1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GINGIPAIN R
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
4AL8L 5C2BH 3RUGF 2RGSA 5FM4A 1FNAA 1TJGL 3AB0C 1MVUB 4YFEA 1JHTA 2HFGH 4P23C 4C4KO 2BY3A 1W0VB 2C3GA 3WD5L 3X14A 2BNRB 5IF0B 4N8VG 5A16B 4OLVH 5GHWL 5JXEA 2ORBL 4ZFZA 1KENL 4G6JH 4JFPB 1A3RL 4FQCH 2AXGA 4FG6C 1P7KA 4JZJA 2BZDA 2R4RH 1YDPB 4H88H 2OP4L 5JIIA 3MRIB 4X5WA 5ESQB 2GEEA 4M6NL 4X6FA 5DJ2A 3CVHB 2XG5A 3I6LE 2NY4B 2IFFH 1NANH 4PRDA 2JELL 4OUOA 3OBAA 1YEJH 4OCNC 1F3DJ 4XPTL 25C8L 1U2HA 3IDJA 2YXFA 3IDIB 2R0ZL 4QHLB 4UV4L 1UJ3C 4LCYB 1K4DB 3WIHH 5A3IC 5GRJL 3WIIL 1GPOH 3ZHKA 3E4CA 3RP1A 3DMMB 4Y4FA 5E99H 1TIUA 1JPSH 1R3KB 5DR5L 1CFQB 4M5YH 3KPNA 2YPLD 4K3HA 3T2PA 5CD5C 2YA1A 3V5HA 4C57C 4YNYB 2ZG3A 4QUGA 3GRWL 3MRGB 2EH8L 2FX8L 3VXOA 1EAPA 3B9KB 3F8UB 1NMQA 5KW9L 4UIKH 1D5IH 5FYJD 2IGFH 3H9HB 3VE0B 4Y5XC 2P7TA 1DQMH 4A6YH 1NBQA 2C2ZA 3ARDD 4W4OA 1I7ZB 3T8XB 4NQDD 4M7ZC 2IFGA 1K3ZA 2A38A 1G9MH 3QB7C 3OB0H 3QDMA 2PO6A 1FFOB 2E5EA 4WTZG 2UWEB 4L3EB 3O8XD 4L4TE 3TO2A 2N7AA 4PJ5E 4CNIA 5IBRA 2CUMA 1PKOA 5JR1L 4M61A 4M4RA 5FB8B 1DJSA 5J8OA 1XCTB 1LE9A 5CSBA 2G5RA 5CBEB 1IAII 2RR3A 2H32A 1K4CB 1JHKH 4S1DC 5D72H 4Z77A 4RDQF 4XPHL 1AGDA 5JQHC 2FECL 2VDQH 3FB8B 3KPMA 2HMIC 1GGCL 3RJMA 3OAUL 1MCPL 3TA3C 3TBTB 4WO4C 2HJKB 2V9RA 2EDEA 2GJ6A 5CD3B 3ULUL 3EUUA 2MPAH 5T3ZE 3V6ZA 1T83C 3CUPA 6FABL 4IMKA 3WYRA 1MQKH 3H0TA 1A6UH 5FYJH 2K3TA 3BH8A 4RFNB 4F33A 3PQYB 4I3SH 1DDHB 3RVWD 3BP6B 1ZHNB 2R0KL 1AH1A 4S11A 3B9DA 3NZ8B 3QXDA 5CJXA 1Q0YH 2M2DA 2J8HA 1FZOB 1CFSB 5IMOB 4ZUUA 2F54A 4NOMA 4P57A 3RBSA 3MRDA 3DEHA 2A9MH 3B9VA 4MLIA 3QDGD 2E8YA 1TZIB 4NNPL 5DJ6B 1EHLH 3CH1A 3IVKA 3DRTA 4CDGC 1T0PB 4I3RH 2PF6A 4X7DC 5MP6L 1H5BC 4NO0A 5DF0A 1FSKC 2IBGA 4X9HA 5BS0D 2RHEA 5ADOL 1OGTA 4MJID 1A5FL 1F6AB 3KYNA 3GI8L 4YGVA 3GIZL 2VLRB 4D0CB 4AIXA 1JGUH 1KYOK 4CMMB 3MJ9H 4ZVTA 3GFUA 3OG4B 1MELA 3H3PL 4HWUA 1RY7B 5CEZE 5B39G 1DVFC 5TDPB 1QQDB 3STZA 1MCCA 4NN6B 5EN2A 3SGEI 2I9TA 1Z9MA 4LCWE 4JM2D 4NNYB 1NCCH 3OR7B 3KPSB 3RGVA 5IAJA 2A6KA 2AJUL 3LOWA 4PJGE 4U1KB 1BQSA 2OL3A 4X98A 5DVKA 5KSUA 3NFNB 3PV6B 3FT3A 4BSVA 1BFVH 2PYFB 5GSRB 2F5AL 2VSCA 2D2OA 1RUAH 4PR5B 5BZWA 4EJFA 3TVMD 4LVEA 3NBNA 5DMKA 5DT1L 2NY2B 1PZUB 4LIQL 1FGNL 5HVHB 3NAAH 1S7TA 1VKXB 5DJAA 3BWAA 3EJYC 2G9HB 2LU7A 3LAFA 1FV1A 1BZ7A 3DX6A 4MLSA 3BSZH 4YUEL 4HJGA 3OJDB 1YQVH 1ZTXL 4OCRH 4KUZL 3FT4A 4PRHD 3DTXA 5MEOB 1LEGA 1QLFB 3CLEH 3GM0A 1M6OB 4X6EA 3STBA 3DX7A 2NX5B 4JDZB 4KK8C 3S3PA 2W9DH 4MCYB 5LXGL 2H5JA 1HH9A 1KC5H 1FNFA 4OB5L 1DQDL 1OAZH 2D0GA 1M05A 3OKEA 4H1LB 2Z8SA 3F12B 4RNRB 3TH3T 1RURL 5EUOE 4LHUB 3PIQA 5CINL 1D5BA 1BWMA 2XZDA 3TT3L 3VD7A 2B39A 2DTML 4GBXA 5IMMB 3THMH 5E4EB 3MXVL 4M7KH 1KLUA 5E2WH 3NIFE 3JWOL 4IRJA 2HLAB 2DDQL 4HPOL 2DWEB 3HZVA 4FNLH 2QQQA 4HKBA 4JREB 3UJTH 3NZHH 4D9QE 3AREC 2A1WH 5MEPB 3T1FB 2DQHH 3ULVL 3GJRA 1F00I 3TN0D 2NY6D 4JFFA 1MCWW 2EC8A 3HC3H 3QQNA 3LRSB 1KCUH 3DYPA 3SPVA 5ESVA 5CBAA 5HHVL 1ORQA 1A6VL 1I1YA 1YEDB 5KSBB 1OL0A 5FM5M 2YD8A 5EOCH 4NUGH 4OGAD 4OSUL 3GIVB 3MLVH 4BFIB 5M94B 5D8JH 4ZVUA 3S8EA 4F7TB 2VSDA 1VFAB 4JFEB 2EDWA 3NCJH 4TN9A 1BGXH 3RUGE 1IBGH 2XN9A 1P4IL 3EHBC 1NAMB 4ODBD 3OKKA 2AAVA 4WJ5A 3EZJB 1GGTA 1YC8A 4P23B 3CX5J 4K8RD 3I6KB 5SX4I 4X99A 4LLQA 1JGDA 1ZS8B 2X89A 1ND0B 3DVGA 3ARQA 3MLWH 2RFXA 4GW1A 2F58H 4KKCC 5GRUL 3C5JA 2FBJH 2QL5A 4FEAA 1Z3GL 2XYPA 2C4XA 3UZVB 5TE6H 4DVBB 1DUZB 2O5YL 2BC4B 2WP3T 5JW3H 1RV6X 1ZVSA 3PABA 3MOQA 1VFBA 5D7IF 4OFYA 4H25A 5DDHA 4JO1H 3I50H 4LU5L 4Y2DD 4ZODA 3V9FA 5FYJU 4IRSA 1E27B 4X9BA 5A2JH 1JWUA 1UJ3B 5KG9A 5F8QC 5MERA 4Q9RH 1S7QB 4F9LA 5FA3B 3EDDA 4N1HB 5GIRA 5I1AA 1WJ3A 4OGZA 4YO0B 1B6DA 2BJMH 4PY7A 5EU7E 2NZ9C 5I16A 5DWUH 1U41A 1IGYA 1U3YA 4UT6L 5J1TC 2BVPA 2A6DA 3CFJB 1A7NL 1F2QA 3MNWB 2VXVL 2ENSA 1DN0B 1U8KB 4PGCA 2P24A 3PWNB 4IIQC 3F7RA 4K8RH 1EFXB 3UTSD 5D1XC 4JPVH 4ZUVA 4FXOA 1ED3B 4Y5XB 4RMWA 3HI1A 1RQ5A 4APQD 1ACYL 1SHMA 3L5XH 3RVXD 4PRIB 4QRPA 3VXSA 5DHVH 1UQSA 1BX2B 4R26H 1K86A 1FDLH 2PW2A 2NXZC 5F8RC 2X4OB 4XC1L 4Z7WB 1CCZA 4Y16B 4YHZH 2O5XH 3ZTNH 3PP4L 2P1YA 1I85A 1S78C 3H7BA 4HXBH 3QEUB 5EZJA 5E24E 4E5XA 1U92B 1X5YA 1QFWL 1Q9KB 2H4YA 1M4KA 2HJFA 1RAMA 4Z7VF 1CXFA 1F02I 3BDXA 3QRGH 5EBWA 4DKFL 2BVEA 2Y07L 1U8IB 1IKFL 1BQLH 1H3UA 2BSRA 4HIEB 4JJ5B 1XMWA 2VLJA 1G6VK 3HNTL 3UYOD 2VERN 3H42L 1A9BB 2X09A 3KXFE 3MCLH 3QNZB 3QWRA 3WFDL 4QRTA 4JQIH 4M93C 3FHQA 4HFUH 2VITB 2EEBA 3VFRB 3G9VA 4JN2B 4JFDE 3ZTJH 4XX1G 1L0YA 4JRXD 1Y6MR 4JRWA 4ODHL 3C6SB 3GSQB 3V6LA 4JAMA 1E28A 4ODWA 4FP8H 4Z7UA 5E00B 5F7EL 2WUCH 2JE8A 4JFQB 1YY8A 2FB4L 4AG4L 3F58H 3VXPA 4HBCH 4R7DB 5DRWA 4JZNB 3LQAC 1CL7H 1WCBB 4JO4L 4N6OA 4RWYL 4OCWL 3QQ9D 5HDQH 5D70H 1CICC 2APTA 3HLAB 3FFDA 5C09A 3EO1A 3DO7B 4MQTB 1Q9OB 5DQJB 4ALAL 4E41A 3ARBA 3HE6D 5E8DL 3KPLB 1NDMB 4GRWH 5GGVL 1L0QA 3D0VB 5BV7C 4M9RA 2C1EA 1AD0A 3TYGH 2HT4D 3VG0L 3CIQA 1K8IB 5JDSA 4ODTH 1OD7A 2V17H 1NCAL 2EDNA 5BRZE 3IXTA 1U8QA 2APWA 3PWVA 3CFDA 3U9PH 5HXMA 3NN8B 4YBQD 4E9LA 1KGCD 