1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GINGIPAIN R
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
4WRLA 4MZ2A 4KRMB 3JTSB 1A6AA 4GKZA 4OZGB 1J88A 4YFEA 3U48A 4Y5VC 5ADOH 4QTIL 5J56B 1WEJL 2D03H 1LO3L 1WCBB 3N1QC 3MRLA 4YLQT 2W9EL 3MJ9L 3M1BA 3OKMA 3BP4A 2D31A 1CD1B 1KJ2B 1LDPL 3VXSD 2AJSL 4ONOA 5ITBH 4KPHH 5C7XH 3SO3C 5I17B 4HC1L 1DANT 5E6IA 1DFBL 3CU1A 2BERA 3U36B 3DUSA 2AJVL 1WWBX 3U7WL 3I3DA 1HQ4B 4RMVA 2YUXA 2C7UB 2LV4A 4R4FL 1H15B 1KCVL 4FN0A 3T3PF 5KVFH 2NW3B 2OYPA 4NJAL 4LASL 4QOKA 4O2CB 4PGEB 2C3HA 2FO4A 1IGFH 5DRWB 4QOKE 2JB6A 2EIZB 3BHBA 3MOAL 4PV8B 3S96B 1DEEA 4PJ5B 5C0ND 1PBYA 4TUJA 3RVWC 3MLRL 4KKBD 2VN7A 4X4YB 3VFRA 2JB6B 4C4KT 2ZOLB 1T7VA 4O5LL 4YBLB 4FNLH 2NW2B 2R2CA 3OJ2C 4G8GA 1U8HA 1EJ6A 4OFDA 4NQDB 3R0NA 4P4KC 2O26U 1HH9A 1RJLA 3KPOA 4OGXH 3QNWA 4G3YL 3IU3B 2NY7L 3NZHL 1MIML 3O4OC 4MXVE 1U8LB 2EDEA 5TFSL 2FD6L 2VC2L 3IDJA 4ZAKA 1ZANH 3NTCH 4CVXA 3QP3A 3DGCR 1I3RB 2DQGH 4Y1AB 2BSTA 3UTSE 5FM5M 4R26L 5GHWH 2J5LC 1OHQA 1FNHA 2X10A 4UT7L 5E99L 2O61A 2AK4E 3G04B 1UCBH 4DN4H 1OPGH 4YAQB 3VXNB 4XPFH 1MRFH 1HSBA 5D7LD 4WGVB 4NO2A 1H3PL 4PP2B 2EYTB 4OSUH 1CF8L 1GZQB 4UINL 1UQSB 3LIZL 5HHOA 3WL9A 4GG6F 4JQIH 1PW3A 3HZMA 2Z93B 2Q6WB 3AY4C 4K8RD 4KTEH 2EC8A 3NIDF 4ORGA 5T5NF 5JO5B 2Z91A 3N50A 1T7XA 5IVZA 1BIHA 5CINH 2EH8H 4J8RB 3O9WB 1J0HA 4TULH 3C5ZC 4YHIA 4MXVF 3F58L 3GSUB 5FYJU 3LOWA 4F37K 1CDJA 3TV3L 3BDXA 1MHPL 1WF5A 1QEWA 3VRIB 3K4ZA 3HC4H 1T0NA 4JRXD 4TUJB 4X7SL 1GOFA 1UC6A 3BZDA 3PHQB 4LF3A 4KVCH 2KQMA 3C5SA 1IAII 5D8JL 1G84A 2X9WA 3VXTA 1TQCB 4ZUTA 1R3IL 3EDRA 2QLFA 1MI5D 4NWUL 4AH2B 5AZEH 2CGRL 2H45A 3HZYA 4AT6B 2RB8A 1F4XL 3K2UH 4JPIB 1MIMH 5EOCL 3PIQB 3N1PC 4YHLH 1XF1A 2QHRL 4PRIB 4I9WE 3RVTD 2D3VA 1A9BA 3AXLB 3PHSA 2OS7A 7FABL 5FKAA 1X5YA 3BP4B 2EE6A 5LG1A 1DQMH 3QG7H 4IOIA 3RTQD 3BWAA 4JZOA 2PYFB 4JPWH 4HH9B 4LNRB 4PV9A 4LKCA 4IOFC 4Y19A 1AKJB 1SY6H 2CSPA 5DHVA 1L9NA 3OAYK 3O4LB 2IALA 5GGSY 2APFA 4QRRA 1BFVL 3JWOC 4YAQA 3ILQD 5FM8A 1FVDA 5KAQG 2EYTA 1OGTB 2NR6D 3LQAC 3SGKC 5L7XL 1HHGB 4GW1A 4OQTH 4DGVL 3W11C 5BRZB 5L8KB 3MRHA 4NKOB 4EXPX 2J6EH 5MEPB 4O51B 4LEOB 4CVXB 5C09E 4MJ5B 4TOYH 2Y0BA 2FB4H 3FQRB 4F9LA 4PJXA 1I9RL 3DX7A 5JIPA 1D6VL 1RK1A 3TESA 3B9KB 4LHUG 4I48A 3TPUA 5A1AA 3BEVB 4E41D 1ZLUK 4PJFF 4J3XA 1P1ZA 2A9ML 5J1AB 5BVJB 2F54E 4RWHA 4I4WB 4I3RH 4NQDE 5EU4B 1PG7L 5DRNB 2QEJA 2R15A 1DQJB 5DZNA 4M7JH 2VZOA 1CLYL 1JF1A 2P4AB 4MJ6A 2AXGA 3E3QC 2VLKE 4TPRH 4GW5A 1A7PL 1FRGH 4PD4K 3GUTA 2FJFB 3GSQA 3FQTA 2VLKD 3OG6B 4XPAL 3C5ZA 3PABB 3ZT5A 5GJSH 3QEQE 1H5BB 4ODHL 2UUDH 1ZXQA 3G5VA 2BC4B 4AIZB 1IL1B 3BKJL 1WBXB 1FVEB 4IRSB 2LABA 3RWDA 5IBRA 5GRUL 4KDVA 4OD3L 5IBTL 3P4MA 3KPSA 4E41E 4POZD 3QFJE 3QNYB 1OGAE 3STBA 1TMCB 1MHEA 5A2KH 3CVHB 4YEFA 3HAEB 1LP9F 2R0WL 4NRYB 4HBCH 2ZSVB 3GGWB 5D93C 1MF2H 3VFVB 5I1LA 3QNXA 1QKZL 3MJ8A 4YIQA 1AC0A 1K85A 3DV6B 3VGGA 4ODVL 2ZCHL 1AD9B 3DURB 2PYEE 4F3FA 4M7ZC 1J0KA 2HFEA 1R3HA 5KBNC 1WZMA 4I13B 4RX4A 5TF1H 3LRSA 3VD9A 5GGVY 3QQ4A 4PY7A 3UTSA 4QRSB 4N7JA 4DQOL 3QJFA 3WLBB 1RHQA 4ISVB 4X8JB 3LKPB 5DQ9A 3AVEA 3IKCB 4FFWD 1P7KA 4ZYKB 3DYOA 3T1FB 3LEVH 2APWA 4LGPB 3WNNA 3AU1A 2XZAH 3O8XD 5JXAH 2F53A 3CMOL 4M7JL 3E3QE 1N0LA 3FB6B 1ITCA 3GBML 2AJ3A 3CVHL 5FF6A 4P3CH 3D39D 6FABL 3TT1L 4JZNA 1E4XL 3PWPD 4PJEE 1Z2KA 3NIFE 3FQUA 2RR3A 5CGMA 3OKNA 4JG1L 4L3CB 2ERJC 3SE3A 4N0UE 1LP9B 4HG4J 2ICWB 4NUJB 2VRAA 2Y72A 4PRPE 5CP3A 2FATH 1UM5H 3UZEA 2C5DC 4W4NA 3THMH 3L6FA 3PD0A 5EC2A 2DLFL 2VE6B 3OXSB 3VFSB 5T1MB 3RBGA 1VERA 4N8VA 1KENL 4X7SH 1YMMA 1YY9C 3IF1A 3FTGA 3S35X 4KRPC 4EVNB 1AXSA 3WFBL 4MNGA 5FUCC 5T1MA 3K81A 4EI5D 1PEZA 2D7TH 1EBPA 3HI1A 4GRMA 4J1UA 1QFUL 2K7PA 4R2GB 2VLMD 1WQVT 3O9WD 2NTFA 2Q86A 3QBTB 4FTVA 1BF8A 5INDB 2FX7L 4JHBA 4OT1L 3UC0L 4QRTB 3SE3C 4X7DC 3MJ8B 2IQAB 3AM8C 3L1OH 4WENB 5C86A 1CI5A 4KJYB 3ARFC 3V4UL 1MHCB 4MA1B 5F6HJ 4WO4B 1EAPB 1D5IH 3ULVF 3QWOA 3MTRA 3WNOA 3MA9L 1TDQA 2R29L 4UILH 1ETZB 3QO1A 3P4MB 1EZVY 1ZWIB 2XN9A 3CFJB 3FT3B 4WU5A 4HKBB 1HQRB 5DK0A 4XHQA 4OD3H 1NDGB 1P7KB 1A8JH 2P8PA 4WFFE 1F58L 3UJTH 5ALBL 3BW9B 1L7TL 4WU7B 4QRSA 1FIGH 5D7IA 4GKNA 3GSNL 2VQTA 3FN0H 2QQKL 3RWFB 2H2SD 5SX4H 3RAJH 2HG5B 4IJ3B 4JFQA 4MYWB 2CPCA 4RRPG 1M7IB 5HHOE 3NACH 1AXIB 3GM8A 1EMTH 5DQDL 5CD5C 5JHLL 4LKXA 1NUGA 1YEDA 2OSLA 2HT4D 1T3FA 3QIWC 4A2LA 3HNTH 3MRKA 2W92A 5E08H 2X1PA 3WFEH 43CAA 1I8KA 5F44A 2O5YH 4JG0L 2Z8VC 1JZ2A 1MPAL 3MQIA 1SJVA 4OZFH 3KG5A 4LLUA 5C07E 1QBBA 4LLQB 2WUCH 3HRZB 4CMMA 2ATKB 2JB5L 3NKFA 4QRQA 3H7LA 2UZYB 3RVXC 2VMFA 1JRHL 3UROR 4H88H 5T1KA 1TTFA 4UT7H 5E99H 3DRQA 4PJBB 4JREC 1Q9WA 1LE5A 5C07B 5C6PB 3ZDXE 3DV4A 4OGAD 2AGJL 4ZUTB 1TVHA 3FT4A 4EJFA 1NCBH 4BFBD 5LUAA 4LKCB 4M6OH 4S1SL 2F9BT 2YSSA 3JTTA 1QSEA 1C1EH 1EEZB 1X4YA 3MV8D 4L1DA 4N9GB 5MEOA 2FBJL 4YC2B 1L4IA 2PUQT 5I66A 4YHIB 5IHLB 4X98A 2COQA 3MFFB 4LAQL 4CMHC 4N5DA 2I26N 1G9MH 1ZHBB 2X4OB 3GMNA 4MA8L 3QCUH 1HXMA 1FPTL 2BNRD 3ME0A 4LSPH 3ARYA 5T3ZE 5HDQL 3VD4A 5GQBA 4HS3B 4S1RH 3HUJB 3GJFK 3FQNB 5KVMC 