2Z31B

Crystal structure of immune receptor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGDASGGNTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31B00
3GJFA 4ODWB 4DCQB 1CN4A 4WO4C 4GMSL 2E8ZA 4KRMB 5IIEA 5IKCB 3WO3B 5I8CA 3WJJC 1NCDH 3MACL 4HKBB 3CFEA 4L4VD 3U2SA 5H94A 1TZGL 1RZFH 3N9GL 3SGEH 4MJ4A 4QHKJ 2A38A 5L9DL 1QYGL 2VLJE 4ORGB 1OTTC 3KPLB 2VWEC 4KVCH 3M1BA 3OKEB 2P5WB 2BNQD 1G7MA 1ZTXL 3WIIH 4LK4A 4LLYA 1JF1A 2R15A 3IFOB 3C5SB 5IQ9A 12E8H 3GJEA 5ETUA 3L6FB 3IAPA 3DLQR 3MV11 5BO1L 4XBPB 1MHPH 4JFPA 4UNTA 4AJ0A 4GAFB 4JPIB 4RMSA 4PY7B 1UZ6E 5MEQB 1CG9A 5I15H 1FNHA 3ARFB 3KPNB 5CJQH 1J9CT 1AR2A 1A14L 4L9LB 4YPGB 4UIKL 5J1TC 2HFEA 3EYOA 1LO4H 1TQCB 3A6CH 5A40E 1DFBL 1XR8A 2WLYA 5E2VH 2X1QA 5J06A 3MLWH 5KVEL 2G75B 5DHVB 3X13B 3OGCB 1XF4A 1ZS8B 3C60A 2ED9A 1LE9A 1YDPA 3SPVA 1YYMH 4H26A 5CEXA 3EW3B 3ULVH 4WU7B 2WM0A 3HRPA 1NFDB 4Q9CA 3WLBA 4K3DH 2DWEA 2OJZH 5C0GB 3B6SB 4HGWB 3O6LL 4YZFE 3VMPA 3U9PL 3VD4A 5E7FA 5MEPB 3PWNB 1RIUH 3UTOA 3L5JA 4HKXB 1CDGA 1QVOB 3CJJA 1RUML 1QRND 3V5KA 3NCBB 3CCHA 3ARTA 1TXKA 2UWEA 4ETQB 4WCYH 4WHTA 3IXTB 1AY1L 1R6VA 3GSXA 4MNHA 5EU7C 4DEPB 3ULUL 3DMMA 2BHZA 4BQ8A 1HSAB 5IM7A 1X7QA 2HKFL 3S98A 2BDNH 3ESUF 1IMHC 2D7TH 5EIVA 4CVXB 1KN2H 4N0UB 1T3FA 5E2WH 4KRPB 5E00B 1W8OA 4NQVA 1WQVT 4QRUB 2NX5A 5D5MF 3L3OA 4LFHD 1LO2H 4U7KA 1A6WL 3VWKC 4H1LG 1F4XH 4HZLA 4IDJL 1QPXA 4ELMF 1BQLL 2Y25A 5DD1L 3QG6B 3V6BR 5F7KC 3RIFF 4OCRH 5C07D 1BAFL 4NKMA 4WNQB 3PXHA 1T1YB 2X9YA 4S1SL 2ARJQ 2DBJA 4ZODA 1J7VR 4B41A 1LEKA 2JJUA 4DVBB 5DJYA 2BVPA 1JZ4A 2DAVA 1VEOA 4P46B 4OZFG 5IW3A 5GZOD 1UM5H 5BXFB 3ZSSA 3QEHB 3OKKB 5KW9L 3ZKQD 1Z9OA 3GMNB 5BS0B 1O5DT 3LRSA 3V8OA 1UWEH 1PYWB 4XNZB 2P8MA 3GKZA 1ZT4A 1CZ8L 1PKOA 5TFSH 1CL7H 3EJYC 1XGYH 4YE4L 3V7MA 3GRWH 4P4KD 1CXLA 1KGCD 1YECL 2MSPA 3BXNA 1YN7B 4OAWA 3V9FA 3BZ4B 5CUSL 3RDTD 2DQTL 1LK2A 3LDBB 3THMH 4WHCA 1CFTA 4OLYH 4PJ9D 1P7HL 5IVZB 4Y4KB 1XAUA 1LP9F 1WIUA 1UKTA 1E6OH 4X0KA 4JQVC 4O4YL 1XGUB 3P0YH 3RX7A 2DQDL 3O11B 1JGLL 3I2CL 2DQUH 3PGFL 4NJ9L 1XCQB 4HPOH 3V0WH 3L3HB 4YK4C 4IS6B 3FN3A 1S9KC 4QEGA 2E7CA 3HZYA 4LAQH 5D7LA 3VRJA 4Y5XB 2ZKHL 4FP8L 3QG7H 4L8CA 4ZAKC 3LEXA 4PTTB 4U1MA 5IV2B 3GMQA 4JFHD 1Q9WB 3CGTA 3JV5A 3L3DB 4YO0B 3B8YA 3I9GH 3ULUC 2E5EA 3QJFA 5FA4A 4MJ6B 3SDCD 3O2WH 1MELA 2XN9A 5F7MC 1E27A 4UV7L 1UWGL 1JPFA 3C9NB 3OXSA 2LVCA 5D6CA 3BPNC 1X5KA 5JIHA 3RU8L 4CNIA 4QOKA 2B4CH 5CEYB 5E9DE 1TJHH 3F58H 3OF6A 2XQBL 3TA3C 1OCWH 1ZHLB 1KIPB 4R4FL 1FZJA 1ND0A 1CFVL 1OAYH 3SKJL 1FIGL 5MENE 4XPGL 2VC2H 1VHPA 2HG5B 4JO1H 3S7GA 1KTLA 4C56A 2J4WL 5LKNA 3DXAD 1A3RH 5SWSE 3WFCL 4YWGL 4QRPB 5EC1A 3MLXL 4EUPA 4L3EE 4QRTB 2RFXB 1TETH 1UVQB 2AV1B 3CMOL 5DLML 5GGVH 5HHXL 3CZJA 4UT7H 1OW0A 1MHCA 1RZIB 1I1AB 4JHAH 1IT9H 3BW9B 1MCWM 1BJ8A 1MJ8L 3EOYG 1U3HD 5CGMA 5EA0L 3MBEA 4WFFD 3JVGA 1MREL 2AKRB 3CC5B 2NY6B 4MNQB 5ICYB 4X80L 2R4RH 1WK0A 4YNYB 1MFBL 5IBUG 4I18C 1W0VB 5EBLB 3O3EB 2HJFB 4GKZB 1MCFA 5F88A 5F72S 5C09A 2BERA 3D3VA 1BVZA 3QUXC 4YGVA 4BH7B 3CXDH 5DFWH 2FLRT 4MA3A 2QL1A 2R2CA 3HZVB 1F90L 2CKBA 2V5RA 3O4OB 3SE3C 2YUWA 3GIVA 1CXKA 4JQIL 5L8KB 3JV0A 1DQTA 1RZ8B 3OKDB 5ALBH 1YEGL 4LLQB 1NGXA 3WN5C 4HUWB 3WNLA 1UXWA 1LILA 4JPKH 3D2UD 4XI5D 4PY8J 4DUVA 5DVKA 3RY6A 4RQQA 3T2NH 2R2BB 2ZUSA 5IEKB 2VTFA 4D0DA 1OAUL 2C3HA 4XAWH 3RNKB 4ETYA 5FYKH 3PWPE 4LLDA 5DGRA 5AWNH 4M7LT 1DBAH 4NWUL 2APBA 4TTGA 1D3CA 2A1WH 3GMRA 1BBDH 1I9IH 4FTVB 4HPYL 2ESVD 4Y16C 3O8XD 3SKNA 5E94B 2IAND 3U0TA 1DLHA 5HTSA 3TV3L 1O7VA 3GUTA 1MF2H 2FWOB 4XBGA 4PJBB 4XP4H 5HGDB 2A77H 5C0EB 1RZJH 4TSAL 4YDJA 3FO2A 5IMLA 4KI5D 4MX7B 3ZDXE 2PXYB 2XXMB 4JFED 1N0LA 3RP1A 4UUJA 5JHDA 4XC1L 3QIUB 4WRLA 4LLUB 3ZE2E 5L88H 3TVMC 2DOCA 3O6FC 3GMMA 4GUPA 4K71B 3CVHL 3OB0K 1K9TA 1HXYB 2XY2A 5E6IC 4FQXD 4P2QB 4Y19A 1FH5L 4NO0B 3AREC 2QHRH 2B0SH 4PJIB 4UV4L 3LZFL 1JZ6A 1LO0H 2D7MA 3MRJA 3HAEH 3RGVA 4QHUA 3HE6B 2QKIB 2QQQA 1IFHH 4WUUA 5EBMA 2W0FB 4HWZA 1S9VB 1IKNC 1KCRH 2VLRA 4R3SA 3L3IB 1YPZE 2X89A 4OGXH 2A74A 1BFOA 2OL3A 4I3GA 2EE2A 5AD0A 1HH9B 3W2DL 1ZLSH 1CLCA 2OMBA 1K8DB 2I07A 2O26U 4Y8DC 3QEGL 3MRIB 4N9OB 5GS3A 5EOTB 2KH2B 3ROLB 4F58L 4LGRB 1DVFC 1KTDB 2JB6A 3IAQA 3SDXF 1F6AB 2D2OA 1P1ZB 3IFNL 5L2KB 1ZGLM 5F7DB 4WO4D 1FFNB 2Y07L 4PJAA 3T1FA 3UC0H 2NY2B 4UNUA 4GXUM 2J5LC 4ZUUB 4ODXB 4XCEB 1Z3GH 2ZNWA 2HT3D 1KCSH 4AEIL 5C0FB 4UIMB 3ECBA 1NCNA 3VXRE 5CGTA 4W4NA 3ZL4H 1W8NA 4HEPG 5ITBH 4Z7UF 4XVSL 4YR6A 1KG0A 3MPCA 3QEQA 5AYUL 4PJ8A 4ZFGH 4IMKC 3PHOB 4GRLA 5I8EB 1MEXL 3QDMA 3DO3A 4UB0L 1QFWL 4X5WB 4GT7A 1VGKA 2ZUTA 5E6ZA 1HSBB 1XF5A 2OTPA 3PWLB 3IJSB 1J88A 1KB5B 3VFRB 3WSQL 1M7XA 3A6BL 3BO8B 3G5VB 2DB8A 3BP5A 3E8UL 3KPRE 5T1DL 1YJDH 1CXFA 4RAVA 1IGMH 4WENB 1D6EA 3GJFH 4X5XA 1RUKH 3QFJB 1BJMA 4OZHB 1ETZA 1NEUA 4KI5F 1MIEH 4V1DA 1CR9L 4L4TB 3QYCA 2LAAA 3OTTA 1U42A 1TDQA 5B8CA 3UO1H 4RZCB 1FBIH 1NAKH 1R3JA 3T0EC 3EYVB 3RPKA 5DMKB 2GJ6E 2Q7YB 4QNPE 1TPXB 3NFNB 4RAUB 2MHAB 1AE6L 1U3ZA 5GGTL 3D87B 3JTSB 4UILH 1DDHA 4GS7C 4Q9RL 5EU6D 3VW3H 4ZOBA 3BGMA 3MLUH 3HHRB 2QTEA 2BCKA 