1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GINGIPAIN R
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
5AAWA 4L4TE 1NC2D 3Q2CA 3B5TA 3QIUA 1UM5H 5C08A 3PV7A 3ZT6A 3BZEA 2EKSB 3NH7H 1BOGA 1U36A 4YIQB 4L9DA 2HJLA 4FQQB 3T0EA 1SJXA 2OTPA 3TP4A 3SKNA 1U95A 3QIUD 1VPOH 5IHZB 3RTQA 4Y5VA 3BGMB 3H9ZA 5L6YH 3CDFA 1FPTL 3OKYA 1BX2B 4X80H 3OJMB 3EDDA 3LDBC 1S3KH 3GMQB 3GNMH 3U7WL 1AO7D 1FJ1B 3MYJB 3MLXH 4HUXB 1D5IL 5KSAB 3TVMC 4GAYB 1QEWB 4TUKL 3S35L 1DBML 4JEGB 3H1PA 5F7NC 5CBEA 3QYCA 3JWOH 5T3XD 4JGUA 3OKNB 3V0WH 4NBNA 4J6RH 2H3NA 1YZZA 3QEQA 1WFTA 2OI9C 1PEZA 3IDMA 4RZCB 5KOVC 4APQC 3NIDE 1OOAA 1YNLL 3E8UL 3QG6A 2FX9H 2NN3C 1BLNB 4G8FA 1ERNA 4MAYA 4Y8DC 1NC2B 3N9GL 4AT6A 2YPLB 4DEPB 1T1ZA 4PY8I 3ARED 4ZODA 4K2UL 4NQED 3T09A 1FNLA 4EUPH 5DJ8B 1Q94A 3DSNA 3SKJL 2XA8L 4HUKB 5I9BA 3MXWH 1DEEA 5ANME 5H8DA 1LP9E 5C09E 4EI5B 1CTOA 1MEXL 3TBTA 3KYNB 4JFXB 4QNPF 1JNJA 4KI5E 5DRZB 4I2XE 2F5BH 4U1GC 3WDJA 3TYFB 1LVEA 4AM0A 3D3VE 5I76A 3W5NA 1EVUA 1QNZL 4HZLB 3RIAK 4M61B 3AM8C 1VFUA 1F4YL 4QRRD 4NNYA 2VE6A 2W0PA 1ZT7B 3B5GA 4YFLI 4YHZH 3BP4B 1UACL 2ICEB 5GSRB 3SOBH 1BWWA 1A6ZB 3BMVA 1I8LA 4JCLA 1LE9A 3GMQA 3VXSD 4PJDB 1RZKL 5B39G 3JTSB 4QT5A 5DO2D 3BKJL 4LCCA 1EK3A 4NN6B 4AENA 5L2KE 2IPKB 4OIBA 5JHDA 5CEZL 4XNYH 3SBWA 4LLDA 5T3XL 4QU9A 4QRUB 1WZKA 4KMQA 3ZKQD 4ODXA 4HEME 1GJIA 4JQZA 1TJGH 5GS3A 4NRZB 5GGVH 3AS1A 4FQXC 2BNUA 4XMLH 3ULUD 3GJSA 4QO1A 2CDGA 3PGCB 1IAII 1RWMA 2IFGA 2QQLH 3RWIB 4JG1H 2H1PH 4U49A 4JM2B 4OLUH 4QRSA 3C6LB 3OSKA 3SN6N 2EDRA 1HWGB 4LLWA 2VABA 1OW0A 1OARH 1NGWB 2DQIH 4MS8C 3L3KB 5CUSH 5LUBA 3BRDA 1JCKA 1ZTXL 1R0AL 5I6XB 4F57H 1I4FA 1P4LA 3KYNA 3VDAA 2V5TA 3QFDB 2Q86B 4TULL 1N6QH 1F3RB 2E9BA 2H48A 5I1AB 3M1BB 1S9YA 2IAMC 1E4WL 5C70A 2ZNXA 1NMAL 3ITNA 2IALA 1SC3A 1RZJL 3REVA 3E4CA 3CLEH 3MRCA 4BSVB 2Z35B 5FB8B 1FN4B 1CP3A 3UTSD 1OM3H 4N8VG 4XWGH 2MCG1 4QHMA 3BDBA 4X4ZA 5JIKA 4YR6B 4Y1AA 3UDWC 1ZLSH 5C0IA 3L3JA 3L7EB 4M5ZH 1RVFL 4BFEA 1QDUA 1UM6H 1K8IA 4LCUA 2BMKA 3FQWA 2AV1B 3GM8A 4UTBH 4IDJH 1VFAB 4K8RL 2W1NA 5IMOB 4P2RE 5ETUB 5JXEA 3F65A 4JCMA 1I85A 3DBXA 4Z7VF 1JTTA 1YYLL 4JM4L 4LGSB 1RZFL 1RZIA 5M94B 5ANMA 5C09A 5T1MA 4PGEB 3U48A 4M7JH 5DD6A 1RAMA 2DBJA 1PQZB 4NRXA 1BOGB 2YMXH 3QUYD 3SCMC 4JQXA 2F19H 3BAEH 4HSQA 4NQTA 1AI1H 4WHTB 4PJHE 4BJLA 1J1PL 3HI1B 5ITBL 1EHNA 2Y72A 2FB4H 4FG6D 3PWUA 1QA9B 4LCIL 4P2OA 2Q8AL 5AG8A 1E6OL 5C0AB 4ZO9A 4TOYL 4H1LA 5CS7A 5KSAC 1EDQA 1FNGA 1I4OA 1U3YA 3ZE2F 2OTWA 5FGCB 1CL7L 4Y88A 3BO8A 1U93A 5C0DA 4DQOH 4H88H 1H5BC 4JFZH 4EI5D 3MMEA 5TQ2H 1EHLH 4N7JA 3BW9A 1AR2A 1QPPA 2VDLH 1K6QL 5EZLB 3UMTA 5GISH 1QUNA 5DDHA 5CD5D 2QKIB 3E2HC 3C5ZA 2Q8BH 1T6VN 2B4CC 1WBYB 4U0RC 1RV6X 5FDWA 3MUZ1 4DZ8A 3W11D 3FHAA 5LVEA 4Z78A 2QSCH 3BEVB 4P2RA 4WHYH 1A1NA 3QUYA 2DQDL 1VACA 1WC7A 1RUAH 1U42A 2OBGA 1CDIA 2HJFA 5IB3B 5HYJD 4CN1A 1SHMA 4PLKD 4WFHD 1YPZA 4YUEL 2NY0C 2M8XA 1JNLL 2PYFA 2GY7B 1XIWD 3GMMB 4M1GL 1K86A 4NPYA 4LEXL 5I2IA 3GSUA 3QQ3B 3SE8H 4LVNC 5ITFB 3QCVH 4XVSL 1GSMA 1OTTC 1B88A 3WHXB 2XRAL 5L7XL 3CD4A 3EYFA 4P5KB 5AG9A 1SYSA 4BSWB 3JVGA 3FO1A 1HIML 1ZSDA 5I19L 2G5BA 1ZHKB 4OLXL 1KTLB 3KS0J 4QUJA 1EGJH 1CT8B 2A1WH 4L3EA 4KZDH 3CZJA 1T03L 3DROB 3QQ9C 4HDIB 4POZD 5H94B 5TDOB 3FN9A 1MI5E 1NUNB 2PCPB 5J1AA 1HCFX 2DTSA 3C60B 3TNNB 1OGAE 2HG5B 3BDYL 4WIQA 2MKWA 1OPGL 4PB9H 1O7SA 1JZ8A 3FB8B 3KPRB 2EYTA 5J06A 3QI9A 2VDNH 3WL9A 5I8KL 2FNBA 2WAHA 1SYVA 1TZGL 4Y8AA 4J3VA 3NBNA 1ZEAH 4NOBA 1F58L 1U8NB 1CS6A 1U3HA 3NGBB 3VXME 2C3XA 3QI9D 1HSBB 3MRMB 3ARGD 1UB6A 4HS8L 4N5ED 3UYRH 3GSQB 4F3FB 4G6KL 2HVKA 1MIMH 3F6IA 3BQUB 1V7NL 1FNEA 3LRGA 5CJOH 1A7NH 3GJRA 1BZ9A 1J8HE 2RB8A 2EO1A 3LPWA 4OLVL 5FM5M 1BF2A 2X1QA 3SPVB 1G9NL 3VG0H 2G9HA 3RUGB 5JW4R 3P4NB 5FYJE 2EKSA 1MCPL 4QTIH 4NHCH 5I1GL 5IIEA 5DHYB 4K71C 4ISVA 2X9YA 1IL1A 4U1HA 1A7QH 5D70H 4S1RH 1P9MA 1V3KA 4KTDL 5ALCH 1HHGA 4PJFB 1QFWI 3U82B 1RHFA 3UPRB 2QQKL 3UCRA 2J8UF 1KCLA 5DWUH 2AKRA 3LV3A 4HJJH 1AHWA 2HN7A 4Q2ZB 4JFFA 5E56A 3QPXH 4Y5YB 3O2WL 4OF6A 4FFWC 2PCPA 5BZWB 4OFYA 5FUOL 2P46B 1ZLVK 5I8OH 1PW3A 4O51B 4JO3L 4S1SH 4Y4FA 4H25A 5C7XL 4YXHH 2Z9TA 5F7DB 3QUXD 4IRSC 2VITA 1QSVA 5I66A 2FYYA 1CDCA 1SY6A 4LVHB 5AUMA 4GMSL 3V6ZA 3VXUD 1FV1B 2DLFH 3FOLB 3GBLA 3DUSB 1PQZA 1E4XH 2DI9A 2DIJA 5TE6L 2B5IB 1U2CA 4D0CA 4ORZC 2UY7A 3BUYB 1L7TL 5F1KC 3BP5A 2AVGA 4LSRH 2ESVD 2EZ0C 3HE7D 3WUWA 1JV5A 2ZG3A 5B8CC 1NFKA 3WDHA 1MJ8H 3MV7A 3LPFA 3IU3A 5F7LB 3IBFA 2ZZUT 3M45A 3MGTB 4OV5B 5FYKL 2GEEA 4ODTL 4TQEH 4E42B 1YY8B 3MLUH 4NJAL 3FOLA 3RY4A 1M7XA 3WFHA 2WQRA 2I27N 3S70A 4KMLB 4NCDA 5ISZE 5HJ3B 3NS7A 3GHBH 3TIDA 1I7RA 1CTNA 1KIPA 1F6FB 1Q9KA 1OB1B 3RTQD 3U30C 3HLAB 5SWQB 5JQ6H 4GW1A 1DLFH 4GKSA 3NCFB 3NCEB 5JHLL 3DUSA 4QNPE 5IESH 1NBZA 2HN7B 4Q2ZA 5B22A 3OF6D 4J4PD 3BIKA 2XWBA 3FQNA 1ADQH 4IHOB 1PKQB 3RWFA 3HRZB 2HYMA 5CZKA 1UKTA 3ALWA 4JJHA 15C8L 4L4TB 3S37H 1D6EB 1M7IB 2GHWB 4NQEA 3VJ6B 1MREH 3DX6A 3GSWA 2EYRB 1ACYH 1CD1A 5I1DB 1U8JA 3VCLA 3CX5K 2N1KA 1WIOA 2ADJB 1S8DB 2OR9L 3B9DA 4HFWA 1A7PL 