4C83A 3GMOA 2YXMA 1J7VR 4H8WH 3PNWB 4OZGF 4NZTH 4PJEB 2OCFD 3QZWB 4M1GH 4P2RB 5DI8A 2MWCA 3MOAH 4ZUUA 1Z9OA 2Y5TA 3RWGA 2FH8A 4WCYL 5T5FH 1E4XI 1HIMH 1OAZL 2IFFL 3MJGX 2FZ3A 3FQXA 4KAQL 5T33H 2AEIT 2J8OA 3QUYC 1NDGA 2YWZA 1DBKH 4PR5B 4E0RB 4OLYL 5ERWB 1AGDB 3MLYL 5HPOA 5EOCH 3MYJB 4HW6A 3NFSH 1CVRA 1AKJA 2XQBL 1P2CA 5E9DA 4YXKL 5JZ7D 1EAPA 1NGYB 3KPLB 4PV9B 5E1AA 3T65A 1X5FA 5KVEH 4I3SL 3B9AA 4J3OC 2C3XA 3HLAA 3OL2A 4R3SB 1C08B 3QQ9D 3VGHA 2WBJB 4HV8B 3WN5C 4YGAB 2QBWA 1OLZA 4NT6A 4PJGB 4PJ9A 3O41A 2WSKA 5ADOL 5SX5K 1I4FA 3OR7B 4X0KA 5ENWB 4AQ1B 2VDNH 3MC0A 4OGAC 4YQXH 4FQHB 1YMME 2BOBA 4IMLB 4DN4L 1N6QH 4HIIA 1JGUH 1HHKA 3FTGB 4W6YB 3WO3B 4Y88A 4JQVA 4P2QA 2H32H 4EOWH 3G5YB 4ZG1A 3BH9B 3SOBL 3ZE0E 1WAAA 3QEGL 4TQEH 5AWNL 5IEHA 3VA2C 1WAAE 3VXSA 1H5BA 1S3KL 4O2CA 2WAHA 4OCWH 3BYTA 1HI6A 1NCCL 3EW3B 5GZOC 2IPTH 5DD1L 1U8OA 1M71A 3GO1H 2J12B 4G8EB 7FABH 3MV9E 5GS1A 3SCMB 1BZ7B 2P8MA 1MCCA 5CINL 1DQJA 2W0KA 4XPGL 4Y2DA 4XZUA 3NAAL 1C16B 4GBXC 4D3YA 2YPKA 3MA9H 2ADJA 3H0TA 4FFYL 4P46B 4PRNB 2V2WB 4JGUA 4O4YL 1PAUA 4QYOB 4TNWK 4EN3D 1QFWI 5DFVC 1R3IH 5KAQF 2HTLC 2WP3T 2ATPB 3GMRA 5FYKL 1KJ2L 3QHZL 4WHCA 1T03H 1NANI 1FNSL 2JIXA 4YH6A 3U30B 4NQEE 1F13A 4ZAKB 3GBNH 1UG9A 3M17A 5KN5A 2AP2A 2OMBA 3TT3H 1JTOA 4ALAH 2J31A 4Q0XH 4XHJD 1QSVA 2WMPA 2A77H 4JJ8A 2W9DH 5DTFA 3U9PL 4BSWB 1KJMB 3UYOD 3UJTL 5FYKE 1FFQA 1G0XA 1T21B 4PJCE 5EFIA 2N7AA 1KCUL 4Z95H 3E6HA 1KJMA 4KK8C 3HE7C 2VABB 3E2HC 3JXAA 1C7SA 1G7HB 4GRWE 4H1LA 3IDNB 4OZ4A 5GRUH 4L29B 4NSKA 1YEKL 3KPOB 2X5PA 3EZ8A 3QIWB 4FQJL 4ODVH 1UKTA 1LK2B 1S3KH 4BSJA 5F7FA 2YC1B 2VLJE 3PWUA 5EIQA 3SPVB 1WBXA 2AI0H 4OCSH 1YA5A 4XPAH 4Z76A 1CFQB 1PLGH 2A6KA 1FCCA 4QOKB 4S1DC 4HWEH 3PABA 4PJGF 4GO6B 2CIIB 2J88H 1BMGA 3LKQB 1OAKL 2BNRA 1KEGL 2VLKB 1J05A 1D5MA 4NKMB 5IJKC 1KNOB 2E7BA 4OFYA 2VWEE 4U1GB 1HHHA 3RDTC 2LVCA 3FKUS 3KLAB 2AXFB 1AJ7H 2AABL 5J0BA 1JPST 3B6SA 1A6PA 1D7FA 5IR1B 3NCFB 4C83B 3OB0K 4BSVA 3U30C 2X1XR 4LLMB 3O0RL 4K71C 1DL7H 2SEBA 5FYJL 2P8MB 4S1QH 4HAFA 1MCEA 4H25B 5CSZB 4EN3C 5JR1H 5J12C 2H5JA 5JW4N 1ZA6A 4FABH 4J3WA 2YPLE 1HI6B 1YEJL 4L3AA 8FABB 2DOCA 1B4JH 3HC0A 1RK1B 1S7VA 1FFNA 1IC7H 1O0VA 1Z9SA 3ARFB 3ARTA 3V0VA 3TO2B 3G5ZA 1L0YA 1C12A 4YHNA 3QDMB 3MRMA 4JFXA 4GAFB 4X4MA 5D1QB 2A9MH 3TO4D 5C6TH 2MNUA 2CLZB 5GRXG 4ZFZB 3D25A 5DVOA 4PUBL 5HI3C 4GBXA 4LHUB 2EDBA 1YEFL 3V4VH 4ZNEE 1TETL 3ZTNL 3OV6A 1A7QH 3CDFA 3B83A 5JOFB 4J4PD 4AG4H 4ODSH 5BOZG 1F45A 1PVHA 3DSFL 3RFZC 4D9LL 4HIEA 4JR1A 4ELME 2B5IC 1L7TH 3SJVA 3BGFC 5E1HB 5L8JB 5CSGA 5L7XH 2EXWD 1CK0L 4YUEL 5FF6B 5I1HH 4PPTA 1TPXB 3ULUD 4U1LA 4P3DA 3I75B 2J3SA 1KT2B 4EHNA 5MENE 1K5NB 1NAMH 3VFUB 3FMGH 3VXRA 3CCHA 1SQ2N 2Q8BL 4UILL 2WWKT 5CZKA 1PY9A 2O5XL 2BVPA 3TM6A 4C57C 1T3FB 4U7KA 1X9QA 5JW5B 4NOBA 2JJTA 2BVTA 3RY6C 4LIQH 4GRWF 2E6JA 1NFIB 4XB7A 4CVUA 5IMKA 3MCLH 3AS3A 4LIQE 1EUTA 4ZTOL 1PX4A 3GMPA 4KQ4L 1N3NA 2P43B 4I1RA 1I9JH 4WHDA 5ISZD 1F4AA 3L5WB 3RWCB 1QFUH 4WJ5A 1NANH 3X17A 4PJ8B 1I7ZB 4F3FB 2ZWLT 2EDYA 4PRHA 3VWJB 5IV2A 5J1SC 1JV5A 3KXFB 4HSQA 1XGPA 4QRPA 2X4OA 4FQ2H 2X42A 1V7MH 3IFNH 4YHOL 5JNYB 4O9HL 3WSQH 1JHTB 2XFXA 3A67L 1KB5A 2QQKH 4HKBA 1YQVH 5IHUL 2BXZA 5J89A 5CHNA 5HGDA 3DGGA 4KROC 3L3JA 4PB0H 1WISA 3MLTB 3IJSB 3OJVC 2LTQC 5DJDA 1RZ8B 1JWSA 4G6AD 5IB2B 4OZHB 3LKSA 4Z18A 5TDPB 3SCMD 4OUOA 1ZAGA 2GJ6B 3VI4F 5BS0B 2R9HD 3DV4B 2VQ1A 1EVTC 3CC5A 2FEEL 4MLIA 1QPXA 1VPOH 4XCCL 3MRIB 43C9B 2MOVA 3LN5B 4MAUL 3GB7A 1FGVH 2CDGB 4GKNB 3QXAA 3MV7D 3GMPB 4JFDA 3ULUF 3O6FA 4WFHD 3S4SB 1C5DB 3S70A 3KYAA 4R8WL 2AJUL 4L8DA 1O5DT 4XH2B 1CR9H 4KJPD 1I4EB 1GAFL 3V6LA 1U42A 1HCVA 2DQUL 1RJYB 3BN9C 5AAWA 3BAEL 1CQKA 1QKZH 4LOUD 1A1OA 1S8DA 4APQB 2AEQH 3GBNL 2CKBB 3GHEH 1OB1A 4WFEE 1JFQH 4GMSH 3RP1A 5K9KB 3OQ3B 4ODWA 5IQ9B 2QTEA 4Z7VA 3UTQB 5DD1H 4HQ0A 3VXPA 1I51A 4PV8A 3S96A 1RD6A 2C1PA 4XBPB 5D7IF 4NQCA 1Y0LA 4DCOA 3O3DB 1MQKL 1X5LA 3WIHL 4Y8DC 4YDJA 2OJZL 1RWWA 4G8FB 4OGZA 3QJFB 1DBBL 3N06B 2EYRA 5D7JA 1MRCL 3OZ9L 3CH1A 2H48A 3F6LA 4QHKJ 2R0KH 5K33A 2R2EB 3UDWC 5HVWA 4ODXA 4IS6A 4WO4A 1AD9A 1U93B 1RUMH 4G9FE 2HKHH 1I9JL 3VDAA 4NP4H 3CX2A 3KXFA 1FGVL 2D9CA 5EZLB 5IVXF 1T04B 4QHMB 4HWBH 4YDIH 4CW1B 1BD2E 5LAXB 4LCCB 3UBXA 2CO6B 4KUCF 1SMOA 3MJ7A 4LBEA 2F53B 2A83A 3PGCA 1FNLA 4FZ8L 4YXKH 4WI4A 5HSFA 2GSIB 4P2OD 4G9FB 2IH1A 4QU0A 1HINH 5IW1B 5BMFH 4NOJA 5DSCA 1A9EB 4JFYB 4UQ3A 3GMQB 2AJZB 2ZUVA 3F12A 2C2OA 5T1DL 1I1RA 3DTXA 5IAEA 2XZAL 2J30A 1DDHB 2DTSA 5EU7C 4KC3B 2NR6C 5F7YC 4PRAA 5IBUG 3UP1A 4RAVB 4ZTPL 2J7LA 4P5MA 2CNLA 3W11D 5JO5A 3QIWA 5B4MD 4ZFFA 5CWSB 4FHBD 4L8SA 3SJVB 3KPNA 5EZOL 4XCEB 2I60L 4ZOCA 1FNGA 3MRNA 3V7MA 1FVCB 1UXSA 4DCQA 3QZWG 2DMKA 1HWHB 4K9EL 1F8TH 1VFBB 3RL1B 1M05A 1Q9OA 4PP1D 3EYQC 2BNUA 2KUTA 1C1EL 5E8DH 3NCMA 1ITBB 1JJUA 5FUCE 5IQ7L 5JPNB 5FYJD 1TJGH 3BPLB 4U1JB 1YMHA 4G8GD 3W0WA 2NYYC 3HFML 4C54A 4CU7A 2L4OA 1FPTH 1MVFA 1I4OA 5IK3B 5KTEL 4AMKH 1S5HB 2NYYD 5IC4A 5FGBC 2E5EA 5EU6B 1MJJA 3GIZL 3D6MA 3B3IB 4H88L 5FV2A 4K7PL 5IAKA 1E27B 4QXWA 5D5MF 