2Z31B

Crystal structure of immune receptor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
111
Chain Sequence
AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGDASGGNTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31B00
4F7TA 4JY5L 1XT5A 1RIHL 2I9LA 1KYOK 4J3UA 1BZQK 1XF1A 4JCLA 4FFWD 4YLQT 1WWBX 2BSED 3SPVA 5BO1H 1IM9B 2K7PA 1W8NA 4PJFA 3JV6A 3QXVA 4UIMA 4G8GB 4LSQL 4MX7A 3Q6FB 5FUOL 1H3VA 4HUVB 3KPMB 1BQLL 3LKSB 3GBMH 1UCBH 2L0DA 3BKML 4R90H 5HI4C 4P46A 4PRHE 2SEBB 2VDNH 3SDCD 4JFYA 2RCSH 3IDXL 4M6ML 3MRJA 4FQJH 1N64L 1NL0L 3IB4A 3JUYA 3RZWA 3WEXB 4OLZH 1FBIH 2EH8L 2LV4A 3ULUD 5DTFB 5F71A 5EC2B 1DUYA 3X13B 2FLRT 4P0DA 2FBOJ 3Q5YA 5FO7B 4XCNB 1EHLL 5D93B 5HHOE 4Y16C 3I2CL 1NGQH 4FQPA 4OD2A 5C08E 5ADPH 3KXFA 3GMRA 1MHPL 2WBKA 4I2XE 3QCTH 3B8SA 4BFIB 5C3LD 1NKOA 2BXYA 1A3RL 3TYGH 2GK0B 4ODSL 3SCMA 1UWXH 3DX9A 1X9QA 4HAGA 2AI0L 4UIKL 3VFWA 1RK0A 4Q6IB 5FYKD 2BK8A 3LD8B 4JY6A 1YYLL 2NXZB 3BGMA 2MCPL 4OTXH 3IVKB 5JHDD 1QFUH 2OL3B 1IAII 2R15A 2YXMA 1VFAA 1LO2L 1MFAH 3C08H 1FLRH 2EDWA 3F12A 3FT2B 4J12A 1E27B 1EEYB 1CVSC 2QTEA 1F02I 3HZYA 5E7BA 2I60L 2A74A 4WHTA 3BP6A 5I71C 1BJ8A 1U8IA 4P2OC 2XQYK 3BIKB 5SWZB 5L2JA 1H0DA 2Q86A 4JPVL 4PRDA 3RGVC 3LEYH 3RIFK 4PLNC 4F9PC 3OKDB 1JZ3A 1WZMA 5IB3A 3MRPA 1T0NA 1I3RB 5E00A 2R8SH 3LS5H 1Q9LB 5KANI 2R4RL 1BVLA 1DEDA 1G1CA 3ILPA 1IQWH 4XNQA 4MJIA 5D8JH 4OI7A 2P1YA 3ET9F 4HK3N 2BOBB 3NCFB 4NQVA 3SDXE 4ORZC 3KPLB 3MRGA 3VD5A 4M1GH 2F8OA 1DUZA 4MA7L 2AXHA 2EDHA 2EYSA 4FXLA 4U0RB 2YUXA 2FO1A 1GOGA 4HIJA 4HT1L 1A9EB 4MAYA 3ARGA 3P4OA 2ITCA 4HMEA 5IROA 1XGPA 4LDEB 1A2YB 4X5LA 2R0KL 3NVQA 4Y5VA 5DRZB 5D5MA 4XRCA 3UTPD 2F58L 4N0YL 5GGRB 4KTYA 5MEQB 2C3XA 4TOYL 4WUKL 4Y5YC 2XWBB 2V6HA 3DURB 3AS2A 4CN1A 2NY2D 4PJGB 1QLEL 1UM5H 3C09B 4S1DC 5KSUB 3NA9H 4GW1B 3F7QA 3X3GH 4AM0B 3U7WL 1CFVL 1ZTXL 3QIBB 1HEZB 1U0QA 3T0EC 4HXAL 3VCLA 1IQDB 3V6OC 3OXRB 5IJVA 2IANB 4DCQB 5D6CA 3CFJA 2P5WD 4JZOA 4YHZL 1OSZA 1N0XH 3CH8A 4LEOB 5FM4A 5T3XL 5FHAH 1NFKA 2Q7YA 1X44A 3W0WE 1K6QH 4M6OH 1NCAL 1RUAH 3MBXL 4P2QE 3VWJC 1CLZH 5GRUH 1DFBH 1P6FA 2KQMA 2DB8A 5HI4D 1LE9A 3UBXG 4H88L 4G6JL 2VAJA 4WUUD 1L6XA 1T5XB 2IEPA 4OBRA 5EBMA 2W59A 1U92B 2WQ8A 3GDBA 1ITCA 1JYNA 4LMQE 4YGAB 3LRSA 1GZPA 3BW9B 4ZPVA 1NMBL 5I0ZA 1PY4A 3PE9A 2H2SD 1D5IL 2OR7A 2W9LA 5D1ZA 2GT9A 2WINB 3BKCH 2V9QA 5EU3B 3U83A 3B9EA 3MYJB 4YDJB 3PL6A 1LP9B 2N7BA 4HJGB 3O4LD 4Y16D 1KN4H 4PJIF 5FO8A 4R96B 3ARBB 5GSVB 5C07E 1BECA 4PJEF 4NQDE 3KYMB 2VLJB 4G8GA 2DJUA 1OT1A 3DV6B 4R2GC 4KRNA 3KPMA 3G6AA 3ZE1F 2YUWA 3LKSA 4KKBD 1QEWB 5C1MB 3RTQA 3ELAT 1S9YB 5IB1B 3D87B 3R4DA 5HGAA 8FABB 4KH2A 1UEMA 2ICEB 2BY2A 5FDYA 5HYJD 3UJTH 2SEBA 4TULH 3GK8H 4RAUB 4D2NA 2X9YA 1RU9H 4WWKB 4Q58C 1P4BH 5EU7E 3WEXA 3L1OH 4JREB 2UYLA 5TE4H 5DTFA 4HS3B 1FYTD 1YMMB 2ESVB 2D7MA 5EC2A 1C5CL 2R0ZH 1JGVL 1EZVX 3QI9B 3RL2B 2ZKHH 3VRIB 4P5TB 4P2OD 4GG8B 2HT2C 5C0GB 4Z8FL 4N9OB 3R8QA 4RDQG 4QCIB 1C5DB 4Y4FC 2GSIB 2XA3A 2IH3B 4ZYKA 4KJYA 4FZEL 3VMOA 1A6PA 1MUJB 4BFIA 1I85C 3BUYA 1NC2B 2FBJL 4QRSA 2XV6B 5BVPH 1IRAY 4NKOB 5DT1L 3FRUA 4CN6A 4HKBB 4I0CC 3VXSB 4Q6IA 2JE8A 4P46D 1UA6L 1MCRA 2EXWC 2DD8L 2BNQE 4GRWF 4WI4A 4XZUB 3HUJE 1XR8A 2QADB 1PZ5B 4UT7H 2GSGB 2B1AH 3FT2A 3PJSA 2R9HC 1AJ7H 1WZKA 4OM0H 2VSDA 4MDIA 1E4KC 2Z93B 2XICA 3DI2B 4U1SB 5MI0B 4MXWH 3C6LB 5IV2B 3RPIB 3BUTA 4ZUUA 2XIDA 3OJVC 4JANB 2V9RA 4L3AA 3IFPB 4Y8DC 3U82B 4Z5RA 4GQPH 1CFTB 2NY5L 3BEWA 3UBXB 1G9NL 3G5YA 4D9LL 3OKDA 4ZSOA 3MUZ1 5CZXC 5E8EB 1FNEB 1CBVH 5FOJA 1I3RA 3QXTA 2DLEA 5H37H 3T0ED 1D5MA 5I1JL 2XXMB 4HKXA 3UO1H 3OB0K 3CMGA 3VI4F 5ABDE 2FHFA 4XNYL 3FZUC 4G6MH 5FA4B 1MCJA 3QDHA 1MCDA 5TE6L 3I9GH 4KHTH 3QG7H 1UXSB 1A9EA 1OP9A 1V3MA 5LCVH 3KPPA 1VGEH 4O51A 1VPOH 2DM2A 3Q3GB 1WCBB 2Q6WA 3CFBB 1A2YA 2OBGA 2Q7NA 1BD2B 1F4XH 3KPQB 4IDLA 1XGTA 5GGRA 5I75B 1BJ1H 3P9MA 5D2LA 1UFUA 3U0TB 2FX9L 4ZS6C 4LGPB 2XWBA 4HV8B 3DURA 3RWEA 5C9KA 4JPWL 4LCWB 4PRNB 5DUMH 4TN9A 1HNGA 5IF0A 2FSEA 1RZJH 4AENB 4ALAH 4XWOC 3AAZB 3NCEB 4Z0XA 3OXRA 4MJID 4ZXBC 1KCSL 1EA9C 3LKQA 2VO5A 1I9JL 2IANA 2W07A 3LD8C 2FNBA 2AJSL 2DTML 2VE6B 4LLUB 4YFLI 2JELH 3WN5A 4Y19B 4NQED 3CXHK 3MLRL 4RFNB 4LEOA 4A6YB 4N0CC 5D7JB 4MD4B 4K23H 1JRHI 3LV3B 3DMMB 1N5YL 5ITBH 5DK2A 1DTUA 2OTUB 1WV7T 3ARGD 3IRZA 5KVEL 3G04A 4ETQB 1Q94B 1U8NA 4MD5A 4OF7A 4RIRB 4DKEL 5MP6H 1FGNL 3OXSB 2JF1A 2IQ9L 4P9HH 2DBLL 1T5XA 4BZ1L 1B2WL 5CKGA 3BPOB 2I9TB 1PBYA 1BQSA 1ZV5A 1V3JA 3BW9A 4OCSL 5BVJB 5JZ7D 3FT4B 3MJ9H 1IGTA 2CK0L 4F3FB 4QYOB 1RZFL 1QR1B 1LP9A 4HJGA 4Y4KB 1BHGA 2VDKH 2HT2D 2D31B 5C08B 4ZS7L 4WV1A 3KYMA 4QWWC 2VSCA 4YGVB 4DW2L 2B7DT 4GW4B 1QEWA 3S88H 2R56L 1JHTB 2FR4A 2BRQA 8FABA 4Y4HB 4TNVK 2VXQL 2ICEA 3X12B 3MCG1 3FQTA 2EXWD 4RAUA 5EUOE 1R5WA 3JXAA 4U1LB 4CVWA 4WWKA 6CGTA 4P48A 4GO6B 4JN2B 4NZUL 5IW3A 3HFML 4YE4H 2YD1A 4X98B 5D7SH 1E4WL 4MZ3A 4TQEL 1ADQA 1RQ5A 4HS3A 1NEUA 4MNGA 2ESVA 1T1XB 3RI5F 1QO3B 1NFDF 3QI9A 3Q48A 5D1ZD 2R9HD 4PV8A 2VABB 3ZZ1A 1YPZA 4NNXB 1MCBA 2XKNB 3QIBC 5EC1B 4P5TA 4IRSC 5IFJA 1FG9C 4GG8A 2XOTA 5EORL 2CUIA 1V8HA 