5HY9A 2GJ6E 4HWEH 4MAUL 2Y7QB 3SY0B 1WAAE 5E8EA 3T08A 3AC0A 2YD1A 2ZCLH 3SGKA 5EG6C 4KV5F 4QUEA 5DVMA 3B2VL 3BE1H 4NN6C 2ADGA 3X11A 1RULL 3B9KB 1B6UA 3DXAB 4UQ2B 5HI3D 4U6HB 4XXDB 3LS5H 2HTKC 2WBJA 4WFFD 4CGTA 3IAPA 3EJZC 1X6LA 3D6FA 1D5ZB 4R26H 5IMOA 3ILPB 3SO3C 4JAMA 3BRGC 1FZJB 3VXSA 4UDUB 3RHWK 3QA3B 3SJVA 5EU6E 4Z7WE 4QXUH 1NBVL 5HVWA 4LP5A 3GIVB 5DJCB 4PBXA 3O3UN 3U79A 2HBQA 5I1CH 4LCUB 4CU8A 4LSSL 2DRUA 1E0OB 4NNYB 2VE6B 1GGYA 1NCAH 4JPKL 2AEQL 2I5YL 3VGDA 3GK8L 3WNPA 5I76B 5IC6A 1W0VA 3BQUA 5C2BL 1HEZB 2DIAA 4YE4L 5DURD 3MRQA 4JFXA 2NY7H 5DTFB 1RI8A 3P2TA 4ZG1A 4BH7A 1AGCB 4XTRC 1ACZA 4F2MB 2CDEB 5K9KB 3D87B 2HJKB 3DUHA 3BYTA 5JIIA 4KY1H 5GIRB 5B39B 3SPVA 5B38B 3WKNA 2VLJD 5TPWH 2FL5A 4MWFB 3KPTA 3KJ6H 1DANT 2AERT 3GMPA 5TE7L 3WO3B 3B9VA 1CFVH 3LKRB 2V9QA 4ZXBB 3QO1B 3R06B 1MQKL 5D72H 3MCG1 2NW3B 4P5TA 4O9HH 5EOQL 2XN9A 2A6KB 5MP6H 1JWUA 1F6AA 4FQIL 2NZ9C 1R24B 4FQPA 2VXSL 3V6BR 3ZMRA 3FZUD 2QQNL 3OKKB 1JRHL 4MJ2A 4JFED 5I15L 2YEZB 1KTRL 3ARGC 1GZQB 4QOKD 5LUAA 3CSYB 2UVEA 3MACL 1JF1B 4LIQE 3S8EA 4NQXB 1H0DB 1MLCA 2ZKHH 4EI6A 1A02N 4XVJH 2FO4B 5D7IE 5BV7B 5DEGA 1JPGA 5ID1B 5JXAH 2W9DH 1I9RH 5IHZA 4Z77B 4Y5VB 3QPQC 3S97C 3UO8B 1BOYA 5I1EL 4YGVB 1TZHA 3ALXA 3WD5H 1A4JB 3V0AC 4PGZA 2I07B 3HG1A 1MJJA 5D8JL 1K5NB 4JREC 5DI8A 1MCWW 1S7SA 1IILE 4G6FB 1NAMH 1HK6A 2P43B 2A9ML 4JO2L 4NFDA 3MO1B 2B0SH 4N68A 5BS0B 3FTGA 5FYKD 2PYFB 4G8GD 3GRWL 3QNXA 4WENB 2OL3H 5DXWA 2DN7A 2UZIH 4CADB 3WS3B 3NZ8B 3W11C 3KXFE 2W0FA 1IGFL 3AU1B 3VD3A 3BKML 4PRHE 2JCCA 4LKXA 5C3LD 2XG5A 4KJPD 2WBJC 5CJQH 3KYKL 3ILQC 5LXGH 4L4TD 4G7YL 2CMRH 5GS1B 1T80A 1A6UL 3VFGL 4R4FH 1KCUL 1SEBB 5JO5B 1YYML 1JZ2A 1EEYA 1ETZA 4YHLH 1WBYA 5JMRA 5CCKL 3PABB 3O3BB 4FQXD 3ARDC 4I18B 3GMOB 2OSLB 4ODUB 2YPKA 4IM8A 1DVFD 4I4WA 3DX7B 4RISL 3RVXD 4JO4L 4ZQKB 4C56A 2CJUH 1AGFA 1YMME 5SWZE 1MCNA 1J05A 5TFSL 1DBJL 2GAZA 2P8LB 3CLFH 4GAYA 2R23A 4U1MA 2W92A 4QEGA 3V55A 5T1MB 1UZ8A 4RGOL 3L3JB 1B4RA 2XZQL 5FECB 2VQ1A 1W0YT 4LHUB 4LVNB 1CU4H 4M6MH 4XRCA 1G9EA 2M1KA 5E1AB 4LKXB 1EEQA 3QCUL 1U92A 1YEIL 1NAMA 1U8IA 3QUKA 5DT1L 2F8VA 4NDMA 1UWEH 5DMKA 4ESKA 1DLHA 5IBPA 1SHJA 4XVTL 1C16A 3SQOL 1HZHL 2XZAH 3ZZ1A 3MNWB 5IBTH 1KLUA 3UO1H 2R9HD 1KJMA 1MSPA 1GGBH 2YA2A 2IF7A 4QHKI 3L7FB 2BOBA 2FATL 3DRTB 2E7LC 3UC0H 4NJ9L 4P59L 5I74C 1XF4A 3GI9L 2CGRL 4OCNC 4K3JH 1PDKA 3QUMA 1UGNA 1ZE3C 3OAUH 4NZUH 5IBCA 5D7IA 1B2WH 3BGFB 3OXSB 3DX7A 3Q6GH 1HHGB 3V2AR 1MCBA 4YDJB 3IU3B 1J10A 1F4WH 1VEOA 3TF7C 2NYYD 4D0BA 3LZFH 1FH5H 4XVUC 3ULUL 2VAAA 4Z7QE 5JTWA 5HHOE 3CFCL 1JJUA 1CLZL 4KHTL 4DKFH 4U6XB 4L3ED 1FO0L 4A6YL 1NJ9B 5LBSL 4YHIA 5F7WC 4OT1H 3FO9A 2R1WB 4M93C 5IB2B 2KKQA 3RWIA 1NKOA 1FORL 2WBWB 1B90A 4F7PB 3O6FD 5BVPH 3ULVC 4PG2A 5E9DE 4H20H 4UAOB 3C5SA 3RVVC 5CP7A 2VQUA 2O5XH 2XZZA 1KEGH 2FHBA 4G9FE 3N85H 12E8H 1FL6A 2GTZB 1E4XI 5DK3A 2X4UA 2H2SD 2Z8SA 1RZ7L 3U7WH 3O2VL 5CGYC 4XAWL 1EFQA 3QSKB 4NN7B 2A74A 5HDQH 5FHAH 1DBMH 1OD7A 2VWEE 4G5ZL 1RZ8A 3Q1SL 3PHSA 1F3JB 1FNFA 2FDBP 5F7EH 1ZGLA 2C2ZA 4XHJC 5GJTL 4WJ5B 3JWOL 3AY4A 5EU4A 1AR1C 2ATPA 4F7CA 3DOSA 3H42L 5CAYB 3V6LA 5CJXC 1NLBL 3W82A 5A1AA 2P5EB 1G7PA 1RHMA 3T1FB 4KI5C 4XCYB 4RGMB 4K94C 5DGRA 1OAZL 2PYED 1CFQA 2BNRB 3HNVH 1VB9A 3BJLA 5D7JC 5BZDA 1RZJC 3UTPE 5F3BA 1ZHNB 1HHJA 1XH3A 4UV4L 1MCKA 4EVNA 3HB3D 1J0YA 3V0VB 4LARH 2H4YA 3IJSA 3VWKA 1IQDA 1KGCE 2GSIB 4QUBA 3LPGA 3ULUE 1G7QB 2VB5A 5DJ0A 4HK3N 3IT8D 1M72A 1AH1A 3MRNB 3NCJH 5KOMC 3GEWB 1F4YH 2FD6H 2BRRL 1YA5A 2D31B 3P77B 4G9FA 4R7DA 1L0QA 4NZRH 1F6LL 3O2DH 1HN1A 2HJLB 1MWAL 3NZ8A 1IBGH 3C6LC 5EBWB 2FECI 4G8GB 1VHPA 1MFAL 1WTLA 4XNYL 1NMEA 5KJRL 1AE6L 3IFLH 2X1PA 5D2LB 3D39E 1UJ3A 4NZTH 4L3EB 1FE8L 2APWA 4KUZH 4OZFB 5J12C 1XGUA 3AS0A 1UEYA 1UKSA 2AV7A 4LNRB 1QZ1A 2EH8L 1SJEB 4QF1B 4ODBD 3WYRA 4KRMB 3QUZA 2YN5A 4DGVH 2NY4D 3RBSA 4M7LT 5CBEB 4ZFGL 5CSGA 5F7FA 3BZEB 1BVKB 1D6VL 3L5WB 4ZOEA 4WW2C 5D1QA 4HS6B 5ID1A 3E6HA 1Q0YH 3RGVB 4BYHA 5ITFA 4X6EA 4JPVH 2NY3B 3QDMA 5HGBB 1K8DA 3U4AA 4JDTH 5IR1A 3MUJA 2ID5A 4LLAA 4IOIB 2VZSA 5D7SL 4GOSA 3PWJA 1U92B 2VJXA 5FHBH 4YDLB 2NY5H 5C0BE 4YHML 4RGNC 3ROLA 3ZT5A 3NACL 2VAJA 4MNGB 3BEVA 2QR0A 2AK4E 3CFEB 2C2MA 1OAKH 4RFOH 3U4BH 3QFJB 3C8KB 5DMGD 3DURB 3L9RB 3ARBB 4X5XB 4OUUB 3VRJB 1EVTC 4MB5A 2VN7A 1VADA 4QUAA 5B38A 2WANA 2EIZB 1I9IL 3K74B 2CIIB 4CVZB 1UKQA 2Y06H 3D0LB 3TJEL 3QISA 3RDTC 1FFRA 1AGCA 3V6MA 4PJBE 4MAYD 4U1SB 2J30A 1HYSC 5E2JA 3LIZL 4UILL 4MCZA 1NEZB 3TT3L 1HI6A 2ZSWB 5GRWA 3MBXL 2Z91B 3TBWA 4I0PA 4WFGD 5C0RH 1B0GA 1CE1L 4U2ZA 1NGYB 2H32A 2BDNL 3QH3B 3OKLB 2JJWA 3GJQA 1UA6L 4WJ5A 4ZVSA 2EDEA 2EDLA 2H51A 3VI3E 3KWWB 2Y36L 4P2QB 2BERA 4AEIH 3H9HA 1ZGLP 2ORBH 1FL3A 3B6SB 1JGUL 3BN3B 1BF8A 5IKCB 4KUCF 4BELD 4P57A 4NNPL 3QQ4A 4QTHA 5IQ7H 1AP2B 2B1HL 2HMIC 5H0IA 4ZS7L 1RU9L 3CGTA 2QSTA 3DETD 2NPLX 2ZG2A 2QR0B 3CFEA 5KSBF 1FDLL 4OD3H 1PEWA 3BP5B 3O9WA 3DIFA 3LQAL 2IPTL 4M1CD 3RUGA 4BZ2L 3LHPH 1VSCA 4Y16A 1S7UB 2GK0B 4MJ6A 2NX5D 1BZ9B 3OX8A 3B9KC 3VDBA 3RWCA 5MERA 2A0LD 3LQZB 4ZVPA 1S9VB 