5JIHA 5TDOA 4OM0H 3GRWL 4XVJL 3MCLL 1PYWA 3WJLC 5EBLB 4P9MH 1A3QA 5IR1A 3QUZC 3S37H 4OD2A 5ESQA 2E9JA 4R0LC 1KYOK 3T0EA 4LK4A 3HPLB 3IJYA 4OLXL 1T1WA 4K3GA 4L8CB 2B2XH 1S9XB 3TGXA 4I0PD 3N85L 4IOFD 4JRXE 5D2LE 5HHXL 2VLLA 5CIPA 4ORZC 3CUPB 1BVKA 5GSRA 1RHUA 3QI9D 2PR4L 5T5NG 3NZ8A 2GIYA 1JI2A 4QUAA 3ULUL 4F9PA 3FB8A 1R3KB 4HFUL 1DUZB 3BI9X 1MWAB 4HGMA 1LK3H 1NJ9A 4JO2L 3NACL 5JOPD 1NSNH 4FQXB 3BUYB 3LEXA 2R69H 4TOYL 2V17H 4WUUE 1NMQA 1ZSDB 5JUEH 5L2KA 3OGOE 3TH3T 2JLLA 2OP4H 3S36L 2A77L 3P2TA 3ULSA 2I9TB 5I8OH 4JFOB 3HR5A 1GGUA 2XZQL 1CXKA 3VFWA 3U2SB 1LEGB 5BVJA 3F7RA 4QHUB 2AK4A 5DDHA 4KAQH 1H9VA 4JFHE 4F33B 4PRDB 4D0DA 5B39G 3SO3B 3RGVC 3BUTA 1TZGL 5I1IL 4JN1L 4QRUA 5T1DH 4KJWD 1VKXB 5JMOC 1DSFL 1FAIL 3UYRL 2C1OB 3LQZA 3HE6C 5I1KL 3UBXI 4KUZL 2V7HA 3S3JA 4N6NA 1QUNA 1AGDA 2B4CH 5HHOB 4HMCA 4M03A 4XNUH 2X4NB 1PZ5A 5FA3A 3GJQA 2D4FA 2IGFL 2NXYD 3BVNB 3KJ6H 3L3KA 5D1ZB 1G0DA 4QXUL 5C2BL 2IANB 2WM0A 4PRNA 2FBOJ 4OF3A 5J11C 5IMLB 5BZDA 4S1SH 2KDGA 4OSUL 1XGQB 1K4CA 2VDKL 3MREB 2ICEB 3D2UA 4M6MH 4AWAA 5GS3A 2J8UB 1XF5A 3GMNB 2FEEI 5IB5B 1FFPB 2SEBB 2EDTA 3Q48A 3SKNB 5TGBB 5DD6A 4KROB 3VFPB 2BNQA 4X98B 4BA8A 1XF5B 2EYSA 3BZFB 5CILL 4FFVD 3WYRA 4RNRA 3TV3H 3OAUL 1MREH 4Y4HB 1IJ9A 4GG6B 4PS1A 1WEJH 5EZJB 1YEEL 4KKLC 4IEFB 3VXNA 1OM3L 2R0ZH 3S3SA 5EH1A 3D18A 4JFFB 4I0PA 3TYGL 2DQIH 1RUKH 5CJXC 1PZ5B 2F58L 5FYKU 4LSZA 1SY6A 3IFLL 4LPXA 2WDPA 5D71H 2VL4A 4Z78A 1KIRB 1JCKA 3KYNB 5SX5H 3OKDB 1IQWH 3QFDB 1BFSA 4JQIL 1I8IA 5D70L 3S5LA 4ZUWA 2L0DA 2DI9A 4RGMB 4KUZH 4U49A 4IOSD 1UYWL 4J8RA 5F7HA 1DLHA 1ACZA 3CVHH 5HGGS 4HUWA 3MYJA 4HKJB 3U4BH 1SJXA 4PRDA 2Q6WA 2VLJB 4G7VL 2WINB 3KYKH 4S2SA 5FK9B 3U83A 5JTWA 2GT9B 2ORBH 1BQHA 1PQZA 1EAJA 5EULV 1BQLH 4KJQD 2BP3A 1FLRH 4KMTL 3M17B 3SKMA 5IANA 3KPRA 3QDGD 5EU7E 3SGKA 4DUXA 5KJRH 2GJ6E 1HZHL 2ZNXA 4IMKA 5D96C 5K9QI 4HUVB 3KR3L 2D7NA 2FYYB 3MGTA 5I1GH 5CP7A 3B5GA 1CGSH 4RMUA 1IEBA 4JHAH 3RVUD 1CZ8H 1T20A 1W0YT 1T66D 4UIMA 4NN6B 4ZD3H 4L4JA 1UZ8B 4HZLB 3EO1A 4AG4L 1QFWM 4XPTH 4YJZL 2HVKA 1NAMA 2EIDA 5LU9A 3NFSL 2B7DT 3SEPA 2XA3A 3GHBL 2EKSB 3HB3D 3F7PC 4XP4H 5LAXA 5IEKA 2OJEB 4O9HH 3RY5A 3WSQL 5LWYL 3Q6GH 3OB8A 4YNYB 1SYVA 1U2CA 1M71B 3AUVA 3PL6A 3FFCA 3C60C 2IG2H 3QIBA 3ZE2E 4KDWA 1MFAH 4TVPE 3RWIA 3RUGB 1OW0C 5EA0L 4D9LH 4OF7A 3MV7E 3MLUH 4M5YL 4XP9H 5EBWA 2RHEA 4P2QB 4HDIA 1W2KT 2B2XL 1DBAL 2CDEB 4N90E 3MV9B 1EVUA 1WT5C 3EYSH 2HBRA 2A6IA 1ORQA 5IB4B 3BP6B 3X14A 3ITNA 2GUOA 3DX8B 2XN9E 4X0KB 3CVIL 2DI7A 5T1LA 1G1YA 4LARL 2V5YA 2C3GA 4LPWA 1ZGLB 1ZT7A 1GGYA 1CFVL 4S2SB 1WIUA 5FK9A 5DQDH 3O6ML 5CEZD 3P0GB 1K3IA 4LVHC 5D5MA 3GSNB 2EH7H 2YEZA 4GAJL 4PRAB 2P1YA 1CIDA 1RJYA 2FJHB 5ALCL 3SDCB 1MCFA 1A1MA 4YXHL 1A7QL 1J0YA 1UCTA 1J1OH 2ZPKH 3ARQA 3IDYB 3S5LB 4TN9A 4XAKE 4MA7H 4QU9A 2QR0A 2YN3A 3KNBA 4LRIC 3TVMA 3I50H 1A0QL 1A3RL 2JJSA 1IGIH 2GTWB 4JM2F 4P9HC 4FZEH 4ZVRA 3STLB 3G6JA 4RRPA 2VYRE 2GKIA 3QHFH 5LWYH 4PJCF 3WLWD 3WNLA 4GQ9H 3QXTA 3PQYA 4XNYL 5B22A 4JRYE 4JVWA 1BFOB 5CEYB 4I3GA 5I76B 3O11A 4TSAH 4JO3L 4TVSa 3MCG1 4XP1L 4EQ2A 1G6RL 1FLRL 2Q1EA 1WSST 2AQ1A 3T4YA 3PHOB 1D5ZB 3O0RH 1IC1A 3UTSD 3MFFA 1T1WB 3AB0B 3ARBC 4JCMA 3BP5B 3H3PH 4M61B 1N2RA 3VJ6B 5HGDB 1X44A 5I8EB 1AR1C 3OKKA 5IMMA 4WI9A 1KSRA 3HAEA 2PCPB 1R24A 3TBTA 2P5WE 5HTSA 3RPKA 2HVJB 4OD1H 5KW9H 3LKRB 2QQLL 3U4AA 4OCLC 4HLZH 4TPRL 2H6PB 1RZFH 3OKEB 3ES6A 2DLFH 1X4XA 4QNPE 3T2PA 1JV5B 4YHMH 2CDEA 3LPGA 3WHXB 4DTGH 4G7YH 4N5UA 5J13B 5KSUB 1RZ7L 5ABDE 4HIXH 4MQ7A 1IL1A 2FIRT 1AY1H 3BZEB 4P2YA 4R9HA 5DHYA 2JJWA 1AJ7L 2AABH 3IXAA 2UWEA 1L6ZA 2DBLL 3R8BB 1QTNA 5KTEH 4DVBB 2GY5A 3UTZB 1EGJL 3EIFA 4QNPF 1TFHA 3F7VB 4Y4HC 5E8EA 1AKJD 2KPNA 2CUIA 3DXAB 4Y19D 1EFXD 1YYMH 5C0BD 2Y36H 3CLEL 4I4WA 4YE4H 8CGTA 1Q0YL 1JHKL 1H3TA 4Y4FD 5TFSH 3X13B 4XCEA 3QXVA 3VMNA 4NUGL 4MX7B 1KPRB 4XPFL 5C0CE 3MO1B 1T2JA 1AGFA 5TQ0L 4B0MM 4JFQB 1HKFA 1G7JB 5F1OB 3V6BR 1J8HA 4N0CD 3MRIA 1U8IB 4U31A 4A6YB 4N0YH 3C8HA 3O8XC 3TVMD 4YDKH 5EWIH 1F4YH 3UAJC 2X9YA 4KI5C 4JY5H 2DD8H 5JPMA 2NY5H 1QRND 4WI3A 1MLBB 3IVKA 3V5DA 4KDTC 4RBPK 4YIQB 3VXRD 4R6UA 1BZ9B 2HMIC 2XKSA 3EOAB 2P42B 3DXAE 4FZEL 1N8ZB 4K2UL 1BD2B 2NZ9D 3CVHA 3QA3A 3GM0A 5KSBE 5SV3A 1EXUA 4HK3N 3H11A 5E24E 4HH9A 4FQ1H 3CFJA 4QXUH 1QLFB 4JRXB 3DMMC 1QR1A 4CMHB 1N4XL 1AE6L 5H37H 4FTVE 1JUFA 3PHOA 1FP5A 1K9TA 3MA7A 4N1HB 2OP4L 3T3ME 3WDHA 4JM4H 1N26A 4N1EA 3BZEA 2W9EH 3HI1B 4YHZL 4GKSA 4YHKL 4LHQB 4Q9RH 3QI9B 4D0BB 2AJSH 3FFDB 5DC0A 4FTVB 3CD4A 3TT1H 5IVNA 1YN6A 2A6IB 1M05B 1KC5H 1AO7B 4U1SB 2Q76A 5DD6B 3VFPA 4QO1A 5FXCH 3A6OA 1S7RA 5F1IB 4GH7B 2D7OA 1WBYB 2A9NL 4U6YA 4NC0B 5BXFB 4ZXBD 4JFPB 4ODTL 3U79A 4CAGA 2W07A 2LQRA 4OQTL 1XZ0A 3SN6N 4J2XA 3ZL4L 2F8VA 4R7DA 1KFAH 1DBMH 2QADD 2AV1B 2L7JA 4AMKL 4LHUA 3RIFF 5FEBA 3C5JA 3ARED 2K7QA 2XYHA 4LVOB 1S5IL 4M93B 1A7PH 1FRGL 4ZPTB 4NO0D 2F15A 4IYRA 3WE6A 4PREB 4OZGE 5JOFA 1JGLH 32C2A 1NBYA 3CH8A 1NAMB 4IRZL 5DJXA 4OCSL 2NXYB 1R5WB 2Q7YB 3RGVA 3O4LA 1MFBL 2LU7A 2XWTB 4OZIA 3H9SE 3GEWB 3LMJL 1N4XH 2R2BB 1INQA 