1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GINGIPAIN R
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
2XZQL 3ET9F 4R3SB 1YECL 5CINH 2O5YL 3JSSA 1WTLA 5AWNL 4WCYL 3NR2A 1EAPA 3FAWA 4NNYB 4BK5A 5J13B 4TRPH 1G6RH 1LVEA 2I5YH 1BIHA 2E27H 3IDIB 3RIFK 3KLSA 2W91A 1W72H 2Z35A 4P2RE 3HMWL 3H6JA 4UQ2B 3ULVD 2Q7NA 1WWBX 5AYQA 4MXWL 3WEXA 3BX7C 1XIWD 2CUIA 3WO4B 1UA6H 4OD1L 3IS0X 3M07A 1CXIA 4GRWF 4KXZI 4YXLL 1YY9D 4ZOAA 1A6VL 5INCB 1BZ9A 1OAYL 1MSPA 2ARJQ 2VLKB 3PIQB 3EOYG 3PD1A 1S5HA 5GRUL 1DDHA 4A6YB 1RZKL 5F9WC 1CG9A 4X8JA 3L3DA 4FRWA 4DGYL 5HYIA 1CR9L 3PWLA 5HDQL 3S5LB 1FV1A 2B4CL 1T0NB 1Q9OB 1BZ9B 1MVUB 4OF6A 4CNIB 4L8SC 1AQKL 4U3XA 2ZZUT 1FL6B 2ZKHL 4L8SB 2P43B 3ULSB 2YPLB 1I7ZA 2DJ4A 3CFEA 4WUUA 2FEDD 3WEXB 4U49A 4OFPA 1J1XL 3ESUF 4LNVA 1G7LA 5T3ZD 2WINA 4DEPC 4HCRA 4O5LH 4PRPD 3K46A 3VRJB 3T0DA 2GUOB 3O2WH 3EOTL 3RVVC 3CFBA 4GG8A 4Q7DA 5C09E 4HWZA 4LAJH 4TPRH 2R4SH 5A3IC 2WIIB 2XFXB 2QJDA 2UYLB 3DROA 3LIZH 1JWUA 2GUOA 1PYOA 4JKWA 2JB5H 4J4PC 1LK2B 1NW9B 5D93C 4L9LB 1KPRA 2EZ0C 3A67H 5EU5B 5F21B 3IAGC 2A0LD 4XXDA 1T83C 2AV7A 3QUXB 1LE5B 2BVOB 5T5FH 4XP5H 4MCYA 5IG7A 3JBG7 1RWOA 5GRVL 1V3LA 4XXDB 4S1DD 4QKXB 4IRJB 3BPLB 2GEEA 5DS8B 1WQVT 3KPNA 3WFDH 4H88H 4AM0B 2WUCL 1FRGH 2NX5E 3QDJB 1REIA 3L5IA 1QX3A 4A6YH 5EULV 3BPNB 1MOEA 3UJTL 5D6DA 2YPVL 2R2BA 4D3YA 4YDIL 3F7YB 3QJHA 5T33L 1G7JB 2OJZH 4ZUTA 1ERNA 3VXQB 2P5WE 2W60B 2HMID 5GZOC 1K3IA 1FIEA 4GQPH 1D5IL 1B88A 2VZUA 1N6QL 3SGKC 1AXIB 1BBJA 3FOLB 1ORQA 3RL1A 1PQZA 4YUEH 1G7PB 2R15A 5EOCJ 5ICXA 2Z8VC 4Q6IC 4OLXH 3IJSB 5ADOH 4M03A 4NO0D 5IV2B 2QSCL 2J6EH 3ECBB 1X5KA 2X4QA 3DRTA 2XWJB 2QSQA 4I18B 2J5LC 4RAHA 3BDXA 1MHEB 3OWEA 4KJQD 4L29A 3O3UN 1JPFB 1CTNA 1WC7A 2ICWI 3QEUB 5J11C 3MCLL 2E9JA 2I60L 3MV11 4D9LL 2ADGA 4P5TC 4Z76A 4C56B 2OI9B 1NUDA 4K3DL 4Y19E 