1CIUA 4L8SB 4OUOA 5HVHB 1UC6A 3DVGA 4QXTB 4TNVK 3KPMB 2RJMA 1PJ9A 1RJZA 3FOMB 4C83B 1CQYA 3V79C 2YD2A 4HIEB 4AENB 1TQBB 3SGKC 4ZAKD 4PV9A 4Q9CA 1E4JA 5IBRA 1JZ6A 4NCC2 1CFQB 5IB4B 3DX9B 4GW1B 2W9LA 3DMMA 3UTTA 4BZ1H 5K9QG 3WNOA 4H0HB 2IANE 4XP5L 1I1AC 1A3QA 1P4LB 4G8GA 1AKJD 3KPMA 2XWJA 3V9FA 2XZTA 1BQSA 4Z7VB 3SE8L 4XPGL 4HK3J 4JQIH 5CILL 5FDYA 1O5DT 2D31A 3RWCB 2V2XA 4Z7WF 2I9TB 4NUGH 1CN4A 4W6XB 3FCTB 1J8HB 4PP2B 3SDAB 4JLRB 1ZHLB 2NMSA 1I3RA 1HEZA 4FZ8L 2Q6WA 5I17A 3T4YB 1FVEA 1HH6A 1EGJL 5DS8B 1WK0A 2H4WA 1U2HA 4NN7C 3RY6A 5E94B 1NCWL 2VLKB 3VWJC 1MVFA 5J12B 3BUYA 3VGAB 5IK3B 4U4BA 3VXMB 1JK8A 1NC4D 3IDMB 4UV7L 3UTSE 5EDXA 4KDTA 1BJ1H 3MRMA 4R4ND 4QCIB 2FHFA 1K85A 4PJIA 2FIKA 2R0LL 5E8DH 3EGSB 1L7IH 1CD8A 4ZNCD 1G7JB 1BAFH 4AIZB 1XZ0B 1IGTB 4UAOC 1U8QA 1QTNA 5ESQA 5DDHB 1U8HA 5HGGS 2OP4L 1MIML 1A6TA 5A40E 2N7BA 1KCVL 4PJDF 3VFRA 3QRFM 5DJ6A 5DFVD 4L5FH 3ZDXE 1JIBA 4JFFB 2MQ3A 3DUUA 4JO1H 4MCZB 1IVLA 4LPYA 4BUGA 5C0FA 5DK0A 3B4NA 2VC2H 4ERSH 3WS6A 3UOAB 3TA3B 4FQQA 1Q94B 2ESVE 4BZYA 1MCPH 4N9GA 4QTIL 4EHKA 1DVFA 2VR5A 5J6HA 3CMGA 1QR1A 4N8CH 2HP4A 3UP1A 3VJ6A 4MAYB 1WCBB 2XQYG 3F6LA 3ARBA 4X5XA 4OZIF 3X3GH 4P9HC 2UUDH 4ZFZB 4HIXL 3MOAL 4GKOA 4ZUVB 2IWGA 1MCLA 5MEQB 3U4EA 1NC4B 3FJTA 3IDIB 4JANA 1S7SB 4OGYL 1BBDH 3N1QC 4IRSB 4ZAKB 5KSUB 2JIXD 1J1XL 5IJKC 2X1XR 2VUOA 3FMGH 2JELL 1NGQH 3VFMA 5J3HC 4FXOA 1YUHB 3D6HA 5KTEH 1SC4A 3LEYL 1CXEA 4HG4J 3I3EA 2FH8A 1N7ML 1JYXA 3QPXL 3H9SA 2DQJL 1K3IA 1TETH 1A6VL 3QIBC 4H1LG 4JKPL 3OKEB 4J3TA 3JV0A 3X3FH 4S1SL 4KAQL 3H3PL 4MQ7B 3WFDH 3RIFK 5C1MB 4B0MM 1IGTA 5GRVL 2I26N 4KZEH 4U0QB 4F9PC 4YHOL 4P4RB 1EJOL 3G04B 5I75B 3EBAA 1KPUA 3MCKB 5BZDB 4G9DB 4NQDD 4PTUA 3BVNB 3QNZA 3H8NA 5IW1A 3OAZH 5D9SB 1MQ8A 4UBDD 2E6QA 4J4PC 1NQBA 2Q76B 3MQIA 5FB8A 1CT8A 2J8UA 3LSOB 1NL0H 4EIZC 1T89A 5C9JA 1NBYA 4LAQH 1C1EL 3NH7L 2G5RA 4OCWL 1J0JA 3HC3L 5K33A 2XKUA 3TYGL 1Z5LA 5TDNB 1NPUA 4CADA 5CJ8A 4ORGA 5I30L 3MLRL 4OD1L 4CN4A 1NFDA 2WIMA 2UUDK 3SDYH 1TZIB 4ETQA 1HHIB 3MX0A 3O4LB 1LO2L 4BQ9A 1DSFL 3REWB 1HHKA 5ESQB 1OAXH 3BN9C 4R0LC 3VFWB 1SEQL 1D5IH 1W0WA 2CH8A 1HH6B 2ZSVA 1IQWL 4Q9QH 4U0RB 5IV2B 4YGVA 3INUL 3GMOA 2I9TA 3ES6B 2EXYD 4NQDB 1N0LA 1I1RA 4WUKH 1IL1B 2HFGL 2YK1L 1BMGA 1A3LL 2ZUXA 3VFPB 1HNGA 1CGSH 1PSKH 4JHWH 3BH9B 1HH9A 4X7FC 3NCCB 2HFEB 1IKFH 3I6KA 1DFBL 1YJDL 3BOVA 3S8WA 4Z7WA 1N6UA 3MRLA 5HYSG 1OWRM 3HC4H 1UADC 5HYEA 4QHLB 2ARJA 5IB4A 2OI9B 1V7ML 3BT2L 4PJXA 1XR8A 3IJHA 3TN0C 4KRPC 5HY9B 2PR4L 1Z9SA 3TNNA 2EDFA 2JTDA 5F89B 2DMCA 3F7VB 3KYMB 3ARFD 5E4EB 1FAIH 3LKPB 2B39A 3QFDA 3MLTA 5IROC 4LBEB 4KQ3H 4HAGA 3DRQB 2MNUA 4K7PX 5B39A 4N0FB 3IXTB 3MUGB 3PDGA 4GMTL 3BP7A 4F7PA 3TO2B 3CDGB 5LGHL 2RR3A 2X05A 4PRPE 4NO3A 1H5BA 2JJSA 2NNAA 4HIHB 2OYPA 1V8HA 4JFEB 3MODH 2I5YH 4M1DH 4Q0XL 4XC3L 4HV8A 4NRZA 1CDHA 5FV2A 5IFJA 4CJ1A 3I6KB 5ADOL 4X8JB 2G5BB 1WWBX 1RURL 2DQUH 5GZND 1ULVA 3K80A 3HC0B 2MOVA 5SX4H 3KPRD 4PJDE 5F70A 5IARA 4CDGC 4EJFA 4WFFE 4ZVQA 3VXOB 4XMLL 5I71C 3SGEH 4RQQA 1MLBB 5FF6B 1BM3L 5GRVK 5ISZB 1I3UA 4FQ1H 1T0NB 1KN2H 2NQCA 4KPHL 3T0VA 5KS9A 4UDUA 2PTVA 4OLUL 3KWWA 1X7QA 2CD0A 4C56B 4J23A 2XY2A 2VLRD 1G7MA 3AM8A 4HIJA 4AQ1B 1P9MC 1ZT7A 2HWZH 1K4DB 4UB0L 4E0RB 3KS0H 5JZ7C 3H6JA 4IRZH 5E8PB 3HI5L 1QLRA 1INDL 1HQRB 1OGTA 4NOMA 3B2UD 5KVGH 4FXLA 1G6RL 43CAB 3OKMB 1MAMH 1Z9OA 5LCVL 4DK3A 2VOTA 3EJZD 4LVOC 4OJFH 1AXSA 5E24E 3CZFB 1KENH 5DMKB 4DCQA 4U1SA 3NAAL 2I25N 2YPLE 3EYUL 5L8KB 3QIBB 1MCDA 3VCLB 5C8JB 1NBYB 3MNVB 1BIIA 3PWPA 1IJ9A 3OL2A 1DL7L 5FECA 4RGND 1FG2A 4QRTB 4I48A 3HR6A 3QNYA 2VABB 3ZSSA 5F44A 2AABH 5T5FH 4KVNL 4FQXB 4O5LL 4M5ZL 3LB6C 1W8NA 3DSFL 1F11B 2CK0L 4TNVF 3CZFA 3QJHB 5BV7L 2A77L 4IEFB 3MRIB 3WD5L 3A6OA 4TYUA 4JRYB 3H11B 2CIIA 4CVZA 4P49A 1QFUH 4OQTL 2OXHA 5EZIL 3QRGH 3L5IA 1UWGL 2VO5A 1J9CT 2A9MH 4PJGA 1YMMA 4EKXA 2EDOA 5ETUA 4GG6E 2AJUL 4PJ5B 5FA4A 3T77B 4X5WB 1WISA 4X4MA 3C09C 5BO1L 4ZOCA 4HS6A 4NWTH 3CFBB 4LSVL 4OTXL 1WWAX 5EIQA 4YK4B 3PG2A 1JTPA 4LAJH 5E99H 2HH0L 1Y0LB 3QEQE 5DHVA 3QIBD 1IAIH 5CZVH 5J11C 3GSNH 4FFWD 3SQBA 2Y6SC 2ZUVA 3BGAA 3HE7B 3RUGE 4RDQF 4LCIH 5CHNB 1ES0B 1WZMA 3E3QE 4UU9A 3X13A 4NGHH 4ZXBA 5CCKH 4LIQL 4U31A 3T04D 4KRLB 2EYSB 4HKXB 1AXTH 3QUXC 1D7FA 2ZCHH 1FLRL 4K3EL 4YHNA 3QXDA 4P5TC 3NIFE 1UZ6E 3QHFH 3GIZH 1YN7B 2EDJA 1KFAH 1MRDH 4PS0A 2Q20A 4G6FD 4YHYC 3A6BH 4Y16D 3C2SA 2NXZC 4Y5XC 3NA9L 4XCYA 3GM0A 4WI6A 3DEIA 1H0DA 1JNNH 4P9MH 4PRAA 1H5BB 4PTTA 4GXVL 1U8HB 3NZHL 25C8L 1ORQB 3MRCB 4BSVA 5C0JB 1PAMA 4Q9RL 5K93A 1XZ0A 1GZQA 1QFHA 4C54A 2VXUL 2NY6B 2NXZD 2PKDA 4JB9L 4MNQA 1DQQB 4KRNA 4KC3B 2VDQH 5TJWK 1I7TB 3VGGA 3U0TB 1CGTA 3BYYA 4L9LC 4OSUH 3OPZH 1FAKT 2IQAA 4M3KB 1DUYA 3OB8A 2Q7NA 2QHRL 5F1IB 1RIVL 3RJDA 4JRXD 2J32A 3P0YH 4P5TB 2NW3A 5C09D 3EOBB 1FC2D 2XY1A 3OKOB 4H26A 5T3XE 4WGWB 1O7VA 4PJAF 3IJSB 3STBA 4DN4L 1JWSB 1OY3B 2CXGA 3D69B 3JSSA 3GMLA 5JQHC 2VIRA 4P23C 1NEUA 2IBGA 1A9EB 1P4BL 1JE6A 5TE4H 2B2XH 4GLRH 1ZHBA 4LPXA 3QIWD 1NBQA 1FVDA 3GJFA 4QRRA 4HUVA 3W2DL 3DXAD 3CFIC 2DDQH 