4X5WB 5DWUL 4WY7H 3BWAB 4HUXA 3V0VB 4OBRA 4P23D 3HUJF 3C8DA 3ZSTA 3B5HA 4K94L 4AY0A 1IKFL 4JFEB 3LS5H 4PG2C 4DJMA 2XQBH 1UJ3A 1FV1A 1K86A 1OTTC 1R3LB 3RI5F 1YEJH 4M62H 1CGUA 4PJBE 3AFLA 3Q3GA 3WIHA 5A2IH 2R8SL 1CLYH 2OJEA 4NRYA 4LSPL 2QHLA 1MRDL 5J3HD 3HC3L 3O3BA 5HYIA 3TIDA 1NFDB 2R56L 3V5HB 1XCQB 3VXSB 4HZLA 2UY7A 4Y5YA 4YGVB 3I6KB 2WZPD 1T20B 4NJ9H 2ESVD 1U8PA 3FRUA 2OTPA 3HAEH 2FJFA 3ZTNH 3IS0X 4H26A 4I0PB 2XTJC 3UJJH 1J1OL 1CFSA 1GHFL 2ZPKL 2OM5A 4KKNA 3NIDE 5HGAB 4AIZA 1GXEA 1AP2A 1F5WA 4F7TB 1KEML 3MOBL 2DJSA 4ZTPH 2B5IB 1P84K 4LCUB 4LQFH 5IVZB 1H15A 1G7JA 1RURL 1Y6NR 3BO8B 3LQMA 4HV8A 3FRPA 3LN9A 3QNZA 4OI8A 3RIFK 3CCHB 3ARDD 3L3OB 4QWWC 1NGYA 2VO5A 1X5ZA 4ZXBB 1DANU 3MPCA 1MH5A 1MELA 3HE6A 1D6VH 4HC1A 3GBLA 5DJ8A 1TJHL 4D0CB 4JB9L 4MXWH 1YY8A 4Z8FH 2VIRA 3QDAA 3VXUA 4M02A 1T1XB 5ICYA 4RX4D 4HPYH 4HX1B 4Q6IB 4HK0A 2IANA 3B2UC 5JOPE 1MHHA 5T1LD 4DUVA 3GMRB 3LKNA 3DBXB 4JG0H 2WNGA 5BVPH 5JXAL 1CFTB 3CFBB 5D1QA 5BO1H 2UUDK 3G9VA 5DRXA 3B2UD 1NCAH 4Z7VE 3GDBA 4YK4C 3EJZC 2JJSC 3MUHL 4G6KL 1B0GA 1ZHNB 4K8RH 4R90L 1INEL 1W72B 1FZOB 1Q0XH 3UTTA 3RDTB 1KIQA 1C16A 4LCUA 1HILA 4ELKA 1JYNA 3MCKA 1MLCB 4WTZG 1GSMA 4NN5B 1T83A 3IDIA 1XGQA 2DIAA 4M8VA 5EC1A 4N90D 4NQUA 1WCQA 2EIZA 5KJRL 2DQTH 4YGVA 5IEHB 4UB0L 1IQDB 3Q1SL 4LL9A 1WFUA 5TE7H 5MEND 3CLEH 4LPYA 1HHKB 3VDBA 1HHJA 4YXLL 3U0PA 3C9NA 4WFFD 5DMYA 1F3JA 3UMTA 4FQIH 4P2OC 3KXFE 4PBWD 5GZNC 1Q38A 1Q72L 1PKOA 1NH6A 5K9JL 1CR9L 1CLZH 4GUPB 3V95A 2IPTL 4X9IA 5D93B 1I4FB 1RPQA 3OR7A 4Z5RB 1AIFA 1ZGLP 5D2LF 4JFEA 1T0NB 2DWEB 5FA4A 1CU4L 2Z91B 3I9GH 4GAYB 1B0GB 5FO7B 5IBUB 5HHPA 5HDBE 5A3IC 1KIRA 3KYNA 2OTWB 4IMKC 4UDTB 5A2FA 3LEVL 4PRYA 4WGWB 2G75B 3VW3L 1TCMA 4ZVOA 3R4DA 5TH2A 4WUUA 1DBJH 1T4KA 1LILA 2BFVH 2NX5B 4BSWA 2QQLH 1IGIL 4LLDA 4Y5XC 3TZVD 3IVKB 4APQC 4P2CG 5JQ6L 4WW2A 1E4XH 5E2VH 4TVPH 4U1KA 1CFTA 2YPVL 3CFBA 4FQXC 3TBVA 3UTQA 1X5IA 5IMOA 1UADC 4TSCL 1HIML 1OAZH 2D7QA 2JIXB 5D7IB 3T0AA 5EOQH 1D5XA 3W9EB 4E5XA 3P9MB 4A6YA 4WU7A 1OSZB 2CK2A 3I3EA 5H2BB 5JMRA 3NCYP 1KJ3L 3WS3A 1RUPH 4D0DB 4I77H 4YWGL 3RHWK 4YQXL 2VDKH 3RL1A 4HIXL 5T3ZD 3NCCB 5SWSB 1CQYA 3QHZH 4JFFE 5MERA 4ZD3L 4HHAB 4RAHA 2EDWA 2DWDB 3KYMA 3QIBC 1EEUA 2Z35A 4OZFG 5IVXB 1AP2B 3QO0B 4NC2B 4S0SD 5F7DB 2D7MA 1JP5A 3HMWL 3FN9A 1Z3GL 3C9NB 3SE8H 5SWZA 5GS0D 1ACYH 4I18C 5D1QD 3W9DB 12E8H 5HI4D 1CFQA 2A6KB 4XNZB 5KVGH 1BP3B 1HXYB 4FGUA 1FZKA 1CGVA 3KJ4B 3VD3A 2H32A 2NY1C 1A22B 5D4QA 1AGEB 1Z0MA 2ESVE 3VXOB 1FL5B 5C0AB 1JGVL 1T2XA 3DETC 4L29A 4GXVH 4NSKB 4R4FH 4ELMF 2CLRA 4L4TA 3GHBH 3RL2B 2X41A 4MD5A 3EYSL 3BD5A 3L5HA 2VAJA 2AVGA 4M9OA 5AUMB 3U7YL 4AJ0A 5E6IB 2FB4L 4OZFA 2V9QA 3WIFA 1NMAH 4HKJA 2VDRH 3KVQA 1YEDB 1A4JA 1QVOA 2YBRB 1XGUA 4KKLD 5DF0A 5DMGC 4F58H 3QCTH 1TTUA 5IAJA 4XVSH 2NLJA 4GRLA 3WCYA 3WFHB 4HXBL 3AGVA 1MQ8A 4EHAA 2JTDA 1CVSC 3HZKA 5DURD 1T89C 1QZ1A 3IDUA 2CJUH 3BPOB 4JM2B 4M7LH 2Y5TB 3QEUB 3DX6A 4N0FB 3MV9D 4XPTL 2CUHA 3BESR 3QZWA 4CN6A 3PDDA 1NGWA 3VFNB 1JWMA 1SC4A 2CRZA 2JB5H 5GRZA 5J57B 1RZKC 3OKLB 1KCUH 1ZT1B 1AHWA 1OAKH 1U8OB 2N56A 3BIKB 4YX2L 4Z77A 1MCWM 4W6XB 4NN6C 3I3BA 3FL7A 3BAEH 4KDTA 2VL5B 5DUBB 3LPFA 2AEQL 2OQJA 5MEOB 3KLHC 2HH0H 4JVUA 1P4IL 5CD3B 5F1KC 2G2RB 3GI8L 1DL7L 4BJLA 1A1NB 2V2XA 3GSRA 3DRTB 3HZVA 1FSKC 3ZHKA 5HYQB 1WBZB 5FM5O 5DEGB 3T0WA 1H3VA 2DM7A 1IM9D 1I1AD 2HLFC 3LN5A 2OL3A 3ARFD 5CGYD 1NCCH 4HUNB 3U4EB 2BMKB 5E9DD 1YPZE 3BPNB 4MJIE 2VZSA 3M8OH 4WTWA 2CKBH 2Y9RT 3RWIB 1B2WL 1A1OB 1S8DB 5DMGD 3R5KA 2R9HC 4NN7B 5ILTH 1JXQA 3JV6B 4HPYL 1MCLA 2NY5L 1MRFL 5IROC 1T0MB 1F4XH 4PJFE 4Q9QL 3PL6D 1BGXH 3O6LL 4UTAH 3JWDH 4QCIA 5C1MB 4XH2A 4OCWL 2NN3C 2PXYC 4LQFL 2I9TA 3WLBA 5I1KH 3RGVB 1JZ5A 3EOBA 1Y0LB 4J23A 4PRZA 2VZ1A 5GGVH 3BEWA 4KJQC 3NCJL 4CVWA 1P69B 4DCPA 4Z7VB 2ZG2A 1CICC 1OD7A 3J7HA 4RIRB 1ND0B 3LKOA 2AK1L 5FGRA 1F6LL 1MVUA 1QLEH 4NNPH 2P2CA 3SIPA 3MV8E 3A6CL 2NY4D 4UZGA 4F7EA 1O7SA 2Z31D 4OKVB 5L8LB 4OLVH 4OZHA 1BAFH 1VEPA 3VI3E 2R0KL 4BFGA 1VFAB 2VLRD 4Y7MA 3KPQB 5DLMH 3SDXE 3L7FB 1DQDL 4O00A 1D5BA 2I27N 4M62L 3U1SL 4P9HH 2A74A 4E42B 1I75A 4JN2A 5IGXH 3SGDH 3OAZK 4HLJA 2P5WB 4XB8A 5BO1L 3TO4A 5CILH 4HQQL 1GOHA 4M9PA 4RFOH 2CDFA 3ARVA 5FOBA 3QEQD 3RGHA 3UPRB 1RHKA 3MRDA 3M8OL 3L3IA 4FFVC 1XR8B 2IH3A 4LSDA 4PLJC 4V2BA 5I2IB 2UWEF 1WICA 4Z8FL 4CKVX 2BCKA 1NBVL 3GMLB 5JORA 4Y2DC 5HVHB 1K2DB 2X89D 5E5RB 1HNFA 1NCUA 3FFCE 4XMLL 4EBQL 4MVBC 4NQDD 4GAGL 2VDMH 3G5ZB 5F93C 4S0TD 2DMBA 2DRUA 5FO9B 3H11B 3GI8H 1W0WB 1VADB 4HJJL 5KZCB 4CJ1A 1MFBH 3QJHA 3SQOL 2XKUA 1S7TB 4RAUA 3VWKD 3IKKA 1A14H 5C08D 4HLZG 3VRJA 4NCDA 2VR9A 5DEFB 4JFDB 5AD0A 1BPVA 1AGBA 2QL9A 1MLBA 4TSBH 5I18H 4XRCB 3QH3A 2CLVB 2H41A 4L8BB 2HTKD 3BGFB 5FDWB 1XT5A 3MRBA 1OSZA 4M1CD 5D5ME 4YZFE 1F3RB 3GRWA 4G6JH 5M94B 1T89A 4Y2OA 1MAML 3DSNA 5HHNB 4PG2A 5T3ZL 3V3KA 4D3XA 1U8IA 2PR4H 5HHQB 5EDXA 3HG1E 1AHWC 3B9EA 3EYFB 3GMQA 5IIEA 4G42B 5DFVD 4QXGH 4XAKD 4YHYB 2OK0L 4Z76B 2J6EA 1NSNL 4HWNA 1JNNL 3NN8A 2X40A 5F89A 1JGLL 4FFZL 3VFOB 1R0AH 2VLRB 4MD4A 4XVSL 3ZYIA 