3WDHA 2EYRA 1K2DA 3K4AA 3HUJA 5F1IB 2IG2H 4TOYL 3DV6B 3QIWA 3U9UB 1NL0H 2XXCB 2JB6A 5F3BB 5GS0L 3QJFA 3L5WB 1QHPA 2NY5L 4F7PA 4ZNEE 5EPMA 1LEIB 1MI5E 3MV7E 1A3RH 3ARDC 5FF6A 2OZ4H 2YD8A 2F54D 3IDUA 3L7FB 4C55A 1MAKA 4D94A 3C2AH 3MYZA 4HBQA 3L3GA 3QFJB 2QSTA 3GI9H 4Q0XH 2Z91B 1W0VA 1U8LA 1XGQB 3K81A 4ALAL 4ISVB 4IOIB 4LPYA 3MA9L 3IETB 1YYMH 4UT6L 4LAQL 1NC2D 4LPCA 2J5LB 4E42B 4PP2B 2FH8A 4GBXC 4AWAA 1JNNL 2MOVA 5EORH 1JI1A 3IDGA 5I6XC 2PXYA 3P4OB 4P49A 1KG0A 1VCAA 2FDBP 4M00A 2Y36L 4LBEA 5A2KH 3WJLC 3AMKA 4OZFG 3L1OL 4KMTH 4M62L 3NAAL 2YXFA 2FZ3B 5GRWA 3MYJA 2BC4A 1P1ZA 2HN7B 5C08B 3CFJA 3GFUA 4Z7VF 3MRIA 1MCNA 3BISA 1EJOH 5IC6A 1FNHA 1OVZA 3RY4A 4ISVA 1Z5LA 5F7DA 4PJFA 5IK3A 1S9XA 4MWFA 4NO2B 4DKEL 4NQXB 4I3RH 1HOCB 1PG7H 1JPTH 1MHHA 1NGXB 5L2KD 1LE9B 3MLRH 3BMWA 1HWHB 4XPHL 1BOGA 4NQXA 3GMQA 3VXUD 4XC1H 2BVPA 3LS5L 1IEBB 4PRBA 4XNYL 3KNBA 4XRCB 3D85B 4LDLB 5L7XH 4F37F 1PKOA 5DRXA 4Z7VE 4QUIA 3P9WB 4U2YA 4U1GC 4YFLI 1UXWA 5TF0A 2DQJL 1RJCA 5DC0A 5I1IH 2PR4L 4HS8H 4BSJA 3TESA 3ZKND 3S8EA 4K7FA 5GGTH 4ACPA 1A6UH 1S7XB 3PGCB 4WI2A 5JDSA 2DQUL 4KH2A 3LCYA 4XPGH 5F8QC 3RNKB 3TH3T 1A22B 3R06B 1DFBH 1ZS8B 1KCRL 4UDTA 3HC3H 3UYPA 4I9WD 4PGCB 4PFEA 7FABL 3B9KB 5I16B 4FFWC 4KK9D 4O2CB 4K55A 1NBZA 4C56E 3GB7A 1BVLA 4HT1H 4HKZA 15C8H 2BNUA 3ZO0A 5FYJE 3T3ME 1EV2E 2P8LA 4KZDH 2ZUUA 3DURA 8FABB 1BIIB 2Q86A 1FG9C 4ETQB 3PL6D 5DGRA 1WAAA 1JTPA 2FX7H 3VFRB 3OZ9H 1IEHA 1EPFA 2C7UB 4NQDE 1HOCA 3FT4B 4M5YL 2VDPH 1INDH 4MA3B 2DRUA 3DX6A 3S34H 5E7FA 4HV8B 3V6OA 3RWCB 3TVMC 1E4XL 1KPVB 1ZHLA 4XCNB 4XHJD 5BVPL 4HWBA 4PG9B 2VXVH 4LF3A 4PRHB 3JWOH 3F65A 2VDQL 4LFHD 4XRCA 4LSQL 3BT2H 2AABH 1MIEH 4RGOL 4Z0BL 1NGQL 1HKLL 3EYSH 3UX9B 3HPJA 4N9GB 5FO7A 1MIML 3VFRA 1ZVSB 4F9LA 4FS0A 5J1TC 3SDCD 4TSCH 2VNCA 4WGWB 3G9AB 4P57A 3ULUL 3VFUB 1NH6A 