1MIMH 3PJSB 1CD9B 4PTUA 3MXWH 4V2BA 1K6QH 5SWZD 1MCCA 1WWCA 2DRUA 3H9SB 4NQSB 2W9LA 1CT8B 2BK8A 2LU4A 4S1RL 2DL9A 4PJ5D 1BREA 3PWJA 1JVKA 2IPUK 2VABB 2H3NB 5FYJL 5TQ0H 3VRLE 1AGFA 4DGIH 2G2RA 1L4IA 2WUBL 4OD3L 4J3XA 2EXWD 1D6VL 2UY7A 3LH2L 35C8L 3RTQB 5I66B 3VWKD 4ZO9A 4KTEL 3BIAX 4ZUTB 2R0ZH 5IJVA 4O5LL 1JF5A 1Z5LB 2HMIC 2ICEB 3BMWA 3K4AA 5FGBC 5FM8A 4PP1C 4JN1H 3GSVA 4G9DA 2J2ZA 4OLUH 1FL6B 5HHOE 5I74B 1MFEH 2DM4A 1MHEA 1JGUL 2C1PA 5KSAB 4L3CA 4P5TA 4NN5B 3BUYA 2VH5L 3UBXA 5IK3A 4PRIE 3F6LA 1D9KB 1L6XA 2EE3A 1DL7L 1F8TL 3TJEL 1IGCL 3ZTNH 2B2XH 2PYEA 1I1YA 3EJYD 4JG1L 1FYTB 2AK1H 2YUXA 2EXYD 3G6DH 2VQUA 2NXYC 1NC4A 1T7WA 4YAQA 3MODL 1C16B 5C0AE 1FG2B 5MP6L 4A6YL 3NCFB 1GJIA 1VFOA 4KHXL 2HFFB 1RIHH 3WS3B 4QRRA 2CKNA 1OGTB 3GB7B 5D2LB 2UUDH 1IGYA 7FABH 1KN4L 4MLIA 3MV9D 3S35H 3HG1D 1U41A 3MRHB 1I1FB 1QHOA 1FVEA 3V52L 5E95B 2D31B 1PLGL 4XBEH 5FA3A 5FDYA 2Y06L 3D39A 4NRZB 3UJIH 2WNGA 2FX9H 4DN3L 1R5VA 4IEFB 4MJ2A 4NKIH 3M17B 4D9QE 3DUHA 5INCB 5HHMD 1Y0LB 2XZAL 5EWIH 3FT3B 3IJYA 5HDQH 5AG9A 4UNVA 3MNWA 4Z7WB 3X12A 2VITA 3BIKB 3GSUA 4NQCD 4RGOL 3QUYB 2J6EL 3HC4H 5BOPA 2PN5A 3S88L 4XPTL 5D2NC 2A0LC 1EZVX 3DVFA 2FRGP 3TA3D 3IFLH 1M7DB 3QR2A 4Y4FC 4UT9L 3PIQB 1H0DB 5HYQB 2E9JA 4GG6B 1YEJL 4NQXB 5LGHL 3T09A 4Y1AA 2NXZB 3HRZB 5ACMA 5FO8A 4RAHA 4LBEA 4HUNB 4XAKE 5K33A 2J7LA 2AJXL 5GS1B 3FB6B 4X4XB 5FO7B 4WFHE 2YPLD 1JNHB 5HVHB 3WFZA 2MFNA 2BSSA 1I1CA 2NTFA 4XH2A 2R0KH 3BP6A 1CGWA 3SDAB 5I1KH 2VDQH 3RY4A 4GO6B 4Y5YA 5BCAA 1A6ZA 3MROB 1IARB 1SY6L 4LSSH 2VISA 5GGRB 1LNUB 1U3YA 3WFEL 4JCMA 4OT1L 1QEWB 4HLZG 4CW1A 3PDOA 2AJUL 1QO3B 2ZUWA 1QZ1A 1RZKL 4HKZA 1UFUA 3B5HA 4BFIA 1MJJA 3TBSB 4R2GB 1AO7E 4OCWL 4Q9QH 3GGWA 4HXAL 3MA9H 5IB4A 1EAPA 4J2XA 5HGAA 2EDKA 3TCLA 3BKJL 4Q6IB 2IPKA 4IRJA 4JEGB 4L8BB 2OQJB 5HYJA 4F9LA 3S96B 3STZA 4M4RA 1IGJA 4J1UB 4XWGH 2EDFA 2V7HB 5I1HH 1P4BL 2Z31B 1FNGA 4K8RL 3PNWB 2YPKB 2YOCA 1I7RA 3O6KL 3EGSA 3MNVB 3QUZA 1JTOA 1BOGB 4LCCA 3K7UA 2FDBP 5IESH 2HWZH 2X9XA 3VU2A 2VDOH 5ALCL 1HHIB 4RNRB 2DDQL 4M93C 5FUCE 1G0XA 4I48B 3WCYA 4U1NB 4U3XA 1TVHA 1AC6A 1UWXH 3KLAA 5ESAB 1ED3A 1E28B 4RWYH 4PR5B 4K7FA 4F15B 1JNLH 1A5FL 4Y16D 4HAGA 3BH8B 3QQ9C 3WUWA 1G7JB 3CFJA 5EG6C 2Q86A 1AFVH 3FN0H 4WV1A 1A9EA 2G5BB 3MYJA 4DEPC 1BECA 4JVWA 4MJ5A 2OSLB 2VDNH 1INQA 4QO1A 4HIJA 1UYWL 3FO9A 1YMMB 3P11L 4PREB 3VGAC 4KRPC 3ULUF 2F58L 4E42B 3KJ6L 1IC7L 2X4NA 3O6FD 1MQKH 4I9WE 4U2ZA 2ADGB 1QPPA 1A4JB 5DVLA 4G7VL 4OZGA 3G08B 5E6ID 4K7PH 1P7QB 3IDIA 3W0WE 2WIMA 4XP5H 5FYKE 2ZWLT 5I6XC 4M00A 3KLSA 5D4QA 4H20L 4HT1L 5EPMB 3KPSE 3KYKL 5TPWL 2BSED 2FZ3B 4TUOA 3TBWB 5F7HA 3U0PA 3MJ9H 4HSQA 1F5WA 5CJOH 4HMCA 4X6DA 3AVEA 4H0IA 1NMCC 2UYLB 3U9UA 5FIEA 4P46C 4WHYH 1RZKC 3TNNB 5CJXA 2EE6A 4FQ1L 3N1PC 1NGPL 3CXHK 1CQKA 5DUML 3F7PC 4OLVH 3HPLB 4GMTL 2FNBA 1PW3A 1UB6B 3MJGX 3SDDB 4QLRA 1KIUA 5D7SH 4XNZC 1VFBB 4L9DA 3F7VA 3SE9L 5CINL 1JGVL 4M8QB 3V8CA 2WBJB 2BRQA 2F9BT 3K46A 5F21B 4I3SH 3VXUE 4I0KA 1GOGA 5I8OL 2YD9A 3A0OA 3MFFB 1KYOK 4NP4H 3MRBB 4Y89A 1FFPB 4K8RC 2PTVA 3LDBC 2FL5B 5GZNC 2ITDA 2OLDA 4Y4KC 2G9HA 2GK0A 1T83C 4I5BA 5IWLA 1IC5H 4PLJC 3L95A 3JWDH 3RBSA 2DQGL 1KBGH 2PF6A 3CIQA 2R1WA 2BNRA 2VKWA 4M5YL 3VXSA 4PG2C 3B2VL 5EOCH 3C09B 1TZHB 2R39A 5DTFB 4ZXBC 5FXCH 4XVJH 4R96B 1I3VA 1K4CA 4M3KB 4DZ8B 4JRYD 2X6MA 3QULA 1KJ2A 1TIUA 3H9HA 4Y5XC 4QRSA 4BH8B 1MFCL 4RA0C 2CIKB 4P2RD 5JO5B 2O5YH 2X4QB 5JW4M 2H1PL 4UQ3B 4NZUH 4NHUB 4ODBD 3UTPD 2Q76A 3X17A 1OB1A 4K07A 2F53E 4OM0L 1JPSL 3QUML 5LQBH 3EYQC 1JI1A 3EKCA 5D9SB 1FO0L 2HLFC 4TSCL 1NSNL 4MB3A 2CJUL 4OCMC 3BH9B 3PQYA 1MUJA 3UZEA 2RIKA 4G6JH 1KPUA 2P5ED 4MQSB 5EBGA 1YNKH 3BAEL 4Q2ZB 5ANME 1REIA 1M71A 3K2UL 4YDVB 1PZ5B 5FDWB 1AIFB 3H8NA 5E70A 5FGSA 3GMOA 4GXVL 1EGJL 3P4LA 4I0PC 1Q0XH 1C7TA 4JQXC 4XP9L 4JFZH 3DX6A 2D0FA 4FNLH 2PCPA 3WHXB 3KYMA 4G9FE 1BD2D 4W4OC 4I0CC 2OK0H 3V0AC 4HUVB 5SWQB 4L29A 2ZUQB 1E6JL 2GSGA 5IW1A 3RVTC 1KFAH 3WE6B 5D7JB 4ALAH 4XCCH 3C6SB 3T0ED 2GITB 4NRXB 4QF1B 4WI8A 1UACL 1I1AC 4NRYA 2J8UE 5DJ0B 5DJ6A 2QQLL 4MLSA 3AS2A 1W2KT 1EMTL 2IADA 3VRIB 4EVNB 5BZDB 2AJZB 2FSEB 2AK4E 5EBWB 3VE0A 2GUOB 2NY6C 3QA3B 3IS0X 4HUKB 4U1HB 5K59F 3BD4A 4U1LA 2ZCHL 5T1MB 5HHNA 1ZLUH 4IHOB 2NW3A 3D25A 2C1OB 3O4OC 4HBCL 1CBVH 4ZFZA 1FNSH 3ZYIA 1Y6NR 4XZUB 3QRGL 5B38A 4ZPVA 4NQDA 3RHWF 3VDAA 1BFVH 2RR3A 3UMTA 3GO1H 4ZS7H 3MQIA 5KS9E 4Z0BH 4ZUWA 1ZAGA 3BYYA 3SQOH 2P7TA 1IL1A 5F1NA 4PJHF 5H94B 5DJAB 1CD0A 1EHAA 2HMID 3IFPA 3T0BA 2EDNA 4XCNA 4D9LL 3M1BB 1DP0A 3UTTE 4KROB 1J8HD 1G7MB 1XGTA 1JF1B 5FECA 4HIEA 3ORJA 2JJSC 4HUUB 3GJEB 5ETUB 3KGRA 1LO3H 5EUOE 3ROOB 1NAMB 5BVJA 3ARVA 5EDXA 4JPVH 4XP1H 3TH2T 4IBLT 2W92A 4JFPB 4YBQC 4G5ZH 1CG9B 4NHCH 2GAZB 1MRFL 2AGJH 5DFTA 2PXYC 5KSUA 1TJIH 3Q5YA 4JR9L 3WHE1 5GRZA 3QIUC 1KB5L 2O93L 2NXYD 2HFEB 3EYOB 4D0BA 1A22B 4K71C 2WV3A 1XR8B 4D3CL 4NBXB 3WS6C 2QSVA 1XF4B 3BDXA 1AQDA 1LE9B 2E9IA 3S34L 4RX4A 4KH2A 2VSDA 4QWWC 3SPVB 1DQLH 1NCDL 4H26B 5CEXB 3HE6C 4Y5VA 5TJWK 1RHHA 1JMZA 3BGAA 5TDPA 1X9QA 3WLBB 2AJ3A 2CUIA 2DWEB 1DCLA 3OX8A 2HT2C 