3V4UL

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
molecule tags Immune system
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
total genus 58
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL01
1BQHB 5SWSD 5C0BE 2BDNH 5C0FA 2X4QB 1U8MA 4NJAL 5CJXA 3D2UB 3LEXA 1IGMH 1MEXH 1SQ2N 5EOQL 5DEGA 4BUGA 4HIHB 5IJVB 4NQEA 4YFLF 1YYML 5ACMA 4MXWL 3CSYB 1VFAB 2IAMB 3VXSD 5EORH 1MUJB 3MNZA 5JHLL 4LSRL 4Q6YA 1C5CH 3ES6B 5KVDL 4JFFA 4ZXBA 2OTWA 1C5DA 1EUTA 2CDGA 2HT2C 4MJIA 1FZKB 1R24B 1CXFA 4G5ZL 1ZS8A 4AH2A 3GKZA 4X98A 3OAZK 4KXZI 1NFIB 3VDAA 1KB9J 4PY8J 5BW7A 4IRZH 5FO8A 5HYJE 4YFEA 5E0QA 4K7FB 1L0QA 1Z9SA 2Z35A 4LSSL 5JO5A 4K3EL 3MJ9H 3MRLA 4KUZL 5E2WL 1T03L 4P57B 2VDKL 1E4KA 4UBDD 2ZSVB 3VD7A 4WDIA 3D5OF 2SEBB 4K3JL 5C0GB 4PD4K 4FXLA 3IT8D 4UIKL 3D1MC 4IRSB 4XVJH 1F3DJ 3O6KH 2J8UB 4X6DF 1HIML 4HAFA 2WZPD 2AERT 1BVKB 4JHWL 3S35H 2Y7QA 3MV8D 3QCTH 4R96A 4EI5A 5HHQA 1TZGL 2CLZA 1WIPA 1XH3A 1CICC 2EKJA 3TIEA 4P2OA 4JY6B 3HFML 3E8UH 2Q20A 1MCEA 4BQ6A 3AU1B 4YBQD 5F93C 3FAWA 2B1AH 3OF6D 5I30L 3UYPA 4ELME 4YEEA 3SDCA 4Q2ZA 1ZHLA 1PKQB 3HAEB 1U91B 3PWVB 4J8RB 3GMLB 2VDRL 1B2WL 3RBSA 2X4OB 4NZTL 5J9PA 1D6EB 2CR6A 4G3YH 2NR6C 4Z0BH 3OKMB 1YEFH 3BX7C 3IFNL 3TBYB 1J05A 1NUDA 3SY0B 1KCVH 3OJDB 3F7RA 2AJUL 1ZLWH 3STZA 3HZMA 1NUGA 1AD0A 5TE4H 2JJTC 5BS0B 5CILL 1H3GA 1GGIH 3FB8B 1JNJA 2VXVH 1OP5H 2BMKB 2EDYA 3EFFA 2APVA 3V0WH 4MB4A 2OK0L 1BEYH 1N4XL 3MUGA 4HGKC 2IG2L 4OCNC 1YQ2A 5C8JB 1MRCH 2ARJB 5HI4C 5TE6H 1S9XB 1W0YT 5E2WH 1R5IA 2EYRA 1RURH 4F2MA 1WFNA 5ID1B 1EVTC 1EO8H 1DDHA 1T20A 1CZ8L 4HW6A 1RY7B 1UC6A 4X0KA 4X6DA 4ZD3L 3T77A 1RZIB 3J7HA 2BJML 3C6SB 4LSDA 2IFFL 4YUEH 3B2UC 3HG1D 2H9GA 4M7ZB 1C5CL 1INQA 2ZCKL 4LP4A 5E00A 5C2BH 4OFYA 3WFBL 3L5WB 4LLWB 1YN6B 1YDPA 4G6KL 3FHAA 3ARDD 3HUJF 5M94B 5EU3A 3ARFC 4JHWH 2QQNH 4MSWB 4HF5H 1UADC 3DVIA 2EIBA 5JDSA 2VMFA 3EJZD 4LK4A 3RZCB 1KIPA 4TRPL 1D5MB 5ANMA 2NXYB 3DX9A 3HKFA 2HKHH 2Z91A 4YXHL 2CMRH 4XBPA 3T0WA 3HAEH 4KFZC 1S78D 1FAKT 3RPIB 2I26N 1UT9A 2NX5E 3P73A 2DQEL 2D03H 4LAQL 3HI1A 3P4OB 4MJ6B 4U6YA 5DMGD 4OT1H 3VFPA 2VB5A 3OX8A 4A6YB 4NQCE 2WWKT 2BOBB 4WV1B 4KJQC 4P46C 3EHBD 5TF1H 2DQEH 4X6FB 3QI9B 3SE4C 3BXNB 5GQBA 4PJ5B 1IGFH 3TCLA 1HINH 4EXKA 3P4MA 4YDVA 3R0MA 4GRLD 3BGFB 2X9XA 4IIQA 1S7VA 1MF2L 1KTLA 4ESKA 3IDIA 2E6PA 3B43A 4X7CC 3ALWA 3QA3A 4LPWA 4RX4A 1KCLA 2OR9L 3OKKB 1JZ6A 4PB0L 2PETA 3HZYA 5DZNA 4UIMA 3A6CH 3CVIH 5CSBA 2ZKHL 3GMOB 1MLBB 2VABA 4J4PD 4XAKE 1KSRA 1TVBA 3MA9L 2V2XB 4EOWH 1G9NL 3LN4B 4L9LC 4OZGF 4I3SH 3QSKB 1H3PL 2EDKA 3JV4B 3GSRB 4OCWL 4XHJD 1RZ8B 4PJEE 3VXUD 3L7FA 1E4WH 3KPOB 3RWCA 1LO4L 1YNTB 4QO1A 3LDBC 4WFFE 4FQCH 1EX0A 3CK0H 3QEUA 1G84A 5ILTL 4PR5B 2DQCL 3ULUH 1A6VL 4NKIH 4JVWA 1GIGH 1NFDA 3LEVL 5CHNA 3MRDA 1OVZA 4Y4KB 4KXZH 1FVEB 3SGJC 3VFVA 2R9HD 5DUPH 3SE9H 3ILPA 1BFOA 4XP1L 3UPRB 3AM8A 3G5VB 3GHBL 3PG2A 2BVPB 3BN9C 1GZPB 1KJ2B 1HYSD 3LS4H 3O3BB 2QSCH 3MACL 2O5ZH 2VYRE 3HI1B 3P4OA 3BDYL 3B5TA 4QRSA 3VWJC 3QWRD 5LVEA 1FFQA 1A6AA 3ARZA 2QQLH 3PABB 1DQLL 4R0LA 1OM3L 4UV7L 2P46B 4XVTL 5GS2H 1KGCE 1I4FA 4XRCA 4HIJB 4DZBB 2XRAL 4L4VB 3EFDH 5I1LA 1IQDA 3SO5A 4ODXA 3RBGA 4POUB 1PSKL 3TA3D 5BV7L 3STZB 4OLWL 1T83A 1AXSA 1MF2H 1Z6JT 3C5ZA 1H0DA 2EEDA 3KHOA 5KS9A 5SX4H 3PNWB 3X12A 5FF6A 2D0HA 1UCBH 1RZJL 3Q5OA 4C56A 1UM5H 5GGRA 4HK3J 3MBXH 1PAMA 4TUJB 4TOYH 4Z76B 2BY0A 2P24B 2W38A 1FGVL 4PJAE 4QKXB 5I1CH 3TA3A 5IHBA 1F13A 3DWTA 2DKUA 1U9KA 1FFOA 4IJ3C 5M7QA 4KJYB 3IGAA 3RUGE 3CU7A 4FFVD 4OLEA 4KK8C 1U3HD 1JRHH 1BZ7B 4LHUA 4LSSH 4JQVC 2E9IA 3RDTC 5D70L 5DTFB 1DL7L 3ZDZE 4PTUA 4GS7B 3VXRE 1PYWB 4NYLA 3VD3A 1UM5L 5C86A 4JPWH 1AKJA 3D6GA 5CEZE 1J1PL 3HB3D 4X8XA 4IJ3B 4MXVE 4XNQB 4QWWD 3T3MF 2KZWA 2RFXA 1OGAB 4ALAL 4ERSH 3TO4A 3MRGA 3FQUA 5EU5A 2I9LA 2F74A 1QBMH 1NMCC 1UXWA 1UM4L 3L5IA 4BM7A 1S7QB 1UEYA 3QDMB 3MRLB 1DL7H 5TF1L 2HLFC 5IB2B 4G6JL 1I1FB 4FXGB 4HJ0D 5D7IF 3T3PE 3CAFA 3TESA 1LHZA 3RWJA 5EOQH 2DQUH 3RTQD 3BP4B 2HLFD 1JGLH 1XGYL 2R9HC 4Z7VE 5E99L 3TEUA 3PWPA 2XKNB 1OTTC 3JTTA 5A3IC 1CGWA 1YEGL 5IESH 4UT9H 4K94H 1YEEH 3MV8E 3RPIA 2NYYD 4G6FB 4ZFZA 4R4BB 5HYJB 4YXLH 3P0VL 2JF1A 1J0KA 3QUKA 2J6EH 3T08A 3MROB 3D0VA 4KTEL 5C3LD 3IDUA 4V1DD 1ZLVH 3RAJL 3PIQB 2WQRA 3BW9B 3VDBA 1CBVH 4FS0A 1RIUH 4I77L 4HXBL 4K3DL 2UZIL 2IALA 2VIRA 2PTUA 2MQCA 3T4AB 3QZWB 1CDYA 4HXAH 2GQHA 5I1AA 4YXKH 2BNQA 1YEJL 5FECB 3CFBA 5CEYA 5CCKH 5DRZA 3WFHA 5EU7C 4F7CA 4MWFB 4OI7A 4Z7WE 2GK0B 1VENA 3QIUA 3CZFA 1ZS8B 3BPNB 4XVTH 2OP4L 3WKNA 1C5DB 2CDGB 3DRQB 3NZ8A 4XNMA 1UWEH 3LQAC 1P4LA 4LP5A 4Z7WA 3FTGB 5IKCB 3GHBH 3MLUH 3DMMB 4NKDA 4GH7B 4GRWF 3S3PA 1YECL 2DM4A 3VFGH 4N8VG 4L1DA 4OM1H 5D2LE 5ICXB 1Q72L 1I8MB 1OF2A 4HUKB 4E42A 5D6CB 5D4QA 2PO6A 2F54E 2P8LB 2CH8A 4OSUH 3KPSA 2PCPB 2VDRH 4AEEA 4HUWA 4AEFA 2FX7L 2NMSA 5EBLB 1G7LB 2P5WD 2NLJA 1F45A 5FUOL 1HNFA 5F7HA 3HI6H 1E28B 4JDVB 1G9NH 3QXDB 5T3ZE 1AHWA 1IC4H 3N85L 3QFJD 1U8OB 3M45A 1IFHH 4PJGE 4YHLL 2IQ9L 5F3BB 1IJ9A 1BFSA 3QUML 1AGFA 3PJSA 2UWEE 5DJYA 2AJVL 4GJTB 4I2XA 4EI5B 3MRCB 3OPZH 5K9JL 