2PYEB 4JGJA 4M1GL 5GS0L 1P2CB 5ESAB 2OTWA 5D96B 2XZCH 1A9BB 4FTVD 4LHJB 5CEZE 4OM0L 3NFPB 2GEEA 3V8CA 4PLJD 3H9HA 1RJLB 1GVIA 5MI0C 4BSVB 1MFAL 4JDTL 5EOCJ 3ARBD 4GKOA 4XGZB 3NABH 1S9WB 4MQTB 3O4OB 5DJ6B 3RVVD 3TBYA 1BJ1J 3CH1B 3MBED 2P48B 1JYWA 4I1PA 4ENED 4MCYA 2DLHA 4X4YA 2PW1A 5KSBA 1TJGL 3BXNA 5IB3B 3S3PA 3CMGA 1P4BL 3Q1SH 2VITA 2VISB 1OP3K 1NUDA 4F57H 1IQDA 4OCXH 2B4CC 2HMID 4I2XB 2E7LC 5SX4I 3L6FB 5A16A 4IM8A 2XRAH 3VRLE 4U2YA 2EC9U 2YKLH 5DD0L 3I75A 2Z92B 4EIZC 1YJDL 4BQBA 2KQNA 3OJDB 4KVCL 4LVOC 4M93C 1ZV5A 1NBZA 3HRPA 3QO0A 3LEYH 1ONQB 4MJID 1NCTA 5DUPH 2GFBB 3T4AA 5H0IA 1FSKB 1RUQH 3FB6A 1I1AB 2E9BA 5LQBL 1D6EA 1BM3H 3H13A 4PGCB 3V6OC 1PKQE 4OT1H 1NMBH 1LNUA 1MCPH 5KSVB 1U3HB 3WS3B 1TLKA 1VACA 4NO2B 1IGFL 1A6UL 1S9YB 4RMRA 2V7HB 3HRZA 4EUPH 5F9WC 5JLZB 2HWZL 1NGXB 1OPGL 1EJOL 3LSOA 1Q1JL 2M26A 1S7UA 3DURA 5HDOA 2H8PA 5DR5L 1KTDA 3G9AB 2X4TA 2ZCLH 5AUMA 4Q58C 4UB0H 1N6QL 5I16B 3U2SA 1U8LA 1ZGLM 3GI9L 1OAYH 5GRWA 4FRWA 3L3OA 2FLBT 4N0UA 1UACL 2V5SA 4MXQD 3T1WA 2DF3A 1ONQA 1OTSD 2C26A 1LO4H 2P7TA 3NCEB 3H9SA 2N7BA 1DUZA 2VDRL 5TDNB 2BXYA 3FRUB 5F9OL 3U6RA 2FH6A 2AEPH 3EGSB 1KTRL 3I9GL 1XIWD 1TCRA 4V1DB 2ZOKB 3QAZB 1X5AA 3WHE0 1SHLA 2Y6SC 2VITB 4RMTA 1OGAB 3K80A 2YPLD 3BDYH 1T80A 3RNKB 4PGCA 3W2DL 3QXWA 4RNRB 3OZ9H 1KCRH 4GQPH 2J8UF 1NCDL 2VABA 3QCVH 3GHEL 4G6FD 5LQBH 1SBBA 1E4JA 2DAVA 4EDWL 3MUZ1 3KPPA 1MHCA 4JHWH 5CLTA 1PSKH 4XI5C 4NZRH 3IJHA 2J8UA 3BKML 1A64A 4C56B 1RVFL 1VENA 4G7VH 3Q5OA 5TGBA 4U6TA 5LBSH 3J8F7 1RZKL 1KIQB 1OSPH 5I1DA 4FFWC 1NW9B 3MREA 1I3GL 1EEZA 4O51A 1FN4A 1A7RH 2F19L 2HH0L 1IZJA 1MIEH 1QP1A 4J6RH 1IEBB 4K55A 5JPNA 3E8UH 4J7RA 3BXNB 3TBVB 2VXSH 3MLXH 4N8VB 3WD5H 4UV4L 1DFBH 5K93A 2GHWB 1Q9WB 1LE5B 5I1JH 5I75B 4Y16B 5C0CB 5IFJB 3N9GH 1GGBH 5IG7B 2JCCE 4RA0C 1GQFA 3V4OA 1F2QA 1QBML 4Q6YA 2YR3A 5IW6B 1BECA 4IRJD 5SWSD 2PXYA 3D3VE 4UAOC 3F65A 3MROB 5J4MA 1CDIA 4L5FL 2A38A 2K9UA 2DQFA 3NFNB 3MNVB 5F3HB 3HE6B 2WQRA 4C56D 3RA7H 5BCAA 5E9DB 3MRJA 4RGNE 4BZ1L 4Y4FA 5CBAA 1HK6A 3RPIB 4KGJA 3PJSB 1EJOH 2X4RB 4JFHD 2F8OA 4MLSA 4ZFGH 3BJ91 4ERSL 3LZFL 5DJAB 1HH9B 1NMCB 4G6FB 2W0FB 1UZ6E 4XP9L 4XXDB 1ODAA 2CIKA 2IWGA 2FL5A 1C5BH 2A1WL 4KK6D 2VXTL 4MS8C 3IDGB 5DI8B 3CLFL 3QDJA 3FOLB 5J06A 4FS0A 4PJBA 3QHFL 3UO1H 5CIPB 2EIBA 2B1AH 4JREB 4FOMA 1NMAL 5K9OB 4U1HA 5E2TL 3GSWA 5K9JH 2AJYH 4XC3H 1HNGA 3ROOB 2QHRH 2FX8L 3QUXD 4JO3H 3G6DL 1MAKA 1HYRC 4YHPB 3WFCH 4ODHH 2IBBA 3O3BB 4FMKA 4KQ4H 1T5WA 4NC1C 3QWRD 4WCYH 3ARGD 2CO7B 1CGSL 2XG5A 2XTJB 4WWKC 3TJHC 2AK4D 2P5EE 2W65A 3EJYC 2JCCF 1VFOA 4F7EB 5IASA 1KUMA 3MV11 5E8OB 2BC4A 5DURB 1KTDB 4WI6A 5EO9B 5I1AB 4UBDC 4X4ME 1VESA 1SEBB 2YMXH 3G04A 1WC7A 5TQ2H 3WUWB 2DQHH 2QQNH 4L8BA 1ED3B 1OWWA 1UWEL 2X4PB 5GGTA 3V5KA 4HWBL 4YDIL 4OLEA 4JZJB 2V5RA 5DWUH 1DTUA 1NBQA 1TQBB 1QLEL 2RQ8A 4NNPL 1NFKA 1TXKA 2IF7A 2P8LB 3QJHB 1FG2A 2ZJSH 4XMLH 1P7QA 1J12A 2L7UA 3LIZH 4NYLB 3S34L 1DQQB 3DROB 5D70H 3AS0A 3MO1A 4XNMA 4NO5B 4LOUC 5I1CL 2V7NB 4PJ7B 3PDOB 1OARL 3UDWA 4LEXL 3OSKA 4K7FA 3MRJB 2X70A 4MAYA 3KYKL 3BIAX 4PJXB 2BJMH 4MS8D 3SOBH 2UZIH 3B9VA 2HWZH 3V6ZB 5BW7C 3WEXA 1KCSL 2HKFH 2DM4A 4HGKC 2JKXA 5TQ0H 1BBJA 4U1NB 4WVRA 2B8OT 3TYFB 4U4BA 4F2MB 4PJDE 5DSCB 5EZIH 3K8LA 5DHYB 4JPVH 4KUCD 3BP7A 1LDSA 2MPAL 3I6KA 3ES6B 3A6BL 4PYHA 2EIEA 5KSAC 5DHVB 5DGRA 4DZBA 4KFZC 1LE9A 4ZYKA 5KSUA 3E2HB 3HE7B 4DAGL 4QCIB 3V55A 2BY0A 1X3DA 2GSGB 3A6CH 3JWDL 5ANME 3TCXA 3V2AR 1I8KB 1T5XB 1IFHL 4QHLA 4Z7UB 5E8DL 2DBLH 1ETZA 2GSIA 4UU9A 4G43B 4DKFH 2DDQH 5BV7H 1KB5H 3MNWA 4XVUD 1MREL 3FQWA 2IPUK 1R24B 4NUJA 3CZFB 1N6UA 5GGVL 3QEQA 3QIBD 2HRPL 1A6VL 4QT5A 1T03L 1MJ7H 1N2RB 3LHPH 1Z9LA 5C2BH 1IGJB 5GGQL 1TTGA 2BMKA 5INDA 1QBLH 1EA9C 1ZVSB 4MNQB 2X4UA 4MHHI 2I9LB 4JVPA 3DEIA 5EUOF 1Q9LA 1JF6A 5I76A 3VFGL 3G6JB 2CJXA 4F7MB 1A1NA 5ILTL 3K4DA 1UXWB 2XWBA 1RIVL 4MQSB 2OX5A 3RHWF 3VE0A 5ADPL 4JY5L 5JIKA 4WU5B 1XFPA 4FQXD 4P59L 4UUJA 1G9MC 5IUSA 3QWOB 1FFRA 3EFFB 3D9AL 4QRRE 4DW2H 1NGPL 4GSDL 2AXGB 1EGJA 4PS4H 3PP4L 1WK0A 2B0SH 1GL4B 1I9IH 2R0ZL 3ETBF 2MPAH 1LQSR 3F6IA 4GQ9L 4POUB 4W4OA 5HHME 4NYLA 1P7QB 4LPCA 2ZNWA 3GSXB 2FX9H 1GIGH 1MCDA 4HKZA 3JWNC 5GPRA 5GRJL 4UU9B 4EZMA 1A3RH 3F12B 5HYJD 3T3PE 1RY7B 2IQ9L 5FAAA 1NMEA 1YN6B 4Y89A 5DJZB 3V8OA 1YDPB 5H35A 1QFOA 2XY2A 1LD9A 1C5DA 2XTLA 4S1QL 3X14B 4L4VA 4EUPB 4WFHE 4L3EE 4AK1A 3S35H 4JEGB 2RGSA 3ARFA 1KV3A 4BZ1H 3PE9A 3FZUD 1HHIB 4PLKD 1R3HB 2ENSA 2I9LA 1I9RH 5I9QC 4F2MA 4R4BA 4D3CL 1U3HD 2W9LA 4GT7A 5DK2B 2D03L 2HKFL 4X4XA 3DV6A 2JK5B 4YDLB 3DECA 5EO0B 2AKRA 1NC4B 1W72H 4HKXA 1FZMB 3QEHA 4G7YL 1BOGA 2A73A 5D2LB 1IBGL 2X70B 4OAWA 1MCRA 5F9AC 3LB6C 1P5UA 5C2UB 3VDCA 4MA7L 1XGPB 2OR7A 5I0ZA 5TE6L 2AJVH 2GI7A 5HDQH 3VH8B 4F15C 5JPMB 4N7MA 5JNYA 4K7PY 1X5JA 2WUCL 5IFAH 1DE4A 4EKXA 1FBIH 5F9JB 1V3MA 4OM1H 4PGEA 3O6MH 4O58H 3SDAA 3FQTB 5TQ2L 4HQRA 4OCXL 3AY4A 2E3VA 1IEAB 1TQBC 3DVNA 3HAEG 3BEWB 2NY2B 3TA3D 2EE3A 3NOIA 4NKIH 2Z35B 1CG9A 1CDCA 1RV6X 4QLRA 4ERSH 1MCJA 4ELMA 3D39E 2ZSVA 3GGWA 1E28B 1T7YA 5L2KE 