1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
b'YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINGIPAIN R
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
4RZCA 2BXZA 1DUZA 5D7JA 2XQBL 4RX4D 3REWB 4MXWH 3SN6N 2ADGA 4K9EL 3SO3B 1Q0XH 2UYLB 5GZND 2C3VA 4PB0L 4RGMB 3FZUC 1HILA 4ZFZB 1UZ8B 1RPQA 2V5MA 4CN4A 3KPMA 1PG7L 4ONGH 4MCYA 3MRJB 5A3IC 1CU4L 4CVZA 1OF2B 3EJYC 4O00A 5IKCB 5I6XC 5GGRA 5J8OA 4ODUA 1XF1A 1X5ZA 5FFLA 1SEBA 1ZHNB 2G5BA 3DV6B 4GKSB 1LVEA 1NMAL 1K86A 1WJ3A 4JO1H 4JDZA 5IESL 2FATH 3BN3B 1JPTL 4YHZH 1KACB 1Q9WA 2CGRH 4U1SA 5LXGH 1XF2A 3PWPD 1X4YA 4GRMB 2WUBL 2BX5A 3REVB 4HGMA 4Q2ZB 3P0VH 3PD0A 1CXIA 5TQ2L 4JZJA 4DGVH 5IAKA 2GW5A 3DUUB 2NY4C 3OKMA 1OAXH 2LAAA 3V6ZA 4KK6D 5IFHL 1HNGA 1VDGA 4GOSA 4XMPH 1ZEAL 5MERB 4W4OA 5IMMB 1EDQA 3QA3B 1MY5A 3QUZD 4K7FA 1KTDA 3BIBX 1I1CA 1LP9B 4Y2OA 4CADB 5EOQL 3C6LD 5AEAA 3ARRA 3Q5YA 3S7GA 4LSDA 1CLYL 1NGYB 3MLZL 1OSPH 1NFDE 5DJDB 5C07B 4JQYA 4NC0B 2XY1A 2GYSA 4U4BA 1HDMA 5IJKC 1JHKL 3WFCL 4RGNB 1GSMA 4Q9CA 5IM7A 1SJXA 1AI1L 3U0WH 4ISVB 4LK4A 1UWGH 3SDDD 1R0AL 3F6LA 3BP5A 4C57C 3CSYA 5JHDD 3JUZA 4NHUA 1WAAA 4U49A 1SVZA 2WAHA 2NY3D 3OX8A 4G8GE 3VA2C 1WUNT 4X7EC 1HQ4B 4HXAL 1IAIL 3Q6GH 2F53E 3EHBC 3L5HA 4PJ7B 1I9IL 3UTSA 3PWNA 4PPTA 2B20A 2DQDH 4PJBB 4KVCH 3S98A 4YDIH 1IFHH 3H8NA 4APQB 3SCMA 1A6PA 3L3GB 4U31A 2EDOA 1K3IA 2IBGA 4D9QE 2XKNA 2AI0H 4RWHA 1GGUA 3ET9F 4M43H 1CDUA 1RIUH 1H3GA 1JGDA 1JHTB 4PY7B 4HHAA 3IDYC 4B53A 5JW3H 2MCPH 1YN6A 2B1AH 4PRIE 4X80H 4P9HC 1AP2B 3M17B 5ICYB 5HPOA 2GTZB 4OFVA 4XP4H 4PREA 1R3JB 4BQCA 3MOAL 1MFDH 4I1PA 4AIZA 5ID0A 3UYPA 3BT2L 4PJAE 3EOTH 1IGFL 3EFDL 4KXZI 2FEDC 2K7QA 4L8BA 2OI9C 5I8CB 3T1FB 1OVZA 2VZTA 3BGFB 2CKNA 2WW8A 2D0HA 1N8ZB 3H42L 5IG7B 2NZ9D 1U2HA 3G9VA 3NABH 5FGCB 4O2FB 5E8NA 2ED9A 3B8SA 2ITCA 2VC2L 2Y07H 3OR7A 3C5ZC 2I5YH 4PS4L 2CDFB 2QQKH 2VXTL 3MRFA 3VE0B 3U0TB 4GQ9H 2YUVA 5IVZA 4G80B 3P2TA 4RCAA 1T89C 4XAKE 3QWQB 2HKHH 2P5ED 3EKCA 4U6HB 5DQJB 4BH7B 2Z93B 5D1ZA 5FYLL 1JTPA 2C4XA 3DMMC 3KPPB 3O3DA 4WWID 5GJSH 5D96B 3B3IA 1VCAA 5E8OB 3FB7B 1R24A 4GRWH 2A6IA 5AYUL 4PGCA 4HWEH 2CNLA 2W65B 3FOLB 5KJRL 4ODWA 2I60L 5FDWB 1NCAH 1A3RH 3BN9C 3MRQA 5EB9A 3R8QA 4AQ1B 4D0CA 2YD7A 1RHQA 5DD6A 3I6KB 1NCCL 5IW1A 1A8JH 1U3YA 3MLTA 4LPTA 5D7LB 4Z77A 4S11A 1NAMA 2HT4C 3FQNB 5I1EL 3PHOA 4W4NA 1GGBL 4C59B 3OAYK 3H11B 2P43B 1SVCP 1U8QA 3T08A 5HYQA 5EH1A 1UVQA 4LQ1A 1F11B 1EAPB 4FQCH 1A1OA 5CGYC 3V7AG 3QG7H 5T3ZH 5CEZL 1AGDA 4LPWA 1KIRA 2MQ3A 4NO3B 5EIIB 1RUML 3KPOB 2WIIA 4JCLA 1AR1D 4PFEA 4GKNB 1K4CB 1ZANL 5EU6D 3Q3GB 4P5TC 4LRIA 1JWUA 4TSCH 1UH4A 3ARGD 2Z91B 5H2BA 1CFQB 1LK3L 5IROC 1VADB 2HRPH 2NY6C 1P4LA 3O3UN 1EXUA 3B6SA 4XVJH 2V2TB 2GIYA 1CIDA 2YPVH 3E6HA 3IGAA 4UQ2A 4DCPA 5ACLA 5HI3C 3WS3B 1EGJL 1RMFL 1D9KA 4NN7B 4P2RB 1PZ5B 3GFUA 2R4SH 1BQHG 2EXYC 4PJ8A 4U6XA 2Y72A 2R23B 4PR5A 5DSCA 2VLJB 3LKNB 4NCC2 1T6WA 1KJVB 4KWUA 2X4PA 2G9HB 3GMNB 4N9GB 4JZOB 5F9JA 5GQBA 3TGXA 3I6GB 2AV1A 5LAXB 4JQIH 1KIUA 4JFEB 5DTFB 4AY0A 1NL0H 3MA7B 3IFPA 4HPOH 4YDJA 4XNYH 2Z8SA 1CK0L 3HPLB 1YPZE 2NY5C 3AROA 3KVQA 5INDB 4PRPE 4KPHL 4ZDHA 1EO8H 1NGXA 2YD5A 3CXHK 5E6IB 4WHDA 4F9PC 1NFDF 4D0BA 5FB8A 4PJ5B 1ZOXA 2DOCA 4TPRL 1SMOA 2VQTA 1CE6A 2W0FB 4FG6C 3VFPB 2VLKB 2PYEB 4NQDD 5I8OL 1KXVC 5AZ2L 2A38A 1MEXL 3VH8G 4HGWA 3H9ZA 2XN9B 4NGHH 5LUAA 4UTBL 2AJ3A 3T65B 4XB8A 1P4BH 1YUHA 1UJ3A 2CRIA 3BFOA 5SWSE 1MFBL 3FB5A 3OKDB 3TA3B 2XWBB 4GMSH 2KZ1B 4K94C 3S37X 3PJSB 2QJDA 3VU2A 3ARBD 4HSQA 2AS5M 2CR6A 4EHFA 5CEXB 3HI6H 5IASA 2YWZA 4P3CH 3N0PB 2F19H 1HNFA 5DEGB 4YXLL 1FFOB 3BISA 1XGYL 1SYSA 3Q1SL 3QB7C 4GG8A 4I18A 4KHTL 5DA0B 4A2LA 5M7QA 1FE8L 3K1DA 4ZOAA 1IC7L 1OLLA 3PDGA 5F6IC 1XGRB 4WI6A 1B4RA 1KV3A 2EYSA 5F3HB 3ARSA 4N8PA 1II4E 3LV3A 1GXEA 2BVUA 1NBVL 4LPXA 2IG2L 3VXUA 12E8H 1FSKC 1REIA 2OBGA 1QFUH 3H2WA 5CSZA 1CBVH 4XCCH 2OJZH 5GGTL 1ES0B 3MJ9L 4J12A 1ZA3B 2XV6B 3HUJA 3QJFA 3ZTNH 2AP2A 4PV9B 5DK2A 4DAGL 1D6VL 4HZLA 5K93A 1R3HB 1AHWB 4EN3A 4OLXL 3FQWA 2FDBP 1E4WH 3PXJA 4PJAF 3V5HA 4ETQA 4QRRB 3D0VB 1FO0H 1PX4A 3I75B 1A7NL 2J31A 3NN8B 3PP4L 2DQIL 4BH8B 3BKMH 3MRGA 3WUZA 3DURA 2KH2B 5MENE 4PRHB 3FQXB 4HK0B 5JXAH 3D6GA 2FZ3B 3ESUF 4DJMA 2PNDA 5GRZA 5GGTA 5FGSA 2Z0BA 1NUDA 3WKML 1HHKA 3GK8H 5HVHB 3NS7A 5IC4A 4TVPD 4FFWC 1KULA 3JTSB 1RZKL 2YEZB 1DVFD 2Q6WB 4WHYH 4DCQB 4WU7A 1B4JH 1CYGA 5JXED 1A6ZB 4LHUG 3JV4B 5F7DA 1A3QA 2FIKA 4LLWA 4U33A 4PYGA 4U1NA 3PWPE 4BSJA 5J6HA 3OXSB 1G84A 1SBBA 5C86A 1CE1L 4XNUL 4TSAH 5GGQL 4K3JH 3LKSB 4KTDL 4OZ4B 4IHOB 4FGUA 1I1YB 4KDTC 4LDOB 1F3JA 3IFLH 3F65A 3O3EB 4YHPA 1UWEL 3GMOB 5I17B 3RJDA 4K8RH 3WE6B 3PWJA 3MFFA 4H25B 1S8DB 8FABA 4NKMA 4FQXB 4PJIA 3UTSD 4MDIB 4Q9QL 2CRYA 4RIRA 1JN6A 5DRXB 3SCMD 3SDCC 5B38A 3GSNL 5ECJE 4QUEA 3FB8A 4QXUL 3O4OB 3HE6B 1ZK9A 2QQLH 1SMAA 1S7SA 3WLWC 4PD4J 2X4TB 1LQSR 4ZS7H 5FYJU 4XP5L 3SDAC 5JHDE 2QR0A 1LO0L 5IR1B 4JFPB 5HYJB 3GMLB 4QGTA 1F97A 4CUCA 4GT7A 3L3OB 1KC5H 3U7WH 2WP3T 1A1NB 5IAEA 1VFAB 2FO4A 5D2NA 1ACYL 2VYRE 2C4FU 3L5WB 1FGNL 4J4PA 1DN2A 1QBLL 