4JPWL 3TV3H 3BKCH 3NCJH 4K3GA 5CBAB 4WHDA 2YRLA 4NC1E 2EDNA 2V7NA 4NP4L 1A1MA 2ATKB 5DLMH 5HGDB 5JHDA 1MCOL 3O6LH 4N90E 1RUPH 4HKZB 4LVNC 4QRQB 5LQBL 3JUYA 4PJDF 1IC4H 2PTUA 5KOVC 3UTTE 5IB4B 2FUNB 4QXUL 5DJ2B 3QEHA 2B1AL 4UT7L 3AU1A 3IFLL 4QHLB 3OG4B 2CLVA 1IC5H 1QVOA 4FFYL 2NX5D 1EBAA 1SBSH 1KYOK 1HZHH 1C5CH 2FHCA 2PF6A 3VJ6A 4MQ7A 3G5VB 1MRFL 1TVBA 4ZAKA 4PB9H 2VXTL 1I3UA 4ODWA 3BH8A 3SIRA 1OD9A 1MFAH 5SWSA 4WW2C 5D5MF 5DK0A 3IFPB 3HN3A 4X8JB 4Z7QE 4K8RH 2DN7A 3ARFD 1WIOA 3FB6A 4QWWC 1V7NH 3T0EC 1S7SB 3VFSB 5I9QB 4HJGB 4N0FA 4WI9A 4G9DA 5FO9A 3V7MA 3SO5A 3C60A 5IT2H 3K8KA 4I48B 4D8PA 5JA9A 3RVTC 1WSST 2QQNL 3T4AA 2H26A 4Z77B 5B21A 2VXUL 3GJFB 4LSPH 2GSIB 1A6WH 5DD3H 3WUWB 1Z5LB 4XX1E 2H3NA 4RA3A 4YHYC 5A2JH 1ZHNB 4KMLB 3IRZA 1C7SA 2EDQA 2X4TB 2N56A 4YE4L 1F6AB 3JZ7A 4G6JL 4HH8A 1P5UA 1NBZB 5ILTH 1KIPA 2ZCHL 5D7JB 5EWIH 2BSSB 4WUUD 4PBXA 1UC6A 4ZMAT 3HUJF 2FGWL 4U6XB 2FR4A 4FTVB 4MAYC 3UOAB 1BJ1J 2NN3C 3GMRA 3S88H 1Z3GL 3EO0B 5C3LD 4TTDD 1KIQA 3ARVA 5K93A 3BPOB 5C0AA 4QTIL 1FGVH 2JCCB 1WZKA 1YEGL 3N85L 1CDIA 1DBAH 3W5NA 4DCOA 1A2YB 3K8LA 1OB1A 2HKHL 3KPPA 1H8OA 3ZHDA 1I9JH 5IBLD 1M05A 1JF1A 5IVNA 3PP3K 4PLNC 4JLRB 3VXMA 5IW6B 4WVRA 3KJFA 1FJ1B 5TE6L 2DQCL 4JRXA 4FA8A 5LU9A 3TN0C 3ARTA 4QHNB 2A6IA 1OCWH 4DCQA 5GRYA 2NZ9C 4LEOA 4OCLC 1C16B 1UYWL 5D2NE 4L4JA 4HLJA 2AJUL 5BQ7A 1NCDH 5EBWA 3O2DH 3REVA 4HULB 4NQVA 5E8OA 3GMOB 4M9OA 1SY6H 1ROWA 3VA6A 3OXRB 3BN9C 3C5SB 4YC2B 2PYEA 5HHVH 1R24A 1JNHB 3NA4A 4OLYL 3AMLA 1TZGH 3T3PF 3P4NB 2P8PB 2H3NB 4JFPB 4CW1B 5JOFB 1UT9A 4OF3A 1U3HC 1MJJB 4HFUH 4FABH 2HVKA 5C0NC 4PGBB 3R0MA 2Y1VA 4UV4H 1C08A 4L3EB 4ZFOB 3GK8L 3CUPA 3X12B 4DCPA 2FSEA 1I51A 3LVEA 3MRQA 1UWXK 2XZCH 4DEPB 1HNGA 3K1DA 1UM6L 4KI1A 4NO0A 4KQ3L 4YHKH 1WK0A 3D39A 1F58L 4ZAKB 3HE6A 5DR5H 4S1SL 1DJSA 1CLYH 3RDTC 1WZ1H 