4J6RL 1SVZA 1NCWH 5DFWH 3O41B 3VXMD 5CLWA 1JPTH 5DJAA 1QFWL 4GRLD 5CZVL 3K7EA 3S8EA 1AD0B 1I7UB 3P4OA 5DZLA 1AGEA 3I50L 3KWWA 1B4JL 3NCYS 2DQFB 3NFNA 2DLIA 4S1RL 1FFOA 3R6LA 5I73C 3QQNA 4XTRD 4WFGE 4EI6A 4BZ2L 5GGSB 3TN0A 43C9A 5F7EL 3QDMA 4KQ3L 3KPSD 4WWID 2Y5EA 3P4NA 3WJJA 1T4KB 4XPHL 2OTUB 2FL5B 2HVJA 3T8XA 1FYTE 4X83A 1IGMH 5C0BE 3DNKA 1I3VA 1I3RA 5DO2C 2IBZY 1NEZG 1EV2E 1NGQH 4UI2A 5EOTB 4AL8H 3O3AA 4PJDB 3UBXG 3S37X 1H3UA 4Z0BH 2XYCA 1ZA3A 4ZMAT 1Q8MA 4MNQD 2NPLX 4LCYA 5EOTA 3TO4C 4OD1L 3T0EE 4DVRL 3FQUB 4P5TD 5ID1B 4NKDB 1GC1L 3SGJA 3VGDA 2YSSB 3Q6FB 3SDDD 1VGKA 4PJAF 3JUYA 4LSQL 3EO9L 4MCYB 4WFGD 2R1XA 5E08L 1MHHB 4YFLF 5E2JA 2P24A 3U82B 3SDDC 4UIMB 4UV4H 5FB8B 5D1ZA 4X6DA 3WFDL 4U1GC 1S7QB 3BKCL 1XAUA 3KWWB 1YY8B 4QHNA 5IESH 2BSTB 1FL6A 2FX7H 1W8NA 3ARDC 4Q2ZB 3UTSB 3KPRB 4MCZA 1LVEA 3WIIL 3E6HB 1VHPA 3GJFB 2OL3H 1ZLWK 1D5IL 1RI8A 5LU8A 4MCZB 43CAB 3PDGA 3AROA 4ONFL 1L7IL 4ELMB 2QV2A 4PJIA 4LDEB 1ZMYA 2EZ0D 4WV1B 3TJEH 4R7NB 4JKLA 5BS0D 4NQXB 3RWHA 2NNAA 1ERNA 3LSOB 5DTFB 4Q6IA 2NW2A 3C8KB 5I8CA 4DKFL 1MVUB 1BREA 4HS8H 2EO9A 3QFDA 1JGDA 4PJEA 1CXHA 4R97C 3WNKA 1RURH 4JDVB 2AQ2A 2NY6D 4YE4L 3EFDH 2WLZA 1WIPA 2FDBP 5L9DL 1S9YA 3EDEA 4PRBA 1B9ZA 3K7UA 4LRNH 1CTNA 4MD0A 1LNUB 5KSVA 2HFFB 3RUGF 1ZWIA 3FT3A 1A5FH 1ZHNA 4JPVL 3X11B 5C0RL 1M4KA 3KPMA 4OFPA 2GJZB 5DHXB 1FIEA 1CD1A 1KJ2A 4CDHA 4FXOA 5I16A 2YD8A 1PG7W 4M43H 2UZIL 4JFZH 1I9EA 4U1JA 3RNKA 3B9KA 3IRPX 4AEFA 1FHGA 1J05B 1D5MB 1Y6KR 1DEEB 4PJ5A 1OAUL 4YC2C 4DK6A 1ROWA 4P5KA 1OP5H 2OMNA 5DUML 1A02N 1KIPB 1Q9OB 3O6KL 4PUBH 5DJXB 4P3WA 3RWEB 1DBKL 1A7BA 2R1WA 3T0VA 1VDGA 2LAAA 4PJIB 1SBSL 2NY0B 5MEQB 3QWQB 3K2MC 3PG2A 4KXZI 2DKUA 3JWOH 1L6XA 2DTML 3BKMH 4MAUH 3V4VL 5AZ2H 4IDLA 5D7SH 2IPKA 1U8QA 3LQAH 3RNQB 5E1AB 3T65B 4YPGB 1BLNB 4FXGA 2DWEA 4J3TA 3VFWB 3GO1L 5E2UH 4C56E 5IIEB 5BQ7A 1NDMA 2C3VA 3WFCL 4ONGH 2R4RH 5JQ6H 4GUPA 2EE9A 4LVHB 4X7EC 2FO4B 2P24B 4L4VE 2BVQA 2XQYG 4PR5A 4Y8AA 5HXMA 32C2B 5DS8B 4JE4B 3ORJA 4UIKH 5CZVH 1XF2A 3RJMA 3FB8B 1Y18A 4HMDA 4ODUA 15C8L 5IHZA 4XC1H 2ZCKH 3CX5J 4JPKL 4RGOH 3MLWL 3TNNA 5DT1L 2PO6D 1P9MA 4KMLB 1BEYL 4Y2DD 3SDDA 1JBJA 3M1BB 1MJUH 4V1DE 5HYSA 3VH8A 2CXKA 4GXUN 4PJ9D 3HR6A 1ORSA 3GSUA 1XH3B 1FG9C 4X4XB 2BNRE 4OD2B 4JRYD 1TQCC 4NBXB 4L9DA 1BJMA 4JFFD 2FJGA 5AYUH 5GXBB 3PWNB 4OQ1A 2Q86B 1RZKH 3WUWG 1K8IA 3VMPA 2LFGA 4HXAH 3QUZD 3TFKC 3HMWH 1TZIB 4TSBL 4RMWA 1FYTB 3CK0H 3O45B 3MLPA 1UJTA 1AXSB 4R26H 3DARA 1SBSH 4NO3B 3OKOA 3SBWA 2UVFA 1A6ZB 1YMMB 2X4NA 4P5TB 5CD3A 4ZOAA 2H3NA 4NHCH 5I1JL 1MFNA 1KELL 4JR9L 4HIJB 3DPBA 3TH2T 4WNQB 4AIXA 4BQ9A 1T83C 3UTTD 1J87A 5MP6H 1RU9H 3IU4H 3TLRA 3AAZB 5F96L 5FYLL 1QG3A 5IVXA 2FIKB 5F88B 1JPGA 2APTA 4QHUA 1RJZA 5HBBA 4AW9A 4X6FB 2A6DA 3ARDB 1DQML 5LXGL 3EYQD 1I3OA 1KTLA 4RQQA 4CU6A 1S7WB 4LPVA 3LMJH 4QUHA 3QNZB 2UVEA 2F74B 1N64L 1I1YB 1JGEA 4TTGA 1I7RA 1ND0A 3LKOB 2JJVA 1YN7A 5BV7L 4MXQC 4OZHE 4KI5D 2VKXA 2YS4A 1J8HE 4CU8A 4FP8L 5HJ3A 4KTEL 2OL3L 3LHPL 4Z0BL 5GGTH 3B5TA 1XGUB 1J86A 4JRYA 3ZL4H 4ENEC 4IRJB 1F9EA 4L8SC 3EFDL 1DUYA 1MEXL 4I8DA 3F5WA 3HNVH 1MHPH 2DN7A 4HIHB 3CDYA 1J11A 3G6AB 3B4NA 4KKAD 3W5MA 1Q0XL 4MD5B 1N8ZA 2HRLA 2P47B 5E8EB 4YHPA 3L3HB 5JA9A 3U36A 4DVBA 4LCWD 5IV2B 1INDH 1VFAA 3O2WH 4KK6C 4XI5D 5C8JA 3OXRA 4NJAH 1LEKB 1WCBA 5DEGA 4OFVA 5D1XD 4Z7UA 2HBQA 5IMKB 1YYML 4R4NC 1G6RB 1G9NL 4RIRA 1MJ7L 4YR6B 5F3BA 5CP3H 2IAMC 2XNAA 3O3EB 2F74A 1MY5A 1CDBA 5HGHB 3BP7B 3X13A 4LP4A 4NKIL 4XXDA 2AS5M 3GJFH 2HJKB 1VA9A 3BSZL 5DJZA 3S34H 2V5MA 5IBLD 4MMXC 1IKFH 3IDIB 5EC2B 5F88A 5EU6D 5KOVC 4P3CL 2IC2A 3D1MC 3DI3B 3TIEA 1DQQA 2PXYD 2K3TA 3DROA 4RWYL 4J4PC 4HIEB 1EHLH 3D6FA 3QUKA 4M00A 3DMMB 3QXDA 1BJ8A 4JFDE 4K7FB 4UUJB 3EO0B 4HWBA 1KCVH 1KIUA 2ZCHH 4UBDD 1ZANL 4XX1E 4W6WB 3MODH 4ZNCD 4FNLL 1GZPB 1OTUC 3MXWL 4KI5E 3O6FC 3RU8L 1CIUA 5HYJB 4KU1A 3VFNA 5T1LB 4LSQH 2DQUH 2XWBB 2R4RL 2HLAA 4NQSA 1IM9A 2BHZA 4G3YH 3T1FA 2ARJB 1RHJA 2CH8A 5TH2B 3OTTA 2YXFA 4OIBA 3O4LE 4NM4L 5F3BB 4ISVA 4X8JA 1J1XH 2FJGB 4AWBA 1UXWA 3C6LD 3CFIC 4MQXD 4YHLL 3RRQA 2WP3O 4PJBF 3QO1B 3RVUC 1TJHH 1CE6B 3GKWH 3IJHB 3MLSL 3S88H 3QQ9C 2NY5C 4OF5A 1IAKB 1LO2L 1J1PL 5DD5H 3H7BB 4OB5L 4KVNH 5HI5D 2X4QA 3MLTA 2IQAA 2W59A 3IFPB 4PB0L 1FCGA 1VGEH 3KPSB 1YNLL 3K1DA 2CQVA 3HPJB 4TRPH 4U6XB 2O5XH 1ZGLA 1KCSH 1RWOA 1KB5B 4NZUL 3I6LE 4I1NB 1RHHA 1X6NA 1EIBA 4LSTL 4H5SB 4MB3A 3RL2A 5CBEB 1F11B 3BIJA 1RUPL 2F53D 4Z7UE 2F54B 4PJHF 2NY3C 3TJHD 3MV9A 1IBGH 3IDMB 4JO4L 1EEQA 1PJ9A 3S37L 1IBCA 3ESVF 5IT2H 3TVMB 2LTQB 3ROLA 1F2XK 5K9KA 1CYGA 1HXYA 2X4RA 4LSUL 4I18A 3EGSA 3JVGA 4UT9H 5J13C 1CGYA 3WS6A 4HK3J 2ICCA 3FO0H 5EN2B 1BHGA 2VDOH 2MKWA 4F58L 2AR9A 5I74C 5EB9A 2Q7NA 4JQZA 3MGAA 4XMPH 3WNMA 2DKOA 3GSVB 1CXEA 3VXMB 1XF4B 3GKZA 2XZDA 2BVPB 2NY2D 2PKDA 3O6FD 1UQSA 3MBEB 4KXZH 5I1GL 1HN1A 2QKIB 3O8XA 4EDXB 2JCCA 4TUKL 3EKCA 1KIPA 5EA0H 1F4HA 3RY6A 3QUYA 1E4KA 1T66C 3N1FC 1JN6A 3VXQA 4PTUA 1MFEH 4HDIB 4WFED 3FB7B 3IB4A 4FQIL 1ES0A 1ULVA 2E9WA 4HS6B 5IGXL 1HHGA 5HPMA 1EERB 3T77B 3EAKA 