5EOCJ 2AP2A 4MYWB 5I19H 4FQLH 5CIPB 1PZ5B 1DQTA 4GRMB 3IDXL 4JFDD 4KZDL 4ZSOB 3WFZA 3O3AB 3KPNB 1R3LB 1UCBH 1NCNA 2Y23A 3T4AB 1FO0B 2MHAA 4NOJA 5FCUH 1JPSH 2FLBT 3M8OL 4NT6A 1P4IH 1JFQH 4DZBA 1M7IA 4GAJH 3V4UH 1Z5LB 4A6YH 3PQYA 1Q0XL 1TQCC 4HC1L 4PJGE 4KKLD 1CZ8H 3WL9B 1BFOB 3QDAA 2DBLH 1ORQA 1ZWIB 4IIQC 4F7TB 3QUMH 4XPBH 1IEAB 2RQ8A 5DUPL 1FNSH 4Z7NF 4IRJB 4I0PD 4LHJB 1I1YA 1KEGL 4FFVD 4Y2OA 4RA3A 3KYOB 2QADD 4Q7DA 5KS9E 5EO9B 4UQ3B 5CP7B 4UQ2A 1KPRA 1WTGT 1JPFA 4Y2DB 3BPCB 4RSVA 4NM8L 1ZS8B 3RVTC 4KU1A 1LQSR 3R5KA 1XGTA 4I18C 3H0EA 4I77H 5EUKB 1UYWH 2XN9D 2EE9A 1J8KA 3DPBA 3NN8B 4GKNB 1YEFH 3D2UA 4MA8H 4CRPA 4Y16B 1IAKB 3FAXA 5HHMB 4XI5D 3ZLQC 5EWIL 1NLBH 3NCYP 5FYJD 4Y4HA 1TNNA 3S36H 2BOBB 2QSVA 4PRIE 3WFBH 1MRFH 5D70L 4S1RL 1MCSA 4QTXA 2H9GA 4X83A 5IBUB 1TVBB 2NX5A 4G42A 3PQYD 4JFDE 4P2RB 4FNLH 2R23B 4OCRH 3KJFA 3L5XL 4DJMA 4HKJA 1BD2E 4R3SA 4ELMA 3IDIA 4MQXC 4WEUD 2AEPL 5DD3H 5A2IH 5CGMA 1NDMB 4P2QA 3QB7C 5GHWH 1NAMB 1OSZA 1U8IB 3CFKA 4P3DB 4LEOA 1KPRB 3DRTA 3S3SA 4M8VA 5IGXL 5D5ME 3RIFF 5EORH 1RY7B 1T3FB 1QO3B 3TWCL 4YBHA 1XF3A 2IFFH 1NDGA 1UZ8B 1HHHA 2C5DC 3QJFA 4GKZB 4DW2H 3U36A 2V6HA 3MRIA 4BM7A 4GRWH 1F90L 3IKCB 3SBWC 4K3HA 3WFCL 1NCUA 4NZRL 1MPAH 3ROOB 1ORSA 3O2DL 2F8XC 4YDVA 5DEFB 5IEKA 1GOHA 2GJ6D 1P5VA 3ULVL 2JB6A 3VD5A 2BXZA 3JUZA 3ZDZE 3GHEL 4NHUA 5I18H 3RGVC 2DLEA 1IGIH 4XNZC 4DOHE 2OSLA 4LFHD 5I1KH 3STLB 1NCBH 4PUBL 5KJRH 3V52L 5A2JH 1BREA 4D9QD 1ZLWH 3O3AA 4OLZH 4G6MH 1FNHA 4RFEB 2AK1H 5IHUH 2X4OA 1OP9A 1RZGB 2OJEB 4R6UA 3VG9B 1YN6B 2HLAA 4P2RD 3ARDB 5IHLB 4NRXB 1HE7A 3RA7L 4Y5XB 3BSZH 2WUCH 1U8MA 4R0LA 4PJAA 4DCOA 3AROA 3PDDA 1LDPH 2EDHA 2DMBA 3GHBL 4Z7VE 4XBEL 3MJ8A 4B41A 1K2DB 1I1AA 4Y2DD 1ZHLA 3SE9H 5SWSA 1AO7B 5TF0A 4ZDHA 2IANB 3C08H 5DZOA 4TUOA 3RWGB 2DLTA 1YEKH 4QRQA 2A83B 5FYLE 1ZA6B 1R3IL 2I07A 3HG1B 3EO9L 5DF0A 1CVSC 3QI9B 4LNRA 5E2UH 2J1KA 5I0DA 4LFHG 1MREL 4PRAB 5EU4B 3H7BB 4TN9A 3E8UH 3KPNA 3CK0H 4MXWH 3WFEH 2QTEA 1N59A 3BZ4A 4JFDB 4O02L 3D3VB 4MCYA 3OKDB 1EAJA 4NKIH 3TM6A 2W60A 4WW2A 1U6AL 1YEDA 2EIDA 5JMOC 1ZSDB 1PZUB 1F3DJ 2F58H 5KSBA 1AGDB 2AJZA 1A6AA 1P7HL 3OKKA 4U1IB 2NY0D 4WY7H 2X4TA 1CLYL 4JZJB 4UDTB 4R8WL 2NY3D 1LEGB 2EDKA 2KQNA 2KQMA 4WW1B 3OWEA 2KZ1B 2VXQH 2LU7A 4MA3B 3WUZA 3ARSA 5TF1L 5MERB 4HCRA 4JR0A 1N8ZA 3OJVC 3S3PA 3V6OA 4MDIB 5IB5A 1J1OH 3P9WB 3TCLB 2XYCA 4RQQB 4HJGB 5FF6A 5L8LB 4PJEE 2FGWL 4IMLB 1C5DB 1YEGL 4OIIL 4Z95L 3D85D 1LMKA 4IIQB 5EH1A 1OQOA 1NCAL 3C9NB 3K0WA 5F9WB 3H7LA 3CMOH 2K7PA 2ED9A 5JIPA 2BNRA 4HLJA 5ESAB 1J0HA 2VSDA 1R5VB 3MRQB 4PY7A 4LPTA 2DLHA 2BX5A 1J86A 5H2BB 5C2BH 2IPKA 5JHDB 2VDKH 3WXVL 3VFSB 1IEAA 3UYOD 1FFNA 1W0VB 1NANI 3I02B 5GGTL 2Q87A 4ONFH 1ZA3A 2GQHA 1YECH 3CJJA 2BNQE 3ARDD 1U8PA 1TVHA 2HT4C 4N7MA 5DRWB 3Q6FA 1RJZB 4G43A 4OCXH 4K55A 2MSPA 3LH2H 2DQIL 3KLHD 1JHKL 4KDWA 3SDCB 2VZTA 4JN1L 3IGAA 4KI5F 2R0WL 1NFDB 4NBZB 2UYLA 4CUCA 4P3CH 4ALAH 3IKKA 4LQ1A 3I50H 1MELA 4NDMB 1XR8B 2APXA 5HYJA 2J6EH 4QRRB 3WNNA 4ZVTA 4J12A 3RWFB 4UZGA 1C8PA 2ZCKL 5HSFA 2ZJSH 3T3PF 2C1OA 3EFFA 5JUEH 3TPUA 5JOFA 3G5VB 3BZFB 1R3KA 4JFPA 4XHJD 4FOMA 3EYOB 4RRPG 1FFNB 3OKOA 3D25A 4HFWB 2ZSWA 2X4SA 4K7FA 3EOTH 1FRGH 1LO3L 4EOWH 4NBXB 1LD9A 1CD1B 5FOBA 4D0BB 1RHRA 3JWDH 1RHUA 3GB7A 3AMLA 4AEHH 1U8MB 5L88L 3OAYK 1NAKH 1MFDH 1RVFH 4LLYB 3MR9A 3FFCB 3HR5B 1WWCA 3GGWA 1PG7X 3QUZD 1NCCL 2DQHL 3P11L 3T2PA 1KCSL 5SX4I 5C0DB 1QFWH 4JM2C 1ETZB 1OAYL 4UOW0 4F33A 3DURA 1RUMH 5CLTA 3VXUE 5AEAA 3MSPA 3UZVB 1FG2B 5T1DL 4AK1A 5ILTL 3CVIL 4L29A 3ZYZA 4NQCE 1OTSC 5HYQA 2OR8A 2C1OB 2DI8A 2OL3L 1T2JA 3O6FA 3P0VL 3T0EB 1EMTL 4ZD3H 4PRDA 5EOCL 5GGQH 3HZVA 4N0RA 3IDUA 2WIIB 2QL5A 1SM3H 4X9HA 4LLVB 1UH3A 3M17A 4PJ9A 3X17A 4QU8A 3FT4A 1QBMH 4UI2A 3REVB 1IC7H 1J1PH 5EZJA 1BLNA 5GGTA 2ZPKL 3VW3L 4HWBL 5GRZA 1FC1A 4PJHA 1OB1A 4NKOB 4JY5H 1ODAA 4JQXC 5MEPA 2JJTC 1AQKL 1T7WA 3CC5B 3A67H 1TPXC 2LV4A 1T0MB 1JV5B 2V17H 5E5MA 4K9EH 2L4OA 1KEMH 2AQ1A 2LTQB 3H0TA 1MCJA 2CSPA 4N0UE 4XVUD 3AAZA 1G7IB 2QL1A 5IW3A 2AI0L 4DQOL 2XYGA 4ZYKA 4MNQD 3IFNL 5MHSE 1G9ML 5IF0B 4R97C 5TFSH 1FJ1A 3EFDL 3DUUB 5D7JA 3RWGA 4PRBA 3LRSB 3RGVD 1G0XA 1WFNA 5KW9H 1S7TB 4U1JA 3CSYA 1Y6MR 1Y6KR 4JDVB 3GBML 4MQSB 3H3KA 5D1QB 1GCFA 5E2VH 2OMBA 4TNWK 3SKNB 1KTKE 2PXYD 4ZUTA 3FT3A 3RWJB 1ZHNA 4JRYA 3H11A 2J8OA 1MI5D 5CLWA 1R24A 4UBDC 5FK9A 4HWZA 4NRYA 2Z35A 2HAZA 1J1XH 1F8TH 2BRQA 4CU7A 4OI8A 3OXRA 3K8MA 1EO7A 2X9XA 1G7QA 4ELKA 4RFEA 3QWRA 3QDMD 5FM4A 2YBRB 3FQTA 2F54B 3V6FA 2MHAB 5EA0H 1FSKB 3O4LD 1I1YB 1NFDF 1X4ZA 4A2MA 3ZTJG 3F7VA 4WWKC 5MENA 2R2CA 5KVFL 3JTTB 1XGPA 3WFDL 4UOJA 3QCVL 4XVSH 5T5NG 1UT9A 3ROOA 1KIRB 4J3OC 4PJXB 4QTYA 3D39D 2B1AL 3ARFC 2EE6A 2UWEE 4XAKE 1MJJB 3TJHC 2WM0A 3FRUA 5DJ8A 3MLPA 4K8RC 3RX7A 2P8PA 4Y4HC 1T66C 2VXTL 3LSOA 5CINL 1I3VA 4RDQG 4NFCA 1FH5L 3ULUH 5FGBA 1ZGLB 3OXRB 3HN3A 1OSZB 3CFKB 5I6XC 2CJXA 5E70A 2VDNL 2R2BB 3RY6C 1F4XL 1ZHBB 1TZGH 1GZPA 3LDBB 5KG9A 5DZLA 1D5ZA 1LO0L 3RKDC 1NMCB 2R0KL 1MFEL 2GTZA 4MQXD 4NP4H 1FORH 1RWXA 4S1QH 3ARBD 2HKFL 4U6YB 