1DQJB 3V7AE 3LN5B 5E2UL 2NY3C 4JVWA 4ODTH 1HHIB 1A3QA 2W0KA 2VXQH 1Q9WB 5I1CL 4OUUA 2MKLC 3MGTA 5T1KB 5ID1A 2AKRA 3WKML 1ZT4A 4JZJA 3UC0L 1J0YA 4CL7A 3W81A 1DANU 2IBZY 5ACZA 3EFDH 3EDDA 1I3GH 4FQHB 5B39B 1JGDB 1FORL 2YKLH 3P9LA 4QTXA 1Y6KR 1RU9L 2AGJH 3DNKA 3HI6L 2AV1B 4FTVE 1D5XB 2OMNA 3QDJE 2F54A 3AREC 4AW9A 4G9FB 4NGHL 2FJGA 2O61A 4FFZH 1YN7A 1DZBA 2HTLD 3IFOA 4UTBL 5BW7C 1LQSR 2BVOA 4FQLL 2CK0H 1MREL 4OZHE 2JTDA 4QXWA 5F9JA 5LXGL 1DEEA 4BA8A 5I74C 2PUQT 3CD4A 4OUOA 3SDAC 3V4VL 3LHPH 5GS0C 1G6RL 2H51A 4JAMB 4OBSA 5EIVA 3B6SB 2IGFH 3I75B 1B9ZA 5TE7L 1W72L 3NCEB 3UCRA 2JJWA 5JOEA 5DD5H 1AHWB 5T5NG 1JNLH 4XNQB 3MMEA 4MA1B 4NKIH 4HCRL 5HYSB 3S98A 4AMKL 1NCAL 3G6DH 4OGXL 5J6GB 3PGFL 1KCVL 4PRPB 3MRMB 4MNQE 4JR9H 5FYJD 3GEWB 1X4ZA 4PLKC 2RJMA 2GTZA 4N0UB 4Y4FC 4HQRA 1CR9H 4X4YA 3NH7L 3BPNC 4XHJC 2BCKA 5CWSB 2X9WA 3GZKA 2PCPA 1YUHB 1N3NB 4PJBA 2DTSA 2VZ1A 4D3ZA 1TETH 5K9QI 1S3KL 5LG1A 4LCWE 1XF3B 5JXEC 3I6KA 1EEQA 2NNAB 4HS3A 3I85A 3VXUA 4X6CA 5F1OB 1IGJB 2ENSA 3FCTA 2CKNA 3G9VA 2SEBA 2IANE 5D96B 5E70A 4D2NA 3ISWA 2WWKT 3BIBX 4XX1G 4JE4B 3NGBB 3OKNB 1R3HB 4EZMA 3ZKXB 1GGCH 4W4NA 5K9OB 3TA3A 1I9IL 3T0XA 4PJHB 3QI9A 2QHRH 3UTTD 1KXVC 2P5EE 4JFYA 4RQQA 3QIUD 4DN4L 4P2CG 1WBZB 4M1DL 3EDQA 3M8OL 4J8RB 2I07B 4WW2B 3DX9A 2XA8L 1AR1D 1KF9B 2VLLB 4WI3A 3PP4L 3S37H 5IHZA 2XA3A 1OAKL 1Y18B 4F57L 4KJQC 3MREA 1MRCH 4ETQA 4MS8C 3QUKB 4K71B 3OJMB 1VSCA 2V7NB 3OKMB 1MVUA 2YMXL 5I8OL 1CGTA 1R3IL 2E7HA 2DICA 2ZUXA 3SJVE 4D0BA 2XYPA 1JZ4A 1M7IA 3ZDYE 5GS1C 5IFJA 1E6JL 2VWEC 2HRPL 3LKOA 1TTFA 3IYLW 4RGND 4LIQH 3SKOA 5IJKC 4NKOA 2G5BA 4MMZC 4HWBL 3UAJC 4X6BA 2V6HA 3C09C 3H9SA 3LKSA 4Y5YC 4QHLA 3R1GL 4Q58C 3WFHB 5GGUB 4PRHA 3V5HB 4P3CH 1GC1C 1RFDH 4OV5A 5EO9A 1MI5A 4H1LH 5F7KC 5C86A 4Y7MA 1N5YL 3FN9A 1UWXH 5HGAB 3GSNH 3QHZL 4HVAA 3RI5F 1FL5A 