3V4UL

Structure of a monoclonal antibody complexed with its mhc-i antigen
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-MHC-I MONOCLONAL ANTIBODY, 64-3-7 H CHAIN
publication title The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
pubmed doi rcsb
molecule tags Immune system
total genus 58
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v4uL01
3F5WA 1YNKH 3BPCA 2IQAA 2K9UA 2W92A 5ENWA 4JRYB 1VFOA 3QUMH 4P5KA 4XBEH 1X44A 4LAQL 4IRZL 4MZ3A 4RMQA 1MFEL 1EHAA 4RZCA 5DEZA 1VGEL 4YQXL 4FQXD 1MWAH 2EDBA 3KJ6H 5GPRA 2C7UA 4HJJL 2AJ3A 4AIZA 3VXRE 3CAFA 1FO0L 3CUPB 3DJ9A 3U7WL 1RZ7H 1KXTB 1MEXH 2BVPB 1F2XK 2EDXA 4HJ0D 3KYMA 5FO7B 5GGRB 5GGVH 4MS8C 3RIAK 4LHJB 4PJCB 4HC1L 3I6KA 4WO4A 3T3PF 4UINL 3O4LD 3BQUD 1F4HA 3RIAF 2HWZL 5A3IC 1CFVH 4KKLD 1D5MA 1DBAH 1VSCA 2PTTB 5L0QB 3BH9A 3QHTC 4CU8A 3T0DA 1JHLH 4PJFF 2VABA 1MLCA 2GJZB 2NY0B 3BRFA 4OZGF 3LIZH 1MWAB 5MENA 3Q3GB 3FN9A 4G9FA 5I8KH 1KTLA 5DO2C 1P4BL 1OTTD 4H5SA 5EBMA 4X6EA 1DBMH 3Q6FB 1GJIA 5D5MF 5I8EA 5I1KL 4OQTH 1TQCB 1L7IH 1NGPH 1T83A 4H88H 2Q8AL 4XVUC 4S1RH 1FFOA 3N85L 5FM4A 5GZOC 3KPNB 1JZ7A 2CRYA 3ULVC 1A14L 3FB8B 2FEDC 2G9HB 4X6DB 5E9DD 3PJSA 1SMAA 4XMKL 4OCWH 5BMFL 2XICA 2VDML 1N8ZB 4HUUA 4F7CB 4G8IA 5I0ZA 2W65B 4LF3B 3VGHA 5IW1B 4UBDD 2XV6B 3GIVA 4M5YH 4JRXE 2PYEE 2WBJA 4KHTH 5EZOL 5GJSL 1ZLWK 5BJTB 4PRHE 4XX1G 4FQ1L 1IGJB 3L7EB 1KT2A 3R06B 2BP3A 1AP2B 3Q5OA 3QXUA 1NLDH 2OTUA 1VFUA 2DQDL 3T4YA 5KVGL 4QTIH 4WFHD 4RGND 4NQDD 4ODVH 2E7BA 1A3RL 1U8LA 5F7HA 5DDHB 3A6OA 5AYUH 3VFNB 4AEHH 3T2NH 4N8VA 1G0YR 4H26A 4HUWA 4NDMB 2RJMA 2NY1B 3RIFK 3HMWL 5IMOB 3CFKB 2EH7H 2J4WL 4F9PA 4TRPH 1UJ3B 2EE6A 4RQQA 1XGUA 4X9FA 3BGMA 4WI9A 5C0FA 2YD7A 4RGMB 4X4ME 5I76B 3S8WA 3O2DH 3RWIA 2X05A 4L9DA 5D2LA 4F57L 4PRHB 2BC4B 5DQ9A 4AM0A 1EJOH 4K3JH 4OQ1A 2EDYA 4NCC2 1XFPA 2FZ3A 2KUTA 1SYSB 2FNBA 4KKAC 2B8OT 3DV6A 4JB9L 3QWOB 5GGTL 1D3CA 2OK0L 2YA0A 5FAAA 2JIXA 4Y5YA 4G8FA 4BJLA 2XKSA 3P77B 2JB5L 3H9ZA 4JHWH 4NQXB 3DBXA 1Q9WA 1IZKA 3V6OC 5ITFB 3DYPA 4YGAB 1NAKH 1FRGH 2GTZB 3UTZB 1D9KC 3TPUA 4I8DA 3T0BA 2OL3L 1N0XH 5DEFB 1N7MH 1TENA 3QIUC 3WJJC 1I1AD 2CLZA 1FHGA 3MRGA 3W5NA 4XCNA 3PWVA 5ICYA 3SN6N 3G9AB 3PE9A 2HT4C 3N9GH 4XBGB 3ZTJG 1ZGLA 3SDAD 2R2HA 4JVWA 4Y19A 5GSVA 3TJHD 3HAEA 1SEQH 2R2BA 3IFLL 1K2DA 5T5NG 2DI9A 3DIFA 5IFJB 1SHMA 1B0RA 4M43H 4P4KA 2W1NA 4ISVB 4WI2A 4R90H 1HH9B 1MAJA 3MRDA 4ZFZA 1NBQA 3C5JB 2H2PC 3N1FC 1NDMB 1KCRL 2A74B 1CDIA 5IEKA 2V5TA 2A77L 2XY2A 3V0AC 3MROB 3ARDD 5ACZB 1OF2B 4J3XA 3S3SA 3MGOA 4GXVH 4U6YA 1JVKA 3SCMD 4EQ3A 3EYQD 2OQJA 4PY8I 3RWFA 3F62A 1GH7A 1AD0B 3FONB 3OG6B 35C8H 1IKNA 2P8PB 3OKDA 1YY9D 2FR4A 1EVUA 2DQEL 2AK4B 2E9WA 1ZVYA 4U1KA 5GSRB 4P57A 5IMKB 2O61A 2GKIA 2V5SA 2BRRH 3VI3F 1IJ9A 4MJ4A 5ID1A 2I9LB 1G9NC 3P73B 2CIKA 4FQXC 2ITCB 4X4ZA 4CVXB 1J5OH 3BE1L 1BGXH 3MA7A 5K9KA 1A7QL 1U2HA 4J4PA 3HC0A 1OW0A 4KVNL 2CDEA 3IJYB 3U0PA 4I3GA 2CDGA 3TBSA 2QBWA 5LWYH 5HI3D 3IVKA 2CKNA 4HJ0C 1KLUA 2UV3A 1IAII 2EECA 4RAUA 5FGCE 2VDPL 2NY3C 3QH3A 5FF6A 4UIKL 4UQ3B 4PRNB 3RVUD 3BQUC 1V7MH 3KDMA 3DROB 4MNGB 2ICWB 5D1QA 5HGAA 2EDKA 5JORB 1VCAA 5D6DA 4KKLC 3T2OA 2NXYB 4X6CA 5C0GA 2ADIA 2XRAH 5CP7A 3ZDZE 1G6RB 3TESA 4ACPA 3SDCA 2AQ3A 1S7RB 4S0SD 1HINH 1AXIB 3AXLB 5IHBA 1Q38A 1ZT4A 3VCLA 5E99H 2XN9D 4P2QD 3QUXA 4GAFB 2JK5B 4X7SH 4IBLT 4GMTH 1OTTC 1YQ2A 4WWKA 5C6TH 2YR3A 3S97C 5IB2B 5FGCB 5ALBH 1CFNB 5I71B 1X4YA 4MA7H 1QFWI 4PJXE 1B4JH 5JUEL 5DHYA 3QCTH 3RRQA 1WBYA 1U8IB 4MQ7B 3EZJB 1P6AB 3HRPA 1QSZA 3MRHA 4BUGA 2X1QA 4P5MB 3AMKA 1P7QA 2VDQL 3MRMB 1TJHL 2F15A 3NCBB 1RZ8B 5TE6H 4ZS7H 3VXPB 2ADJA 4UBDC 5J1TC 1A7RH 2B4CC 4HIHB 4HH8A 3MLYH 2VDOL 1Z0NA 3JV0A 4X6FB 5JPMA 1OD9A 5DK0A 4M8QA 3LRGA 4N68A 1LE5B 1E4KA 2Y72A 5FUOL 5IK3B 3VI4F 1DBJL 4JHAH 1UYWL 4H20L 2BFVL 2YD6A 4MAUL 3BGAA 1NGQL 4PJXB 5AWNH 3HNVL 4RGNC 3BDXA 2B1AH 2QQNH 3LQZA 4MDJB 1AGBA 2CRZA 2PCPB 1LK3L 5E8DH 1N26A 3L1OH 3PWPE 4JLRB 2HFFA 1IQDB 3QJHA 5KSBE 3KAAA 2IQ9H 3TGXA 5HI5D 1YA5A 5I8OH 2D0GA 3JWDH 4F7PA 4K3HA 3GRWA 3NPSC 4LIQE 5FOBB 2WW8A 2DQGL 4O4YH 3U4BH 4DWHA 4ETYA 2EH8L 4WCYH 4HK3J 3SDXE 5JLZB 3SJVD 2R0LL 4XVSH 1YYMH 1H8SA 5F1IB 2VLKE 3WSQH 4DVBA 4UT9H 2YSSB 1YNKL 1S7XA 2C4FU 5LAXB 3QUML 5EU6A 1S7UA 1FCGA 4XBEL 3WFHA 4OCYH 4F9LC 1B9ZA 3RGHA 4YDJA 4MHHI 3WNMA 4JRYD 3KPOA 3GFUA 1E27B 1SEBB 1T6VN 1MWAL 5ACMA 5IVXE 3KJ6L 3PWPB 1Q0XH 2E7HA 3D5OF 2X89A 1FSKB 1HOCB 3RWCA 3NIFF 4IMKC 1RZ7L 1MEXL 4FQHB 5C7XL 3IDUA 3PXHA 4Y4KA 4BFIA 4OBRA 5GGVL 3ZYOA 3SDXB 1Z5LB 3V9FA 5CMAA 4C54A 1I1AC 4G7VH 4WTZG 3OHXB 3EJZD 3EFFA 5C08D 2EE3A 1DDHA 5BCAA 3DX8B 4D9RE 5IR1B 1CFVL 2DM2A 1JTTA 3RWHA 1I7ZA 1DBAL 3TJHC 2X42A 4N5ED 4TUOA 3SKMB 5F7DB 4JFOA 5IVXB 4HZLA 1PYWB 1JHLL 4XAKE 3NABH 5D7IF 3S5LG 1G7HB 2VISA 4NQCA 1MOEA 3LIZL 4G8EA 2X9WA 1A21A 2AJVH 1J86A 1YPZF 5CSZA 2BNRA 5I8KL 5CJ5A 2VLRE 5I0DA 1I7RA 3ARDC 4LFHD 3MRIB 3VXRD 4X7FC 1DBML 1KN4H 1KJMA 3NCEB 4W4OA 3SCMC 3EYQC 3RDTA 1J8HE 4OQTL 1L7IL 5IFAH 4DKAA 1NGPL 1CVRA 4H88L 4S1RL 4PJIA 5C2UB 3B43A 4TSAH 1NH6A 1YY9C 4DGYH 2W38A 1CL7I 4K23L 2JCCF 5LQBH 