4JRXA 5IJVA 1FYTA 2DTMH 5FUCE 1V7NH 3SDXA 3D9AL 4AL8H 5J9PB 4PRPB 5INDB 5I0ZA 4OZHA 1I8MB 5BJTA 1SEQH 4MXVE 2DAVA 3ZTNL 2VYRE 4Q6IA 1G9NH 3VG0L 2VWEC 2IH3B 4JY4B 4X7CC 4KQ4L 1FQ9C 3H0TB 1XR9A 4G5ZH 3KVQA 1ZS8A 2W65A 4I2XA 2DICA 4KRPB 1ITCA 2D03H 4MXQD 3FB8A 4WUKL 5C2UB 3IS0X 1I9JH 3QIUB 5E7BA 1CD9B 1IMHC 3H42H 2R29L 2GKIA 4JFDA 4QOKA 3HUJE 3RI5K 2KH2B 1LO4L 3VGHA 1UENA 4PJCE 3GJFH 1N64H 1OAZH 1RSFA 4PP1C 1VGEH 2D0HA 4FTVB 1FGVL 1XF4B 4KK9C 4BSWA 1Q38A 2ARJQ 2HJFB 3VFVB 2NY1D 5A2LH 4K71B 4W6WB 2VN4A 4UV4H 4ZFFB 2IANA 1KB5L 2YD3A 2R4RL 3WNMA 4JFYB 4Z7UA 4I8DA 2H41A 3OKEA 1B4JL 1TENA 1ES0A 3FO0H 1CE6B 2YD4A 4N1HB 3W9DA 5D7JB 1W72L 3IRPX 2K1MA 3F7YA 1WBXA 3CVHA 4PG9B 4XC1L 4MXVF 3RZCB 3QUKB 1Z9LA 5EUOA 2O5ZL 4GMSH 4ZO7A 3VFMB 1VFBA 1IM9B 5IEHB 2PO6C 5ABDE 2VIRB 4QUDA 1C5CH 1IAIM 3RWDB 2YUZA 4HUUA 1JHLH 1BGXL 4HBCH 5BW7C 2YPVL 1QX3A 3O0RL 1TMCB 2OTWB 5IT2L 1J7VR 3O4LA 4LASH 2I60L 2GY5A 2FR4A 1PD6A 1RURH 2DQUL 2GITA 2ZUTA 3STLA 4P2OB 1J05B 1GPOH 2D7OA 2VDPL 1U9KA 1UM5L 1CR9H 3GMRB 4RIRB 4XWOD 5BXFB 3BXNA 5ACLA 4IHOA 1PBYA 4TQEL 5CKGA 2W0FB 3QEHB 4DGVL 3G5YB 3GBNL 1YDPA 2X9WA 2IBZY 5DJXB 3QNXB 3SDXF 4UINL 4C56D 1OWWA 3UBXG 3MZTA 5DD6B 2HWZL 1C5BL 1CI5A 2O61A 2D9CA 4ODVL 1FIGH 1CICB 4IRZL 5KN5B 1NFIA 4G43B 3MV11 3ZTJH 1VEMA 2OMNA 1UXSA 5HGAA 3IFOA 3G6DL 4WI2A 1D5BB 3WS3A 3T2QA 1ZA3B 3R8QA 5DFTA 1WBXB 4EN3A 1H3UA 1SVZA 3ABZA 3ZYJA 3SGJC 1RFDL 2AXGA 1XGYL 1PZ5A 2W07A 4OB5H 1MRCH 3FRPG 2VDRL 5SWZD 1HDMA 2XYPA 5IFHH 5I8CA 2FX8H 2PTUA 3N9GH 1Y0LA 1MY5A 3VGFA 3JV5A 4K2UH 4N90E 3DTXA 4P4KD 1WJ3A 1UQSB 4KDTC 4KKAD 4LKCA 1T89C 1IEHA 3I3BA 2LU4A 5K9OA 3V6ZB 3EO1A 2JLLA 5DJ0B 4PJ5A 1BFVH 1P53A 2R1YA 5FA4B 1E6JL 3QO1A 2BK8A 3M1BA 3MBXH 5DLML 4YR6A 1CXIA 4HPYL 2H8PB 2C4XA 1F5WA 4M48H 5ELIA 1OW0C 4ETYA 2V5SA 1FGNL 2C4FT 5DJDA 3LEXA 3L1OH 4WEBH 4LDLB 2UZXB 4Z0BH 5F96H 3R7BA 2Z8VC 3FB7A 4PY8J 3SOBL 4HF5H 2H5IA 4XBPA 3TO2A 4XPTH 3G08A 1WBZA 2FO4A 2AEQH 1KC5H 1IAIL 5CZVL 1FFQA 4Z7WB 1YEJL 4YH6A 2EDTA 1QSEA 4PJFA 3DO7B 3FOMA 3UBXI 5IQ7L 4DVRH 5KVDH 4YBQC 2VERN 3LKOB 3VMNA 3TLRA 4R7NB 2VDML 4YE4H 4X4ME 1EAPB 1YNLH 1FDLH 4O4YH 3K2UL 4ZTPL 3SO5A 5K9OB 3P77A 3O41A 2IPTH 3VXMD 4AH2B 4NM4H 3RAJL 3DV6B 3HUJB 4RMUA 4OLYH 5D1XD 3TNMB 2H1PL 1A6WL 1QYGL 5IWLA 1MH5A 1MRDL 3MRFB 2VLJB 3ME0A 4HHAB 4C4KO 3TCXA 4B7IA 3G6JF 4PGBA 5IMLA 2E5EA 4W6YB 4F57L 3RZCD 4PJAB 4HKZA 5C0AD 4HPOL 4JKLA 4YNYB 3MRRB 2Q6WB 5I17B 5EOQH 3H2WA 4TULH 1N6QL 2CNOA 2ZUUA 2IPUG 4QT5B 1DBBH 5FKAA 3MV9E 4XNXH 1A1MA 2GFBB 2YKLH 3KXFA 3MUHL 4FQIH 2XACC 1LK3H 1WSST 1KNOA 3S34H 1RZJH 4YHIB 2NW2A 3PL6B 4H8WC 4U6XA 1CIDA 4RX4A 3E6FB 4PGDA 1CXKA 1N2RA 4G3YL 4BZ1L 4HEPG 2Z4QB 4PJ5E 1Q72L 4R7NA 2UY6A 2VLMD 3O6LH 4KJPC 4GBXD 1GAFH 1X9QA 2ADFL 4G8FB 4I0PB 1W72B 4NKMA 3VDCA 3DETC 1PGRB 5TQ0H 2E6JA 4X9FA 4P46A 4X6EB 4XPGH 3ZL4H 1KB5B 3F7QA 5ALBL 1X5YA 1G7IA 4X4YB 1S7WB 2DQGL 5E2TL 1I1AB 3MYZA 2QQLL 4DGYL 4P5KA 1WV7T 3TVMA 3BQUD 2WBJB 1AQDA 3CNKA 4ZXBD 1OARL 2B0SL 4EQ3A 3T0BA 1A7RL 2YUXA 3MOBL 3GRWH 1XGQA 4F9LC 1D9KA 1FL5B 1JPSL 4LF3B 4JPIA 3G5ZB 3E2HB 4Y2DC 1NKRA 1KGCD 4APQD 2WUBH 2RBLA 4PGEA 5HHPB 4FQCH 4IOSD 4LRNH 4HBQA 5SX5H 4DUXA 2QEJA 4FFZH 4IRSA 3W0WE 4HFUH 4NBLA 4R4FL 4PLJC 4YDJA 4CDHA 4NQSB 1ZANH 3U4EB 1AP2A 4EUPB 1HWHB 2R15A 5ENWA 2PW2B 2OP4H 1KN4L 3IFPB 2VLRA 3NIGE 4K7PY 1O0VA 3NA4A 1PG7L 5DRXB 3NN8A 3VRLF 2PUQT 4JE4B 5J6HB 4LLVA 3D6MA 2F5AL 2VC2L 2FYYB 5AUMB 3O4OB 4RNRB 4QF1A 4LSZA 2EC9T 3P30L 3KPPB 4MA8L 4LSPH 3UTTE 5FOBB 1IKNA 1QSED 3EOAA 4BFIB 1AKJA 1M1SA 3MFGB 1H3VA 4IJ3B 3NFPB 4CW1B 3FONB 3MNZB 2DQFA 3J8F7 4PJBB 1UG9A 2IAMA 3A6CH 3RKPA 3FT4B 3B2UC 3QT2A 1MHEA 4X6DB 3V7MA 2P45B 1JGLH 2X40A 4S0SD 5TGBB 1KG0B 2YRLA 4M7KH 4J1UA 5TDNA 1MHCA 3IXTA 4TSCH 1JYWA 3C60C 2YMXL 2KUTA 4JFQA 1TJHH 5DJZA 2PXYA 2IEPA 4WHTA 3U0WL 3SDDD 3SQOH 4NUJA 5KTEL 4K7PH 3MLTB 1F97A 2FO1A 2PTTA 1K88A 4ZAKC 3MOQA 43C9B 4NN5B 5ID0A 3PV6B 4LL9A 2I9LA 2LTQC 4AIXA 4LEXH 4P2OC 2VLKA 1VGKB 1T20A 4M7ZB 2XPGB 4LSQH 2VLJE 3DI3B 1SBBA 1I8KA 4U1MB 2ZNWA 4E0RA 5DD1H 4YEFA 1RE1A 2IFFL 2NXYC 1OP3H 1A4JA 4HD9A 1AGEB 2VXVH 1OD9A 4GAGL 4I4WB 1N5YH 1AC6A 4LOUC 2B8OT 4YBLC 3WFCH 5F6HI 3DV6A 3HUJA 5I73B 4U1HB 3PGFH 5J3HD 1UM4H 1K4CA 3PWPD 2DYPB 3VFSA 4Z8FH 1G7LA 2G60H 1JK8B 2E7MA 2K9UA 5E0QA 2X4RA 1G7PB 2RFXB 4PBVC 2B4CL 4I0CC 2HT3D 3DJ9A 4QHUB 3QDGD 5LGJA 4N0YH 2Q8BL 3G5VA 5IV2A 4Y5VC 4HIIB 1BQLL 1NGZB 4GRWE 1INEL 1C5DA 1NMSA 3NTCL 3PQYB 3ZE2E 1C1EH 3CXHJ 4KJYA 5HYSA 2J31A 1ZEAL 3D39B 3ZKXC 5K59E 4Z7UF 1UWXH 3EDEA 1E27B 3RVVD 4PLNC 4HQ0A 1TVDA 5JA9A 3T3PE 5GGVY 5BRZD 4CKVX 3TV3L 4MD0A 1S9WA 1YMMD 1YNKH 3BKCH 4OZ4A 3S36X 4F80A 5HVGB 5J7CC 4G6KH 3DRQA 1WCBA 2H6PA 5AZEH 1GC1H 1U3HC 5IAGA 3O2VH 5EULV 1I8IB 3DX9A 3A0OA 3LKNB 4LU5L 5FHAL 2BVQB 3JV4A 35C8L 5KANI 3WHXA 1G1YA 5IMKA 3D39A 5C07B 4U1KB 3SDAC 1P1ZA 5DFWH 5GJTH 5I2IB 2G2RA 4XP1H 3TH4T 3DIFB 3TT1H 1WZ1L 3BP6B 3BGFC 4PRHD 5DEZA 3UJTH 2H3NB 5HHVL 3VXTB 5JOEA 1I9EA 4CU6A 1XCTB 2BNQB 4XPHL 1ZT4A 2R8SH 1DFBH 2VH5L 3QQ4B 4QTHB 4WO4B 