1OAQH 2DIAA 4ODXA 4PREA 5ILTL 1KLGB 1A2YA 2AEPL 5LAXB 3SDCA 1DL7L 4Q6YA 4PS4H 4RISH 4FFYL 2DD8H 3DXAE 2CGRH 3W9DB 2CNNA 3BGMB 4LPCA 4B41A 2HVKA 3QEQE 4K9EH 3GI9L 3SQBA 4V1DD 5T5FL 1XAUA 3BAEH 4Y8DC 4GMTL 1YJDH 1U2CA 1DBKH 3JXAA 5F70A 4ISVA 4ORZC 3P73A 4K2UH 4Q58C 4BELD 3V6OE 2XNAB 4JKWA 1CD8A 2I9LA 1CDGA 4Q0XL 3H6JA 3WEXB 3WFCH 2YD6A 5I8KL 4TSAH 5B38A 1NMCC 1NGYA 1P7HL 4XCNB 5EC2A 5A2IH 1GCFA 5CZVH 3IDXH 4AWAA 4LHQB 1N64H 1UB5B 1SHJA 2WWKT 4X8JB 5EU6E 5I19H 3PL6B 4EUPH 4IOFC 2IBBA 4I0PA 4V2BA 3FQTB 3S5LA 1KTLB 2PR4H 4MHHI 5IKCB 4YDKL 2OTWA 1YEKH 4Y19B 3C5ZD 2GKIA 2Q8AH 4FZ8H 2R2CA 4YGAB 1KB9J 5D7SL 1OP3K 3SGJA 4Y5YB 5JHDD 3P0VH 2Z8WC 4TTDC 3O3EA 2HTKD 3MJ7A 1T20B 1HNFA 5IR1A 2R9HD 4NSKB 4L9LB 4B7IA 1HEZA 5B8CC 5GS1C 3SJVB 1JPFB 1F58H 3FZUD 4UV7L 1EXUA 2AW2A 1MF2H 5EIVA 4J6RH 5AYUL 1QBAA 3I2CL 1XF3B 3GUTB 5F6HI 3QDJD 2XTJB 3HUJA 5HGGS 2AJZA 4PRPA 2ESVE 1WAAF 3VXMA 1INDH 4NT6A 3ITNA 3C8KA 5IHZB 3U7WH 2D03L 2Y9RT 5CZXD 1TDQA 4I1NB 2EXWD 1A6TA 5TFSL 1E6JL 4GAGL 4ZQKB 1U8PA 5EDXA 2WWMD 3IFNH 4C59B 4OF3A 5EU7C 1W72A 3SDAB 3OGCB 1I3OA 1YNLH 4KJQD 4OGXL 2FEEL 1B0GB 1A6ZB 4WFFE 3PDOA 5H94A 2HH0L 2Z92B 2VISB 1OSPH 3RY5A 3RTQD 5D7IE 3SE4C 3VFNA 5CEXA 1LK2A 4K7PX 5GRVL 4EHFA 4FN0A 2CR3A 1ORSA 1H3PH 2C26A 1FG2A 1XF2A 1WF5A 4HXAH 4PIRF 4AT6B 4CU6A 2P5ED 4KWUA 5F7DA 3SCMA 4PGEB 1TCRB 4JFHE 5I1JH 5J1AA 2ZCHL 1WFTA 2ADGB 2F5BH 4NRZA 3GSNH 4Q9CA 3EYQC 1XR8B 3MLTB 3DRQA 3V2AR 1OT2A 4CJ1A 3EFFB 3MUZ1 4I0CC 3OGOE 1KV3A 3PWPA 3R1GH 3L5JA 4U7MA 4NQCB 4TSBL 3MZTA 2H1PL 2LV4A 1EH9A 5IVXA 1KPVA 3MBEB 1RK1B 3O2VL 3LH2H 4UT9L 1HZHH 4KTEH 3ARXA 5I17B 3ULSB 1U3JA 2J3SA 3GSOB 5K9JL 2Q8BL 3BO8A 4XPGL 1Z9LA 4L8CB 4AEHL 3LKPB 3VXRB 2QL9A 5C0AE 1KJVA 4KZEH 5F9JB 4D9RE 5K9OA 3CXDL 3QUZC 2ED9A 3WMSA 3UTTE 2WDPA 1CP3A 1Z6JT 3FO2B 4FHBD 4P4RB 1T04A 4OTXL 4KVNH 4Z7VE 5C2BL 1JZ8A 1Y0LA 1A6AA 2F8XC 3U82B 2HFGL 2E9BA 5IMKA 4BH8A 4LLYA 3QIUB 4EN3B 4XXDA 4XBEH 4XT1C 3O41A 4ZPTA 1DP0A 4OLVL 3BPNC 4G6JL 5EBMA 3MUHL 4FQCL 1CFVL 3CU7A 5KSVB 1RUPH 1CFBA 2OMNA 3MXWH 2R4RL 4H88L 1KF9B 4WI6A 5J11C 5M7QA 2X1OA 2ITDA 3SDDC 1GH7A 3M07A 2G2RB 3OSKA 3ZT7A 3TZVB 3U0TB 1IEAA 2QTEA 2IFFL 1AKJD 4YHOH 1LO3H 1YEJL 5T1LA 4HUXA 3WHE0 4WVRA 5FA4B 4YPGA 4D3YA 3WIHL 5I8EB 1NPUA 4K94H 1GPOL 3QULB 5I1LA 3I85A 3GJFH 5E99L 1JPSL 1ZA3B 1FYHB 4M5YL 4M7JH 2X41A 3D39B 1SJHA 2NXYD 2I27N 3X3GH 4UIKL 2FWOA 1D5IL 3C08H 4X0KB 1A1OB 2IGFL 3V0VA 1F2XK 3UTOA 1DQML 4A6YL 4ZXBC 3U83A 2FECI 4U05A 5HI4D 2DQFB 2P5WD 4EI5A 4HWBH 2H2SC 1G9ML 1T4KB 2NW3B 2VE6B 1DLHA 1HH6B 3EOBB 3PWLB 2HN7A 4HGWA 4MA3A 1FJ1A 2IQAA 2EDQA 1QBMH 3MV8A 1XCQA 3RDTA 1NMEA 4OZIF 3V6OC 4DKAA 1RWPA 3U7YH 2VQUA 5IB2A 3UTPE 1CD1A 5D72L 1E4JA 1JHKL 3E6FB 1U3HD 4G8GD 5D7JA 1WSST 2OR8A 4FQXA 1IAIM 2VDQL 1T0MA 4QHNA 4JLRB 5ERWA 1S7VA 4CDHA 2WBJB 4OZGB 4JGMA 4CGTA 2DIBA 1CFTB 1QSFE 5DHYB 4AQ1B 3T0EA 3B3IA 4HSQA 4YAQA 2MPAL 4DCQB 3ZKMD 4HG4J 1NUFA 1HXMA 4LDLB 4IDLA 4RZCA 5CP3A 3UTQB 1MQKL 5D71H 1A6UL 1QSEE 1RZGA 5FYJL 4ZPVB 1HN1A 5D7LB 4I3SL 4PBWD 1Z0NA 2AXJA 1C5BH 4M9PA 1MVUA 2M26A 4X9GA 1Q0YL 5H35B 5EBLB 1QFUH 5FKPB 1W0VA 1NLBH 1U8OB 1SY6A 2BNRA 1NGQH 4WDIB 2A9ML 4IHOA 5IF0A 5A16A 1E4KC 1JGLH 5F7UA 1EHLL 3L3HB 4MNQD 4I3RL 3CJJA 4JFPA 1U8NB 2CJXA 5FXCH 5M95B 1CF8H 1YDPA 3FQWB 5HHME 2H6PB 4RGNB 3MRIA 5ESQA 2VZ1A 1JGUL 3CVHA 2B4CH 3MJ9L 1U8MB 1VB9A 3IDIA 4QHLA 4LCYA 1K4DA 4BZ1H 4P4KC 4CKVX 3QXUA 3WV0A 3DMMA 1KJMB 4RDQG 1NCCL 1XGPB 3MGOB 4S1SH 1R3KA 1CFQA 4HS6B 2WM0A 5C0BE 2H5IA 4YNYA 1MCFA 3F6IA 4LVNB 4LRNH 3MRGA 4OJFH 1BFVL 3B9KA 3JUZA 2NYYD 3H13A 1OTTD 1KPRB 5CZKA 2YR3A 1HHGB 3H9HA 1RUAL 2Q20A 2CK0H 1A4JB 2YD4A 3MV7D 1WAAE 3BRGC 4AH2B 1I7ZA 3BT2H 4Z76A 3DURB 3T8XA 3RZCD 3T0AA 4HJJH 1G1YA 1FFOA 3NAAL 4K7PH 5KJRH 2UWEA 4L3EA 1NFDF 4KXZH 1TTUA 4MXWH 5EC1B 3FFCB 1TPXC 5FB8A 5L2KB 1YMMD 1MHCB 1XCTA 4WWID 3BSZL 5CBEA 1IGCH 1YQVL 4OM0H 4OCRL 2PYED 1J1OH 3FONB 1KNOB 3FQRB 3O3BB 4J12A 3FB8A 5IWLA 2I26N 1KJ3H 4JKLA 4MAYC 4NBYB 1NGWB 3KJNA 2W9DL 3TBTA 1KC5L 2HJKA 4FQJH 3CVIH 3SY0B 5F6HJ 2Q86B 5CD3A 2XY1A 4P5TC 1OAZL 2NNAB 1ZWIB 1S7XB 2N56A 1S9KC 1XF5B 3U36B 4TNVF 2VLLB 5JA9A 1I1FB 3PQYA 1DDHA 3BP6A 1C7TA 1PYWB 1ZHNA 3MRBB 4M7KL 4WFHD 2R0WH 3CZFB 3FN3A 3NZ8A 5E2WL 1FZOA 1CFSA 2Z91B 4GT7A 4U33A 5IMOA 4FNLL 2CNOA 3C8HA 3UJTL 5KVDH 1A7PH 3TC9A 1TZIA 5DJ6A 2A1WL 3TO4D 4OI7A 2DQHL 1OB1A 3H9SE 1V3LA 1R5WB 3HAEH 1N5AB 2VAAB 4WY7H 5FDWB 4DCOA 2KDGA 3HC3L 3TCXA 3RWEB 1F6AA 1ZGLB 4KK6C 5CJOH 2G60H 2VLRA 1KCUL 4D0CA 4CMMA 2DIJA 3H3BC 1RIUH 4LGPB 5EOCL 4NUGL 3MLVL 4F8QA 4HH8A 5D8JL 5DK0B 1S9WB 3NCJL 5TDPA 1QQDA 1BGXL 1UZ6F 3LEVH 3ZHLA 1IBGL 3G5XA 1KBGH 1RHHA 4NNYA 4CL7A 3OR7A 3VH8G 1EJ6A 3KPSA 1H9VA 5EULV 2ADIB 3WBDA 3EYFB 1FNHA 1A64A 4WHDA 4U1KA 2DKUA 1QLRB 1WICA 1JNJA 4B53A 3NFNA 3PV6A 4YFLF 3G6AB 4R3SA 1A14H 2PYFA 5TH2B 3MLWL 2IMNA 2F58L 5L88H 2FBJL 4PR5A 4S1RH 4GAYB 3RL1B 5TE6L 1CGTA 1XIWC 4HWZB 1IKNC 3KLHD 5JW3L 4K7PY 4O58H 2LE9A 2E7MA 2VABB 4JO1L 1YC7A 4DOHB 3C60B 3I50L 1VKXA 1MRFH 2G9HA 1VEOA 3ARFC 4JB9H 