4U6VH 4JKKA 1QBAA 4C56A 1VEPA 3KPRA 5D2NA 4U0RC 2NYYD 2AQ1A 2A6KA 3GSRB 4KJYB 4OCWL 5SWZE 3EYSH 1QSFE 2DMKA 4XXCA 4WUKH 3NFPA 4M5YL 1MAKA 1CXKA 4KHTL 1EPFA 4PPTA 5HI3C 1A64A 4PB0L 5L2KE 1A6AB 4YDIH 1RIVH 3GB7A 1FAKT 4R6UA 4ZDHB 3O8XD 1A1OB 4IOIB 4F7EB 1NLDL 4LOUD 1J8HB 4FOMA 4QTIL 2A6IA 4XXDB 2YEZB 4EI5A 4ODVL 3UTSE 3RVUC 5DVOA 4HUXA 2DQCH 5AYUL 3T4AB 4AEHL 4JGMA 3T2NL 2F54A 4MWFA 1WUNT 4LCWA 5ICZB 4LGRB 3ARPA 4CMMA 2EH7L 3IU3A 1CGUA 4TRPL 3TVMA 4Z78B 4XNQB 2NZ9D 1MCEA 5H35A 5SWZB 4JO2H 3O2DL 4JZJB 4HIJA 2ZUVA 2NY5H 5DSCB 4RFOH 4LVHB 2CQVA 4QGTA 5L2KB 2FO4A 1EJOL 4K3JL 5B8CA 3OKNB 4JRXD 2OXHA 2PYED 5F7FA 1ZT1B 4WHYG 4LLAA 3BW9A 3T3MF 4PRHD 3KPQB 4OZIF 4X6BB 1OT1A 4HAGA 4CBPA 4FZ8H 3ZE2F 2GIYA 2AERT 2DKSA 3HUJF 4JHWL 2QADB 4R4ND 5EUOA 3BRDA 3BPCB 5E00B 3L95B 1NAKL 4MVBD 1FRGL 1EERB 4YZFE 4CVUA 4XZUB 1C7TA 3FFDA 4JQXA 5I17B 1N0XL 1N7ML 4JG0H 4MZ2A 4U1SB 1PY4A 5HHOE 4GKSB 5DGRA 1ED3B 1HSBB 3VG9B 4I77H 2C7UB 3N9GL 5DJXA 1LE9A 2B2XH 1EHLH 4P9MH 1C08B 4WI5A 3K3QA 1KTKE 4QXTA 2ED8A 2X6MA 4QTHB 1Z6JT 1SEQL 5D7LB 4I18B 3G5ZA 4ETQB 2D31A 1F90H 2AJUH 4GSDH 3BZ4B 4M43L 1U8HA 2IEPA 3S5LB 4R90L 1KOAA 3UZVB 2GFBB 3VXUE 2R29H 2X4QB 3WHXA 3NZHH 2B7DT 3QPQD 3FMGH 5T3ZH 5JXEA 1MCBA 4PGBB 5SWQA 3UJJH 4GXVL 4A2MA 4PY7B 2BX5A 2L4OA 1ND0B 2VIRB 2BY2A 1S7QB 1AE6H 3LKPA 4U1LA 35C8L 4LCCC 1QPXA 1TQBB 4FQCH 4LMQI 5EZLA 4MXVF 1LMKA 3IF1B 4H1LA 2BRRL 4YGVB 3HA0A 1BMGA 1E4WH 4JFDB 3BVNA 3LSOB 5DJCA 1BGXL 3VA2C 1C8PA 1ADQA 3VXUB 2J5LB 5CP3H 1U8KA 4WHYH 1FFNA 1X3DA 3QI9A 1FFOB 5LWYL 5BZDA 2CO7B 4LNRA 4NKOA 2HJLA 2NLJA 1XF1A 2V7HB 4F37K 1QSEE 4YK4C 3EJZC 2RGSA 5IQ9A 1NFIA 2ENSA 4AENA 4F37F 5L8KB 3ZKND 1F00I 3SGEI 2R2CA 1I1RA 2C3VA 3GHBH 4WI7A 4XPHH 5JO5B 1H9VA 1KBGL 2XRAL 1NBZA 1L6ZA 1JGUH 3CC5B 1DE4A 1A0QH 4FTVB 3MRKB 9CGTA 4WW1B 1HINL 2NXYD 5EZIH 3FOMB 5E99L 1JK8A 2OSLB 4X7SL 4GMTL 3DTXB 3TA3B 5C6TL 1N6VA 4U6HA 5ALBL 1LO4H 1NDGA 2X40A 3GMOB 5HDBF 1QSEB 2DLEA 2A73A 4MA7L 1B4JL 2EEBA 4AL8H 5KVFH 1U6AH 3QCTL 3GBMH 1RZGB 2XWJB 5KS9F 3HPJB 4NFCA 4PJHE 2GTWB 4TPRH 2E7CA 2KQNA 3ZKXC 5DJ0A 5HYJE 1TQCC 4LSQH 3HAEH 3EKCA 2NYYC 2JB6A 4LRIC 4WHDA 5TE6L 4ZS7L 1I8IB 4CW1A 3PWLB 1G7MA 3MV7B 1A7RL 3MLYL 5KG9A 2BZDA 2EYRA 3WNOA 1MHHB 3JTTB 2D4DA 5EUKA 3O81A 3EUUA 2IBBA 4JHAL 2HAZA 2Y23A 4PJ9B 3O8XC 4QRPE 4H0HB 3GJFK 4GRWF 4LOUC 5AWNL 2P1YA 2B1AL 2QQNL 4L3CB 4NRXA 3WE6B 4RAVB 4ELMF 3LMJH 5E8DL 1S8DA 2Q86A 2BVOB 3L1OL 3G5VB 4WUUE 3EYUH 5HYJB 2VKWA 1A4JA 2IQ9L 2DM7A 1BVLB 2VN4A 1XR9B 5I8OL 3JWDL 2NZ9C 3SE3C 2DL9A 2DDQH 2YN5A 4HKBA 4LSPL 2VZUA 4O4YL 1WCBB 4FQQA 3U4BL 5HJ3B 4WCYL 2BSSA 1VFBA 4XVSL 1YYML 4P46B 1K2DB 3WSQL 4RGOH 1R5WA 5DXWA 3IXTA 4S1SH 3GGWA 5I1AB 4QRPB 4XH2B 3MGAA 5ETUB 3SDYH 4NZDA 4OCYL 1ZLUH 3RZWA 4JO1H 5IJKC 1PZ5B 2H8PB 2XG4A 4MQXD 4XPAH 5GS2H 4YBLB 1UT9A 5T1MB 1KN2H 5CGTA 3X13B 3BSZH 3C5SA 4WUUB 5GRYA 2MHAB 3CFIC 5F9JA 1QNZH 4R4NC 3CFJA 2ORBH 2XI9A 2D0HA 3Q48A 4TVSa 4PD4J 3I6GA 4MVBC 3NCCB 5FYLE 3K81A 1H3TA 3PWPD 2HVJB 1ZE3C 5E94A 1L0QA 1WWBX 2H6PB 5DJ6A 4XMLH 1OP3K 5HGDB 4G7VL 4NQVB 1OAYH 3TF7C 2VXUH 4OI9A 3SGKC 4DUWA 2EZ0D 2Z9TA 3VFTA 1A7NH 4QRTA 3BIKB 4P2CG 1JNJA 2VLKD 2CDEB 1K5NB 4O5LH 1JGDA 1OWRM 4LSSH 4KTYA 5J56B 3GUTB 4R9HA 3IAPA 5KJRH 3F65A 3ZKQD 1VERA 3NABL 5EOQL 3QEUB 1KCKA 2NTFA 2HJFA 3CSGA 1FE8H 4H0IA 4NM8H 5TGBA 2AJVL 3OKKB 4JFHE 5ESVB 3QPQC 1JMZA 3PL6B 1YN7B 3QUYD 2OJEA 5EO1A 5I6XC 1KN4L 1QTYT 2OMBA 2VZSA 4Z0XB 1FNGA 1YY8B 2FEEL 4XB7A 1P5UA 2NX5B 3O6LH 5IFAL 2C9AA 3PHOA 2DAVA 4J3TA 2AAVA 2ARWA 5FB8B 4PJDA 5DK2A 3EGSA 4DGYL 2WUBH 4YH6A 2P7TA 1X7QA 3MA9H 4PJGF 5GRJH 4M7ZC 43CAB 5LQBL 5JDSB 5HY9A 5CJXA 4U6VL 1OOAA 1ONQB 3A6BH 3KYKH 4OZHA 3BKCH 3FQWA 3RJQB 2VN7A 4F80A 2RIKA 4D9RD 3EYSL 2Z35A 5GQBA 4HLZH 4WUKL 5TFSH 1UCBH 2DN7A 5L9DH 3VFOA 1MAMH 3MLWH 4O2CA 1KCSL 3PP4H 4N1CA 4XAKD 5TPWH 4YDIL 1RIVL 1L0XA 4PJEA 4KHXH 4EEEA 3CXDH 3G6DH 3CSYB 3D2UB 3BXNA 1FZJB 1EH9A 2VLRD 5A2JH 2P4AB 2GI7A 2DQCL 1Q9OA 1QLFB 3O0RH 4Y7MA 4FFYH 3TBTA 4MSWA 2YA1A 5EBWA 5IQ7H 3ZKNC 4UAOC 1J8HD 2HP4A 5F3HB 4NKDB 5F6HJ 1ZHKA 3W9EA 1B2WH 1D7FA 3HG1B 3U0TA 1TVHB 2A38A 5E8OA 1JRHL 4FQPA 4JO2L 4YUEH 5FDWA 3BAEH 4PRIE 3ZTNH 2NY5L 2NXYC 3VGDA 4RFOL 5K59F 5SWZD 3OKOB 1QSFD 4G5ZH 4EUPG 3EDFA 4ONFL 3QDAA 4Z77B 3AFLA 2Y4SA 5KANI 5SX4I 5L2KD 1G9MC 1JUFB 4FZ8L 4OAWA 4WY7L 3UTSD 3EYVB 1FV1B 1Y0LA 4E9LA 4D0BA 1T0MA 3IDJA 1IAMA 2IPKA 1A7PH 3RTQB 1RURH 1T1WB 5EZJB 3L3OA 3Q2CA 2OTWB 3OR7B 4P3DB 1W0WA 4JG0L 4PRIB 3UDWC 4WI8A 4QGYA 3VXME 3QG6A 1XGQB 2NY6B 4I77L 1LNUA 1FLTX 4YE4H 3V0VA 3QXTA 2W91A 2P24B 2B2XL 3TFKD 1EHLL 1MI5E 4P9ML 2CJUH 4ZSOA 2UWEE 5IM7B 5J9PA 2XA3A 1U0QA 3UBXG 5J6GB 3L3DA 2YKLL 4JQIH 4G6KH 5EBLA 1F90L 2AJUL 3VH8G 1R3HB 2YC1A 3MXWH 4GBXA 1B6DA 3EFFB 4P3WA 4U1NA 5D7LD 3H42H 2FJFA 3QG7H 2R29L 3NZHL 1B0GB 3FMGL 3GSUB 5T3ZL 5AUMB 3UJJL 2I24N 1MCKA 1H3GA 3MV8E 4L4TA 5EU5A 3MUGA 4PJFA 5I66A 2C4FT 3TZVD 4I3RH 4NQCB 4FQCL 1EZVX 5IV2B 4K94H 3BPLC 5LKNA 3MCKB 1JI2A 5CSZB 3MOAH 3BI9X 3P2TA 4MQXC 4RA3A 1B6UA 1FNEA 1E4WL 4BFEA 4YHNA 1DLHA 3ARUA 3IFNH 3MJ9A 3W39A 2FJHB 