2FBJH 4GSDL 1TCRA 2D7MA 2JB5L 3IJYB 3UTQA 2OXGA 1F6AB 1WLHA 4O58L 5C0JA 1F4AA 4HJJL 5FUZL 3OKDA 1D5BA 1RHJA 2GK2A 2NY0B 3NIGF 3I6GA 4YXKL 5J1AB 5DD5H 4R8WH 2FX7H 1GHFH 4ZUUB 3V5KA 2IAMD 3DXAA 3S3JA 4PJEB 2VLRE 3T1WA 3FHQA 1S5HB 5JXED 3BD4A 3EYVB 3TYFA 4A6YB 2IAND 3ORJA 1DBKL 3ARZA 4ZXBC 4OGXH 1IGJB 1SJHA 4F2MA 1LDSA 3TH3T 4Z5RB 4PD4K 4PIRF 5FFLA 1EIBA 1G84A 1PY9A 4WTWA 1MWAH 4PRDB 4E5XA 4JKMA 1WZLA 4Z7VA 3CFDB 3ECBA 3QQNA 3B3IB 4NC0B 2X44D 2VKXA 3RNKA 4N5DA 4PRHA 2E9JA 1UVQA 5CD3B 1BD2D 1RMFH 3VFNA 4O2CB 1DQMH 2J8UE 4G6JH 4KK6C 4M62H 3SCMD 2D3VA 5D7JD 4NFBA 1OHQA 4X7EC 2NY6D 1T04A 4PGCB 5J1SC 4LLUB 2EH8H 1MCIA 2ZUSA 4G9DA 4PJBF 1M6OA 4HCRH 3U9PL 2D7TH 4QXGL 4WFEE 1BHGA 1U8OA 1KF9B 5GJSL 3GB7B 5E00A 5L2KA 3ARRA 3OJ2C 3HG1E 1S7VB 2OCFD 4JDVA 3O2WH 5DQDH 5SWZA 2F53A 4MA7L 3VD9A 3BX7C 3HI5H 4LMQI 4UT6L 1S7TA 3L3GA 4ALAL 5GZNC 2VZ3A 4NBKA 4JFPB 4CVUA 5IF0A 5BQ7A 1S7UA 5I1HL 3L5JA 4E41A 5EN2B 2C2OA 1QTYT 5D5MA 4G8IB 3QCTL 4HS3B 5D1XC 4I48B 4PLJD 3PD1A 1QO3A 2YXMA 3RNKB 3RDTB 15C8H 4JPIB 5KZCB 4PJ7E 4RAVA 1HNFA 1I85C 4LLMA 5M95B 2VL5A 5CZXD 2R0ZH 1UFUA 5H35A 2DWEA 3IS1X 3ZKMC 2DM4A 1A7PH 2C26A 5EZJB 3AFLA 4N0CD 5BS0D 1FV1A 2X09A 4PJ7B 4XT1C 3K4AA 1N5AB 2IMMA 2WP3T 5F9OL 4DKEH 2VITB 3P3YA 4ODTH 3ZHLA 3HMWL 5LAXA 2FJGA 3VFOA 1Z9MA 4LBEA 3O6MH 4QHMB 1OAYH 1N6VA 4XNQA 4OCYL 5HJ3A 4IRJA 4MJID 2EC8A 4P3DA 5HHXH 4QY8B 1OTTD 2D4FA 4FA8A 5IJVB 4F33B 1AD9B 5FXCH 3IXAA 4X6CE 3VXRE 3GNML 3HI6H 1PVHA 3HTLX 5EOCH 5GGQL 1YY9C 5KVMC 1MF2H 4OTXH 4IMLA 4MLSA 3MRKB 1PFCA 4GQ9L 3JZ7A 3THML 1T83A 2GT9B 3O3DA 1OGAD 32C2B 5K9JL 4HMCA 2A9NL 4XGZB 5D96B 1KOAA 2XN9B 4XNUH 4PJ8B 4QGTA 4M6NL 4HV8B 2MTPA 3OQ3B 1RWOA 5GS0L 1Q9LB 4Y19D 2V5RA 1LGVA 2WV3A 2E6PA 1VFOA 4NC1E 3U0PB 4OD3L 5T33L 3SHSA 1NGPH 2P7TA 3PHQA 2J12B 5FO9B 3T4YA 3LVEA 3HE7C 4K3EH 1LHZA 3O9WB 4WW2F 4JLRA 4AMKL 1TFHA 4HUWB 4S10A 3QHFL 4XNMA 5BRZB 3SKJH 3HPJA 3OBAA 3BKYL 1T20B 3F7YB 4KDVA 1OT1A 3JBG7 2UYLB 4XX1G 2CR6A 4P9HH 3A6BL 4KROB 4PV8A 1KT2A 5IR1B 2WDPA 1SY6H 1U8JB 4ZVRA 5IFAL 1ED3A 4MJIA 5D72L 1R6VA 2QLVB 2OJZL 3S35H 1DQQA 1DQDH 4QHLA 4JQVA 4D3YA 2EZ0D 3AMKA 3VI4E 1U8PB 1J87A 3MLZL 2XWBB 5ISZD 2AXFB 3BDXA 5DO2C 4NT6B 1NLDL 5EFIA 4QHNB 5E6YA 1IC1A 1R3HA 3I02A 1H3PH 4LSSH 5B21A 3LD8B 4NC1C 4J3UA 3X14B 3ILPA 1Q9LA 4FXKA 3L6FB 3P40A 3DROA 1AKJB 4ZTOH 2P24A 1T21B 2VAAB 2AW2A 2V5MA 3VRIA 4JB8A 4JY6B 4M1CC 3TZVB 2DI7A 4QKXB 3RIAF 1S9KC 2P2CA 3D0LA 1T1YB 2CLVB 3QNWA 3EYFB 1JN6B 5C0CD 1RIUH 5D96C 5E4EC 5IG7A 5IVNA 4WU5A 4WEMB 4N8VB 4URTB 1EBAA 3DGCR 4KY1L 4ONHA 2DDQL 4D9LL 2E7CA 4NQSA 1UB6B 1UH2A 5CUSL 4FHBD 3SKMA 4JHAL 2DQCH 3X12A 7FABL 1R0AH 3ROLB 2PXYB 5I1LA 4PJCA 3QFJE 5IVXB 1P4IL 1CQKA 3NFSL 1ADQA 1G9NC 3MLVL 3MRFA 2CLVA 5MP6L 1OP5K 2LABA 5F88B 4ZPTB 1F13A 3CFBA 1N0XL 3KPRA 5FYLL 3HS0B 3G5ZA 1NMAH 5HTSA 1QD0A 4KROC 3U1SH 2IADB 5B38G 1I1AD 2DWEB 1BVZA 5HGHB 5I66B 1K8DB 5FDWB 4KVCL 2FUNB 4ZFZA 5H94A 5TDOA 1OCWH 2R56L 3T2NH 4Y19B 2IQ9L 3MA9L 5HYQB 2WQ8A 2PO6B 2PYEB 4GBXA 5EFIB 3SGJA 2O61B 4QYOA 3BN9D 3BIBX 2R4SH 2BVYA 3MV8B 4YHNB 5BQ7B 1RWWA 1XGUB 1UM6L 1BQUA 1KCRH 4YDKL 2FP3A 3BO8B 1KIQA 4XP9L 1DQJA 4EZMA 2PNDA 5IW6B 1UJ3C 4OKVA 3SGEI 4L3EE 2CDFB 4YHPA 2BSED 4KK5C 4K3GA 1Q9WA 2VLKD 1GGTA 1A8JH 5EWIH 2XZQH 3GSXB 5DD0H 4HIXH 1IGMH 2AQ2A 1P69B 5HPOA 1XCQB 3S4SB 1U8KB 1BIHA 1RZFH 3C09B 3WSQL 5FYJH 5EUOE 1DCLA 5JNYB 4K23H 1XIWC 4POZC 2YSSB 1NMBH 1NUFA 2VR9A 4NRYB 2W91A 3LRHA 1QOKA 5IVXE 1OM3L 4LPVA 1B3JA 1OF2B 1AI1L 3BPCA 5IBTL 2SEBB 3RQ3A 3MROB 2CMRL 4WDIB 1N7MH 5ITBH 1Z0NA 4PG9A 1KB5H 4OLWH 1YEHL 1Q9WB 3VFGH 1J0IA 2XTJB 1BIIB 4U1LA 4EHAA 3H13A 1G7MB 4HIJB 4YHLL 3AB0C 4TOYH 3GO1L 3TWCH 4GW4B 5E2WL 1W72H 3R1GL 3QWRD 4F15B 1KIQB 4X5LA 1ZLUH 5IEKB 2NY4B 2JJTA 4LQFH 5GRXG 5ISZA 1AHWB 4K3JL 5IHBA 1TJIL 2NY2D 4AH2A 4K8RH 3L3HB 1NSNH 1AD9A 4H88L 3LS4H 5MEND 4YBLB 3DHJA 1LWRA 4MD5A 4YHYB 2VDLL 3Q6GL 1I1CA 1FFOB 1IGIL 1M71B 4LCYA 3WE6A 1CFBA 5I1KL 2COQA 3PD0A 3S5LG 4HLZH 1I7RB 1G7JA 3C2AL 3IBCA 3PP3H 4FRWA 4M7JL 3QIBA 4E5XB 5D93B 5EBGA 5D1XA 1EEZB 2IGFH 4NIKB 4JJ8A 4LEOB 1KELH 1RZ8B 4G6ML 3DMMB 3GKWL 1IC5H 4M5YL 1MI5A 1HKLH 1TPXB 4E42A 4YZFF 2FB4L 3S96A 4LLMB 3RNQB 5F7UA 4QUHA 4X8XA 4XRCB 4QULA 5IMLB 3RPKA 4K3DH 3KHQA 3V7AE 3UO1L 2VLJA 5EB9A 3G6AA 1ONQA 1FYTB 4LHUG 3QO0B 3VGAC 1VESA 1WT5C 3FCTA 3QG7H 5BRZE 4RX4D 5CJ5A 5E9DB 2BC4B 4GKNA 3WS6C 4MNQB 4AYFA 1CF8L 4PJ9D 3UAJC 2NXZB 5HI5D 3FFCA 5CKAA 1C7SA 1R3IH 3KR3H 1U58A 4BFGA 3HNSH 1E4KC 3NCYS 2X41A 2AJXH 4Z7QF 3CXDH 1D3CA 5I9QB 5E2UL 3HAEB 3OZ9H 5I74B 1EEZA 3BWAA 4X6DF 2IC2A 2ICWA 4M7LL 1S9XB 3OV6A 3V7AG 3NMEA 5IFHL 5CWSA 4O02H 1NGXA 2CLRB 4NKIL 3MCLL 4TUJA 3AS2A 1DDHA 3RL2A 3OTTA 1OLZA 2QADC 2AXFA 4GRLD 3QI9C 4XP6H 1UZ6F 1A64A 1A7OL 1V7MH 3BT2H 4H8WL 3CCHA 3WXWH 1AO7E 4C83A 2BVOB 6FABH 4Y5YC 5CSZB 2Q7YA 1E6JH 3QUZC 1FZJA 3U46B 3VXSB 3ARFB 3X13B 1TZIA 3K81A 4I3GA 3UYRL 4NWUH 4YHKL 1FL6B 1T7ZA 3KPQB 1KIUA 5E95B 4V1DE 4GJTB 5L7XH 5HXMA 3HPJB 1CFTB 5D71H 1BQHA 1QACA 2AXJA 4XAWH 2CDGB 3BHBB 3PGCA 4FP8H 