1PKQE 1BOGA 4J3SA 1NW9B 3OJDA 4KKAC 4Q9RL 2EEAA 1J0JA 5ETUB 5BRZB 3SO3C 2BJML 2W92A 2UYLB 4NJ9H 5DWUL 3UMTA 5MEOA 1XZ0B 1QLFA 1M6OA 2NX5A 4JDZA 4ENED 1QG3A 4K8RL 1TETH 5F9AC 1TQCC 4Q6IC 1QFWI 4H1LA 4V2CB 4JPVL 5DJZB 4PV8A 5DYOB 3F12A 1ERNA 1Q8MA 4HUKB 3L5XL 4RNRA 5ITBH 4OI8A 4P49A 5AD0B 4LHUA 1X5ZA 2IADA 2FCBA 5C08D 1PG7X 2P44B 3LKOB 2L0DA 4R26L 1FDLL 5IMMA 4PJCB 3GKWH 1YEIH 3U2SB 1SJEB 2HLAA 2RBLA 5E9DD 4OZIE 2DWEA 4YHZL 3LRHA 2O5XL 3ZTNL 2BCKB 4HXBL 1JNHB 3R8BB 1BF8A 4FQQB 3QWQB 5MEPA 3T1FA 4Z0BH 3KJ4B 1JZ4A 2AK4B 5EUKA 3EIFA 2FHBA 3X11B 1EUTA 3UAJD 3QRGL 3LRSA 4MA1C 1NQBA 5D1QB 1BQLL 3NCCB 1OLLA 1YEDA 1UKQA 3ARVA 5KSBA 4UDUB 3OJ2C 5ICXB 2FGWH 3V3KA 4N0RA 3GIVA 4BFIA 3MCLL 4F7TA 4JQIL 1VFAA 4NNXB 4HFUL 4JFEA 1P4LB 1KIQB 2CJUH 4N8PA 2I07B 2X4UB 2ARJB 1QA9A 1B90A 2GW5A 4M03A 2APBA 1NAMA 4I18B 4P99A 3P4UA 4FFWD 4FP8L 4I2XB 4S1QH 3W0WE 4P23A 2WUCL 4LNRB 2DKOA 2VDKH 1MFCH 1ZS8A 3T0DA 3F58L 2BOCB 4HBCL 3UDWA 1U58B 2B7DT 3L9RB 1CL7L 4DVBA 5IEKB 1DUZA 2PXYD 2BC4A 2FUNB 5SWQB 5HDQL 4GLRI 3WO4C 1H15B 3CXHJ 1A1MB 4R2GD 5D70L 3T3MF 1PAUA 3GHBH 4PRNB 1VSCA 4EHAA 1YQ2A 3CX2A 1JYNA 1E27A 1XF4B 1UJ3A 3PGDB 2Z9TA 1S7QA 2PTTB 4RRPA 3HPJB 4QNPF 4YO0A 3BGAA 3TYGL 3ZKSD 2FJFB 4W4NA 4TUJB 4GOSA 4ODTL 3CFJA 3MNWA 5MEND 2V17L 3V6MA 3CSPA 1I3VA 4JFYB 1DN0A 1U8KA 3RI5K 3JSSA 3KJ6H 3U9PL 1HNGA 4AWBA 3PWNA 1EFXA 5GISH 1BLNB 1D3CA 1OAQL 2CMRH 1ED3A 4Y5XA 3DSFH 1M72A 1NCDH 1G7IB 4MB3A 3FO9B 4LPUA 4PS4L 5IFHH 1WWWX 4RISL 5KZCB 4AMKH 5GGRB 1CIDA 1IM9D 1NFDE 1FFNB 2DD8L 5KANG 2X4OA 3PP3K 4BH7B 5ACLA 4Z7WA 4LSDA 4F15B 4Y16A 4K9EL 3BAEL 3QEUA 2XQYG 3HE7C 1YJDL 5IK3B 1DBKL 4WHYH 1U92A 3DJ9A 1J8HD 1Q9KA 5E6IC 1BOYA 2EKJA 4JFXB 4K2UL 3A67H 1H0DB 1MHEB 3WFCL 43CAB 1U8IA 4TSAL 3TA3A 2BNQB 4HIEA 4JJ5A 3ZE1F 2KQNA 2X2YA 5ACZB 1PDKA 3O2DH 5J9PB 3EO9H 3F62A 3IDXL 1A9BA 4JFOB 1N64L 1T83A 3TBSB 1QFPA 5CZVL 5I19L 2AV7B 3QNZA 5DMGC 2FIKB 2VITA 3TM6A 1AO7D 3SEPA 3VFRA 3QI9B 2ZSWB 2PR4L 4JN2A 3C6SA 3VXTB 2G75B 2C4FU 1LEKB 1YEKL 3P9MB 2Q8AL 3VXUE 4PLOB 2H3NA 4FZ8L 4MJ6B 4Y1AB 3C9NB 4ELMB 4S10A 2BP3A 4U6TA 4JFQA 1VPOH 3P0VL 1HHJB 4KRPD 4Q2ZB 1NGZB 4YE4H 3RWJB 5HD8D 1A6PA 1V3MA 3HTLX 4UUJB 4U0RC 4G80B 1H5BA 1N7MH 3D3VB 4KH2A 3V5KB 1F58L 1MF2L 4J6RL 4UMGA 3JTSB 1ICEA 2DJ4A 2CNLA 1RZJC 2FEEI 3DO7A 1ZLVK 1Q9OA 3INUH 4MMXC 5DQJA 3T3PF 2DL2A 3VGFA 1UZ6E 1JF1B 3KWWB 1V05A 1INDL 3QUYD 1H8SA 2FZ3B 1YEFH 3DI2B 3KPLA 1NDMA 3Q6FB 4HIIA 4KK9D 3U7WL 1K8IA 1J5OH 1RHRA 5LUBA 5CJQH 1KCKA 4NFCA 3IFNL 1N8ZB 1I8KB 1MI5B 4IOIB 4QKXB 4Z7QF 3LB6D 3GJEB 4NYLB 1YNLL 3NN8A 4N0YH 1GOHA 3QQ3B 4X80H 1EHXA 1IC4H 4U1JB 5CIPA 2IANB 1OSPL 1KLGA 3ZL4H 5LAXA 5HYSG 3BN9C 3RVWC 1XR9B 2ZNXA 4JO3H 1H3PL 3W9DA 2ARJQ 5GQBA 4HXAL 3BGMA 5D2NB 1EIBA 4Z95H 3CMGA 2NY3C 2BOBB 3FB6B 4OBRA 3UZEA 5LBSH 5I1JL 4J1UB 4QGYA 4LARH 1UH3A 1CLZH 5HYJB 2YMXH 2F5BL 3GSNL 1MY7A 4G9FD 3MCG1 1A4KB 3FKUS 2D4FA 3R1GL 2XNAA 1HYSD 4QRUB 1PX4A 2VZTA 3V4OA 3WEXA 3WN5C 4AW9A 1AR1C 1MIEH 5JQ6H 4XCNA 5D93C 2DYPB 3ILQD 3LH2L 1F4AA 1HZHL 4BUHA 3LSOB 1W0YT 4GW4B 5BW7C 1UB5A 4KTEL 4NP4H 4X8JA 4X9IA 3PL6A 1KACB 3BYYA 1QSFB 3FQTA 4X4ZA 4L4VD 2GSIB 1KTLA 1GRWA 5CLWA 5IKCA 3TESA 4F2MB 4KZEL 4Y19A 3W9EB 1YEGH 4LCUB 1YEEH 5LQBH 4Y5YA 4QULA 1WTLA 5C0GB 1JMXA 4OM1H 3AREA 5F7MC 4KVNL 3M17B 3TBVB 1T20A 5F21B 1NANI 5LU8A 1TITA 4NQED 4WUUE 2OL3L 4NSKA 4L9LA 2MKLC 1QKZH 5GGQH 1MH5B 3SJVA 4LPWA 1JPFA 5EOTA 3GMQB 5GGSY 5CCKH 1O7SA 4XBEL 4TNWK 4EJ1C 5I66B 4W6YB 4Z18A 4QOKD 1XF3A 1F11B 3EAKA 3GUTA 1TMCB 1NFKA 5CMAB 5AG9A 1IQDB 3D85A 1RUPL 3UJJH 3MXWL 1RIVH 3ZLQC 1DBBH 3N1PC 1FN4B 2QKIB 5IHZA 5C0DB 4J2XA 1WCQA 2FHCA 5CP7B 4YHOL 1LO3L 4G5ZH 1P53A 4ZQKA 4XMLH 1OP3H 5SWZB 4X4YB 1KGCE 1WITA 4IMLB 4L9DA 4EDXB 3OGCA 3V6FB 2IPUG 4JDTH 5C7XH 4K94L 5TQ0L 3EYVB 2BDNH 1B0GA 1A6ZA 1SBSH 2VUOA 4NCC2 2Z92A 4IJ3B 2VISA 4OKVB 3HB3C 4M7JL 1NGPH 3T3ME 1AY1H 4QO1A 3K0WA 5JMRA 2J5LC 5C0CE 2P8PB 3X3GL 5E2JA 4WW1B 3C08L 1OCWH 1ZA6B 4PRYA 4AT6A 4UNUA 4PGEA 4TVPD 1TCRA 4XTRD 4KJPC 2YC1B 4L4TA 4HWBL 1MFBH 2ADGA 4O00A 4R96B 1HKFA 4ETQB 4QNPE 5ISZD 3MLTA 1XR8A 2VL4A 3OB8A 3EFFA 1OAYL 1KEMH 1QBML 4GG8B 1QP1A 2X6MA 4NQVB 1TENA 5CEYB 3O4OC 3FN0H 1MEXH 5F7KC 1UCBH 3U7YL 1QOKA 3MBEA 1RK1A 3OQ3B 2VDOH 4NQXB 4JG0H 4JHZA 5I17A 3NPSB 3ULSA 3GSOA 3CLFH 5FO8A 1AGEB 4J4PA 5HHOB 1T0NB 4C56D 4L8CA 5FGSA 4OKDA 4NN7C 3LKPA 3VXRA 1C08B 4OZFG 1YN7B 4HC1A 4NRXB 5FO7B 5JHDE 5F9JA 2VLME 3VXQB 1JPGB 2NY5H 3C09C 4NGHH 4KJWD 2GJ6E 5D71L 4A6YB 3FO2A 4MD5B 2FX9H 4P4RA 4LQ1A 2W65B 3N1MC 4TVPH 5IHBA 4IM8A 1S8DB 1C5BL 5DFWH 1QFUL 1NLBL 3ZE1E 4EN3A 5DJXB 2E7LA 2ADJB 1NGQL 1MAJA 5BQ7A 3KG5A 4Y2DC 1JGLL 1HQRB 4GKNB 5FGBA 1S9VB 4OQ1A 4Z7UF 4P46D 1FBIH 2F54E 3CD4A 5EFIB 5KSVA 4EHLA 1CF8L 1KXQE 4PJ8D 5EZIH 3O9WC 2G2RA 3QIBC 3U9UA 1BIHA 3TZVA 3U0TA 3IDGB 2B4CL 4LSPH 1S5IH 2VDNH 1ITCA 2YPLB 3Q3GB 2P2CA 3IJYA 3VDCA 1VHPA 1Y18B 1L4IA 2FDBP 2MCPH 1BBJB 3FOMB 4P5MB 5FA4A 2K7PA 5JOEA 4BZ1L 5J12C 5I8EA 4QUJA 2QL1A 4Y4HD 3QULA 7FABH 1IT9H 3IF1B 4S1SL 4APQC 15C8H 1ZA3A 3RVXC 