2YKLH 1JNNL 1IM9D 4QCIA 5FGRA 1C5DA 2DQIH 3P0GB 2GSIA 4KTEH 2IBGA 4G8GD 3SDAB 1MUJA 2Y07H 3IU4H 5J57B 3MGAA 4G6AC 4D9RD 5JW4Q 3OAYH 4ZOCA 4NKOA 1MAJA 3MRKB 1AY1H 1LD9B 5IESH 5ALBH 3VXSA 3FZUD 4OB5H 3GMPA 2BRRH 3U4BL 3A6CL 4XZUA 1XF2B 2V5MA 3NFSH 3L5HA 4TUOB 3WKML 3ARFB 2FB4L 2GSGA 1S7VA 5HHNB 1CXFA 2R29L 2DDQL 2E7LC 1MWAB 3PXHA 2NR6C 2YMXL 4U6YB 4KQ4H 4LEXL 5IV2A 3ARBC 1EPFA 1IZJA 1W0VB 4JANA 4ZS6D 2OYPA 3B4NA 4G8FA 4M00A 4Y5XB 3UBXA 1UT9A 4HQQL 1WITA 4OLWH 5E8EA 3MR9A 1WEJH 4EVNB 3K1KC 4OGYL 4OF6A 1IEBB 4XWOD 1CG9B 3H2WA 1OWWA 4PJDF 2KKQA 4W81A 1WT5C 4B7IA 5HD8C 3NIFF 1NBVL 3GIZH 4KTDL 2NXZD 3THML 1IC7H 4HBCL 1NBZB 4H0HB 3T4AB 2ZUTA 3DI3B 2ARJB 3FB5A 3VGHA 2B4CH 1CL7H 3W0WB 3Q3GA 5A2FA 1K85A 4C56B 4XNMB 5CJOH 3L9RB 1KJ2L 4D0DA 3RVWD 3FQNB 3KPQA 2NTSP 3N1MC 1WISA 3DUUB 5SWZD 2ZUQC 2Q76B 1X7QB 3S35X 4AEIH 2DQGH 1HIML 2ATPB 2WQRA 4HV8A 4TNWF 3REVB 2PUQT 1TLKA 4TPRH 4PRNA 4LCWA 5HYEA 2I24N 1I8IB 2XTJE 3SE9H 5F3BB 5C7XH 3DRQB 1MJ7L 4OJFH 4N5EC 3QO0B 5DSCB 1T1WA 1MCNA 3FQRA 2F5AH 4XXDA 3QNZB 3QYCA 4MNQE 5ICYB 4X0KB 2MQCA 3IJYB 1QP1A 5J8OA 5BXFB 4NQDB 4PS4L 4Y19A 4QWWD 3GMMA 2Z8WC 2QADC 1FFQA 3QQ3B 5D7JA 4Z7OE 1QSEB 2VC2L 4MD4A 5GHWH 3DMMA 3G5VB 1EVTC 2VNCA 1J1OL 3CSGA 1ZGLB 4MS8D 5MI0C 1RZKH 3OR7B 3VW3H 1KIQB 3C6LC 4XC3H 1YNLL 4XMLL 5K9OB 1J5OL 2F53A 2B2XL 1C08B 1PW3A 3VDAA 2I9TA 2RFXA 3FTGA 3BYTA 1S7RA 1JGLL 2BVQA 3KPNA 4F9LA 5E56A 3OAZH 1YC7A 4YFDB 1U8HA 3FT4A 3MBEA 1WZ1H 4IMLB 1RUKL 4BQ9A 5HHVL 5CAYB 2CGRL 2F19L 3QIBD 1OPGH 5LQBL 2D31A 4LHQB 1S9XB 3FQXB 3SE4C 2IAND 3FJTA 3IJHB 4KY1H 2MQ0A 3VFPA 4YGVA 3FO2A 3GSVB 4LRIA 1R3LB 2DIBA 3NH7L 5DR5L 4G6AD 4TRPH 3B5HA 1U91A 4LQ1A 5KJRH 3HE7B 4B50A 1JHTA 1EO5A 4YX2H 1IGIL 3TP4A 2YPVL 4Y4HA 1FORL 5JQ6L 1FZMA 4FQXC 1RJYB 5LWYH 5HHMB 5IWLC 4MMXC 2PETA 5I75C 2R0WL 3HUJB 4WHYG 3GUTA 5BJTB 1IVLA 4D0BB 4NKQB 1NCDH 4DFIA 4X98A 4QY8B 4M7LH 1N59A 1K9TA 4BUGA 1T1XA 4ELME 1IILE 3KJ4B 4NNPL 2B1HL 3T1FA 4JRXE 5J12B 4CADB 2NR6D 3MUY1 1NEZB 4WO4B 1BEYH 4ZOEA 1KPUA 1Q38A 2XQBL 3RL1B 1F2XK 2F8XC 1VFUA 3ARBD 1B0GB 4ZTOL 3J7HA 1U93A 1TTUA 2VLJD 4N8PA 4DZ8B 5JIPA 2UY6A 3OQ3B 3U1SL 4KV5E 3BKYH 5E6ZA 4X7TA 2IPTL 4N8CL 2JKXA 1DJSA 4KJPC 4EN3B 1VFMA 1X4YA 3MRKA 2XFXB 1FL5B 3MRBB 1QVOB 4G7YL 5JORB 1I1YA 2XN9B 4WWKD 1LEGB 3RHWK 5C8JB 3AREB 3WS3B 4XPHL 1QR4A 5J6GB 3BPOC 3MZGB 1IGJA 4P9ML 3MRCB 3ARFA 1CE6B 1YMMD 2ESVD 2BSSB 3QI9D 25C8H 4UDTB 1MWAA 1CIUA 5I15H 1K8IB 5I76A 2IGFL 4PGDB 1N5AB 4P5TD 4Y4KC 3IJSB 4I18A 3QUML 3BP4B 4KQ3L 4G8IA 5TE7H 2EECA 3OL2A 3VFVB 3HCVB 1R24B 4LSVH 3NZ8B 3VGEA 1W0VA 4MJ6A 4NGHL 3V4PL 1P69B 1JTPA 4DVRL 4IIQC 4WY7H 4Y5XA 4NC2B 4KZEH 3SDXF 3CLFH 1NC2D 1UJTA 4RZCB 4L8SA 3A6OA 2JB6B 4ODVL 1IEBA 1CG9A 2HLFD 5F7DB 3VXSD 2X41A 5KAQG 5T3ZH 1DE4B 2AJVH 5E8DL 4P2RA 1GGIL 4HKZB 5KTEH 4E5XB 4KJWC 2ARJA 4NN6B 4KGLA 4WEBL 1T20B 4JG1H 1JTTA 4JO2H 1YJDH 4Z76A 3TH4T 3CMOL 1FC1A 3EHBD 4C56A 1W0WB 2FEDC 1PEWA 3LKRA 5CSBA 1XGYH 2A6KB 2KH2B 3C6LD 2A6DB 4PJBE 1MAKA 2VAAB 1HQ4B 2Q76A 2HKFL 1I7ZA 3REVA 3PGCB 5TDPA 1IEHA 2C3VA 2ZUYA 4KXZH 3VXUE 3SDAC 1DBJL 2V2TB 4OZHB 2NY0B 4YAQA 1PFCA 5F3BA 2AEPH 3F7YB 3WLBB 4PLJC 5DSCA 4QXGH 3WNKA 4XMPH 5L7XH 3FONB 1RUPL 3SJVE 3IS0X 1S5HA 3QNZA 5ICYA 1MAML 4XVSH 4X0KA 1AHWA 3WFEH 1P9MA 4OUOA 1QFWI 5BXFA 4NQDA 1IT9H 1P2CB 2EZ0C 3BN3B 3HN3A 5DC4B 4TTGA 1I1AB 4KK9C 1ZEAH 3STLB 1IGCH 3QQ3A 3BH9A 1II4E 3CDCA 4HPYL 3MLVH 1QSEA 2X4SB 2AJUH 4NFDA 4P59H 3T4YA 3GMOB 4HK3J 1MFCH 3G5VA 2YUVA 3V0VB 4UQ2B 1ZGLA 3NCJH 3LN5A 1R0AH 3C8KA 3N1GC 4L4VE 4XI5C 3OR7A 1KIQA 5EUOB 1BD2D 3MO1B 3WD5L 2YPKB 2OSLB 2VQUA 4WWID 5FUZL 3ZKNC 2FATL 2WUCL 1G84A 5FKPA 2JCCE 5DJCB 3W5NA 1C08A 1YEJL 2Y25A 2EYRB 5T33L 1ORSB 4HXBH 3OBAA 4XAWH 3WSQH 4WW1B 2Z31B 4JDVB 5E4EC 5E2VH 4LCWD 3IFNH 3BXNA 4JCMA 2V5TA 2HYMA 4IMLA 1DL7H 3GMNB 1Q0XL 4CN4A 2DQTH 1YEEH 3HE6B 3L3DB 2HAZA 5I1KL 1A7RH 1T2QH 4NWUL 3EOAA 4Y19D 4JFHE 1DLFL 3DPBA 5D7JD 3GSVA 5F1NB 1R3LA 1LWRA 4F7CB 4DKFL 4M7ZB 2ZUWA 3DMMD 3MXVL 4NSKB 3VXRE 3ZKXB 3UTZA 4LK4A 4JVPA 4MCYB 4KK5C 4KJPD 4ZO8A 1BOGA 3IDNA 3CXDH 3H9HB 4RGOL 2CSPA 3CUPA 3O2WH 5I1IH 1RJYA 5EZOL 3V5HB 1RJZB 1YEGL 1AKJB 4D0BA 2F53D 5J9PB 3MMEA 5ESQB 1KCUH 4FQLH 2OCFD 5HTSA 4JY5H 1JWUB 4ZODA 1RIHH 1CIDA 2JK5B 4CADA 1FNGB 5HJ3B 4WO4A 5GRWA 5C0BA 1H3XA 3D48R 3EO0B 4K2UL 3AB0C 4PRPA 4Y4KD 4K3HA 1NSNL 3KYNB 4LSQH 5C08D 4H26B 4JGMA 1B0GA 1CTOA 5FUOH 4AZ8A 1BQLH 1X5JA 3QRGL 4G7VL 5SV3A 4HUXB 1TVBB 1MJJB 4LNVA 2XG5A 3BKMH 3MGOB 1A6WL 4RMRA 2QEJA 3UTTE 4JM2B 2VXSL 5I74B 3IDXH 4M6MH 4EN3A 3ZHKA 1KNOB 3HUJF 1N64H 1NL0H 5DYOA 4Y4HD 4K9EL 2XFXA 4MJ4A 2EH8H 3MRBA 4KDTC 3ROLB 4UU9A 3TPUB 4IRJB 2XN9A 1LEGA 4PGZA 5EU7C 3AREA 3WS3A 1OTTD 1S7SB 3BQUA 5J6GA 4KJWD 3ARDA 1EHLH 4BUHA 3I2CH 5I1DB 1S7WB 2X10A 4UDTA 3MLWL 2PO6B 3P0VL 1K8IA 1I1CA 3L5XL 3IFOB 4UAOB 5C71A 1I1RA 1UH2A 1N5AA 1MHPH 1ZVSB 4LBEB 3BP4A 2PKDA 2CLZB 3HCVA 2VKXA 4ZG1A 3NZ8A 1A3RH 4MQTB 2AJXL 5BV7L 1KOAA 4ODSH 2C1PB 3BVNB 3ZE2F 3S5LG 2XTJB 5L8JB 1B6UA 1KTDA 4LF3B 2AI0H 4UIKH 4JO4L 1NUGA 1RZ7L 4PLJD 4KU1A 5FV1L 3HE7C 