5D5MA 2DIBA 1KCVH 3CFBB 3QPXH 3VMOA 1VHPA 1UKQA 5JW3H 2IPTH 3NN8B 3HC3H 4R4BB 4IIQA 1OSZB 1OGAE 1RJZA 3KYOA 1RMFH 1N2RA 4K07A 1FSKC 1A5FL 5F7YC 4RMUA 3MV8B 3VXUD 3B3IB 3W9DB 3FN0H 1SMOA 3OB0H 3MXVH 5IB3B 2EZ0C 1F42A 4HUNB 2O5YH 2P42B 1IKFL 2YA2A 1JWUB 3GHBL 1C12A 4XPHL 5F88A 5C0BA 5KN5A 2BXZA 3B9EA 3ES6B 1JGUL 1A0QL 5GGSA 4GKOA 3G6JE 5IB5A 1TITA 5EZIL 4QHMB 3T1WA 3VWKA 2VXSH 1YMMA 5D71H 1OGAB 4YHPA 4QRRA 2VXQH 2ZOLB 5IWLC 3P4NA 1MH5A 3QUYC 2WBWB 4TTGA 2H9GB 3ARFD 1LO4L 2BHYA 1T7WA 3ZDXF 3WS6C 3P9LB 4QYOA 1J05A 1U6AL 3VA6A 3GBML 5KVFL 1J1PH 3RX7A 3TA3D 1CLOH 3DXAB 5MEPA 3ULUE 4F33B 1KIQA 4TPRL 4O2FB 4UI2A 1QSED 1YJDC 5T1LA 3W11D 1BQUA 3IGAA 4LSQL 1T5WB 4F3FA 2GJ6B 4JDZA 2CLRB 2F53A 3VXOB 5MEOB 4QHUA 3G6JB 3V52H 3C6LB 4OFVA 1QO3B 1CICB 2HVKA 1MSPA 1VDGA 5L88H 2NMSA 2MNUA 3H0TB 2P5EA 1MCNA 5DWUH 4RRPA 5JHLH 1A1MA 3MCLH 3HZKA 3U30B 3VFMA 1QLEH 5SV3A 2EEDA 4KDTA 4QF1A 3UBXB 4RMTA 4QRUA 4HKXB 1MCLA 2NW2A 2DQFA 3LMJL 2V2XB 3VH8B 1HQRA 4PJ9D 1KPVA 3IS1X 3CFEB 4HMEA 3EYUL 2APWA 1NEZA 3P0VH 3BZEB 4H1LH 3SKNA 5HVFB 4K7PY 3VXNA 5A2IH 3C8DA 4JVPA 5E03A 5AEAA 3NACH 2DDQL 3NH7H 3O3DA 4Y4HD 2EIBA 1GOFA 3KPMB 1JWMA 3EYOA 5HYJD 1KC5H 3MMEA 4PLKD 3DWTA 4X7TB 4F15B 3ZSTA 2Y25A 4X8XA 5DI8B 3LKQA 4RGOL 2QKIA 1ADQH 4ZOBA 3RQ3A 1KPUB 3AGVA 4ZS6D 4S1SL 5D7SH 4L3AA 2FHCA 3BEVA 3PQYA 4N0CD 3LS4L 3VE0A 4YFEA 1D5XB 5CWSA 5DHVA 4UNVA 3N1MC 3SDYL 4JO1L 1DVFB 1U8PB 4LVHC 1EK3A 4U1IA 4XPAL 1AKJD 1F45A 1KN2L 2O26U 2Q1EA 3BSZL 4N8PA 4X7CC 1S9XA 4QRPD 4KXZH 1BF2A 1QNZL 5DD3H 2ORBL 4QY8A 4OKVB 4UILL 3MFFB 3QXAA 4WUUD 2X4TB 2I07A 4LCYB 3KG5A 4XMLL 3PHQB 2ATKB 4LP4A 3OQ3B 1H8OA 3E1F1 1WAAE 2AQ2A 5DJCB 3MLPA 2VXUL 3RU8L 1S7TB 2AXGA 4HWBA 5ICXA 4HK3N 4EQ2A 1A7NL 2R2EB 4FS0A 3PIQB 1NCAH 2ICEA 1U3JA 5JNYA 5F21B 4O5LL 1LEIA 2ZUQC 4LSSL 2B5IB 4LNRB 2GCYA 1B88A 3B9KB 3QDMA 3JV6B 1JGEB 5KJRL 4PTTA 1FE8L 3D85D 4NM8L 1IL1B 4YHYC 1L9NA 3LKNA 4P48A 4B41A 1CD8A 2ZSWA 2P8LB 4GT7A 4RSVA 2BVYA 4ZMAT 4OZ4A 5EU7E 4BELD 3CCHA 4L9LB 1E28A 1MCOL 1X5YA 2W0KA 4GKNB 2ZUXA 4KUZL 1ULVA 5FYLD 3JXAA 3QAZB 5BV7C 3O6LL 2M26A 4POUB 5DRWB 3TZVC 5HHXH 4POYA 3JSSA 4S1DD 2WUBL 3EO0B 5GRJL 3MA9L 1HH6B 1HN1A 4LSTH 4LLUB 4QRSA 5HHPA 3K4AA 3A6BL 3KYKL 4PG2A 5T1KD 3H6JA 4PLNC 4HKZA 3BKCL 3LS5H 4R97B 1XF3A 4P5TD 5TFSL 3OKEB 1UCBL 5L9DL 3MJ8A 1JGLH 4G8GE 1MAML 1KJVA 3MLWL 3VRLE 5JTWA 2BCKA 3PP4L 4PFEA 5JW5A 5TPWL 5TF0A 4MDIB 3HZYA 1K4CB 5E5MB 3D3VA 2AS5M 4KHXL 1BZ7A 5CD3A 3CXDL 4PJAE 4IM8A 3G6DL 2HTKD 2PW2A 1T80A 1OAZH 4HK0B 4JFHD 3HN3A 1AO7A 3EJYD 4JZNB 3QRFM 1R5VB 1JPFB 1XR8A 2OXGA 2QSVA 1M7DB 2CXKA 4PGCB 5DHXB 5CZXD 2FO1A 4PJCF 5IB1B 5CD5D 4FFYL 1XF4B 4JE4B 5IQ7L 4Y1AE 4JPWH 1IC7H 2VQTA 2APTA 2PNDA 3QIBA 4JGUA 5LJYH 1PVHA 4EN3A 5FYKE 1B2WL 1T1ZB 3RUGA 1AXSA 5C0IA 5A2FA 4M1GH 1QBBA 1ZHNB 2UVEA 5LG1A 1ORQA 3CFDA 4D8PB 3GSWA 4WEMB 4NC1E 3MRNA 4MJ6B 3ZSSA 4HJGB 4YUEL 3BAEL 3ARWA 5J6HA 3ZTNL 4GG6E 3FZUD 4IRSD 3W0WA 3I3EA 4G5ZL 3VD7A 4IS6B 5E6ZA 1AIFB 1DLFH 3ARFC 3B2UD 4ONOA 1M05B 4QWWC 1T6WA 3ME0A 3O11A 4CUCA 2JLLA 3LN4A 1VADB 3TA3C 2NY2D 3PDDA 1KFAH 4Y1AB 3HE7D 2VLLA 1GGIH 1U8NB 4WW2B 4NO3B 4F7TB 1NCWH 2AABH 5CEYB 4ERSH 1A7PL 5EU4A 1RURL 2G5BA 2EDLA 1CT8A 4Q97A 5C9JA 2CKBA 4BQ6A 4X6DF 1LHZA 5L8JB 2H32A 3NIDE 3R4DA 3FTGA 2K3TA 3RTQD 4M1DH 1KCLA 4YE4L 3STBA 4F8TA 1R3KA 1A7BA 3ZDYF 4PRID 4DGVH 3ARYA 4Z7UE 2CJUL 4K8RH 3VGAB 4OLUH 1LEKA 5I1CL 5DFWH 2NY6D 2P46B 3S35X 1SJHB 1VACB 4JQIL 1A1NA 1R5IB 4G6KL 4W6XB 4YHKH 2YWYA 4PJ9C 1K8DB 2YUWA 3MXWL 3F12A 4Z7NF 1CD1A 5C09B 1Q8MA 5DRZA 2R4SH 2XXMB 3H42L 3QG7L 4NUJB 4NZTH 3H9YA 3CPLA 3S96A 5J3HD 3N1GC 2DIAA 1HCFX 4I5BB 4Y4HC 1AGFB 1RUPH 2IAMA 2ICWJ 4JGJA 1CTNA 4N9GA 3HR5B 4PLKC 1T89C 4ODWA 2VERN 4R7DB 5D7IA 4I3RL 4N0CC 3TN0D 4K94L 4L8CA 3KXFA 3VXMD 3LVEA 3MOAL 3U48A 1YPZA 2IC2A 3HCVA 1ZLVH 2J88H 1HYRC 2G2RA 5KVEH 5HHNA 1NGZA 3QUKA 1MI5D 1F3DH 2WBKA 5IG7A 4HWZB 2CUIA 3IFNL 5JIKA 1KCVL 4HV8B 4HX1A 1VGKA 5C9KA 1CE6A 2NXZB 3QPXL 3UJTH 1WT5C 3LRHA 3HRZB 3U4EB 2IPTL 4KMTH 3HC3L 3MACH 4HULB 1GAFH 1BBDH 2RQ8A 1IGMH 4K3DH 2JCCA 1RMFL 2J8UE 5ESAA 4WDIB 4OLYH 4Y16A 2Z92B 2UUDH 1U41A 2WNGA 2ZSVA 3UYOD 2C1PA 1WBZB 3QFDA 3ARGA 3FN0L 2IJ0C 3ARBD 2A1WH 3MXVL 1TZHB 3CVIH 5D96B 2O5YL 1RK0A 3MV8D 4ZUSB 4LLQA 5CEZH 1G0XA 4M62H 5C07B 3OAYH 2GJJA 3O3AA 1PQZA 4LCUB 4YPGB 5EO0B 3I3DA 5IVZB 2EE2A 1NUGA 4GUPB 1G7QA 2D4FA 2R0ZH 4JKPH 1ZXQA 4WV1C 3REVA 1DN0A 2KL6A 1BPVA 4W70A 2VXSL 1ZVSB 3X14A 5D71L 2VXQL 3O3BB 3D39B 4Y5VB 2J8UB 1N5YH 2Z31D 1BOGA 2ATPA 1LO2H 2XACC 4YO0B 5SWSE 1O0VA 1OGAD 4M3KB 4Y89A 3H8NA 2APBA 1BREA 1CYGA 1J1PL 3C60A 4LGPB 3QFJB 4PJAF 1CLOL 5FV2A 2IH3A 2HMID 3DVGA 4H25A 4BK5A 4HGMA 1F3JA 4YXKH 2APVA 4FHBD 2RFXA 4LLDA 5FO9B 4JFYA 3ZYZA 1Y18A 4P5TC 2W9EH 3MC0A 3V52L 5CHNA 5IF0A 1WIUA 3QJFA 4C55A 1U58B 4Z7WB 2EXYD 4Z7VA 4N0FA 1S9WB 5L88L 4JANA 3RA7H 1JBJA 1NBYB 2BXYA 1K3ZA 3GSNA 3HUJA 5DWUL 3C6LD 1NC4D 2HKHH 5JHLL 2ARJA 2PYFA 3MCLL 1CICD 3MBEB 2A83B 2E8ZA 5ID0A 1T0MB 2BOBA 2HTKC 2Q3ZA 4OUOA 1QLEL 1YUHB 4XT1C 5SWSB 3EJYC 3S35H 1KIUA 3RI5F 3BHBB 4OZFA 4XNYH 