2LFGA 2MCG1 3L1OH 4EBQH 1F6FB 3HE7A 5JXEC 1IBGH 2AQ1A 5IVXB 3T0AA 4MAYA 3WIIL 1CTNA 2NNAA 4PB9H 5DJCA 4MQTB 3CCHB 12E8L 2MMXA 5DWUL 4PGEA 4JKPH 3IGAB 3VD9A 4WHTB 1MHPL 4NO3A 4GRMA 4ZDHA 4X6EA 4BZ1L 5M94B 5FYJD 4JM2A 1CE6A 3DMMB 1U8HB 3R1GH 3ZDZE 5I15L 5IM7B 5J4MA 1YC7A 4Y4FD 2E7HA 4AZ8A 4NT6A 1F3JA 5FHBH 1KSRA 4OB5H 3WV0A 1T3FB 2W65A 1EX0A 1LO4L 4NQVB 2VLKA 3BEWA 4NOFA 3A6CL 2NX5B 1X5HA 5E2VL 3L3OB 3UYOD 5T3XH 2NLJB 4HZLB 2X1XR 5GS2D 2VUOA 4TVSa 1RJYB 1YYML 3ULVL 3KPQA 4N8PA 3REWA 2IBZY 4Z7VE 2VDLH 2HLAA 3IETA 3DX9A 3MUZ1 1HYRC 3B9KA 3MTRA 1LEKB 2OJZL 4MA7L 5BZWB 2BVPB 1IM9A 5MEOA 1WFUA 4LPYA 2R8SH 1W72A 1MCEA 5TE7H 4I3RH 2ZPKH 4XXDB 2XTJE 1IC4H 1I3GH 1FGNL 1FLTX 4X4MA 1R3KA 1NCCH 4XNMA 1BIHA 3LRSB 4PJ7B 2P8MB 1RK0A 5AAMA 5T3ZH 4M02A 2DBLL 3BXNB 3KXFA 4HDIA 4OAWB 2FJGA 3F65A 1K5NA 3UTSD 5BRZE 1LK2B 1S5IH 4OD2A 2BDNL 5FV2A 1QFHA 3K8MA 2IQAB 1NFIA 2D7TL 5KZCB 2RJMA 1KN2L 4X0KB 4I2XB 5E8EA 1U8MA 5ID1B 1QA9A 3MBXH 3C5ZB 1RJLA 1LO2L 3FO1A 1TPXC 1T04A 2W0PA 1MNUH 2X2YA 3N50A 5IBTH 1F4XL 5DD0H 5D7LB 2VXVL 3HZYB 3FCTA 5HDLA 5LCVH 3S35X 2IAMD 3JWOH 3QXTA 3VRJB 2I9LA 4YDLB 3MRQA 1WZKA 1N64H 1VESA 1U92A 3LEXB 4U1MB 3QQ9D 3GMQB 3LRHA 2N56A 2V2WA 3QQ3A 3TT3H 3PF2A 4CADA 4OCXL 2E27H 1MRDH 1X6LA 1HWGB 1S8DA 1E27B 1UM5L 2UY6A 3GBMH 3HPJA 4LHUG 5BVPH 1JPFB 4UZGA 3OXSB 1NL0L 4J12A 5LAXA 5D6CB 1S7WB 4CNIB 3DVNA 4QOKB 1TENA 1VSCA 1GVIA 1UWEL 4EI5A 1HEZA 1CL7L 1XGYL 1Q94B 5D96B 3FB5A 1T5WA 1IJ9A 4C56B 3THML 3ULVC 2LU3A 2P48B 3G6AA 5EC1B 4EUPB 1PFCA 5GXBB 1KB9K 1P69B 4PJDA 1IGFH 4YHYB 2ATPB 1WUNT 3ZHKA 5I74C 4BQ6A 3C6LC 1IGTA 1MHCB 1LDPL 3ALPA 4IJ3C 3RKDC 4XTRC 2XZQL 4LAQL 1GGBH 4G6MH 3MBEB 4LLMB 4NN5C 2NPLX 3DUSA 3IU4H 1RFDH 4JRXD 3GBNH 2DN7A 2YSSA 1D9KC 2VAJA 2DICA 4C55A 1OQOA 5BS0D 2V5MA 4AIZA 3ZO0A 5MHSE 5KJRH 5TF1H 5LGJB 1G1CA 3LKOA 4IOSD 3D3VB 1S7RA 4OQTH 4MB4A 4MA3B 4K8RD 2CKBB 4JFFD 5GZND 2QSCH 4U0RB 1BP3B 4Y4KD 2B4CL 2X9WA 4PLJD 1F3DJ 1U8OA 3X14B 1NGXB 4J8RA 1FN4A 2X4UA 4X9FA 1S3KH 1UZ6F 1AGCA 4P3CL 4AL8H 3FQWA 1UM6L 4G8EA 3WNKA 3EFDL 4PJGF 4ZXBD 4RQQB 1NMAL 5F1KC 3OAYK 2MQCA 1WEJH 1FORH 2FJHB 1CFSA 3VFPA 4DUXA 4LLDB 5C2UB 4CN4A 3CAFA 4NFBA 3WD5H 4JO2H 4UT7L 4GQ9H 3E2HB 1P7KA 3U7YH 1I8IA 1IT9L 1NFDF 4LIQH 3GMRB 1KIRA 3EYQD 3QI9B 4CU7A 4CMHB 3FB8B 2HLFD 5L0QB 3U0TB 5IHZB 3GUTB 5CEZH 3QUYC 2IALA 3ZZ1A 4XBGB 1RULH 4H1LA 2R4RL 2QR0A 4YDJB 3FO2B 5IMLB 5KSBE 5DC9B 4GW4A 1EFXB 1R3HA 3SJVA 2IFFH 3BYTA 5F8RC 5HI3C 4AMKH 3QUKB 4UUJB 1FL3B 1ITCA 3RI5F 1JZ3A 3CXDL 4NJAH 2NXZC 5DURB 1OARL 5DMIH 2EKSA 4I0PD 2PKDA 3NGBB 3EDKA 3EYFA 2XZCL 3GMMB 5HJ3B 3DARA 5GS1C 3NAAL 6CGTA 4E41E 2ZUUA 4U1JA 1CCZA 5SWSD 5HVHC 2FH8A 4W81A 4N9GA 4K7PX 5DRXA 2VZUA 3MRNA 3SDAC 4C4KO 1P5UA 1T7YA 4NO2A 3MRJB 5BV7H 2YPVH 4X7DC 4XAWL 1FG9C 4WUUB 5EBMB 2FR4A 2CXGA 2JCCA 3D9AH 4HWZB 3GI8H 2NY6D 2GK2A 2VLRB 2BHYA 4MXQD 4R3SB 4HK0B 1SJHA 3GSNH 1F4YH 3NMEA 2A74B 2B1HH 3V79C 1I9IL 2JE8A 4R2GC 2IPTH 2OL3B 4LSRL 4JPWH 3C87A 3QDJA 1DBJH 4D8PA 5JW3H 2W07A 5AD0B 2B4CC 4XC3H 1U8IB 4LKCA 4OZ4B 3FO0H 2I07B 5BW7A 4PJAE 1RZJL 1T6WA 2AQ3A 3PV6B 3PP3H 3O3BB 2RCSL 4KDVA 2Z31C 3DNKA 3T1FB 3U4BL 4GW5A 4JN2A 1F4AA 3L5WA 3VXPA 5L88L 3EFFA 3VI4F 4Q58C 4P2OA 5HDBF 4DW2H 4GLRH 4BFBD 2F54A 1D5MA 3BESR 2YC1A 1NJ9A 3OKLA 3EUUA 2B0SL 5C08A 1U3JA 4BSWA 1ADQH 2ARWA 1LO0L 5DR5H 3PWPD 3QEQB 4PJ8B 4GRLB 4BA8A 2KL6A 1T7VA 5ACZB 3FONA 4WW1A 1S7UA 4LCWA 4OFYD 3QXWA 4CN1A 5DEFA 5GGSA 1GGUA 1T0MA 1VGKB 4LKXB 4YBQD 4MB5A 2CH8A 3R4DA 4OGXL 1T89A 2H9GA 2PXYD 1OGAE 1AD9A 2CRYA 4NQED 1VA9A 4OZIA 4XVUC 3BP5B 3QIUD 4WUKH 4K9EL 1IC1A 2CXKA 2XWTA 3NFSH 4NNXA 3HKFA 4RAVB 3QO0A 1JFQL 4OFIA 4X5XB 1J1OH 3MRGA 2WWKT 2DQHL 5DA4A 3EYUH 4H5SA 4ZFOB 4LQFH 4NO0D 1ETZB 4W6WB 4PJCA 3UC0L 4XRCB 5GGSY 3Q5OA 3J8F7 3ARQA 2KKQA 4V1DB 1DQDL 4ZNEE 3N85H 1KCSL 3HE6D 5CCKH 1R3JB 1MWAB 5ICXA 5F89A 3UTQB 4RA3A 2IQ9L 3ZL4L 4QTIH 4OQ1A 3V5DA 2M26A 3UPAA 1DDHB 5JPNB 1QFWM 3WEXA 3BGMB 4ZQKB 4ZFGL 1U91A 3SDDC 5LBSH 4PTUB 4JAMB 5B3JF 4QKXB 5IBLC 4OUOA 3NA4A 1SVCP 2WBJC 1MCBA 3BWUC 3HZMA 4I13B 4ODVH 1D5IL 4KHTH 4U1SA 4RGNB 1O0VA 5L2KD 1TVBB 3DI3B 2AJYL 3QWOA 1MH5A 3IDMA 1U6AH 3S36H 4P3WA 3P4OA 1AGDA 4AY0A 1NLDH 1R5IA 4FG6C 1HHJB 5GRUH 3LQMA 5CP3A 2XRAH 1AGFB 5FCUH 2C3GA 1E4KA 2G2RB 2JB5H 3C09C 5HGBA 2GI7A 2VZSA 5I1GH 2G5RA 4J3TA 4FQPA 4N8CH 1NC2D 4D0CA 1MIEL 5IJVB 1SBSH 3VXRD 3UO1L 4MS8C 4Y7MA 1NAKL 1EUTA 1PSKH 1A7RH 4Z0XA 3V4VH 2APFA 5I9QB 1WZMA 4HULB 1A7PL 2XI9A 4J3SA 4NGHH 1CTOA 1T2QH 4JDZB 2C1PB 4KJPC 2QJDA 3Q6GL 3E1F1 4L3CB 1MQ8A 2NR6C 3BISA 2IMNA 1B0RA 4MAUH 1HQRA 5GS0H 3BUYB 5IK3B 1I7TA 5HVWA 3VW3L 4K9EC 4YGAB 1GGYA 5F93C 2APWA 1KELL 1OM3H 4M9OA 2PYEB 3SGJC 1SJEA 3R06A 3B2UD 3MRLA 1T4KA 3KPRD 3QFJD 1R3IL 3AM8A 4PJBF 3FFCA 2R29H 1NC4B 3MRCA 4YAQB 4NKOA 2BSTA 2FB4H 4LRIA 4S0SD 2J88L 4QRRB 3OG4B 2JJVA 1U0QA 1JPTH 4NDMA 5D7JC 3HUJA 3SKOA 4DGIL 4NZTH 1H5BA 2Z8WC 3HR6A 4LQ1A 2FX7L 4PPTA 4M6OL 4ONFH 3L5HA 4LVNB 2Z8VC 5FA3B 2GJ6D 3D39B 5DD3L 3ZE2F 3VCLA 3MJ7A 1WTGT 2A6DB 1MFDH 1R5VB 5E24E 1KC5L 4I77L 2EEDA 