2AK1L 5JXEC 1YYLH 5JOPE 2MCPH 4MNQB 4KUZL 5DD6B 3CSYA 2VDPL 1DE4A 1LO2H 2PXYB 5B3JE 2EZ0D 4HKZA 4RAHA 1NMAL 4KK9D 4MA1B 4BZ2L 2PTVA 4ZUVB 3ARFD 2I60H 1T20A 4U1KA 2D4FA 1QFPA 3VG9B 5CEXA 1MSPA 2ZJSL 1IC4L 1W0WA 5KSBB 2QBWA 1INEL 3TBTB 3TH2T 4JPVH 1MHHB 1SMOA 2ZG1A 2A38A 3MODL 3GGWB 3E6FB 1HH6B 3GJFB 1DEEA 1J0KA 4UINL 3C6SB 3TWCL 2R4RH 3BHBA 3F7VB 1RMFL 2Q20A 4OZHA 4L3EB 2COQA 3X11B 4HUUA 3WLBA 1OP5K 4D9QD 1UADC 3QUZB 1MELA 3C5JB 4MA7H 1D7FA 4HLJA 4M9OA 3GNML 3DGGB 4HT1H 5I8EB 2PW1B 3DYMA 1K5NA 4G42A 1MCIA 4QRRE 3BT2L 1VSCA 3MLYL 2E7MA 1JNHB 2AEIT 2R0KH 3W0WD 2F58H 3GMOA 4HWBA 1RD6A 3JWOC 4N0YH 4KK5D 3SKMB 4UQ2A 5KBNC 4C56D 2N1KA 5F70A 5TFSL 3ARYA 4WUKH 4TOYH 2YPKA 2OSLA 4PIRF 4CJ0A 1KB9K 3NACL 1QLEH 1CCZA 4N0FB 1J9CT 1KB5B 1PLGL 4I48B 2DIAA 3U7WH 4XXCC 1T89A 1CFVH 2R1YA 2Z31A 4JDVA 1ZTXH 4ELMB 2HT4D 4HXAH 1PYWA 3QIUB 4JRXB 1EGJA 3DOSA 1ERNA 3GMNA 3SBWA 5EWIL 5C6WH 3AY4C 5BZDB 4FXKB 1NCWL 4UT6L 3MYZA 5F1KC 3RJDA 4YHZH 3ARRA 4PJ9B 2VDRL 3BN9C 3L3DA 4XGZA 1JMXA 4MZ2A 5T3XH 3MA9L 3P73B 4NQDD 3EFDL 4NQUA 1NCAH 3MBXH 4OGAC 5E5MA 3MFGB 2C5DC 4NN6C 3H7LA 5GS3A 1QSED 2B20A 4H88H 5EUOF 3MLTA 4YBLC 4G9FA 5E95B 4G6JH 4MCYA 4X8JB 5IHLB 5FUCE 4R0LA 3S5LB 1U6AL 1RJZA 1AKJA 1NMBH 3ULSA 5HGDB 4W70A 1D5IH 2R2CA 4OGXL 5J9PA 5KS9B 3IDJB 4JVUA 5ESQA 1ZHLB 1BJMA 4OV5B 4JE4B 5B39G 3HI5L 2ICWJ 5E99L 4AIZB 2XA8L 2JK5A 5HJ3A 3AS0A 43CAB 3EO0A 2OTWB 4Z7UE 1CDCA 3QQNA 5DWUL 4LSDA 1GGBL 2Z9TA 4U05A 3I3EA 3RIAK 3SQOL 3T2OA 4P23A 3BP7B 4HUXA 5DFWH 3QDAA 4ZNCD 1TVBA 1FFNA 1MJJA 3ALWA 1I1AC 3RU8L 3OV6A 3MGOA 4K8RL 3HE7D 1KNOA 1EEZA 1CLYL 3TPUA 3DX8B 5HHMD 1U8MB 3WV0A 3D6GA 1ZLUK 4GAYA 3G6JA 1C5CH 1JGVH 4H1LG 1YQ2A 4JKWA 1ZS8A 4CL7A 1ED3A 4W4OC 4X8XA 1ND0B 3DXAE 4Z8FH 4ODWB 3IFOA 4WO4D 5LG1A 1ZVSA 4PJBB 4PRPD 5D9SB 4F58L 3HE6C 5IFAL 3OF6D 2HG5B 3MV8B 4FZEH 3AU1B 5C9JB 1EX0A 2A0LD 1HKLL 2OLDA 4JM2F 4K8RC 1EK3A 5IVOA 2FBJH 4X6CB 3VXUB 5J56B 5ACLA 4U6XA 5DJ8B 1GGTA 3QO1A 3C60B 5DT1H 1I8MA 1KEML 4LCCC 1UA6H 3VMNA 2WLYA 3SJVB 4CU6A 4EN3D 2DD8H 4MNQA 3R0NA 1HHHB 4OF5A 1IJ9A 5D5MF 3MUGA 2NYYC 4JHBA 1FPTL 2XN9D 2D7TL 4RQQB 1XCQB 3ARED 3CFKA 3MNVB 1EXUB 3AXLB 1W72L 1BZ7B 1DR9A 1KG0B 2GFBB 4ZUVA 1CT8B 4GRWH 3VFMB 3O6FA 4ONFL 1BGXL 2ZNWA 2YD3A 1U9KA 3RRQA 2C3HA 4L4VB 2E7HA 2YRPA 5KSBA 1FG2B 1S78C 3TBTA 1MHHA 3WDJA 5FGBC 2NY5H 1KF9B 5KSAA 1G9NH 4D9LH 1HH6A 1N3NB 5IQ7L 1S5IL 3GJFA 5IVXE 3E2HB 3VI3E 5I1JH 1FIEA 2EC9U 4L3EA 4LPTA 2NY3C 2CIIA 3X11A 3QPQC 4XNYH 4JM2C 5I74C 3DV4B 1QRNB 4YBHA 5TE6H 2F15A 1IL1A 5B39B 4Z7OF 1ONQB 1WGOA 1AGCB 4IRJC 4MXQC 4PJ7A 2GTWB 1WFTA 5CEZL 2PW1A 3RUGE 1MCWM 2HRPL 3B3IA 2Y72A 5MEPB 1JNHA 1ZA6B 4JAMB 1MLCB 3BZFB 2X70B 2PO6C 3CCHB 4GJTB 1CGVA 2FX9H 5DD5L 4JPWH 4N0FA 1UXWB 1KB5A 3LKNB 4I48A 4GT7A 3V7AE 3L3HB 4X6DE 3N1FC 4U1MB 3QDME 4XVJL 2XTJC 3HPLB 4MDJB 3W2DL 2NY0D 1KCSH 4A2MA 3BOVA 1PX3A 5FYLL 1I9JH 1ZAGA 4S0TD 4X6BB 5IMOA 4H1LB 5DRXB 2AJSH 5BZDA 2DTMH 3P0YL 4TYUA 2FRGP 4YZFF 3MLRH 5C0CE 2QSVA 4ZO6A 3P73A 2PXYC 3PDOB 2W65B 3TFKC 1N5YH 5ECJE 5KVEH 1AXTL 3HAEG 3MV7E 3NZHL 4LNRA 4MA1C 5C0DB 1H8OA 4RFEA 4QO1A 5I66B 4N0UE 3UTTB 4M5YL 4DKEH 4YXKL 1FGNH 2IQ9H 2DBLH 3VG9C 4WHCA 4R4FL 1T6WA 4ODTL 4YPGB 5J11C 1FV1B 4NOFA 3MRNB 4UMGA 4BZ1H 4LHUG 1B2WH 4JFDE 2P8PA 1UYWL 4JFPA 4ELMF 5BMFL 4OCSH 1NKRA 1CFBA 4JN1L 1KIPB 4DN4L 1OF2B 5KS9A 3IDJA 3FFDB 1OTUD 4L9LC 3OR6A 2CK0H 1X5YA 2Z31D 1RZFH 4AIZA 2OS7A 4X7EC 1AXIB 2VLME 3S97C 2NX5E 4ZS7H 1IFHL 5IEKA 3MLUL 3L7EB 5DJ6B 1A1OB 3NPSB 4GLRI 3QUZC 1R3JB 5ISZB 3HE6D 4EKXA 4DW2H 4IMKC 2H32A 1F5WA 3WIIL 1HOCA 2IFGA 4ZNEE 2UZXB 2R56H 4XP9L 3VWKB 3K4AA 4U3XA 2QSCL 1A21A 2VXQH 1M05B 3JV0A 3REWA 4MVBD 1FHGA 3WO3B 2C1OB 4WGVB 4NZUH 2UWEB 3HFMH 3HR5B 1VERA 2CDGA 3I50L 3SGJC 2HFFB 5J3HC 2NYYD 3DX8A 3JWDC 1E4WH 5B21A 4TQEH 1AKJD 1VKXA 3GSUB 5EZLA 5I1EL 1IAMA 3HNSL 2G2RB 4M03A 3F8UB 5CD5D 3AVEA 5F6IC 3QIUC 3DVFA 5EORH 5EBWB 4ODWA 4XX1G 3S4SB 5EOTA 2NW2B 1JNNH 1HXMA 1S78D 4C58B 3PABA 2CLRB 4JGJA 3H6JA 2HG5A 4PJ9C 3MV8A 5C9JA 1N6QL 5DI8B 4B5EA 4P23D 1LEKA 4X6CA 5CUSL 1N6UA 4HW6A 1R3KB 1J0IA 3L3GB 2EEBA 1Y6NR 3QPQD 4JM2D 5T1LA 4NNYB 4RMWA 3U4BH 3A6CH 3OKNA 4ZPTB 5DRWB 3DO7A 1LNUB 3IDYB 3TZVB 4IRJD 3WKMH 4MXQD 3EYOB 4JZJA 1BFOA 2FB4H 3WNNA 4RQQA 5D2LF 1QFOA 2R29H 2DDQH 2A9NL 1BZ7A 3KLHC 2YMXH 3BYYA 2A6JA 4O58L 2E8YA 3VFMA 3OGCB 3FQUA 4PJBF 4LEXH 5EU4A 4PBXA 1F3RB 2PO6D 1QQDA 1FG2A 3D85A 4B41A 5INDB 3CU1A 2UUDK 2HTKC 1L0XA 2XRAL 4G9DB 4HQQH 5T5NF 3EYQD 5ESAB 3HC4L 5DD0L 3IKCB 3SY0B 4LHUB 4OGYH 2P8MA 3HI6L 1Q1JL 2XTJD 3KPSA 1EMTL 3QISA 4TSCL 4R3SB 2B0SL 1MCOL 5T1MA 4HZAA 1NBVH 4KTDH 4L3CA 1QRNA 4AK1A 3THMH 4MNQD 1T3FB 4HBCH 4TSBL 5B39A 1XF4B 1ONQA 3NMEA 5C0IB 1AGCA 3B6SB 2GTWA 2PXYD 4NJAL 4IOFC 1JUFB 3FAXA 4IRZL 5CLTA 5FK9A 5MEPA 3PP3H 1ZWIA 1HYRC 4FTVE 1KJ2H 1ZA6A 4JAMA 1MLCA 3JVGA 1F6AA 5TF1L 5ENWB 1M71B 2JCCF 3LPWA 1U41A 1UCTA 1HIMH 1SVZA 5HGHA 2IG2L 3W9DB 1UXWA 3AS1A 2A6IB 2CIKB 4U1IB 1MCFA 4YWGL 1UH4A 3WL9B 1LEIB 3TA3C 4GG6E 1MJ7H 2Z8RA 3B43A 1X6LA 1NDMA 4U6VL 4I0PA 4M3KB 2EDQA 3HPLA 3C60C 