1J1XH 4UDTA 1R3KB 4ACPA 1RIUL 4I77H 1F42A 2YA2A 3UTSE 5D2LB 1MY5A 1MEXL 4EDXA 5DRNA 3QUMH 1H0DB 3P0VH 4N8PA 4BFIB 3SQOL 5GS1B 1CD9B 3VD9A 1UEMA 5F7UA 1JGVH 1VEMA 3LKNB 1P7QB 3O3EA 1B6DA 3FN0L 3QULA 4OCYL 2DBLL 1QACA 1MCOH 4ZUSA 4BH7B 3KYMA 5I8EB 1Q9LB 1QEWA 3TJHC 5DURD 5L2KA 3VI3E 2I07A 3QH3B 1KB5L 3PWLA 4F7TA 1Q9WA 4JCMA 4AM0B 3SKUD 2VLKB 5K9OA 4Z5RB 3DRTA 3O2WL 5HVGB 3C60D 3VMOA 4H0HB 3QUXA 4OQTH 5D7LA 4NNPL 5E1AB 1O7VA 4L3AA 1Z0NA 3C2AL 2B0SH 4PJ8C 5EIQA 4EI5D 2EICA 3QUYC 3BHBB 2HKFL 5M95B 2DIBA 4NJAH 4QNPE 1OGAD 1BP3B 1HH9B 2Q8BL 3HMWL 4M7LL 1CK0H 1OQOA 3MLUL 4XVUC 3DSFH 3SDXA 1XF4B 2X41A 1T89A 5ESAA 4G42B 2B5IC 1P7KB 4LLMA 4UQ2A 5JPNB 2L0DA 1MCFA 5D5MA 1CK0L 1IARB 5J12B 3Q3GA 4WU5B 2F5BH 4UB0H 2OTUA 3B9KA 5HYSG 4XCYB 3VXOB 4QHMB 5GGVY 3OHXB 3KAAA 1QTYT 3BGMA 5ADOH 3VXSA 4Q97A 3M07A 4N8CL 2XFXA 1BPVA 1YQVH 1TCRB 3MV8B 1PX3A 1WWBX 4U2YA 3MJ9A 4M62L 2ADJA 1I1AB 1LNUB 2OCFD 1YJDL 3L3KB 3HC0B 3JVGC 1B0WA 2H3NB 3VGAC 1QLEH 5IK3B 1Q1JL 5JR1H 5KVEL 2JELL 2CUIA 5FF6B 3UTTE 1WTLA 5D7SH 1VA9A 3KGRA 2HFGL 3RNKA 5C0FB 1I7RB 2ZG2A 5FB8B 3ZTNH 3FT2A 5F21B 5FUZH 1QBML 3NACL 5IBLC 3HMWH 3BKMH 1T0MB 4XPGH 15C8H 4I0KA 4PJ8B 3KPQA 1EHAA 1NMBL 4NQCA 1N3NB 1RZ7H 2HRPH 5IEHA 2EXWC 2WUCH 5B3JE 1G0DA 3MRFB 3BD4A 3QHZH 4WU7A 4JFHE 4DUWA 1MCOL 3ULVC 4YHIA 5E1HB 5DUML 3AREC 4ZFGL 5E00B 3DI3B 5FYJE 3TH4T 5HGBB 3GSWA 4M6AA 4I48A 4XC1L 4LRNL 3WUWA 2B1HH 3CZJA 3SJVE 4L8DA 4LSVH 3VFSA 3L3IA 5BV7B 2YUVA 2FGZA 1N7MH 4PJIB 3UTOA 5CHNB 1P9MC 3LH2L 1OTTD 1MCLA 4RWHA 4EBQH 5JHDD 5IBTL 1JN6B 3GM8A 2JK5A 1IC7L 3I50H 3SGDH 4Q9CA 5DR5L 1UZ6E 1UA6L 3DLQR 2CKBA 5LGHL 4LSRH 4BFEA 2R2EB 2BXYA 4I0PC 4KHXH 2DM3A 4U1HB 5E9DD 1MFNA 1F4WH 2GSIA 2IH1A 4P5TA 5EU6D 3JWNC 4I48B 3UXFA 1N7ML 4NCDA 1DBBL 1PFCA 3MRRB 2R1XB 4PGBA 2IFGA 4NGHL 2DJSA 1LD9A 5DS8B 4I5BB 4CADB 1WBYB 1UKQA 3HI6L 4KROC 5B3JF 1TZHA 4O2EA 3BW9A 1BQSA 1KIPB 4MAUL 5EC1A 3TPUB 1N8ZB 2DKSA 1N59B 4JPKL 4D94A 5I1KL 5D72L 5GSRB 1RUQH 2EE9A 3QQ9D 1HILA 2CDEA 1S9KC 5GRZA 4XBEL 1GOFA 3DTXB 4MHHI 1QZ1A 3IDMA 3MJ7B 4KROB 4JM4H 4R4FH 4AQOA 2YUZA 1P4BH 3QJFB 1PLGH 3KS0H 3WIFA 4LVHB 4HLJA 4DKEH 4R97C 5C0AB 3ISWA 4PY7A 2XNAA 4L5FH 1GGIL 2OR7A 1A7OL 4HK0A 1WC7B 5C7XL 3CK0L 2AGJH 4DW2H 3ZE0F 1U8LB 3B9AA 3CXHJ 3W81A 3MRHB 3BPOB 4R2GB 3EDEA 2JIXB 3SE4A 2JJSC 2ESVD 1UKSA 4P9HH 4LVNC 5JOPD 3O2VL 4JG0L 2PN5A 3ARFB 3HZKA 2OYPA 5JDSB 1DFBL 1MIEL 3I75A 3V4UL 4O2CB 2R1WA 4EN3B 2AGJL 4MJ5A 2FL5A 5LGJB 3DX6B 4HGWA 3LEVH 4S11A 4ELMA 3UPRA 4I9WD 3QPXL 1J12A 1S7UB 2H9GB 4R6UA 4TSBL 5B39A 1CF8H 1LO5B 4CVXA 4I3RH 3MRHA 2XG5A 4MGXA 2Z31C 4M1DL 2DLTA 3SHSA 4CUCA 2AV1A 2V6HA 5CS7A 2ZCLH 5D2NB 4LPYA 1FRGH 7FABH 1MCNA 3EBAA 1SY6L 4QWWC 3TV3L 3AB0C 3IF1A 4FXKB 2VDOH 5DVKA 2CD0A 1KB9K 2FLBT 2J88H 2AK4B 3BYYA 3GGWB 4ZTOH 3CVHA 1NGPL 4Q58C 3N1GC 1PKQE 2AABH 1JFQH 5FYJL 4CVZA 4ELMB 3GKWH 5D5MF 3DVGA 3LD8B 5DS8A 2R8SL 4LIQL 4JHBA 2UUDK 2DTML 5GGSB 4XPTL 5C0EA 1SVCP 1VADA 5E1AA 1EJ6A 4OV5B 1F6LL 2CO6B 2I27N 4JDZA 1QSFE 4NNYB 4HKJA 3X14A 1G7MB 5HHPB 3GIVA 4RFNC 4OQTL 3ORJA 4KRPB 4BKLB 1Q9LA 1JV5B 2NXYC 2DQTH 4OAWA 4Q9RL 1NBZB 1FVCB 1T22B 1EV2E 2J5LB 5D70H 4ZUUB 2VJXA 5I8KH 5K9JH 4FFYH 2QSQA 1JRHL 2PW2A 2FWOA 1XGRB 2HVJB 3GSXB 3V5DA 4QT5A 4W6XB 5C0AA 4WV1A 3DX8A 2ZJSL 1M05A 3EDFA 2R1YB 2Y5TB 4MCZB 1Z9MA 1BX2B 1F4YH 1I8LC 4P9HL 3GSWB 2A38A 2JLLA 3BQUC 3BUYB 1JYXA 4RMQA 3VRLF 2DM2A 2COQA 4KI1A 1RZJH 4OGYH 1KTKE 4KMQA 4KJQD 1F8TH 2J12B 1IKFL 1CT8B 4FMFA 5IMMB 4JFZL 1BD2E 4BUHA 1C5BL 4ZPVA 1U92B 1S78C 3FFCD 4XXDA 4R3SB 3PDGA 4ZXBD 4KZEH 1EXUB 1AGDA 1HDMA 3NACH 4U7MA 1JHLH 2IMNA 5K59F 3TZVA 1FGNL 5T1LA 2NW3B 1R3JA 4UQ3B 3W2DL 4LNRB 2C7UA 1A14H 1KG0B 4LBEA 4HDIA 3H9SE 4FQXB 1E4WL 4GG8B 1YEHL 4KVNL 3QIWB 1PW3A 2OJZL 4HS6B 3TN0A 3QB7C 1QHOA 3IU3A 1RJYA 4WFHD 2AKRA 4Z9KB 1S7WB 4P23B 4OKVB 3VG0L 5BRZD 3LS5H 2EDBA 5D1XA 3PGDB 1T1XA 5TGBA 3VMPA 2UY6A 1ACYL 4GRWE 1EFXB 3TBWB 1JF1A 3T1FA 4G8FA 4JM2A 1B90A 3KJ4B 3D39B 2EEBA 1AGBB 2G5BA 5DF0A 2DWEB 1BQUA 2A6DB 4PREB 4G8IB 3AUVA 5IK3A 1JNNL 3WNKA 2GJZB 2FH8A 4PLJC 1LNUA 5GS1C 4PJ9A 3SE9L 4BZ2H 1JNLL 1RHHB 2EO1A 5FK9B 4NWUH 5FKPA 4PJBA 1DEEA 1SY6A 1RK0A 2H26A 2X4PA 5BZWB 3S5LG 1YMMA 3VXNB 1U3HB 3O0RL 4I9WE 4UAOC 3ZTJH 3K80A 3GSVB 3S96B 4K23L 3IDYB 4J7RA 2G75B 2G5RA 1X4ZA 4HV8A 1TZGH 2FJGB 1AGDB 1HDMB 5D71H 4CDGC 3U46A 1T89C 2VDML 2X42A 1JGUL 1TQCB 1GCFA 4QXWA 1S7RB 1OWRM 1V3MA 1T2JA 2CIKA 2X1OA 3DMMA 5BZDA 1TJIH 1B0RB 4ORZC 2ARJA 5DHYA 3IJYA 2VDKH 3ARDC 5KSUA 5C08E 1AJ7H 1GXEA 1I9RL 3FFCA 3I6LE 2YMXH 4KTDL 3KLHC 1GGTA 4PJBF 4WHCA 5C0BD 3TZVC 3GSNL 5EIIB 1GAFH 5IG7B 4PJGA 4M43L 4ZAKA 4J3WA 4S1RL 5IFHL 3EYSH 2A73B 3GSUA 1WZ1L 3QHZL 3EO1A 4L4VD 5C09A 2BRRH 4JKKA 2G60L 3OJDA 3QCUH 3UAJD 5C0CA 3FRPG 3U36B 3CSBA 5BMFL 4IOSD 4HX1A 5EU6E 1I9RH 3ARGB 4P4RA 1AO7E 2AI0H 3BEWA 1G7PA 1AQKH 1GH7A 5DHYB 1GHFH 4HKJB 4ZUTA 3KPSE 1MRFH 3ZDZF 4P2QD 2AS5M 2BSSA 1BJ8A 2R39A 3PUCA 4I3RL 3RHWF 2EKSB 5H35A 4JZOA 2BJMH 1R5VB 4NWTL 3UDWA 3QPXH 1FV1A 4LCUB 4HJJH 5E5RB 5J1SC 4MXQC 2IC2A 4KJYA 3QWOB 3Q5TA 