4LLMA 3ZDXF 1K88A 2GK2A 3LQAC 1DVFD 4LKCB 1IM3A 2CRZA 4B7LA 2BNUB 3EW3B 1I3RB 4P2QE 1SQ2N 4XH2A 4JM4L 5B4MD 3VD4A 4JPVL 3C60B 1ZSDA 3EDEA 3WUZA 1MF2H 1BIIA 3OR7B 1UEMA 4XI5D 3O9WB 4QWWD 4O58L 5DFWH 3MLUH 4MD0B 2YD9A 4PGDB 4AL8H 4QUDA 3MRBB 5CUSH 2NY3D 2VLRA 3ZYIA 4RNRA 5FA3A 3R7SA 3O4LE 3NCMA 3CZFB 5H8DA 3SE9H 1PYWA 1MPAH 1SVZA 1TVHA 5DRXB 3WIIL 3BZEB 4JFOB 1OWRM 3EYQC 3C8KB 4UINL 1F6LL 5GZND 3KPSB 1U6AL 4HUMB 2HLAA 5I1DA 4C4KT 4NKOB 3RZCC 3UO1H 4ORGA 4H20H 2P5WB 5HVFB 1RV6X 3RVWD 4HKJA 3RWDB 1N4XH 5CMAB 5HHOA 4ZDHA 3P11L 4Q0XL 1FZOB 5KS9A 2WBWB 1RUMH 4PY8I 1RHFA 3ZDXE 3C6SA 4KHTH 3RWGA 3GHBH 3ITNA 4X83A 3MJ7A 1AD9A 4FQXB 1MCWM 5HGAA 1DUYB 2Z93B 1FZOA 5KS9B 3ULUE 1BBDL 1IFHL 1S5IH 2EH8H 3HZYA 3ZL4L 4L3CB 3HRZB 3MRDB 2I25N 3VFMB 4IDJL 2HFGL 1OF2B 1T6WA 4MCZB 3E0GA 1BEYL 1KJMA 2Z0BA 3KWWB 5JQ6L 5IESL 1JYWA 5D1ZB 2OSLB 3T77B 3AFLA 3GIVA 3JVGA 1LDPH 1ZLUK 1DQQA 1HN1A 5KS9F 4P2YA 3BP5A 4FQIL 4NQDD 4RA0C 5TQ0H 5DRZA 1BZ7B 2FD6L 1FL3A 1RUKL 1OTSD 3MOBH 2IPUK 5C6TL 4MVBD 2CJYA 1U3HA 1JFQH 2UY6A 5C0AD 1AFVL 3JV4B 3C6LC 3TYFB 5D96C 5IASA 4O02H 5I17B 4G8FA 5DFTA 3HRZA 3MV7B 1EHXA 3DRTB 4I77H 2Q20A 9CGTA 3NS7A 3IETA 2J2ZA 5D8JL 3QFJE 5GS3A 4I13B 3U0PA 3QFDA 5HVWA 5F96L 1SHMA 2Z31D 1IRAY 3UZEA 4YHOL 1XF1A 5HHPB 5AAMA 5HDQH 5C0RH 1ETZB 5KS9E 3KHOA 4ONGH 4QRTA 1TZHA 4G5ZL 1FNSH 4OZIF 1FDLH 2H2PD 4PB0H 4XPFL 4Z95L 1A8JH 3WHXB 4L3ED 3MNWA 5GGTL 3MYJB 3E6FB 1T7XA 1B6DA 4PJEE 2HH0H 5BCAA 4Y19D 3KPSD 2X4OA 5KSAB 5F9DC 3QWQB 4I1PA 2JIXB 5KSVB 5HHXH 1SJHB 1UKSA 4U2ZA 2R9HD 1AJ7L 1VACA 3I75A 3NFSL 4JPKL 4RFNC 4NOJA 4ODBD 3IFNL 4R4FH 2ADIB 1S7WB 3SKJL 1B0WA 2ZUSA 1RWKA 1G9ML 4I3SH 5L2JA 3UO8B 1LP9F 4PRIB 5I2IA 2FEEI 4KZDL 4K7PX 1U8LB 1URLA 1CLCA 1XGQA 4X8XA 1N7ML 4WFFD 4DKFH 4EN3B 3S36X 1BLNA 4HKXA 4U1HA 3SCMD 1KC5H 5FUOL 1OTTD 4M5YH 