4OIBA 2DQJH 4PGEB 5CZXC 4NO5B 4FZEH 3VFRA 5EWIH 5CD5C 4HPYH 2HTLD 3P0VL 5T33H 3K8LA 2PUQT 3TH3T 5T3XH 5EOCJ 1DEDA 1QQDB 5ADOH 3ULUD 5GGUB 1DEEB 3NACL 3NH7L 4ZPTB 5J9PB 3MYJB 3B9DA 1KC5L 3MJ9H 2C4XA 2HLAB 2Y9RT 2Z91A 1JZ8A 4IRSC 5L8LB 3AU1B 1ADQL 1HILB 4Y8DC 1M71A 4MNQE 4JJ5A 5D7SL 2W0FA 2VZ3A 1XGTB 4PJ7E 1P2CB 4L8SC 3OX8B 5D7JB 5FO8B 3KJ4B 4E42A 5I75B 4UOW0 2NY2C 3HE7C 1R3IH 3IDIA 3UTQB 1DVFD 1RULH 5DD3L 3FQXA 4PG9A 1LD9A 5FUCE 1IBGH 4U3CA 4ZO6A 3MUY1 3GNMH 1FZOA 4OLZH 5CZKA 4LDOB 2DYPA 4EOWH 1HYSC 4XNMB 1RUKH 1QKZH 1T04B 4Z95H 3O41A 3RGVA 1NCBH 5HVWA 3J7HA 1UZ6F 4GW4A 4KH2A 1MFCH 4MNQB 2Y07H 3IYLW 4JM2B 4X80H 3RTQC 1I9JH 2IANE 5GS1A 4PJ7B 1NCAL 1U8QB 4WJ5B 3FO2B 3MRLA 1NFDE 2KZ1B 2W60A 4L3EE 4LSVH 4D0CB 2XG5A 5IB4B 1HQ4A 3BH8A 1CBVH 5HBBA 3RWEA 4KRNA 5I1GL 2X1OA 3VXQA 3GSXA 4QEGA 1QBMH 3U9UB 4N1HB 4UNTA 4BQCA 3B9KD 4Y2DD 3MLTB 4U1GC 1BX2B 4NN5B 1KB9K 4PGDB 1Q94A 1U3HA 4QOKA 1YEDB 4UDTB 1BZ9B 5J0BA 1UGNA 4JREC 4P23B 1U36A 5F72S 5ALCH 5HHXL 4QT5A 1A2YB 3AB0B 1BVKA 2WK2A 3TN0C 4LSTL 2GSGB 4Y5XC 3I2CH 4A6YB 1D5ZB 3TIDA 3V6ZB 2XPGB 4QRQA 1A6VL 1MELA 3LS5L 5GRVK 5ITBH 4LKXA 4ZAKA 4DAGH 2OI9B 5C6WH 3ARVA 1MFAH 3OMZA 3ARQA 1F6AA 2DL2A 2V5YA 1RVFH 2ADGB 5HGHA 3AC0A 5KS9A 3BUTA 1INQA 4KV5E 1MCWM 4YNYB 5I15H 4Y2OA 5IESH 4JPIB 1OAZL 4OFYA 1E6JH 1KB5A 3REWA 5BVJB 3ARBC 2V9RA 3LDBB 3Q5YA 3MLZH 4JPWL 5I30H 4TVPE 1IC7L 5DHVH 1RJYB 2VZVA 3MLVH 1RIHL 5K9QG 3X3FH 3IXAA 3MR9B 2AGJH 4M1GL 4NN7B 1W72H 2HFGH 2XZAH 3VFSB 2BSRA 2MKWA 5E56A 1PJ9A 3PV6B 4TNVF 4UDUA 1IGFH 5C71A 4YHML 1FH5H 2IALA 1J7VR 2YK1H 2FJGA 15C8H 4FFWD 2X4NB 4UTBH 5C0RH 2Z31C 1DLFL 4G8GD 4LEOB 3QQ9D 2VLJA 5DJZA 4Q6IA 3ZKMD 4X5LA 3O3UN 5HDLA 4F8QA 3HI1B 2H26A 5LBSH 5HHMB 4OFPA 4QXGH 4JPVH 3D0LA 1KFAL 4HWBH 3ZE1F 1GGIL 1LDSA 2DM4A 2HFTA 3D48R 5M94B 2HMIC 4WNQA 1JJUA 1U8OA 2J8HA 4IOFD 1NCWL 2AABL 2NW3A 4QHKJ 4JHBA 4N0RA 1S9YA 4ERSL 5F7MC 4Y1AD 3G5XA 3BRGC 4NNPH 1CGTA 3FRUB 1I7TB 5FYKD 1W72B 2E6QA 3SPVB 2EXYC 1XIWD 1YQVH 1KV3A 2WV3A 4XHJD 3VD9A 4M1DL 3IDYC 3QQ4A 2PO6C 2HT3D 1GZQB 3C6LC 3TYFA 5LGKA 4HIIA 3O9WD 4EZMA 4DGVL 3G9VA 1JYXA 5HPOA 4K8RL 2CRIA 4OLUL 1HZHH 1I9IH 2XFXB 2H41A 1V5JA 5JOEA 2I07B 2AVGA 1AC0A 4YHKL 2CD0A 3QIUA 3WHE0 6FABH 5MEQB 3U30C 5JQHC 3T0EA 5I19H 2R4SL 4PJBB 1U91A 4NZTL 3AM8C 3P9MB 4HGWB 3ULUC 2ZNWA 4OCRH 4HDIA 3MJ6A 1YMHA 4HS3B 4LHUG 2GITB 4MJ5B 5ECJE 5FKPA 4OI7A 1KIPB 4NRYA 4R7NA 2CGRH 1EFXA 1AI1H 1H5BA 1YDPB 4XNZB 3EOAA 5J12C 1P5VA 4F15C 1OP5H 3VXSB 2J88L 3CCHB 4OUUB 2V2WA 3HE6B 3NA4A 1F3RB 2ICCA 5E6ID 1DJSA 1NCUA 3ULSA 4XC3H 1B4RA 3UJTL 4EJ1C 5ACLA 3FOLB 5CINH 4HAFA 4KMTL 3MACL 3SBWC 1WWWX 5SX5K 2QQQA 1GAFL 1BBDL 4GW5A 1IGML 4Y19E 1MCRA 4K3DL 4PJGA 1CCZA 5FA4A 3TP4A 3EFDH 4OLYL 5JHDA 2NXZD 5HVHC 4OLWH 2PXYD 4FQXA 2X4PA 5F9WB 1S3KH 5CIPA 2A1WL 2JTDA 4UUJA 3CVIL 5I2IA 2HG5A 1K4DA 4AEFA 4K7FA 2EICA 1UM5H 5CEZL 2B1HH 4GAGH 3ZT7A 2DKMA 3QDGB 1JHTB 3TV3H 2G75B 5LVEA 2C1OB 1WSST 2C5DC 3NFNB 3X11B 3QEQA 1PKQE 5DJ2A 3LOWA 3UTTE 3U36A 4JKPL 4FXGB 4AEIH 1F02I 2DLHA 1NMCB 3B9KC 4Y2DC 3KYNA 4MD0B 1U8MA 4V1DE 4LL9A 1KJ2A 2JJVA 2AI0H 1FC2D 2CKBH 3F6IA 4KKBD 3T65B 8FABA 5C0AE 3MV11 1LO2L 4G43A 3LN5A 4ONGH 1MNUH 4PJ5E 2H32H 5I9QB 3CVHB 4C83B 3PWNB 3ALXA 2UY7A 4YXKL 3V5DB 1T3FA 1X4ZA 2AK1H 1LEGA 4WFGE 1I75A 4HUVB 3LH2H 5DMGD 1PKQB 1CLZH 2X7LA 2W9EL 4J8RA 5E8PB 3FO1B 1I9EA 1YC8A 1NJ9B 1OD7A 3OF6A 5E08H 3QUZA 1BWMA 3RA7L 4R97C 4V1DB 4LGSB 2HN7A 2HKHL 5GRXG 4OFKA 5C0AB 4PJ5B 1SBBA 3S35L 2GEEA 5EU7C 5GS3A 4XNYL 2G5BB 2GQHA 2DQJL 3K74B 2Z93A 4FZEL 2CMRH 1CXFA 5JXAH 1CG9B 4HPYL 5SWSD 4WU7B 1S9VA 4D94A 3H7BB 5D7KE 5T33L 5GZND 1I3RA 5BS0E 3ARED 2GT9A 2Y36H 1Y6KR 2FWOB 1TCRB 4MAYB 1NAMA 3UX9B 3P40A 4XCYB 5ADOL 1FYTA 4Z76B 1QA9A 4ESKA 1WQVT 3HHRB 3ZHKA 1U95B 4NQDA 2EDDA 2YRPA 5HYSG 3MJ9L 1S7VB 4YBQD 4LHUB 5C0JA 4CU7A 5J1AB 3DPBA 1RJCA 4Z5RB 6CGTA 3DUUB 5E5UB 3QQ9C 4R0LC 2VWEE 1JF6A 1XF5A 4ZNCD 1XCQA 4LQFH 5FK9B 2ZCKH 2B39A 1MJJA 3BKMH 1R3IL 1T7YA 3MJGX 1JWSB 1RULL 4AYFA 1P7KB 5BS0B 5D7JD 1IBGL 3GNML 1FL6A 5D2LF 4EOWL 1GGCH 4F9LA 5J13C 1KUMA 5DS8A 3TBVB 1RUKL 3SKJH 1QKZL 3OAZH 4Z95L 5F1NA 5FGSA 3GMMB 1NCBL 3MOQA 3WUWA 1XIWC 1M6OA 5DRXA 4XHJC 1MFCL 3QNXA 4JFXA 4X80L 4NC1C 1I9JL 1YZZA 3HI6H 1EO5A 4JFZH 5C0EB 4HUMB 2HT3C 5HYIA 5C2BH 1CE6B 1T20B 3BUYB 3O9WC 4IMKA 1ZA3A 1C16A 1JNHB 3BPNB 4MNQD 4JM2D 1P1ZA 4AH2A 4ODTL 5BZWA 1I8KA 1CBVL 1DUYB 2YWZA 3FB7B 3AY4A 2EDRA 3HTLX 5C1MB 3JVGA 3FRPG 1X5GA 4IRJB 2CR6A 3V4UH 1QBML 5EU6E 2WP3T 1QR1B 3SDAA 5BXFA 1J0YA 3OJMB 5IW3A 4HSQA 1KNOB 1WGOA 1LILA 2ED7A 3NCFB 3X3GL 3D0VB 1TZIA 1EFQA 2A9ML 2E27H 2GW5A 3K4DA 5ALCL 1DQJB 2KQMA 4TOYH 1TJIH 3GSNH 4JFEE 1X9QA 2A6DB 1FZKB 5KSVA 5ILTH 4X5WB 3ARDA 3D69B 1CU4H 3I2CL 4YWGH 3MV9A 4P23D 3ZLQC 1AC6A 4OZFH 2IAND 2N7AA 5E6IC 5ITBL 4DAGL 4DUVA 2XTJE 4WHTA 5H2BA 2AXFB 5D1XB 4Y4FB 5HGBB 1ZWIA 4L3ED 1MFAL 4FXKA 1OAKH 1KIRB 1QLRA 1RVFL 3IJHA 3B2VH 4NSKB 5CBAB 2OL3A 1BLNB 2L7UA 5I15L 1CLYH 2YD1A 5IESL 3RHWF 2XQBH 4BQBA 2PXYC 1E6JL 4L8BB 3QDJB 3LRSA 5GS0H 4MXWL 5DD6B 1JRHI 3MLZL 5I30L 1ZA6A 3MLVL 