4UU9B 4TSBH 1G7LA 3BEVA 1MFEL 1N8ZA 4KJWC 4JJHA 1N3NA 3IJYB 1W72H 1OOAA 5DRNA 3SBWA 5C0IB 3CSGA 2AABH 4HUMB 4JFOA 3MNWB 2IBGA 4XMLL 3X12B 2VITB 5T3ZE 5JMOC 3RKPA 1LE5B 4HX1A 5FYLH 5T5NG 3GSUB 2ADJA 2IG2H 1R5WB 1I9EA 5A2LH 2OMNA 1RUAH 2B2XL 1MSPA 1OAQH 4OKVA 1RZ7H 1YPZF 4WGVB 3UBXI 1FFOA 1MAML 4X4ZA 2AK1L 4N0CD 4HJGB 2XQYG 3ZMRA 2BXZA 1G7IB 3LEVL 5FO8B 4JG0L 4LBEB 3ULVD 1DTUA 3CXHJ 4B53A 3QIWA 4GH7B 1FC1A 4XNUH 2AP2A 3L3KA 5D5ME 3ZKND 4WI3A 1YYLL 3QP3A 1GRWA 2QBWA 2NTFB 4XH2B 2UZYB 4R9HA 5I75C 4KROC 3BP6B 4F7EA 3C6LD 4B50A 5IFHH 4ELME 1GXEA 1CF8L 2FX8H 3J7HA 4Y5YB 5D93B 3RKDD 3CVIH 4XTRD 2ZOKA 4KKNA 4R0LA 3TO4A 2VISB 3UJIL 2DJSA 5HHOB 2VAAB 1EH9A 3VFGH 2FX9L 1UQSA 4F8QA 3H0TA 3D85B 4NKIL 1L0XA 1MRCL 3LIZH 1FZMA 4NKDA 4L4VE 3PDOB 2ICCA 4J6RH 1QFOA 1YNTA 4RFEB 4PRID 3UPCA 3H3BC 4BFIB 1MJJB 3KNBA 1FYTD 1PY9A 3QIBA 3GGWB 5IB4B 1EAPB 1QLRA 3IVKA 1N7ML 5HGAB 2BNQE 4WIQA 1TQBB 3TCLB 1CGSH 1UJ3A 2IPKB 5FYJU 4IRJB 1FGVL 5I2IA 4QHKI 1EK3A 1DANU 4BZ2H 5HHPA 5HYJB 3STZB 3SN6N 3T8XA 1IGJB 1FE8L 1HKFA 4NSKA 1CLYH 2CUMA 3IFLL 4JHBA 1ZT7A 3C60C 4U6HA 4UOW1 1FNGB 1XGQA 1I7RB 4G80A 3FRUA 1A6AA 1LP9E 3QUZB 3O0RL 3MFGB 3VFMB 1WFTA 2J12B 1FHGA 2W60A 4ZFFA 1H15A 1HXMA 4RFOH 4XP6L 5J11C 4NCC1 2BJML 4FQHA 5ENWA 3FT4A 4PYHA 1T5XB 1OF2A 2R0KL 3KLAB 3UJTL 3KJ4B 3VFNA 1T66C 4K7FB 2R2HA 4LSSL 4JY6A 4GJTB 1IAOB 3VA2C 2D7NA 2X4SA 3N9GH 4X9GA 5ESVA 5L6YL 3QB7C 4P4RA 3CFJB 4K55A 1V3JA 3QUYD 4JO3H 5IEHB 1QYGH 5EUKB 4WV1B 1A9EB 3G9AB 3Q5TA 2BRRL 1JGDA 1XFPA 3TFKC 4P49A 3DMMC 1KJVA 5M95B 1ZTXH 4NQTA 1ZA3A 2NY3B 3HN3A 5HI3D 4HIJB 4YHKH 2DM3A 2V9TA 1W0WA 3FO9B 1BMGA 3O6ML 5DJZB 1A3LL 2DQCL 3QCTH 1ZE3C 4NNPH 4HIXL 1KXVC 4WHDA 1QRNE 2X4NB 4XT1C 1XF3A 4PJEA 4MHHG 2Z91A 4OZGB 2Q1EA 5CBAB 3IDIB 2QSQA 4EIGB 1OSPL 2PO6D 4ODSH 3SDAD 1T22A 4WFHD 1URLA 4UIKH 1JPGB 4Y4HA 1S7XA 2NY1B 4B5EA 5IW6A 4LIQE 3U0PB 4GAYA 2HWZL 5F7EH 2VDOL 4DQOH 4X6DB 3U9UB 5KVEH 4G6KH 3ULVF 1U93A 3E3QE 3FRPG 1L7TL 5IKCA 2ZUYA 1QR1B 4PJXA 3EOBA 4C54A 4EQ2A 1UM4H 4DKFH 2B5IB 4RWYL 5JA9A 1IQWH 1JNLL 4R2GD 3RWGA 5CLWA 3TCXA 4HWUA 3FN0L 1WISA 3U9PH 1AO7B 3MYZA 1PBYA 3OKEA 4U49A 2EDDA 4AM0A 3DBXB 1IAMA 3PGDA 1T0PB 2GIYA 1RUMH 4U6VH 4DOHE 2ITDB 3SDYL 4F37K 4Z18A 2CKBL 4LMQE 4Y8AA 3L95B 4AG4H 4GRWF 4F80A 5KOVC 4OZFH 4XBPA 5SX5H 2VXQL 2BNRB 1AY1H 1WVZA 4JPIA 3VXSB 4BK4A 2DMCA 3ULUH 1EIBA 2OP4H 3H7LA 3TWCH 2F19L 4XP5L 1K4CB 2HKFH 3ARFA 4AT6A 2R56L 3ETBF 3QULB 1KJ2B 4YDLC 4L9LA 4QRSB 4FZEL 1MCPH 2DTML 5D2LF 2VIRA 5GSRB 5KOMC 3CFKA 2N7BA 5C0CA 3INUH 1BVLA 4P23B 2Q76B 4ODTL 4YXLL 2CIIA 1JK8A 3QDHA 2G75A 3AU1A 2NZ9C 3OAZK 4IDJH 1MUJB 5IFAL 5DHYA 4BQCA 4WU7A 4S1SH 3MO1A 5F7NC 2ZG3A 2K9UA 4NOBA 2FYYB 2P8LA 5DFVD 5D7SL 4KC3B 3CU7A 1M71B 4X99B 1LD9A 4NIKB 5F96L 4Z7WF 5MEPA 4Z76B 5D96C 4KDWA 4RMRA 4NP4L 4JFHE 4UOJA 3QDGE 5KW9H 4F7PB 3DX6B 2PCPB 1WITA 1DE4B 3WHE0 5KVFH 1IC5L 1EAJA 3RVVC 3K3QA 4LP4A 3W0WB 4YHYC 1KBGL 4W6YB 1CZ8H 4YE4H 1YECH 1OW0C 4U7MA 4NRYB 2V5TA 5CUSH 1HSAA 1LWRA 4DKEL 5DJ6B 1JHTA 5K9JH 5AUMB 3MBEC 5T1KD 1JV5B 4CVXA 3JVGC 2ED7A 3RL2A 4O4YH 4NZUL 2DQDH 1JGLH 3I2CH 3SDDD 1QQDA 3PGFH 4KUCD 2R1XA 5B21A 2FIKB 5IBLD 1CWVA 5E4EB 4OLWL 4RMWA 2ZG2A 4ZTPH 1CLZL 2MKWA 2OR9L 5HHNB 2NW3B 3D25B 2OL3L 4WNQA 5C07A 2ZKHH 4PRHA 3OV6A 4FP8H 3QWRA 4U0RC 4PUBL 3MGTB 1YNKL 3VXUB 4ZPVB 3NCJH 5D70H 5E03A 4NQDB 2VO5A 2XPGA 4DVBA 3BGFC 3SDXE 3P4MA 4DAGH 3VXOA 4ZUWB 5BXFA 4UV7H 3QEHA 1UWGH 3RY6C 4HIHA 4JFZL 4OUUB 3RU8H 4M62H 1A1MA 3GMNA 1V7NH 1EO8L 1P4LA 1XGRB 2XQBH 3H7BA 1KFAL 4XCNB 3JXAA 4R4FH 1H3TA 4U6XA 4LDOB 1FIGH 1XGTB 2XG5A 1RURL 3LKRA 4Z7UE 4JVUA 1PKQE 4CMHC 4TULL 2DLFL 4PJ9A 5IVZA 3WFCH 4YWGH 3MRFB 4P57A 3MLXH 2CR3A 4FQ2L 4KFZC 2ICWA 4MSWA 4XWOC 2JF1A 1C5BL 4LNRA 4PGZA 2VE6A 3CMOH 1JWMA 2W0KA 5DSCA 5I16B 5KSUB 1U9KA 1SQ2N 4N0FA 3L3HA 4OIIH 5DF0A 4KK8C 4YFLI 4F2MA 5ANMB 3PWUB 3TJHC 1UH4A 4D0BB 5L7XL 5FKAB 1YY9C 4OGZA 4ISVA 2CRZA 4JKMA 2ESVE 4X80H 5IV2A 1MFBH 3L3DA 1J1PH 4YO0A 5ICZA 4G9FD 1AQDB 3RWIB 2CR6A 2D4DA 4KI5E 3RGVC 1F90H 3BWAA 1PDKA 1QTYT 4Y5VB 4JFEE 1RHHB 3LRGA 5TDPB 2AJ3B 2AI0H 4AENA 5EZIH 4PJFF 2J8UB 2E7MA 1T21A 1ZHLA 3HE7B 1D5XB 2YUZA 1V3MA 3HNVL 4MAYB 3MLZH 3NCYS 3S97C 4KJWD 1JTTA 5DJCB 4KMQA 4BYHA 4PGEB 2FO4B 3DXAA 5J1AA 1X3DA 1OAUH 4JPVL 2RFXA 1IKFL 1UVQA 2VOTA 4NO3B 4GRMB 1NBYA 4ZDHB 3VD7A 4OV6F 5KVDL 1EPFA 2V9RA 4KRNA 3PUCA 4JM2B 4MD5A 1CE6B 2CDEA 2FGWH 4HLJA 1F4HA 2KZWA 3ARSA 4LCYA 5FUZH 3OAUL 4K3EL 4PGJA 5C7XL 4HPYH 1U3HA 4NT6B 4KUCF 3PG2A 2HJLA 4JKLA 3GDBA 1P6AB 1B0GA 5EN2A 3OXRA 3CC5A 3S36X 2VLKB 2GJZA 4MNQA 5KS9B 4TSAH 5C0BE 4LCUA 4WEMB 1W0VA 4GKZA 2K3TA 5DXWA 1EHNA 3FFDB 4XC1H 3KPQB 4PJ8C 1DJSA 4GRLC 2HLAB 2X70A 3IETB 3CVHH 3DX9B 4MNGE 1N0XL 3UTTB 1RZ8A 2Y72A 3BHBA 4EBQL 3L1OL 5MEOB 4G6AC 3FB7B 4IIQB 1ONQA 3STBA 4UV4H 2V9QA 3QXAB 4PV9A 2CLZA 3MMEA 4PB9L 1P9MA 2EDHA 4RBPH 4JKPL 4Y2DA 5DDHB 1R3KB 3I6KB 2VWEE 4XNMB 4EOWL 4KKBC 4YDIL 1RK0B 4FMFA 1MCOL 1VB9A 5JIIA 3KXFB 2FJGB 2YKLL 4FQLH 5ESQA 5DRZA 4EXPX 4OD2B 3C60D 4FTVA 1NFIB 4RGMC 3DYOA 5FHBL 5IT2H 2F5AL 