1NLBL 4L3ED 4J7RA 4N8VB 3UEZA 4O2EA 3RDTA 2XYCA 1A47A 3WIFA 1UB5B 4M93B 4H1LA 4Z7UB 3V6FA 1EHXA 3QUZD 2HVKA 4PS4H 1EV2E 4G5ZL 1U3HB 4XBEL 3PDOA 4YDVB 2VC2H 5E8OB 5C0FB 2P5EA 2XNAA 3L6FB 5C0DA 1J1OH 1MCHA 2BVEA 3BZDA 1A6VL 3SDDB 5I66A 3UTTA 1OLLA 1XCTA 2HJLB 3T2NL 1EHNA 3E1F1 1Q9KA 1YNLH 1UENA 4YPGA 4XMLH 4ZUSB 3L3KB 2VZ1A 3MRNA 5DVMA 1J5OH 2B2XH 1IC1A 4HK0B 5F93C 4WDIB 4YHIB 4LKCB 5J3HD 1P5VA 1OGAB 1A6AB 3FMGL 4KI5E 3MCKA 2VL5A 1PKQB 1JGLH 5CJBA 5F1SA 2XI9A 1KIPA 1OF2A 2EDEA 3FFDA 1Z9OA 1RUKH 5HHVH 4MB5A 2CGRH 2DLFL 2F19H 3E2HC 4D94A 2X89A 5LQBH 4L8DB 5JDSB 1A14L 3QIUD 4JRXD 1CGTA 1MNUL 3WUWB 4M1DL 5DJ6A 1A1OA 3PWNB 2GTZA 1R3JA 5ISZA 1EO8L 1P4LA 3MNZB 2EO1A 4HS6B 4PJ9D 5TDOA 5J13B 1DANU 3NCMA 3RQ3A 1BF2A 5DR5H 1NCUA 3NH7H 4KGJA 4PJXE 4NYLB 3VWKA 1OAYL 3ZTJH 1IGIH 3MXWL 5E9DE 2YPVH 1FORH 2DJSA 1M05A 2VOTA 2GJZB 5FDWB 5JQ6H 2DQUL 4J8RB 5E1AB 5CP3A 5DVKA 1ORQB 2UVEA 3I02A 5FGSA 5AZEL 2R0WH 3F62A 5E7FA 5AAMA 2C1OA 2AXGB 2BHUA 2UWEA 3HR5A 4LLQB 3BE1L 3B9VA 5KVDL 3UX9B 1CR9L 4NNPH 2B1HH 1J86A 1CXEA 4ZQKA 3OTTA 5ERWB 3IDUA 4L8CB 2BX5A 3B9KA 4NN5B 2XQBH 2H26A 4RFOL 5EBWA 2OMNA 4ZTOH 1QNZL 3BPLB 1TQBB 2CJUL 3EZJB 4Y2DA 1MVUA 1RHHB 5IK3B 2MFNA 3VXPB 2F9BT 4MMZC 3MREA 2DWDB 4PR5A 5DI8A 3FCTA 3U1SH 5IVXB 2RBLA 2AK4E 4NO2B 2IPTH 1YZZA 3GSOB 4N8CH 1NUNB 1ACYL 3L3GA 4X9GA 3A6BL 4NNYA 5TH2B 2PW2B 5B3JF 4G7YH 1S7TB 1QLRB 1Z5LA 4PTUA 4P57A 1WC7A 4XPHH 2WK2A 4KVNL 4ZPTA 2BVTA 3TZVA 2A73B 4K3JL 4P9MH 4WJ5B 3WHXA 4APQA 5IQ9A 4LDOB 3UTSE 1GC1L 3QDGB 1T5WB 1LO5B 5EB9A 1H5BB 5DUPL 4KPHL 4YHYC 2NW3B 2IGFH 3QQ4B 2Z4QB 3T08A 1JF1B 3QDJB 2EKSB 3T8XA 1M6OB 5E94B 3QUMH 4KQ3H 3BWUC 3NBNA 1IARB 1G0DA 3HAEA 4L4TE 5E0QA 4NGHH 3V4PH 4D8PB 5EOCL 3ESUF 4WGWB 4DVRH 3LCYA 4LVOB 2F74B 2PTTB 3MV8D 1JPST 4AEHL 4G9DA 4OD3L 4JFFB 5F97E 4YNYA 4HJ0D 3VXTB 1EEUA 4X6DB 5AUMB 1EAPB 3VXUD 4H20L 3MA7B 4LHUA 4ODVH 2D2OA 3M45A 3C60D 4R3SA 5IW6A 2NCMA 2VDOL 3TBVB 5E2JA 1F4HA 1M4KA 3MRRB 1JWSA 1SVCP 4J1UA 2EDKA 4XB8A 5E8DH 1F8TL 3SJVD 2X44D 1GGIH 3TCLB 1GC1C 5C0CB 5IMMA 4YIQB 3GJFK 3TN0B 4WRLA 5C0IA 3RY6C 1RZGB 3O8XB 1DBBL 2RQ8A 5DEFA 1BQHG 4WEBH 2EE3A 1JUFA 3MV7B 4L29B 3RWIB 5MENA 4GKOA 3O41A 3CMOH 4N0UB 4CMMA 2OM5A 3SGKC 2EDNA 9CGTA 1OD9A 1UWGL 3CK0L 4PGJA 3TNNB 5ENWA 1M71A 4L4VD 2HKFH 4JO3L 5F21B 2YN3A 4XBPB 4X6FB 3W9DA 3BMWA 3C8HA 4CW1A 1BX2B 3WNPA 2CIKA 1DBJH 4U1IA 1LEIA 2Y6SD 1F6LL 3UDWC 1T83A 1RUPH 2P7TB 1AD9A 4BELD 1MAMH 1F97A 5B8CB 4GSDL 5BW7A 4Z7UA 5EFIB 4U7KA 4DVBB 1QRND 4JFZL 4QRPE 1DBML 2ITDB 1AGDA 2W0KA 1S3KL 2QSQA 3QWOB 5FV2A 1FQ9C 4PJHA 4HPYH 3U9UB 5GS0L 1MPAL 4YDVA 2YD6A 3RNKA 1JI2A 5C0FA 4JFHD 5I16A 5D7IE 1RI8A 3U48A 4ZUWB 1FDLL 1XGQA 1KTLA 3QG6B 3WD5H 5FUZH 2FATH 1T21B 2WUCH 3O2DL 4ZUSA 4LP5A 1YEJH 4HK0A 4WDIA 4LKCA 5T33H 3QSKB 2ED9A 1OGAA 5JHLL 4KKLC 3RVXC 1CE1L 1PKQA 3U4EB 1JPGB 4KMTL 2X1WL 4PP2A 5JPMB 1Q0XH 2FHCA 4YPJA 5JDSA 1CICC 3QUXC 4MD0B 4NHUA 1FVDA 5I1KH 1U8LB 3UTOA 1AXSA 3NIDF 4NWUH 4Z7WE 3MJ8A 3MNZA 2APVA 3BSZL 4U1GC 1DLFH 1A4JA 5EOQL 2WV3A 5JA9A 2E6QA 5SX4H 4DKFH 3MXVH 1LK3L 3HG1E 3CZJA 3UTTD 4RGOH 2A9ML 5FB8B 5EZOH 1YEGH 1RK1B 1OHQA 2AXGA 5FUCC 1DBKL 2BNRA 3FN0L 2G5BB 4WIQA 3RWDB 5GS1B 5ANME 3O3EA 2LU4A 4LDLB 1MWAL 5D2NE 4L8CA 4K2UH 2P8LA 3CNKA 1NH6A 1NSNH 3ECBB 1CGXA 4PREB 4M93C 3HR6A 3QRGH 4G7VH 5ISZD 1F3DH 2IALB 1RHHA 5IK3A 1CDBA 1FN4B 1U3HC 3NAAL 4PG2A 5CCKL 2DWDA 1A6WH 4U0QB 2IFFL 5FF6B 3QFDA 2VXSH 1CD8A 3GSOA 1NBYB 3VWKD 5SWSE 5CIPH 4X4YA 4O4YL 4K9EH 3SDDC 3RVUD 2EIDA 2JJUA 2BCKA 3K80A 5TH2A 5JOPD 2FCBA 2X40A 3K46A 2BVOB 4ZD3L 1QLRA 5EBGA 4GRLC 5HYFA 4M7JL 3VD3A 4FABL 2BP3A 1INQB 4UBDC 2I07B 2A73A 1NBQA 1T5WA 3QDGA 5AZ2L 2X4OB 1H5BA 1Z9MA 3MLWH 2J8UA 3P0VH 1WFUA 1AQDB 3L5XH 4PYGA 2Z4QA 3QDJA 2EKSA 3ILQC 3C8DA 1M6OA 4OCXL 3O11A 5CZKA 3QH3B 1B3JA 4D8PA 2AJXH 3VI3F 5BV7H 2EDFA 1JZ2A 4JQXA 4ISVB 1WBZB 4JFFA 2PN5A 4GG6B 2D7OA 2JJSA 2ZZUT 1IZKA 4JO4H 1RZ7H 5AUMA 1EAPA 2AK1H 4XP5L 4KUZH 2BSRB 3ROOB 3IDIB 4X4MA 4S1RL 2VDPH 3NCYP 3CX5K 2H8PB 1TCMA 3M1BB 5I1HL 1TQCC 1Y6KR 4ZOAA 3U30B 1VENA 3RUGF 4J4PA 1NMAH 1P84J 3TN0A 3T09A 4RWYL 1U8QA 4JM4L 4BZ2H 3TZVD 1RZGA 3O8XA 3MC0A 2J8OA 1TJHL 4L29A 4QLRA 2ZJSH 3DETC 4EI6B 3V5DB 3B5GA 1IC4H 4EI5B 1INEH 4WW2B 5TF0A 2V2XA 2FH8A 4XTRC 3BEVB 3MODH 4FG6D 3B83A 4PBVC 5IW1B 3QAZB 4X6DF 4X6FA 3DRTB 4UINH 3WBDA 4KKLD 4FXGB 5GJSL 5J4MA 3TWCH 4UB0L 1MFEL 5HI5C 2AP2A 4XH2B 1RMFH 2N7AA 5GSRA 1B6DA 3K3QA 4AMKL 4QHKJ 3O4OC 1WICA 3WFCL 4LHUD 2IH1B 1G6VK 2P7TA 1VA9A 4P3WA 2DAVA 5B8CA 3EIFA 1I3VA 1HHKB 3O3UN 3ULVE 3GNMH 5EFIA 1U8JB 3EO1A 4DVBA 2E7BA 3DROA 2ZUUA 3PWPA 2ITDA 3QWOA 1ZOXA 5I73B 4HDIB 1YY9C 3BT2H 4OUUB 3MLYH 1FNFA 3H0TA 3O3DB 4PJXB 4W4NA 1S9WB 1DQJB 5E9DB 4E0RA 1EBPA 1Q9OA 2PR4L 3QG6A 5TFSH 4U1NB 5JR1L 5F3HB 2VWEE 4PJ5A 4KI1A 2ZSWB 4HFUL 2VJXA 1EJ6A 3NACH 3RAJL 5IJKA 2EYTB 2AV1B 1PLGH 3UTQB 1IKNA 1UKQA 4HZLA 3I75A 4LVOC 5JPNA 1D5BB 3U4EA 1OB1A 4FP8L 4AJ0A 5JPMA 4BA8A 3K74B 3PGFL 5EWIH 1NCWH 4NUGL 4UT6H 4BSWB 1I8LC 4Z78A 3GSXB 1N26A 2VDRH 1PQZB 1U8LA 5DMGC 3MA9H 1ODAA 4KRMB 1ZLWK 