5HPMB 4RIRA 5BXFA 1HIMH 4EBQL 4JR9H 4N8PA 2GJZA 3TFKD 2HFEA 4OZGE 4AT6B 1JWSA 2J5LC 2FWOA 4X99B 1S9XA 2F15A 1KC5L 5EU5B 2BOCB 3I9GH 2P42B 3QO0A 2QADB 3BDYH 3JWDC 2C3GA 5IKCA 2Z31A 4PPTA 4OFPA 2W59A 4OQTA 2YA1A 1GC1C 4NUJB 3T65B 1GYAA 2MCPL 4KUZL 2OR7A 1KYOJ 5EOTB 1F58H 1X5LA 1JZ3A 1IT9L 5DMYA 4KTDH 5ALCL 1B6DA 2P1YA 4J1UB 4JKKA 4OLYL 3SCMA 4BKLA 2X2YA 1KN2L 1MI5B 2QLJA 5GGRY 5KN5A 1VKXB 3FT2B 4TTDC 3QJFB 1KULA 2ADJA 5HDOA 4Z0XA 3FB6B 2FEDC 4Z7NE 1ZVYA 1N4XH 3PCXA 5J56B 3OGOE 2DOCA 5EU6D 4KK9D 3E6HB 4QHKJ 3GMPB 2EH7L 5JDSB 5LU8A 3IDYB 1IEBB 2RCSH 3HZYB 2YD5A 2WWMC 3WN5B 3H9YA 4MD5B 4GG8A 4P5MB 4OJFL 3MV7E 4NHCL 1SBSL 4PFEA 3W0WD 5FHBL 3D0VB 4TTGA 1X44A 5D2NE 2DLFL 2J8UB 4H5SB 3BESR 4MSWA 4HKXA 4XHQA 5CIPH 5E1HB 1PX4A 4LK4A 3ZYOA 2AJVH 4WU7B 2EXYC 5MENB 4JDZA 4U1LB 3UBXB 1CBVL 5E6IB 2ADFH 1OAUL 3AS3A 2Z31D 4LP4A 3WIIH 2XN9E 1NGWA 2JJVA 3PHOA 4AEHL 3B5HA 3G6JB 4RGNE 4UUJA 5DWUL 3WKML 2HTKD 2E8ZA 2BVUA 3L3HA 5TDPA 1U0QA 4MA1C 4Z77A 1QKZH 1L9MA 2CIKA 5GRUH 3KJNA 4IOIA 3SGDI 3LIZH 2VLRB 1AGBA 3QDGA 4EHNA 3VXNA 4NQXA 1B0RB 1FPTH 3K8LA 4X8JA 4XPAL 3DV4A 4H25B 1CE1H 2YEZA 5E9DD 2XZDA 4DCPA 3SO3B 3VE0B 4PJ5D 4U1JB 4I3RH 2NY3C 4HX1A 4Y4KA 2QSQA 5D7SH 4PRBB 2MPAH 2EXWD 4DVBA 2C3HA 4M03A 4XP4L 3IB4A 4LF3A 4TVPL 4QU0A 1L7TH 2CRZA 1J8HD 1JMXA 3SDAD 3TA3D 1A14L 1KLGA 3EIFA 3L95B 3S37L 4RGNB 5C0AA 2EDNA 4YDLC 2ZUWA 3CFDA 4LIQH 3WDIA 3EZJB 1QSFA 2DQTL 3MBEC 1J8HA 3SDAA 4GRLB 3QZWG 5B4MC 2DM3A 4NNXB 2X4QB 1I9IH 3F7PC 5ICXA 1TVHB 4MAUH 1KJ3H 4X80L 4M6AA 1NDGB 1VERA 1YPZF 3MXWL 4QU5A 4YPGB 3EYVA 3VXMA 1BP3B 4P2YA 2XQBH 1HH9B 4U6YA 3FZUC 2NY4C 5GS2H 3RRQA 5C71A 3KLDA 4QWWD 5FIEA 4X9GA 3BUTA 1L0YA 1UJTA 2XQYK 3HZKB 4M4RA 3O2DA 1HHJB 4XCCL 3VXNB 4NOFA 5IESL 1QNZH 4XCNB 4MS8D 5SV3A 1KPVA 5F88A 1G6RA 4D3CL 3GGWB 3AXLA 4LVEA 4H0GA 1DQLL 1P6FA 5DUML 5FKPB 1QRNE 8FABB 3V4PH 2YRZA 1PYOA 1MVUB 4TTDD 5ICYB 5D6CA 2ORBL 4OSUL 1ACYL 3MYJA 5KSAA 1EPFA 1H9VA 3L3OB 3GUTB 4XP5H 2F53D 5E6ID 3P4UA 2OR9H 1P2CB 4B7LA 4MNQE 5MHSD 1GQFA 4PJXE 5I9TA 1FN4A 2YXFA 4LGRB 4HUMB 2X4QA 2R2EB 4M43L 1FYTE 2KDGA 5L9DH 1ZHKA 1MEXH 4XMKH 1Z3GL 1KJVA 5AZ2H 4ZOBA 1T1YA 9CGTA 1YPZE 1S9YB 1UXWA 4FZ8H 3WN5A 3EW3B 4WV1B 1NC2A 4FQLL 3PWNB 4ONOA 5JORB 3L7FA 4N0UA 2VXTH 2AJSH 2P24B 1S7RA 4J3WA 1RWKA 3QQ3A 3TVMB 3BPLB 3ULVE 1S78C 4X7TA 1NBVH 4XMPL 4MD4A 1CLOL 4I3SL 1T5XB 4R4BB 4WFED 5FO8B 4BQ8A 2GK0A 4MJ6B 4HQQL 1N3NB 1HQ4A 3MRLB 3LD8C 4X6DE 4NKMB 2FJHA 2HBYA 1WUNT 3IVKA 2R0LH 4HIIA 5E8DL 1JL8A 2NZIA 3QDGE 4ZNEE 5T3XH 3OAYH 4X9BA 3KNBB 3C60D 3UTPD 1QBLL 5CWSB 5DQ9A 1H3GA 3DVGB 1FNSL 2CRIA 2VKWA 4PREA 4Z7OF 1QLFB 3BKCL 2AXGB 1EO8L 4KHXL 1GRWA 3LKSA 5DC0A 3KAAA 1GC1L 4PJDA 1V3MA 1X4XA 4JG1L 3MLSL 5KANG 5BMFH 1CD0A 3P4NA 4I5BA 3HCVB 3IYLW 1KBGH 2YPKB 3BW9B 5TE7H 4IDJL 1ZVSB 1REIA 5E4IA 6CGTA 2X10A 3RKDD 1LD9B 4N8CL 4Y4FD 4Q97A 3REWA 4GG6F 4C4KT 43C9A 2OK0H 2BJMH 2BHZA 1PYWB 4PG2C 4PRIA 3MFFA 3QAZC 1AFVL 1VFMA 4H1LB 4S2SA 2CNKA 1E4WH 2CKBB 4YC2C 4U6VH 5DJZB 4JN2B 3CLEL 3QEHA 3CCHB 1UXSB 2VZOA 2NYYC 5DC4B 3QXAB 5EIVA 4X6BA 3OB0K 4UT7H 5T1KD 5HHQA 3MMEB 1KG0A 4ZUWB 2DMKA 4NQUA 5JPNA 5HYFA 4XWGL 1NGYA 1P7QB 2H32B 4PR5B 4F9LA 3F62A 3DECA 4DKAA 3C60A 3FONA 3MNZA 4KJQC 5LQBL 4N0CC 4PYHA 3WUWG 3MJGX 3RHWF 1RUQH 3FFCE 3H3PH 3RJMA 2C1PA 3UZEA 2J2ZA 1H3WM 3HKFA 4WFHE 3D18B 3NKFA 2KBGA 2Z0BA 4HKBA 4Y19E 2VRAA 2GJJA 1GOGA 1VADB 1EHLL 1ZOXA 1MPAL 1DBAH 4OFVA 3WV0A 2AJ3A 2CO6B 1K6QH 1YEEL 5I71B 1E28B 4XTRD 5FM5O 4WNQB 3R5JA 2ESVA 1T22B 2VR4A 1MHHA 4HS3A 2AK1L 3EO0A 1DANU 1HCVA 4DGIL 3AU1A 2UWEF 4U1GB 1R5WB 3AGVA 2NTFA 4U05A 4POYA 2APFA 3D5OF 4D9RD 1HDMB 4HCRL 3U9PH 2YUWA 5HDBE 3NVQA 4PJAE 1T04B 4X5WA 4KTEH 3MRBA 2XZAL 1FBIL 3LEYH 1C5BH 4JJEA 2P48B 4KJWC 3WIFA 1RPQA 2NXYD 4UQ3A 3RGVA 4FQJH 4RWYL 5I1JL 4I1PA 3IDYC 4PS4L 3TBSB 3DMMD 1GFWA 3C87A 3UTTB 1AGDA 3FKUS 2RAMA 3VXRA 3P73B 4FQ2L 4TRPH 2EYTB 5DMIH 2J8HA 1VA9A 3QHZH 1KB5A 4ZFOB 3ZDYE 2HBZA 2V9TA 3I75B 5DYOA 3FQRA 4OZGA 5A2KH 1W72A 3MV8E 2GUOB 4CNIB 1JZ7A 1EUTA 1MRCL 3FQXA 5FA3A 5D6CB 3MNVA 3SCMB 4BKLB 4MXWL 3WFEL 2A38A 3PWUB 2HTLD 4ODWB 4LLWB 3T0WA 1RHQA 2X1WL 3J7HA 5DRNB 2FJFB 2RHEA 3OR7A 1KNOB 4I0PC 3N1MC 5I8KH 1JPTL 3OR6B 4OCWH 5LGKA 3IJYA 3UTQB 5D1ZA 1ONQB 1HYSD 3BP4A 4J8RB 1D9KD 2G9HB 1RUPL 4HXBL 3EZ8A 5HDLA 3UROR 4DAGL 3S5LB 5BVPL 1NCDL 4FXGB 4O2FA 4U6HA 4GRLC 1XCTA 2BNQA 3LEVL 4JZJA 4HS8H 5IUSA 4X6CF 3V0VA 4X7SL 1EFXA 1I75A 3ARTA 4HPYH 4PJIF 1FVEB 4MJ4A 3EOBA 3UPCA 2XRAH 3GJEA 4AEEA 2G2RB 2QQQA 4XCFH 3NFNA 1IAKA 2Y7QA 3SY0A 3BIAX 5BV7C 4HGWA 3OR7B 3QXUA 1YEGH 4Z95H 1MF2L 4PJCF 2X4OB 3VXPB 1KACB 3DVIA 4HGKC 1T03H 2E8YA 2NCMA 1A0QL 3L7EA 4D3ZA 3C5ZB 2J5LB 1BWMA 3FQXB 4EQ2A 3ARPA 1A5FL 1FCGA 2PO6A 3NPZB 1F1JA 3CFCH 3DYMA 4RMQA 1QSEB 1ZV5A 4JHWL 3P45A 1IC4L 5DYOB 3FQRB 3BH8A 3PGDA 4HH8A 4U1KA 2XA3A 5JHDE 2YS4A 4ZPVA 1QHPA 3KPPA 2P5EE 1AO7A 1BBJA 3BISA 1AJ7H 4W70A 4PJXF 1NGZA 2PF6A 2VSCA 3N85L 4S11A 1EH9A 3BPNC 5JOPE 1RWVA 3UJIH 3NABH 5ENWB 2YWYA 1FZOA 4ODSL 4HWBA 5HDQL 5KVGL 5MI0C 1C16B 3CAFA 