2IANA 3W2DH 4HGMA 5B8CC 1U8MB 2EC9T 3HI1A 4K3HA 3MJ6A 2Q20A 4MJIE 1QA9B 4QXGH 3QEGH 2GY5A 5T3XL 3VWJB 4I1NB 4HMEA 1UXSB 4MX7A 1B6DA 4RMUA 5J6HA 3IFNH 3FCTB 2VNCA 1WLHA 2ENYA 3MXVL 4O2CB 5FO9B 3RGHA 4W70A 4LLUA 5DK3A 1WFNA 1T66D 1EHXA 2O5XL 4AEIH 2MCPL 2R1YA 2GW5A 3QQ3B 4G8IA 5D7IF 3G5ZA 4P2QA 4FQXA 4LSPL 3EO1A 4PJIA 4AEHL 3QPXL 3VXMA 3T3MF 1S8DB 2RB8A 4I3RL 3TFKD 3UPRA 4BQ9A 4RGNC 1IC4L 1I3GL 1FFRA 3LS5L 3HLAA 5AYUH 1NCCL 3QQNA 2QKIA 4UB0H 2AXGB 3TYFA 1QFWH 1HEZB 2W0FA 5B4MC 3MX0A 3OKMA 1SJXA 4KKAC 5EU6E 5T3ZL 2NX5D 5IVOA 3FB5B 4GQPH 1T5WB 3NCCB 4LVHB 1S5IL 5EO1A 5CKGA 4BZYA 5FB8A 5SWZE 3G6AB 3WSQH 3CUPA 4YUEL 1F97A 3W39A 3A6BH 5EU7E 3I3DA 2FEEL 4PJDB 5T1DH 3SKUD 4KVNL 4CU6A 5CBEA 3KHQA 3MBXL 3MRIA 2H6PA 4R4ND 5EOTA 4PJ5E 2PW2A 1IGTB 5DJ2B 4YEFA 4M61A 3WKNA 5DD0L 1P1ZA 1GC1H 4P5TC 1DEEA 2Z4QA 3DUSB 1RVFL 1N64L 2CUHA 4A2MA 4FXKA 5C0FA 4UIMA 1KCUL 2XTJB 3WXVL 5F9DC 5I1IL 1MRDL 2VXTL 4IMLB 1AE6H 5JUEH 4IRSB 1F42A 1S7RB 5GGTH 4HH9B 4Q9RH 3VGGA 2VZVA 4E9LA 1T7ZA 5KZCD 1A6UH 3PHOA 1A0QH 5M7QA 1ZT1A 3MSPA 2DLGA 1WJ3A 5BRZB 4J8RB 2UZIL 2X4UB 1QKZL 2FHBA 1AGCB 3FQWB 4G8EB 1J05A 1NBZB 5HGGS 4PRPE 2X1OA 3PWLA 1EFQA 3AXLB 1C5DA 2IH3B 4S1RH 1IILE 1OWWA 1M05A 1F4WL 1A1OB 3U7WH 3TYGH 1CFSB 3SQBA 3VFPB 1JNNH 5IUSA 4EJ1C 4EN3B 4ZYKA 4OD3H 2DQFA 3BN3B 1D6VH 2KQNA 2X05A 5A2IH 1I8IB 4TUJA 3LH2H 35C8H 2Q8BH 1KIRB 1PGRB 4OZHA 4BKLB 4KTEH 2AXFA 1KXTB 2NZ9D 3MRRA 1GGBL 4G6ML 2XN9D 4KPHL 2ZG1A 3EJZC 3ZYOA 4Z7OF 3IU4L 3X3FH 3GBNL 3HG1E 4O5LH 4YX2L 2IALB 5DI8A 4XHQA 4H1LB 2XXCB 4QOKD 2QR0B 3OF6D 4TUKL 5DMKA 2X7LA 2Q7YA 1R3HB 5GS2H 3ARWA 1KTKE 5DS8B 1C08A 1OD9A 2UWEF 2MHAA 2LQRA 5CZVH 4RRPG 1DN0B 2VH5H 3BRGC 5HHME 4C56D 4KGLA 1NUFA 3EYFB 3ULUE 3IDYB 3QO1A 1CICA 5C0NC 1F8TH 3PJSA 3TJEH 1IGCH 3RVVD 3I84A 3OR7A 4H0GA 1S3KL 1U2CA 4NQCE 3RVWD 3MOAH 4JG1H 5DRXB 3MRNB 2HT4C 3ZDZF 2NY4C 4NO2B 1CT8A 4Y5YC 5D93C 5I19L 3MODH 5MP6H 5C86A 2QADB 2V2TA 1UENA 5K9KA 2H3NA 2JCCB 1NGQL 3WD5L 5DHVH 5JORA 4ZD3L 4Z77A 1AH1A 3CLFH 4RMQA 3RTQA 4WWKB 5I66A 1BQUA 3V52H 2YPLE 5JXAL 3HI5L 5C09D 3QDJB 3LPGA 4MVBD 1PLGH 5MHSD 4ESKA 4LOUD 2EYTA 1S7SA 3G04A 4TOYH 5CEZL 2A83B 2C7UA 4IRJC 4DN3H 3I3EA 5BMFH 2YD1A 3LKNB 3ARZA 1NGZA 4F9LC 4LSVL 2XZAH 5KSAA 4GW5B 3AS0A 4JN2B 1T7XA 1UKQA 3L5WB 3VXPB 1KLGA 3HB3D 5DMIL 4P3DA 3N1GC 3QUZC 1VFUA 4HLZH 3EFFB 4LCCC 4PD4J 3R8QA 4M7ZC 1DBMH 2J6EH 3S88H 4P2OB 3EHBC 1FAIH 3I50L 1IM3B 3BD5A 1LMKA 4LHUA 2EKJA 1D5MB 2YC1B 1NJ9B 3DURA 3OKLB 5HYFA 2EH8H 2Y7QA 5C08B 2AW2A 5CFHA 1YEJH 2Q3AA 1AD0A 1S9XA 3B9AA 3KJ4C 2SEBB 3RZCD 1B0WA 3ZE1F 1KJ2L 3MLYL 3U36A 3GJFK 1C16A 2WUCL 2AJXH 2HFFA 3FONB 4PP2B 5TF0A 1S7UB 4LCWB 4MQXC 4WV1C 5GGSB 1ZVYA 1T0MB 4XWOD 4X6CA 5D8JL 4H25B 1MCIA 2BOCA 4MXVE 2WLZA 3MV9A 4NN6B 1Q8MA 3MRHA 2Y4SA 1AD9B 3B43A 4WVRA 4KK8D 4JPWL 1DBJL 2NTSP 1SY6H 3LD8B 5ADPL 5JHDD 4OZIB 4XC3L 3WFEH 4JDTL 4U6YA 4M7KH 3TJHD 3L9RA 3FO0L 1YY9D 4OT1H 1OAKL 1A7NL 5D1ZA 4YDKL 5HI4C 1A7OH 2AJUH 2DYPD 4Y19D 3FHAA 4H5SB 1RZKH 1WGOA 3UTZB 4WI4A 4PJCB 3IYLW 3SHSA 4GW1A 1JZ5A 4HXAH 4E41D 1NKOA 3BIKA 3RGVD 1A1NA 1YY8B 2NY1C 4FRWA 5F89B 3W9EA 3CPLA 4KK6C 5CJXC 1P4BH 3V5DB 4OV5B 4GKOA 4GG6A 5DR5L 4K8RH 1CIUA 3V4PL 5TE6L 2X89D 5IB5A 2B5IC 3NOIA 3WEXB 1CFNA 1U91B 2F5BL 1OP5H 5K59E 4X7SL 4G6FD 3FB6A 3P77A 3CFBB 4X4XA 5ALCH 5E2UL 2XKUA 2VYRE 2DDQH 3HZMB 3V6FB 2EDRA 4LARL 4HWEL 4M6AA 3D0LB 3MV7A 3MV8E 4QXTB 3L3GA 4P99A 2L7UA 2Y36H 3IDMB 5IWLC 5GGRA 2FECI 3P4OB 4LSDA 4HWBA 1QEWA 2CO6B 4M7LL 4U1KA 3BPLB 2JK5A 3EYUL 5AZ2H 3P9WB 3FN9A 4A2LA 3MOQA 1UYWH 1JE6A 5JZ7D 4PJHE 3P11H 5FYKU 1HK6A 4Q6IA 1KXQE 3N85L 3QEQD 2F58H 2VL4A 5I71B 1YC8A 4PJ8D 3KJ6H 1VEPA 5ISZA 1KJMA 3QDMD 4FXLA 5A3ID 3S96A 1YEEL 5GGRY 2YXFA 4G6AD 5CJ5A 4QTIL 1Q9KA 1MLCA 5ERWB 5BQ7A 3PL6A 1B0RB 3PNWA 2YPKA 3GMLB 1HQRB 3ISWA 4H20H 4HT1H 1I7TB 2UUDK 3KYKH 4PLKC 5TPWH 1BOGA 1TMCB 5LBSL 1AGBB 4JRYE 1T03H 4KKBD 1HHIA 2WIIA 2YRPA 1OGAB 2EC8A 1SJEB 3ZTJH 4P2RE 4I48A 3T77A 1MPAL 3MRLB 1T4KB 3CDFA 1NGPH 4FS0A 3FFCB 3OJVC 3MGOA 1E28A 3MRCB 3PE9A 5DUMH 4NKOB 3GHEL 2BSTB 1ZVHA 4LSUH 4U33A 1XF1A 3S36L 3BH8A 4V1DD 3ARDB 1NLDL 1T1ZB 4P5KA 32C2A 3PHQB 3SE9H 3RQ3A 5CINH 1CK0L 1PAMA 2XRAL 3HAEG 3HUJB 4NDMB 5FCUL 3SKOB 3H2WA 4AK1A 1H5BB 5EFIB 5I8OH 5A2KH 1S9YA 5I1GL 3IF1B 3DSFL 4N8CL 4Q6YA 4UMGA 1CDHA 4R90L 4UOW0 5T1LA 4PREA 4J3OC 4UAOB 2Q3ZA 4G3YL 3VCLB 5AZEL 4PLOB 3V4VL 1G7LB 3B2VH 1BD2E 1N8ZB 2H41A 3BEVB 4N0YL 4NGHL 1SM3L 4R7DA 1NEZB 5E4EC 1N3NB 1P7QA 1QSEE 5KVMC 1I4FA 2MNUA 1YA5A 4JFOB 3ZKMC 3T0EE 1KTRL 4HX1B 1AKJA 5EPMA 5EIIA 5F9AC 4ZG1A 2FZ3A 2H1PH 3WKML 4Z9KB 4TVPH 3TBWA 5F7YC 2OR7A 1OM3L 5C2BL 2Z35B 3WXWL 1WWBX 4OM0H 1JPSH 5B4MD 4KKAD 1WAAA 1FFOB 1SBBA 1MLBA 3EDEA 2Z0BA 4TSCH 2UVFA 3BZEA 2CJUH 3N1QC 3AY4A 3HPLA 3U7AA 1UB6A 3LKPA 1P6FA 3BAEH 3RWFB 4P2CG 1VFBA 3L3KB 1KJ3L 4PJAF 3TGXA 2IBBA 1JPTL 4M8QA 4JLRB 4HJ0C 2H45A 1HDMB 3PGCA 2ZUXA 1QSFE 5I1EH 4F7EB 4GXVH 1JRHI 1FFPA 2ZOKB 4R0LB 4XP9H 5D1XB 1BJ1H 4P5TD 4E5XA 5IGXH 3RL1B 1KOAA 1LO5A 1UQSB 5KN5A 3H0TB 4XNXH 2IJ0C 5HYSA 1E6JH 