4BJLA 3EFDH 4ZAKB 1FIGL 1U3HD 1G7IB 5DJXB 3WMSA 5F88B 1PDKA 2AK4B 4QGYA 3BO8B 2WIIA 1OW0A 4HX1B 5DHYB 1ZSDA 2QHRL 4XP6L 3ARXA 4PGBB 4WI5A 2XPGA 2VZSA 3LH2L 3SDDD 3WDIA 5EIIB 1RAMA 3FKUS 4R4BB 2GYSA 3N50A 2CO7B 4UUJB 4EDWL 1U6AH 4CVXA 1RK1A 1BFVL 2ED7A 4OGXH 1HE7A 2VLKE 3LDBB 4UBDD 2G5BA 2XWJB 1OGAD 1RURL 1W2KT 1A02N 5CGYC 5GS1A 2OI9C 3HI5H 5E99H 4NUJB 1JZ5A 2XA8H 5D7LE 4Z9KB 3V8CA 3ARTA 4AQOA 4ZFOB 3WFDL 2DKMA 1KIRB 2ZUSA 1UZ8B 3DHJA 3WDHA 5DWUH 1GGBH 1IGYB 1BQHA 3ECBA 5DO2C 3CVHB 3SQOH 4FNLL 3TBYB 3EYVB 3KPRB 3RU8H 5FEBA 4NDMA 1EBAA 1FN4A 2VERN 4NQCA 1MEXL 3C2SA 3HS0B 2A2QT 5FF6A 4HG4J 1JP5A 4K8RH 3BH8B 2NZ9D 4FZ8L 1CLYH 4NT6B 1VACA 1U58A 2VDML 4URTB 3TJHC 4JDTL 1T1YA 3RPKA 4YBQC 4WFEE 1ES0B 4PRAB 1G6RA 4G43A 2GEEA 3GMQB 3RWFA 4WTXA 3VFSB 3TIDB 1JHKL 2X4OA 2HFGL 2P43B 3DETD 1K8DA 4I3RL 2Y9RT 2VIRB 4YQXL 1ITBB 4F58H 5IFAH 3L5WA 1SJHA 4Q0XL 2BOCB 4Q9QL 1HKLH 1N6VA 2PTUA 3NFPB 4JQIL 1K4DB 3HPJA 1WBZA 4JQVA 1KEMH 1UJ3B 5ID0B 2VXVL 4OQTL 1NC4B 3GM0A 5BRZE 1YUHB 1RZJC 3P40A 2BSRA 3ZYZA 4B53A 4GRMB 3ROOA 4BQCA 3IDIA 2R2HB 1FZJA 4BM7A 2DQEL 2H8PA 3QFJA 3M1BA 4QRPB 4ODHL 5DS8B 1FPTH 2CKBA 5EO9B 3RZCB 2D7TH 4P5MA 1FJ1B 5DFVC 3L95B 3MFFB 2DYPA 4QOKE 1YY9D 2P44B 2R1XA 4HC1A 1W72H 1WCQA 3QXDB 4MJ5B 3DIFB 4TUKL 4ONFH 3QDGD 5D7IB 1BGXH 4EI6A 3U2SA 2YD9A 3OKYA 4LCUB 3DVGB 3RGHA 3PHSA 4WW2A 3QDJD 5D70L 1L9MA 3BEVA 2X5PA 1Y0LA 5IQ7H 4P9HC 3Q0HA 1S5IH 5IMKA 2ADIA 3RWJB 5IW1A 4NQXB 1X6NA 3EFFB 4FXGA 4JFOA 5GGVL 4JFFD 4XH2A 3NN8B 1X5ZA 1AGFB 2A77L 4E41E 4JPIA 1CGYA 1EGJL 1RSFA 2JIXB 5HHXL 2W92A 2AJZB 2FWOA 5DEGA 5K9JL 3GIVB 1MOEA 4LMQI 3SGEH 1AFVL 1CFQB 4G8EB 1J8KA 5CEZH 1AO7A 3O3BB 3RA7L 1PJ9A 3TN0D 4OUUA 5EUKB 2HRPH 1AR1D 2UV3A 2DOCA 1U2CA 3D1MC 4F2MA 3O8XD 1S9WA 4LSTL 4V1DA 5E9DA 3MV7D 1T22A 4XAKD 1ZXQA 4DK6A 1S8DA 3O45B 4OD1L 4U1NA 5HBBA 5F3HA 4KI5F 3D5OF 1DQTA 5DD5H 2EYTA 1R3HA 2AV1A 4NO0B 1D5XA 4QT5A 4TTDD 5I9QB 4P5KB 4KK8D 4OLVL 1AD0B 2GAZB 4OFKA 4XVJH 3W2DH 5FYLH 1GGYA 2BVYA 2MMXA 3H9ZA 5D2NB 4ODXB 1KLFA 4JKLA 1CFSB 4XNZB 3C9NA 3CIQA 3P0YH 2XKSA 3OKEB 3O3AB 1RV6X 3HLAB 1PQZA 4OFYD 4ODBD 4X9FA 3QXWA 4ZAKA 4F33B 2X4QB 1FCCA 1TTGA 1AXTH 3NZHH 1G7IA 3F7RA 5F88A 2D7NA 2J3SA 2AK4A 1OGTB 4M5YH 2FD6L 4YXKH 5SWSB 4HX1A 5DHYA 5EIVA 4R4FH 4B0MM 4ODTH 3WJLA 3TVMB 3W9EB 1MIEL 4R4BA 4EI5C 3TJHD 4UUJA 1UYWH 4YBQD 5BMFH 2MQ3A 4QHNA 1MI5E 4JN1H 3LS4L 4JJ5B 4DN4H 3QB7C 5C0AA 3QAZC 3INUL 3RBGA 4KI5C 2XWJA 3FFCA 1CD1B 4XCCL 5IHZB 1TZGL 2R1WA 5F7NC 5BCAA 4RA0C 4GMSL 1HQRA 1IFHH 3MLUH 4ZFOA 1FLTX 3RBSA 5GGTA 1KPVA 1Y6MR 4NZRL 2RR3A 2EH7L 2VITB 1ZA3B 3MTRA 4LLMA 4P3DA 1ZT4B 3LIZL 3CVHA 5C86A 3QXAB 3VFTB 3WIIH 3TBYA 4XP9H 5HY9A 1JPTL 3EYVA 1MVFA 3KPRA 4QRQB 2YZ1A 3QIWB 4R26L 2QSCH 2GJ6B 3HS0A 4HF5L 3CDFA 5BS0E 1WFNA 4Q9BA 2EDTA 4ERSL 1I7TB 2V5YA 1OP3H 3VRLE 4HWNA 3I50H 1HXYB 4CDGC 4GAFB 4PRAA 4UV7L 5DFVD 4HJJL 3UC0L 5I1EH 43C9A 5EZJB 3HNSH 3LN4A 5H8DA 4XBGA 1U8KB 4PJCA 3VI4E 3DVNA 1S9VB 5ESVB 4DKAA 1YQVL 5ICZA 2B4CC 5HYQB 3VGDA 3CDGB 4NC1E 1F00I 1WLHA 1L0QA 2VR5A 2XTLA 2WBJB 4Y1AA 2X42A 5LBSL 2APTA 3AFLA 2ZCLL 4F80A 3EOTL 1N6QH 2BOCA 3R1GL 1A7NL 1BZ9B 3FT3B 4YXLL 5CUSH 4M5ZL 3NFPA 1K4DA 4K3DL 3TJEL 3BKJL 2HMID 4XC3L 3OKKB 5ID0A 1KBGL 5CJ5A 5JW4N 5I8CB 1QPPA 2GUOB 3PIQB 2GW5A 3OHXB 1ZT7B 4NKIL 2R2HA 5IOPA 3H3BC 1K4CB 2YOCA 5DS8A 1S7QB 1J87A 4NBYB 5LGJB 1FJ1A 4M48L 2D9QB 1LO3L 4QTIL 3QEQB 1FNAA 2A9NH 4RWHA 5HVFB 5FO9B 4O58H 4MJ5A 3OKOA 5IMLB 4JB9L 4F7MB 2DF3A 3BDYL 1MFBL 2H9GA 2XRAH 1RZKC 3GI9L 1QKZL 4EIZC 3WS6C 4X5WB 2H45A 4H5SA 4NQXA 1KB5L 1UGNA 3EFFA 3BAEL 3HC4H 4QNPE 3MV9E 2Z8SA 5DD0H 2OR9L 3OPZL 3HI6H 1Q1JH 5C0RL 3QUYB 1EMTH 4TSCH 2B0SH 1MCOH 1AGFA 2R2EA 5IT2L 2H1PL 2RJMA 3T77A 4YJZL 2H6PA 1UZ6E 2ATKA 3W11C 4TSBH 5I71B 3GIVA 2K7QA 3QFJD 3EYUL 5ACZB 5GRVK 4U49A 4G8EA 4NJAH 4YDIL 3KLAB 5D7IF 2PCPA 3O3BA 4I4WB 3AGVA 4P4KC 3RGVB 4IRZH 1L7TL 5F7MC 3ALPA 3IS1X 5CJQL 3BRGC 5DJ0B 3K2MC 1HKFA 3P9LA 1D9KB 1MJUL 5TF1H 3TIEB 1IAIL 1ULVA 3CVIL 1WAAE 1MLBB 4EI5D 4JEGB 2IG2H 4NC0B 1CXLA 2R4SL 5SV4A 4NO0A 2VLKB 1TTFA 4YWGH 5H35B 4P5KA 4K07A 5JHDA 4KI5D 4M1CD 4U6VH 2UZYB 2GAZA 2YD8A 3LB6C 5GGSA 5D7LB 3EDDA 2OZ4A 1NLBH 1UJ3C 1FH5L 4JRYB 5JQHC 2X05A 5D2NA 2VLRB 4ODXA 2DKUA 3D9AL 4Z7WF 1VESA 3T3ME 3G5XA 4QHKI 4G5ZH 3QA3B 4UNUA 4XBEH 1NFDE 5JW5B 4Q6YA 3RZCC 3FN3A 2Y4SA 1ZK9A 4Z7VA 2X4QA 1AO7D 4POZD 1A6VH 3HMXA 5C0EA 4LLAA 2ADFL 5E9DD 2FGZA 1V3LA 5FCUL 3T2NH 3TYFB 1G9EA 3BPNB 1I7UA 2LE9A 5FM5O 1E4XI 5A3IC 3SEPA 4OFVA 3F58L 1OAZL 3P4MB 3FMGH 3T2PA 5E2WL 2WWKT 2MPAL 1J7VR 1X5FA 3C5ZB 5CJXA 2JJTC 4R7NB 4JJ5A 2G60L 2YRLA 5HI3D 1F6FB 5EG6C 2DLFH 5IHZA 5DD1L 5LVEA 1XGUA 3B9AA 1A14H 3VXME 1MNUH 2BMKB 2AW2A 4M1DH 3VWJB 4GBXA 5B4MC 2CR3A 1MJ8L 4GW5B 1EO8H 3HZMB 2XZQL 2QR0A 3QXAA 5EOCJ 2IPUG 2EKJA 2QSTA 1OAYH 4ZAKD 3QIWA 1BMGA 3MXWH 2GJ6A 5ELIA 4WCYL 2AK4D 2DQUH 2HJFA 5GQBA 1T2XA 4PJAA 4JR9L 2VZVA 5AZEH 2P4AB 1LHZA 3EJYC 3TO4B 2WMPA 2J4WL 3BE1H 4EQ2A 1YN6B 5KVDH 4M7KL 4LPUA 4NO3B 1BPVA 1CR9H 4QOKB 3LEXB 5DVNA 3CH1A 3P3YA 1U8KA 4EDXB 4R2GB 2NY4D 1YN7B 