4R96B 4WUUD 5DLML 5MHSE 4QYOA 5E6IB 3LRSA 2IFFH 3B3IA 1LK2A 4YC2B 3U48A 1BD2B 1LK3L 1S7RA 1MRCL 1TCMA 3WEXB 1G1CA 2Y9RT 4XCEA 3DRTB 2X1QA 3IU4L 1UH4A 3VGDA 4KI5D 2HN7B 2I9LB 3VH8G 3H0TB 4M7LH 1S9WA 4TSAL 3HPJB 3VW3H 3SDAA 2EIEA 5JO5B 4U6XA 3TJEH 5IVZB 3ROLA 3UBXA 3HUJB 3MBEB 2X09A 4NQXA 4FQIH 3WHXA 4P2RB 4LPTA 4C57C 5C9JB 1OSZB 5SWQB 3NPSB 4G43A 4AK1A 5ENWA 3K3QA 2N7AA 3GZKA 4JZJA 3W0WB 4DUVA 2XN9B 1XF3B 1ZHKB 2AJZA 4LKXB 1KFAL 4O5LH 1JHKL 3MLZL 4HT1L 3Q1SH 3QXVA 4KPHH 4PRPE 2WBJB 1EAPB 1J0IA 1LEKA 2IMMA 1BLNA 3PJSB 2J8HA 5CP3A 5DJYB 3WD5H 2IGFH 4FP8H 4ENEC 1BF2A 5TGBB 2X89A 5TDOB 3RGVB 1KCRL 5IW3A 1F11B 4Y5XA 1F58H 3FZUD 4X80L 2R0ZL 1KACB 2YUWA 5HDQL 1L6ZA 1YEDB 4LSTH 5TE7L 2VIRB 2NY3B 3MYZA 1DP0A 1T5XB 2WINB 5DRZB 2Q7NA 1FORL 4F7CB 1R3HA 5EC2A 4R4FL 5GSRA 5IIEB 4AEIL 3I84A 2ICWB 2ICWI 3GSNB 2XZQH 1M4KA 3GMNA 3O3AB 4KTEH 1U3ZA 2V9QA 1RK0B 1S9VA 2X4PB 3MROA 4P2QA 3RDTD 4Y19D 3Q6FB 1Y18A 5D1ZB 4ELKA 5AUMA 1KCKA 1HHJA 3X13B 1IC4L 2BX5A 4NQVA 3WDHA 3CDCA 2DQUL 4L3CA 4YR6B 5A2JH 3D39A 2V7HA 5IFAL 3B4NA 5IVXA 5GGUB 4HBCL 5DT1H 1NFDB 5FYLD 1HKLL 1HEZA 4X6BB 3FRUB 4QRPA 1HEZB 3MGOA 4WGWB 4L8CB 1M05B 2RFXB 3BKCH 4KDWA 1EJOH 1P6FA 3RWCB 1T3FA 2K1MA 3X3FL 3VFSB 1NCBL 1YYMH 2C3GA 1CICB 1FDLH 4DN4H 1I3GL 4K8RD 4PJHA 2G2RB 2ZPKL 3LKQA 3NFSL 1U3JA 2DQFB 1WBXA 4CNIB 1AGCB 2VXSH 4LEOB 3WXWL 3LMJH 3CFCH 3OR7B 2Z31D 1LEIB 4UINH 5CEZH 1R3LA 2DM7A 3EYOA 3MA7A 5ANME 2Y06L 4R90H 3QFDB 5CLTA 3RTQC 3RZCA 1W8OA 2FJHA 4NHCH 1QBLL 4EKXA 4UDUA 2VLRD 4LCWD 1UCBL 4TRPH 3RWFA 5BQ7A 4IS6A 1BZ9B 1MOEA 1QSED 1MWAA 4YJZL 2ZOKB 3VXSE 5JIPA 3N1PC 1Q72H 4B5EA 1G7HB 1P6AB 1NKRA 2P49B 4OM1L 5F88B 3RJDA 1WV7T 1DQQB 4Y4FA 1J5OL 4NQCD 3QBTB 4Y5XC 1QKZH 5FHBH 3SN6N 2APWA 1JHTA 5FA4B 1D5XA 4MJ2A 5I1LB 3CFKB 4YFDB 1OP3H 1FP5A 1NBZA 1I4FB 3LKRA 3AMKA 5D7JB 3L3KA 4HGMA 1ULVA 1YN7A 5KVGH 3V79C 4MAYD 3FB5B 5EA0H 4KK8D 1RIHH 1B2WH 1H5BC 1B3JA 4F80A 2GY5A 2E9WA 3OL2A 4JDZB 5J11B 3GMQA 1Q94B 5E8NA 1F6AB 4OZIB 4WV1C 1HQRB 5JW4M 3LSOA 5DJ8B 1U3YA 3SKJH 3FB8A 3QAZB 5E8NB 5C0JA 3UPCA 2NY0D 3ZKQD 2VLRB 5FO9A 4HMCA 4MZ2A 1QFUH 5TE4L 1YN7B 1ADQH 4PRDB 4XGZA 4NBXB 4ELMF 4QHUA 5LAXB 4QRPE 1FHGA 1CFTA 5BV7C 1P7KA 3O6FA 1TFHA 1CLCA 1EEQA 2XZZA 4MD4B 2V17L 4JO4L 1HE7A 5FYKU 3MRDB 4KK5D 2DJUA 5ISZA 1WF5A 1W72H 3FQTB 2NY4B 3PDOA 4K2UL 1S7UA 5I1GH 3IXTA 1BZ9A 4XT1C 3KYNB 3D85B 5DD6B 3QEHA 4U0QB 3HR5B 4OCSL 1AGCA 4U6TA 3FN0H 1M71A 4IRZL 3CLFH 5B8CA 4M7JH 4PJHB 5JOFA 1I1CA 1I9IH 3D69B 3GDBA 3IKKA 4CRPA 3VFWA 3L95B 5HDOA 3GRWH 3X3FH 4Y1AA 3BP5A 3T4YB 3CXDL 2X89D 5GRVL 2NY4C 1T1WA 8FABA 1OPGL 2R2EA 3IFOA 1MRFL 5IBTH 2JK5B 5FYKE 4OQTA 1BVLA 1B6UA 1FSKB 1HINL 4K3JH 2ZG1A 3GSUB 2F8OA 4ZO7A 4TNVK 2AV7B 3O6LH 3UX9B 3GKWL 5L9DH 3O8XB 3C60A 1Z9OA 3K8KA 1VB9A 5A2IH 4IRJB 2F58L 3OAYK 1DQLH 1UQSA 4HBQA 2EDXA 3D18A 5EA0L 4UV4H 4OD2A 3HMXA 1A2YA 5LG1A 2HKHL 2D03L 2AK4D 4C55A 2XTJE 1L7IL 3MUJA 1KUMA 2WW8A 3QHTC 3AFLA 1BWMA 2H1PH 1T0PB 4OIIL 5C07A 1N59A 4DCQA 4E9LA 1J5OH 4UDTB 5JUEL 2N4IA 5CLWA 3WO3B 2Q76A 2YPLD 3GIZH 4XMKL 1IQWH 2FX7H 4TPRL 3V6BR 4R0LC 1EDQA 5I8OH 3GHEL 3AS1A 4TVPD 1CDHA 3NN8B 1MFEL 2BXZA 2FECL 4LSTL 4AZ8A 3EYQC 5FUZL 2XWJB 2XQYK 2M8XA 4YWGH 5AZEH 2R0ZH 1VACB 1MVUA 4BELD 1HHGB 2CRIA 3WMSA 1HQ4A 2BY2A 5AEAA 3EOAB 3LB6C 4OF8A 1LEKB 3DV6B 1K8IA 2XI9A 5BVPL 3FO0L 1MQ8A 2CO7B 3IDYC 1A6WL 1HN1A 1K4DB 3QQ4B 1YJDH 1AFVL 4PJBE 5KVFH 4EOWL 3G6JE 2P48B 1N26A 4ZPTB 3V0WL 3G5YB 5T1MB 4M5YH 1X5XA 5B4MD 4I1NB 1CD8A 1YUHB 4BQBA 2DLGA 3EFFB 3VFPB 5GS0L 1OL0A 1FCGA 4NKIL 4YGVA 1CE1H 2DQGH 32C2B 3MRMB 4HJGB 5T1KB 1VKXB 2VO5A 5HGBA 4G8GB 1NL0L 2BNUB 5C0CD 1HI6B 3ULUE 3WHE0 4RDQG 3MO1A 1FZMB 5IT2H 4Y19B 5DUBA 5DK3A 4TSAH 5AWNL 3CCHA 4IEFB 4PGDA 4WTZG 4KWUA 2FB4H 3MYJB 4NO5B 5DFTA 1J8HA 3GBNL 4MD5B 1U58B 1U8NB 4NRZB 3EYUH 5CMAB 3TYFB 4NZJA 1ZHLB 5EZLA 4EI5C 2VH5L 1CS6A 4LHUG 3F6IA 4RRPG 3MFFA 4UT6L 3BDXA 3EOBA 3HZMB 1XF1A 3LQMA 1OTSC 2DYPA 2I60L 4DGIL 1Q0XH 3VFUB 3ZT6A 4Z7VA 3CPLA 3RVXD 2LVCA 2QV2A 3QWOA 3S97C 2GCYB 2N56A 2IADB 3VRIA 1HIMH 1MFBL 1JPST 1YPZB 5FM4A 1BD2A 4J3OC 2GUOA 4AT6A 4OGXH 4QXTA 3FJTA 1PZUB 3AU1A 3SJVD 4CU6A 2W9EL 3QNZB 1IM3B 5C8JA 1NEUA 4P59H 1NGZA 3TBVB 1ZLSH 4JFYA 1JTPA 4KJPD 1CVSC 5HGAB 3BOVA 1XZ0A 5CGTA 5E6IC 3FB7B 4RA3A 1TTGA 5FYKD 4QRRD 3ROOB 3HPJA 4N0UE 1ACZA 4FFWC 1ORSB 1NCTA 2BC4A 4LGRB 5JIIA 4KTDH 2GJ6D 3DO7A 4QXUL 5A43C 1KB5A 5I74C 1U8KA 1CFQA 1M7DB 1B0RA 1X7QB 1FE8L 2C1OB 5ESAB 4KGLA 4PP2B 4ERSL 2FRGP 3WFZA 2CKNA 3EO9L 4WJ5B 4P9MH 4KAQH 3WLBA 4C83B 2HFGH 4MVBD 5DJAA 3K1DA 2AEIT 4JFFB 2CLZB 4OZHE 2GFBA 4Z0BL 1JWUB 4M61B 1EO8L 2A77H 3WO4B 3P9WB 3DIFA 1F3JB 5IM7A 1Y0LA 2YK1H 5DGQA 4C56B 1A4JB 4F8TA 3TVMD 4Z7NE 1M7DA 4FZ8H 1G7PB 2Y6SD 4XI5D 3UEZA 2AV1B 5CGYC 2BOCA 3AREB 5ADOL 5CAYB 4P3DB 5F3BA 1UWXH 2H45A 2R0WH 5T1KD 3Q6GL 3G9AB 35C8H 4B53A 3DX7A 3P11L 3BVNA 4WFFD 4U1LA 2CIIB 2LAGB 2VR5A 1S7XB 2A0LC 1Z0MA 2ERJC 4ODXB 3RL1A 3SE8L 2HLAA 5GGVL 3AS2A 1XZ0B 3L3HA 4L29A 3BZ4A 4WHTA 2AJXL 3C5ZD 1CLYL 1SJHB 3L7EB 4W68A 3O4OC 3KLHD 1TNNA 2DLIA 5HVFB 