2W59A 1FZMB 4NKDB 4TSBL 3QJHA 1HZHL 3DX7A 1YNTB 4UDTA 1UACH 5DTFA 2IMMA 1W72L 4R96A 2AJSH 3KNBB 4CJ0A 1I7UB 3QIBB 2QQLH 1XR9A 3IVKB 1J8KA 4ODHH 4ENEC 1EMTH 5FYLL 1ZHNA 2WINB 4WU5A 1JNJA 1M7IA 1UJ3B 1NC4D 1G7QB 2H26A 5I2IB 4XGZB 1GSMA 2IG2L 1X5XA 2PR4H 2C26A 4JGMA 1UWXK 1RUAL 4TNVF 2FH6A 4QRRD 3T8XB 4LASL 1OAQL 2CDGB 4NSKB 1GIGL 1Z0NA 3NIFF 5SX4I 1RZ7L 5T3XD 4MCZA 4U6HB 2ZCHH 1UKSA 5F3HA 1XGQB 3FJTA 2C4FU 5FF6A 4JFDE 4G8GE 1A6AB 5FFLA 3VGBA 3K80A 4Y5VC 1LDSA 1S7VA 3MRMA 4KV5F 2P5EA 3QRGH 4KWUA 1H15B 1HXMB 3D39D 4Q2ZA 4ZFFB 4XNUL 3MLTB 5ENWB 3FT4B 1F6LL 3HE7C 4OFDA 3MLPA 1JTPA 4N1EA 5FDWA 4MXWH 4O51A 4MAYC 2X4PA 4WY7L 3OR6A 5I1LA 3MLVH 2D7QA 2FX8L 2ORBL 3VFNB 1HHKA 2VR5A 3NTCL 4WEUD 4L5FH 2R2HB 3WHXA 1GHFL 4F9PA 3EJZD 5ESVB 4P4RB 3VFGL 3RUGA 2XV6B 3FQTA 3V6OA 1KPVA 4D9LH 5T3ZD 2BZDA 2GITA 4JM2C 4NRXA 4QF1A 5KAQG 4J6RL 3DO7A 4QGTA 4Z7NE 2CSPA 1JMXA 4HUXB 3HNSH 3I75A 4EDWL 3TNMA 3V5HA 1ACZA 1W0WB 1H3WM 4XMKH 4Y1AD 4JJ5A 3VRIA 1OTSC 1CGSL 5BZDA 4PBXA 2XTLA 1FP5A 3UCRA 1X5ZA 1CVSC 1XF3B 5HHQB 5C0ND 2Z91B 1EO7A 4QHLA 1MRFH 5K93A 1AXTL 1AHWB 3PV7A 1N6UA 4LAJH 2NY4D 2E9BA 5D2NE 1TFHA 1T22B 2C1OA 1KB5H 1Z6JT 4Y4HB 1S7XB 5DHXB 3B9KC 1WC7B 5FKPA 4GAYB 3TPKA 4D3CH 3HZKA 3ZSTA 5I30L 1U93B 4ZMAT 2AXHA 3OSKA 2ITCA 4PJXB 1L0YA 3EOBB 3S34H 3U1SL 2C4XA 3KPMB 3RWGB 2HRPH 1NLBL 2P5WE 1Y6KR 5DJAA 4JO3L 1T20A 5DVOA 3BPOB 5T33H 3BDYL 1BZQK 5DEZA 4HJJL 3WL9A 5IG7B 4JO4L 4XMPL 1UH3A 4AM0B 5CHNB 3PGDB 4YHKL 4HUUA 5DWUH 1MI5A 2JELL 3ROOA 1NAMA 3QCTL 2Y5TB 4NNPL 3EAKA 4LLVB 1FVCB 3F12A 3C5JA 3UXFA 4KK9D 4BZ1H 3UDWA 2EDTA 3EHBD 5F1OB 4FFVC 4NZDA 1J1XH 2GAZA 5CS7A 5E1HB 5IQ7L 5J8OA 4DGYL 5LXGH 5I0DA 2D9QB 4PJGE 4ODSL 4AT6B 5JIPA 4YBLB 1VEMA 2VIRB 3GNML 1GZPA 3CFKB 5C0CB 4LGPB 3UTSE 4M7JL 1BVLB 2ZSWB 5F7EL 2CIIB 4N0RA 1JK8B 3BX7C 4DQOL 4G6KL 2HAZA 3AU1B 3QHFH 4MQXD 3HCVA 2EYRB 1NFDE 4AH2B 5E08L 2W91A 1UM4L 1YEDA 2ZNXA 4DKFL 1RSFA 1RUPH 5DHYB 4JKWA 2YMXH 1IQWL 5DO2C 2AERT 3MO1B 1RJCA 2EDWA 3ARPA 4F7MB 2FJFB 2P8LB 4LPTA 4EI5C 4ZSOA 4MA7H 1A4KA 3O4LA 3HR5A 3SGDI 1LD9B 5FOBB 4PGCA 5IVXA 1X4XA 5HI4D 5LJYH 3EO0A 4LVHC 4U6VL 3G6JA 3M8OL 1FGNH 1H3PH 2P43B 3IGAA 4AG4L 1IZJA 2NY1D 3NZHL 1ZLUK 4TNVK 4ELKB 2DBLH 2EH7L 2OP4L 4GRWH 4H0HB 4N0UE 2OTWA 3VG0L 1U8HA 3TWCL 1FRGL 1WZLA 2MKLC 5GJTL 1JHTB 1O7SA 2Q7NA 3WNMA 5JA8B 5IJKA 1A9BA 1MCPL 3JV4A 5JR1L 2YUVA 5A2FA 5LVEA 4DKAA 3RL2B 3INUL 5CEZD 3U30B 1QQDB 5LWYL 2NCMA 4J4PA 2NLJA 2B39A 2R1XB 1UC6A 7CGTA 2VXVH 3VD5A 5C1MB 4K23L 1V3KA 2A9MH 1RJYA 4ACPA 1S78D 3L3JA 5C07B 2DLTA 2VLJA 4PRHB 5E2TL 2P42B 2XPGB 4YBHA 5BZWA 5C0RH 2A73A 3MRDB 5DMGC 4JRXE 2BNRD 4OCXH 2WK2A 3P4MB 3VXOB 5BS0E 2QQNL 3BRFA 4XXDA 4HIHB 3O81A 1NL0H 5KVFL 4HXBL 1A1MB 3VI4E 3VXTB 1NUGA 2I26N 4PJ7A 4R26L 1P4LB 5EIQA 5HDBE 3H7BB 4A6YA 4JFFE 2AEIT 1ZV5A 1CIDA 4P4KB 4U6XB 3U0WL 3LKRB 4BFEA 3LS4H 3RDTB 1DQQA 5K9JL 5E8NA 1GGCL 1P5VA 1DQJA 4PJ9B 2IQAA 1G7HB 4P57B 1YEHL 3PQYD 4U4BA 1Z2KA 2ICWB 3VH8B 4I2XA 2VQTA 4MSWB 1CS6A 5ID1A 1E4XI 4LNRB 1ZA6A 1GZQA 2VE6B 2BVEA 1JWMB 3C5ZA 2FECL 4CMMA 5DSCB 1NGYA 3ILPA 1J0IA 1JI2A 5I73B 1LDPH 4N0FB 3B9DA 3ZKSD 4U31A 3HC3L 2XZQH 4ZTPL 1KEGH 4YC2B 4F2MB 2IAMA 5EU5A 3WDJA 4I4WB 4PRNB 4ISVB 3STLB 3IDYC 3MOBL 4HWBH 3NCJL 5D70L 1JYWA 3FRPA 2DI8A 4OBRA 2EECA 4HK3J 4QRQA 3RRQA 2IC2A 3QDGD 1EEZA 5ICZB 4JFYA 3MUJA 4ZUSA 4DAGL 4U1GB 4YQXH 4N90E 3CK0L 3BWAB 1B3JA 4FFWC 1IAII 1S7WA 4OZGF 3NIGF 4M62L 2QADC 4J7RA 1V7NL 4AENB 1WF5A 3LVEA 3VI3F 2VDKL 4CDGC 1Q72L 2E6QA 1T21B 1QBAA 3P9MB 3EO9H 2BY1A 5KTEH 1Q94A 1T1XA 2HN7B 4P3CH 3DVGA 4QRPE 2VL5A 4Q97A 1UM6H 1TZIA 3EFDH 1NMAH 1WBZB 3DXAB 1VENA 3GBLA 4X6DF 4ZPTA 5J1AB 3ZKMD 2NYYD 1CI5A 5K9OA 2Y9RT 5BW7C 1NBYB 2DWDA 2ATPA 5B3JE 4XCFL 3NN8B 1NCTA 4NQDD 2I9TB 4MD5B 4ZS6C 2BY3A 2CDEB 1JYVA 3ZE0F 3M45A 3L7FA 4LCYB 4OIIL 3T4AA 3ALXA 4MNQE 3S4SG 1HHHB 1U3HB 2ICWI 2HJLB 3LKSA 4LLMA 4Z5RA 1A8JH 1B0GB 5EN2B 3OXRB 4N1HB 2GJZB 4P2OC 2D0HA 5GPRA 1J1PL 1MCKA 4LCUB 4MCYA 1TITA 5LGJA 3CZFA 4HJ0D 3IJHA 4POUB 3QNZB 2BVUA 1I9RL 1OARH 3U46A 4U3CA 2WAHA 5K9QI 2X70B 2XZCH 1NQBA 2AI0L 5EZIL 3NAAH 3BHBB 4MA8L 3QXDA 4J3VA 3X14A 5JOEA 1XIWD 5E1AB 1PKQB 2XKSA 1ONQB 1RPQA 2W9DH 3MLZL 4JHZA 4PV9B 1T89C 2CLZB 3MMEB 4NN6C 2RHEA 5CIPA 4TVPE 3D2UB 4X7EC 3IDJA 4Y2DB 3LD8C 4MDIB 3A67L 4FXGB 3QNYA 4UTAL 1OLZA 2FJHA 3OKOB 3TP4A 4F3FB 4FTVE 2FGWL 2BY0A 5ESQB 5DRZB 2ZCKL 5FUZL 3QI9A 4NO5A 4PJBE 1HKLH 2ESVB 3FB8A 3FOMB 1YEFL 4LSRH 3RIFK 5IHZA 5A2JH 2IANB 4GSDL 1JRHL 3HI1B 4K2UL 2EYSB 4TTDD 4NQEE 1G9NL 3ZT5A 4RDQG 3NBNA 2AEPL 1EFXA 1UA6L 3HE7D 5J6HB 5KVGL 4ODUA 5BOZG 2RCSH 5TDNA 4JFEB 3H6JA 1S5HB 4HAFA 2NMSA 3QUKA 1FL3A 4P9HL 3U4BH 5E9DA 1HILA 5GS0D 4P2QE 3HMXA 3BKYL 3S37L 5HJ3A 1NBVH 1U8LB 5MENA 2R1YB 1KACB 2WWMC 4LSQL 2D3VA 4G8IB 3G5ZB 4FQXB 1YZZA 3EO1B 2E6PA 4YFLF 3VXMB 1LK3L 3UPRB 4L3EA 2LTQC 3WIHA 2LABA 3T08A 5DK0A 3CNKA 1HI6A 3HLAB 3PXJA 2QHLA 3TYFB 1I8MA 1PG7H 1A2YA 4XXCA 3OKMB 1WCBA 1E4KC 1H3GA 4HK0A 4FQLL 1KPRA 3T3PF 5C6TL 5EO1B 4M03A 1UCTA 5FB8B 1J5OL 3Q3GA 5GGUA 5IT2L 3CUPB 1TNMA 1G6RA 