2CRMA 4X6CF 5HHME 1FVDA 1NAMH 5I15L 2X4OB 5KSAA 3IJYA 3ES6A 4FXKA 5I8CA 3QDME 2F8OA 3GJTA 1UA6L 2JCCE 2VSDA 3D39D 4WY7H 3HE6D 3SY0B 2D7MA 1DQML 2GCYA 2XWBA 3V0VB 4I2XE 3DIFA 3E8UH 5ICZB 4GS7B 4JZJB 3CC5A 2P48B 2NY4D 3JWOL 2WUCH 1WICA 4YEEA 4R4BA 5ALCL 3DI3B 1CL7I 4MLIA 4U1IB 4HPYL 3QPXH 4YHML 2CDEA 4N7JA 2BHZA 1AQKH 5D2NB 1WVZA 1U9KA 2YPLA 4WUUB 5GJTL 3ULVC 5E8NB 4K3EL 3SE4A 1QLEH 2DBLH 2H32H 2AXJA 4MAYD 4PRIE 4PP2A 1T89A 3ARZA 5EOQL 5DMKB 1ODAA 3STBA 2CLZB 1TJIH 5DJXB 4EJ1C 2X7LA 3MLYH 1RUPL 2KL6A 2R4SL 4M02A 4JDTH 2LU4A 4WO4C 5DEGB 4BSVB 1X6NA 3LS4L 5GGVY 5EG6C 3IAQA 3WL9B 1X6LA 4HKBB 1KPRB 3FRPG 5EU5A 5IVZA 2WSKA 1OT2A 2IBZX 2YN5A 5ALBH 5BV7H 1OT1A 4H1LG 3QQ3A 1XGPB 1TFHA 1UADC 3EJYD 4JM2F 2YEZA 3BKYH 3NCFB 4D9LH 1DUYA 2YSSB 4PJ8D 5J06A 1FIGH 4ZVQA 3ARGB 1OL0A 1AKJA 4PD4K 1NBVL 3C08L 1Y6NR 2FEEL 3LOWA 1T5WA 3EYUH 4GKSA 3RDTB 3GSWA 4CBPA 2VB5A 4GRLB 3D3VD 2XOTA 3WSQH 1EIBA 5ITBL 4PJEB 1H3GA 4P46D 2CUHA 4M7JL 2AP2A 1WBYB 5IMMB 3MBED 5HTSA 4GRMA 4B53A 3HE7A 1CVRA 3PJSB 1F1JA 2R1YB 4YDIH 3DUSB 5EC2A 3TZVA 5EUOE 1BM3L 3KPLA 4UB0L 5IHLB 4UNUA 2A77L 4GKNA 1N2RB 3ROOA 1YYML 4UT6H 1ZT7B 1W72A 3T2QA 3BKMH 1K4DA 1J05B 2R0ZH 4YZFE 2QQKL 4HZAA 1YEKL 4HIHA 1J0HA 3NKFA 5IFHH 2X42A 4LGSB 3WIHL 4QTIH 4AY0A 2DAVA 5MEPA 3CVIL 2RQ8A 2QSCH 4EVNA 3L1OH 1DBMH 4FQJH 4AEFA 4HKBA 4JKPH 5I74B 4OZHB 4YWGL 5T1KD 5CEZH 2B7DT 3Q48A 2NW2A 5LUAA 1T7YA 4NKDB 2M26A 4Y16A 4F7CA 3B3IB 5EBMB 1CT8B 4JJ5A 1HXMB 3CH1B 1OP9A 1AGEB 2VH5L 3EGSB 1YNKH 3KPRE 3ETBF 1IGTA 4OCRH 4HWEL 2ZSWA 1U2CA 4GRWE 5D2NA 2HJLB 4KRPC 2HYMA 4PRPE 1LK2A 3CSBA 4J3OC 3HI1B 3CZFA 4HDIA 2APBA 3PGDA 4LPXA 4YQXL 3R6LA 1IEAB 5ITFA 4JO4H 1CFSA 4KKAC 1AH1A 1GGBL 1ES0A 3LEVL 2D9QB 3ARUA 3MA9H 5FM8A 3MTRA 4XAKD 5HHOE 3WFBL 2JJUA 4NN7C 3EDRA 3BDYH 1B2WL 1AD0B 3VI3F 1I8LC 3FOMB 4CMHB 1OP3K 