2NY1C 3N1FC 3BGAA 2X4RB 5DI8B 3X17A 5JNYB 3MJ9L 4L3EE 1LO3L 2EH8L 3CLEL 3RQ3A 5I71C 3T04D 4NBZB 2HAZA 2NZ9D 5EOCH 1P4IL 3TVMA 3LEYH 2XA8H 5I15L 1FVEA 1A7NH 3FOLA 5F7EL 2FJGA 1FPTH 2QR0A 5KVDH 3WIIL 1JUFB 4G6AD 2Z0BA 5L2KD 3WFCL 4TQEL 1J10A 4M8QB 1JPGB 5DJCA 1A1OA 1LDPH 4TPRH 2AXFA 1FPTL 3EOTL 2X05A 2MKWA 1G0YR 2JJSA 1KG0A 2P8PB 5E8PB 4OQ1A 5HHMB 1TNMA 1IKFH 4U1IA 3JV4A 5F7WC 4DKDC 2WP3T 3G6JB 4N0FA 3U1SH 4AEHH 1FZMA 4BZ1L 2IALB 2YPVL 4P23D 4I5BA 4CADA 5GSVB 3ZDXF 4M6MH 1FZJB 4X9FA 1M7IB 5J1AA 4ZO9A 5IP4A 1F4YL 4WW1B 3JWDC 2UZYB 5ETUB 3T0EE 2OQJB 2F15A 5HD8C 1HHIB 2DKMA 1MH5A 4RAHA 1S5IH 3VWJA 1IAOA 4ZUVA 2VE6A 4G6JH 3HNTL 4MS8D 3TIDA 2OR9H 4IRSC 4GQ9H 5SV4A 3TPKA 2FSEB 3MNWA 4JRXE 5IHZB 3QEQA 1ZEAH 5I18L 5IGXL 4J4PA 4PJFA 3OXRB 3CVHH 3K1KC 5I0ZA 3EZJB 3GMRB 2IAND 1JCKA 1VGKA 3QI9A 5CD5C 1PG7W 1ZGLP 5JPMB 3L3JB 4OFVA 1JGEA 3SJVA 2ESVA 3QHFL 3ABZA 4WWID 2F53D 5IFJB 2WANA 5I1AB 3DX7B 3VJ6A 3RX8A 2P7TA 5A16B 1AY1H 3THML 5ALCH 5E70A 5TQ2L 2CGRL 3T1WA 1FFNB 2HH0H 3NABL 1F00I 1W72L 4HWZA 4GUPA 1ZWIB 1XGQA 4IDJH 4ONGL 5J3HC 4HIIA 3OAUH 1DUZA 5DRXB 4HK3N 1INDH 4N0CD 1X5FA 4PGZA 4XP6H 4R4ND 3MRNA 4NKOB 2ZCLL 4G8GD 3PNWA 5HYJD 1INQB 2D7TH 5HHOD 3KYAA 3MLSL 3QNYA 1FNFA 2FX9H 6FABL 1OGAE 2YWYA 3VH8A 5JXEC 4K8RL 4DAGL 3MLVH 3WFBH 5F1SA 4M1CD 3DBXB 2ZUYA 4MD4A 4FZEH 3EOYG 2FWOB 5DJ2B 2VDPH 2PO6D 3DGGB 4WY7L 1MHHB 1O5DT 1N6QL 4NCC1 3JUYA 1HH6A 2XZCH 5CBAB 3X11B 3HG1A 3H9SA 4M1GL 4WI2A 2F53A 4P5TD 5E8EA 5JIHA 2FJFA 4I4WB 1MWAL 3O11B 1R3IH 5GRVK 2A6KA 1JPTL 1OHQA 4WTWA 2AV7A 4NM4L 3QI9D 2IANA 1TVDA 3T2OA 4NNXB 1CDJA 4W6WB 4GKSA 2VOTA 2HFFB 1VFOA 3AC0A 4DEPC 1MJUH 2DAVA 4LLDB 4X8JA 2PF6A 8FABB 3H9YA 4XHJC 1QFOA 3QG7L 4G9FB 1KTDB 4IRJC 1A6VH 3UJJH 2DD8L 3O3UN 3HMXL 3PWPD 1NDMA 4DVRL 1R0AL 1BIIB 3RTQA 3UTQA 1EEYA 1RUQL 4HMDA 1S5IL 5MEND 2KKQA 4ONFH 3BUTA 1G7QB 3O6ML 4OV6F 3U4EB 4CDHA 1CTOA 4Y7MA 4PRNA 5MP6H 3V8CA 1BIHA 5CGMA 4U1NB 3EDDA 5MEQB 3EDJA 3BT2H 2YSSB 3QIWC 1KIQB 5GRYA 2CDFA 4DUXA 4C54A 3OF6A 3QFJB 3HZKB 1QR1A 1QFUL 1V7ML 5MEPA 4RMUA 2V2WA 1KJVA 4DN3H 5DMGC 3X11A 1JN6A 1A3LL 2D0FA 3RIAK 1ORQA 1H5BA 4JFEA 1JPFB 3H3PH 1SYVB 5L7XL 3IFLH 3P30L 3TO2B 5FYLH 1CGSH 5FO7B 3VCLA 1K2DB 4GW1A 3I6LD 1A7PL 3LHPH 1KLFA 1K4CA 5C6TH 5DVNA 4J2XA 1NCAH 3CDGA 3QQ4A 5DA4A 2VLLA 3P73B 3UTPE 4LHUD 4D0BA 1PDKA 3V6ZA 3DGGA 2ZOLA 4OGZA 3B2UD 1EGJA 1IAIL 4PJCF 4K7PX 3ARSA 3LIZH 1PX4A 4L8SB 1I1RA 3ZLQC 3LZFL 1UM6H 3RRQA 4OZFH 1MIML 3SE8H 4GG6B 2ZCKH 5C2BL 3G6JA 5D1ZD 5FV1L 1IC5H 1N64L 1KCRH 1ZAGA 2K3TA 1AHWB 2Q1EA 2PXYB 3PV6B 5IFJA 4ZOBA 3C5JB 4M1CC 3SGDI 5HD8D 5D9SB 3L1OH 5CEZD 1MCPL 4YK4C 4DCQB 4JM2F 4O4YL 1X5AA 2NXZB 4UINL 2A6JA 4UNVA 5CEZL 4B41A 4QTIH 1A64A 3VXPA 3MLZH 3U9UA 2NX5B 2P7TB 5A16A 4HZLB 1U8QA 3O6LL 3TIDB 4XP5H 1T0NB 5D7LD 2P8LA 5BOPA 4JQXA 2IG2H 5DK2B 1JTTA 1GOHA 4Y8AA 4ODVH 5F6HJ 4GW4A 3CUPA 3RWIB 4B7IA 3OHXA 4XC3H 2V5MA 5JW4R 3FOMB 2OTPA 4G7VL 3U79A 4QHKJ 5I6XC 4GAJH 3T2NL 1G7IA 5DD0L 1S3KH 5CKGA 3GMPA 5I66B 5DDHB 3P0YH 1QRNE 4EIZC 1N5AB 5MP6L 5FGSA 5MENA 4JVUA 5T1DL 5CBEB 3QUYA 3RWHA 5JIKA 5CEYB 3NAAH 3O4LB 1MCWM 1IEAB 4RX4D 4XAWH 4LCWB 2IPKB 3ZSSA 2KUTA 4O00A 3SDDA 2D2OA 1T1YA 3JTSB 2L7UA 4OUUA 5FKAA 1HH9A 3SDCB 4OCRL 3NTCH 5LAXA 5J13B 4NKMA 2FR4A 5KANI 1DBAL 2WQ8A 5I19H 3LV3B 1F97A 1MHPH 2ADJB 2X7LA 2XTLA 5HJ3B 2EIZB 4X9IA 1Q0YH 3W9DA 4S2SB 4H88L 2QEJA 4JE4B 5C0GA 1GGCH 3WNOA 5INDB 3INUH 4XWOC 5KJRH 5IB5B 2B5IB 4KRPD 4QRPD 2PTTB 5E08L 3GK8L 4ETQB 4OZGE 1NC2A 4L4JA 2Y5EA 2A1WH 4QRQA 4Y89A 4YHKH 2OTUB 4RA0C 4AMKL 4ZS7L 4ZUTB 4ONHA 2NPLX 4PRPA 4NQUA 3UTTB 2F19L 4FFZH 2DJ4A 3GNML 3QXAA 3QCVL 1QEWB 1KXVC 1MI5B 4JRYB 5ACZB 4FQIL 3EJZC 2FX8H 5D7JA 1G7JB 5HPMA 1U8IB 2FEDC 2WBJC 4WUKL 1OSPH 1MJUL 4Q2ZB 5H2BB 2FYYA 1S7XA 2JKXA 4MA1C 2D7MA 1F2QA 4HWEL 5TQ0L 1C8PA 1DSFL 1TITA 1VFBB 3BDBA 4P4KC 1F02I 3I02A 1R3KA 3I6KA 1JPSL 5FDWA 4ETQA 4NC1C 4Z78A 2CR3A 3T65B 4EDWL 4XNYH 4JQIH 2P5WB 4L8BA 1AHWC 5FGRA 4PP1D 1SMOA 4KMTH 5D2LA 4ZXBC 5DA0B 4OFYD 3FKUS 3UTZA 2XACC 4YFLI 5BOZG 3BPNC 5A2LH 3FQXB 3D85D 4O2FA 2IQAA 5CJOH 2K7PA 3WFDL 4Y5VB 3S98A 1Y6NR 2OL3L 1RJCA 3O3DA 3SGEI 2ED9A 2LVEA 2PYEA 4FMKA 3SDYH 1M7XA 2QKIA 1X6NA 1DZBA 3BQUD 43C9A 1OGTB 3MPCA 4ZQKA 4MA1B 4HZAA 4HH9A 3NPSC 5HI5D 2IPKA 5C07D 1IL1B 4F3FB 4ZAKB 5GGTA 1T3FB 1FLTX 1G1YA 5SX5H 1XCQB 2QADC 5L8JB 1U8HA 1EO7A 4QHLB 5F72S 4RGNB 1HSBA 3KXFA 4PJFF 1VEOA 3KPRD 4YDIL 3GMRA 1CDBA 4U05A 3MYJA 4NO5A 1FJ1A 1NAKL 1OOAA 4G6ML 1KLGB 3DECA 2JB6B 4KU1A 4Z7QE 4M43H 5IFHH 4P2OD 4JHAL 3NVQA 2DQDH 1HXMA 3VG0H 3N9GH 2Y72A 5KBNC 1JGVL 3VI4E 4FG6C 3LOWA 4OBRA 4XCNA 3H9ZA 4X7EC 4NQVB 4PJCE 1GZPA 3CDFA 4HG4K 3T0AA 4KVNH 3WNLA 2Z8WC 3FO1A 3CFBB 4TTDC 4JN2A 4ZSOB 2EIDA 4CMMA 4Y1AD 4UMGA 1MREH 1S9VB 3MTRA 4P2QB 2P44B 3QO0A 3GO1L 3JV5A 1TPXB 3V4PL 1U3HA 3PIQA 2OJEA 3T0DA 4H1LB 3QDGA 1NDGB 3UBXI 4NPYB 1RU9H 2VDLH 3BSZL 5IQ7H 4DGIH 2DDQL 3LKSB 3IB4A 2EH8H 4QOKB 1B0GA 3O6FD 1NH6A 3V6OC 3NCMA 5DJXB 4KK5C 5DMKB 4YAQB 4H26B 1FH5L 4RMVA 3V5HB 3AGVA 4M9PA 4GW4B 4TUKH 1FG2A 1MFDH 2YD9A 3TM6A 