5C0BD 3W39B 1R0AL 2OS7A 4X6BA 4K9EH 5I71C 5TH2A 1U8IA 2DQJL 4OZ4A 5CBEB 4E0RA 5L2KE 4QXGL 1JFQH 3KPTA 4KTDH 1F2QA 5E7BA 3B9KD 1QACA 2H6PB 3KS0H 5D6DA 2PW2B 1GPOL 1IM9D 2DQHH 3PV6A 4M61B 2CMRL 4N1CA 3O3BA 3EYSL 3DRTA 3TIEA 4WO4B 1DEEB 2Z4QB 1WBYA 1JZ7A 1NEZG 1DQDH 3ARRA 5FYLD 4FXKB 2NY0C 1DSFH 5FAAA 1WTLA 5HXMA 2EDJA 3DYPA 2IQ9H 1OTTD 1HYSC 3KXFD 2Z93A 5GRJH 3AM8C 3MJ8B 2EIDA 2FLBT 2AV7A 4CKVX 2YD7A 3PWPA 3E6FB 3QEUB 4LRIC 1ZT1B 5ACZA 3TZVA 4IRZH 4M6NH 3VFTA 1G9NC 2BX5A 1I7ZA 4OFYA 1H5BC 4LKXA 3VFVB 3D69A 3WFBL 2DQIL 4KJQC 1J05B 2XNAA 4FFVD 1D5IH 4P9HC 2D03H 5C0DB 2R69H 4LLAA 1C5DB 4MJID 1M05B 4X4YB 2AJYH 4JB9L 5JNYA 2GFBA 3QFJE 2EO9A 4KK5C 3T2PA 2OR8A 4HCRA 4ZYKB 3DV4B 4M1CC 1F2XK 2DQFB 2MQ3A 4MZ2A 2OTUB 4TUJB 5LGKA 4L4TE 1SEBB 2AXFB 4ZFOA 3SBWC 1GC1L 3MRRB 4XRCA 1BQHA 5DI8B 4O02L 2H32B 4PS4L 5IHUH 1MWAA 2DQEL 4EI5D 2X7LB 4PGDA 3U83A 1A7PH 3UTQA 2MWCA 2P8PA 4LPXA 1C08B 1H8OA 1XT5A 1RJZA 3ZT7A 1S9WA 4AEFA 3Q6GH 3QCUH 3CX5K 5JUEL 5C71A 4HG4K 5JPNA 1CVRA 3DHMA 4ZQKA 1NAMH 1A6UL 1CICB 3QIWC 1A0QL 3QO1B 4JM2F 3H9SE 4ERSL 2KUTA 1KELH 3OR7B 4JAMA 1ES0B 5SWZB 1CU4L 4CVZA 1R3IH 4R0LC 1TVBA 3TO4C 3BSZL 2Z9TA 3U7WL 3TYGL 4PJ5B 4DKDC 2V2TB 3WJLA 5K9KB 4DK3A 2J88H 3PP3K 1HHJA 1JNNL 2N1KA 4S1QL 1CGXA 3ULVE 3FOLA 4JZNB 5JORB 3CU1A 4Z77B 2Q8BL 1HNFA 1YN6B 3GM8A 2FX7H 1JWUA 4M6OH 2DTSA 3WFHB 3QIBC 5JQHC 4U1IA 1K8IB 1NC2A 2WANA 3G5XA 3R0NA 3X3FL 5DD3H 3FQNB 2EYTB 1S7SB 3G04B 3I02A 4HS8L 1UJ3C 3VXRA 2C7UB 3PDGA 1KC5H 1QBLL 3C8KB 1PEZA 4I77H 5FUOH 1NGZB 3C2SA 2HFTA 4BJLA 4M5ZH 1DR9A 5DMGD 4JDZA 5ELIA 5DJDA 2I27N 1XZ0B 5CZVL 2DIJA 3HMWH 1KLGB 1EJOL 3KR3L 4MD4B 4P3DB 4XMLH 3HA0A 2Z92A 4GRWE 4M1GL 1FYTE 1U2HA 3LOWA 4PRPD 2H2PC 1BHGA 4LHUB 3K74B 3DURB 1VGEH 1R24A 2Y7QB 3MOAL 3SE4A 1GC1C 1MAMH 3OKYA 1AD0B 3KPRA 1S9XB 4O2FA 3LEVH 3U36B 4JG0H 3TPUB 5D2LE 1X5GA 1G7PA 4UI2A 1P4IL 1K4DA 1CDIA 4QHNA 2PTTA 1YYLH 4X6CB 1T0NA 2G60L 2BOCB 3CLFL 3MV9B 3S5LB 3BE1L 2OZ4A 3SJVD 5CMAB 1CF8H 4QYOA 1TNNA 4F7CA 2ZP0T 5F1IB 1GOFA 3BKCL 3U6RB 2GJ6A 4TOYL 4U6YB 3L9RB 2Q8AH 2A6DA 5BMFL 4ZAKD 2LU7A 3S3PA 1MRCH 4H8WL 4UU9A 4WFGE 4Z7WE 5D1ZB 5CWSB 1YUHB 1D5ZA 2GY7B 3ULUD 1N5YL 4GW1B 5C0IA 1N7MH 1LE5A 4Y4HC 1A1NB 4YHML 5DEGA 4FFWD 1DBML 1FGVH 3O2VL 5CSGA 1R5WA 1SYVA 1MJUL 2QADD 1FAIL 2YZ8A 3W9EB 3CPLB 5CSBA 1LVEA 1IEAB 4CAGA 1FE8H 3TA3B 3F5WA 1EBAA 2EH8L 1E4XL 3VFUA 4PJDF 1I3UA 5IB5B 4HJGA 2FGZA 1G7IA 1CFNB 3T0XA 3O0RH 4XNQA 3ULSB 4WW2A 4XP6H 2X4OB 1CDJA 3T4YA 3P77B 4C59B 2BJMH 2DJ4A 2YPLB 4JDVA 3E0GA 3ME0A 1BOYA 4YXKL 2MPAL 4ZS6D 3SKMA 3DTXA 5L8JB 2XOTA 3UJTH 3MV7B 4NUGH 3L3GB 1DBKL 1NCBH 4K94H 2W1NA 5HHOA 2VAAA 4M7KL 2YRZA 5L6YH 3VD3A 5F9JB 4GAGH 3D85A 1T2XA 1IAIL 4JFQA 4P2OD 1FQ9C 4U1KB 2BRRH 1A7OL 2CLVA 2F54D 2JK5B 2AXJA 4RFEA 4PRIA 5CD5C 3ARFC 5C08D 3AFLA 4YBLC 3QUXD 4L9LC 5C9JB 3O6MH 4OF3A 4JHWL 1A3LH 2IEPA 2DQCH 4HIXH 4IDLA 3RX5A 5ISZB 1TQCC 3TH3T 1KJMB 3BUTA 2R23A 3VXQB 1Y6MR 2HYMA 1DUYA 3MLSL 1YNLH 4RRPA 1JCKA 4POZC 4JGUA 3QWQB 1Q9KB 1MLCB 5C0AA 5BQ7B 1OSPH 3PL6B 4LFHG 2FIRT 3ABZA 1EZVY 4J23A 5D71L 3AB0B 4U7SA 3ZYZA 4EUPH 3VFMA 4MYWB 1NDGB 2YWZA 1L9NA 2YD2A 3U48A 4QY8A 1EUUA 4H8WC 2WIIB 3LEYL 3MRKA 3BD3A 3T77B 1JGEA 2RAMA 3HI6L 1T5XA 2EDLA 1L7TH 3QFDB 1I3RB 5ID0B 3MGOB 2Y36L 3FTGA 1IAOA 4XPBL 5FHAL 1EHLL 4P5KB 32C2B 1B4JL 5IEHA 5EUKA 1UZ8B 4CGTA 1ZHBB 3MUGB 1II4E 1YMME 1S9YB 3GRWA 1QBBA 5AZ2L 1INDL 2YRLA 3SDYH 2CKBH 3JUZA 3O41A 5T1LB 5DJZA 4D9RE 4PFEA 4PJFE 3TVMD 2VXQH 1K3IA 1SYSB 3VGDA 4JE4B 5CBAA 3VH8G 4R7DB 2VDML 4Z78A 1I4FB 2J1KA 2F19H 1G84A 3ARED 1KNOA 3MC0A 4Z6AT 2PO6A 2JCCF 2R56H 4RSVA 1GGIH 4J3UA 1AKJB 4FZEH 5EIIB 2OBGA 3LQAL 2DTMH 1JPGA 2IPUG 2VLLB 3SCMA 3B5GA 1V3LA 4ODTH 4XHJC 4YXLH 1T03L 5EZJB 4KQ4L 3MV8D 4NWTH 2B20A 4PBWD 1DUZB 1MLBB 5C92A 5K9QG 4ZNCD 1QR1A 3BZEB 1ZOXA 2YEZB 5IFAH 2BVTA 4LSUL 3AS1A 3LKPB 1VPOH 4BM7A 1ITBB 4M1DH 5EOCJ 4FQJL 5CP7A 5F96H 1AO7A 3PGCB 4LL9A 4PJHB 4UTBH 1DVFD 1KLFA 2V2XA 3DBXA 4HIIA 4PJ9C 4MMXC 3TO2A 1OPGL 1EO5A 4JM4L 4E5XB 1IRAY 1LO5B 2YK1L 5KN5B 5HYSB 3NA9L 4OFVA 4QCIB 5C3LD 2NY0D 4DJMA 3QJHB 3DX7B 4UDTB 1MCLA 2JIXD 4DKEH 2HKHL 3O9WA 3TC9A 3CLEH 4YC2C 3DX8A 1XR9B 4JRYB 4NBZB 1ZHNB 1FSKB 3GK8L 4U0QB 4WU5B 2O61A 1M7IB 1WWWX 1Q38A 5GSRA 1J87A 4P2RB 2H26B 1RI8A 4TVPL 1AP2B 4P23A 4PRDB 2HA1A 4R7NB 1NUDA 4OIBA 1F45A 4MCZB 4OLWH 4OZIF 4HQQH 4MXVF 5F3HB 4U1GC 1CLZH 2OR9H 5FF6B 1CE1L 4AQOA 2OL3H 2GEEA 1S7VB 3MRMB 5GGVY 4PUBH 2P5EB 1CDYA 2FYYA 4OLZL 3W5MA 2Y1VA 4PJCF 4LHJB 3QNXA 1QG3A 4X99A 3CSYB 4JREB 4Z76A 4O51B 4M1CD 2X4PB 5F7FA 5I1EL 3KDMB 3OR6B 1KF9B 5I1LB 1HHKB 1IEBA 4F7PA 1Q1JL 3V6OE 3LQAC 5GIRB 3ARXA 1DE4A 1BD2B 5IGXL 3RUGB 1EO8H 1QSED 4XNXL 3W0WA 2GJJA 3FQTB 5GQBA 5D7IE 1KPVB 4XPHL 4WI9A 1RQ5A 3T0EB 1AR1C 3DO7B 3KPSA 3T3ME 3I75B 1RURH 2AJSL 2NQCA 1U3HC 5AUMA 4TULH 2DLFH 3TNMB 3V5HB 4DK6A 4N8VA 4ODHL 1JV5A 1C1EH 3IU3A 4JJ5B 3P0VL 4GS7B 1U95A 4FQ2H 3I6GA 1H3VA 1PG7W 1C5BH 2PR4L 3QIWD 2EEBA 1PG7X 4QHLB 1Y18A 4Z95L 1JN6A 5EZLA 3C2AH 2FIKA 3IAGC 4LLWB 5F7UA 4M48H 2Z8RA 1S7QA 3Q2CA 