4NO0B 5E2TH 1BQLL 1HYSC 5D2NA 5IFHH 1NCBL 5I71C 3KPMB 5FDYA 4FXKB 1JF5A 3PV7A 2LAGB 2PW2A 2W0LA 3R8QA 2VXQH 2XV6B 2H4YA 1MCOH 5FKAB 2MCG1 2AQ3A 5ISZA 5J6HA 4NP4L 4ZVUA 3QWRA 1QHOA 1UACH 1OCWH 4AEIH 4WHYG 2APBA 4XVUC 2AJXH 3WBDA 3BE1H 3UPAA 4JFDD 1JNJA 5LUBA 3MV7A 3LCYA 4S1DD 4GOSA 3SGJC 5FCUL 3HZYB 4WWKD 3GBMH 5CZXD 2EDFA 4HS8L 1E6JL 3REWB 3OB0H 3D18B 4OLZH 2DQJL 3G5VB 3SKJH 1U8JA 3H9ZA 4K3DH 4K9EC 5EU6E 2H9GA 3MRCA 5TPWH 2G60H 1IGCH 1BVLA 1G9NH 1HSAA 3GUTB 1KLGB 1WTGT 3L3KB 3ARGB 3EOTL 4YBQD 3ARBA 4MWFB 1HQ4A 5KS9A 5E6ZA 3MRCB 2EEBA 4ODBD 1PKQA 5DJ6A 3QCTL 4MNHA 4LSVL 1S7SB 5DMKA 1EHNA 3VFUA 4JB9H 1KXTB 2YC1A 5CJQL 4OGXL 1UGNA 3LB6D 5LCVH 1CXIA 2QSCH 3RDTA 4XT1C 3H9SB 2HN7B 4NQEA 1REIA 3QDGE 2Q20A 3C60B 1IRAY 1FJ1A 3MLVL 3PP3K 5IESL 3P30H 2MQ3A 2VC2H 3FT2A 1BGXL 3O6LH 1ZHLB 4OGYH 3SDAD 1ADQL 5EIIA 1FZOA 3UTTB 2HAZA 3ULSB 3DBXA 4NOKA 4Y16A 5IFJA 1MCPL 3LVEA 2CRMA 3ZT6A 4ZUUB 2BSSB 5DRXB 2CXGA 1JI1A 2CLZA 1B2WH 4DWHA 1U36A 3LKNB 3ULVE 1HSBB 4EI6B 4W81A 3WFDH 4K3EH 5TJWK 4EHLA 4R7DB 1NMSA 4AIOA 5C08E 1BQSA 2NY4B 1FFNB 2XI9A 3U9UB 3QUXB 5D8JH 5KSAD 4Y16C 3IJYB 4C56A 1QFWH 3LH2H 2DDQL 4GAYA 2R4SL 1S7TA 4RAUB 5F7MC 1EO8L 1I1CA 4Y16D 4M9RA 3T2OA 2Q76B 3ZE1E 3QIUD 5DVNA 3CVIH 1XIWC 5JHDE 4L4VD 4ZSOA 3V6MA 2Y1LA 5D1QC 4I2XA 4LCWA 3JTTB 2DLGA 5DD3H 1SEQH 3RI5K 3FT4B 3FFDA 2X09A 3BFOA 3TPKA 4RISH 2J8UE 2GCYA 1U8HB 3VCLB 4OCMC 1U8JB 4V1DA 3EDQA 3EDKA 2ZUYA 4QKXB 1WIOA 2DJ4A 2HTLD 5CS7A 3VXUD 2KH2B 4OLYH 3HMXL 3MRDB 1VGEL 2C4FT 4ETQB 1MUJB 4LSUH 4LP5A 3T0EB 2OZ4A 2CD0A 2YA2A 1QBMH 4M3JA 1EK3A 4FP8H 3UJIH 3WUZA 5F7UA 5L6YH 1JK8B 1I85C 4NNXA 1MJJB 4NJ9L 2R2HA 1RUAL 3HLAB 4M48H 4U0RB 2FR4B 4X7CC 3TVMC 4Y4KA 3PWPA 1OSPL 5IOPB 4ZS6C 2JF1A 5E8PA 3QUML 5HYEA 1KEMH 3MOBH 4XMKL 2G5BB 1A0QH 5D6CB 2ZUTA 1DN2A 3KJFA 3L3GA 4WHYH 2DTMH 1LO2H 2O61B 2KZWA 3AREC 4TTDC 5H35B 1MF2L 5ALCH 1SM3H 5HDBF 2MCPH 5GGUB 3MRRA 4RGNB 3QH3B 2FZ3B 2CKNA 3FQXB 1YNKH 4HH8A 4JLRB 1A14L 3OF6A 2XRAL 5AAMA 3KHQA 1XCQA 3V0WL 1Z6JT 4PGDA 3IRZA 3DEHA 4HKXB 1WFOA 3Q6GL 5LGKA 4GW4A 2H5IA 2YD7A 3EO0A 5DVKA 3BZ4A 4JKKA 1QD0A 3GSNH 3GSNA 4D9RE 5ISZE 3OBAA 3OJMB 5J11B 4HJGA 3MACH 3DIFB 5ALBH 3DHMA 3UC0H 3E0GA 1DBML 1U8MA 3JSSA 3H6JA 2PN5A 3OJDA 1C5BL 2A1WH 2Z4QB 3IXTA 1UT9A 4KKBC 2EDXA 4YK4B 5FKPB 4IMLA 3FO2A 3BN3B 1EZVX 4WEMB 2ADIA 4NQCB 3EYOB 3IGAA 3CDGA 3QPXH 4H20L 5ANMB 3BVNA 3IF1B 3UBXB 1E4WH 4NT6B 1FNGB 4I5BB 1N5AA 1GZPA 1NPUA 3IFPA 2HYMA 1JNHB 4XP6L 3VI3F 5ACZB 1U93A 1A2YB 3NA9L 1MAMH 1RUML 3T4YB 3O81A 1XGYL 4IS6B 1LO5A 2ITCB 4JAMA 2HP4A 2P49B 4QUJA 1M7DA 2VDLH 5BOPA 4HD9A 1GGCH 4GW4B 3CFKB 5F89B 5I30H 3PDOA 1JHKH 3BKYL 3EOTH 4XWGH 1RZJL 2E6QA 3OF6D 2AXJA 1NC2A 4RFOL 4PGDB 5GGUA 1CT8A 3I6GA 2OR9L 3D0VB 4X9HA 3ABZA 4Z7UF 2WK2A 1F02I 1YEEH 2X1QA 3L3GB 5EZIL 5A40E 1INEH 2IH1B 5D72H 5IB1B 5BQ7B 3DO7A 1XMWA 1I3UA 3HI6H 1LEIB 3V6OA 5E8PB 1H3GA 1AY1L 5DK3A 1DQLL 5KSAB 1NL0L 2ZKHL 1MNUH 1I85A 4QHMA 3QQ3A 3DO7B 5D2NE 4CBPA 2KL6A 4PJ7F 5E94B 1LEKA 4FQQA 2BOCA 4LSRL 1GFWA 1MRDH 1XZ0B 2EE2A 3NIGF 5KVFL 3I6LD 1KB5L 1I7RB 4PJ5D 4OZFB 1BQHB 1IM3B 4P2OA 4PJ7A 1KPRA 3NCJH 2ICES 4AL8L 4N9GA 2XICA 4HUWB 3NAAH 4Q9BA 1SHMA 1LO5B 2ITCA 4JAMB 3PWVB 5TE4L 3RIAF 4WY7L 3O6FB 4DKEL 5C07A 3ROOA 2V2XB 3GSRB 3R0MA 5CEZL 1SVCP 1XIWB 2VAAB 4V1DD 3CSYA 2CMRH 1PY4A 3SCMC 4PJ8A 5CCKH 1G6RA 3L5WA 3RWCA 1WVZA 1MCQA 5LGJA 4OLUL 2NY1B 4GXUM 3DIFA 3CC5B 4QF1B 4HC1H 4FDLA 2IAMA 1KELH 3KYMB 4X9GA 5KZCD 4JPKH 5EIVA 2QLJA 2IMMA 2UWEE 3X3FL 5FKPA 4NCC2 3ZTJG 4X5LA 3IXTB 2A74B 2MTPA 1JF1B 4K7PH 3CIQA 4JRXA 4LASH 5HDLA 4ZO6A 2BSRA 2VDNL 4XMPL 5CHNB 3UZQA 1B6DA 4WIQA 3L3HA 4QULA 3BP5A 1QSED 2Y36L 5MHSD 1UCBL 1F3DH 5F9WB 1JGUL 1UKQA 1DQTA 3RWJA 4NQED 4WWKB 5C3LD 3ZSSA 3OKLA 1JYVA 5CKAA 3RTQC 4MSWA 4ZQKB 3CSGA 2HT2C 4XCYB 2NZIA 4OKVA 1CBVH 4PB9L 3LS5L 5GRYA 1F6AA 2MSPA 2FGWL 2NCMA 1P4LB 3JWDC 5IB1A 3VWKB 1FGNL 4QRRB 3UJIL 2ZP0T 1N6VA 3NZHH 3GJEB 2CIKB 3P0YL 4N6OA 1UWEH 4UTBL 3I6GB 4TRPL 1G7QB 2Q3AA 1IGYB 3G5XB 3NGBB 3RBSA 1AO7D 3INUH 2I5YL 1FJ1B 3FO0L 5I8OL 3WV0A 5JW3L 4JO1H 1JZ8A 5JUEL 2GTWA 4AEHL 4XMKH 2RIKA 4K94H 1KN4L 5T3ZH 1A7NH 4QXTA 1T0MA 5CJ8A 4ZTOH 1LDPH 1EFQA 1NC4D 1TZGH 5I1IH 4IIQC 4Q2ZA 1IGJA 3UO1L 4KMQA 1FL5A 5C0AA 2BY2A 4QGYA 4JJEA 3PIQA 4D9QD 1B0RB 2DS4A 5D5MB 3KPPB 3VFTA 4KKCC 1KBGL 3R1GL 4ZUVB 1VPOL 1YNTA 5F1NA 4XXCA 3ARBB 4MWFA 4N8PA 4HWZA 4F8TA 1TNMA 5IROA 2Z4QA 1UWXH 4U3XA 1WT5A 5A2LH 3F8UB 3O6KH 3BQUB 4NBNA 2EYSB 3BZFA 3G6JF 4LVNB 3VFMA 3VXTB 3VXRB 4HVAA 1CFVH 1MLCA 1VB9A 3B8YA 1LK2A 4D9RD 2C2KA 2HFGL 3UTPE 1Z5LA 5I8EA 5T3XE 4I77L 2EICA 2VZTA 3ARXA 2CKBA 3VGAB 2J8HA 1DR9A 4ZSOB 4NOLA 3TNMB 1K3ZA 3ZKXB 4X6DE 5A2JH 3BQUC 5DYOB 1JWMB 5FHAH 1A4KB 1I8LC 3QI9C 1NGWB 5JHDB 2AXFA 2VSDA 3KLAA 4K3JL 4HX1A 3BEVA 2VIRB 3QULA 5IK3A 3B8SA 4L8DB 1IAIH 1RULL 2HVKB 1BIIB 2GTZA 1QYGH 1BOYA 3PP4H 2Z9TA 4Z95L 3LQZB 5F6HI 3QXAB 3MRHB 1NEUA 4NKOA 2C9AA 4P23B 4K3EL 5I8KL 2O5ZH 3D69B 5I1EL 4YPGA 5JA8B 1SEBA 4UINH 4WEBH 2E27L 1P7QD 2C4XA 3P73B 5FECA 4LNVA 1FLTX 3TCLB 