4I2XE 2JB6A 4NC2B 3TFKD 3BIAX 4JFQB 3TJHD 2ORBH 4U1JA 4J1UA 4XC3L 1CQYA 5FGBC 5TF0A 5SWSE 4Y19E 1QNZL 2D9QB 1CFVL 1HXYA 1J1PH 4ZPTA 1JWSB 3PGDA 4PJCA 1A1MB 3REWB 5J7CC 2APBA 4M5ZH 5BXFA 4DK6A 4L3EA 4FQHA 4RAUB 2NX5A 4H8WC 3WL9B 4PJAB 3W9EA 2EH7H 1DUYA 3MRGB 2VLJD 3MC0A 3VGHA 5L88L 1OAYH 1AR1D 4R9HA 3PF2A 5TJWK 1C12A 4DOHB 5C0DB 3RY6C 4A2LA 1XGPA 5IF0B 4XNUH 4U3CA 3DSNA 1K9TA 4YZFF 1MJ7L 3V8OA 5ICZA 3KXFE 3TA3B 1YEJH 1EFQA 1WWCA 5IR1B 5EU3B 1UB5B 2LU4A 2YPKB 4OD1H 2VXQH 2ICEB 5EBWB 4LCCC 1NLBH 1OT1A 1QRKA 4M1DH 4QRUA 4Y4HB 2HWZH 4S1SH 5E5MA 2VN4A 3R06B 3RFZC 2BVQB 3SKNB 1A0QL 3LAFA 1TPXC 3I02B 4QRRA 2HJKA 1NAML 4H1LH 1UVQB 4XB7A 5F89A 3RVWD 3HCVA 5GGQH 4RAVA 4PJ9D 1IAKB 4WW2A 1CFTB 1IAII 4YPGB 3QRFM 3PWJA 4W81A 3X3GL 3IJHB 4GLRH 3DARA 4X4YB 3B8SA 4F7PA 4UV7H 1QBLH 5C6PB 1NCNA 2NNAA 5FO7A 1RURL 2N1KA 4JANA 2YRLA 3QYCA 4RBPH 4IM8A 3TBTA 1MPAL 5C0NC 1FC1A 4HPOH 1FDLL 4AY0A 4MDIB 4X4ZA 1CDUA 3MLRL 5CSGA 5I19L 1OSPL 4MD0A 5E6YA 1P84K 1T1WB 1RUAH 3C87A 3RWEA 1FG9C 5H37H 3D39D 5IV2B 4PJEB 5E9DB 3K8LA 2Y4SA 2JCCE 5T1LD 5CBAA 5HHOB 2W60B 3Q2CA 4WUUB 4LCWE 2J5LC 3HR5A 3EUUA 3OAZH 4OB5L 1FZOA 1QSEE 3KPOA 3O6MH 1RZGB 4JPVL 4U0RC 5IOPB 3B2VH 4PJHE 1ZSDB 2GT9A 4WNQB 3H7BA 5DD1H 1UENA 1WLHA 2G9HB 3CDYA 2A83A 1NMCB 1Z2KA 2ZSWA 4MMXC 2D4DA 1XF2B 2R4SH 1A9EA 4MA7L 4HULB 3I75B 3L3DA 2H8PB 3UJJL 5DRWA 5FCSH 3GMQB 1RZFH 3QG7H 3HLAA 3RGHA 2H26B 5BZWA 4NOFA 4XNXL 1X5GA 1R6VA 3EJJX 1WBYA 2V2XA 2PYFB 3QWQB 4JM2C 4QRSB 5EBMB 3D9AH 4N0YH 1U8LA 3AROA 4M5YL 5BCAA 5KS9F 2MKLC 4LCCA 1PG7X 2H2SD 3LS5L 4NCC2 1AFVH 3EDKA 4KKBD 4LLQB 1K5NB 3V7AG 2EYSB 2LAAA 3RVWC 1QLRA 4C59B 5C0RL 1KBGL 1OQXA 1AXTH 4J3XA 2NQCA 1K4DA 3RA7H 3RGVD 5LQBL 3MLPA 4APQD 2Z31B 1IAKA 4WW2B 4WRLA 2EDQA 1UB6B 4HWBL 1FO0B 2NTFA 4RNRB 3EOAA 2QSVA 3MOBH 5GS3A 5JLZA 1ROWA 3MLVL 1CU4L 5JHLH 4JR9L 3TNMB 3H9HB 2ITCB 4HHAB 4BFBD 1CFSA 1KYOJ 1WFOA 2H6PA 1VHPA 1HHJB 3BWAB 3G04A 3T3ME 4JB9H 2AQ3A 3F7YA 5EG6C 2VRAA 4APQA 5KN5A 4MZ3A 6FABH 4K71C 3DROB 1JF6A 1WBXB 2V7NA 3BWAA 3NFNA 4TUOB 4OKDA 1MCIA 1SBBA 1CLOH 3BWUC 3K2UL 4RZCA 2PXYC 4GKZB 3CX5K 3QFDA 1T66C 3IRPX 5C07E 1R3HB 1H15B 3MLYL 2DMBA 3BO8B 1YA5A 3O41A 1CLOL 3S7GA 3RVUD 3ME0A 1KCSL 2ZPKH 3TCLB 4OD2B 3GRWA 1QFHA 4PJIA 1YQVL 4X4XB 1K6QH 5DC9B 2E27H 3L3IB 1V8HA 1S5HA 1RULL 3K74B 4M6NH 5HSFA 4KQ3L 1X5ZA 1W0VA 5GGTL 2E8ZA 1C1EL 2HJLB 1E4KC 4CBPA 2HG5A 2CK2A 5ICYB 2LABA 5IUSA 4WI6A 2Z91B 2VN7A 1J9CT 1HHIA 4GMSH 4CU8A 3H42L 3BMVA 4NO0B 1SJHA 3KXFB 4MSWA 3SEPA 5C0EB 4NOBA 3WLWD 3G6DL 1FH5H 5F6IB 1KJMA 1ZA3A 4P3CH 2EH7L 2YPVH 3K81A 4MJ4A 5DJ6B 1NFDF 3U1SL 2NXZD 2WWMD 3L6FA 2RQ8A 3H9HA 4BK4A 4KMTL 4NPYA 2LFGA 5DVMA 2NXZC 2WWMC 2YHGA 3HFMH 2XZQL 5JA9A 1G9MH 2WBKA 1F6FB 5EC2B 3H7LA 3UZVB 5FXCH 1AQDB 1DVFC 4UU9B 3PHQB 2DQIL 4S1DD 1FC2D 3SDCC 4DKAA 1DANT 3OGCA 3CFJB 3OZ9H 5INCB 5F7FA 4XVUD 3HZVB 5L2KE 2QR0B 3KJ4C 1NBQA 3QNXA 4QXUH 5E9DA 2GSGA 4WCYL 4JG1L 1QFPA 3U30C 5B39B 5J06A 2DQIH 4GFTB 3MUGB 5E5UB 3L7EA 3G5ZB 3NAAL 4NQSA 4PJ8D 3VA6A 3UZQA 5E2VL 4LLYA 4JRXD 4AMKH 2I5YH 4P57A 5K9QI 5SWSB 3BZFB 3GSQB 4YNYB 3RWDA 4MDJA 1N5YH 3FQNB 1OY3B 4Z5RA 1TCRA 3N9GL 1KNOA 3BVNB 1L0YA 4TSCH 2NY6B 4CN1A 4UQ2B 1SM3H 3NOIA 2X4OA 3IDXH 4GAGL 5E2TL 1QBBA 3MLRH 2ZSWB 1JNLH 2FX9L 3HCVB 5F9JB 5FO8B 3MNVB 3V5KA 1C1EH 3DUSB 3QUMB 5LGKA 2B4CC 2ARJQ 3NH7L 1P2CA 4XPHL 4IHOA 1EMTL 3B8YA 5DQJB 4AL8H 1ODAA 3TN0D 1BMGA 2NX5D 4KV5F 2EKSA 5KSBE 1ZGLB 3ARBC 1HSAA 1H3XA 3TZVD 4IRSA 3FQRA 3CFEA 2KL6A 2ATKA 3A67H 4Q9QH 3PHOB 3TT3H 5EFIA 5EH1A 2D31A 3BH9B 3HS0B 5ITBH 3DVFA 1MIMH 4QOKA 3G6JF 2BSTB 1LD9B 2BZDA 5HY9B 1IM9B 4N5EC 5FDWB 3E6FB 4S1QH 3L6FB 2BSSB 4JQIL 4YBHA 4G7VH 3O4LA 3IJSA 1ADQA 4JANB 3MRBA 1U8KB 5DJCB 3PWUA 2A0LD 2MHAB 1I7ZA 1BREA 1DANU 4XMKH 1MQKH 1OP5K 2Y07L 3IS0X 2KDGA 3ZYJA 5EPMB 5HYQA 5FK9A 5FKPB 3SCMD 4QTIL 4PTTA 3U0TB 32C2A 1BOYA 4HAGA 4OZHA 4PV8A 1IMHC 3MRCA 5DWUH 3RX5A 5HHME 4J6RH 5T3XE 4PB9L 2ZJSH 3GEWB 2XWTB 1YNKL 4JFXB 3MGAA 4H0GA 3NA9H 5DD3H 4ZTPH 3VFRB 2NXYD 5D7LE 4WEBH 1F3DH 1QSZA 4JKWA 3ELAT 3FO9B 1ZTXH 1QA9A 2E7CA 2R2BB 3OPZL 3VXQB 4BH8A 3OG4B 4DN3L 1YC7A 1E4XH 5D7IB 1CBVL 1EBPA 5CP3H 1YEDA 4Z7VB 1JWMB 2BNQB 3CFDB 4M7JL 4OLYL 4PJBB 5KVEH 4FTVD 3IRZA 1RMFH 4U1SA 5DHXB 3ULSA 1JI2A 5IJKA 3MRMA 1U2CA 2B8OT 5E99H 2VH5H 4JFFE 2E7BA 1AXIB 1ZE3C 4Y2DC 5CD3A 1Q9OB 1X4YA 1SY6H 3TV3H 5J56B 4X7TB 5IVOA 4K9EL 1V7NH 2X44D 1SJVA 1KPRA 1CDCA 2GITB 1U93A 2Z4QA 5DD5H 3HUJA 2CRYA 2DS4A 4KQ3H 4Z6AT 3KLAB 3TP4A 1JPTH 3RVTC 4GRMB 4CAGA 2PTVA 4XPFH 4ODVL 1H5BB 4ODHL 4TNVF 4KKLD 5DHVB 1MVUB 2Q6WA 5EBMA 2ARWA 4A6YH 3B9DA 1QFWI 5AG9A 4WHYG 3TO4B 2DF3A 2VZ1A 1FNEA 2XICA 4GG8A 4FQXA 2DI8A 3O3DB 1ED3B 3O4LE 1L7TH 4FQJH 2N7BA 3T4YA 4ODWB 3FO9A 4Y5VA 2VNCA 5IB4A 3QFJA 2DMCA 4YGAB 3D69A 1LK2B 3W2DH 2C3VB 3C6LC 3HMXH 3WJJA 1NJ9A 1BM3H 3QDHA 2W1NA 4J3SA 3ZDYE 3NN8A 2A83B 4DKFH 1WAAF 2P5WA 5IROA 2EIZA 2C4XA 4CVUA 4PV8B 4EZMA 1AQKL 4UTAL 4PD4J 1FZOB 3MRKB 1FVDA 2VXTH 3MREB 5JUEH 5E8DL 2Q3AA 1UJ3B 2CGRH 4PLKD 1NC2D 5D2NA 1OAYL 1T1YB 3KWWA 4GW5B 4TNWK 2HMID 1BJ1H 