3UZQA 2DWEB 3ILPB 3QNZA 3X3FL 5DMKA 2AGJL 5F6IB 1JCKA 3BP7A 3INUH 5D96C 1W72L 1ETZA 2HFGL 2XZAL 3L5XH 2XTJB 4MJIE 1ZLUK 4LLMB 1AD9B 3P3YA 3RPIA 1NLBH 4X9BA 1FGNH 2CK0H 5HYSB 1JMXA 1IGFL 2BNUB 2N56A 2FECL 1CFQA 1YN6B 4HUKB 1FH5L 2YK1L 1OVZA 15C8L 4UTBL 4C56E 4QO1A 5C0RL 3QEGH 3KPRE 5D2NE 1II4E 5E2VH 4GAYA 5LBSL 1NC2A 4X6CF 4QXGL 4Y5VC 4JPVL 4HWBL 4OV5A 2ERJC 5FHAH 4LDEB 4P2QA 1F8TH 1B0WA 4URTB 1VKXA 1OPGH 1HI6A 5ESQA 1IM9B 3FQUB 1OGTB 1HHGA 3LEVH 3F7PC 1J12A 4KZDH 1A9BB 1QOKA 4GXUM 4MJIB 5DMGC 3PDOB 3N06B 4TVPD 4PRPA 3LQAC 4NNPL 3X17A 1XZ0B 3DURA 2D7NA 5DUPH 4P99A 1U93B 2F54E 5B38A 1YQVL 4JFPA 3TNNA 2YBRA 5F96H 4HIEA 2OR9H 5EC1A 4JG1H 1FPTH 3MFGB 1HZHL 1I9IL 1WIOA 3HZVA 1NKRA 3EOTH 4DGIH 4DOHE 4Q2ZB 1UB6B 5D9SB 2XWTB 6FABL 1QD0A 3RAJH 2YMXH 3BWAB 3WLBB 1TLKA 4NQSA 3KNBB 5I19L 5IHLB 3BP5B 5GZNC 3IDMB 3ZMRA 3AREC 3SE9H 2E3VA 3F7VA 5I1LA 2J7LA 3VD3A 3NCYP 2WBJD 4OCRL 5CGMA 1UWEH 1ORSB 2R9HD 3I3BA 3PWUA 4YBQC 1G7IB 4O51A 2Y6SC 2BY3A 2CGRL 1AGDB 5EUOE 1BFOA 4OD1H 5FUZH 3L7FB 5FM5M 4PV8A 1I4FA 5CSBA 3ROLB 1UWGH 4AY0A 1G1YA 1XGPB 4OCXL 5C0CA 4TUJB 1MHCB 2I26N 5C3LD 4NQEA 4ZYKB 1KB5H 3PNWA 3ULVE 4LPCA 2ZUSA 4QNPE 5DC9B 1S7SB 1XAUA 4G42B 4XC3L 4I4WA 3OR6A 4ENED 3E6FA 4LCCA 1G7JA 3KJ4C 5CINL 5I75C 5DQDH 2LAGB 3U46B 1T7XA 4AG4H 1T1YB 4F7MB 3EFDL 4JRYA 4GRWH 4OLWL 4FMFA 3TCLB 4OBSA 4JPKH 1S3KL 4JKWA 3UTOA 1F6AB 5IJVB 1D5BB 1QSVA 1UM5L 2JIXD 2ZJSH 1T4KB 2EYSB 2B1HL 4GAGL 3TV3L 4JM2C 3T2QA 2LE9A 4JN2B 3CLEH 3CUPA 4JHZA 3LEYH 5E4IA 2BVPA 1KLGB 4AEIL 4WGWB 5FO7A 5GGRA 3UCRA 4PJCA 4TSBH 2DI8A 1Z3GH 4HHAB 2AI0L 4U7KA 1A3LH 5FUCC 2CKBL 4LLWB 4PBXA 3V8OA 4ONGL 1MNUL 4NN5C 3BKJH 4Y19D 3FB5A 4P2OB 4NBZB 2PTTA 3IFPB 1AHWC 1BQSA 4KGLA 4MB4A 4JDVB 4P4RB 1NUDA 3MGTB 4KKCD 5ADPH 4P4KD 2GJZA 3GK8H 5GGQH 2AK1L 3Q6GH 4Q74A 4U1MB 4KTDH 3LH2L 1CLZL 3Q3GA 3TPKA 2GUOA 3IJSB 5E08L 2BVUA 3Q6FA 2K7QA 1S78C 3A67H 4FABL 3UTTD 1FJ1B 1LP9E 2ADFH 4PJIF 2JJTA 2YPVH 4OF8A 2FL5B 3LY6A 3KPNA 4V1DD 2CMRL 3FB8A 2G9HA 4EI6B 5JXAL 1FVCB 3B8YA 4X6DA 5E70A 5C0AD 1INEH 4G9DB 4PJ5D 1K85A 1N8ZA 3FFCB 4F7CA 1RQ5A 2NY5C 2W65A 3MRQB 4LF3A 2Y36L 5E6YA 1SJVA 4X4XB 1QR4A 1D9KB 5B4MD 3WNNA 5BJTA 1GOHA 3L7EA 3R06A 1IE5A 3CMOH 4WFGD 5KOMC 4BZ2H 2FGZA 1AP2A 4WO4C 4G6JH 1PDKA 1V05A 1MRCH 2MPAH 1G7LB 1LP9B 2DICA 5DDHA 4ELKB 2EDEA 3VFNA 5D1QD 5I16B 4J3UA 4NDMA 1X5XA 3A6CL 4LQFL 3CZFB 1HIMH 1FFQA 5IMOA 2V9TA 3CFKA 2ZCKL 5CIPH 1UJ3A 3BKML 2XZCH 5FKPB 2VXVH 3OB0K 4HH9B 3SDCD 1EFXB 2AXJA 5I76A 4M9OA 5I74C 2D7TH 3V8CA 5IROC 3CGTA 5F97E 1GGCL 1INDH 4PRHA 5DRNB 1JF1B 3SKJL 2BC4A 3FKUS 4V2CB 5D7KD 3FO9A 2X4SB 1S7WB 5BS0D 4WWKD 2FH6A 4HFWB 1YYLH 1SYSA 4HFUH 5DTFB 3HI6L 4JFZL 2UYLB 2IFFH 5KAQG 3QWOA 5C2BL 1T83C 3P4OB 1KJ2H 3NCJH 5HHVL 3QA3B 3KPSE 1X5JA 3EBAA 3U0WH 4MCZB 4XBPB 2EC8A 3P77A 3Q1SH 4MX7B 4P2YA 2BVEA 4K7PX 5ERWB 4NQXA 3GMQB 5ITFA 3E2HC 1P7QD 2GTZA 4FQXB 3UTZA 3ISWA 4LAQH 3SGKA 3MLUH 3V4UL 3U2SB 1MCQA 5DEFA 5EA0H 2E7LA 2WBJC 4POZD 2YUVA 3DUSB 1T66D 1P4IL 2R9HC 5IMLB 4XBGA 2NY3B 3U7WH 2QR0B 4J2XA 4KY1H 2E27L 3O4LB 3BQUB 4TOYL 1TJIL 3GSNL 4M9PA 1WC7B 1I1FB 1X5AA 3KPSB 3VGEA 5IFJA 5ILTL 4KQ3H 4YWGL 4ISVA 1CU4L 1HH9A 4F9PC 2R56H 3C5JA 1NDMA 2A74A 4U2YA 3BO8B 4ENEC 2MQCA 3MROA 3N50A 5ACZA 1YEEH 1OAKL 1OF2A 1WZMA 3ROOB 1EEZB 3B2VL 4M5ZH 4PS4H 1L0YA 1NAMH 4OIIL 2FCBA 2FIRT 5BOPA 5D1XD 3FONA 1CLYL 3LEXB 5EU6D 2XQBL 2ZG2A 4QKXB 2X44D 1SYVB 2AK4A 5GSRA 5IMKA 2IMNA 5GS0L 2FYYB 2I9LA 3P73A 2EDHA 4Y5YC 2ITCA 4CVXA 1FGVH 2XKNB 4J1UB 5I1KH 2X89D 1UQSB 4LARH 1E6OH 3OKLA 5TH2B 3INUL 4JFED 3L5XL 2EIEA 1OAQH 3IJYA 5E9DB 3RVTD 1H3UA 1KULA 1NLBL 2CK0L 4Y4KD 4RNRB 3GMPB 3GSOB 5KSAD 3WEXB 3RL1B 4OCLC 3W81A 1BHGA 4DK3A 4EIGB 2XTJD 4JZOB 1ZHLB 3VFUB 3B5GA 4UQ3A 5BQ7B 4PRNA 4R2GB 3QEGL 4OZHE 2C26A 3DROA 4I1NB 2ICWA 4MNGA 5HYEA 5JORA 2WWKO 2QLVB 4RGNB 4U31A 4KI5F 1KACB 3C09B 4M7KH 5FHAL 5C0JB 1F8TL 3NOIA 2IG2H 1G6RA 5HDOA 4KKCC 3IDGB 4P4KC 1S7RA 1C5DB 2IWGA 4PJEE 3LEVL 3AXLA 4KZDL 5EIVA 3NCMA 1NMAL 3NPSB 3EHBD 5J4MA 2JK5A 4BA8A 5DUPL 1ZT7B 2J4WH 3MRJB 3PV7A 1DANU 2WINB 5IB2A 1RK1B 4MJID 1EBPA 5F96L 1CFNA 3KLHD 2W9DH 1DR9A 2OR9L 4JG1L 4L1HA 1NFKA 1IKNC 4LCIH 4RBPH 1FPTL 1U8IA 3AAZB 4MQ7A 4XRCB 4K7PH 3BP6B 1GOGA 1HXYB 2VDLH 2ZOKB 3EOTL 4F57H 2I5YH 4UZGA 4P5MA 4C56D 3RAJL 2YMXL 3MRMA 1BIHA 2XZQH 3WS3B 4D3CH 1RZ8A 1QPPA 3VXPA 3SE9L 4J4PC 4HIHA 5F71A 4HBQA 1AGCB 5B4MC 1Q9LB 4X6FA 1UWEL 1LE5A 4XVJH 1DP0A 5IK3A 2XA8H 1I1AB 2YPLE 4PR5B 4PJXA 1BVZA 1A6UH 1BM3H 4EI5D 4ZD3H 4OD1L 5FUZL 2OL3H 4MDJA 3NBNA 4CADB 1UWGL 2F54D 2PCPA 3DUHA 5D1QC 1QFWM 3CDGA 1KB5L 4JLRA 1KB9J 3TVMD 2FX8H 3SDCC 4OLEA 5EIIB 1WBXB 5JLZA 5DQDL 1ROWA 3UC0H 4I2XE 5F1IA 4AG4L 3QUXC 4OTXH 3R1GH 2YSSA 4OCNC 4WW2F 4FA8A 4Z8FH 5LAXA 4Z18A 4WWKC 4JPKL 2YPLB 3SCMB 1WIPA 4YXLH 3T3PE 1NKOA 2A77H 5ANMB 4AIOA 2V9QA 1TFHA 4WI6A 1YEGH 1NPUA 3T8XB 3H2WA 2IGFH 1QLRB 5JMOC 1E27A 1K9TA 2F8XC 1SEBA 2ZJSL 3M8OH 3C2SA 3PWPA 4W81A 3CLEL 1HOCA 3MTRA 4MHHG 4U0RB 3LEYL 4WGVB 1U92B 4ZNEE 4FQHA 2VWEC 3UBXI 3UO1H 3LPGA 4KI1A 3DX7B 4PJFE 3BPNC 3F7YB 3DI3B 1J0KA 