3ARDB 3HHRB 3QEHB 2DBLH 4X7FC 4NQDB 3PGCB 1RHJA 3RVVC 4H0IA 4LRNL 5FYLD 3FCTA 2AJSH 5E2VH 3D39A 3G08B 4OJFL 4M7LT 2DLEA 3T2NH 4X5LA 1RHFA 3O8XB 4LMQE 2AJVH 3RGHA 4X0KA 4MZ2A 3KDMB 3T3PE 2DQEH 2CK0L 3W5NA 4GS7C 4K23H 1RZKH 5DTFB 2DQFA 3BT2L 1T4KA 4HJJL 2NW3A 1AHWC 2VE6A 1HH6A 1FFPB 3EOBA 3U30C 1ZGLM 3PWLA 3I6GB 1RVFH 4K7PL 5KJRL 1LE5B 4YBLB 3TLRA 43C9B 4Z7QE 4MXWL 2LAAA 2KZWA 1MJJB 1IGCL 1QDUA 3VFWB 4OM0L 1QO3B 3E6FA 1J1OL 5KTEH 1CDYA 2ZNWA 3WUWG 1FZJB 4XI5C 3N1QC 1KJ3L 5IT2H 4JLRA 3TCLB 9CGTA 3VGAC 2WBJA 3E3QE 4OZGA 4FQJL 3CVIL 1CFTA 1RIHH 1HK6A 1IGIH 4U6XB 1CE1H 3GRWA 4DCQA 5FYLH 1ETZB 4UQ2B 2J8UB 3LS5H 5DLMH 1N2RB 4PJBB 3KNBB 3H7LA 3UTQA 1X7QB 3QCTH 5DJ0B 1EERB 3QNWA 3QDGB 4ZPVA 3B8YA 4ZS6D 5EU4B 5D7LA 3CGTA 4M48H 2DMCA 5AWNH 2AXFB 2EXYD 1O0VA 5BS0B 2R0WL 1NEZB 3QQ9C 1HKLH 4I77H 5H35A 4MJIB 2XXCB 5EBLA 5FKPA 3ARSA 1U8OA 1FVEB 3K8MA 5JA8B 4JR1A 1FLRH 2R1WB 4GG6B 4WDIA 3DETD 1JYXA 5KVDL 1A7PL 4PRID 3D5OF 2XKSA 3L3HA 1A7RH 1I7TA 2H26B 1U8NA 2GAZB 5ALBH 4QLRA 3LY6A 2J31A 4WY7L 2YK1H 2N1KA 1F4HA 1M71B 3MRHB 3FQWA 2H6PA 5CJOL 4KKLD 2G60L 2LTQC 5GS0D 2BHZA 4JM2B 1A9EB 1RIUL 3OAZK 1PFCA 1U8MA 2VOTA 3BYTA 5IABA 4KI1A 1EBPA 2VXUH 3UROR 4JZJC 3WO3B 1ZLWK 3LEVL 3AVEA 1KBGL 4J3TA 1KJMA 1X5AA 3MGOA 1XGPA 3TVMB 5I1DB 4GSDH 3KS0J 4HS6A 1LEIB 4ZO8A 2XN9E 1NSNH 4HX1B 1AR2A 4P48A 1G7QB 5AUMA 1GC1C 1A14L 3BD3A 1I9EA 1K3IA 1KPRA 2N7BA 5L88L 4Y4FC 1HHGA 4S1RL 1A4JA 5BJTB 1G9NH 3ARRA 4AH2A 5E1HB 3DURA 1IJ9A 4WV1B 4KKNA 4MDJB 4O58L 4F37K 5CGYD 4PRHB 5BCAA 3AM8A 5GS0H 3V6BR 4JB9L 3C87A 5EC1A 4W4OC 5L2KA 1MHCA 3EDJA 2YRLA 3IKCB 3TBWB 1GXEA 3FONA 1KNOA 3FQRA 2MFNA 4NJ9L 5KVMC 4Z9KB 3VMPA 2XG4A 2Y25A 1BP3B 2DLTA 2O5ZH 3O6FD 3SY0A 1IZKA 2Q86A 3C5ZC 4IS6B 1L6ZA 4LKXB 1TETL 1ZWIA 5JW4R 1S7XA 1H8NA 5IBTH 4X4MA 1XF5A 5ITBL 5IVXF 4NFDA 3U36A 3BVNB 5K9QG 2R2EB 2PTUA 1QFWM 1ZSDB 1I1FA 1VADB 4HUUB 1QRND 5FFLA 3J8F7 3BQUD 3MYJB 5AZ2H 3TN0B 1PYWA 4WHCA 3MRBA 2NY6B 3GKWL 3CZFA 1YEIL 1KN2H 4QRPE 3NVQA 3VXSE 1OGAB 1BMQA 4XVUC 3DO3A 4HLZG 4IMKC 2Z91A 2DKSA 5F89A 5GGUB 5JPMB 3B2UC 4LVHC 5LKNA 3P4OB 2CRMA 1KB5H 4N1CA 5EU3B 2NY0C 2JB5H 4Z0BL 1R5WA 5IW3A 3EYOB 1N5AA 2VAAA 4QWWC 5FDWA 5CJXC 3CDGB 3HI6H 3RWEA 1ZGLA 5FCUH 4BM7A 4N1EA 3TH4T 3BZEA 3MBXH 2A6IB 1GSMA 2FGWL 4H8WH 1CL7I 1NKOA 5DK0A 2VRAA 1LO4H 1S9WA 1PZ5B 4KI5F 1XEDA 1NDGB 4KJQC 1YY9C 2CJUL 3HCVB 1EHAA 4HQRA 3FMGH 4UZGA 4Y4KB 3EJZC 5DHVB 4OF8A 4GH7B 2ADIA 4D3CH 5I76B 4S1QL 3L6FB 4EOWH 3EYFA 2EKSB 1CTNA 1QLRA 4QU0A 2VDKL 1MFCL 3GJTA 3G6AA 1T22B 4QUAA 2CQVA 5TH2A 4Z7UE 3GBNH 4J8RB 4Y2DB 5C3TA 1YYLH 4GAYA 3RL1A 3RGVC 3TF7C 3RU8H 4F7EB 4HWZA 4ZOCA 2V2WB 4TPRH 5SX5K 3MRRB 1CYGA 4YDJA 3ISWA 3RKDD 3GHBL 5EWIH 3LD8B 4XP9H 3FQNB 4JRYD 5DHXB 1UWXK 3C60A 3QJHB 3RBGA 4HKXB 5ID1A 5C09E 3NGBC 4XVSH 2A73B 3Q5OA 3UTSB 5ETUA 3BHBA 2C2MA 5BRZA 1A0QL 1WVZA 1C8PA 3BRDA 4L29B 1NCWH 3VWKD 2UYLA 4Y5VC 4APQB 4O2EB 4E41E 1XZ0A 5HPMB 2X89D 1LD9B 4HKJB 4XXCA 1RZIB 4MCZB 1UEYA 4LP4A 1BVLB 3EYSH 3KJ6L 4O9HH 1P2CB 4PY8I 1HXYA 1W0WB 4JJ8A 3E3QC 5GISL 5J56B 4MQSB 4ONHB 2CMRL 3QUKB 3RVUC 5DYOA 1TNMA 4C83B 3CFEB 3BIBX 3DSFL 4L8BB 1NCDL 4MNHB 5AD0A 2HLFD 3MO1A 4M7LH 5DVOA 3WKNA 4HMEA 1PEZA 1ADQH 4NQUA 1MCHA 5C2UB 5IFHL 4AEEA 1TVHA 3LN5B 4AMKL 4PJCA 4XHJD 1HI6B 3WLWC 3U2SA 1SJEA 3QFJD 5C70A 3VH8A 2YD3A 2C2KA 2BCKA 4WWKD 1RWWA 5AYQA 1JNHA 1I4EB 3HI5H 4FQQA 4CVXB 4WU7B 2OI9C 2Z4QB 5I71B 2AK4A 4GBXC 1CU4H 3A67L 4WI4A 4GRWB 3X11A 4XWGH 1E4XH 4X7SH 4JRXB 3K4DA 2R8SH 4QTIH 4QRQB 5DZNA 4UDUA 5EA0H 5ICXA 3EO9L 3QCVH 4KDTA 3FO0H 5FGCE 1IRAY 3S37X 3MODH 1FZKB 4WFGE 2YN3A 4NNXA 2ZKHH 1P4LA 1KIQA 2I07A 2X4UA 1R3HB 3JVGA 2ARJA 4U0QB 1F3JB 4YEFA 3ZT6A 3VFGH 4J3VA 1EFQA 5J57B 1NCTA 4LNRA 4JVUA 2KBGA 1VPOL 1MCRA 2DBJA 4Z0XB 4YE4L 2BOCA 4ESKA 1U58A 5HHNA 3QUMH 4I9WD 1A02N 3L9RA 5GPRA 3G6JF 4ODUB 4D3ZA 2GITB 1RSFA 1N7ML 4NBKA 5SWQA 1T89C 2FGZA 2BMKB 1H15A 3B2VH 1A1MA 1UG9A 3HE6B 5JLZB 2LTQB 4PRNA 1P84K 4GMSH 4U1LB 3ECBB 1R3JB 3OKLB 2RQ8A 3BWUC 3INUL 4LSVL 2P47B 1T21B 2AJYH 1XF4A 4EUPB 5MEQB 5SWSD 4KKBD 2DKMA 3ARGD 3GMLB 3PGDA 5EOCJ 3QIUD 5IJKC 2PTTA 1YEFL 3HPJA 3ESUF 5C1MB 3HMXH 5D6CB 3DI3B 2FJFA 1J5OL 4TUJA 3VXME 5CJQL 1V7MH 3DVNB 5KS9B 4FXKB 4IRSC 4QRSB 3K8LA 3W11D 1Z0MA 3LKNB 1OVZA 4JFYA 4LDEB 2Q1EA 4F9LC 2UWEF 4N0YL 5C08E 4X80L 3M8OH 4UU9B 1BLNA 1IC4L 1HDMB 4V1DB 4DGYL 1BMGA 1S3KH 1G7IA 1MLBB 4U49A 2DAVA 3ZL4L 2VMFA 3FO9A 2W1NA 1CIUA 3O3AB 2OCFD 4JO3L 5GGRA 2Y72A 3P4NB 4BH7A 2OJZH 3MSPA 3QNXB 2H65A 5IIEB 5DEGB 1S5HA 5E6YA 5C07D 3F6LA 4Z95L 2I24N 3UX9B 5LBSL 3DVIA 3KLSA 4YPJA 4LARL 1CLZL 2YMXL 3PE9A 5IK3A 3BW9B 4JDVB 1OQXA 2EDJA 3PD1A 4LVOB 5D1ZD 4CAGA 2J8OA 4RMRA 4JFXA 4LGRB 1X5HA 1H0DA 1MHEA 2CO7B 4OV6F 3C6LD 1JNLH 43CAA 5MHSD 1I85C 4P2OD 1MIEL 2BNQA 5JQ6L 1I7RB 5HPOA 1UJTA 2ARWA 3PWPE 5FHBH 3C5ZB 5F88B 5J9PA 4JFOA 4G8EB 4NP4L 1PQZB 3TBSA 2AV7A 5IVXE 4K71B 4JVWA 3DV6B 5C0AA 5JHDB 1LVEA 2X1XR 2DS4A 1YMHB 2ZSWA 2YD1A 3VXTA 2NLJB 2G75A 3PP3H 1A7QH 4P2CG 1PAMA 1LEKA 5T3XD 4O4YH 3BKCH 4G43B 1YEGL 4NZUH 