1KLGA 1UXWB 5IESL 1AY1L 3GJFK 3E3QE 4IDJL 1NEZA 3MRQB 4O02H 4KC3B 3GSNH 2QQLL 4U1MA 5IW1A 2JJWA 3IFOB 3GIVB 43CAB 5CIPA 3SQOH 4NO3A 4Z0XB 2OR8A 5EIIA 4LLVB 1EERB 4HIJA 3IKCA 4BSVB 5JHDA 3S37X 5L7XH 4K94C 3J8F7 2DIJA 3LKPA 3S37L 1YY9D 3IDNA 4HS3B 4EDXB 5I71B 3RL2B 2QTEA 3BRDA 3L3OB 1EJOL 1ZLUK 4P0DA 5D1QB 5DR5H 2BNQD 3HPLA 3SDDD 1ZKAA 1VADB 1BBDL 1CIUA 1HYSC 2CIKB 3DNKA 1TDQA 3CLFL 4KI5E 1KJ2L 2DWDB 3EW3B 4NN5B 3ULUD 1ZGLA 2WNGA 5GGRB 1JHTB 3PHQA 3ZTJG 1IGTB 1L7TL 4TTGA 4QY8A 2NY5H 4LSUH 1F90L 4MQSB 3PP3K 5KJRL 3BGFC 4OGAD 3MLTB 5F9OL 1X6LA 1PQZA 1UYWL 1A7RL 4GS7C 5KS9B 1GC1C 2NY3C 2ZG3A 1NUNB 4NM8L 1HHGA 3B6SA 5GRUH 2X4NA 2D7PA 5DK0B 2W0KA 3RJQB 5D71L 1J88A 1CIDA 1JNHB 2BRQA 3BZFA 3GSQA 3HNTH 1CCZA 5TE7H 3FRPA 1OF2B 1IGFL 3DXAD 2ICCA 3TO4D 4XP5L 3VRJB 5EUKB 5TPWH 3G5YA 5F44A 4L3ED 3VFNB 2F53B 3FB5A 1GZQA 4HCRA 3OXRA 3CNKA 3MODL 4GMSL 4GW5A 1A6ZB 1MCPH 3KWWB 5ELIA 1CXLA 3CZFB 4TNWF 1ETZA 5GPRA 4URTB 5FKAB 4GG6E 3QIWA 4PY7B 3VXRB 4L3CB 4YR6A 3C09C 2RB8A 4KDVA 1DR9A 2UZIH 5E5MB 5I73C 3M17A 2JJVA 1FZJA 1C16A 1JZ3A 1FAIL 4UB0L 2CDEB 2FIKB 4M48H 1CG9A 3KNBB 3BRFA 2NY0C 2R1XA 2X10A 1MLBA 2VABB 5EO0A 3HLAB 4YUEL 4ZUWA 4ETYA 1ERNA 4OM0H 1OB1B 5DMIH 2R0WL 3DURB 4HUUA 4ZD3H 5EUOB 5TH2B 4U3HA 2AW2A 2WBJD 1XGTA 1EA9C 4G9DB 3QDGD 1S7VB 1WCBA 2Q6WB 4DGVL 3CFCL 4EUPA 4MA8L 1WAAE 1I3GH 4PIRF 2CLVA 3GB7A 3BPOC 3OKKA 2W9DH 4R2GC 3BP4A 1QD0A 2EYSA 3AVEA 3LZFH 4GW1B 4MS8C 4EUPG 3TVMB 5DC4B 3GFUA 3BP7A 3TNNB 5C3TA 1DVFB 2GHWB 4ODSL 1IGJA 1T5WB 1XIWA 1SM3L 3VMNA 5J12C 4FQ1L 2ICWJ 2FGWH 4EBQL 3BZEB 2A6IB 2J4WH 1YY8A 4M8VA 5DEFB 3GNMH 4HKZB 4NRYA 5IBUG 3OKNA 2X9WA 4YHIB 3QQ3A 5AZ2H 4HUVB 4IMLA 2OXGA 2FX8L 4KVCL 4Y1AE 3N0PB 1EGJH 5GGSA 4PUBL 1W2KT 2R0LL 4UTBH 1CI5A 2V7NB 3NFNB 2ZP0T 3RU8L 2GJ6A 4MB5A 5I8KL 3INUL 2OS7A 1I1YA 4U1LB 5DC0A 3MBXL 2JJTA 4WEMB 3FQTA 4Y2DD 4NRXA 3HR6A 4BFGA 1U2HA 3F62A 1RZIA 5F1IA 5IB3A 4F8QA 2O5YL 4PJXF 4ONOA 1DJSA 1I75A 4YHPA 5AAMA 4XNZC 4ZMAT 2HJKB 25C8L 5H94B 1JZ8A 4JZJC 1ITCA 1DVFD 1CICD 3HI5L 4RWYH 4LLUB 4LKCA 4YHYB 4OIBA 3KPLB 3WD5L 5IWLA 3EYFA 1OAXL 3EYSL 1SYSA 1TVHA 1JPFA 4XCNB 1HK6A 4F7MA 3B9EA 1RIHL 1R5IB 3GBNH 2BNRA 4UUJB 4ODUA 2ADGA 3F7PC 5F97E 4F57H 2FBOJ 2IH3B 3HAEG 2VLKA 3UMTA 4GRWH 4BSJA 4MXQD 3SY0A 2BP3A 3LS4L 4HC1L 3DV4A 1A7OH 3HG1B 1MLCA 4FQ1H 4PJIE 1ZVHA 1CE1L 2DQGL 3PWUB 1YJDC 1U8HB 4UOJA 2KH2B 3O3BA 4M7KH 4PFEA 2B7DT 3ZE0E 3MREA 3QJHB 5KOMC 1J8HD 2BSRA 3WNMA 3S88H 1P7QA 3O3EB 4WEUD 5CJQH 1DFBH 2IPTH 5GRJL 5IOPA 3O8XC 3MV9B 5DD3L 1U93B 4YDLB 3ARTA 4JFOB 1LO4H 5EOCJ 4QY8B 3K4AA 3OAUL 3T0EC 3ARDA 4PJDE 1AE6L 4NHCL 3WEXA 4RGMB 1JK8A 4P46A 1MH5B 5DRXA 3A67L 4NUJB 5ALCL 4PJEA 3QUXB 1D5ZB 1JWUA 4N5ED 4ZS6D 4YDLC 3MOAL 3ULSB 4DN4L 5AYQA 4DTGH 3ZT5A 4NWTH 4LFHG 3ARPA 4NHUB 4N0FB 2HKFH 1IC1A 3C2AH 2VKXA 1HWHB 4XP6L 1TQBC 3L3JA 3FQWB 4Y2DA 4NRZA 2HTKC 2IAMC 4H5SA 4BYHA 1Q9WB 1MI5A 2NY7H 4JRYA 4PRAA 1GL4B 1NCCH 4MAUH 4DZ8B 3KJ6L 3U36A 2B4CL 2VWEC 1ES0A 1F4AA 1UGNA 5K9QG 4CW1B 5C6TL 3I85A 2EDRA 2OL3H 3ES6A 2AEPL 1V5JA 4RDQF 2F58H 4ODUB 2M1KA 1ZA6B 1W0WB 5DJDB 5HGHA 3QG6A 3PHSA 2A77L 2VITB 1UH2A 1F4WL 2BNQE 1TTUA 4NQSB 5DRNB 1S9YA 3QNYB 1TIUA 4WFED 2X4RA 5DI8A 2CLRA 3PGFH 4NKOA 5SWZB 4I13B 3U7YL 1OD9A 1T1XB 5GRWA 2X6MA 3HC3L 4PJ7B 5CJQL 4Q74A 1CL7I 1MAMH 1MELA 1I7TB 3K7UA 1A6UH 3ZKSD 1BF8A 5IHLB 2E7MA 1FQ9C 2FZ3B 5EN2B 1JPGA 3OZ9L 3G9VA 1TMCB 4GT7A 4RMRA 5F7LB 5H8DA 1JYNA 5EBLA 3MLTA 1R3JB 2ERJB 4P2QE 4R2GD 5DHVA 4L3EB 1OCWH 4X5WA 3TGXA 4ZFGH 3U0PB 4YE4L 3UAJC 2NY2C 3UJIH 2YPLE 4E41B 4C56D 4D3CH 3VU2A 3SOBH 4AENA 1QYGL 2YRZA 5HPOA 5EBGA 3P30H 4P2RE 3MRJA 5FHAL 4M4RA 1CT8A 5T1DH 1AGBA 1DBKL 2G5BB 3REVB 4XP4L 1NCDH 4ONFL 5E24E 3CGTA 3L5XH 4U1KA 1FV1B 1DBAH 2DIAA 4R26L 2C1PB 1HHKA 1HHHB 2VZ3A 5T1KA 2UYLA 4WI3A 3HC4L 3AY4A 1MFBH 4QHLA 1OT2A 4MWFA 2E6QA 4QF1A 3VCLB 1JNNH 5DJDA 5GS0H 5BS0A 5GZNC 3GM0A 1T0NA 3LB6D 4LRIA 1U8PA 1UJ3C 1NBYB 2NY5C 5ACZA 3V4UH 1NGXA 2HN7A 1KTRL 5A1AA 1I7ZB 3U82B 1I7UA 1D6EA 4R4NC 3F12B 4MNHB 2R69H 3PHOA 4BQ9A 3T2PA 1FL5B 1OTUC 4HDIB 1HNGA 5DYOB 3MLYH 3BMWA 3SE3C 3BIKA 2AJYH 4M6OH 3E6FA 4LCIH 1RHFA 5I17B 1I9JL 1B9ZA 4HH8A 1FNSH 4P2YA 3FOLB 1N6QH 1CR9L 5IB5A 5CZKA 3QWRA 4U4BA 4WI8A 3NCJH 5FHBL 3MXVH 5E03A 4U1GC 2OZ4L 2GSGB 2XT1B 5H35B 4OLVH 3KYOA 3C8HA 2ZUTA 4XP9L 2H2PD 4GXVL 1XMWA 2FNBA 5JA8B 1QR4A 1HSAB 2ZUQB 2D3VA 2BCKB 2XZAL 5IJKC 2CSPA 5BJTA 5IB2A 5KW9L 4QHUB 1FIEA 3BZ4B 4OI9A 4LSQL 4OZGB 3O9WA 4MCZA 5F9AC 3VWKB 5F71A 3T0VA 4O4YH 1H3PH 2AK4E 1PZ5B 4G6FD 1KC5L 2ITDA 1ND0A 2VLRA 3QEQE 1IEAA 3ARQA 5LBSH 3QUZC 4F3FA 5ECJE 1QQDA 5D1XC 1FL3A 5CKAA 4NHUA 2UYLB 3FFCB 2X4NB 4HLZH 1RZKL 5F6HI 4Y1AB 5BMFH 1YY9C 3OKLA 4PGEB 2VDQL 4KZDH 3MGTB 2H2SC 1XIWB 4L4VE 4HWBH 2YEZA 2DBLH 1KJ2A 4L4TB 3WKML 3EHBC 1RD6A 1H8SA 3H9SD 2CQVA 4GRLA 4UT7H 4M6ML 2Q7YA 4XNUL 2XTJB 1B88A 3JV6B 4I18B 1X3DA 2DRUA 4F15C 5T5NG 4CVXB 5FGCE 3T65A 4OLYH 2E6JA 3S36L 5KSBF 4HIXH 4I18A 4JJ5B 1XGUA 4BSWA 3QUMA 1S7WA 4FTVB 5ALBL 4IS6B 1BJMA 4PJGF 4G9DA 3VGAB 2GYSA 4FRWA 1QLFA 1LILA 3RUGB 4Z95H 