3ULVD 5F1OB 2DB8A 3SDXA 1SQ2N 1Z5LA 4I2XB 4POZC 1S5IH 4TSBL 2NNAB 3OHXA 5E7FA 1Z3GL 1QEWA 5T3XE 3EJJX 1A3LL 1PLGH 4K71C 4LKCB 1QRKA 5BW7A 3DX8A 5IR1A 3NA9H 4TULH 3P4LA 3BKJL 3UYRH 1A02N 5D5ME 1RHFA 1A8JH 2R0WH 1UVQB 4XI5C 3SKMA 4GLRH 5F7DA 5IVXA 1PYWA 4TN9A 5ADPL 3GK8L 1G7HA 5GGQL 4P2OD 3Q6GL 4YEEA 4KTDL 2MJWA 3WN5B 3UTPE 4NQTA 2F8VA 4HXBH 1OAXL 2VE6B 3TH2T 3MRIA 4X8JB 3C6SB 4OZGB 5CILH 3ZYJA 1JYWA 1A9EB 4YIQB 2XN9B 2D7OA 2OCFD 4U1HB 3A67L 1ZLWH 1KEGL 4PYGA 2CLVB 5D1XC 3T77B 2ADFL 1ITCA 5T5FH 4PJDF 1BJ1H 5C0BE 5DVKA 2YPVL 3NMEA 3B5TA 2AW2A 1J0ZA 5I8CB 4NHUB 2V2TB 2DKUA 3GSRA 1INEL 1I3GH 4KJYA 1V3LA 4QRRE 1NBVH 5MERA 1G9EA 4ZFGH 3AS3A 3QO0B 3DGCR 5L2JB 3RVTC 1Q72H 1ZLVK 4YHIB 4Y4KC 1A6AA 4OFIA 5KSAC 4KMQA 4BZ2L 2VL5B 3O2WH 2M2DA 5F6IC 4ZDHA 1A1OA 2QTEA 4IOIA 4F7EA 4G6JL 1J8HA 1MIEH 2XTJC 1UB5B 1MRCL 2MPAL 4XXDA 2YEZA 3WIHH 1H0DB 2BY0A 4NBYB 4KXZI 3C2AH 4GH7B 3GZKA 3T4AA 2OJZH 5HDQH 5FIEA 5IIEB 1FL3B 1G9NL 3T04D 2F53E 1J88A 1N3NB 1C5CH 2XZCL 3LQMA 2R1YB 4XNQA 5SWZA 1T2QH 2VXVL 1F6LL 2P5EE 4JZJA 2D7TL 3GM0A 5A1AA 4PV8B 4DCQB 5DSCA 2Z4QB 1INDL 3EHBC 1MCJA 5L2KA 3QXVA 1RZJC 2Q76B 1N59B 3I84A 2H2PD 3OKNA 1ZT1A 1YYLL 3SJVB 1N6QL 4W4OC 2CUMA 3KLHC 4HFUL 3C8KB 3UTSA 1X6NA 2IFFL 3KPQA 4X6BA 4NT6B 5J7CC 4Z7WF 5TDNB 1KJ2L 3NCJL 3RWGB 4ZPVB 4DFHA 3U0WL 3Q1SL 3IU4H 3MRRB 5E00A 3TLRA 1TNMA 2X09A 3L95A 5D2NC 5TF1H 1W0VB 4XZUA 3MLUL 5I17A 2AKRB 3RVXD 4XXCC 4IHOB 4LHQB 5E7BA 5EA0L 4LEXH 3X12B 4U1SA 3QULB 4AT6B 1K8IB 4GKSA 1ED3A 4WTZA 1HSBA 5F9AC 1F11B 4K94C 5F9OH 4CAGA 1CFSB 1C08A 3PGDB 4YK4B 4KY1L 5C7XH 4QTHA 4EI5C 5D7LA 5C08B 4I18A 3IAQA 4ETQA 4X99B 2JE8A 3BOVA 4KQ3L 3BZ4A 2NY3D 3S5LA 5GIRA 1RZFH 2R56L 4JO3H 3TVMC 1DUZB 3OAUH 3OGCB 2E9IA 3VI3E 5DD0H 1Y6NR 2GFBA 3MRFB 2X4QA 1A22B 3KPSD 4ODHH 4E41E 4BH8B 1QFHA 1YEEL 4PGBA 3FB5B 3OZ9H 3P9WB 1RPQA 5TQ0H 4JY6B 4U6TA 3IDNB 4PY7A 4M5ZL 4PS4L 1ND0A 1NAML 1V3MA 1XGYL 2VIRA 1X4XA 4GOSA 3L3KB 3RY5A 1S7QA 3VU2A 3VXRB 5B8CC 3QDME 2GY5A 3VMNA 1T21B 3G04B 3IF1A 2GUOB 1WZKA 4YGVA 2EDQA 2FIKB 4NZJA 3UP1A 2SEBB 4JFDA 3QHZH 3NTCH 3LSOA 3ZKXB 1FGVL 3VGGA 3K1KC 4LARL 1E6OL 3HMXA 3VXUA 12E8H 1OAQL 5I73B 4RIRB 4HQQH 4E41B 3KPLB 5D70H 4K23H 1G7PB 1MQ8A 1G84A 4C57C 3T1FB 2CPCA 3S9DB 4RMWA 2V7HA 4UQ2B 1I1YB 5C3TA 3UEZA 2M1KA 4NKQB 5TDPA 3O8XB 1FLRH 2XNAB 4WEBH 1EEUA 2ILLA 5EULV 1UFUA 2EO1A 4PB0H 4R2GD 2VDRH 4M7KL 1KXQE 2LABA 5JO5A 2IG2L 1BIIB 3WIFB 1BFVH 4FTVA 3CC5A 4YJZL 2X5PA 3MRKA 4IMLB 4KRPD 3S98A 3L3JB 4WW1A 4HBCH 4P2OC 3VFWB 4JJHA 5B3JF 3FOMA 3KPPB 1AO7E 2OSLA 5E95B 4KJWD 3D25B 1J0HA 1GSMA 2HFEA 3DTXA 3MNVB 3TA3A 5CP3A 1JV5B 2L0DA 3MBXH 5D8JH 4LPWA 4NBXB 1EAJA 3ET9F 5H94B 3GMOA 2W9DL 1QSEA 1A4KB 1RD6A 3VW3H 3FCTB 4LCIL 4JRXB 1DQQB 1RZGA 2PYEB 2XWJA 3VI4E 3HPJA 4K7PL 5EFIB 2GTWA 2VDLL 1HHKA 2I5YL 3HPLB 5HVGB 3VMPA 3FO9B 4PBVC 2XZQL 1QHOA 5DF0A 3W0WE 3QBTB 4D3CL 1I8IA 5MI0C 1KGCE 4JFQB 1ZAGA 1ZS8B 3PWLA 3MV7A 3RKPA 4FMKA 3QI9C 1MHHA 3JTTA 3MO1B 1YEHH 4QCIB 4XVJL 4ZUVB 1MCHA 1G0DA 3ARTA 3M1BB 4PJ9A 2XA8L 4U05A 3DO7B 4X7EC 3GJEB 1RZKC 3LPFA 1N0LA 1A6UL 1BM3L 4OJFL 4ZD3L 4E5XB 3WL9B 2YD5A 4L3CA 3WE6A 4RAVA 4NYLB 3MSPA 2C3WA 2ZG1A 2C3XA 4X5XA 4LMQE 2BVOA 3G5VA 5HYJA 2BJMH 5KOVC 2DOCA 1BVLA 1XR9A 2FX8L 1X5KA 1X5IA 5IW6B 4RA0C 4W4NA 2X1PA 1H3XA 1FC1A 3VG0H 4H0GA 5DZOA 1U2CA 1WCBA 5KTEH 5HJ3A 3UC0L 4P46A 3WFCH 3NIFE 4NKMB 4OTXL 3MRPB 3R1GL 1KPRB 4Z8FL 1GRWA 2OZ4A 2XWBB 1CDCA 4LVEA 4J3WA 4LAJH 5I6XB 5I1AA 4QRPA 4XH2A 5ETUA 2X2YA 3OXSB 4AJ0A 4YXLL 3DGGB 1NGYB 1PZ5A 2H8PA 1EXUB 4NO2B 1YEGL 1V7NH 5IKCB 3KLDA 2IGFL 1PW3A 4Z7QF 5T1MA 3M8OL 3X13A 5GRWA 3QO1B 2YPLD 4WUUA 5F8RC 4CMHB 2MHAA 4M7ZB 3O45B 4HEPG 3CNKA 1L9MA 3UO1L 2HVJA 3MNZB 5ABDE 1G6RH 5D7IE 3RVXC 2H6PA 3C87A 4GRLB 5HGDA 1S5IL 3KXFE 4NQVA 4DEPC 1YPZE 4PJBF 3VFPB 1PLGL 4XGZB 3OKLB 3BIKA 3AMLA 1ZMYA 2GAZB 3NA9L 4TULL 3UYRL 1K5NA 2R0WL 5EIQA 1IGCH 3GUTA 2NY4C 4X9IA 3E6HB 4BH7A 4GBXD 4UAOB 3QEUA 5L6YH 4ODXB 2JCCE 4HMDA 4G3YH 2EEAA 3OKKA 3GMNB 5ESVA 4N1EA 1NGWB 3PL6A 4HXBL 3RWJB 1MFBH 1YN7A 3MX0A 4W6WB 4WWID 5CILL 4Z0XA 1YY8A 2RBLA 1KBGH 2NX5A 5EB9A 2IFGA 5FGBC 5T5FL 2UY6A 5FB8A 4PRDB 5EORH 1GC1C 4ZFFB 4P5TA 3ZTJH 43CAA 5JDSA 1DQDL 4ORZC 5T3XD 1ONQA 2BHUA 1CI5A 1F4XH 1I3GL 1NBVL 4ZFGL 1T22B 1Q72L 1OP5K 3G08B 1GL4B 5EPMB 3O2WL 2AEIT 3CSYA 4PLJD 3V6FB 3D2UA 3UTPD 3PDGA 1MIEL 1FZJA 2HH0H 5CZVH 3QQ3B 2OR7A 3WIHL 4KVCH 3DI2B 3C2AL 2OJZL 5HDQL 1QLFA 5FA3B 5F3HA 4NKDA 3T3ME 1CVSC 3RUGF 1C5CL 4OZIE 1Q1JH 4R2GC 1XGRB 3ZE0F 3HG1A 1TVHA 3U6RB 3ZE2E 1ZVHA 1T2QL 1OLZA 3BPOC 1IGTB 4XHQA 3ECBB 3HUJE 4KRPC 2NPLX 2EDNA 3C09C 4AK1A 4N0UE 4F2MB 3CDGB 3OKOA 4LVOB 4KJWC 3DVNB 4QRRD 3KWWB 4LIQH 3CFCH 4BSWB 4OGAC 1DANT 5LCVH 1BEYH 4Z77A 1UKTA 1JUFA 4LSPH 4KRLB 3STZB 4FQJH 4DZ8B 1UACH 2RAMA 3BPLB 3IFOB 3QISA 3Q5TA 4BKLB 3FT2B 3IU4L 5CJXC 5T1LD 4OZIB 4S2SB 3EYVA 1I85A 1FV1A 1FIEA 3EOBB 2J6EA 5TF1L 2F53D 3RTQA 1QRNE 1T1WA 2X1WL 4LPTA 5EZJA 1WWCA 2OTWA 3OR7A 3DARA 4P3DA 4PRIA 5ISZE 4LEXL 1T0NB 4EXPX 3MJ7B 4N0UB 3L3IB 2F58L 4XP9H 5E2UH 3RZCB 4PV9B 1XGQA 3G6AB 2P5ED 5KSBB 