3CU7A 3TH2T 2ILLA 5L2KD 4ELMB 2V7HA 1BX2A 3OX8B 5GRJL 4LMQE 1RQ5A 2GI7A 3KLSA 5I1GH 3DTXB 4RMTA 3HFML 5HYIA 3PWJB 1A1NB 1CXLA 3QUYB 5DA4A 1T4KB 4KKNA 3DBXB 3O11B 3WUWB 1Q72H 1XGQB 4OFIA 2AJYH 4FZEH 1GAFL 4YX2H 4ZSOA 4R90L 2Q3AA 2FIRT 4JRWA 4FEAA 1M4KA 2CLZA 1QRNB 4WWID 1KXTB 2AV1A 1S5IL 1JGDA 3GSRB 4KI5D 4LSTH 3D0VA 4MGXA 4HKBB 5BVJA 3HZMB 4QRPD 2J7LA 1XMWA 4OQTH 1SQ2N 3C8HA 5I8OL 4R9HA 2HLFD 2YHGA 3RU8L 3TIDB 2WBKA 4YXHL 2IAMB 2JJUA 5ID0B 1ZAGA 2V2WB 3MUY1 3PP4L 4JDTL 2AJUH 4WHDA 4MX7A 3LKQB 2BFVL 2YZ1A 3MJ9H 4GG6A 1YMHA 1JGVL 3ZSTA 4IRJC 2Z92B 3ZKSD 4LSVH 2H9GB 4P4KB 5TE6H 3S98A 1N0XH 4PJCB 1CK0H 3HHRB 4YDIH 4DCQB 4WUUE 5LWYH 3QQ9D 3RUGF 3QDJA 5J1TC 1FZKB 3QIWB 4HWBH 1AE6H 3V0WL 2W9EH 1SJVA 4BQCA 4PJBA 2BNQD 2Q3ZA 5JO5A 5IK3A 4NZTL 3D25B 2IQ9H 1HQRA 1OGTB 3ALPA 1I3OA 2Y0BA 4N8VA 4YC2B 4DEPC 1KN4H 4K9EC 4XAKD 2DJUA 3K7EA 2X4NA 7CGTA 3R0NA 1T4KA 2P4AB 2VNCA 1R5WA 5T3ZH 1XH3B 5C0CB 4LLYA 5IM7B 3RVUC 4FDLA 1VPOL 4P4KA 4W68A 5KS9B 1JPFB 4Y2DA 5L6YL 4WO4D 4OF5A 5FM8A 2UWEA 1QRNA 3RL1A 3IXAB 4H26B 4O51A 3Q5OA 3HMXA 4AIOA 5C0IB 4Z7UB 3TT3H 5HGBA 1TTFA 3C6SB 3CSGA 2Q7YB 3U46A 3EYOA 3GZKA 4IRJD 4MVBC 3UTTD 5I75C 1YMMB 4J3XA 4PJGB 5GS1A 2Y5TA 5L2KB 1BPVA 4N5UA 5LAXB 1VENA 4TVPE 1JF6A 5D6DA 1I51A 2WW8A 3MGOA 4QXUL 2WK2A 4R4BA 1F8TL 1T5XA 5FO8A 1UACH 4NWTL 3O8XA 2DKSA 4UTAL 4OZFA 3WIHH 1Q9OA 4WV1C 3N50A 4K7PL 5KAQF 5E99L 5C07D 3QUXA 1BD2B 5FGRA 4GH7B 2BY1A 5DR5L 5HHMD 4PJHF 4PRHB 4M02A 4MZ3A 5ESVA 3B83A 1JWMB 3CH1B 3SIRA 3GO1H 5I8EA 3DEKA 4I2XB 2XA8H 5BOZG 3ZE0F 2BSTB 3PL6A 3VH8G 1RWPA 4RAHA 1BMQA 4WWKA 3CIQA 2AEIT 5T1LB 1A1MB 5F93C 3SDDC 43CAA 3GSQA 1P2CA 4M8QB 3RFZC 1HSBA 2B4CH 3C9NA 4JZOA 3QZWB 4YHZL 5GGRB 3ZT7A 4HXAL 3HE6B 3LN4B 4GAJL 5I1CL 1SYVB 5F21B 1BQLH 2BSRB 5D7IB 1NH6A 5DJCA 1JHTA 4JPKH 4MDIA 1YEDB 1D5XB 5CGTA 2DD8H 1C12A 2OL3A 5C0EA 4MA3A 1IGCL 3HB3C 1JMZA 5D4QA 4JB9H 4ZS7H 5FYLD 2A6JB 1T2XA 1HSAB 3MXVH 5L0QB 3FQUB 5GS1C 4LGPB 1YNKL 2CRMA 1CDYA 4LPCA 3WEXB 3S37X 4ZUSB 3KDMA 5B4MD 5E6ZA 3FO1B 5D1ZB 4HG4K 1QVOA 4EN3D 1N3NA 4HQRA 4ORGB 1BZ7A 4CBPA 5ADPL 2V2XB 4KQ4H 1QFWM 4TUOB 3SIPA 1P4BH 1X5ZA 4WI9A 5TE4L 1G1CA 3HNSL 3R0MA 4KRPD 5D8JH 4IYRA 4L4VE 3MJ8B 5HHOD 2F54A 2MFNA 3EYSH 4O9HL 2OQJB 2D2OA 4JO2H 1D6EA 1Y6NR 3DO7A 4PJGF 1YYLH 4M7LH 2EO9A 3CDYA 4LPWA 2AK4B 5AD0B 2R8SL 1MCHA 5D7KD 5EO1B 1C12B 4D8PB 4KMTL 2ADIA 4OM0H 1JI2A 3L5XH 4Y4KB 2ARJB 1AGFB 3VU2A 5HD8C 2F19L 1A7OH 3BAEL 4B53A 5JZ7D 1H8OA 5E8OB 1P6AB 1CL7I 1U91B 2CPCA 3D85B 2X4PB 1R5VA 4XVJL 4YXLH 5IVOA 4ODHH 5IGXH 4K8RD 3QUML 2R4RH 3B9KA 5C0BD 4WNQA 1H15B 2W9DL 2V7NA 3N0PB 1MFCH 4PJ8D 5CILH 1I7ZB 1PKQA 2XI9A 1MCOH 4P99A 3T0XA 1CL7H 1V05A 5D71L 1L6ZA 1YY8A 1I3GH 3RTQB 2HVJA 2NTFB 4XNZB 5E08L 3KPOA 5TQ2L 5IM7A 5LJYH 3VFNB 1UYWL 5F8RC 1QSFD 5KSUA 3U2SB 3GHEH 3F5WA 1T5WA 3VFWA 4E41E 1X5IA 4HBCL 5GISL 1GXEA 3I9GL 1VGKA 4PUBH 5JW3L 2PETA 4LASL 1CFSB 5JW4Q 1PX3A 1KJMB 4M62L 5DVKA 2CJYA 5CJQL 5AYQA 1NBZB 5L8JB 2FZ3A 3GJFK 4KJWD 5D93C 2ED7A 4QRRE 2WINA 1A6UH 2DQDH 4JVUA 5EU3A 2HRPH 5FGSA 1NFDE 1RZIB 1NGQL 1E6OH 1IEBA 3WE6B 4Y4HB 5BOPA 1ZT1B 2HT4D 2R69L 1J5OH 2DQJH 1B0WA 2ITCB 1A6TB 2C3VA 4M1GH 4PJIE 3KPOB 3DVNA 4JFZL 1K4CB 4HKJB 4R3SB 5SV4A 5J89A 1URLA 2EEDA 3UTSA 4CAGA 4U7KA 5DFVC 3UC0L 1YEKL 2LE9A 3EGSA 3C5JB 4G80A 3PWPE 4Y16C 2DLGA 3CPLB 1B9ZA 4PJEF 2O5YL 1JYNA 4I9WD 3FN0L 4X4XA 3DI2B 5FOJA 5I1IH 8CGTA 4JY6A 4P46D 5ACMA 3BP6A 3ILQD 1RFDH 2ITDB 4ISVB 4XPFH 1CYGA 1NCBL 4Y5YA 2AK4D 3LZFL 5DHYA 3V52H 2CIKB 5F72S 1LE9B 3KNBA 3QDJB 1JVKA 1X5HA 2BHYA 4BUHA 1RUAL 4RWHA 1VFBB 3KPSA 5IEHA 2F58L 5HHPA 5K9KA 3D6GA 1KJ2L 4HT1L 4OLEA 5EUOB 3KJ4C 4JN2A 5EO9A 3I2CH 1A6VH 1CGUA 1QHOA 1MHEB 4I1NB 3EDKA 4HVAA 4HW6A 4AM0B 4H20L 3NR2A 3L3KA 4ZUVA 4KUCD 12E8L 5D1ZD 4PJ7F 5CIPA 4M48L 3FQTB 2YBRA 2CGRH 5GXBB 5BCAA 4BFIA 2H2SC 3G5XA 5EBLA 4OGAC 1QR1B 3DYPA 5DRWA 3Q6FB 4NZUL 1A7NL 2FJHB 4I3RL 4M6OL 1QVOB 4N9GB 1HQ4B 4PGJA 5T1KA 1JGEA 4F7MA 1XF5A 3T0AA 1IQWH 4X4YA 4Q9QL 3CVHL 4DZBB 3SEPA 3R7NA 2G75A 4TVPH 2HVJB 3PJSA 2BXYA 5ICZB 1WT5A 2ZUYA 5F7EL 3UDWA 3NCMA 1D5MA 4PRPA 3T2OA 4Z0XB 1OPGH 2DYPA 4JR2A 4PB9L 3HE6D 4KHTH 4BK4A 2EKJA 2HT2D 2A73B 5DQ9B 5T3ZD 3K4DA 1EUUA 3GFUA 2DQTH 4JFHE 5C6TL 4L8CB 1OQXA 2H2PD 2XYHA 4X0KB 2X4PA 5A43C 4JG0L 2A6IB 2DQEL 2Z31C 1KB9K 4EDWL 5I30H 3EDRA 1I1FA 1BEYH 2KL6A 3HNVL 4OZHF 5CMAA 1AD0A 2YRPA 3O6FC 1KJ3L 3QXTA 4HZLA 2XZCH 3P4MA 4Y4HD 3GSUB 5FGBC 1DSFH 4DK6A 3GJEB 5GQBA 4ETQB 3ET9F 2HTLC 3RY5A 4ZS6D 3BGMA 4BK5A 4Q9BA 5IBLD 4GUPB 5GGSY 1JN6A 2J6EL 4WRLA 1YQVH 2QHLA 4XNXL 1PAUA 5F3HA 5TF1H 3HNTH 4U6TA 1JXQA 1S7WA 4GRWF 5KSBB 1BBJB 3UJJL 4PJFF 2YPLA 2YK1H 2W60B 5JUEL 1EXUB 3I3DA 4YAQA 2NX5E 4HJ0C 3C6LD 2AS5M 2VL5B 1IBGL 4RCAA 1WITA 4PRNA 3TN0A 3CUPB 4W4NA 3BWUC 4RAVB 1FFOA 1M71A 4LCYB 1ND0B 4XWOC 3OJDB 3OKNA 1DVFB 4LCWA 1NMQA 4ONGL 5TQ0L 2P8MA 4Y4KD 4GXUM 1NAKL 1YC8A 5INCA 2HLFC 4DFHA 3VH8A 2X6MA 4IBLT 1DN0B 2R9HC 2B7DT 2DLIA 4G8EB 4WCYL 1JBJA 3NGBC 4FG6C 3SJVB 4TSAH 1FO0A 4TVPD 4ZFGH 5L0QC 4EUPA 2OM5A 2EIZA 1AHWC