4Q0XH 5HI4C 2X7LB 4RMTA 4JFZL 2ID5A 3RTQB 2PO6A 3ARTA 1U8HB 4H5SB 1VACB 5HHMD 1N26A 4G42B 3Q2CA 4OZFH 5K9JL 4H20L 1QVOB 4L3EA 4A6YA 1PD6A 4XVUC 3A6BL 4MXQD 1BFSA 3B5GA 4HWZA 4L4TA 4OF3A 4QXTA 5FYKH 1CN4A 3E1F1 4QTIL 3BEVA 4CKVX 2LTQC 3TP4A 3ARFC 2HH0L 2NY1B 4PRDB 3DBXB 3GMPA 4B7LA 1GC1L 5MP6H 2DTML 2V17H 4TNWF 5D1ZD 4M62H 2OP4H 3O6ML 2NX5A 2FO1A 4S2SA 3R7SA 1YPZF 2AGJL 3WL9A 3LRSB 4KZEL 5IB4B 4JJ7A 1UXWB 1ORSB 1UM5H 1FGVH 3U2SA 2F8VA 1FNAA 5E8DH 5CEYB 1VERA 3TCLA 3NFSL 1BQLH 4QYOB 5IVXE 3GSQB 4KTYA 4G5ZL 5FYJD 1N3NB 4P99A 1L7IH 5GRYA 2FUNB 3DRQA 3FQTA 5BRZA 4HUVB 3OMZA 1C7TA 4J6RH 4CVXB 1FL3A 5CUSH 2NTFB 1RHFA 2A6DB 5IMKB 4O2CA 4CMMA 4IOIA 1JHLH 3EDJA 1EJ6A 3CFEB 4IIQC 2P5EE 3KPNB 3VFRA 1FC2D 1LD9A 1RZGA 2BNRB 5F1IB 4M5ZL 4WO4C 3QDHA 3CVHH 1NCUA 1T03H 4HIHA 1JZ6A 3V4LA 1MHEA 5F7HA 4ONFH 4CN1A 2NY7L 3HI1A 3LY6A 5ICZB 3HTLX 4Y88A 3BP4B 3T4AB 1I85C 3MLVL 4HJGA 3FOMA 5BOPA 1SM3L 5L0QB 5E5RB 2X4UB 3PQYA 4OLWL 3I9GL 4Z7VA 2J7LA 1MWAL 3QPXH 1BVZA 3TJEL 3VW3H 1AFVH 1JGEA 3C8KA 3GSWB 4LAQH 3UTTD 1MCIA 1LO3H 2XY2A 4JY4A 5KSBB 1GQFA 1S9XA 5MEQA 3BPOB 4OGYH 3A6OA 4JQVC 1D9KD 3D87B 4HGKC 4PJ8D 3C09C 4DUVA 1JMZA 3NFNA 4KY1L 5T1KA 5KBNC 4KQ4H 1S7QB 4NN6B 1KF9B 3UCRA 5EU6E 5DQDH 3RZCB 4NQEA 4M4RA 3TIDB 2APFA 4YZFE 4IOFD 2Y6SC 1MVUA 2YK1L 2GJ6B 2X1PA 3QCUL 1QFWL 5DK3A 4GRWB 1MWAA 2DLHA 1BQHA 5DJ2A 1Z6JT 4ONHB 1ZLWH 2YC1B 4POUB 5KW9H 3MA9H 3QNXB 2OR7A 4QCIB 2FRGP 4KZDH 3F7PC 2VDLH 1C16B 3W39B 2A1WL 2DQTH 4LCUB 4UUJB 1WITA 2ZUXA 1R5VA 3B2UD 4J3XA 5A16A 2EDYA 4LSPH 2BVPA 1BZ7A 1QO3A 1KJ2L 3T3ME 3WJLC 1U8JA 3QJHB 2EIDA 4P9ML 4YGAB 4OT1L 3HCVA 1U92B 3LZFL 1RJZA 1B9ZA 2E6JA 2R0WL 1MAJA 1UCTA 1MRCL 1T1WB 2HJKA 3PWLA 1N64L 3L5XH 4D8PA 4ZTPH 3G5YB 2DLTA 1TJGH 5L9DL 1KG0A 4C83A 4Y4HB 5DK0A 3RQ3A 5B4MC 3MOQA 3ARXA 1IJ9A 2HLFD 2XI9A 1CGXA 5DUPL 4TRPH 3IDGA 1E6OL 4OLVH 4YDLC 1ZS8B 2F54B 2QHRH 3HNTH 1O5DT 2BC4A 3VXUD 4ZTOL 5IHUH 3V0WL 1KJ2A 4LVHB 4R7NA 4L9LA 1QBAA 1I7TB 5BZDB 1PKQA 3EYVA 3V6FB 4CVUA 2XOTA 4N5EC 3X3FL 3KYKL 3SO5A 1WCQA 1E6JL 2D03L 3MRRB 1DN0B 4RFOH 3INUH 5TQ0L 4D9LL 5F9DC 3O6FD 1TVHA 5HDLA 2FJGA 4KK8D 4HKJB 3OKOB 2KKQA 1FVDA 1KN2L 3SBWC 1RZFL 4P2QB 2VIRB 5H35B 3TT3H 4MJ5A 4YXKH 3D18A 3IS0X 5LU9A 3CDYA 2P1YA 2F74B 2HN7A 3SKJL 2A6JA 5ITBL 2ICEB 4L8SB 1MCPH 4NWUH 3VRJB 2BSSA 2QQQA 1KBGL 4JPWH 5AD0B 2DJSA 3V5DA 1Z9SA 3QIUB 3STLA 4D2NA 5JIKA 1MJUL 4ODSL 3GZKA 2XQBH 4GAGL 3NCFB 1EPFA 1M6OB 5MHSD 4N0UA 4JY5H 3H6JA 1H8NA 4JREC 3H0EA 4K9EH 1BOGA 2A73A 4PB0H 2ZCKL 3NA4A 5FKAA 1IGIL 2X1QA 4FTVB 3BAEL 1PG7H 1S9WA 2FBOJ 2LVCA 1DR9A 4X6DB 1CU4H 1QQDB 1IARB 4RGNE 4WJ5A 2I07A 4OI8A 5IVXF 2DMCA 1IE5A 4LHUA 1WFTA 2WQ8A 3DO3A 4LCCB 5CZXC 1H5BA 1NMAH 5A2JH 4MD4A 5IESH 1KLUA 3QRGL 1JPTH 4POZD 1VEOA 1P6AB 1AIFA 4TVPE 5BVPL 1GOHA 2WUBH 5KSUB 1CGWA 2NR6D 4TOYH 2OSLA 4Y19B 1PQZB 5TQ2H 5IUSA 1X9QA 4Y1AB 4IJ3B 3JWOC 1EMTL 3MJGX 4XPAL 3V4OA 3DIFA 1OWRM 4YUEL 1T4KA 3DHMA 2XTJB 5FECA 5IFHH 2UWEA 1ZEAH 4W70A 3WKNA 4Q74A 2YZ8A 3I3BA 4X0KA 4X5LA 1QLRA 4M6OL 1Q1JL 1RUKL 1P2CB 2C1PB 2X4NB 4NUGL 5E2VL 5EOQH 5SV3A 4F37F 1AR2A 5F3BA 1NCWL 1NMBL 1E28B 1CLYH 3CFJB 3MLZH 1FO0B 5C0DB 5DF0A 3NIGE 5E1AA 2RFXB 3TN0C 5TFSL 3V5KA 1BF2A 1HQRB 3AMKA 3HZVA 1ZGLB 1JPFB 1JHKH 2GJJA 3RKDC 2RB8A 1RZIB 4J4PD 5KANG 3WFCH 1DL7L 4FQQA 4UBDD 4ZO7A 5C08E 4AWBA 5LGKA 5SX4I 1IGCL 1AI1H 3ULSA 2Y7QA 3ARDA 1AH1A 3AU1B 1PG7W 1R0AH 1AE6L 3AXLA 4AG4L 4WW2B 4L4TD 5F1SA 2MHAB 4HXAH 2ZUQB 4QRPA 2QKIB 4NRXA 2VL4A 1IAIH 3G6JA 3O4LA 5T1LA 2YPKA 1I9IH 4OKVB 4QRTA 4YZFF 4MSWB 5E2TL 2AK1L 3K1KC 4ZXBB 2VLRA 1KEMH 2NX5D 4CW1A 2J12B 4QOKA 2NY3C 1UFUA 2ENSA 2Z35B 3P9MA 3QUZB 5HHQB 3VDCA 3UDWC 2XZTA 1G9NC 2ZZUT 3CUPA 5HHME 1XF3B 3BZ4B 1W0WB 2XQYK 3OHXB 3PD1A 5MEOA 1A7BA 4MWFB 1FQ9C 4Q9BA 1ZT4A 5GSVA 4HS8L 1Z3GL 3FONA 3HS0A 5CJBA 3G08A 3LEYL 3W81A 4UAOB 5BRZD 5IB2A 3T3MF 3TVMB 3MOAH 1AC0A 1AO7A 3FFCB 1GGYA 5D7LE 4XBGA 2XPGB 3BT2H 4HW6A 1IGFH 3EFDH 2OCFD 3IFNL 4HS6B 1W0VA 4G9DB 4OF6A 4DVBB 2NTSP 1U93A 3MUY1 5I16A 3TWCL 3H42H 2WINA 3BIKA 2JB6B 1JWMB 5EUOE 4O5LL 3EZ8A 5H37G 3MZGB 3VFOB 5LU8A 4PS4H 5D1XA 2VXTH 5KZCB 3BSZH 3L1OL 5FYJE 1HEZB 3ULUC 3CDGA 4R4BB 3PQYD 3DSFL 4JJ5B 4LARL 4AL8L 3RGVC 3MBEB 5DI8A 3RBGA 5FYLH 2NZ9C 5T5FL 1P7QB 1U2CA 4GRLB 3TV3L 2EKSB 4OZFB 1CXLA 1INQB 1TENA 5EC2A 5BW7A 4OZHE 3BKJL 3UOAB 3KPQA 3TYFB 3D9AL 4GH7B 5AYUH 1BZ9B 4FXGA 3T0WA 5KJRH 1ZT7A 2IH1B 4JM2B 1U3HC 2I60H 2JJTA 3JUYA 4GLRI 5T1KD 2VLMD 1FRGL 4HV8B 4P2RE 3E8UH 5E2WL 2C1EA 2IF7A 1GZPB 5DMGD 5GGSA 1NCCH 4NQED 5HBBA 3EFFB 4U1HA 5JZ7D 1F4WL 4N8VB 2R2CA 2EYRB 4Z78A 5I1EH 1GGBH 2COQA 4OFIA 4D94A 5KAQF 5I8EA 4DN3L 4LF3A 4XPHL 1MLBA 3WFEL 1P4IL 2C3HA 2BSED 5DJYA 5FO9A 4LLDA 5CMAB 5LBSL 5CEZH 5ID1B 3UTTE 1T7VA 5GGRY 1RUMH 3TH4T 3J7HA 2ERJC 5MI0C 1LE9A 1ZANH 1NDGB 4N1EA 2W60A 4DEPC 2Z8RA 1YEHL 1NUFA 3B43A 4MVBD 3U9PL 5EBLA 2GSGB 2EDTA 2O93L 2VLKE 1EAJA 1UB5A 1CICD 1LK3H 5IW6B 3DXAD 1XMWA 5JOFB 1ZWIA 3CVHB 4TTDC 3PNWB 1MCCA 5HHNA 2XN9E 1TTUA 1AR1C 1GGCL 1ND0B 3O8XC 3MRCB 2X41A 5C0CB 3O2VL 1J0YA 