2X42A 3C9NA 4R4BB 4Y1AA 1D5MB 2DQIL 4ELMA 1MJ8H 1YEEL 3IFPA 5LQBL 2XZQH 2F8OA 4Q2ZA 1HHJA 1TNNA 1NGZA 3GB7B 3RWJA 4FTVD 4OM1L 1NMAH 4G80A 2MSPA 1T5XB 3QDJB 3GSNB 3S97C 3BGFB 2XZAH 1QKZL 5GGQL 5CCKL 3V5KA 3D6GA 3SE8H 3BRFA 4JKMA 4KQ4H 4MMZC 1N26A 3O6MH 2BXYA 3GBMH 4KI5E 1SEQH 2Y1LA 4XP1H 5HI3D 3UJJL 1DFBH 1RIVL 5F3HB 1JF1A 3KWWA 3L7EB 1DBBL 5ID0B 2FZ3A 3Q6FA 3BXNB 3BP7B 1K9TA 1GZQB 4G5ZL 3RTQB 4XMLL 4Z7NF 5CSGA 1N8ZA 1I8KA 1MI5A 4IOIA 1N6VA 1QR4A 5T3XH 5JZ7C 3GJEA 4NYLA 4NWUH 4B7LA 3PDGA 3ARBC 3HKFA 4KPHH 3T4AA 5AAWA 4JDTL 5C7XL 3QQ3A 2BDNL 5JOPD 1SBSL 5IAKA 5BVJB 3ET9F 2P5EB 5L0QC 4OF0A 3CCHB 4U1JA 1CK0H 4DAGH 1AGFB 2IANA 1NGPL 1AY1L 1IKNA 4N0CC 4POUB 5HVFB 1LDSA 5DC9B 5IW1A 1XGRA 1ZVHA 1HSAB 1XR9A 1UFUA 2GHWB 4EIZC 1U93B 1VEPA 1ZLVH 4N5DA 1OCWL 4M6MH 5D2NA 1UB6B 1SC4A 2BOBA 2GQHA 3FB6A 4TUOA 2NN3C 5HYJA 2CRIA 1MFBL 4X4XB 4XCYB 3SDCC 4X6CB 2WLZA 3V0WH 5D7KD 4CUCA 1JXQA 1A4KA 1RZ7H 1CI5A 1JBJA 1KEML 1ZT4B 4Y5VB 4QRUA 3ZKXC 4XH2B 4RAHA 3FN0L 5KVFH 1MEXL 3KPTA 1UCBL 4OLXH 1WZMA 1DE4B 3MV8E 3LSOA 4GW4A 5E1AB 2VDOL 4IOSD 4JG0L 3MR9B 1QSFA 1EVUA 3GJFB 3MRJB 3CLFL 2GSIA 2QADC 3VWJD 2OXGA 2FYYB 3FFCD 1BIIB 2P45B 4F2MA 1C5DB 3W9EA 3VJ6B 1YN6B 4KQ3H 1KMCA 2KUTA 1DBJH 4EHDA 2NY5L 4NGHL 4I0PC 4LCUA 5JNYB 1DLFH 4HUNB 3S37H 1AIFB 2FX9L 5EOQH 5KSBF 1QUNA 3M17A 4TVPL 3KJFA 3TBVA 3OJMB 1JZ6A 3WDHA 3IDNB 1MH5A 3GMQA 4PY8J 4R0LC 3UYPA 3SGJC 4XAKD 5B4MD 5I66A 2MMXA 2W38A 4P9HH 1AKJB 1F11A 3QPXH 4OGYH 1FBIL 4Z78B 4U1GB 5CMAA 4X5XB 4PS1A 2BNRE 1WWCA 3RAJH 1IQDA 1FFRA 4O2FB 1CVSC 4NO2B 3PHSA 4GRLD 4CJ0A 5EZIL 3TP4A 4KMLB 1FN4A 4XWOC 2QKIA 5C0DA 1AXSB 1KTKE 2APVA 3KYKH 1EUUA 1TTGA 4LSPL 1S5IL 2VDNL 2ZOLB 4XNQB 5F7YC 5CP7A 3HRZB 1SBBA 5SWZA 4EHNA 1HIMH 4X4YA 4IMLA 3T04D 4NKMB 2WSKA 2MCPL 4EDXA 1A1NB 2NXYB 2IH3B 4MQXC 4HZLB 4B50A 5C0BA 3MUJA 3NMEA 3G6JE 3EYVA 2VTFA 7FABL 3QIWD 5DK2B 1IT9L 1J0KA 2ERJB 2WP3O 2MHAB 15C8L 1C1EH 4OKVA 1G6RH 2PW1B 4HFWB 4KXZI 2P5WB 2DBLL 1I8IA 2DL9A 4R4FH 4O5LH 4CMHB 5E2VL 2AJSL 1YZZA 4WIQA 5IG7B 1OY3B 1RWKA 4QHMB 2P8PA 3T2NL 1XH3B 2AJVL 4WW1A 5FEBA 3V7AE 1ZA6A 4U1IB 1G0XA 2ITCB 4K23L 1RZKL 3P0YH 1B0WA 1LMKA 2YC1A 3QXVA 4NZDA 4DVRH 4OCXH 4ETQA 1ZLUK 1VA9A 1RVFL 2VZUA 1U3HB 4G8GB 1RHKA 4GG8A 4PYGA 2UZIH 3KPPB 4NQVA 4PG9B 3SCMC 2A0LC 5CEYA 3VU2A 3GSXB 5C0EB 5DVLA 4DEPC 4YK4B 2UWEE 4L3EE 3FOLB 4UNVA 3GDBA 3JWNC 1KJ2H 4YWGH 3WIHA 4NQXA 4JM4H 4Z7WF 1PX3A 2V2XB 5KTEL 2F53D 4QTHB 1AGEA 4YIQB 5LCVH 5HHOA 5IT2L 1T0NA 4Z5RB 4ZNCD 2OJEB 5HVWA 1C08A 1RIHL 1IGIL 2G5BB 4FFWC 1CE1L 4NRXA 5FO7A 3ARYA 3VXQA 3HG1D 1JPGA 5FYLL 4U3CA 3LS5L 5DLML 3WHXB 3ME0A 1IL1B 3QCTL 5CHNB 4A6YA 3ALWA 4MD5A 1SMOA 1QRKA 4ZOAA 5JORB 3H9YA 3QO0A 5IAEA 4MNQB 4M48L 2W65A 5AWNL 5LU9A 2PXYC 1S8DA 2QHLA 3O11B 3I9GH 3UC0H 3UBXI 3QUXD 2F74B 4BA8A 1HKLL 4I77L 1RI8A 3PQYE 5DJXA 1FLRL 2ADJA 5BOZG 3HC0B 1HQRA 4GKNA 1S9VA 1QYGH 5D2LB 4QY8B 1A7RL 2JB6B 5EFIA 5ALBL 2YK1L 3BKJH 2H9GB 5IBCA 2X5PA 1J8KA 1ZE3C 4KI5C 2FQQA 4AIZA 5I8OH 4WUKH 2ZUXA 3IDGA 2YPLA 3Q3GA 2VLRE 2VXUL 1MCSA 1YNTB 4WFED 3S96B 1S9YB 2C3WA 1Y18A 2LABA 3UPCA 5IB4B 4JVPA 1BBJA 3FOMA 2VZOA 1KXTB 4BZ2H 1BM3H 1NLDH 4X9FA 4PLNC 2Z31D 3IF1A 4GSDL 3ARDA 3MV7B 4Z8FH 3MLXH 1OAUH 4HEME 4NQDA 3PGCA 3RZCB 4MA7H 1QVOB 3S8WA 3KPSE 3G08A 4XPFH 5F1KC 1WZ1H 3O8XA 2NW2B 3KDMA 5T1DH 4DKDC 2EC9U 2NTFB 1G9NL 5B38G 4N0UB 4PJXB 5DTFA 1YMMB 1DCLA 5DQ9B 3HAEB 4MS8D 2WBWB 5TDNB 1KTRL 3KYMB 1HQ4B 1MWAH 2H51A 4MWFB 1FFPA 3T1WA 1PKQA 2Y4SA 2PYEB 4YC2B 1BVKB 4I1PA 1KT2B 1LE5A 4Z7NE 3N1FC 5GS0L 43C9A 5JUEH 3S5LG 3MJ9A 4RX4D 1J0IA 1L9MA 3UBXB 5I0ZA 4EI5C 5E56A 5CP3H 1MJJA 1I1AD 3DYMA 1RPQA 1SJVA 3ZYZA 3VFWA 1QO3A 3IDYC 1FZJA 2YKLH 2GUOB 4H5SB 4D0BB 5DO2C 2E6QA 3PUCA 3RDTC 3TCLA 2QSTA 2O5ZL 1DUYB 1V8HA 1QD0A 4F80A 2Y36H 4U6XA 1ZKAA 3TWCH 2EIZA 2B20A 1ETZA 2NX5E 2J8UA 5IBTL 1G7JB 1N2RA 3U4BH 8FABA 4PJBA 4FQXC 3KNBA 4DUXA 1X7QA 5DJ0A 1A8JH 4QRRD 2GJZB 2A83B 4NN5C 3TO4B 5EU4A 2AXFA 5AZ2L 2V6HA 3GSUB 5BS0A 1KN2L 1NEZA 1T7ZA 2NTSP 4LAQH 4MJIA 1OTUC 4HW6A 3TIEB 1FVEA 2UZXB 5TDOB 3PHQB 2R1WA 4GG6A 4UILH 1KB5L 2WWKO 3BOVA 1F13A 4R90H 3SDXB 2JB5L 2H26A 1FIEA 5KAQF 3GMPB 3UPRB 4EQ2A 1TQBB 1M71A 3MRHA 5HHXH 3HI6L 3PWUB 3MBXL 4JM2A 1A9EA 3QZWB 2JJWA 4QT5B 1CGYA 4PJAB 3ZKQD 4H8WL 1LO4L 3OAYK 1CDCA 3SE9H 5C0FB 4RGOH 5KSBE 2JJTC 4JQYA 3FMGL 3TVMA 5I1DA 2NY4C 3RVTC 4HJ0C 2NR6D 4JFEE 4D3CL 5IM7B 5FKAB 4EOWL 1LEIA 3QPQD 5JW5B 5IV2B 4HX1A 5DZOA 1G7QA 2H2PC 3HS0B 1FYTD 3QI9D 3GBNL 4ZMAT 3DMMC 4LLVA 4NDMA 2ZJSH 1YYLL 3IBCA 4NOLA 1ZAGA 3RU8L 5BJTA 4G6AC 4M02A 1T2JA 3MV9D 1JGEB 4WV1A 4TPRL 1OTSC 1FLTX 4MDJA 5TE7H 2I5YH 3OAZH 5EWIL 4XP9L 3GSVB 3QWOB 3B9KC 4GXVH 4YHNB 2OLDA 5JMOC 2R0LH 1HYSC 2ZG1A 3UTZB 3EDKA 3WFBH 3QHFH 2C1OB 1ZLWH 5D6DA 5KSAD 1OHQA 4XVSL 3D3VD 2YS4A 2AEIT 2YXMA 3IKCA 3TBWA 2Z93B 4PD4J 1FCGA 1NCWL 4NZJA 2EDXA 3V4VH 4KTYA 3O3DA 3D18B 1IGTB 3QG6A 3OX8B 5C08B 5ELIA 5DSCB 4IDJH 3QT2A 3GSRB 1X6NA 3EYSL 4O9HL 2ZUQB 4IS6A 4LKXA 4RMUA 5E9DB 2H41A 5CUSH 4POZD 5I1KH 2R39A 1FC1A 5DRNB 5IWLC 3BVNA 