1TVDA 5F9OL 2BVQB 5DEGB 2P24A 4HEME 4R96B 5IM7A 5J6GA 1B3JA 1YJDH 3R8BB 5E2TH 1H15B 2GSIB 1R3HA 2VLKB 3OBAA 3RWDB 4MXVE 1REIA 4S11A 1RZFL 1QEWB 4JO3L 3OAUL 5DD0L 3PGCB 1RV6X 5DJAB 1B0GA 1QRNB 3H7LA 4ODHL 3GSUA 4OM1H 2AP2A 4Q58C 5AUMA 3DECA 2D7PA 1HHIB 5ISZB 3OZ9L 3DRQB 4OB5H 5TQ0L 3LKOB 3TN0A 1BJ8A 3S4SG 4W6YB 1JPSH 4PUBH 4E0RA 5EOQH 1N64H 4X4YB 3QUYB 4WTXA 2HT2D 5HHQB 5IV2A 2UWEA 3MCKA 3T0AA 2VUOA 2ZCHH 3NIGF 2NCMA 4QHNB 1CDHA 5EOTB 1ZV5A 2YN3A 2L7JA 5JW4Q 3QHZL 3NTCL 1XH3B 2FECI 2FJHA 1FIGH 1LO5B 4JN1H 5EC2B 3CFBA 1CFBA 1AQDB 4QOKE 1IAOB 1MUJB 12E8L 1YEFH 3NN8A 4HQQL 4R4BA 3EDDA 5D70L 1OSZA 1MVUB 4MCYB 3UROR 5DVMA 4M6NH 1M7IB 4NCC1 3MV8A 3B3IA 3OJDB 1FG9C 5EBGA 3W9DA 4E41D 3ZL4H 1B90A 3FQTB 5IB3A 3ETBF 3R0MA 1FNHA 5MERB 4ZOAA 4AMKH 1JWUA 5KSUB 2MCPH 2EO9A 1KCSH 2Y5TB 3RVVC 1FLRL 1JE6A 4WEBL 2VLRB 3OAZK 5HDBE 3T08A 2P47B 2VDRL 1LK2B 4AQ1B 3QDMD 2YD9A 1BFVL 2QQLH 3ES6A 5HPMB 5KS9E 4GBXC 4XTRD 4HBCL 4XCCH 2AV1B 3DNKA 3IETB 4ZUUB 4CL7A 5H37G 4QHMA 4Q0XH 4B53A 5DGQA 4EUPA 1OGAA 2ZOLA 1WLHA 2MSPA 1N6UA 1CQKA 2H9GA 2VQ1B 3MBXL 5D8JL 4EDXB 3WN5C 4CKVX 4WFEE 1JRHH 1QSFB 4LPVA 1YECH 1HXMB 3O3EB 3P9LA 5CJOH 3VW3L 4NGHH 3HZMB 3DXAA 1JPGB 4F33A 3C5ZB 4O2FA 1KELH 4GRWE 4XMPH 1KYOK 5CEXB 3B83A 2ZUYA 1T5WA 4ONFH 4K9EC 2GJ6A 4ELME 2CLRA 3KS0H 3VXOA 5MEOA 3G6JA 5BO1H 4BSVB 1L4IA 3C6LA 3UTSB 3BP4B 1QO3A 1CICA 4KROC 4Z7VF 2R1XB 3T0VA 5A40E 2JKXA 2R1WB 4IIQC 4TYUA 3H0TA 3DV4B 4WY7H 1YEHL 5EDXA 2VXTH 3PWJB 1DL7L 4PLJC 5HXMA 2IPUG 5L7XH 1AO7D 2DD8H 3UBXA 2UZIH 3MNWB 3QZWG 4HKXA 5IBTH 3TO2B 3AM8A 2V2XA 3VH8A 2GK0B 3CFEA 3QIBD 3WIIH 2ZUQB 4EN3D 2BJML 4NZRH 1MF2H 2PR4H 3LKSB 1TNNA 3ABZA 3BZEA 2ZUUA 3GJFB 3N1QC 3VG0L 2FLBT 4YHYB 3UMTA 5HD8C 3KPMA 5KTEL 2AJZB 2YKLH 4X7TA 3S4SB 1TVBB 3WFCL 5DI8A 3HMXH 3W0WD 3EYFB 1KPUA 1KGCD 4EVNB 5GIRB 4HS6B 1D5XA 1OP3H 1HSAB 1MJ8H 4ZQKB 5BV7B 1HEZB 1DVFA 1QP1A 1U8PA 2A6JB 2PTVA 3T0EE 5CUSH 3FHAA 1V7NL 3CU1A 1I3VA 3KLAB 3TZVB 5HHOB 1PY9A 5IHUH 4XP1H 3QWRA 5IHZA 4MB5A 5FFLA 1J11A 2X9XA 4OKVA 1OB1B 2KBGA 3MFFA 3GBNH 1H3PL 1G6RL 1WZ1H 2X4TA 5TE4L 4LCYA 1WISA 2ATKA 3PHQA 5FYJE 2DTMH 3PF2A 4PREB 4X0KB 4MA8H 4JQVC 1S7TA 4JY4B 3I75B 1F4WH 3SO3C 2R2EA 3PIQA 3RNKB 3NZ8B 4GRLD 3ZT5A 4I0PB 3V5KB 4KDTC 3BGFB 3E8UH 5J06A 1IGCL 2FATH 3B9KA 1I7UB 3JV6A 1JGEA 1A5FH 2DIJA 2CDFB 3S88H 5L6YL 5CKAA 4KZEH 4PJGE 1MHEB 1IL1A 5JHDE 4G3YL 2P8LA 1E4JA 4DN4H 5TDOB 5F7NC 2BDNH 5TDPB 1IKFH 5DR5H 5E8NB 1MFBL 4L9LA 1JPST 4GKNA 5F1SA 3TIEB 2ZUWA 4FFVD 2BRQA 3WKNA 5JA9A 1RUAH 5DRWA 2HT2C 5EORL 3ARFB 3DHJA 3EO0A 3KXFD 1TTFA 3QEQE 4LVNC 4O2EB 5F89B 1HH6A 3ILQD 4LLUA 4JAMB 3TBYB 1ES0B 2HFEB 1JZ5A 3RP1A 4R26H 1F4XL 3OKEA 2XZZA 3LPWA 3GSQB 1F97A 5D72H 4MDIA 1K4CA 1HHKB 5DLMH 3O6MH 5E5MA 2IADA 2HRLA 4HK0A 2HH0L 3ARGD 4ZG1A 5CZVL 5I73C 4JZNA 5K59E 1R5VA 1JPFA 4KVCL 2DWDB 1M7DA 4PGCA 4X9HA 3QZWB 2GYSA 3WLWD 2OZ4H 1VFAB 5IB1A 2D2OA 2EYTB 4APQB 1YNLH 1XF4A 3HB3D 3K8KA 4U1JB 4Z9KB 1YNTB 1Q1JL 1MIMH 1T1ZA 2XQYK 4M03A 1ZHNA 5DVNA 3L5HA 4D8PA 2X4OB 4MJ6A 4XTRC 4HJGA 2NTSP 5B39G 4KUCF 5A16B 4PJHB 4X5XB 1CD9B 4Y8AA 4LIQL 4Y4HB 4IS6A 3CFCL 1FDLH 1AIFA 2VSCA 5DYOA 3I9GH 1WFOA 4JM4H 1M05A 5LCVL 1BEYL 4WVRA 3T0XA 4U6XB 3J8F7 1VADA 4FQJL 4C4KT 1QYGH 1UACL 2WAHA 3B9VA 3U1SH 4Y1AA 1FYTE 1NGXB 1U8NA 2ZZUT 1FO0B 4NIKB 4WW2A 5DJ8B 4PG2C 4NO3A 4F7TA 1AKJB 4FN0A 3LS4H 4PLOB 5CEYA 5J57B 2V5RA 3WJLA 3GM8A 1SBSH 2PKDA 4UU9B 4HWEH 4L8DB 4XP9L 1W8NA 2PF6A 1UG9A 5E2UL 5J11C 5FYLH 3QIWB 2CO6B 4LASH 4UB0H 1MJ7H 3L3HB 2VDKH 1Q9KB 5IGXH 5M95B 4BQ8A 1I8MB 1M7XA 3RZCD 4UILH 1EMTH 2FLRT 1U8JB 4PRAB 1YJDL 1SJHA 1VACA 1R5IA 5E2TL 1T7ZA 5KVMC 3OL2A 1K8DA 1FFPB 3QIBC 1VEOA 4X83A 2F74B 5C09A 4EN3C 3RU8H 3QYCA 1A6TB 4NUJA 1DCLA 4OM1L 3DHMA 4I5BA 1YC7A 4WV1B 1C7SA 3D85B 1AGFA 4OB5L 3HR5A 3S3PA 3VRJB 1P6FA 3T2PA 4ALAH 1JPSL 3H9SE 4PUBL 3VFVB 1QRND 3CH1B 4ZO9A 3WXWH 4BH7B 5GS0D 4R7DA 1N64L 5E6IA 5ISZD 3MRCB 4UIMB 5DQJB 4NC2B 4PRBB 3PHSA 2ZCHL 3BISA 2R15A 4UOW1 1MCOH 1KTDB 1V8HA 1UEMA 4KUZH 2ARJQ 4HS8H 4HWZA 4ZUTB 3L9RB 2XKUA 1FIGL 4HV8A 4JN1L 3DSNA 4I48B 5T1KB 1R3JB 3HRZA 1ZGLP 5AG9A 1YEFL 3U4EA 3WO4C 4GKZB 1HHJB 4P2RE 2DYPD 1XT5A 4P5TB 1V3KA 4CMHC 4ZFOB 1TETH 3JTSB 4M6NL 4WDIA 3QWQB 5EU3B 2Z92A 3UPAA 3IAGC 3H9SB 1WBZA 1EZVY 5INCB 5EO9B 1A6ZB 4OLVL 3ZL4L 2IPUK 4Q7DA 1KF9B 3WFDH 3MV9E 3QSKB 3FT3B 1TZHA 3HS0B 2KH2B 1T03H 1E4XH 4AMKL 4GRLC 4RFEB 1EUTA 2MCPL 5E8EB 4ZUSA 3K80A 3BKYH 3B6SB 5C07A 3ZDXE 2BY1A 5EO0A 4YPGA 4LCUA 5LGJB 5IVZA 4K55A 2QQLL 5GRUL 2VB5A 5FYKU 1F3DJ 4GUPA 4XCCL 5B39B 3QNYB 4V2BA 3GMRB 1IEBB 3MRBB 4Q0XL 1ZVSA 4P2RB 2J6EH 3G5YB 3O3BA 3D39A 4Y5VA 2J8UA 4M1CD 1U3HD 4QOKD 4MNHB 4IRSB 4FFVC 4YO0A 1YECL 3V79C 1T2JA 5CJOL 4NGHL 3QFJA 4PTUA 4BUHA 4L8SB 1KELL 4XMPL 3ILQC 2XXCB 3D6GA 5GISH 5FO9A 2NY2B 3DRTB 3ZHLA 3HE7B 4ZAKD 3C5ZD 1CXIA 1FVDB 5BO1L 4RISH 4MQTB 3RVWD 1U58A 1IEAB 4Z7WA 5BRZE 4PY8J 1VB9A 1S9WA 3HC4H 1M1SA 5DUMH 1NBYA 2Q7YB 2VXTL 1CIUA 3MBEA 2A83A 1KSRA 3NGBC 3S6CA 5L7XL 2DLFL 1YUHA 2IBZY 2DD8L 3ARGC 5SWSA 3BHBA 2UZIL 2HYMA 4PGEA 2ZWLT 2CXGA 4NO5A 5IBTL 3WLWC 