4DOHB 5HJ3B 4NQSA 3MREA 4P2OD 3ARGC 4GG6A 1SJEA 3N06B 1EGJH 3WDJA 1RMFH 1N0XL 3V6BR 3VXNB 5E5UB 2EEDA 2LABA 3BQUB 5KANI 3VXRD 3TH2T 1C1EL 3CFDA 2X4OA 1EZVY 4PGDA 3T8XB 3UTQA 3WFHB 3RL1B 5TDPB 1IC5L 1T1YB 2JIXA 4K23L 4NRYB 5IHZA 4HUUA 4Z18A 2IFGA 4HT1L 2MSPA 2ZUWA 3GRWL 3VA6A 2CH8A 3EOBB 1S9KC 1CK0H 2E7CA 3U46B 4PJCA 4KPHH 5HY9B 1M71A 2EKJA 1RHRA 2ITDA 5BQ7A 2YOCA 3NIGF 5C0GA 4MMXC 4LAJH 4TPRH 4JFOB 5FA3A 5I8OH 1VENA 5AZ2H 1MEXH 3HHRB 1VFBB 3MLXL 4UTBH 5BCAA 5E9DB 7FABL 1MFBH 3VWJA 1TQCB 3VXUE 4JG0L 3PIQA 1RVFL 5F89A 2AEIT 3ZHDA 3SO3C 2D2OA 3MGOA 2BHUA 3ROOB 4RGMC 4YXLH 4XBPA 3EYUL 4P23A 1XGYH 1RZJC 3GSXA 1VESA 4KHTH 1CWVA 3ZKSD 1FE8H 4WFHD 1IC7H 1P6FA 5L2JB 1BWMA 4WCYH 1AQDA 1PAUA 3MCKA 1NBVH 4NT6B 2IG2H 3OKEA 3CK0L 3C6SA 4PIRF 2GITB 2E8ZA 3D2UA 1EHXA 3FRUB 4QHLB 2J32A 1VKXA 3V4PL 3MRMA 4RSVA 5GGTH 4HIXL 4R6UA 4LHUD 3H9SA 3MJ9H 5FOJA 3C5SA 5C3TA 3V2AR 1MJJB 4HKZA 4LVEA 4MDJB 2Z31C 4LMQE 4DAGH 3BPNB 4K7PL 1D6VH 1TTGA 5GXBB 4ZD3L 4YFEA 4OLXH 5K9QG 3RRQA 5MHSE 1CFSB 1INEL 3HZKB 1J8KA 2ICES 4BJLA 2FECI 4MLIA 4IS6A 1A7NH 1FAIL 1ROWA 2DBJA 3PP4H 4N9OB 2DQIH 3ARBB 2X40A 4RZCB 5FXCH 4L3CA 5D7JB 1KCVL 2L7UA 1J1OH 5EUOF 4MX7A 5IHLB 5EU4B 4GXVL 1CDGA 4C4KO 3WKMH 1FH5L 1Q72L 2ADGB 4GUPA 5IJVA 3QR2A 2C3VB 3MRDA 3LQAC 2IQAA 1RZKH 1HILB 4RGNC 3M07A 3W0WA 5HYJE 3MX0A 3KPMB 4JO4L 4MCYB 5J6GA 5HPMA 4CVZB 4PJIE 1GGTA 5C09A 3HLAA 4OZHF 1CE1H 4XNUH 1WWAX 2VDPL 5GGQH 3ARDD 4NOBA 4KTDH 3MV9A 1MPAL 3QEUB 3RWEA 1DVFC 1YC8A 3HMXL 3HZYA 2EC9U 4MYWB 3CMGA 4U6VL 1KJMB 2DLIA 4X7CC 5JXEC 1WWBX 4QF1A 3ZKQD 3DLQR 3G5VA 4U1SB 1XF2B 3NPZB 4HLZG 4YHLL 3VG0L 3EO1A 4UT9L 2NXYD 4APQC 5ESVA 5T1LD 2IALB 4U1GB 1KTLA 1KEGL 2EYTB 5K9OA 4Q9QH 3V6ZB 3C60C 3GSNH 4JRXA 5L2KA 4QOKD 4QXUH 2PYFB 1VEMA 1CFTA 1BWWA 3QXDB 3BH9B 2I24N 4XHJD 4ELME 2QADC 4ZAKA 1J0IA 4QULA 5DHXB 1YMMB 3WHXA 3RFZC 2EICA 2D31A 5JR1L 2FB4L 5DUBB 4L4TE 5HHOA 1R5WB 2DS4A 1ZT1A 5IM7B 1AO7D 4Q7DA 2OR8A 3JV0A 3BGFC 1MCKA 1G9EA 3RUGA 1FGNH 4MNHB 3CSYB 1QBLH 3F7YB 3UTPD 2P2CA 4JFZH 5C3LD 4NHUB 4YHIA 1XCQB 3OX8B 5HHPA 3VGAB 2BVYA 3DVGB 4LDLB 5K9JH 4H20H 4U1LA 1XR8A 5GPRA 4EHNA 4DTGL 3A6BH 2AXJA 3P45A 3MLSL 3OL2A 1T2QH 1G7MA 3UTSB 4O51A 5D1XD 3GSRB 1QPPA 4R0LA 1HHGA 4QTIH 5CWSA 5GS2D 2CLRA 2YPLA 2FECL 2HH0H 1OTUD 3CH1A 4Z7UB 3I50L 4XMKL 1AXTL 1GC1H 2DTMH 5BRZE 4N0FA 2XKNB 4P46A 3VXQB 1K8DB 1KLFA 1JGLL 5SWZE 3RPIA 4L4VD 1XF4A 4OI7A 3O6MH 4ZUTA 5J13B 1A6UL 2AGJH 4KZEH 2B39A 3BW9B 3RVUC 5HGBA 1IKNA 4R7DA 5JPNA 3NFSH 3DRTA 4RAHA 4AWAA 1T0MA 5ID0B 3KS0H 1AQKL 5GS0D 3N9GL 4X98A 4NBLA 3CFCL 1SJVA 4YBQC 5FF6A 2ESVA 3PQYE 4PUBL 2AXGA 2B2XL 5DZNA 1LNUA 3V7AE 3FO0L 4PJ9A 4M5ZH 4ZS6D 4FFYL 2EIEA 2BY0A 2ITCB 3OR7B 4IMLA 3C8DA 1LEKA 4JO3L 5K9QI 1EFXA 3MRFB 1RK1B 1CQYA 2NY7H 2NNAB 1IAOB 3HC4L 5E8EB 1S5HA 2C1OA 2VQ1A 3H9YA 3BDXA 5T33L 1DUYA 4ZYKB 3MLVH 1V3MA 1SM3H 2VLME 4U2YA 2R9HD 1Z5LA 3B3IB 4V2BA 3RNKB 4OLWH 4LVOB 1FL6A 2FX7L 3I9GH 1CDIA 4KK5C 4R9HA 3KPTA 1R24B 1AC6A 1MWAH 4NN7C 5FM5M 4PGCB 4M6AA 3NA9L 3TJEH 3W9DA 1I7RA 3PL6B 5DGQA 2E3VA 4ODWB 1ZLWK 5T3ZE 3L7EA 1I1FA 4D0CB 3MRHA 5L8JB 3BKCL 5HGDA 3MLTB 3SHSA 2EDWA 4KY1H 4QRUB 1QSEA 3QI9D 4M7JL 4X4XB 5IFJA 5F1OB 1RIVL 1S9VB 1WFUA 3PHOB 1PDKA 4WI8A 2OYPA 1KXTB 3LS4L 5HYQB 1BVLB 5C6PB 1UVQB 1AXIB 2N7AA 2YK1H 4DFHA 3F12B 3QCUH 1QFWH 2F54E 5C70A 3VI4E 4AIOA 1X6LA 2IAMD 3DXAE 5IABA 2VZUA 1A5FH 5C0EB 4KROD 4LCYA 2KQNA 3WYRA 4X6BA 3MV8D 4UOW0 3VXOA 3OAUL 4GKOA 4MJ4A 3TH3T 4IOFC 4YHMH 5TDOB 1RZ7L 2A1WH 4PJIF 4F7MB 1AGFA 3TA3C 3WV0A 1ULVA 4NO2A 3LD8B 1P4LB 4KI1A 3VXRE 4WNQA 1EXUB 3B6SB 2CDGB 2FEEI 2EE9A 4ZOCA 2QL7A 3E6HB 4P4KA 1KJ2H 1CZ8L 2IEPA 3GJQA 3VWJD 4P9MH 4OT1H 3LZFH 3UZEA 2FJFB 5EN2A 1BMGA 2R0WH 2YUWA 3MMEA 3ZE2E 1MRCH 2GJZA 4U6XB 3FT4B 3MR9B 2GUOA 1N64H 1FG2A 4YQXL 4LP5A 5L9DH 4P23D 4MJ6B 3DEJA 3WS6C 3QUYB 1Z9MA 4E41B 3EGSA 1IVLA 3QUXA 4Z76B 1RHKA 1A9EA 3GDBA 1JNLL 1HHJB 2F5BL 4NQXB 4YWGL 2ICWB 3D3VA 3DNKA 5DUPH 4I5BA 1E6OH 3U7YL 2BFVL 3MXVL 5CJ8A 3ZSTA 5IEKA 5ENWB 1G0YR 4KJYA 3IFPB 1Q9LA 1Q9OA 3MNWA 3D2UD 3BP6A 4LOUD 4ZTOH 4RMSA 3SJVA 3V0WH 4ELMF 4XNMA 5E4EB 1GZQB 3RX5A 1WZ1L 4X6DE 3H9SD 5AG9A 4NP4L 4WUUA 3X3FH 3KYKH 4FQLL 3R06A 3V55A 2BVEA 1E6JH 2D03H 3IFOA 4LCWB 1DE4A 1TZIB 3NIDE 5TQ0H 3WNKA 4D9LH 2D3VA 1A6TA 1EK3A 1D5IL 1F6AA 1QEWA 5DJZB 4Q97A 2AJ3B 2ZCHL 5F9OL 4H0HB 1KN2H 3QEGL 2V7NA 1RZFH 3FB5B 1FNEA 3R1GL 4WI7A 3RWCB 3RVTC 3UJJL 5I1KL 4HULB 1MHHB 5KSAA 4XZUB 4S1QL 3GMQB 3BYYA 3SKJH 4JKMA 5ITBH 1KBGH 4JLRA 3O6FC 1SYSB 4KK8C 4N0CD 3PGCA 2IMNA 3E6FB 3OAZK 4KTEL 1HK6A 1MJUH 3NPSC 4ODSH 1P1ZB 4GAGH 3R6LA 1IQDA 1H3XA 2EYSB 3QCVL 1CLCA 2O61B 2QLVB 3LV3B 3W0WD 2VXVL 3BUYA 4FXKB 1AJ7L 4P49A 3QQ9D 5CSZB 2G2RA 1A7RL 3BPLC 4JB9L 2ZCKH 2A74A 4LLYA 2A83A 2H26B 3MRBB 4MJIA 1IGIH 3ZMRA 3VG9B 4IRZL 3BAEH 3MXWL 1NEZB 3DGCR 4NIKB 4BZ2L 3MV9D 1OP5H 3HUJB 3QJFB 3K4ZA 4U7MA 4W6YB 2HBZA 2UWEE 3ES6A 4HZLB 4ODTL 3G5XB 4EN3B 3LKQA 3FQWB 5ETUB 1IEAB 2Z4QA 4XCFH 4ETQB 1YDPA 4ZO9A 3JTTA 4OUUB 2P46B 3HI5L 2P8LA 3O4OC 2OMBA 3QRGH 1MUJA 4KI5D 