2X44D 5BJTA 1RK0B 3K0WA 4Y4KB 2B0SL 3RAJL 1MHEB 3ESUF 1CTOA 3SE9H 3STZB 4AM0A 2CJYA 2X05A 1ZLVH 1PKQB 5CWSA 2XKNA 3MODL 2AAVA 4QRPE 4ETQA 2HT4C 4Q6IC 2VLKA 5GISL 1MIEL 3DX8A 5E6YA 1EFXB 5C0BB 3VG9B 1FVEA 4OLVL 5GJTL 4M8QA 3DETD 5CBEA 1JL8A 3C6LC 5K59E 3UPCA 4JR9H 3RJQB 3ARGA 1JRHI 1U3HA 1LO4L 3BKCH 5F7WC 1IFHH 3OHXB 2QSQA 3PUCA 4ZUVA 1GJIA 3R7BA 3BIBX 1S9VB 3KPSE 4O02L 3UEZA 4I2XE 2VDOL 2DQCL 1WZ1H 4HUUA 3ULVH 5EBLA 1UWXK 4PRIE 3MNZA 2FO1A 5FGCE 1L0QA 1IAIM 4G80B 3MGOB 5M95B 4Z7WE 3IYLW 3A6BH 1D9KC 2R1YA 5GGRB 5IABA 3OPZH 5AEAA 3MR9B 1QNZL 4ZPVA 4KHTH 2FX9L 3U9UA 4QY8B 1GC1H 1T7WA 4WI7A 4XPHH 3FFCD 4QTIH 2ZCLL 3RGVD 2PXYB 4W68A 1LMKA 4UNTA 4X5WA 5ERWA 5KVDH 4JDVA 5BZDB 1GZQA 1JPTL 4HGWB 5KVEL 2P5ED 1CCZA 4AENA 4U6HA 4GG8B 4ZPTA 2QADC 2NXZC 3K1KC 4KI5F 3C8KA 5I8CB 5IF0B 3RX8A 3ULVC 1VFBA 4MB5A 1P4LA 3VWKA 2ICWJ 5HHNA 1B4RA 4IJ3C 5DJ0B 2Q8BH 2EEDA 3GSXA 5FA3B 2G75A 5I19H 3QULB 3GZKA 1BBDH 5DMJB 2GY7B 5J12B 5BXFA 4LLDB 1RHMA 5HHPB 4P4RA 1X5XA 4F9PC 5EBGA 3X12A 4G8EA 3SDXA 1GC1C 3V6FA 3KLHD 1TJIL 5F1IA 1MCHA 2ID5A 1VKXA 2IFFH 3TNMA 1U3YA 3QRGH 1VADA 3ZDZF 1XGTB 4NWTL 4PJHA 5DDHB 3G5YA 3S97C 3E1F1 2HJKA 5IBPA 2R56H 4ZOBA 2DICA 3H2WA 1HSAB 1CD8A 1VEMA 2HLFD 3FB5B 4RSVA 3RWGB 2J4WL 5GIRA 1P5VA 1M6OA 2AW2A 3BUYA 2QQNL 3LEXB 3TZVA 2BCKB 2IGFH 5D72L 3T0DA 1YNKL 4Y4HA 5FDWA 2XACC 3ELAT 4KV5E 5DRZA 4DN3H 2WBJA 1BVKB 2YD6A 3DOSA 1XR9A 4WWKA 5DT1H 3SPVA 5FYLE 5E0QA 5DJCB 4HXBH 4UV7L 1QHPA 3EBAA 3JV4A 4K23H 5BS0E 5IFAL 4QRUB 1RHHB 1W0WA 1IVLA 2FGWH 1IGTB 4AYFA 5E2WH 2XZZA 1IKNC 3IFOB 2YPLA 4BK4A 2AXHA 2VTFA 3TBWB 4OAWB 5SWQB 4XNQA 3OX8A 3RZCD 1J18A 2NX5D 3PGFL 3INUL 5ID0B 1DBJL 5IJKA 1CICD 5I74B 3EJJX 5IVXE 1QTYT 1DN0B 4PJ8D 3RZCC 1FQ9C 4LAJH 3L5JA 4ZAKD 1FC2D 2HTKC 1U8NB 5L2JA 4QRQB 1RUAH 3ZKQD 2YZ1A 2BVOB 4I3RL 1NMCC 4M1CC 5D9SB 5I6XB 4CGTA 4N6GA 3V6ZA 4H1LG 3BJLA 5F21B 1I8MB 2OXHA 4ETYA 1CL7H 4NKQB 2QKIA 4DKDC 2GJJA 2XYPA 4FZ8H 2DQEL 5BZWB 2YMXL 3KPNB 1ZT4A 4G80A 3T0ED 1D6EB 3SDAC 3RWJB 1FIGL 2VUOA 5EZOH 3MZGB 5CKGA 4Y5VB 4YXLH 3W0WE 1FVCA 3FMGL 1K4DB 2YD3A 3VXUE 2C3WA 2GK0B 4LLWB 3TT3L 3RVXD 2BY1A 3VGEA 4DGIH 2PTUA 5J6GB 2WANA 5E2UL 4DFIA 2XT1B 5LGJB 4UNVA 1NGPH 3ZZ1A 3GJTA 4EN3A 5B39B 1CLCA 4WW1B 5INCA 1HZHH 4U1SA 3GSOA 3HNTL 1N59A 1GYAA 1LWRA 4ZVQA 4DGYH 5JDJA 4ZDHB 2KKQA 2DD8L 4LLUB 3JWOL 1QSFB 4HJJH 1CZ8L 4FQJH 1NFDA 4U3CA 5CZXC 3IFLH 1DJSA 4OUUA 4C55A 3KJQA 2W60A 3RZCB 1NCAL 3DUSB 1F8TL 1XH3A 3ZKND 1S9WA 1EXUB 1ZE3C 3C09C 3PWNA 3NMEA 1I7TA 1KGCD 5GJTH 1NEZA 2V2TA 4HIHA 5BMFL 1OP3H 5H8DA 2DLTA 1EEYB 2CNOA 4NRZB 2ORBL 2AK1H 1QLFA 2E9IA 4PJ8C 1N5AB 2PETA 4LLMA 1NEZB 1X4ZA 2OL3B 1MRCH 3JTSA 1N64H 4UOW0 5BRZD 4P23A 3KAAA 3FOLA 3B6SB 1T2QL 3NABL 2DQCH 4L4VB 3SGEH 1KN2H 3D0LA 1QX3A 3GI9H 4FXLA 2YUZA 1LEIA 1D3CA 3CFDB 3O4LD 4BH8A 4P2RD 1QA9A 3GJEA 4O2EA 1KCLA 3C6SA 1G9EA 4PJHB 5C71A 4RDQG 6CGTA 3D0VA 1K5NA 3THML 2CDRA 1N0XH 1XCTB 3H0EA 3ISWA 1KTLB 4OLXH 5D7KE 3DYMA 3PV6B 1GGTA 2CKBL 2QSVA 4XRCA 4JR2A 4U05A 1A1MB 1MQKH 3SHSA 2RCSL 3HA0A 3LEYL 4QT5B 3MBXH 1TITA 3PV6A 1ZHBA 4U7SA 4HJ0D 2Q3ZA 1A2YA 1RIHL 2XN9D 3FHQA 3FQWB 5EO1B 1EDQA 3ZKMD 4GRMB 1CP3A 2R0LH 1ORQB 2E8YA 2XNAB 4L9LB 4XPBL 5F96H 4HBCL 4N1CA 1PSKL 3CDGB 4DZBB 1LE9B 1CDYA 1RWVA 5HGHA 1YNTB 4M4PA 1V3JA 2H6PA 3A0OA 3BH8B 2VE6A 4ONFH 5D9SA 4XNYH 1JMXA 5C0AE 4YR6A 1MNUL 1CGWA 4XCNB 4EN3B 3FFCB 3CSYB 3WIFB 1BM3L 3BZ4B 3IJSA 4LMQI 4NRZA 1CD9B 5C9JA 5I1LB 1TZIA 4RFNC 5BS0A 3IDXL 4HHAA 2R0WH 1K4DA 4M7LL 2QSCL 4MDJB 3U46A 4ESKA 1RIUL 3L3JB 1RWPA 5BV7C 3LD8C 5CEYA 5D7LB 1LK3L 4M61A 2BHUA 4P0DA 1X5GA 1G7LA 2VNCA 4P46C 1UVQA 4ZFOA 5DQ9B 4LSTH 4MA3B 2XZQH 4KROD 1KN4H 3WDJA 4X5XA 4H8WL 4PY7B 4XHJC 1F6AB 3PWUB 1ADQA 1JPFB 3MSPA 3QQ3B 5JOEA 1HE7A 5SWZB 4YDLC 1TVBA 2FHFA 4PJAB 1GHFH 3MRPA 1OAXH 15C8H 1WC7B 1H0DB 2W1NA 5JXEA 1E4WL 4ZQKA 4P4KD 4YXHH 4RGOL 1QO3B 5I9QB 4UMGA 1VFMA 3EOBB 4BUHA 1RK0A 4MDIB 2GJ6A 5L88H 2GYSA 2WBWB 5ITFA 5J1AA 4HPOH 2WINA 2CLRB 4L4TB 2XN9B 2PYFA 2XZCL 1UZ6F 2R1WB 4LLYB 4PY8I 1G6VK 4Q7DA 1A7OL 5CMAB 3V79C 4KJPC 4K9EH 5MENA 5DJYB 2AGJH 4U1LB 1I1FB 1QRNA 1SEQL 2UWEB 4YPJA 3SDXF 5T3XH 1SY6L 1G9NC 1OLLA 5JLZA 4LEOA 3MXWH 3FCTB 4AEHH 3UTZA 4JM4L 3V5KB 3G6DH 2ZG1A 2D0GA 1EH9A 3GB7B 3GRWH 3C5ZB 1I7ZA 3E8UL 4JHWL 3UO8B 3WNPA 3QRGL 5DXWA 1MFEL 2Y7QB 1BQUA 5F1SA 3T0XA 4RWYH 5E5UB 3QPQC 2H1PL 5E8OA 5JHDA 5EORL 1MPAH 4B50A 5GIRB 4P5TA 2ADJB 4P2RE 1NAKL 3VXSE 5HI5C 2VDML 3T4AB 1VGKB 5ETUA 2PCPA 1OP5K 5MHSE 2J1KA 5F7KC 1BBDL 3FAWA 1FNFA 3HG1D 4LLVA 4UDTA 5ICZA 1MOEA 1FYTA 4BQCA 2ICWI 4JZOB 3N0PB 4HS3A 1SJHB 1A7RL 2F19H 3C5ZD 4O58L 3ARRA 2M2DA 2F5BH 4G6AC 3GIVB 2EKSA 1U3ZA 5IAGA 4XNZC 5IMLA 1RFDH 1ZA6B 3OKKB 3V0AC 3T04D 4N5EC 3FHAA 3SDYL 4ONHB 4ZXBC 1UH4A 2FSEA 3IT8D 3O2DL 3P4NB 5HI3D 1V7NH 3P0VL 4PLOB 4GW1B 1Y18B 1YUHA 4H0GA 2Y23A 2ITDB 3CX5K 1NLBH 4NFCA 3TNNB 3MRQA 3PQYD 1KNOA 4U6HB 4UTBH 1XGRA 1ZTXL 3TA3B 2DIJA 5CP7B 5GGQH 3L9RB 1C12B 4YHNB 4HUVA 4R3SA 3ZKXC 2EDNA 3D39A 3CFKA 5JHLH 1N5YH 2G5BA 1A5FL 2C4FU 5EIIB 5DJYA 2A9NH