1Y6KR 4PRDA 3AS0A 1LP9A 1J8HB 1KXTB 4MLSA 1T6WA 4QGYA 5FYKH 4TUOA 1T83C 4D9QD 2IH3A 4PJ5D 3LH2H 2PO6B 4UUJA 4UNUA 3C5ZC 1G6RB 4NN6C 2BFVL 2DQJL 1F6AA 1T7WA 3HE6B 2X2YA 3C08H 4TTDD 4OZIA 1FO0H 3V4VL 1ZLVK 1MPAH 1KC5H 1FO0A 5D2LF 2NW2B 5SV3A 3NCEB 1EIBA 4FG6D 4UOW0 2W59A 3H9SB 1DE4B 4KUCD 5KAQG 4PGCA 1Z9LA 2BVEA 1MQKL 4NKMB 5H37G 3T2NH 3BE1H 4Z77B 2XZAH 4X7SH 1MAJA 3RVTD 2Z92B 2D7QA 4GXVH 4MHHG 3V4PH 1T4KB 4NRXB 4V1DA 4XP9H 3HE6A 5T33L 4I8DA 4TQEH 5I8OL 3G5XB 3VWJD 5EBWA 1JI1A 4X6DE 1UWEL 4MVBC 3Q6FA 1NFDE 1IE5A 1HZHL 5ICZB 2AJYL 3L7FB 3FO0H 3K46A 4F7EB 4PG2A 2X1WL 4G3YL 3ESVF 3QUKB 1MWAH 3SDAD 3ZHLA 2XOTA 4GKOA 4Y5YB 1T1ZA 1XGYH 3FMGL 1MHCB 4IIQB 2VDNH 2GJJA 4NGHH 1TJHH 3C8KB 1W0VB 3X3GH 5SWZD 1WBZB 3GGWA 4P9ML 4X5LA 3VGGA 3UROR 4KZEL 3DX8B 5HHOE 2OSLB 1IGTA 1MRDL 3C60B 1C5BH 1NMAH 4LL9A 1VEPA 2QQQA 4MLIA 1IAIH 2GKIA 3CD4A 2VERN 3P9MA 3UO1L 2GAZA 2X4SB 4YPJA 1U8JA 1RK1B 4KHTH 5E2JA 35C8L 3QAZC 3RZWA 4UI2A 4EJ1C 2WSKA 3RWEB 5I18H 4Y5YA 1Q9KA 2H32A 1DQMH 3MV8A 4G8EB 3IU4H 2I9TA 3BGMB 3KR3H 4LSVL 2MTPA 4YNYA 3LCYA 2PXYA 3QQNA 1IGCH 1V3LA 2CDFB 4POZC 2NCMA 5C0AE 1CGSL 5SX4I 3RIFF 1JP5A 1A6TA 4LHJB 5AD0B 4H88H 1OAUH 3W0WE 4XVSL 4WI7A 4XPFL 1I7RA 2BNRE 2WUCL 1NCBH 3DVNA 1T4KA 4LNVA 4ZYKB 4NQED 4KMLB 2BVOB 1A1OB 1PBYA 1XF2A 4FQLH 1SEBA 5GIRA 3KG5A 2DOCA 2DN7A 5FEBA 2VDMH 2IBGA 2YXFA 1KELL 1WICA 1OW0A 3OGOE 3DIFB 3MRKA 4JO1H 4WFGE 3ZDYF 5F88A 4JFFD 2P5ED 3ZE2E 2WLZA 2XRAH 1RZGA 5MENE 3JVGA 3HRZA 1D9KA 4Y2OA 4BQ8A 3P3YA 4XNZB 4MD0B 1A6TB 5DJAB 2LTQC 5I76B 4PRIE 2D4FA 1CQKA 5C92A 1EZVY 2W0FB 1ZHKA 2AJZB 3LQAH 1Q94A 1Q1JH 2RHEA 5JR1L 3W0WA 2H41A 4WU5A 1AD0B 4PG2C 3ZL4L 1C12B 4YO0B 1QRND 2EDNA 4WHTB 1WT5A 1WSST 4XMPH 1NGXB 4O9HH 4CGTA 5IB1A 4PGBB 4N8CH 3ZT7A 4XPBH 1MRDH 3IJHA 3P9MB 4G6MH 5B8CB 1U91A 2YN5A 4PRHA 5E2UH 5GJTH 3SJVB 1J1XL 3CU1A 1G9MC 1N0XL 2OXHA 3QPQD 3RVVC 3LKNA 4HQQH 4JY5H 4XMPL 3STLB 1NCUA 2VZSA 5J4MA 4OLXL 1J7VR 5A2KH 2LTQB 5I1IH 5LXGL 5D72H 1VCAA 1MCSA 2FSEA 3HHRB 1NBVL 3Q48A 5DQDH 4ZXBB 4RQQB 4ODTH 1KT2B 2QADD 1IBGH 4FNLH 5JORA 3O45A 1VSCA 2FIRT 3CJJA 4M3JA 4DW2L 4GMTH 2FBJH 4OF7A 1X5YA 4L5FL 2ZKHH 1C08B 2VUOA 1JRHI 1I3RA 5CSZB 1GIGL 5DD0H 1NJ9B 3RI5K 4NQTA 2DQHH 3T0BA 3BKCL 4JFDD 12E8L 3BIKB 5IB4B 3BEVB 1I1AD 3MLXL 1VGEL 3L3GB 5BS0E 2JB5L 1FIGL 1NLDL 3MJ6A 5HHXL 3K8MA 2BVTA 1UYWH 2DYPD 1QSFD 4JGJA 3MJ8B 1R24A 2MCG1 1OAUL 1ORSA 3T0EB 3BD5A 4HUWB 4RAUA 5C1MB 3QEQB 4ZAKC 4JRXB 2WV3A 5L2JA 3V7AE 3S36H 4ONHB 4LRNH 1KV3A 1L9MA 1GVIA 1F3RB 4XWGH 2Y36H 4P2CG 3KPNB 3FO2B 3RDTB 1A47A 4NO2A 3KYKH 2WBJA 2GK2A 4JFQA 3UCRA 2X40A 3ALPA 5IW6B 1P1ZA 1UA6H 4NN7C 1AC6A 3W9DB 1Q9OA 2EDHA 4N90D 4HF5L 4OFDA 2R4RH 3D48R 2EDFA 4Z95L 1M6OB 2YZ1A 3BESR 3HE7A 4G6KH 4DJMA 3MBED 3T0EA 3VXMD 3BN3B 1RJYB 4Z8FL 4JDVA 3FT3B 2BY1A 5IIEA 2Q8AH 4QRTB 1QLFB 1BHGA 2EC8A 1HQ4B 3D39E 1RAMA 4F37F 3WIHH 3B9VA 1JGUH 3CH1B 3QIWD 4EVNA 2ILLA 3S4SA 4MCYA 3CH1A 1M1SA 3PV7A 3VGFA 5ABDE 4QTHA 1RZKC 3IAQA 4DFIA 2RIKA 3DYPA 4DVRH 4R7NA 2EDOA 3FQRB 3IDGB 2DLHA 1DDHB 1T20B 2P5EE 4FA8A 3U0TA 1ADQL 1IM9D 3UTSA 1TQCC 4O51A 3I9GL 3BYTA 5EU6B 2FB4L 1P4LB 3KDMB 4O51B 5HDQH 5HHXH 5DJ0A 1BWWA 4NQEE 3IDNB 4HS3A 3S3SA 3ZKXB 5HDBF 3RWIA 1MFCH 4X6CB 5DFWH 4OTXL 8CGTA 2MWCA 3BT2L 5KZCD 4OCSH 2P5EB 5FOJA 1T22A 3PDDA 4E5XA 3DXAE 3C5SB 4NSKB 5DQ9B 3RNQA 3ZZ1A 1GYAA 3MJ8A 4IOIA 4K3GA 3QR2A 2EC9T 3EO1B 5C09B 3FQWA 4Y2DB 1EHLL 1T5XA 4LBEB 2P5WE 4XZUA 4YHOH 4N0UB 2W0FA 2XPGB 3D0VB 2Q8BH 2UZXB 3NCJL 1BOGA 3LKOB 1RJLA 1A14L 2FEEL 4ZOEA 3PL6A 3HC4H 3NBNA 4WHDA 3V6FB 3HNSH 3QEHB 2D7TL 4X5XB 2PYEB 4TSBH 5KSUB 1LE5B 2ICEA 5DQJA 2JIXD 3QNZA 3ARUA 4R8WL 3O2WH 2VITA 4N9OB 2A74A 1NCDL 4OZ4B 5SWZE 1FNAA 5GZND 5BO1H 1AP2A 3C6LB 4YDJB 4NZDA 3HE7C 4R4BA 3WE6A 2Y06H 4U1GB 1NQBA 3NCYS 3RKDC 1T03H 5IB3B 3UPAA 1R3IL 2CRMA 4YC2C 4C58B 4AM0A 3WXWH 1CGVA 1MLCB 4L29B 3WL9A 1DBML 4PLKC 3F65A 5CP7A 2P4AB 3WS3A 3G08A 4JGMA 2HYMA 1FL6A 3MRBB 4H8WH 4PJFE 4Q6IC 3D3VA 4HIEA 3DMMD 3QCTL 4K7FA 3V4VH 3F7QA 4M00A 5CMAA 3QDJD 3TYFA 3I6GB 5IMOA 1IC5L 2VDPL 3LSOB 5DJ8A 3Q5YA 1ONQA 2QHRL 4C4KT 4OAWB 1JJUA 2B2XL 1SYSB 1G6VK 1TVHB 1BZ7A 4LU5H 4Q9RH 4KHXL 3BD3A 5F7MC 3OJMB 3TWCH 1IM3A 2JIXA 5EU6A 4HWBA 3LIZL 1XFPA 3BPLB 4HSQA 3VDCA 3BJ91 4XX1G 3B3IB 1DEDA 2H1PL 5D8JL 3TT1L 5CZVL 2GUOB 4AT6B 2EE3A 1H3UA 3HE6C 4U2ZA 5A2FA 2G9HA 1KPUA 2Q86A 1PY4A 2XY2A 1K85A 1VFUA 1DQQA 4IMKC 3S6CA 5DHVH 4Z7WB 4Z7OE 2YD1A 4AEHL 5KSAB 4JQXC 1U8OA 2XPGA 3MA9H 3SGEH 2EDTA 4PP2A 4Y4FD 5DUMH 4PRHB 4H25B 3C2SA 4NC1E 1E4JA 3DYMA 4HS8L 2ZNWA 1J18A 4R8WH 3RNQB 5FIEA 4LNRA 5IV2A 4XX1E 12E8H 3HE7B 2DD8H 4OFPA 5C0CB 4Y4KD 4LCWA 1EBAA 2GTWB 1IQDB 4FABH 4PJ9B 3VE0B 2A6IA 4DTGL 3HNVH 4CL7A 4GG6F 1NC2B 1FNLA 2BHUA 4XCFH 2EDWA 3O0RH 2DQDL 4G8FB 1HXMB 4JM2B 4NP4H 2ZOLB 1KTLB 3VFTA 4Y5YC 3GB7B 1IZJA 2HJLA 1BECA 5MI0B 4AL8L 2AJXH 5DURB 3CFJA 3OJ2C 3VXPB 3TNNA 5GGUA 1NUFA 1WFTA 5BO1L 2EYTA 4NQDB 3BJLA 3FONA 2LQRA 3CPLB 2A9ML 4JFEB 4OLVL 4HXBH 4K3DH 1UXSB 3P11H 4RMWA 3LRGA 1KCUL 4GRLC 3WIIH 1A5FH 5DJ6A 1IEHA 2YPKA 5B38G 3JV0A 