1S9VA 2FJGA 2CKNA 1WWAX 3T0AA 5HYQA 4RFOH 3CDGA 5CSZB 1YJDC 4Q74A 1QNZH 3T0WA 5HHPB 3SDYL 5FCSH 2V2WA 1SBBA 2CJUH 5CBEA 1JFQL 4F7EB 5HYSG 2FO4A 1Q9WA 2IAMB 4JHWL 5FYJL 4WUUA 3FT3A 4FS0A 3KPRD 3VMPA 5JW4M 1ACYH 3GRWA 1NDGA 3OKKA 1OARL 1A7OL 3A6BH 4E41B 3I6GB 4X7DC 2GUOA 3PIQA 5MERB 3TVMC 4EUPH 1ZT7A 4FQ1L 3BIAX 2Z35B 4TVPD 4KVNH 4JZJC 5KW9L 4Y16A 3O81A 4K3JH 4OLXL 1GC1H 1NAMA 4QTHA 5DUPH 3HMWL 1AGBA 3QEQA 4KPHH 1TZHA 4PJIB 3SO5A 3WJJC 4DN3L 5FO9A 4S2SB 5GRZA 1NANI 4XPTL 3KDMB 5GS2H 1V5JA 1OP5H 5DMYA 1A6TA 2JJVA 5EOCH 5IG7A 4JFEE 3CPLB 2KDGA 2VKWA 1DVFB 4AEHH 4BH8B 2FZ3B 3HRZB 4LSRL 4OD3H 3SGDH 1BLNB 4X5WA 3LHPL 1A1MA 3VFRB 3KNBB 3T0XA 4H20H 1HSAB 2X9WA 1Z0MA 1FYTA 5AYQA 3ULVF 2F8VA 2VDOH 1TVHB 3PP4L 1F8TH 4HGWB 1QBML 4P2OA 4YHPB 5BZWB 2WUBL 2G75B 3CZFB 4LLWB 2A83A 2DQCL 1DBBH 4QRPD 5HHQB 5F9WB 3RZCD 3D0LA 3KLAA 4KROC 4Z7QF 3RVTD 4F57L 5EH1A 3ULVL 3RGVA 3KYAA 2HFEB 4DUXA 1UWGH 1KLGA 3CK0H 3UAJC 3S6CA 1KTKE 3OAUL 3P77B 3ZYIA 3FOMA 5A3ID 1A22B 4JO3H 2GITB 1OY3B 2WBJC 2I5YL 1D5ZA 2BY0A 2G5RA 3PHOA 1O0VA 5DD3L 3MV11 4FQQA 1B4JL 3FN9A 4NRYA 2ICWB 4AEEA 1U95A 1JGEA 4GRWB 4GSDH 4JRYA 4CNIB 3LKPA 1SM3L 5AD0B 2VLRA 4JFZH 1DBMH 2JIXD 4M7LT 1S3KH 4F37F 2EIEA 3ULVC 1NFIB 5JDJA 3TT3L 3MRHA 5GS0H 1MPAH 3LPFA 1A7PL 3UJJL 4LCIL 1M7DB 4Y5YA 5IEHB 2CMRL 3DX7B 1HWGB 1FDLH 5BS0B 3IXTA 3QZWA 4XWGL 5HYSB 4DGIL 2FEEI 1MREL 2FYYA 1AGEB 1H3PL 3O2DH 4U6HB 4HAFA 3EJYD 3T0EA 3JV4B 4ETYA 2VWEC 5DJDA 3V6OA 1MCQA 4ZXBB 2AEWA 3P4MA 5JHLH 3DYPA 1CE1H 3R0MA 3VXNB 5T3ZD 4NO0D 1H3WM 1BFTA 5EU6E 4KMTH 5GISL 2MOVA 1GZQB 4HUWB 4BZYA 3MACL 3ZDZE 3QUYC 2C4FU 3VWJA 1OAQL 1ZHNB 2YPLE 5GGQL 4GW5A 3HZMA 4C55A 4YFLF 5IBTL 1HHIB 3BSZH 2GIYA 1ZLUH 5EOQH 1DN0B 3RY4A 4R7DB 1T1ZB 3L5JA 4PG9A 1Q72L 3C2AL 1LK3H 2WSKA 3TBSB 4OZIE 1AR2A 1LK2B 4M43L 2P48B 3ORJA 4OM1L 1NAKL 2A9MH 5SWSD 3VA2C 4AQ1B 2R2BB 1UB6B 1D9KC 3U6RB 3TVMD 1CDYA 2WP3T 3MUHL 5DHVA 1DBKH 5DQJA 1JRHL 2OXGA 3FN0H 2DMCA 2AS5M 4GUPA 3KLDA 3QNYA 3LEXA 1JV5B 3IFLL 2DQFB 4LVEA 4EDXA 2DMKA 4NQEA 2D0FA 3QULB 4DAGL 1MWAH 4HPOL 1EUTA 4MAUL 1UQSB 2CQVA 3O6LL 3QRFM 5CEYA 5CSZA 2ARJQ 2R0LL 4GBXD 3OMZA 2IJ0C 4F7EA 3NAAH 4PJ8B 5CCKH 4BKLB 3B9DA 2IFFH 1QSFB 1MCLA 5DDHB 2DS4A 3QIWD 5I18L 2GJ6D 4O4YH 3L7FB 3I6GA 2C7UA 4ZD3H 4YHML 3BPNC 1I9RL 4M61B 5HPMB 4M7JH 2CDEB 5FIEA 4IRSB 3PG2A 4U7SA 4FABH 3MLPA 2FL5A 4H8WL 1P1ZB 4OZFA 3MRFB 4PV9A 3D39E 4H25A 2LTQC 1CU4L 3C5ZC 5AZ2H 2Q3ZA 4Y4FA 3LSOB 4PJIA 1QSZA 2CRYA 4CU8A 1I85A 4PJEA 4OCXH 3KDMA 2WZPD 4RSVA 1IAOA 2X4NB 2PYFB 4HMCA 4WU5B 1RHFA 2AXFA 3ZYOA 3SE3C 2WBJD 4ZUTB 3PWJB 4BH8A 3FQWA 2F54A 3PWLA 3L5IA 1RUQL 5GXBB 4XP5H 1HDMA 2BNUB 4RBPK 4S1RH 5DUBB 5I1HH 1E4KA 3AM8C 2CRIA 1CXHA 4K7FA 3TO4C 2FJFB 5D1XB 2YBRB 2G75A 4RWYH 3CZFA 4JM4H 4LLWA 1I1FB 1NFDB 2Q8AL 2YEZB 5HHQA 3MRQB 3HRPA 1TJHH 1IM9A 4LFHD 2C26A 4YH6A 4YDLB 5JW4R 3QEQD 1RZIB 1MRCL 3Q6FA 3QJHB 1UVQB 4J3WA 3EOYG 5FYKE 4HUVA 1IGML 5TQ2L 4HWUA 4OFPA 4L1HA 2GITA 4OKDA 3WIHL 5GJSH 1KULA 5L2KE 3B2VL 4UB0H 2IAMC 1MFEH 1JYVA 1ZLVK 1GGCL 4AMKH 3WFCH 2ICWA 2VDQL 4NRXB 5EA0L 3QUYD 3VXMB 1NGWB 4OZGE 1NJ9B 1YEFL 5AD0A 3TT1L 3X13A 3GMLB 5I0DA 5FO7A 1EDQA 1J8HB 1INDL 1OD7A 4XCNA 3ZTJG 5EIQA 1P7HL 2YA0A 3GJEB 2J88L 5T5FL 2ZUQB 4Q7DA 1M7DA 3ZTNL 5IEHA 4XPAL 3DJ9A 3PHQB 1ZT1B 3RGVD 4NBZB 2AEQL 1BJ1J 2PR4H 3RNQB 5HYSA 5JR1H 1SQ2N 2QQKL 4HFUH 4LGSB 5DQDL 1QTYT 1D9KD 1X4ZA 4G80B 4PTTB 4U6HA 2GK0A 3RAJH 5CFHA 3JV4A 1WF5A 5IHUL 4ZXBA 4LIQE 5F9AC 2XZAL 1DVFC 4DQOL 1YNTB 5C09B 2H3NB 3MRIB 2H41A 3MRMB 4LSUL 4FP8H 2BZDA 4PJDB 3IVKA 4MQXC 3PGFH 2OL3A 3BJLA 1GZQA 2DLIA 4NUGH 1NCBL 5L6YL 1EIBA 3UTPE 1KJ2B 1W8OA 4HH9B 4JRYD 2HLAB 5SWQB 2VLRD 2VZUA 1E27A 1EEYA 2GHWB 1YA5A 1T0MB 1ZHNA 1GYAA 3X14B 4R6UA 5E70A 1HHIA 1FIGH 3BIKA 2DWEB 1XF3B 3DTXB 5SWZA 5F9WC 4PY7B 4R7DA 2QL1A 2QHRH 4XP6H 1FAKT 5J6HB 5I1AB 5D1QB 1C12B 2X7LB 5CGMA 3VRLF 3LH2H 3PQYB 4S1DD 1U3JA 4EDWH 1S7UB 3P30L 1ZVHA 5TPWL 3GSQB 3ES6B 2P5WE 3K2UL 1BFVH 1Q9LA 4FQCL 3DBXB 1BP3B 3ZE2E 3MV01 4PLOB 2BOBA 4NFCA 4WHDA 1RURH 1DLHB 1JPFB 4C4KT 3RFZC 2BHZA 1JK8B 3KPLA 1JV5A 4YEFA 3GSNL 2DQFA 1IAKB 4M4RA 1RIUL 4HGKC 3WFDH 2DL9A 2VMFA 3D3VE 3T04D 4OAWB 5L9DL 3K7UA 3VWJD 3V95A 4FNLH 4YO0B 5DRZA 1KPRB 4FQXB 1MEXH 1EFXB 2CLVB 2NY5C 1QSFA 5MEQA 1G9NC 3KWWB 4FZ8H 4CUCA 4LLDB 2O61B 2IADB 3GKWL 3E6HB 3O4LE 4PJGA 3T0DA 4NZDA 3L7FA 1D6VL 2VDMH 4U3HA 5KSUA 4GW1A 2EO9A 4JDTH 4AM0A 3EZ8A 1DZBA 5HPMA 3QIBA 1HEZA 1TPXC 2CDEA 3PNWB 4IRSA 3TO4D 3HTLX 1IQDA 3MRFA 3ZT6A 3L3IB 1JHKH 4DCQA 4QOKD 2HFGH 5C70A 5T3XD 4RX4D 4JO1L 4YHLL 3BZEB 3SOBL 4I3RH 4ELKB 3GHBL 2ZOKB 2JB5L 4R2GD 5HYJE 4YQXH 3G5ZB 2X4NA 3P9WB 4NC1C 4RNRB 4WU5A 3QUKB 4Q0XH 4QNPF 4Q9QH 1K2DB 1NCCL 3WFHB 32C2B 3OGOE 4ZUTA 4X5XB 5IIEB 4PRHB 3PWJA 5KVMC 4JQIH 2IAMD 4ZTPH 2HWZL 4RMUA 5CSGA 2BXZA 1A9BB 2VXVH 4OQTH 3I6KB 3G6DL 1U92A 1UZ6F 4OKVB 3TBWB 3KPOB 5F7FA 3R06B 2Z0BA 4ODUB 2DQEH 4E41D 2WINA 2E7LA 5DUBA 4ODHH 4PJFE 5EU3A 2APFA 1CDJA 3MYJA 4YDJA 2FJFA 5HHOB 2B5IB 3LPGA 2YBRA 1UACL 2YN5A 1I1FA 1R6VA 3MNWB 3MJ6A 4R96A 5DA0B 3ARBA 5GSVA 