4M7LL 2C9AA 2R2EA 4MX7B 3IS1X 1ZSDA 2YWZA 3MREB 1J10A 1VADA 4HUUA 4KMTH 3UYRH 3DLQR 4C58B 5I18H 1ADQL 3MYJA 3TN0A 3QQ4B 1E6OH 4PRIE 3VD5A 2XPGB 4NOJA 5GGUA 1OPGH 4DFIA 5JPMA 1CBVL 3P4OA 3GNMH 1MSPA 3HI5L 4RFNC 4Z7WE 5EU3A 2YRZA 1F1JA 3ILPB 1CU4L 3EYOA 4XWGL 4FQ1H 1E4XL 3CDGA 3EDRA 4X7SL 4NQSB 2R8SL 1UT9A 4ZVOA 4QTIL 2A6IA 1MNUH 3NCBB 4P2QD 5EA0L 3AS1A 4Q97A 3QCVL 2VZSA 3FO0L 1PZ5A 3MODL 5FM5O 1VFMA 2EIBA 5GRZA 1NDGA 4X8XA 2ZKHL 1BEYH 5DFVD 3DGGB 3HCVA 4JR0A 5C0JA 3L7FB 5ICZB 5C6PB 1MJUH 4NKDB 5DHVA 2R56H 2PXYB 3OL2A 4PJ9D 5I76A 5AEAA 3L6FA 3VFGL 3VDBA 5FHAH 1CQKA 2EKSA 5DD3H 4R2GB 5FO9B 3B9AA 1D9KD 1TVDA 1T2QH 4KAQH 3LS4H 1T22A 3AXLB 4H20H 1LGVA 1NBYB 4NN6C 3QUML 4J8RA 4Y2DA 5HYFA 1B2WH 1KN4H 3VG9B 1MCEA 2V2WA 5KOMC 2HBYA 2ATKA 3B2VL 4UOW1 2XKNB 3MRRA 1GQFA 5FECA 4NWTH 4GMSL 2DLGA 2KQMA 5FCSH 3QJHA 4PB0H 4DW2H 5I6XB 4XGZB 5MENB 2CXKA 2AJYL 4HKXA 2XYHA 4WEUD 2NY2C 1TLKA 1EO5A 3LPGA 3QR2A 2A73A 3UTSA 4DKEH 5HVHC 3HMXL 4FMFA 4L29A 1X5IA 3RX5A 4APQA 3C8DA 4R8WH 3LZFH 3JTTB 5HPMA 3L3OB 1LD9A 1V7ML 5E8OB 4HKJA 3P30H 1RZIA 4MCZA 2BVUA 3FHAA 1P4BH 1UYWH 1T7VA 1BVLA 1P2CA 1IM9B 4UAOB 1W0WA 5E8EB 4XVJH 5E0QA 3M8OL 4KJWC 2WIIB 3QUKA 4ZO9A 4C83A 3CFEA 4MNHA 1S3KL 5SX5H 1S9XB 3VFMB 2Y0BA 3AY4A 3B6SB 3W5MA 1J8HB 1AHWA 1UWXH 3GBLA 3LN5A 2UUDK 5HDLA 1HI6A 2OJZL 5GGSB 1G84A 2WBKA 1F6FB 4KGJA 3DX9B 1KYOJ 5A3ID 4NBLA 1W8OA 4OZGF 2CIKB 4WCYH 1A6WH 4I3GA 4CVXA 3IJSB 4YXHH 2W91A 2Z4QA 1JRHH 5CD5D 1ZMYA 5DQDH 5F6IB 1AO7B 4YXLH 3A6BH 3MUGB 1JNLL 4PGBB 2RAMA 4JRXA 4U6YB 4JREC 4QRQA 5HGBA 5CSZB 1AQKH 5FHBL 2HVJB 4KJYB 3V4UH 2UVEA 3V7AG 1FZKA 4KRPB 4BKLB 3N0PB 4FQLH 1R3HA 4KROD 1OAKH 1F3JA 1HOCA 1V5JA 1CT8B 1A7QL 3QFDB 4TTGA 2MQCA 4O4YL 3BKCL 4LL9A 2V5YA 4NZUL 4NIKB 3BPLB 1MJ8L 4F7MB 2XZQL 4S1DD 3BZFB 1MAKA 4Y19E 4Z0XA 1QTNA 3L3JB 1NMAL 2OR9H 3ULUF 3AMLA 2YD7A 4ODUA 2GITA 3PG2A 2FEDD 4TYUA 3TA3D 1DANT 1BJMA 2XZAL 4WO4D 3LN4B 2BMKA 3QUYB 3WNMA 3HE6A 5JLZA 3SE8L 3WKMH 2HBRA 4KQ4L 3UDWC 3ZE2F 3HZMB 4U1LA 3ECBA 1R3JA 3SJVE 3OKLA 3O6ML 5IARA 5H8DA 3GBML 2E7HA 1SEQL 1MJ7H 1T21A 3F7PC 4XP1L 1EK3A 3ARUA 4OLWH 1DFBL 4EUPA 5MEQA 5F7LB 1IEHA 3GMLA 4YHYB 1CN4A 5GRWA 5EZLB 2BSED 5DZLA 2KKQA 1RFDL 2XTJE 4I48B 2YA2A 5D6CA 2WLYA 2B5IB 2VQ1B 5ALCH 4HPYH 3DVNA 3G6JB 1KIRB 4FXKA 4QRSA 4Z7OF 5T3XL 3IJHB 1WIPA 3LKNA 4NWUL 2X4SB 2PN5A 2WW8A 4KPHL 1FL3B 4UU9A 4DJMA 4XP4H 5IBLC 1HDMA 4DAGL 4V1DA 5C0CA 3HPLB 3FO1B 1MLBA 4OCYH 4M5ZH 5FOJA 4G9FB 1QHPA 3O3AA 2WINB 3I3EA 3P4NA 4D3XA 5IIEA 4M6ML 5DEGA 5FF6B 1QX3A 1DVFD 3MGTB 5JO5B 3DETC 1INEH 1PLGH 4JDVA 4JHBA 3V0WL 1RZ7L 4G42B 3D48R 3X12B 1KTDB 2K9UA 2XQYK 4UINH 3PV7A 4L4VB 4Y16C 5GS0C 2VLKD 3BDBA 4QCIA 5KVFL 2EDDA 2DI7A 1I7RA 1LILA 4OLXL 1SM3H 3C5ZA 4PRBB 5F88A 4NQCE 4G8EA 5IVNA 2CH8A 3OR6B 3DV6A 5JHDA 1U9KA 4EEEA 1JZ5A 1YMHA 4MZ3A 3KR3H 2OSLA 4XMPH 2NLJA 1FNLA 3VD4A 3EJYD 3QJFB 4NQEB 4G43A 1FZMB 2IPKB 1G9EA 3NA9H 4I9WE 4KQ3L 4R4BA 1D5MA 1DBJL 3IDMB 4HF5H 1DLFL 3VXRE 1Q72H 1FAIH 1MFAH 2ZG2A 1UGNA 3S37L 5IFAH 1BD2D 3GB7A 4QOKB 5EOQL 3WDJA 4GKOA 2CD0A 1T5XA 3QDJA 5C0NC 3GSNA 1CE6B 2KPNA 3MLSH 4MXQC 4WW2B 4DZ8B 1EPFA 3P77B 1LNUA 5DJYB 4ZFFB 5GRXG 1FHGA 1MCOH 3A0OA 4P9HL 4OGYL 4LEXH 3JV0A 3RAJL 1KG0B 5F3HA 2GK2A 1FC2D 4PP1C 3L7EA 5ID0A 3BXNA 2VN4A 3BP7A 3KYKL 4M62H 4H1LG 1GZQA 2AP2A 4CW1B 3ULVF 4MB4A 3RTQA 1HIML 4LHUG 3VFUB 4HUMB 3ARED 2P48B 1JVKA 4LRIA 4HD9A 5BVJA 1X5XA 5HSFA 2P5EA 4YZFF 1NKRA 3CCHA 2X4TA 3RNQB 1C1EL 1CGUA 1G6RL 1AGFA 5HHQB 2YUVA 5IFJB 1YEHH 3R0NA 1QBBA 3MLYH 4R4FL 4O5LL 4XBGB 5INDB 5ISZB 1HSAA 5C07E 3MCKB 3UXFA 1TXKA 1UEMA 4GO6B 3D85D 3I6LD 2LVCA 5E2TH 2CKNA 1UB6A 3D39E 3P0YL 4PJ7B 3EHBD 4DVRL 4OCXL 2IAMD 1JWSB 4XCYA 4X6CA 4QXUH 1J0ZA 2KZ1B 1ZT4A 2IC2A 4RBPK 4Y5VA 4FS0A 4ZVQA 4XH2A 2UZIL 2P8LB 4C56B 4KKCD 1EGJH 3JWDC 1A47A 1DE4A 4K3JH 5C6WH 5TJWK 4PJCF 2D4DA 3WNOA 5E1AA 1KJ2L 2LAGB 4YWGL 4JM4L 2LU4A 3MR9A 3HR5B 4G7YH 2JK5B 2C3VB 1XF1A 3GJFA 3MRJA 3VI4F 3ROLB 5LCVL 3MV11 2IF7A 4LNVA 5BOPA 3RWFB 1BIIA 1DTUA 5F7FA 4WEBH 3QCUH 4UBDC 4FFVC 1C5DA 4EKXA 3BI9X 3VJ6A 4L4TD 3PL6C 4OZGE 4PJ5D 2EDBA 5JNYA 5EIQA 3O4LD 1AIFA 1FQ9C 2VZ3A 2DWDB 4FQ2H 2NZ9D 4P46B 4HWBA 3PD0A 4ZAKD 1D5ZA 4K7FB 3T77B 3I9GL 3UC0L 3R4DA 5IHLB 3IDNA 1PY4A 4PJ8B 5D7LE 4Y5YC 4RRPG 5J7CC 5D1XD 4BK4A 2OXHA 4NJAH 1AKJA 1QYGL 2HT2C 5T3ZD 1IQWH 1EX0A 4X5XA 3U0PB 3BKJL 4L9LC 4O2FA 1OGAD 4NO2A 2NXZD 5I8OL 4Y4HB 3VWKC 5CAYB 2ZOLA 4XNQA 4ODSH 3X14B 3BD5A 3HRZA 2XTJC 1S78D 3L95B 4RGNE 4NKMA 1A1NA 2HFEB 2CK2A 1XFPA 4MAUH 1CFNB 3T0VA 4HZLA 4BZ2L 3ULUE 4XNUH 1BM3L 1NLDL 5DK2A 4XNYH 2MHAA 2H54A 4Z8FL 1SC1A 2PW1A 3MLXL 4HFWA 2P5WA 2IPUK 4K07A 1OAUL 1T6WA 1MLCB 1T89A 4MA7L 1MCQA 3IAQA 3SDAC 5IG7A 4J3UA 3ZE2E 4XPFL 2MKWA 4QHMA 5T1KD 4XVTH 1WZ1L 4YHKH 1XH3A 4Y4KD 5T1DL 4U1IA 2ITCA 4L8DB 5CEZD 5T3ZH 1MWAL 5HDOA 5IJKA 1CDHA 1U3HA 4FQHB 4G8GA 4XPBH 4LCWD 4CN4A 2E6PA 5JUEL 4Z7OE 3KPPA 1EAPB 4PG9A 4DGIH 3QNYB 3S35X 3GSXA 5C0EA 4U3XA 3IBFA 4O02H 3FTGA 2E9JA 3FOLA 2AQ1A 2BY2A 1F5WA 2R2BB 1IE5A 1JF6A 2V2XA 1Q1JH 3FFCE 