2YD3A 4OD3H 4WO4D 5HYSA 2C3WA 3O8XD 1OTUD 3TNMA 3B9KD 3MSPA 4KTYA 5F96L 4L9LB 2YR3A 4JQVA 3SCMC 5E95B 2ESVE 2I25N 1Y6MR 4NZTH 1R3LB 1BVZA 1INEH 3EYOB 1TZIA 3MA7B 1CXEA 4JCLA 3PQYA 3T8XB 1PG7L 4MMZC 4LHUB 4ORGB 3WN5C 1PJ9A 1TVBB 4KKAD 1REIA 4XNYL 1UXSA 5SX5K 4RWYL 2FECI 3C6SA 4HFWA 1ZHNB 2YA1A 1NCWH 3ILQC 5DJZB 2BOBA 3O8XA 4HFWB 3ARFD 5I16B 3MZGB 5C6WH 1O0VA 2CK0L 4Z7VF 1A6ZA 2CKBH 2YD4A 3SDXF 1JNHA 4M4PA 1ZV5A 4EN3C 4F57L 3CVHL 4PGJA 2VL4A 1WZ1H 1K5NA 4JFHD 5IEKA 2HTLC 3L3GA 4QOKD 4MDJB 1A3RH 2C7UB 3WN5B 2ZCHL 1BQHG 3ARBD 3MUHL 1AO7D 4C4KO 2YKLH 5JW4Q 4OF6A 5L88H 2PTTA 3JWOC 4D0DB 4NUGL 4S1RH 2DI9A 3R8QA 3WNPA 4YE4H 3UJIL 4TN9A 1UACL 4LQ1A 1DQML 4GBXC 4JAMB 2IJ0C 4OJFH 3QHFH 1FRGL 4F7PB 1QSEB 2MPAL 3QIBB 3OKDA 4KAQL 2YMXL 3RUGF 3VXRA 4F9LC 5J9PB 3UO1H 4O58L 3V95A 1A21A 3W39A 4KK6D 4P5KB 4Z76A 5CUSH 3UC0H 1KOAA 4U1NA 5FA4A 3OTTA 1ZHBA 2VLRE 2DQHL 3JSSA 2DTMH 4TULL 3LRSB 4RISL 1GPOH 1UACH 2K9UA 4P2RD 3KYKL 5HI5C 4ZTPL 4WHYH 2FHCA 3VG9C 3NPZB 3RL2A 4NZUH 1XCTA 3QPQC 1KJMB 1CZ8H 3GJEA 4WUUA 1XR9B 5F3HA 2VDOL 5JNYA 3VD4A 2XN9A 2AQ1A 2EE2A 4WI4A 4NFBA 1AE6H 7FABL 3BQUB 4YBQC 2DDQH 1NGYA 1FNEB 2DL2A 2YD7A 4OD3L 1FJ1B 3MV01 1NEZB 3MRQA 3KJ6H 4JB9L 4MNQD 5ISZE 1A5FL 4PBWD 4QHMA 4JN1H 3ULVF 4U6HB 1KIQA 4JR9H 3ZO0A 4NO3B 4LPUA 4QXGH 2VZVA 3H7BB 1PZ5A 2QHRH 3IXTB 1KCVL 4L8CA 1OM3H 4PRPD 1A7NL 4ZAKD 2KQNA 1HHKB 1HHHA 1LO2L 5JPNA 2F8XC 4P2OB 3OMZA 1INEL 5ITBL 2WM0A 4FNLL 5EFIB 1MHEB 3ZMRA 1EEYB 1P5UA 3RWFB 4KPHL 4RAVB 1T1ZB 1QLEL 4WFHE 5FGCB 1JHKH 2P8MA 3VFMB 4I3SL 2NY1B 3F7VB 4XB8A 1TQBB 5FUOH 1A1NA 1QFWL 4EI6B 4JAMA 1RIVL 4XMLL 1J1OL 5GISL 4MA3A 1QKZL 1UWXK 4MJ6A 1CG9B 2AJ3A 3HI5H 4KRPC 5DQDL 1CFNB 3BP6B 4FQQA 1AIFB 3T2QA 5GJTL 5I1IL 5LXGH 1P4BL 3R0NA 4WWKB 25C8H 4GO6B 2XKSA 5GRJH 4HEPG 1D9KC 1BQHA 2C9AA 5GGVH 5CUSL 3UC0L 4X7FC 2GSIB 1WWAX 2IH1B 1A7QH 3EO9H 2ICWA 3P2TA 4CMHB 3KLAA 2EYTB 3ARXA 4QRTA 1F8TL 4JPKH 1Q9KB 2H32B 1FCCA 1KN4H 1KEGH 1YEEL 3AB0B 4MJIB 4JREB 4XP4H 5F7KC 4Q9BA 1CN4A 2J6EL 2FD6H 5FB8A 4FZ8L 4PRPB 4NUGH 1DE4A 3KPMA 3RWDB 2VLJE 2YK1L 2VXSL 1MNUL 1X5JA 4YDJA 4NT6B 3FO1B 2BRRL 5FYLL 4X6CA 1IGCL 3MRPB 1D5IL 2NY3D 1YEHH 4J1UB 5I75B 3WIFB 3VRJA 4YXHH 1N6UA 1IT9H 1UM4H 1NGZB 5ID1A 5DJ0B 3O2DH 1CFBA 2ENSA 2J6EA 4YXKL 4LIQE 4GOSA 4ORGA 4X9GA 1E6OL 3TBSA 5ADPL 3SO3B 2VR4A 5I17A 1PVHA 4HS8H 4RGOH 1L6XA 4RISH 5EDXA 2AXGB 3BKML 4FOMA 5C0ND 3STBA 1WJ3A 4NQEB 5I2IB 2GJ6E 3UBXB 5D7IE 3T3PF 2XQYG 5D7IA 4YQXH 1CXKA 2CPCA 2DQFA 5GGSY 4OJFL 4D8PA 3A0OA 1JUFA 4LARH 1ZSDA 2GT9B 3AAZA 4XPTH 1A1MA 4LIQH 4V1DB 1FFPA 3E1F1 5IVXE 1AKJD 2X4TB 4HJ0C 2AXFB 2D31B 3BH9A 3HS0A 3TH2T 5CZVH 5CBEA 4QF1B 2XWTA 5F96H 1EFXD 3M8OH 3NA4A 3QO0B 3LQZA 4PS4L 2OX5A 1CLZL 2CJUH 3HC0A 1EHNA 4OF0A 2DQTL 3P77A 4TOYL 2B39A 4JY6A 3MO1B 3WSQL 5F7DA 5DEZA 2CLRB 2J4WL 4L8BB 3REVA 4XPAL 4DK3A 5ETUA 4V2BA 2DWEA 4X7SL 1I9JH 3FN9A 1NSNL 2WBWB 4KK9D 1NMAL 3TBTB 4X6CE 3X13A 2BHYA 4WFGD 2J8UA 2HLAB 5IVZA 4QTHB 1MJJA 4Y4HD 4PG9B 3KPMB 4MNQE 4FQJL 3LKSA 5K9OB 4CW1A 1FVCA 1KFAH 4O5LL 3WS3B 4M62H 3U9UB 5GS0C 3W5NA 1E0OB 5IEHB 4JY4B 3QIUB 4PRID 3FMGH 4OI8A 5T3ZH 2QSCL 4X9BA 5J13C 2Z35B 1AKJB 4ZSOE 1KN4L 1N2RB 3HNVL 4OTXH 1KEGL 3TC9A 2A9NL 5CZXD 3QUXD 2VL5B 1JIBA 3QRGH 2J8UE 3F7YB 1I3RB 3MLSH 4JM4L 4APQB 3U0WH 4KKCD 2Y1VA 5DUPL 4RBPK 2AK1L 2WAHA 3AY4C 3D0LA 4NUJA 3LV3A 1EHLH 2NY2B 4RNRA 5F9JA 1T7YA 3GJFA 3UTZB 4QNPF 3SOBL 2APTA 1T7XA 4K3EH 5K59E 4UILL 2VL5A 3QISA 1UQSB 1DQDL 4M03A 3QXAB 3ECBB 4HJJL 4LF3B 3RWJB 3ZYZA 5EZOH 2BSRB 1QSVA 1EEZA 1FBIL 4FXGA 1I1FA 1X7QA 2C1OA 2E9JA 4PJGB 2VWEE 3QULB 4ZODA 3QUZD 1FO0L 5L8KB 2B0SL 4R26H 1XEDA 2DQJH 4D0CA 1RFDL 4OUOA 1JV5A 4XVJL 1T6VN 4M9OA 1OGTA 4P48A 4XTRC 4W4OA 2AJ3B 5C08B 5DFVC 1H3VA 1IGYB 1KB5H 4S2SA 3ZKMD 5LGHH 1Y0LB 1RFDH 3U7YH 4YDKL 1LDSA 5ALBH 1IC7H 3I50L 4FFVC 4FQLL 4X7DC 5B21A 4OV5A 3L3DB 4KUZH 4F37K 1TLKA 4LEXH 4OGAC 1KT2A 1L7IH 1S5HB 1WC7A 2H2PC 1IRAY 5IJVA 4WNQA 5DD1L 2Z8SA 3D2UA 2Q3ZA 3WFEH 5EU7E 2LV4A 5FYJH 4EUPB 4BA8A 3CFDA 2VLJA 1N2RA 3IAPA 4UOW1 4YDKH 1WEJH 1XAUA 1BIIA 3RTQB 3ARGC 1X5LA 1YPZE 1PEZA 1H15A 1MAML 3FT3A 5HHVH 1MAKA 5HHOA 4ZYKA 3DURA 1D9KD 1C7SA 5LWYL 2OBGA 1CTNA 2C5DC 3WUZA 1HCFX 4UQ3A 3W11C 5DZLA 2AXGA 4AIXA 2EEAA 4JLRA 2UWEA 4PB9H 1WWWX 4IOFC 4JPWL 5LGJA 2EDEA 4ZNCD 4AJ0A 1EO5A 4LSQH 4JFYB 3NCBB 3QIUD 3O6FC 3GMPB 2AJSL 3TBWA 4PP1C 1JVKA 1K8DA 3OKOA 2XYCA 5EPMA 5T3XD 3BZEA 1WAAA 4KRNA 2XWBA 4PRAB 3O4OB 4OM0L 1K2DA 1MFCL 4IRJA 3MACH 4ZO8A 2FEDD 3CIQA 4IDLA 1IAMA 4GSDH 1KN2H 2OK0H 4A6YA 5B39G 4LCCB 3QDMA 3S4SB 1X5IA 1NLBL 4JFPB 3AS3A 1I1YB 3ULVD 3ZTNL 4IMKA 1S8DB 1XGTB 4P4KA 1CFNA 1CR9H 3BP6A 5EZLB 4F9LA 1JZ2A 4G7YL 1I1AC 2GTZA 2HT4C 5HXMA 1I85A 5ILTH 4X9HA 3C5JA 5LJYH 2Q76B 3UDWC 1RVFH 3QO1A 4NQCB 1PG7H 3IXAA 3VXTB 5D7KE 4QHNA 4NO0A 4U31A 3C60C 4ZO6A 5JORB 4GG6A 4KKLC 3UTTD 4RQQA 1IILE 1J0HA 2O5ZL 3FB6A 3QDME 3T0XA 3P0GB 5HVHC 1MHPL 3RNKB 2MMXA 3ARVA 2BFVH 2WK2A 4EEEA 1V3KA 2MNUA 4NT6A 1JF1B 3T1FB 3TO2A 4HKBB 4Z77A 1KPVA 2UV3A 5L0QB 1CFQB 2CLVB 4RGOL 1CLZH 2CJUL 4HZLA