4XPGL 5SWZA 5EZLB 3F12A 3MUY1 2GJ6D 1KJVB 4OLWL 1ZA6A 1XGRA 4OFIA 3RWGB 2OMBA 4U1MB 3T65B 4DCQB 1G9NL 5GS0D 5DSCB 1DVFA 2MWCA 4YBLB 2WBJC 1S7RB 5KSUA 1I1YA 2M1KA 3VGFA 2DKUA 5TGBA 1FNEB 3B9KA 5I16A 3S35X 3DVGB 2FB4H 1LEGA 5FHBL 3QUYD 5DUBA 1YY9C 1EJOL 4PG9A 3UZQA 5DT1H 5E00A 2FIKB 2VISB 3F7VB 3VFGH 4G9FD 3ARRA 2CDGA 1QSFE 2ESVA 3OG6B 1QFPA 3F8UB 4EKXA 4ZFGL 1MEXH 3BZEA 4G3YL 3O2VL 2VLRD 1G7MA 2KQNA 1KLGA 3KHQA 4PD4J 3VFNB 2VLMD 3BP6A 2DQGH 4IMLA 4M7LH 3TFKC 2X4SB 2C7UA 2W9DL 1ZGLP 2V17L 4WO4B 3MRCB 1E4XH 1IAOA 5EIIB 3D5OF 5BVPH 1YEIL 2VXVL 3VG0H 3OKMA 3AXLA 4GSDH 4KVCH 4BZ2L 2OTWA 2W0LA 1JVKA 1MCDA 3O41B 2APTA 3BD5A 2XRAH 5L7XL 4TUJA 3KR3H 1CWVA 2H26B 1I7ZB 4OQTA 1YPZA 3MLWL 4YR6B 5GSRA 1RZJC 4EN3C 1I3RA 2NW3A 2DQJH 3PWVB 4UQ3B 1FFPA 4XMLH 4HUVA 4NUJA 2JE8A 4TULH 3E6HA 3VFVB 1UZ8B 3KPOA 1LK3H 5ENWB 1EUUA 2NLJA 4K2UH 2IGFL 4MD4B 4IMLB 3GBLA 1FVCA 3N1PC 3OKLB 1JNLL 5E9DA 5CP7A 3U4EA 3PABB 2J8UE 4JEGB 2MKWA 2X9XA 2CIKB 4KK8D 4HT1L 1LO0L 5I9TA 1QSFB 3BGMA 1KEGH 3U7YL 5KANI 3AY4C 5FM4A 4OGAD 2R56L 1PJ9A 4HJJL 2F19H 4UOW1 1H3WM 1NDGA 2FBJL 1IZJA 2DQHH 4I0PD 5T3ZL 2J12B 4YHLL 3PWVA 4XBEL 2K1MA 4FFVD 4ZUUB 3MNVB 1N5AB 4PJAE 1QYGH 3VFVA 1RZJL 4HK3N 2GSIA 2VC2H 5BOPA 2IQAB 4UNTA 1D9KA 1J0KA 2Y1LA 3G04B 3MOQA 3QWRA 5F71A 4MNHA 1FL5B 3NCYP 3D87B 5DMIH 4Q9RL 2UZIL 4LPUA 4PLOB 3BN9D 2QL5A 2I9LB 2VDML 5A16B 2IAMA 5DRNA 4ZOBA 2VDNL 5GS1A 2V7HA 2ORBH 3ARWA 1MIEL 3QIUB 3MR9A 4FN0A 1JUFA 4WUKL 4XBGB 2QR0B 4JM2A 1Q94A 1ZANH 2QLVB 4H8WH 4HIJB 2Q8BH 5LAXA 4BH8A 1U8OA 4KTDH 4QYOB 1CN4A 1CFBA 3L3OB 5DS8A 2NLJB 3VXTB 4Z7OF 5DJYB 4NN6C 3O4LD 4IHOA 2EE6A 1IQWH 3PHQA 2DDQL 2FYYA 2FWOA 4NN6B 1FC2D 3B9KC 3IF1B 3IU3B 3VGGA 3FB8A 5FCUL 5FK9B 1CYGA 3MO1A 3UDWC 3X11B 3U0TA 5C8JA 4N0CD 1IGML 1CF8H 2PYFB 3HZYB 4RGNB 3S97C 1IC4L 3CAFA 3WD5H 4KI5C 3NZHH 