3IYLW 1MCKA 5L2KE 4QTHA 3TBYB 5H2BB 2YKLL 1CICD 4XNMB 2PO6B 4YIQA 2AERT 2F15A 5DGRA 4Z5RA 3WUZA 5IQ9B 4HAFA 4ZTPH 3MBEC 1FRGH 2Y36L 2G5BA 1DQQB 3TWCL 4UB0L 3NTCH 1U8HB 1J0HA 2UY7A 3NH7H 3U4BL 4XAWH 1IL1A 1ITBB 4P5KB 5TF1H 2DLIA 4QHKI 4J4PC 5CHNA 5GS3A 2Y5EA 1ZLUH 3OXRB 5JORA 4MNQA 3SHSA 4X4ME 2BNUB 5I1GH 1B4JH 4KUCD 5CEZH 3O11A 1UADC 2F74A 4LAQL 2AJXH 4G8FB 2Q6WA 5DUPH 4E42B 2V9TA 3RY4A 4XMKH 4FZEH 4UILL 4LIQE 2W59A 3HC0A 1JGVH 5D2LA 3BX7C 4R90L 3BUTA 4QY8A 5DJDB 2JB6A 4HH9B 5I9TA 1G0YR 5I9QB 4ELMF 3LQAH 1F90H 2X1PA 5HHXL 2H9GA 5T5NF 4WNQB 1MUJB 3QIUC 4DZBB 4EN3C 2E7LC 1U8JB 5ANMB 3VMOA 3V55A 4F7CB 5FGBC 1TTFA 3AAZB 5LVEA 1YNTA 3S96A 3H3KA 1P9MC 5IB4A 3SE9L 3DRTB 4RGOL 3WJLA 1PD6A 4D9QD 3TZVC 2VN7A 3WS6A 5BV7H 3MV7A 3CDFA 1OP5K 2AV1B 3RZCA 2EEDA 1QVOA 1EEYB 2V5TA 1NFIB 4HIJB 3VMNA 2VYRE 2NW2A 4IOFD 5FOBB 3JZ7A 2OBGA 2ZJSL 1KB5B 4GKSB 1I9RH 5EZOH 2NTFA 2I9TB 5F1NB 4N0UA 4PJXA 2YZ1A 3BESR 1YMMA 1SQ2N 3EO0B 3HAEA 1UXSB 2DF3A 3OPZH 5DQ9A 3TYFB 5TDNA 3KYMA 1HQ4A 5TE7L 2I5YL 2A6KB 2R15A 5DVMA 1U0QA 4GXVL 2PYEA 1BVKA 1NC4D 3ULVE 2R0LL 1KT2A 4YXKH 4G7VH 3WFBL 3MX0A 3FT3B 1IFHH 5CS7A 3CDCA 4TTDD 3QHFL 3UBXA 3O6FB 4DOHE 1SVZA 1HCFX 5L8LB 4YZFE 2J7LA 2A74B 5KAQG 5IC4A 3V4VL 2GUOA 4H5SA 4F9PC 4D0BA 5IAGA 4IDJL 3MACH 1DUYA 1QRNB 2COQA 3L3KB 3BQUB 2Y06H 1BZ7B 4XPAH 3WNKA 2Y23A 4LSZA 2EYSB 2D7PA 1G7JA 1DQLH 4MXVF 5CUSL 4HJGB 5I1KL 1HHHB 1WTGT 3D1MC 1E4XI 2CKBH 3FT4B 1I8LA 2A83A 2GJZA 2WBJC 4G6MH 3TO4A 1IMHC 1BWWA 4KMTL 3UYRL 4FABH 5I18L 1N4XH 4FRWA 1CTOA 1T7WA 1LWRA 3GSUA 1E6OL 4RFOH 3BIKB 4DCPA 3MC0A 1GOGA 3S4SB 4N0FB 1OPGL 2AEWA 3TIEA 5TDOA 3PHQA 3GNML 4PJCE 1MHPH 1OAXH 1I51A 3SDXA 1QACA 2CDFB 3U79A 3VI4E 3UO8B 4L1HA 4PLJC 3GMPA 3UPRA 4ZSOB 4FQ1L 2I25N 4UQ3B 3ZSTA 2QJDA 1UH2A 2R1XB 4POYA 3PWUA 1KLUB 5MI0C 2AK4E 4IRJB 3QZWA 1J11A 1MNUL 4JE4B 1DANU 2C5DC 4HCRH 4PJAA 4F57H 4FQIH 4R4NC 1HE7A 5C0FA 3EYQD 1BEYL 2EIEA 4RGNC 4MHHG 1MJUL 2R56L 4BQ9A 5IM7A 3ULUC 5FHAL 5FKAA 5CBAB 5DD3L 5E8NB 5JW5A 1A22B 5IV2A 5A2FA 4R0LA 1T2QL 3SKUD 4KAQL 4LKCB 3LS4L 3HS0A 4I2XE 4PJIB 4JRYB 4H20L 1WEJH 2CUHA 4GFTB 5D5MB 1B2WL 4QXTA 1KN4L 4JANB 3KXFD 5J13B 1JGEA 1F45A 2VC2H 1RHUA 5LGJB 4LVNC 1H3TA 4OZ4B 1R5VB 3OZ9H 1L6XA 1AP2B 4JFDD 4PJEB 1UACH 2CR6A 3GSVA 4YHNA 4NWTL 2CO6B 4G6FD 3VWKB 3P40A 3QUZD 3UTZA 4X99B 4LLQB 4KZDH 4TNVK 4PB0L 3OAYH 4DW2L 4NM8H 2HBQA 3UCRA 2C1OA 4N90D 3Q1SH 4M8QB 2Z93A 4DKEL 1ZVSB 5DRXA 4ZYKB 3AM8C 4JGUA 2W60B 2NY1B 1AXIB 4R8WL 3LZFL 3D18A 3OX8A 5C08A 5DSCA 3P30L 1KCRH 3P3YA 1P4BL 3GSRA 1UYWL 3S35H 5GRYA 2DLFH 1LDPH 4XVJL 5DD5H 3QFJB 5E9DA 3U4AA 1EO7A 5KG9B 3QUMB 4WWKB 4WHTB 5DRNA 2E7BA 3SDDD 5GXBB 4MX7A 1EEQA 3MREA 4GAJH 1NUNB 5C0IB 3QQ4A 2XPGA 5DK3A 3BPOB 1WWBX 4WCYL 1A6WL 4HKZA 3Q5TA 1GGBH 4QUEA 4PJDB 4YXHL 5ENWB 1JRHL 3ILPA 4P2RD 2IH1B 1UQSB 4NBXB 5DQDL 3WFZA 1GFWA 2AGJH 2VH5H 4YXLL 3WL9A 4NQSA 5DUMH 3TJEH 3KVQA 3WFHB 2FATH 3MFGB 3TJHC 2KH2B 3SBWA 3I75B 2QQNH 1AQKL 2YSSB 2OM5A 4DUVA 4JQVA 3H7BB 4ZXBD 3DXAD 3V4UL 3GEWB 4QUHA 2BNQE 1URLA 3QEQD 4FQLL 2HJFB 3GSWB 3DGGA 3VW3H 1OAKL 3BZ4B 3L7FA 2E7CA 4NKDA 1OLZA 3BIJA 2XA3A 3IETB 2PXYA 3F7QA 4AZ8A 3TFKD 1VEMA 2VDPH 1FYTE 1SJXA 3P2TA 5IBPA 4M00A 1P1ZB 5J6GB 2HFFB 5FO9A 3AMKA 1ZHLB 2HTLC 3AXLA 2XIDA 4R97B 5KBNC 1NBYA 1ZANH 3ARZA 5DJCB 5EBGA 3GGWA 4Y1AE 3E8UH 2OR9L 4ELME 3DUUB 3CAFA 5EU6D 1BQUA 3GKZA 5SWSB 5C3LD 1CLOH 3ARGB 3JWOC 3EBAA 1KELH 1UXWB 2XKNA 1WUNT 2R29H 3WKML 3D3VE 4QHKJ 4CVUA 1VGKB 4XGZA 3ORJA 5MENA 1MJ7L 2DB8A 3ULVC 4OLWL 5I1EH 4M1GH 4MJ2A 3BPCB 1YA5A 3VGGA 5E03A 2EECA 3G6DH 3C60C 3RL2A 1X5KA 3JTTA 5ALCL 4HPYL 3FFDB 5E8OA 2HRPH 2R69H 5IEHB 1IM9A 5E8EA 3VGHA 2WIIA 1MI5E 4YHPB 4XP4L 5C07B 4UOJA 3DX8A 1YECH 1S9XA 4OCYL 4XXCC 3VFMA 3MNVB 2ESVD 2VAJA 3KAAA 4M5ZL 3KYOB 3B6SA 5D1ZB 4FQPA 1J8HA 5JDSB 4CRPA 8CGTA 3O6KH 2IANE 5GGSA 1UC6A 2P42B 3C6LB 3DX9A 4P4KD 4P2OB 2Y6SC 2CIKA 3MRQB 4K3GA 2D7QA 1INEL 1PLGL 4XNZB 6CGTA 3IJSA 5D2NE 1OARH 5I2IB 4JR9H 4YR6B 1A2YB 2J8UF 3OKOB 4HDIB 4WFFD 4PJBF 1GAFH 3RHWF 4P2QE 5HYJE 4UINL 1MCDA 1AO7A 3MUGA 2D0FA 4AJ0A 4U6YA 5HHPB 3HC4H 1SM3L 5CSZA 5I74B 2HVJA 4NC0B 5IB5B 4KJYA 3KJ4C 5J1SC 2Z35B 1LK3H 1IBCA 2HBZA 3MZGB 2D7OA 4ZVRA 4BKLA 1X3DA 3MROB 4GG6F 4JFHD 4FTVB 3KR3L 1NUDA 5D1QC 5E95B 1GGUA 1CT8A 2UUDH 4XMPL 2YD5A 3QFDA 2XZZA 1NGYB 4KDTC 3NA9L 3I84A 1CLCA 4HF5L 3TPKA 4F7MA 3L5WB 1Q72L 1FAIL 1MFAL 3BZFA 4JM2F 4RA3A 5IFAL 5DC4B 3E2HB 3DEIA 3JVGC 3L3JA 3S34H 2GYSA 4I18C 1SYSB 3P11H 4MAYD 3MLSL 5C9JB 3LN4A 4U1MB 3QUYA 4P5TD 1MCOL 5MI0B 3JBG7 3HZMA 2CIIB 4LEXL 4D9RD 2VXQH 5IMLB 1MHHB 2ATPB 3UTTD 2JJTA 3RY6A 2A2QT 4OV5B 4IYRA 3Q48A 1YPZF 1W8NA 4I48A 4M62L 3ALXA 4DTGH 2VQ1A 1X9QA 2DRUA 4N5UA 3G6JA 1KIRA 3VXNB 3IJHA 1UM5H 1WBYB 1OP9A 3HUJB 4PGZA 3HNVH 1FL3A 2AJZB 4PRPB 5SWZE 4NT6B 4KK6D 3HPLA 1YEHL 3WDIA 3FO1A 3R0MA 5GGTH 3MLYL 3PNWB 1A6TB 3U46B 2D7NA 4G9FA 2WINA 1J05B 5ABDE 2V7NB 3K7EA 3B4NA 2ED8A 1E0OB 3VE0A 5FF6A 1TCMA 5E2TL 3MGTA 5JO5A 1KUMA 5HVGB 3U6RB 2VDRH 2JJVA 4QXUL 4G42A 4ORGB 2W9EH 1KTDA 3X12A 