1H3TA 3MRGB 4ZG1A 5KVGL 5BVPH 2FEEL 1MREL 5DQ9B 3IJSA 4JRXD 5GS1A 1EMTH 3RDTD 4BM7A 4XPAH 5B8CA 4YUEH 4UQ3A 5B21A 2EDXA 1HHKB 1AGBA 2X4QB 4ZAKD 4IRJA 4POZC 4PG9B 1BD2E 1TNMA 2P7TA 1L9NA 4M6OH 1Q1JH 1OW0C 1RUKH 3P0YL 4NUGH 2GHWB 5F7DB 5E2VH 2FIKB 1JPGB 1NCWH 5HHOD 1NMBH 3FO2B 4KUCD 3B9KA 4KVNL 2XYCA 3RTQC 4XC3L 5HDBE 3B5HA 1B6UA 4P5MA 5TFSH 1S78D 4HUMB 5DA4A 1FCCA 4NKIL 4NO5A 4AEEA 3P4UA 1DL7H 1H3WM 1ZLUH 1IGCH 4YHPB 2P8MB 4FXOA 1BQUA 1AE6H 3U30C 1U41A 3WIFB 3DX6A 2NY1C 5CHNB 4AG4H 2PW2B 2MQCA 5F1NA 5J1AA 3MV7A 3U4BL 3MPCA 4W6XB 2F8XC 2M26A 3MROB 5CAYB 3GUTA 2P4AB 4RIRB 4WV1B 2YPLD 4UBDC 4I77L 3WUWA 5B38B 4UV7L 5HHVL 2E9JA 5I1AA 4ZO8A 5TE6L 1T83C 2H32A 2HT3D 5E2TH 4P46D 4BK4A 3BKYL 3VI4F 2AK1H 2CIKA 4K3DL 1CT8B 1S7SB 4JHBA 3X11A 1Q9KA 1U8IB 5DD0L 1KB5L 4HK3N 5AAWA 5ANMB 3L5JA 3OV6A 2AQ2A 2QR0B 4JFXA 3UTPE 5GRJL 3HMWL 5EC1A 2ILLA 1ONQA 3QXWA 4U1IB 4L4JA 3ZKMD 1JJUA 4X6EB 1UZ6E 1FN4B 3GMRA 2NW2A 3I6LD 4HS8H 3HAEH 1Z3GH 5E00B 2CNNA 4JFHE 3LEYH 2EZ0D 5C0BA 3LKPA 5D2NB 3CJJA 1SEQL 4O02L 1XGQB 3GSNB 1P5VA 4QRSA 2PO6B 2WWMC 3L5IA 2LU3A 3C2SA 4ONOA 5EO1B 2ESVD 3V52L 2JJSA 3IFNH 1MCEA 4QHUB 4L3EB 2EH7L 3VD5A 3ZE2F 1KB5A 4PJ9D 4L4VE 2BVTA 2XNAB 3T0EB 1NCTA 4DKFL 1J8HA 3IU4L 4QXTB 3TWCH 3HE7A 1IT9L 3ARUA 1EFXD 3RVVD 4O5LH 3GMPB 2H8PA 4QNPE 5EOTB 3EOAA 3QDGB 1V3LA 4PBXA 2E6PA 4WWKC 1P9MA 2YSSA 2OR9L 1S7XA 3L1OH 4LP4A 5H8DA 1MI5A 2EH8L 3K46A 4UDTB 4S2SB 3DSFH 3QDJD 4LARH 4AL8H 5ADPH 3BPOC 3MYJA 3F58L 1I7UB 5T5FH 1HCVA 1J1PL 3TV3H 2OTWA 3VFGL 3U2SB 5FM4A 4X6DF 2F5AL 5BV7C 1VHPA 3MC0A 5IMLB 3BKJH 1K2DB 5DEZA 4I0PA 1F13A 3D9AH 5JNYA 5DMKB 3NIDF 1Y0LA 3SY0A 3RZCC 3G6DH 1E4XI 3ILQD 4DOHE 5EDXA 5JIPA 3IF1B 3I84A 3SKOA 1QSED 1FRGH 3RAJL 3BDBA 5E2WH 4CMMB 4IOIB 3TZVA 3LN4B 1T2XA 3AB0B 4G6AD 3VFRB 1F4WH 5J12B 5EPMA 1XGUA 5SX4H 5AUMA 3DTXA 4H1LG 4HIHB 3SGJC 1MHEB 2JELL 4DN3H 4P3DA 4JGMA 1T66D 1K8IA 2C26A 3K7UA 3WFEH 1P4IH 5J57B 2Y06L 2MNUA 3ECBB 3S8EA 4KMTL 5LBSH 1XEDA 1QACA 4MLSA 4GG6E 2P47B 5FKPB 5DXWA 3O45A 4TNVF 4BFEA 1RHHA 1NKOA 2ZP0T 5JW5A 4Z7VB 1YEHH 2D7TL 3U9PH 1XZ0A 1DQQB 4HK3J 4P4KD 1A9BA 4E0RA 4LLMA 5GIRA 5MEQB 4X9FA 2UWEF 4D9RD 1GGCH 1URLA 5ILTL 3O2VH 1HXYA 3OKLB 2YXFA 1I1AB 4X7TB 2M8XA 3NFNB 3GSVB 5I8KL 1N0XH 1B0GA 3QUXD 4NQEB 4P57A 1A0QL 1CICC 3GIVB 5JFTA 4JQZA 3L3HA 3MV8E 3D3VD 5E4IA 4LVHC 4L29A 1MVUB 4MNQA 1WTGT 1MHCA 1C1EH 1YEDA 4G9FA 4HUXA 4EI6A 4EQ3A 3MOBL 4F80A 1MWAB 2YXMA 5DJ2B 1IC5H 2X9XA 1DBJL 4K23H 1NGWB 4P2OC 3SJVD 1PFCA 1WICA 2DWEB 2JCCA 2NY0C 3MNZA 4HT1H 5FHAL 5EULV 1D5ZA 4FMKA 3GRWH 4NQTA 1X7QB 4WUUD 2HKFL 3QEQA 3P77B 5IB1B 3VGFA 4LKCA 3IRPX 1R5VB 5IJKA 5HDBF 5A16B 5K33A 3BOVA 3MNVA 3KJFA 2X5PA 1FG9C 4L8SC 3HCVB 4LFHG 3MLXH 1RJZB 2QQNL 1XT5A 3ESVF 5F93C 5KSAD 2CXKA 2SEBA 7FABH 4D8PB 4JG0H 5HYEA 3B4NA 1RVFH 1A7PL 4J1UA 4P9HL 4XGZB 4C83B 3QISA 5DK0B 3TESA 3PWUA 1HKLL 3K8LA 4UT6L 5DJ8A 4JRWA 4P59L 1FL5A 3EYUH 3IDGB 4NOMA 3PGDA 2BCKA 3GKWL 4BSVA 1WFOA 1CDBA 4OJFL 3W5MA 3DWTA 1KJ2B 5I9BA 4R7NB 4L9LB 3A0OA 4MJID 5CJXC 3KLSA 4JHZA 3T2QA 3HNVL 2QLJA 1PKQB 3EYVB 3CK0H 1OGAA 3BUTA 1UWXK 4I9WE 1NUNB 4LCCC 5CJ5A 4OV5A 1ZVSA 3WFDL 5FOBA 2BSRB 3V4PH 1IBCA 1UZ6F 4HIXH 2QL1A 4PTUA 2X89A 3NOIA 4X99B 1M72A 2BVOA 1FVDB 2DDQL 2YD4A 4NZTL 5I66A 4K7PH 4LEXL 4MJ5B 4ZD3H 1UKQA 2XTJC 5C0RL 5JPMB 4M03A 1EA9C 2VR9A 4JPIA 4Y5VC 1FAIH 1AKJD 2BSSB 1JTOA 4YPGA 4OIBA 4JY6A 5DEFB 3V5DB 3G04A 3L3KB 4I2XA 4M8VA 5GZOD 3T77A 2DM3A 1KCVH 4IRJD 3VMNA 3C5ZA 1KPUB 1TVBA 5C92A 5HD8C 4N0UB 3JV6B 4GXVH 5C0JA 4QNPF 1FH5H 2DJ4A 1Q72H 1GCFA 1RD6A 3D6MA 4KKNA 2A73B 1DQDL 4EUPG 1YMME 1T89A 1U3JA 4WU5B 1JF6A 5FKAB 3B9KD 3U48A 1CFVL 5D6CB 2H9GA 3DMMA 3CFIC 3H7LA 4JO4H 1CD1A 1UEYA 3BMWA 4KRMB 4KI5E 3U36B 4KJPD 4MCZA 2F15A 4WJ5B 5GGSY 5D7SL 2H41A 1K88A 3VD7A 4NZJA 5FCUL 1HSAA 2VDPH 2AXFB 2V7HA 2I25N 1ADQL 3H9HA 3DO7A 1MPAH 1QFPA 3QNYB 2X1WL 3HMXH 4MD4B 1XF5B 4U6VH 3U1SL 1KLUB 3MV7D 1AIFB 1Y6NR 4YHLH 2EO9A 3GJEA 2WDPA 4ZXBC 3VG0H 4UT9H 4MS8D 5I0DA 2H2SD 5EZLA 1KEGH 4EI5D 3BRFA 1T4KB 1SC1A 2ZPKL 1UACL 1YC7A 2BZDA 4D0DB 3H3PL 4Z7UE 1EX0A 3WFBL 7CGTA 1S7WB 1T22A 3UPAA 2Y0BA 5F9WB 3JSSA 1QLRB 2RHEA 3TNNA 1ADQA 2GCYB 4UAOC 1AD0A 3VXMD 5E03A 4HX1A 4GG6F 2WBJB 2EE6A 3MLPA 1YEIL 4P5TA 2WSKA 1QP1A 4H8WC 1D5XA 4KUZL 4IEFB 3AAZA 4ZUUA 5JO5B 3TVMC 4HMDA 1NJ9A 5JR1H 1I8LC 1LK2B 2FB4H 3DUSA 5E1AB 3GM0A 3HZVB 3PV7A 5IROA 2X05A 2J33A 2GT9A 3QZWG 1CDCA 5A43C 3ARDB 1QLFB 2ZUUA 2EIZB 4KV5E 2NY5L 4R3SB 1K5NA 3QQ3A 4N7JA 3BH8A 2JJWA 1CS6A 2X4SA 4Z0XA 5LCVL 1SJHB 4WFEE 1J8HD 3HE7D 4QRPB 3I02A 4NRXB 2P45B 4DTGH 3G6JB 3MLSH 3O4LB 3GNML 5BO1L 4QRTB 3SDXE 2VH5L 5DVMA 4OB5L 2NW3A 1GPOL 2VLRB 2MPAH 4BQ9A 4GRLC 3NFPA 1MI5D 3I50H 4K94L 4XMKH 1AXTH 3P9MB 3VGEA 4OCRL 3WLBB 3HNSL 2J5LC 1JGLH 1L0QA 3MJ7A 4NSKB 3BVNA 3CUPB 1I1RA 2CPCA 4ORGA 1HXMB 1A6UH 5CP3A 4ERSL 4F9PA 4GFTB 1FLTX 1ZT4B 4I0PD 1MCSA 3FONB 3SGEI 1ED3A 3G08B 4EHAA 5IB2B 3FO1A 4ODHL 3UO1L 3BO8A 4AW9A 4K3EL 3KDMB 3QIBB 3X13B 4X5WB 4XBGB 4QRQA 1AQKH 5F8RC 4AH2A 5IARA 4OF8A 3ULVD 5TGBA 1W0VB 