 2YN3A 4M1GL 3VGHA 5BV7C 3KPQA 4AH2B 3R0MA 3V5DA 4UTBL 3BESR 2NMSA 1FSKB 3O6FC 4KMTL 4C56E 3MROB 5DJ8A 1WIOA 1V3LA 1KBGL 4Y4FA 2DMBA 1IJ9A 3WHXB 1ZT1B 3IF1B 1WC7A 4GRWE 5DQ9A 3BQUA 3U4BH 1YEJL 2X4UB 4LHJB 3L5IA 1UB5A 1BEYH 1U8KA 1NBYB 2N7AA 1E4XL 1I7UA 1DVFB 3L3GA 4U1MA 3L95A 1T83C 1NKRA 4F57L 4JRYD 1RMFL 1SYSB 3SBWC 1J05A 4GS7C 1MHCA 1FFOB 1JTTA 4JO1H 1FLTX 5ESVA 4KRPD 1MWAA 4I18A 4H25B 4ZOBA 4MCZA 1MPAH 2BHUA 2HKHL 1P7QD 5J11B 3IDGB 3L5HA 4LAQL 3OR6A 3GIZH 4OFVA 5ICYB 3OKOB 3ULUF 4KY1H 4MNGB 3U9UA 1HEZA 2G2RB 4K94H 4TUOA 2B2XH 5DQJB 2ATKB 3DROA 3WLBB 4J1UA 3VRIA 4S1DD 4ZXBA 1FCCA 2YPLB 2DLFH 4J8RB 2HT2C 4KROC 5EO1A 3GRWL 4MAYB 5CWSA 4P59L 3QHZH 3TNMA 4V1DA 4C59B 1BVKA 4GXVH 5FHAL 2EZ0C 3UXFA 5CZVH 4PJDE 4L3CA 2X4PB 1VGKA 3EHBD 3BKJL 2X10A 1X5KA 1R0AH 1EGJL 2SEBB 3WFCL 1S9WB 1NJ9B 2CXKA 2JB5L 1IGIH 2UWEF 1QEWA 3MBEA 4G6AD 1GGCL 4ZQKA 4L9LC 2UVFA 2MNUA 3QPQD 2X4NB 4YUEH 4C83A 5M94B 3MXVH 3ARDC 3OAYK 1OQOA 2CIIA 1DEEA 1G9NH 4UB0L 4A6YA 2GSGB 2EYRA 4OQTL 1NUFA 4JO4L 1YEHH 4PJAB 2AEQL 2BXZA 1LO2H 4XCFL 4NCC1 5AYUH 3LQZA 4FQ1L 3WS3A 5IVOA 3BYTA 2XKNA 3S96A 1OTTD 4JDTL 1BVLA 2ERJC 4X9FA 5DGQA 1NFIA 2JIXB 1ZHNA 3DX9B 1CZ8H 2PYEA 2L7UA 2X1WL 4L29B 3NN8B 2X4TB 5DLML 4N1EA 2BNQB 1HNFA 3ZT7A 4ZD3L 1I7TA 2KKQA 4HMEA 1TQBC 1A22B 4EDWH 1RHHB 1EXUA 2CUMA 2J4WH 2NX5B 2Z92B 5IBUG 5C0DB 1RZ7H 2AXFA 2FECI 4ODXB 4DKFL 2DLTA 3MRGA 4I0KA 4C4KO 5KS9E 1TZHB 5TE6L 4G80B 3QCTH 2XG4A 2Y9RT 4GT7A 4HS6A 5JQ6H 4XNQA 4QHUA 1BIIB 1AE6H 4QTHB 2JELH 3L3DB 5CIPH 1NC4A 1G6RL 3T08A 3IU3B 2QHLA 1MCQA 1DFBL 4HZAA 5E03A 3BRGC 2O5YH 3P4NA 2GK2A 4U1KB 5CEZH 5DSCB 5JR1L 3QPXL 5HYFA 4QKXB 3WNMA 2FBJH 5IB2B 1HNGA 1LP9B 4JQVA 4IM8A 4YDVB 1DSFH 2YD8A 1MCDA 2DQHH 1ZVSA 2APVA 3GMPA 5DJ2A 4OFKA 4R4ND 4TUJA 5I8OL 3TA3C 3VXQA 4LOUC 1SJEA 4UT6L 2F53E 5TQ0H 3JWOC 4R3SB 2AS5M 1T1WA 3EYQD 3IDUA 1TJIH 5IM7B 4WIQA 3BJLA 3OHXB 2J8OA 3MCLL 4N8PA 1NGYB 2NY2C 3AM8A 1FYHB 2OTWA 2NTFB 4I2XB 5D7LE 4I3SH 4KKLD 4OD1H 5GRXG 3FN3A 5H8DA 3ULVL 4LQFH 5FCUL 3T4YA 4ZS7L 4OF5A 3N1FC 1N3NA 4XWGH 3I6GB 4FQCL 4IJ3C 4XP4L 1DLHB 4AG4L 4YNYB 5L8JB 1N59A 4X8XA 2IANE 2NY4C 3QQ4A 1LE5B 3TT3L 4WEBL 1TFHA 2R1WA 4QEGA 1NGQL 3DPBA 4YEEA 3UBXA 2B7DT 3ZTJG 2JJSC 3QXAB 2VWEE 4HLZG 4XMPH 5C0AE 1N2RA 4OLXH 1AQDB 5BVJA 5CILL 5CSBA 2QKIB 1NMBL 1G7HB 5ISZA 3VCLA 1Q94A 1QHOA 4TSBL 2DIAA 3IDNB 3MLVL 4G9DA 3O6FA 3GSOA 5C0IB 2HWZH 2APWA 5I16B 4PY7A 5C09B 5SX4I 1H9VA