5I0DA 2APXA 4P0DA 5E6ZA 2WUBH 4HIXH 4L4VA 3B43A 4F15C 3BMVA 1EGJL 3VWJB 4YHMH 5JFTA 4CVZB 1I4FB 5F7WC 4K3JL 3OXSB 1K4CA 5FM8A 2VXTH 1XIWD 4JPKH 5K9KB 1MQ8A 3OR6A 4G7YL 5BO1H 3CLEL 2R23B 1G6RB 2DQGH 4M9OA 4JCLA 1N3NB 3K80A 4WEBL 3QCUL 4OF5A 5LGHH 3ARFD 3QJFA 4NQEA 4KC3B 5HHOE 2AKRB 2IPKA 1PSKH 3QPQC 2AS5M 2BVYA 3IDMA 2V2TB 3N1GC 4KKAD 3QISA 4N68A 4P3WA 1F6LL 3QI9C 4QOKA 1YUHB 4FQ2L 3DWTA 2D9QB 3UTPD 3BO8B 1CE6A 4U2ZA 3CDYA 3THML 4JY5H 4WW2A 4DZ8A 5FAAA 3LCYA 3P77A 4GRLB 3SGKA 5DJYA 2EZ0C 2JKXA 4ZFFA 1KULA 4N5EC 2ICWI 1NGXB 5D96B 5I9BA 3NZHL 4NJAL 1WFNA 1NMBH 4NRYB 1IQWL 1KJ2B 5KSAC 5E2UH 4ONFH 1KG0A 4LPYA 1GYAA 1A6AB 5DI8B 4QU5A 1QSED 2OZ4H 2QQKH 3QIWB 2VR4A 3VFTB 2ENYA 3E6HB 1BQHB 1GL4B 2J4WH 3IB4A 3OKYA 4ODSL 4CW1A 4I8DA 1QTYT 5C0RH 2QLVB 4S2SB 3VFUA 5AZEH 4KHXH 3MA7B 4MAUL 4HK0B 4AYFA 4O2CB 4BFBD 2CSPA 4BZYA 2YPLE 4XNUL 1CLYH 3D6HA 4XNYL 2W0PA 3RNQA 3KPRD 4BSJA 5HHQA 5CJ8A 3WFEH 3U1SH 5INDA 5FYJE 5ISZA 5HHMD 3FQXB 3REWB 4D8PB 4XVTL 3EDFA 4YHKL 5GSRA 3O6LH 1AQDB 4NQDE 5HGDB 2XI9A 1R3LB 2DOCA 4PJ7A 5T3ZL 1JWSA 3U7AA 3S98A 1MCLA 4XPBL 2F53B 1ODAA 2QLFA 2X10A 1MAMH 2P8LA 5D2NC 3LDBB 4C56A 4DGIL 2W0KA 4ODVH 5C0BD 4JHAH 3QH3B 4JGJA 4GW5B 3V0VB 4O02L 3HR6A 4YDLB 5GZOC 3HG1B 2ICWB 2JIXD 1IAKB 1K5NB 3HR5A 1Q1JL 5CWSB 2JK5A 4QHUB 2C3VA 4KK5D 3ROLA 1PVHA 2HYMA 1MCIA 5GSVB 3RWFA 4MCYA 5L8KB 1I4OA 4ZTPL 1FRGL 1AGBB 4RIRB 3IFLH 3NTCL 4GRWF 3QUXB 3R6GA 3NH7L 4XAWL 1JMZA 5TF1L 2XKUA 4DQOH 2DWDA 3W82A 2J8UE 4WEMB 4P46A 5IBUB 3EOTH 4PJBE 5I1GL 1B4JL 4ONGH 5ERWB 1JNNH 4RBPH 3LPFA 1MWAB 2EDRA 3PWJB 2LVEA 4K7FA 5F9WB 5CEZL 5E94B 1KIPB 3T77A 4ZUSB 3QDGE 3QSKB 4PJ8A 2AJXL 1P7QD 1RJYB 5DUPL 4L8SC 4XMKL 4FZEL 5BS0E 3SOBH 1JGVL 2M1KA 4L5FH 1Q9WB 3RX8A 4MJIE 5A2LH 2HT3C 1X5JA 3U0PA 4JO2H 4GG6E 3LQAL 1F90L 2L7JA 4Y4HA 3V52H 1WFUA 2Z31B 4PLKC 1F4WH 4W70A 4U4BA 1HWGB 4HQQH 3L95A 4IHOB 3RIFF 3HE7D 5I15H 2HFEA 3GHEH 2GTWB 1CFNA 3OF6D 5E6ID 1CFVH 1T7YA 2YWYA 3GMNB 4LF3B 3H9SD 4HUWB 5BV7L 1OF2B 4YDIH 1MLCA 1N0XH 3KPQB 1EJOH 3I6KA 5IB1B 1U95B 1ND0A 2BVQB 3ZYJA 4OZHB 5DMGD 4IJ3C 5KS9F 1I9RL 4L8DA 5EZOL 4EN3D 4HMDA 1J1PH 2O93L 3OPZL 3LPWA 2PCPB 4U6VH 5L2JB 1I1AB 3LV3B 35C8H 1YPZE 2EDFA 2DQUH 3W81A 1SMAA 4FQHA 4YXKL 1Q38A 4G7VL 2BVTA 4WI5A 2GT9B 1ZT1B 4TRPH 1EZVX 1IFHL 3QNYA 2DJUA 2EE9A 2CPCA 4XCCH 3PF2A 4NO3B 4PRHE 5IVZB 5T1MB 3LMJH 4JFZH 2R2BA 5FA3A 4Z76B 3DEJA 3TBYA 5H2BA 5J4MA 5DXWA 4XNMA 5H37G 4KROC 4QRRB 3R5JA 5TQ2H 5T5NG 4JY4B 2YUWA 3MACL 1IGFH 4OFIA 5IQ9A 3O4LE 2Y06L 5FGRA 1DQQA 4XPAL 1U8HA 4MD4B 1DQLL 2EDHA 3NPSC 4P5KA 1J1XH 4MSWB 5B21A 2ZUYA 2CKBL 2XYGA 4N8VB 3OXRA 4PRIA 4G6ML 1H3GA 3LEYH 2X7LB 4FABL 5I30H 1BX2A 1N4XL 2BNUA 3Q6GH 3ZE0F 2FEDC 5FDYA 4RFOL 3VA2C 2CGRL 5E08H 3M45A 5I1CH 2JCCB 4G8FA 3V5DB 1NBVH 4E42A 3T4YB 3VRIB 3WJJA 4KTDH 1EA9C 1MHPL 1OAXL 1OGAE 4LASH 3BP4B 1TJHH 5DJDA 1G9MC 4LSSH 4HH9A 3HMWH 5L6YH 1UVQB 4BUGA 3CSYB 3BN9D 4WNQA 1MUJA 3MFFB 4DZBA 3RZWA 1U8JA 5ANMA 4JQZA 1QZ1A 5TF0A 4F7CA 1CZ8H 4HCRL 3AUVA 4ERSH 1RZJH 2NY3D 3AAZA 4OZFH 3FB7B 3QXTA 4F57L 4CU7A 5F7HA 4FQIL 1CDBA 1OB1B 2CJYA 1OW0A 2FLBT 1FYTB 3FAWA 1FNSH 4HEPG 2CLZB 4RFEB 3GSQA 1U91B 1MOEA 2NMSA 3K3QA 5JIHA 1HHIB 3MV9B 1AR1D 2AV1A 5E00A 1NBZB 1EEYA 1EAJA 1NFIA 4HIJA 1AXTH 1WEJL 5FOBA 4R7DA 4NM4H 1KB5A 3FB5B 4JZNA 4GKSA 1WCBA 3ARDC 5F1NA 1RHHB 3G5XB 5KSAB 1UXSA 2VC2L 3EO0A 3TYFA 5I8CB 1NC2D 3OZ9L 4ZOEA 5HJ3B 1UACL 3HLAA 4UOW0 4GUPB 1CXKA 3O8XC 3S9DB 4PV9B 4KZDL 4XBPB 3MUY1 3SO5A 4R3SB 5DVNA 4NM8L 3SGDH 5CILH 4LFHG 3W0WD 3O6FA 4WTXA 4MD0B 3Q1SL 1RHQA 1UM6H 1GVIA 2FR4B 2FJHB 4D9LH 4HGKC 2AQ3A 2A74A 5HYQB 1BZ9B 3D0VA 4X6BB 4OD2B 4S0TD 4YBLC 1OP5H 2ICWJ 2P43B 4RGMB 3UTSE 1KCRL 4X6CF 1QRNA 3L3KA 3BQUA 3S35L 2DLFL 1LDPL 4RAVB 4A2LA 5DD5L 1BOGB 2EYSA 1QSZA 1JRHI 4HK3J 1HHHA 2YPVH 5F72S 3ES6B 4EI6B 2LFGA 3ZDXF 4GAJL 4ZUTB 1K85A 4PUBH 2EE2A 3BIKA 2ZUTA 3ZSSA 2ED7A 3S4SA 4N0FA 3ESVF 5EO9B 4DUWA 2MWCA 1OT1A 3UP1A 1QEWB 4YJZL 1FG9C 2F9BT 5HI5D 4P2QB 4PV8B 1GGBL 1U8LB 4QXWA 3HB3D 2IADB 2CDFA 2Y5TB 4MGXA 4ZSOA 1IC7H 5B39B 4UQ3A 2AGJL 2VH5L 5IHUH 1I1RA 2R1XA 5DUML 3TJEL 2FATL 1JI1A 3ZDYF 3HA0A 4B5EA 4EIGB 1Q9LB 4NZTH 2QQNL 4GRWE 4JHWH 4AENB 4PJ9B 4O51B 4PJFB 2Q3AA 4LSUH 2W0FB 4JRXE 1VACB 1T1YB 4KJPD 3MJ8B 3R7SA 1D9KB 3A6OA 1MFNA 4NO5B 5EUKB 3VW3L 2LQRA 4JM2C 1A7BA 2RIKA 4ZO7A 3IAPA 1ADQA 4UT7H 2VDPL 1I3GH 3CH8A 2OX5A 5E8NA 1TZGH 3TEUA 3WSQH 5K33A 1XGYH 4LKCA 4L8SB 4ZO6A 4PJIA 4JRYA 1ZANL 2GJJA 5DMIH 5D5MA 2AEQH 3E8UL 4TSCH 3TVMC 2RJMA 4DFHA 4JANA 1QA9B 3QHZH 1T5WB 5DA4A 4NZRH 2AXHA 2IAMC 4EZMA 1CLOL 2GCYB 5LGJA 1G7PB 1WC7B 1KELL 3GMRB 4OZ4A 1R5VA 4MNGE 4YX2H 3I3DA 4IBLT 3AB0B 1AP2A 4PJEA 1EMTH 4NC2B 2R29L 2FSEB 2NPLX 3VWKA 4OLYH 5GJSH 3V8CA 4PRAB 3VXUD 5EH1A 5DEFB 2VKXA 4KMQA 4WV1C 5I1EL 4M8QA 4M1GL 3VFSB 1F8TH 3G6DL 4ZYKA 1BFOB 3QAZC 2W60A 3CPLB 2J30A 2HRPL 1DZBA 2R69L 4OIBA 3PXJA 5D6DC 3SDAA 4JQXC 3QFJA 5KS9E 3SKNB 3QUMA 5E5UB 4WWKA 3SE3A 4WHTA 1MY5A 2R1YB 3O9WD 1HCVA 3QIBD 1YECL 4ZAKC 2JJSA 1LP9B 2X4PB 5C0IA 2IPTH 3OHXB 1ULVA</