5DQ9A 3X3GH 3BZFA 5L7XH 1TTFA 3TO4D 3MGTA 5FKPB 1QSFD 3VXUA 3DHJA 5FCSH 3HZKB 4HCRH 1KCLA 5DJXB 3PWVA 4MXWL 2ITCB 1RU9H 5IB3A 3MLVL 1P9MC 1ZWIA 5SX5K 1FNEA 4L5FL 4OUUA 4Y2DC 3DECA 3HAEA 3WNOA 3QCVL 4YHLL 1BX2A 1XGRA 4OFPA 1T20B 1MWAH 3HNVH 2XACC 4PP1D 3WL9B 3MCKA 1GAFL 4OF6A 1J8HB 3HNSL 1X5YA 4HWNA 2M2DA 4C83A 1MI5B 3QAZB 4XMKL 3MRFA 1RD6A 3RA7L 1DQMH 2X10A 2F53A 4QTHA 1IKFH 3H9ZA 3F12B 3C5JB 2BMKA 3AS3A 5KVDH 4JFDD 1I9JL 5H2BA 4NZJA 4G8GD 4M6ML 2H2PD 5I16A 4JKKA 4O2EB 4YHZL 3OAUH 4K3EH 5C7XH 3CDGB 5ANMA 3PWUA 2X4TA 5E2JA 2M8XA 2X41A 3HUJF 4MDJA 1GZPB 2NXYB 5FKAA 3V95A 5FGCB 3VFWA 3VFOB 1BVKA 3AMKA 2X4RA 2VZ1A 1QFUL 4FQXC 3HCVB 1DZBA 2RGSA 2FATL 5E5MB 1FZKA 1X44A 3RWIA 4G9FA 3DV6A 2AJVH 1YEDB 1MCQA 4Z7OE 5D7KD 3SO5A 2A6KA 2HRPL 1N0XH 1AJ7H 2KZ1B 4ZSOB 1A4KB 3O4LB 1E4WL 3ARBA 2J8UA 1FCCA 1YQ2A 3HR5B 3TN0A 5T33L 1D5XA 1ZEAH 3BRDA 4XPAH 4PGCB 2UWEE 3VJ6A 3DROA 3EO0B 2AK4A 2LV4A 3G6JB 4NM8H 2UZXB 4ZO8A 1B2WL 2BP3A 3G5YB 4FN0A 2FO4A 3BQUA 3EIFA 4EOWH 4YDIH 3WFDH 4HZAA 3I85A 3OQ3B 4WDIA 5BJTB 3CFCH 4HKJB 1MCOH 2V7NA 2A0LD 1J1XL 2YKLH 1MAKA 2OTWB 4WTWA 4X8JA 5LXGL 5DD6B 4Y4FB 1U8NA 2NY2C 1A9BB 4S1DC 2NX5E 1PD6A 2F5AH 3JV4B 1WCQA 2HT3C 4HV8B 5TE4H 5KS9A 4LPUA 3DIFB 3QHFL 2DF3A 4LCIL 1FV1B 2P5WD 2OZ4H 3X11B 3MXVH 3F7YA 3L3JB 1RUPL 3FFDA 1PQZA 2VLJB 2YMXL 1L7IL 4PGBA 5J89A 3TF7C 2O5XH 3UTTA 2MCPH 4QXUL 3CH1A 2A73B 1HINH 3FB7A 4IIQA 1IQDB 4YIQA 4LSPH 1DN2A 4AEHH 3QPXH 5EUOA 2H8PA 4PJ7E 3QXAA 5EO9A 1SHMA 2GKIA 1CXHA 3OJDA 1H3XA 1H3PL 3ARFD 5CD5D 2A9NH 3LS5H 5DDHA 3I6KA 4NN7B 5C0CD 4A6YB 4F57H 1OD7A 2FHFA 3WMSA 4PJGB 3WO4B 3DGGB 5HDOA 4EI6A 4POZD 4I2XE 3DYMA 3QT2A 1DQQB 5MI0B 5E8NB 5CZXC 3UTSB 4JANA 4IM8A 3FAWA 1DQJB 1QP1A 3ZE1E 4QGYA 1ZKAA 4GAJL 4NZRL 4YUEH 5E4IA 5T5FL 4KVNH 3K1DA 1CDUA 1ZA6B 3OG6B 3WUZA 5D7LE 4HFWB 1GZQB 3ES6A 3RHWK 1BFSA 3VWJA 1TTGA 3QH3B 4L4JA 4CMMB 3L7EB 1NGYB 1UXSA 3AMLA 3ILPB 3JUYA 1OAZL 1M6OA 4NCC2 4M93B 2ILLA 4S0TD 2BOBB 2A9ML 2IAMB 1N59B 5EU5B 1AQKL 1SVZA 5D1QA 4O2CA 1WBXA 5FO9A 1RVFH 5DUBA 1VFMA 4FOMA 2ARJB 3MA7A 1CICC 1N6QH 1CGVA 3LHPH 2XN9E 1Q9LA 2WP3O 1IVLA 4QRQB 5C0RL 1EEZB 1KCUH 1VACB 3WXVH 4JFYB 4OTXL 2BNUB 4OI9A 4DN4H 1JJUA 5I1IH 2VXTH 4ZUSB 4Z7NF 4QOKE 1BZ9B 3QBTB 2XYCA 4PJEF 1J18A 3K8LA 2YD8A 2AXGA 3OJ2C 4KRPD 4YPJA 3VGAB 3QRFM 2UZIH 4C56E 1QKZH 2DKMA 1T1XB 5E8OB 5JPMA 3DVGB 2EXWC 2VL5B 3RTQC 1TZIB 3D18A 3LS4L 3HC0A 4WI7A 3OKNA 1AXSB 1INEH 1F02I 4ZPTB 5EB9A 4Q9BA 1F4WH 3S5LG 5I6XB 5K9OB 4FA8A 1KT2B 4PRHD 5GISL 1ZLWH 3QWRD 2DWDB 1B88A 5TGBA 4PJXF 4XHJD 5DJ2A 2B8OT 3L7FB 2YD4A 5B39G 1NMCB 3T4AB 3OMZA 4P46D 4Z7VA 5KSAC 4MHHI 1KEGL 4FFZH 5IF0B 3GM0A 3LKSB 3P30H 4KPHH 4Z5RB 5I0ZA 5J13B 3WDIA 4JRXB 3W81A 4YX2H 3FHQA 1N4XH 4HWBL 5JOPD 5C09E 4LEXL 3D3VE 1NANI 2BVYA 5JLZA 3O45A 2E3VA 4TUKH 1WT5A 1H8SA 4RBPK 4MCYB 3RIAF 3CZFB 3K2MC 3B5TA 3BKML 3IJHB 4IMLA 4YQXL 3AC0A 1X5AA 3PDDA 4IRSA 1CXIA 4HH9A 1FNFA 5E99H 2EXYC 3U46B 5CKAA 4JFFB 1A7QL 5A43C 1UJTA 3FMGL 3QXDB 1L0QA 5BRZA 3T0WA 3EO9L 5KTEL 1VDGA 4KDTA 2P44B 1D7FA 1NBZA 5CIPB 1X5LA 4LSTL 4UBDC 3AXLA 3V0VA 4ZXBB 1MJ7H 5D72H 2BVQA 2IH3A 3IDJB 5I19H 4FFYL 1A1OA 4TRPH 4LU5L 3QNYB 4GOSA 4RIRA 1KIQA 3MRPA 5IB2B 1NGQH 4EN3A 5D1ZC 5HSFA 1ZLVH 4OSUH 1EDQA 4YXHL 4ZD3H 3UJJL 4BKLA 2VZOA 4NO5B 4P59H 5JXAH 3HI5H 2Q6WA 3BT2L 3V4UH 1BBJA 43C9A 5I1CH 4CRPA 4N90D 4JY4B 4YHIA 5JHDE 3CDYA 3TBTB 3T0VA 1EV2E 1CQYA 1UT9A 4LSVH 4ODUB 5DS8A 5TDNB 3GSWA 4LEOB 5E9DB 1HILB 4OCSL 1EXUA 1DN0A 1JL8A 2XA8H 4I0PB 4R8WL 3CX5J 4Y19E 4IOIA 4HG4J 3O3AA 4QRPD 2HJKA 4V2CB 5MENB 3I50H 4G8FB 1C5CL 3RVTD 2XIDA 5SWSB 2W9DL 1AR1D 4L3EB 1I1AD 2IWGA 4WUUE 1GOHA 3Q1SL 1OY3B 5DK0B 5IFJA 1HI6B 1KJ2H 3MLYH 2VLRE 1BM3H 2YHGA 4JGJA 1NUNB 2WUCH 1I8MB 1KCVL 2CDFB 1A2YB 3KYNA 1WCBB 4MNQD 3RVUC 4BQBA 5D8JH 2YXMA 4EQ3A 4L8SA 3P9LB 1KPRB 2ZCLL 4WWKA 4LVEA 5FV1L 4OCYL 1MCHA 1HKLL 4KGJA 3Q3GB 5GGUB 5F9OH 1G6RB 5ADPH 2ENSA 4Q6IC 4X6BB 4JDTH 5TH2B 4E0RB 2A83A 3EOAA 1OAKH 1A7NH 3LKNA 1U8JB 5HY9B 1Q0YL 2D9CA 4YDKH 3AGVA 2EIZA 3NH7H 5GGQL 1QBMH 3DRTB 5TQ2L 3TIEB 3PL6C 4DZBB 1HE7A 1WBYB 3Q0HA 2WZPD 1FL5A 3AB0C 4Y2DD 1J86A 1NBVL 3ET9F 4TVPD 5CJBA 1IM3A 3MJ9A 5HI5C 5F6HI 1B6UA 3QEQE 5J57B 3QUMB 2Z93B 4MQ7A 3QDME 4JZJA 3S3SA 5JDJA 1FO0B 3V4PH 2AV7B 3JV6B 3MZTA 5TE6H 25C8L 2SEBA 3PWPB 4FTVD 3RZCA 4F15C 2HTKC 3RWJB 3VGHA 1MFAL 2F5BH 4K7PY 3TZVB 3VFTB 4X7SH 4PP2A 1PG7L 2MJWA 1X4YA 1I7ZB 5E2UH 4G7YL 3UAJC 3SE8L 2R4SL 3D69B 3NIFE 4H25A 5EU3A 2XNAB 4LARH 4HWEH 3TIDB 5I1AA 3K4ZA 1WZ1L 3IDXL 5DT1H 4OLXL 1FNAA 5ADOH 1I8KA 3ZKXB 4NQEB 4ONGL 5JNYB 4GBXA 1TTUA 3EDFA 3N1FC 2GFBB 4KV5E 5KSBA 3UZVB 4RFNB 3T2QA 4HW6A 4KTDL 4M7LH 3S4SA 3H42H 2F8XC 3SOBL 4V1DE 2X1WL 3FQUA 5HYSG 4P2QD 4DUWA 2YS4A 2DYPA 3RIAK 5EOQL 3UTZA 5EORH 2DD8H 4ZTOH 3VXMD 2VERN 3BDBA 1BQHB 4KMTL 4QWWD 4E41A 1EEYA 3RJQB 1YY8A 2JJTA 1J0HA 1VCAA 1DSFL 2I5YL 2DLHA 2P24B 4PGDB 2HT2D 1YEEH 4JVPA 2P8PB 4JZOB 1RJZB 3IS1X 5JXED 1S9WB 4OV5A 5GRJL 3NZ8A 5DQJA 1JHLL 3BN9C 5F8QC 3H3PH 3AY4C 5CILL 1YPZB 3E6HA 3T04D 4IRZL 4M6NL 3LV3A 1F58H 3CFBA