4TUKH 5IM7B 3H3KA 4Y4FD 5F6HJ 1WAAF 4I2XB 2VLJA 4IIQB 3DV6A 1RZIA 3QJHA 2AKRB 4HIEB 1JBJA 5D70H 2IBZY 4MQSB 1NMCB 4QHUB 5TJWK 4UQ3B 4UOJA 4ZO9A 1H15B 1S9YA 1OT2A 4N9GB 5IB1A 4XVTL 1WBXB 1ZMYA 5I6XC 1WT5A 1HINL 4AG4L 3MGTB 4PJ8C 5EU6B 1FVCB 5GGVH 3FB7B 2BERA 4AH2B 2Q87A 1I8KB 2A77H 4MQXD 4XT1C 4Y89A 3T3MF 2F54D 1EGJH 4WU7B 4NRXA 2J12B 5F89B 2V9TA 1NGWA 5JUEL 1YMMA 5HHXH 3U46B 5K9JH 1NJ9A 3QUMB 3RL2A 3GMLA 5FAAA 3RVVC 2YPLB 4DFHA 4QGTA 1J8HA 1AFVH 4N1CA 3KXFE 4S1QL 1A8JH 2CK2A 3GO1L 1SYSB 3VRIA 5D7KE 3RA7H 5L0QB 3NCCB 5C0GA 2O93L 4ZMAT 4OCRL 3ZO0A 1SEBB 4NZTL 4LSTH 4KKAC 1KXVC 2AV7B 2J6EA 3ARSA 3PHQA 1WWWX 1ZT1A 4OD1H 2IH3A 1VDGA 3TO2B 2APBA 3U9PL 3V8OA 3M07A 1NC2A 5CZXD 2LQRA 3B2UC 4HWZB 1DDHB 1TCRB 2NTFB 5FXCH 3SDXB 4HKBA 1HSBB 1J0YA 4X4XB 4OLVH 5E6IB 4F8QA 4C83B 1HHGB 1YNTA 5DEZA 5C09A 3P11L 2N56A 3DSNA 3AMLA 4PJDA 2LVCA 3V5KB 1U3YA 2O5XL 1XIWB 3NPZB 2UY7A 1AC0A 1PZ5A 2FX7L 1KJ2A 4HH9A 1PAMA 1P7QB 3ARVA 3K8LA 1T66C 2Z93A 3X14A 4U1SA 5CP7B 1ZHKB 5I17B 3C6LA 5D1XC 3DTXA 1XF3A 5DGQA 3O6ML 2V5RA 3RPIA 4FFYL 2FD6H 3RWHB 4R9HA 3S35L 4LLVB 4YDLC 3IFPA 4OQ1A 5J6HA 2X7LA 3SKOB 1QFWL 1CFTA 5E4EB 4MJIE 5BS0D 3PQYA 1XEDA 1MIEH 4IM8A 5FGCE 1FNEA 1GAFL 2YSSB 1A6UL 3LS4H 4S0SD 2KPNA 1XH3B 3I84A 3D39B 3G9AB 3INUH 1G6RL 5GGVY 4ZXBD 1JPFA 4XCCH 3SE4A 1TZGH 5FA4A 3STBA 1QA9B 1Y18B 1IAKA 4GMSH 1NEZG 3BP5B 1PY9A 4N0CD 5D5ME 4NZRH 1UXSA 2EH7H 4P2QB 3LIZH 1WCBA 3CFBA 1N8ZB 4YO0A 1JPTH 1KPRA 1BD2A 4FQXA 4R26H 5IBUG 1AIFB 5IWLA 4HF5H 4EIGB 1JZ8A 3KLSA 3U0TA 1JYXA 2O61A 3QWRA 5D6DC 3DO3A 4BH7B 4ERSH 5TDNB 1CLCA 1G9ML 3O9WB 4AENA 4KZDL 4XVUC 4UV7H 3UC0H 4HJJH 2CKBL 3AB0B 3AAZA 3V0AC 5CEZE 5C07B 4HC1L 4NQSB 4KDVA 3RWGB 1YQVH 1ZVYA 5IB4B 2VE6A 4LLUA 5LAXB 1MHEB 4ELKA 1KCVL 4A6YA 3MOAL 5JOFB 3X3FL 2PNDA 5LBSH 2E3VA 3LV3A 3LZFL 2ZCLH 3EOTH 2OTUA 3WUZA 4ETQA 1Q94A 3R1GH 1A7NH 4RIRA 4YXLH 4PRHA 3GJFH 5L2KB 1H9VA 4AIOA 4JFQB 3OXSA 4M5ZH 4WTWA 1OLZA 4K3DH 4PJ8D 1FGVL 3TJEH 3BKJH 3AUVA 3FO1B 1QSFD 1KBGH 3D0VB 3JTTB 4U6TA 5KVFL 1G9MC 4TVSa 4W68A 4OKVA 5D1QC 1BQUA 2M2DA 5FYLE 2YXFA 3R06A 5BVJA 4NKIH 4ODUA 3N85L 1VADB 5FOBB 2YS4A 2DI7A 5A16B 2J8HA 4F3FA 4QYOA 4M48H 1QR1A 5HHOA 4IRSD 4Y4KA 4G8GE 1LO3H 2K9UA 4QTIH 3MNWA 3ZE0E 5C08A 4D9RE 1BBJB 1KACB 4JVWA 1F13A 4I2XA 4IIQA 2NQCA 5CIPB 1HCVA 2G9HB 4JB9H 4YZFE 4Q2ZB 4GW4A 1F11B 1MFBH 3BDYH 4QHUA 3GI9H 1X5KA 3B2UD 5FYJU 1QKZH 2V7HB 3ARQA 1BIHA 3X12A 3RKDC 1WBXA 1KB5H 3BAEH 4UI2A 3Q6GL 3GSRB 3MGTA 2OR9H 3OPZH 3WNOA 1FVCA 1CFNB 4U1LA 5C0RH 2BNQB 3FB7A 3GHEL 2BC4B 4LPXA 3BIBX 4MLSA 4X7SL 1I8KA 4JN2A 5IT2H 2H1PH 2IPUK 1LDPL 1NGPL 3IU3B 1YY8B 1NPUA 2CPCA 1QO3A 4LQFL 3EYUH 1HYSC 2VABA 4JHAL 3MLXL 4NNXA 1SYSA 4YDIH 2XKNA 1CF8L 3PDGA 5EC1A 1A1NB 5D1XD 4PRBB 1L7TH 2XG4A 4C54A 5BV7B 5CJQH 1SEBA 5HVHC 1AI1L 4XPBL 2AV7A 3MLZL 4KUCF 3TH3T 4U2ZA 1VCAA 1MJUH 4PD4J 5GZOC 1IAIH 2APWA 4FQ2L 3TO2A 3CVIH 4PUBL 2V7NB 3HB3C 3SDAA 4LLYB 4JPKL 5IBUB 5TQ0L 2R4SH 1I9EA 4HWZA 3RIFF 1TCRA 3PGDB 3WO4C 2NTFA 3VJ6B 2GQHA 4QHMB 3UPAA 3SDXA 1LD9A 3VDBA 1HSBA 2DLHA 2LAGB 3LQZB 5HD8D 1T7WA 3ZDZF 1CQYA 3S37L 5GZNC 1PD6A 1XF2A 1FH5H 2HFTA 3FL7A 3V5KA 1OWRM 4CRPA 5GPRA 3D9AH 4Z6AT 4TUOA 4ZFOL 5GGTL 3VXMD 3D3VB 3HZKB 4XPGL 5HHNA 2X1QA 4GKZB 1FFRA 3FOLB 1J8HD 3CVHL 4U6YA 2H32H 5CP7A 1ZHKA 5I17A 2B5IC 3VGBA 4OZIF 4B7LA 3IRPX 4ZSOE 3VFUB 2M1KA 4I5BB 3WJLC 2ADFH 4LLVA 5FCUH 1X5HA 1MQKL 3SKOA 5FKAB 1KJMB 4LGRB 3F58H 4TVPL 1EH9A 1OAZH 1NMCC 4EVNA 15C8L 4N5ED 2YSSA 5E2WH 1YEHL 2MPAH 5FM5M 1XH3A 2G60H 1A7QL 1QSVA 1YEDB 5DD1H 2EC9T 1CTNA 3S37X 5C09D 2QKIB 4RGNE 1HI6B 4G3YL 1NBZA 5DJAB 3BP5A 2DIJA 3T4AA 2QADD 4OIBA 4FN0A 1MJ8H 3W0WA 1AE6L 4YBLB 4ONGL 4I77L 4P2QA 2XZQH 1TZIB 1ETZB 5D2LE 4XNMA 2VN4A 3L9RA 3FQNA 1VGKB 5L0QC 2XXCB 4LARL 4NP4L 4WCYH 3DUUA 1P53A 1X7QA 2ATPA 4F7TB 2DBJA 4JR9H 3GB7B 5D1QD 2I9LB 4YDKL 2HP4A 3PQYD 1I8IA 2J4WH 3SPVB 1KV3A 3QHFL 4PJFB 4M7KH 5J1SC 2YWYA 3DRQA 3MOBL 4QXUL 3QO0A 3JV6B 1FNHA 3D2UB 4UIMB 4M02A 3I6LE 3VGAC 2XACC 5C07A 5E6IC 3IJYA 3RWGA 1L7IL 4MQ7B 5M95B 1XIWC 3ULUF 3Q1SL 3VFGL 3SDYH 3MRJB 3V6ZB 1GXEA 1JFQH 1T03L 4UNTA 1HN1A 5ITFB 4JHWH 5FYJH 3RKDD 3MPCA 5L2KA 1J1PL 4KDTA 4HUKB 2W91A 2O26U 4FQXD 4JFQA 3ULUL 1EFXD 3FO1A 1U2HA 1OARH 3D0VA 3JTTA 1A7OH 5F9JB 1MY7A 5K9OA 4F15B 4HCRA 3QWRD 4EBQL 4OLUL 4FQ1H 4UT9L 5KW9H 4RAVB 3UMTA 5MEOB 1ROWA 5FOBA 3BGFC 3KXFB 4OLXH 1HYSD 3GMRB 4O5LL 5A16A 4MA8L 2Y36L 3HMWH 4DN3H 3VH8G 1XR9B 1S9XA 3FQXA 4XPTH 3SCMB 3IJHA 4IJ3C 4X9HA 1RK0B 1I9IL 2G9HA 2L7UA 4Q2ZA 3SDCC 4W6YB 2CXKA 4YR6B 3EDJA 1F11A 4LCCB 3BGMB 3HE7A 3RI5K 4LSRH 4ZFGL 5JXEA 4P4RB 5FYKL 5KN5B 3ULUC 5GRJL 3LHPH 1UH3A 4PRHD 4PB0L 1EFQA 3F12B 1YNKL 4MNGE 2ESVE 1CFNA 2BNQA 2BC4A 4OZGF 3HUJA 3HZYB 4Z7VF 2OZ4L 5BJTA 4FQHB 3PP4H 2A74B 1YPZE 4QY8A 5GGUB 3N9GL 3IU3A 1FAIL 1RJCA 1QBMH 4HSQA 2WUBH 3O9WC 2DQCH 1DN2A 1I7RB 2Q86B 4PRDB 1NEZA 4F57H 3ULVH 1O7SA 5HHOD 3V4UL 2KBGA 3RL1A 3OF6A 1WTGT 2XWTB 2YD5A 3MRPB 1T0NB 5E00B 4S10A 3HMXL 3ILPB 1E0OB 4J3XA 4XNQB 1SY6A 3OAUH 4NQVB 3VXSE 5FGCB 5F6HI 4DZ8A 2I5YH 1O5DT 2NY3B 