3N9GH 4YR6A 3CFCH 5KVFL 4KKLC 4NC1E 1A02N 2PXYB 3U79A 1M7XA 3QDJE 4PUBH 1JPSH 2B2XH 2WINB 1G6RL 4OF7A 3FO0H 5BXFB 2AEQL 3KJQA 4FFYH 4FEAA 1MY7A 4AT6A 4AM0A 4JO3H 5GS0C 3HAEB 4NFBA 1RUPL 3OR6A 4Z95L 4PLNC 3SKNA 3CDGB 3HC4H 1LE5B 5IMOB 5T33H 4PJEB 1ORQA 4KHXL 2D7MA 5A3ID 1VSCA 3S88L 4ZS6C 1RIHL 1XGTA 4CMHB 1MH5B 3MLWL 1BM3L 2FX7H 1U8LA 1HINL 4GW4B 4M6NL 3QQNA 4F7PB 5A40E 1F4HA 3NA9H 1G6RA 1IC1A 3L7FB 1ZT7B 5IWLC 3WMSA 1I8KA 3W11D 3RWIA 3CU1A 5CEZE 1J10A 1S3KL 4XNXL 4CNIA 1FYTB 3BKCH 2DKSA 3NZ8B 4U1HB 4PV8A 3P73B 1FVCA 2Y36L 4XNZC 5IEHA 2XZDA 4E41E 4OZIA 4Z78B 1RIVH 4D3XA 4MNQD 1F42A 2NY4D 4MA1C 5JDJA 1W0YT 2YBRB 3LS4H 2I9LA 3UTZA 4K7PY 2IBBA 3VWKC 3TO4D 3P4OA 5DJYB 3OG4B 2Y25A 4LLDB 3PGFL 3QI9C 4NO0A 3QEQD 4YC2B 4D9RE 1LE9B 1JYXA 4PJFB 4QTYA 5DJ6B 2JF1A 3GIZL 5EBLB 3OAUH 3KYMB 1BQSA 5DJ0A 3WXVL 3RJMA 1UB5B 1RZ7H 4KI5F 3LQMA 4LCWE 5D6DC 1FNFA 1BFTA 4MXVE 2IAMC 5D70H 1TQCC 4OCMC 5HHNB 5BJTA 3VCLB 2PW1B 3AS0A 4TUOB 4OQTA 4KDTA 1CZ8H 1WBZB 1UXSA 4PTTB 4Y2DB 1SJEB 3SJVE 3KNBB 4YXHL 3HRZB 5DC0A 5JW4N 3S3SA 5F70A 3S5LG 3QFJD 4NPYB 4YQXH 3R8BB 1UCBL 3GHEL 2DQFB 4F9LC 3CFDB 1BFOA 3WCYA 3DROA 4PGDB 2C3WA 4MAYB 2F5BH 4DCOA 2DYPA 1JZ5A 3SDCA 2JIXB 4YEFA 4YWGH 4F7CB 4S0TD 4Z7UF 2BMKB 2PCPB 4R4FL 3U7YH 4Y8AA 1PY9A 3UBXG 1NFDA 2BFVH 1LO5A 3MXVH 5FHBL 2ZUVA 3BIJA 4WUKL 2BK8A 1S7UB 1OP9A 4Z6AT 2FHCA 3RWDB 3SDAA 4FFVD 2CK0L 2V2XB 4FOMA 4KROB 2AXHA 1M71B 1WZ1H 2AK4E 3BPNC 4RBPH 4ZSOB 2ITDB 3BHBA 1ZHKA 4NP4H 2RQ8A 1DCLA 4PJXA 2X89D 5BQ7B 5C0GB 2R0ZL 4FQLH 1T5XA 4MB5A 5F6HJ 4MD0A 1CG9A 4G8GA 4OAWA 5HHXL 3V0VB 1D5IH 1ZE3C 3Q48A 2ZCHH 2FEDD 4KV5F 5F9OH 2F53A 3QEGH 4JFYB 1C5DB 5FK9B 3R1GH 3PIQB 1FIEA 4FABL 5F89B 3RY6C 3UJJH 4MJIE 1EEZA 4F3FA 3H3BC 4U7KA 4S1QH 1X4XA 2XIDA 1BOYA 3C5ZD 5IHBA 4G8IA 4XBPB 4P23B 5HYSB 5KVDL 3QRFM 4K71B 4MB3A 3SDXF 5T3XD 3TBVB 3MV11 4KTEH 3ARFA 2M2DA 3NIFE 1KLGA 3QCVH 1AQDB 1NGPL 3HC3L 3UROR 3FRPG 4LLAA 2VXVH 2BSTA 2DLFL 4PRIA 1AJ7H 3DMMD 4KRPB 3C6SB 4OM1L 1A7RH 4JB9H 5IOPA 2ZUTA 1VKXB 5GGUB 3NGBC 4N0CC 4IRZH 3MRMB 4HIJB 3QT2A 4HLZH 3MXWH 1HIML 5C0AA 1Q8MA 4K9EC 4PJAA 4BZ2H 1OCWL 4HKZB 2HFEA 3BN9D 3PWVA 3CC5A 1MCWW 4B50A 5JA8B 4ODTH 4GAFB 3N85L 5D72L 1T1XA 3M1BA 3O11B 1JBJA 3TNMA 3HI5H 2YA1A 4Y4KC 5JOEA 3VJ6B 3CD4A 3ZDZE 5A2FA 1F45A 5KVGH 4IIQA 5GRWA 3IKCA 1MREH 5IQ9B 4WO4A 3A67L 4RQQA 3EYFA 2OZ4A 1MFNA 1D5MA 4RRPG 5EBWB 3B9AA 5CGYD 4F7TA 1SY6L 5LG1A 4Y16B 4HJ0D 4GUPB 5EUKA 5EA0L 3IBCA 1I85A 3MRDB 4KI5C 4P5TD 1TZGL 3LKOB 3STBA 3UEZA 4EDXA 4FRWA 3EW3B 1VFMA 2FHFA 3TCXA 3FO9B 3P0YH 5HDQL 3MV7E 5MEPA 3ROLA 3RDTC 3OXRA 5C09B 4KVNH 3KXFD 2H32H 2ADIA 3CVIL 1DANU 4KJWC 4GAYB 3VGAC 3WFZA 2ZSVA 4M8QB 3WHE0 5ABDE 1DBML 4NKIH 3RWEB 2W9EL 3HC0B 4GW5B 5KS9B 1ZLVK 4YBLB 4JQVA 2Q1EA 3KYOA 2ZG3A 2EXYD 2O5YL 2VXQL 3OAYH 3T0EE 2GSIA 5EO9B 4V1DB 5ESVB 4LSZA 5IVNA 3QZWA 3E3QE 3H1PA 3VXME 3U4BH 2DM2A 2LV4A 3PDOA 5K9OB 3MRPA 2W1NA 4YX2H 1J1XL 2NY2D 1OB1A 3U9UB 4JRXB 4UV7H 5HHVH 5L2KB 2IFFL 3BEWA 3CFBA 1QA9A 5TE6H 1IGYB 1PZUB 3BKYH 1CFTB 43CAB 5HTSA 4YGVA 4K3DH 3RWGB 3D69A 5DD0H 2IC2A 4P4RA 5LWYL 3BZDA 3WHXB 5JA9A 3EZJB 1NC4D 3OJMB 2D31B 4M48L 5GRJH 5TDNA 3HMWH 5A1AA 1SBSL 4FG6D 4U6YA 2HT3C 3GBML 4LIQE 4Y8DC 4MXVF 3UBXI 2MJWA 5EU5A 4N0RA 1FZMB 2P5WB 3WJLA 1SEQH 4O02H 4YHIB 3S35X 1CQKA 5HHPB 5FA4A 3V52H 5DFWH 1L7TL 2CQVA 4U1LB 1XR8B 2EH7H 5F7MC 1WCBA 3IU4H 1IT9H 1BHGA 4HCRL 4R0LB 2XXMB 4MQSB 2CJUL 1DZBA 1YPZA 3CH1B 4NZDA 4PRPA 4QHKJ 4N0FB 4X8JA 3GJFA 2OR9H 1MIEL 2APBA 3DV4B 2V5YA 1XF4B 4PJ9C 4NDMB 4QUBA 3PL6C 2HTLC 1ETZA 1A2YB 5DRZA 5EZOL 5I18L 4MA3A 5CBAB 3ULVE 3F58H 1ZHLB 5D5ME 4QUIA 1OQOA 3VFGH 3D0LA 5D9SA 1HHIA 2BHZA 3D25A 5JPNB 5DFTA 5SWSA 2AAVA 1S7VA 3MRIA 4K2UL 4YO0A 1A6AA 4E42B 1T0MB 4NC1C 2YRPA 3LKRA 4WDIA 3CNKA 4L8CA 1MJ7L 4HC1L 1IM3A 3MRKB 1YNLL 3RAJH 2VDKL 4PP1C 2DD8L 2CDEA 3DX9B 2ESVB 4PGEB 2MMXA 3W82A 4P5KB 1S7TA 4TTGA 3X12B 1BBDH 1JZ2A 5DHVH 1IEHA 4IMLB 3ILQC 2JELH 4PY8J 4IM8A 5CINL 4NO0D 4ZODA 1S5HB 2VQ1B 2Y06H 3QDMB 4LNRA 1HN1A 3NIFF 1DUYB 4KMTH 2BOCA 4G6AC 4Y4FB 4BUGA 4H0IA 3OZ9L 5HGAA 4HC1A 5B39A 1KFAL 1FL6B 2R8SL 5KAQG 1D6EB 3IDJA 3KR3L 2D7TH 1C08A 1T66C 3W9DB 1I7RB 4XHQA 3QNWA 4CL7A 4XMLL 2UVEA 4JAMB 3L7EB 1T7YA 3FN3A 4OBRA 2P42B 4M6ML 5HGDB 5MENA 4HKBB 1PX3A 4NN5B 4M7LL 4G8EB 3ZYJA 4B0MM 5I8KH 4LFHD 1TLKA 2FQQA 1TQBB 3KYNA 4YEEA 4G7YL 3O6KL 2VDRL 3ZDZF 1A6WL 1A0QH 2DYPD 4Z8FL 1RK0A 1LDSA 3L6FA 5LUBA 4NQCA 3IETA 1RUAL 3AREB 4G6FD 1H0DA 3MOBH 1JNHB 1QR4A 1XGPA 5J11C 1DBJH 3H0TA 1F90L 4NNXB 5DVKA 1YMHA 3SDAD 2D0FA 4LCYB 5FHAH 5C1MB 3U0PB 4Z7WE 1TPXB 3RA7L 4I0KA 4NKDB 1U58B 2ICCA 3VXOB 1AGCA 2HKFH 3VXTA 4PJGB 1AGFB 1INDL 2MCG1 5EZIL 3QFJE 3TN0A 3WO4B 5I1LB 4WNQB 3QAZB 4P4KB 1N2RB 2F53D 4OUOA 3NCYP 1Z2KA 4MA7L 1G9NL 4HEME 2QQNH 4I0CC 5EN2B 4JPVL 4UNVA 3ABZA 3MMEB 5CCKL 4K07A 2GJZB 3MLRH 3S97C 4KMQA 2Q87A 1A7PH 4P9HH 4R2GD 4D9QD 3VFTA 1FNGB 2VUOA 1HKLH 1JP5A 3PXHA 4UT6H 2BOBB 2C3GA 3D3VB 4P59H 4I3SL 3PE9A 3VG9C 3SKMB 2IGFL 3GKWH 1OM3L 4PRID 4HWBL 1Q9OB 4OJFH 3WN5B 1T20A 3QWRD 