5AD0B 3FQNB 4PRPE 4WFED 3HB3C 5FOJA 3WIIL 4NZRL 3DX9B 1AGEB 2A9NH 1MF2L 2PR4L 1QQDA 2EKSB 5GGUA 1DEEA 1PD6A 4ZPTA 1UJTA 5I1CH 3MYJA 3CDFA 2CK2A 2HLAA 5BRZB 1CGWA 3AU1A 4U1GB 1HILA 3HMXL 3RNQB 3AS2A 1XGTA 1UZ8B 1L7TH 2OBGA 1EDQA 1MJ8L 4MD5B 1P2CA 3OX8A 2VYRE 4IJ3C 4JREB 4D0DB 5CUSL 2H1PH 4LVOC 5D7JA 5FO8A 4L29B 1OL0A 2Z0BA 3TN0B 5CCKH 3LV3B 1IC5H 3VXMB 5IHUL 4XP1L 5KAQF 4E0RB 4Y5XB 3UTQA 3ARRA 4PJ8D 4LLYB 4XCEB 2ZUTA 3PABB 5DUBB 1MI5B 5AZEH 5HHOD 3GBNL 1X5ZA 2UWEB 1TMCB 2IH1B 4XNMA 1WZ1L 2WIIB 1T04A 5CBEB 4OF0A 3TNMB 2DTML 5C0CE 1P84K 4AEEA 5GHWH 4MA8L 4MNQA 4JM2A 4S10A 4NQEE 2BOCB 3V0WH 4DQOH 4ONHB 4EUPH 1F4WL 4PJ7A 1U8QA 2DJSA 4WJ5A 3FO2A 4Y88A 3RZCC 3ARBB 5D6CB 3E8UL 4D0CA 5IB4A 2FATL 3WHE1 4M61B 1OM3H 3S88L 1FQ9C 4KZEL 4I0PD 3T0ED 3TO4B 3U9UA 4JEGB 4RBPK 2V7NB 3UPCA 3WDHA 4DN4L 4DZBB 2BDNL 3MLTA 1BX2A 5DR5L 2Q3AA 4PGDA 32C2B 2X4UB 5BVPH 1GZPB 4M00A 3DX6B 1F6FB 1YEDA 5J8OA 3BD3A 3OXRB 4UDTA 1BZ9A 3SKOB 5E2WH 4GRMB 5GS0C 1TCMA 4Z0BH 5IMMB 1RUAL 4P23A 1HDMB 3B8SA 2Z31B 1A2YA 5FYJD 4XVTH 3FQRB 4EUPB 2GSGA 4LU5H 4A6YA 1D5ZA 4U2ZA 3V6ZA 4FP8H 4R26L 2XPGA 4PJCE 2W0PA 4QWWD 1KXVC 1RJLB 4KJPD 3ULUH 3RY4A 2V17H 5D93C 2VZ1A 4BQ9A 5TJWK 2ADGA 3VXTB 3JWOH 5D72L 2XY1A 1IM3B 2P49B 1EJ6A 3C9NB 4IOSD 5DLML 3O6ML 4YNYA 5JHDD 3RGVC 4JPIA 1RFDH 5INDB 2FX9H 3WD5H 5BVJA 3IDYB 5MHSE 2PO6B 1NC4B 2OZ4L 1MCPH 2CUHA 1NSNH 5GS1C 5LXGH 1YNLL 1E0OB 1RJYA 4WFFE 4B7IA 3MZGB 1MIML 3MR9A 4FQLL 1R24B 5IUSA 4APQD 3VFSA 1GCFA 3QEQD 4KK8D 1G6VK 4OGZA 3ZHDA 1HKLH 3PV6A 4MD4B 3HLAB 2CSPA 2WUCH 3O4OC 5BOZG 4GG8B 3QUMB 3W5MA 2X4NA 1FDLL 1PSKH 1U3HC 4M1CC 2FBJH 3I9GL 3OG4B 4JM4L 1BD2E 4LEOA 5AAWA 5HYQB 4NJ9H 4X6DE 5IBLD 1CR9H 3HI1A 4QXWA 5IROA 1QYGL 3ZDYE 5J12B 3U1SL 3LB6C 5E1AB 1NUNB 5IOPB 1U42A 4JFFE 4NO0B 1JIBA 4HCRA 1M4KA 2G60H 4YR6B 4ZAKC 4U33A 1SBSL 3C5ZC 4Z7NE 2VOTA 3FRUA 1I7TA 4HWEL 2OLDA 3RVWC 3OF6D 1W72A 4C4KO 3SPVA 3QUZD 3CJJA 2N7BA 1ZSDB 2YPKB 3CXHK 5FYLL 4BFGA 4LASL 5E2JA 2HRPH 1RI8A 1GZQA 4UB0L 1MJ7L 2YD2A 1T1XB 2VDKL 5HVHB 1BD2B 5IGXL 5IHZB 4XNUH 1QVOB 2EIZB 2Q6WB 3JV4B 2XFXA 4KTEH 5EN2B 1EMTL 4HKJB 3VRIB 3QIWD 4O02H 1EIBA 2Y7QB 3B5HA 2YXFA 5MEQA 2Z8WC 3WCYA 4PBWD 4L4JA 3MREB 4CVZB 4P9HC 3AS1A 4ZFOL 4JFFB 4PJBA 1PX3A 3L3GB 3P9MA 4HGWA 3MOBL 4NJAH 1FYTD 1A6PA 4HS3A 4MJ5A 2GITA 1KIPA 4ALAL 4Y2DB 3V5HB 3WXWL 1FN4B 1QHPA 1J10A 5I1GH 1YDPA 4RX4D 5C0ND 2DLIA 3RIFF 4G6FD 1MCIA 4Q6IC 1FYHB 1CDGA 1CS6A 1IZJA 5FKAB 4J12A 3VXSA 5GXBB 2QL1A 3VDCA 4OUUA 3HE6A 3L5WB 4RDQG 4HS8L 1MJUH 3SY0B 4WHCA 4PJ8C 1N4XH 3H9HB 2AV7B 4H8WH 1N5AB 3FOLA 1TETL 5I18H 1NL0H 4WU5B 4R3SB 1A6VH 5LGHH 4O9HH 3STLB 1SY6A 3TBWB 3WFDL 3UAJD 1FL5B 2LU3A 1T03L 1E4XL 1EAPB 2ID5A 4TTDD 2AEQH 4CJ1A 3N0PB 2Y06H 3H9SD 1PKOA 3BKYL 2H3NB 3QDGA 1JHTA 2ZG3A 2D9QB 2IADB 2G75A 2QSQA 3EZ8A 1FNLA 2C1OA 4HW6A 3KLSA 2E9BA 3NFNA 3X11A 4I0PC 4YAQB 4YDVB 3T0EC 2DLTA 4FXGA 1JTOA 3BGFC 5F6HI 5I1EH 5FYKH 1BECA 2AK4E 2J6EL 5GGSY 3K4ZA 4MD0A 4QHLB 1RIHH 3O2VH 3T65A 2JJWA 4P2RD 2Z8SA 5I1DB 1H5BC 3CVHA 1WVZA 4C83A 4G8GB 2F19L 4R0LB 3PWNA 4DFIA 4YHMH 4XX1E 3K1DA 2DTSA 3MODH 2VR5A 3V5DA 3MV9D 3QCUH 2EC9U 5GISL 4PJAB 3GMLB 5DYOB 4HUVA 4LBEB 1PKQA 3UTTA 5E8PA 3FO1A 4KJPC 4RISL 4PYHA 5D4QA 1NJ9A 4L4VE 4XPGH 4UV7L 3JV5A 1P9MA 4MNGE 3FT4B 3HC4L 2BMKB 3CSPA 4KJQD 5DUML 5J13B 4V1DA 3P4MB 3PP3H 3KPTA 4MA3B 2JJSA 1YEKH 2Z8RA 1F4YH 1XIWB 5C0AA 4PJ5A 3M17A 4CN6A 3LD8C 1HYSD 1T5XB 3GBLA 3FB6B 3SGJC 3O9WB 4GG6B 1GPOH 3QEHB 1CE1H 1CF8H 1CG9A 2PW1B 4WU7A 1Z2KA 3H7BA 4I3SL 2A9NL 4YPJA 3H3PH 4DKFH 4GW1B 5FV1L 1GXEA 2FWOA 1TCRA 3IKCB 4MAYA 5J1SC 4XCYA 4APQC 4Z76A 3JZ7A 4KK8C 1U95A 4G6AD 4L4VB 1S7VA 4LHUA 1MCSA 4M6AA 5J1AA 1VESA 2MCG1 4Z5RA 3DUUA 3E0GA 3B4NA 1Z9SA 1L7TL 2VTFA 3FHQA 4U7SA 5BRZD 5IEHB 5IBLC 4JR9H 5F3BB 1UZ6E 4N0YH 3JUYA 2H1PL 1H3WM 5FK9A 1NC2D 4LDLB 5K9OB 4P59H 5CCKL 1HHHB 3RY6C 1IC5L 4HG4K 1JWSA 1P7KA 5BS0A 1FORH 1TJGH 1IC4H 2WM0A 5E6IB 4GXUN 1IRAY 1GGUA 4IDLA 4Z7UB 5AZEL 5CJBA 4PRPD 1ZEAH 3TBVA 2ESVE 3GMMA 1UXSB 1FBIH 3QUZC 1FVEB 4JVUA 5GHWL 2R23B 3V0WL 3QCVH 3GSVB 4DQOL 1J0IA 4GLRI 5C0EA 1I9RH 1T20A 3PGFH 3BUYA 3VJ6B 2VAAB 2PXYB 4ODUB 2P45B 2AJYL 1JNHA 1U3ZA 3H3BC 4LLVB 3QIWC 4XPTH 3RJDA 1UH2A 4DKDC 1DUYA 3FB7A 3S34H 4DUXA 1OM3L 4HMCA 3PUCA 2EE9A 2E8YA 3D18B 5D1ZB 1AQKL 3LQAH 4IRJA 5JIIA 4ZXBB 3KYAA 3IRPX 1QR1A 2BSTB 3SGDH 4NNXB 1SM3H 1ITBB 2WANA 3I85A 4K3GA 2ESVB 5BVPL 3TO4D 2MMXA 1KNOA 3BX7C 2HLFD 4CNIB 1X6LA 5E2WL 4Z0BL 5I1JL 3MQIA 3D0VA 1JNLL 1DQJA 4CGTA 5C0NC 3QXDB 2A6DA 1FZKA 5C0CD 4XVTL 4GFTB 2P5WE 4X5WA 3D69A 4LU5L 4NQED 3RL2B 5DJYB 1BQHG 5DFVD 4FP8L 2ERJB 2HJKB 2QSCH 3ULUL 2AXFA 2V17L 5D1XA 4Y4FA 1IGYB 1UEYA 5HGBA 1BBJB 2YD8A 1KIRA 3JWOL 4PTUB 4NSKA 5CBAA 2P43B 3HR6A 2R0KH 1BLNA 4LSUH 4EXKA 3OSKA 3L6FB 1KYOJ 1RFDL 2FX9L 4L8BA 4UT6H 2O5ZH 3WD5L 3QDJA 1R3LB 4AIXA 25C8H 3UAJC 1MCPL 1NSNL 4JFEA 5DD6A 1JN6B 4NM4H 5LXGL 5JOFB 4TTDC 1CXEA 3BEWB 2P5WB 5KSAA 2VJXA 1EEYB 2DWEA 3ILPA 1P53A 2PO6D 3RI5K 3SHSA 2APXA 4BM7A 3AY4C 3CD4A 4PP2B 3ZE1E 4LLMA 1AD9A 1HKLL 3JVGC 2ITDB 4OD2B 5HYSA 4OKDA 2EKJA