4I8DA 2J2ZA 3MRGB 1F4YL 2X1OA 5IHBA 5DD3H 4QHMA 1ZLWH 35C8L 1B4JH 1FL5A 3LQZA 4WI8A 1FZKB 1QVOA 1ZANL 4MAYB 1W72B 3S7GA 3ARGB 5HSFA 1CD0A 4LIQL 5JORA 2ITCB 5C8JA 2HH0L 3GM8A 5I2IB 1SM3H 4ZFZB 4Y5VB 1Z3GL 2UZIL 5D5MB 4XRCB 3MRCA 1PG7W 4WFFE 1GOHA 1CE6A 3HZKA 2ZP0T 2BSSA 4NPYB 3TT3H 2YPLD 1A7PH 3UJJH 4LCIH 4PGDA 2FEDD 4K3GA 2CMRH 3ZL4L 3IJSA 1CL7I 4OIAA 3VFVA 4XWGH 1R24A 3UCRA 4DGIH 3UROR 1MREH 4XXCA 4OCLC 1H3PH 1WBYB 5CP3H 5K9QG 2OX5A 2C9AA 1IGFL 4O9HL 3WFZA 4I3SL 3SDAD 5I30L 5IJVB 3ESVF 4D3CL 4K9EC 4RZCA 3H42L 3CFJB 1H8NA 4JZOB 1JI1A 1I3GL 2JB6A 3AY4A 1OSZB 4X7FC 4OIIL 1V3KA 3UXFA 5GISH 5F7DA 4BK5A 4LASL 2Q7YB 5E6ID 3MACH 4ORGB 5INCB 2QKIA 5DJAA 1LE9B 4PGEB 1XIWD 4E5XA 1OAQH 4TNWK 1IEAB 4UDUB 5GGQH 1G7MB 3VH8B 1KGCE 5IBTH 3H3PL 4RISL 1P7QD 3KAAA 5DC9B 3T0VA 3KG5A 5J11B 1MCWW 1Q72H 4XI5D 3LRSB 3C2AH 4TSAL 1WSST 2A6KA 2A6DA 3ZKND 1KXQE 5GJTL 5BV7C 2VAAA 4M43H 1HQ4A 4OM1H 1NAKH 3GRWL 4DEPC 5F96L 3PL6B 3GB7A 3PGCA 4L9LB 1VFOA 5FO8B 1AC6A 4V2BA 2V2TA 4OLYL 1JRHH 1PSKL 3F7YA 3FONA 3D2UA 4I1NB 3IFLH 4QRUB 4Y19E 1NAML 3D39D 3G6AB 4DAGH 2AJ3B 4N68A 1EO7A 3RTQB 2GKIA 4HPOH 3QQ9C 3LQAL 4MAUH 2NY7L 3O6LH 4HLZH 1P2CA 5HGAB 1A6ZB 1FRGL 1QYGL 4MQ7A 5I19L 1I1AA 3STLA 2R0LH 3W5MA 3S3JA 2CRMA 2X4SA 3HAEH 1BVZA 3V6ZA 4P2QD 3LVEA 5ITFA 2UYLB 3V0VA 2F53E 3QXUA 1CDIA 1E4JA 5EUOA 3MO1A 5T5NG 5I18H 2H2SC 3U4AA 2OK0L 4TNVF 5F9JA 3HNTL 5DJCA 4PJFF 2EYRA 4YHMH 1ORSA 1I9RH 4WW1A 2Z92B 1YEIL 4RAVA 4W4OA 4H8WH 5MEOA 3O9WD 5F6IB 5DK3A 1SJXA 1CU4H 3AMKA 4U2YA 4HHAB 4ZYKB 3LQAC 4KJYB 2YZ8A 2XT1B 3HE6A 5D96C 3BUYB 1XR9A 4KKBC 5C07D 2GCYB 2Q8BL 4QRSB 1AQKL 1GL4B 3RWCB 1X5GA 4IOSD 1MCEA 2WIMA 3FRUB 3LN9A 1DQML 5F1NA 4YR6A 4F7CA 4HEME 4LCCA 1DANT 2W9DL 4NSKA 5B38G 3K4ZA 2KZWA 3CSBA 4P4RA 5KN5A 1XR8B 3BDBA 1URLA 4WEUD 3H9HA 4JZNB 1F58H 5L2KD 5SX5K 3O0RL 1RUQH 3V5HA 3PJSB 4WENB 3HC3L 4MDIB 4FQHA 3ZDYE 1S7XB 2CR6A 5GGUA 5DZNA 3TV3L 1MY5A 1JWUA 4ZUUB 2Q8AH 1SHMA 4XP1L 1I7RA 1FNGA 4S1SL 4Z5RB 3OB8A 3BEWB 3ETBF 3G5YB 4ZSOB 5CWSB 5FGBA 3KYNA 2XWTA 4JG0L 4H26A 1ZLSL 1MRCH 2W60B 3AS3A 4YK4C 1D5MB 1E28B 3ARWA 5I8OL 3NIDE 1IGMH 4HKXB 5TQ2H 4ACPA 4P46C 1SMAA 2YA1A 1T7ZA 4NHCL 4JM2A 3WIHH 2JJWA 4Z18A 4UNVA 3B2VH 5JXED 5F44A 1PZUB 1GGCH 5D72L 3ROLA 1DSFL 1FZKA 2VDQH 3KPPB 4O51B 4IRJA 5EA0H 1W72A 4V2CB 4RGNB 2BNQD 4OT1L 2Q6WB 5I2IA 1YEFH 1S7SA 3TT1H 4ZFZA 4F15C 3QCUL 1INDH 1XGTB 4PFEA 4K3EL 1JTOA 4NPYA 3P9MB 5D2LB 5I1DA 1S7WA 2VZTA 2J88H 4ONHB 2PO6A 5T5FH 3ARUA 3RWEB 1JIBA 3GZKA 3ZTNH 4UV4L 4XPAH 4HULB 4EQ3A 3U0PB 2VXTL 4LBEA 2AEQH 1T80A 4JLRB 2CLZA 5IF0B 2FSEB 5IVZB 2QQKH 5DQDH 3SCMC 3CC5B 4KC3B 3TA3B 1I4FB 4D9QE 1WBYA 4Z0XB 4DGVL 2C1PA 3BVNA 4HKJB 3CFIC 4OCMC 4PB9L 3LKQB 5IHUH 4LF3A 3U7YL 3EAKA 2XZAH 4DQOH 4P2RE 3WN5B 2WW8A 2XKUA 4LSUH 4KXZI 5DD6A 5IB2B 1V7NL 4E9LA 5L6YH 1NCBH 2VQ1B 3QQ9D 2ZWLT 4ORGA 5DK2B 2PXYA 5INCA 4WI2A 3G04B 1EZVY 4AL8L 1U8NB 3HC0B 4MD5B 4PGEA 4C56E 2D7PA 1IEAA 2EE6A 4UDUA 4RMQA 1G7MA 1X3DA 4DOHE 3VH8A 3D3VD 4JHZA 2VH5L 1KC5L 5A2IH 4EUPG 1JN6B 1OCWL 3GGWA 3E6FA 5B38B 3U7AA 2JCCB 1IGTB 1CS6A 3P30H 1OVZA 5TPWH 3LRGA 4L9LA 3IT8D 5EPMB 2FECI 3C6SA 3K2UH 4FQCH 3F7VA 5AEAA 5JA8B 4XHJC 5GRYA 3S98A 4WV1B 1KJVB 3KHOA 4CGTA 5DHXB 4EXPX 4QRUA 3GSNH 3QUZA 2M26A 4YHOL 3C5JA 1RIUH 3BN9D 2AJ3A 1QSEE 3LAFA 4IMKA 4MWFB 4MAYC 2VTFA 3DGGA 3ARGC 2HJKB 2FR4B 5IROC 1A6ZA 2YA2A 5I8EA 3S4SG 3CFCL 5L9DH 4K55A 3FQTB 4OGAD 4Y5VC 1ZKAA 1BWWA 1R5WB 4LCYB 3VXRB 5ID1B 2EE9A 3SKMA 3JZ7A 3SGJA 4MNGB 2QHLA 5JZ7C 1MHCB 3SKJL 3GKWH 1SJEB 1D6VH 2CH8A 4PV8B 5EDXA 1YPZB 4RGMC 2DL2A 5IFJB 3IKKA 5JOEA 4NN7C 4ELMA 2Z92A 1T0PB 3ZE0F 3QIUA 4NQTA 4JRXA 3VXQB 4HHAA 3D2UD 4FXKA 4JO1H 4YHLH 3SOBH 2R23B 4PJ9A 3GHBH 2JB5H 2GCYA 2NY6B 4M9PA 3RWCA 1XAUA 3W39B 1TJGL 3RX7A 1N4XL 1KUMA 4XCEB 1I1AD 1NCCH 3GMPB 4EJ1C 5HHME 5F7LB 2HWZH 5F7WC 4X8JA 4QHLB 4G6FB 1FSKC 3EDFA 4JZNA 3G6DH 1S7VB 3S5LA 1KSRA 4Q97A 1FE8L 3FB8B 5D1ZC 4ZDHB 5HGDA 1S7XA 5C0BE 3PL6C 4YHYB 3NIGE 1ZHLA 4PRPE 4OV5A 3RHWF 2DQDL 3UZVB 1UACH 4YC2B 3KXFD 4G8FB 5D7KD 4HD9A 43CAA 2OTWA 2X4RB 2M8XA 5CWSA 2VB5A 1DCLA 3MR9B 5AG8A 3RTQC 2W60A 5DC0A 3SCMD 3BP7A 1E28A 4K8RD 2D0HA 2W9EL 3GEWB 4XVTH 4EUPB 3KGRA 4OCWL 1FO0B 5J06A 1HINH 4AG4H 2XN9E 1GOFA 1PKOA 5EU5B 1R3IL 4M6NL 1T4KB 4PY8J 3FB5B 1CK0L 1TVDA 2OL3L 1U8MA 4N8VG 5JUEH 4X4ZA 1P5UA 4D0DB 5BOZG 2ZG2A 5D93C 4S1QH 2A1WL 3GO1H 5C6TL 4TUJB 5E4IA 1ZHBB 5CD3B 4GKSB 2GY5A 3MLSL 1ND0A 4ONHA 4OCRH 4NZTH 3JUZA 1JVKA 1WQVT 4XNUL 4PJBA 5D9SA 4HBQA 3U0PA 4JLRA 3U9PH 3AU1A 1T1WB 5IVZA 3CC5A 3TA3A 1I4FA 3FQRB 3OG6B 5CJ8A 4XXDB 3PXJA 3BD3A 4HKJA 3VXUA 4Q6IC 5DJ8A 4XHJD 3C60A 5HDBE 2NY3D 1UM4L 2NXZC 1JGDB 4UTBL 4X6EB 3SJVA 3GMMB 3P11H 1F90L 3WYRA 5DA4A 2O5XH 1HHHA 5IB2A 2Y7QB 2Y06L 2VQ1A 3VE0B 4MAYD 4NBXB 2FX7H 5A2LH 1XCQA 3MNVA 3HC0A 1EXUA 3AXLA 4QRRB 3WUWG 2ILLA 1RULL 3RVWC 6FABL 1KG0A 2GFBA 1CT8A 4OSUL 4PJGF 4C57C 2BFVL 3LRHA 3LOWA 2F53B 3O6MH 4L4VA 2RFXB 4FFYH 4OCYL 1KYOJ 3FTGB 3S35H 5IB5B 1S7RB 2BJML 1QFWH 2BVQB 1JN6A 3KPNB 4OZHE 1UM6L 5HDLA 1U8HB 1N3NA 3MBEB 2JCCA 1C5BL