1D5BB 4MGXA 1KCRL 3UDWA 1MIML 3HNVH 4HMEA 2GK0B 4YDVA 5J1TC 1T7XA 2CUIA 4JFDB 5C0AD 3P4NA 2VXSL 3R06B 3OBAA 1F4YL 3MRLA 3WFDH 2QLBA 3IFOB 4MZ3A 5BS0B 1DE4B 5CP7A 1FFQA 2N1KA 3WNNA 1QEWB 3D85D 2DN7A 3RWHA 1MCJA 4DGYL 2DDQH 3HG1A 4QHNA 5KG9A 3JV5A 4NZTH 2V7NB 4ZFFA 4HD9A 4LEXH 3ZKNC 1E4KA 3TBTB 1CLZH 4HWBA 1S9YA 1NMCB 3E0GA 5C0RH 3BXNA 1I8MA 2ZCLL 2VDQL 4PLKD 3MUJA 3VGGA 3PGCB 3KJ4B 5SWQA 4O58L 1MFAL 1BLNA 1QBML 1IQDB 4YHNA 5GRVK 1T5WA 1OAQL 3JWNC 1DQDH 2GY5A 4BKLB 2PTVA 4RRPA 1DEEB 2A74B 4LLYB 2A83B 2W38A 4UDUA 3RGVA 5IVXA 1CFVH 2V9TA 5GZOC 4RMUA 1P84K 3ULVF 5AWNL 1NC2B 5D5MF 5E6YA 2AABL 2VITB 4YPJA 3GSOB 3R7NA 3QIWA 3O9WB 5D7SH 35C8L 4OV6F 5FCUH 3ORJA 1RZKC 5J0BA 3ES6B 1DJSA 3BX7C 3LKQB 1CFNB 2QSQA 4M9PA 1ADQH 1U3HA 5KVMC 1JNNH 2Z4QB 4RMVA 4E5XA 4WV1C 1MVFA 3B9KC 2R1XA 1RV6X 1Y6MR 4GBXD 3T0BA 3U1SH 2W0KA 8CGTA 3IB4A 1SYVA 5CLTA 4KJPC 2R0KL 4GXUN 2GAZA 2Y6SD 4JN2A 2A0LD 4N90E 4GSDL 5B8CB 5CBEB 1G9ML 4UQ3B 1Q94B 4DW2L 2ZPKH 3QXAA 1UACH 1AGBB 1N5YL 3KXFE 1WZKA 3H3PH 1IMHC 3WFBH 5JQHC 4I4WA 3DGGB 1U95B 5F7WC 2P7TB 4UOJA 4K55A 1CD8A 2JJVA 4JO2L 3IS1X 3BE1L 4D3YA 5D7IB 1PVHA 1RJCA 1YEIH 3CCHA 3KPSD 4KUZH 4EI5C 1DQJB 3OB0K 4HQRA 3FQUA 2J2ZA 4M61B 5CZVL 5LJYH 3WO3B 2Y23A 3KHQA 4OD2B 3MFGB 4NO5B 3EAKA 1YJDC 2YRLA 1W8OA 2EEBA 4X5XB 3T0EC 3O8XA 1BJMA 5K20A 3E3QC 3TLRA 5I75C 2NY5H 3EO0A 4K3HA 1S7RB 4HIIA 4MQ7A 3ARGA 3VD9A 4KKBC 5CP3H 4ALAL 5LCVH 5F1NB 5B4MD 1XH3A 1I4OA 1ZA6A 3KPRB 3GUTB 1TFHA 5J56B 2Q86B 3WUWB 1JYWA 5BO1H 3GNMH 5GGVL 2XZCL 4PRPD 1WF5A 2H32B 2VH5H 3VRLE 4OB5H 4OFPA 4KC3B 3AY4C 3PDDA 1XIWA 4LGRB 4X7DC 1Q9KB 2A77L 1YEGL 1J0KA 3VXSD 2IPUK 4K94H 3LCYA 3IXTA 1CTOA 4PJEE 4OCRH 2VLLA 3EDRA 1B3JA 1DQLL 1U8MB 2HP4A 5J4MA 3X14A 1BAFL 4N5ED 4Z7WF 1DBBL 1ONQB 3V4UH 2X1OA 1RZJL 4ERSH 5I1IL 4F15B 3H7BA 3DPBA 5C0BB 2XFXA 3SGDH 4ODHH 1SHLA 3UO1H 3T4YA 1ZSDA 1X44A 4K3EH 1FYTE 4QRSB 3FQRA 4JR1A 4GS7B 1WVZA 4HDIA 4RFNC 2ZNXA 3CZJA 4C56D 4NZUL 5KVFH 4PRBB 1RY7B 4YK4C 1TCRA 5LGJB 1G6RH 3VDAA 2UYLA 2IADB 4XNQA 2AEQH 4R97C 4ZFZA 1UZ8A 1B2WL 3MRJA 1S7XB 1BGXL 5ADOL 3ULVC 4Z95H 1OF2A 5IQ7L 4PJFE 5EOCL 1WC7A 5JOPD 4KHXH 2AJYL 5BMFL 3S88H 2APXA 2OTWB 1RIHH 4OZIE 5IAGA 5HGHA 4GKSA 5T1MA 1I1AC 3MLWH 1BM3H 3UC0L 2CLZA 1ICEA 5D1QB 1HINH 1PEZA 4M6NH 4GRMA 5CZXD 4Q2ZA 2X1XR 5MEND 2Z31A 3DUUA 1S3KH 2J8HA 4XNXH 3TZVB 3QEHB 4KKAC 5GRUL 5IMMA 3KPLB 3QA3A 5EPMB 2Y36H 4NQCD 1QSFD 1FPTL 1LP9A 1PYWB 4TVPL 5ERWB 4P3DB 4Y0GA 2HVKA 4CADA 2CUMA 3U4AA 3W11C 2NYYC 5L7XL 1NGYA 1JRHL 5DJDA 4LPYA 3AC0A 1R3IL 1XFPA 1EERB 3PGFH 5D7KE 2Q20A 3ZTJH 4HXBL 2FWOB 5GHWL 1RFDL 1OTSC 1J05B 4ZSOE 1ZMYA 1GGIL 4ISVA 5E95B 3TN0D 5JW5B 2R2HA 3GIZH 1L0YA 2EDFA 3WXVH 5I6XB 3RKDD 1J0HA 3TO4C 4N6OA 1U8OB 1M7DA 3LQZA 1MFEL 2E6QA 3NACL 5DHVB 3RIFK 5BZWA 2WK2A 2FHBA 2BJML 1MHPL 2R2BB 1DVFA 1HXYB 2CO6B 1ZLSL 1V7NL 4XCNB 5JXEA 3J8F7 4X6CB 4NCC1 3KS0J 3WHE1 4YXHH 2LQRA 4PP2B 1B0GB 4PJBA 4RBPK 4I1NB 5IBTL 4P57B 4APQA 5JLZB 4EZMA 1UENA 2PF6A 3L3GA 3GHEH 3L3HB 3GJRA 4PJXE 3D39E 1MHCB 4G9FB 1YEDB 3ZL4L 3C60A 4ZOBA 2IANB 4RNRA 1JHTA 1G7PA 4JFQB 3MGTA 5CGMA 4N8CL 4R4FH 1RULL 1AP2A 1D5ZB 3M17A 5FHBH 4HFUL 2EO1A 5ICYA 4WUKH 2GTZA 1P7KA 1R5IB 1R3JA 1JFQL 4TQEL 1QPXA 2CK0H 4UIKL 5E8PB 4GXUM 4LKCB 5C08A 4XCEA 4DK3A 3M45A 4XAWL 1G7HA 2R0ZH 4BA8A 1NGQL 1A6VL 3HG1D 1U8KB 2CRZA 4PJDE 5I1CL 3G6AB 5HHXH 1BVKA 1YY8A 4X7SH 4FFVC 3IAQA 2VO5A 4J3OC 4QY8A 5J9PA 4FABH 1VEPA 4J1UB 1J5OL 1ZKAA 4NOJA 3VE0A 2R15A 2EDRA 3MQIA 1OP3H 5DDHA 4G80A 1KIPA 5DJ8B 5C0IA 3MUHL 5C0AE 2ZKHL 4U1KA 3WNPA 2CD0A 1M7IB 5CIPH 1MOEA 5DQJA 2Z93A 2HBQA 3ULUD 4XP1L 3KPPA 1FDLL 2Q3ZA 2NXZB 4U6TA 4BSVB 3VRLF 3V95A 1AY1L 1OSZA 4WEBL 5E8OA 3FB7A 3RGVD 1NGPH 3HC3H 4IRSD 4PJEF 3RGHA 3V6MA 3ZO0A 2W65A 1OGAB 3FOLA 5FYJL 3QQ4B 4OM1H 3CLFL 3QIWD 4LHJB 3A6CL 2W59A 3I6KA 1HIMH 5D7LA 2A9NL 1NAML 3LAFA 3RNQA 1U3HD 1OCWH 1HYRC 4PJHB 2OK0L 5KS9E 4DUXA 1IZKA 2PUQT 4OZGB 1UC6A 1ERNA 5JIIA 3RBSA 3N85H 3MSPA 5D72H 2KZWA 3RI5F 5C6WH 4WI2A 1J0ZA 2OI9B 4V1DE 4NJAL 5EUOA 2R1WB 4JPIB 2FLBT 3RL2A 4JRYB 1IGML 2X10A 5EIIA 3KPOA 4I2XB 3RHWF 5JORA 3A67H 4GKNA 4N7MA 1CXHA 1K4CA 3P30L 2WBJC 3LN5B 3Q3GA 3IDMA 2BNQD 3VFWB 1SY6H 2Z91A 1FC1A 4FQPA 4JFFD 1BIIB 2ZG1A 2QTEA 1X5KA 1CFQA 3NCJL 4FQIL 5EA0H 5T1DL 5I71B 3QPQC 4OZHA 1VADA 1TZGH 3EO9L 4PJFF 3KAAA 1RQ5A 2C2OA 4JJHA 2H9GB 5I1GL 2V2TA 4NC2B 1CD1B 2B5IC 2Q76A 1FJ1A 3F7RA 4OZIF 4MCZB 4TTDD 1NDMB 3WS3A 3IDIA 4HJ0C 4P2RA 3O8XD 4LMQI 2FH6A 3CVIH 4UNUA 1YEJL 1A7OL 2V7HB 2P5WE 2RR3A 2R23A 1DBMH 1IZJA 2VLJA 2W9EH 3MUZ1 2VABB 4N9GA 4JZOA 1CF8L 2VXQH 2O5YH 2CIIB 2YD1A 1JWSA 4JKWA 3VD3A 2WBWB 5C9KA 4WI4A 4KQ3L 5EZLB 1J7VR 4HFWB 3MA7A 3UTTA 3KPSE 3LHPL 3F5WB 1JZ4A 3GSUA 1IAKB 3CFKB 1XIWD 1J1XH 4PGBB 5INDA 1D7FA 2IFFH 1T22B 2DWDB 4HH9B 1BMQA 4NHCL 4HX1B 2VLKA 2PYEA 5LWYH 4ZUUB 3AAZB 5DRNA 5F72S 1NJ9B 2XN9A 4M48H 5TJWK 3QIBC 4LSRL 3DUSB 2NY2C 1KENL 1SBSH 5DMJB 1BIHA 1MNUL 4JR9L 4AQOA 3RJQB 3TA3A 2XWBA 1V05A 2NY6B 3GBMH 2GT9B 4C54A 5CEXA 2KQMA 2PXYC 4WHTB 5IIEB 4J3SA 5DEGA 4JM4L 3QQ3B 1FFOA 4ZFOL 3MLUL 2FL5A 2KUTA 2X4SB 4Z0XB 3KG5A 3VXSE 1BBJB 5F7NC 1L7TH 1XGRA 3QYCA 1F6FB 1V3JA 3VFVB 3WS6A 2HRLA 5F3HA 4PJXF 1A3LL 4Y5YC 4HCRH 4ORZC 5I19L 2CJUH 2NW3B 1QLEL 4I48A 4HUNB 3QDME 4HQQL 4I13B 4MNGE 3BRDA 2AJVL 1UKTA 2XWTA 1ES0A 1MIEH 5I15L 3IXAA 1QDUA 1T3FB 3MJ7B 3BVNB 3VFMB 4ORGB 4KKCC 4PV9A 1TZHA 4ZFOA 4Q6IB 4POYA 5EZOH 5I18H 4C56E 4WGWB 4L5FL 2Z31D 5IBCA 5DYOB 3I75A 3IDNA 1J87A 4K2UH 3O3AA 4PJDF 4GMTL 1KOAA 4PRHA 1BZQK 3FQXA 4HK0A 1DBKL 4QRQB 2FZ3A 5J06A 5TGBB 1MJ7H 4HC1H 4J8RB 4YR6B 1T04B 2ZSWB 5DVOA 2VDKH 2DD8H 1HSBB 5IBUB 3QULB 4CJ0A 1I8IA 3OPZL 1TMCB 5JOPE 3QG6A 4TUJA 4EQ2A 3QHTC 3TBSB 2RJMA 4YC2C 2Q6WA 3O6FA 4DCQA 5CLWA 4WY7L 1HHHA 1A6ZA 5C07D 4AM0B 5DD1L 4RMQA 4XXCC 2OL3L 2ADFL 1T2JA 2AEWA 3G5ZA 3OR6B 4KFZC 5F6IB 5CINH 2J8UE 4RGND 3AM8C 1ORQB 1OOAA 5JMOC 3ZYIA 5ESQB 4ZVQA 4OZ4A 1XR9A 1X3DA 4G43A 3OZ9H 2X09A 1I1YA 4IHOA 1G7QB 3O3EA 1IEBB 1U8LB 2BY2A 2R8SH 3GMOA 4Y2DC 2E7LC 4LLUB 3WE6A 3HR5B 3KR3H 1A4KB 3QO1A 4NQCE 4HS3A 4RDQF 1G6RB 1QSFE 2IBZX 4H25A 5KS9F 4XMLH 2AKRB 1KT2B 3C9NA 1OAXL 2OL3A 4M6MH 4MAYC 5DRXA 3JWDC 4APQD 4M7LH 4OGZA 3F7VA 1F3DH 3BGMA 1VA9A 4OM0L 4G7YH 1PYOA 3MJ8A 3O6KH 2VDRH 1A6WH 2GTWB 3C60D 5FO7A 4IBLT 4Z8FH 5F7LB 1ZAGA 1RUAH 3R0NA 1BP3B 5IR1A 5HYJA 2QADD 3GMLA 5I1JL 5KVEL 5CD5C 1EHLL 5BVJB 4OCLC 1YYLL 1XCTB 3Q5TA 1NQBA 5C08D 1OW0A 4WHYG 4JFDE 3LPWA 3RA7H 1A1NA 1MRDL 3E2HC 3L5WA 4RISL 5DJ0B 2X7LA 2NMSA 2YD2A 3RTQA 1INDH 5EZIH 3FHAA 4RGOL 4A6YL 5BJTB 2DL2A 4CU7A 4EVNB 2BDNH 5D4QA 4MA7H 3SOBL 1R3LB 4QUGA 1G9NH 4JPVH 5CCKH 4PRDA 4YFLI 5IBLD 1WT5C 4JPKL 1BFOB 3BP7B 2PR4L 3DROB 4M43L 4KRPC 4ELMA 3SDCB 3V6OE 4F57L 1GYAA 3WBDA 3BZFA 3F7QA 1T83A 5FEBA 3UPRA 3DVFA 4I3SH 1KPRA 3GB7A 1NGZB 1ORSA 2IGFH 3HG1E 1NFDB 1OM3H 5IW3A 3NZHL 4HWBH 1MCQA 5CEYA 2J4WL 2YD8A 4QYOA 3GSQA 4R2GC 32C2A 1KCRH 1N3NA 2OJEB 4C58B 1MIMH 5FDYA 3RVUD 1ZHKB 5D7LD 4CVXA 3OF6A 2VXSH 4YAQA 4FP8L 2HG5B 2A6DA 4UV4L 5IMKA 2ZOLB 1CG9B 2FJHA 5I76A 4U2ZA 4G8GB 5JHLL 1J0JA 2BNRA 1WWWX 3JVGC 4DGYH 4BQ6A 1IGJA 2YD6A 4ELKA 3ULUE 4YBQD 4TVSa 4F2MB 2GKIA 1WBYA 3Q6FA 3T2OA 4Y16C 5ICZA 4F3FB 1FV1A 4OZFG 5BV7L 1IAMA 3BP4A 4XI5C 3I3DA 3T4AA 2ZCLH 2VDQH 5ALBL 1KPVA 5SWZA 2CLVB 2LTQB 3O3BB 3ARFB 3QSKB 1K6QL 4O58H 2X4UA 3T0AA 1H3PL 1MFAH 1QBMH 5DUML 4WWKA 1OAQH 2BSTB 4PRIB 5IVOA 1LEGB 2NCMA 1R3KA 5C9JB 1O0VA 1KTKE 3S37L 3IAPA 3S6CA 1CI5A 4KK5D 4PLKC 2DIAA 4YBLC 4MB4A 4P2RD 1K4DA 5KSVA 5E2UL 4PJAB 2EDBA 3DX7B 2AABH 4NBKA 1NW9B 2VLJD 5GS3A 35C8H 3WJJC 3CZFA 5CIPB 4X6FA 3ILPB 3RZCA 5DJAA 1N4XL 1I3OA 2BNQE 4LCIL 4NNYB 4JFED 3TIDA 2DRUA 3TNMB 5GSRB 4JFFE 4J7RA 3D48R 4FQCL 5C2BL 3C8HA 2R29L 3GGWA 5T3ZL 3IKCB 4ONHA 1U6AL 4WO4B 2YC1A 4M4PA 3EYFB 5ISZB 2ARJB 1D5MB 3Q0HA 3LSOB 3SGJA 4GSDH 2BVQA 5E6ID 5FV2A 1G9MH 4IMKC 4QCIA 1U8NA 1BECA 4PJ5D 4QTHA 1N5YH 1LGVA 4GBXC 1C16A 5EUKB 3W39A 2VOTA 1RZ8B 4J2XA 2VLKD 3FHQA 2PYED 4UUJA 2J8UF 1C12A 1IKFL 4EDXB 2B8OT 2XN9D 3V8OA 3N1FC 4JO2H 1CGSL 3BE1H 2YPVL 5MEPB 2A0LC 2DMKA 3TA3D 4NFDA 1U92A 5A2IH 1Z0MA 1ZHBA 6CGTA 5CZVH 2ZSVB 5DVLA 4GO6B 1T1WA 4R96A 1WSST 4LVNB 3P0GB 1LDPL 4JANB 4Y4HA 4PYHA 1IL1A 3KYOB 3GM8A 3O2WL 5F71A 3GI9L 4Q58C 1U3ZA 4Y5XB 4U1JB 4KAQL 5IT2L 1F00I 4ALAH 4U7SA 4M02A 1ZS8A 2F54A 3UMTA 2DAVA 1CICA 3DXAA 3PDOB 4NKQB 5F7EL 3P9LB 1HWHB 3NCBB 1OB1B 5GGVH 2XZCH 4X4ME 3RI5K 3BEWB 1NBYB 1QA9B 2FYYB 2LAGB 4P2OA 3EOYG 1OAYL 3VH8A 2A77H 3VFNA 1FZOB 4P4RB 3MRRA 1DN0A 1NFIB 1DQLH 1BAFH 3VXRA 1DBBH 1BJ1H 4HKJA 2XACC 3OKOA 1M05A 1QRNB 4EHDA 4QRRD 4RAVA 3RY5A 3JBG7 4CU6A 5EO0A 2VIRA 1RZJH 5JUEL 2AV7B 4GMSL 5I1IH 3S8WA 4AENA 5EU5B 2G60L 4PRHD 1GIGL 1QRKA 2F74A 1TDQA 1KELL 4H26A 4MAUL 4L8SA 3VRJA 5AD0A 3IU3A 3RVTD 1B90A 3OJVC 5DURD 4NZUH 4QO1A 4TN9A 1TTFA 4M7LT 4Y4FC 2UVFA 1YPZB 3IKKA 4IYRA 4S0SD 1B2WH 4XBEL 5ADOH 1BGXH 4X6DA 5IQ7H 1V8HA 4UMGA 5CJXA 4JB8A 5EOCH 2WLYA 5DRZB 4MA3B 2AJYH 5BMFH 3BJLA 3FFDA 4LCCA 1HHIB 4JJEA 4NJ9L 4LKXA 1VGKB 1LP9E 2BRRL 3UC0H 4NN5C 5SWSB 2ED7A 4FQXD 4YO0B 1SC4A 1A6AB 1TQBC 2WLZA 5KSUA 4Y19A 4ZNEE 2DKUA 3LKRB 5C07E 2BRQA 1A4JB 4X6CE 1IM3B 4MMZC 2Z92B 3HE6D 3ULUF 1CD0A 3AREC 3RP1A 1Q0YL 4CVWA 4UTAL 2DQHL 5I73B 2ATPA 5GRUH 4Y5VA 3MJ6A 4U0QB 5I9QC 3OAZH 4HF5L 1FFPA 2WNGA 5ITFB 1FPTH 4M1DL 2IANE 4TVPH 5HYJD 1TPXC 1P2CA 2X4NA 3ZZ1A 2ZUYA 1DFBL 5L7XH 1E28A 1GAFL 1FO0A 5C0DA 3P4MB 1JRHH 2CUHA 2VAAB 3L3JB 2VDML 1R3IH 4PJ7E 1JZ8A 3PP3K 2P24A 1HQRA 2R1YA 1ZGLA 1GOFA 3WO4C 2A6KA 4HXBH 5GHWH 1RZIA 1RFDH 3QAZC 5B39B 4PJBE 2ZOKB 3RTQD 1HOCA 1GGIH 1EHAA 1JV5B 2EXWD 2V5SA 3AU1A 2Q8AL 3IDJB 5IC6A 3W5NA 4DKDC 3KLAB 2UY7A 4MQXC 4NUJB 3TYGL 4DWHA 2XYHA 1MFEH 3WEXA 1TIUA 4M7ZB 3NACH 1DQTA 2BJMH 2QKIA 2VZVA 1ZLSH 1V7NH 4H8WL 2C7UB 2NY1D 2OTUB 3ZDYE 1OAKL 4ZXBA 2DKOA 2H2PD 5IBTH 1QR1A 4ZUWB 5B3JE 3OJDB 4Z0BL 3WN5C 1UM4L 5CJQL 2Z35A 1J12A 3L6FB 5HHQA 5E99L 1BD2A 3D5OF 3ZL4H 3ARWA 2D7PA 1W0WA 3PWPB 1YMHB 4N8CH 5IB3A 1AGEB 4J3VA 4R4NC 5FGCE 1RULH 4HFUH 4L8DB 1UKSA 2HMIC 3OF6D 3VXTB 1NANH 1OP3K 3UP1A 4GJTB 1JFQH 4TQEH 3OKNB 4UIKH 3TVMA 3S3JA 3C5JB 3IJHB 3FFCA 1I8LA 4XAWH 3GJSA 1VGEL 3V8CA 4PJHE 2BNRD 1NGQH 1A6VH 1GJIA 4G9DA 2WWMD 4OZGE 4DVBA 4X83A 5DJXB 5I1CH 1UYWL 3C6LB 3HPJB 5FCSH 1A7QL 3DI3B 1W72L 1G7LA 3V6OC 3T1WA 4Q9RL 3V4VL 1PG7X 3QP3A 5I74C 2V9QA 1FZKB 5FGRA 1J5OH 3VFTB 2PTTB 43C9B 5SWZD 2G75B 2PN5A 3V7MA 4JJ5A 3ZE1E 2ZKHH 4WWKD 3SDDB 3TPKA 1E4KC 5JHDB 1P7QA 4GRLA 4JGJA 1FDLH 4L1DA 5DC4B 3RX7A 1INQA 1R6VA 1OY3B 2NY3B 4UIMA 2IMMA 1AY1H 4WEBH 3LDBC 3TIEA 3CMOL 1BZ9A 2EE3A 5GGVY 5FYJH 2VC2H 1W72A 2IH1A 4LLVA 3CLFH 1EBPA 3EJZC 3A6CH 4R90L 4O9HL 4HV8A 5GS0L 4JDVB 1GZPA 3RPKA 3RZCD 1BX2B 3EFFA 2A9NH 1NAMH 3U4EB 2AQ3A 2OK0H 4IRSC 5KG9B 3I3EA 1T03L 4L4VA 2GJ6D 3VRIB 1GHFL 2P49B 2QV2A 1EBAA 2VKWA 1S9YB 3QIWC 1I9JL 3BWAA 4NJAH 2W0LA 4NFCA 5K9KB 1IGMH 5IF0B 4YH6A 5DHYA 1NDGA 1DBAL 4MD5A 2FBJL 1CD9B 1BLNB 4J3WA 2CNOA 3T2NL 3RIAF 1F8TL 3K0WA 2VLJE 4WHCA 1T5WB 1WGOA 2GSGA 4WFGE 4ZMAT 1E0OB 5T1DH 4FQIH 5IW6A 5JOFA 3CVHA 2D9QB 5IVXB 4M9OA 3EO9H 2BY1A 4JFEE 4UDUB 4YE4L 1ND0A 3WD5L 1G1YA 5T3ZD 3MRCA 3EYOA 1MCDA 3N50A 1CDYA 3KWWB 3BZEA 1LP9F 5IAJA 4XWOC 4N0YL 4FQ2L 2A2QT 4Y4HD 4ZFGL 2XG4A 3CPLB 1YEJH 1A7OH 4TUKL 3VXNA 5IWLA 4HIEB 3VXPB 1DQML 4E5XB 3QXVA 2P5EB 2V5RA 1HH9B 4PJ5E 4X6CF 4NM8L 4TNWK 3T8XA 2F54D 2GFBA 1SYVB 2PYEE 3RL1A 1CF8H 4U3XA 5TDPA 4NRYA 2HJFB 2GAZB 1OAZL 2YA2A 1MQ8A 4KQ3H 4LRNL 1QTYT 3EOBA 3GJFK 3LHPH 3ITNA 3BRGC 3U46A 3VWKA 4BZ1L 2NY0D 5F88A 5HY9A 1U9KA 2XG5A 1N5AA 3GBLA 2C2ZA 1HZHL 3FN0L 4NHCH 3QI9A 4PJ7F 2ZUSA 5MI0B 4F15C 5IV2B 4C4KT 4DZBA 4YJZL 4P2QD 1AXSB 4DEPB 2FSEA 4G8FA 2AERT 4PJBF 4KXZH 3FQUB 5C6TL 1XIWC 4GS7C 2EDQA 4LSRH 4NRZB 3SGKC 1PEWA 1KENH 5E9DA 5TF1L 5D6DA 1MNUH 4JR9H 3LOWA 3UYRL 5J7CC 2IAMA 5TH2B 2CR3A 2YD9A 1P5UA 3BESR 3QIUD 1V3KA 3GMMA 5EU6B 3VFUA 1PBYA 3IJYA 4JM4H 5JDSA 5GRXG 4HIIB 4MQ7B 3ARGB 4QU8A 3PV6B 3MLUH 3MV8A 2IH3A 3ZDYF 2X4RA 3VMPA 5IK3B 1ZA6B 5IBPA 5L2JA 5B3JF 4F9LA 3IT8D 4FTVD 1KMCA 1A3LH 4QRRE 5I19H 4LGPB 3FRUA 1YQVL 1QLEH 1DSFL 4HQQH 4PRHE 2RGSA 5D1QC 2AJVH 4RA3A 2VLLB 1FNHA 5I15H 4UZGA 4HH8A 4ZOEA 3ARYA 2E8YA 1IAII 4S1DC 3Q1SH 4PY8I 2WUCL 4YXKL 2Q7YB 5DS8A 4ZPTB 3H7BB 2EDEA 1K85A 2HLAA 4Y19D 1U8PB 2HFGL 4L5FH 2XFXB 4PJHF 4Y1AD 1JYVA 3CX5K 5B3NA 3LEVL 4JPWL 4OZGF 4GMTH 2XTJD 2ADJB 2C9AA 4HDIB 4UU9B 3KLDA 1DBKH 5DD5L 2H45A 3DVNA 4RAUA 3IDXL 1MCFA 5EU4A 3RY6A 4JY5L 5D2LB 5DZOA 1LEIA 2PETA 1MJ8L 1TCRB 3OPZH 1NEZG 4NQDB 3TPUA 3GBNL 2EDDA 1UB6A 4XNQB 3VMOA 1J88A 5HD8D 3OWEA 3ZE1F 4WY7H 5DD1H 3QNZA 2OL3H 2ADFH 1WBXA 4OCSL 1I3RA 1UWXH 1WC7B 3HKFA 1DUZB 2BXYA 4IDLA 3QEUA 1YY9C 5HGHB 5T1MB 3B8YA 2C2MA 1KJMA 1L6XA 2CLZB 1EV2E 1FAKT 4QWWD 4OD3L 3SIRA 4TOYL 2OQJA 1H9VA 5HI5D 2Z31B 3NR2A 2IALA 2EYTA 3L3IA 1B0WA 4ZXBD 3QUKA 5GGRB 4ODUB 4Y4KA 2YMXL 1SEBB 2PYFA 2G5BB 1BD2D 4OM0H 5FYKU 3QXDA 4K8RD 3BH9A 2HVKB 4JDZB 5GRVL 1UWEH 1YMMA 2FGWL 4WI5A 1Q9WB 1BJ8A 3DYOA 2VRAA 4HBCL 4JZJB 3SQOL 5I1JH 5KVEH 5DRWA 5DUBA 25C8L 3GHBL 1EHLH 1R5WA 1YYLH 1GL4B 1MCRA 3OKMB 3TVMD 3CXHJ 3FFCD 2NQCA 2R2HB 5CFHA 1MRDH 4XH2A 4M3JA 2EECA 3RDTA 4RISH 4K7FB 4MNHA 1KTDB 3F7YA 4LLQA 1M7DB 3LQZB 4M93B 5B38G 3FB6A 1XCQA 5DC9B 4RGOH 3VDBA 4A6YH 3DVGA 5BZWB 4JGUA 4XP5H 4EDWL 1DVFB 4DK6A 1DLFL 2H48A 2CNKA 1LO0H 2AJUL 5F7YC 4NOFA 4LDEB 1HDMB 3SOBH 3GSRA 5KZCD 1KGCD 1KEML 2NXZC 4WI9A 2C4FT 2ICWI 4Z7UA 1UQSA 3MBED 2APVA 4JPKH 3VXQA 1K8DA 1ACYH 3BP5B 4OIIL 1P7QD 2PR4H 4GRLD 3C60B 4RNRB 4F57H 1G7PB 2B4CC 3MGTB 2H5IA 2BNRE 4HUWA 3BW9A 5FYKD 2QADB 1WISA 2APWA 3NTCL 3NZHH 5EIQA 4JFHD 2J4WH 1P7KB 2EDLA 4JM2D 5IBLC 3PWNB 4BFIA 4JN1L 5C08B 3QXUA 4XCEB 1L4IA 3SCMB 5D96C 1T80A 3LB6C 4S1RL 4PS0A 1G7HB 4FP8H 4L1HA 4UV4H 5IB5A 3GO1L 4LPUA 2DBLL 4F8TA 5JHLH 1BVKB 1JGDB 3UAJC 1KTRL 1YY8B 4HHAB 3D6FA 1RE1A 4KKLD 1YN6B 3PG2A 4NQVA 4U1MA 3RY4A 4QY8B 5J9PB 3UZQA 5SX5H 1B0RA 3SDXA 3BSZL 5KSBE 1RK1A 4PREB 2GK2A 2NNAA 4G5ZH 5DDHB 5ISZE 1IAOA 4F37K 5BV7H 5E8EA 3LMJL 1KIPB 5C0IB 3TM6A 4AIZB 5I71C 4ZYKA 4U1KB 5ALBH 1Q38A 4L8BB 1NLDL 1CXEA 1JXQA 1K6QH 5DMIL 5HHMB 3RNKA 1H3PH 1OSZB 5DUMH 4ZVTA 2DQJL 1KYOK 3KJNA 5A2KH 4ZQKA 4S1SL 5C0CD 2GJ6E 5E8NB 3VGHA 3PL6A 5I1DA 4YDKL 1HH6A 3TJHC 4GRWE 5ACZA 5KN5A 5E1HB 4WIQA 3S37H 2E7HA 4EJ1C 2O26U 3E8UL 5F97E 4AEFA 5E2UH 1I4FA 5IVZB 3WNMA 3RNQB 4QRUA 3BQUD 4OKDA 4X4XA 4PB9L 5F1KC 1CDHA 5D1ZB 1S9VA 4CDGC 3O3DB 1N4XH 3ISWA 3QDJA 6FABL 4LCIH 2GI7A 1BVLA 5K59E 1CXFA 2A6IB 3MUGA 2P44B 3F12A 5EUOB 4U3CA 5C2BH 3RL2B 2R29H 1PAMA 1U6AH 3MRQB 5IFAL 5JORB 3VWKD 3OGOE 4DGIL 5DD6B 5C0EA 3GJTA 3IDMB 5IW1B 4Z77B 3FTGA 1NAMB 5B22A 2IJ0C 5TDOA 4F7MA 1U8QB 4OZHB 4OF5A 1IKFH 2JKXA 4JG1L 2HJLA 3T0VA 2CDGA 3B9DA 1PLGL 1CGSH 1FJ1B 1QRNE 2Q76B 1NMEA 5E9DD 1A1OB 5E6IC 1AGDB 1KIRB 2YHGA 2FP3A 3IDIB 2WIIB 1H3UA 2FJFA 5FIEA 1OPGL 3FT4A 3MR9A 5FGBC 1JWUB 1LDPH 4MJ6A 4E41A 3QUYA 3OQ3B 4LPVA 4Z76A 5H2BB 1HHJA 4NQXA 3UO8B 3RVXD 1JWSB 3O2WH 3GI9H 2ICWA 5C8JA 2V5TA 4OCWL 4X4YA 4KAQH 5EBMA 5IT2H 1RJLA 2W9LA 2HFTA 1RHJA 3IGAB 5ENWA 4P2QE 4UQ2B 3UTTB 5F7EH 3BPCA 3GSUB 3MACL 1GZQA 5E08L 1CGUA 3ZLQC 1D9KB 2H51A 1NFKA 3WIIL 2D7QA 1EGJA 3OD5A 4Q6IC 4PJ8B 4PR5B 5DSCB 1OWWA<