4P2OB 1I9JL 1CQYA 3Q5YA 4P9HH 3ORJA 5DVKA 1SHJA 1E4KA 2EO9A 3HR6A 2C4FT 2DWDB 2BVUA 5DRWA 1MAJA 1ORQB 5CZXD 5CJXA 1Q1JL 4UBDC 4YDKL 2ZP0T 3SO3C 3TO2A 4I0PC 1CXHA 5GGTA 5E56A 3HRPA 4OGZA 4NN5B 4RAUB 2KUTA 1T83A 3VFWA 3TF7C 1QR1A 3RKDC 5I76B 4ODHL 3X3GH 2VR4A 5E6ZA 5C0BA 1JWSA 4LCWA 2PW2A 1AIFB 4JRYB 2XZZA 4PJAA 2X70A 3KPNB 3SKUD 1IGIL 4NZUL 3DVGA 3P4LA 4A2LA 3CSYA 4JQXA 4R97C 1H5BB 3EYOB 4R4ND 1JUFB 3MJ9A 1DEDA 3VGEA 4O4YL 5GHWL 1A6WL 1QG3A 5DD3L 4U3CA 3ZDZF 2DL2A 1EO7A 4GQ9L 3WXWH 4CJ1A 5IMMA 4HFUL 4FABL 32C2B 4QHMB 3MC0A 1EGJA 2YUZA 1MJ8H 5EUOA 3VXUE 2GHWB 3RVTD 2Z8WC 3P9MA 1KIUA 1MJJA 1AQDA 5IR1A 5C0AB 2PO6C 3P73A 1ED3B 1FGVL 2BY1A 4Z18A 3E1F1 2CGRL 4IRJC 4X80L 4ZVUA 1YEGH 1DBAL 4JN2B 5J11B 5E08H 5D6CB 4HIHB 1F58H 1CLYL 5JDJA 1RMFH 3UTSB 5I19H 1UACL 4MAYB 4BZ1L 3DETC 1GGTA 1PZ5A 2ARJB 5HYFA 1TTGA 1S9VA 1Z0MA 3CX5J 5CLTA 5IP4A 1OCWL 4H20L 4HQQL 2MHAA 3BESR 1JGVH 1RZGA 1RI8A 4DZBB 2FJFB 4G6ML 3OAZK 1YNLH 1QLFA 3C8HA 3OR6B 5FHAL 3RL2A 5EU7E 1VKXA 3SBWA 4UAOB 1BHGA 1WBYA 5KN5A 5FGCE 5IJVB 5EU3B 4YDLB 3LH2L 3G6AB 1VFAB 3OB8A 4HZLB 5T3XD 1SY6L 2H2SD 3KLHC 4JZJC 4PTTB 4P46A 3GKWL 4QRRB 3W5MA 4OLYH 4GKOA 2GY5A 5ACZB 1TZGL 2P49B 5IIEB 3GKZA 4MGXA 1M6OB 4QU9A 3HE7D 3PWUA 5EZOL 2D9CA 5IB5B 4Z5RB 5AG8A 3BH9B 2F54E 4LGRB 5EU4A 5L0QC 2HVKB 3MV7D 4JHBA 1RZ7L 5EN2A 1RJZA 4YHZH 4H0GA 5DJ0A 2C2KA 4PTUA 4RX4A 4PJ7A 5E6IA 1PD6A 2VLKE 4JFFA 3CSPA 4HAFA 3V4VH 3BH9A 4JG0H 2GQHA 4Y1AE 1QHOA 5FFLA 3JVGC 5IMOB 2Q8AH 4TNVK 4QRSB 1CE1L 4YHKL 4XT1C 5I18H 4O02L 1N26A 2CLZA 5KG9B 3UBXI 5J57B 4ZODA 2BY0A 4QEGA 2J33A 4DZ8A 5DO2D 1YA5A 2JF1A 5D2LF 4K8RC 1RSFA 4OCMC 2A38A 4R8WH 1SC3A 1E28B 4QRPB 4IMKC 5I2IB 4M9RA 5FOJA 3TBWB 3FO1A 1DTUA 4R4NC 2HFEA 3QWOA 3AS1A 5C07B 4Y16D 1QRNE 4I4WB 5EOTA 4YX2L 1NCNA 4XMPH 3V9FA 4CVWA 1DQLL 4NT6A 2KDGA 4LNRA 1U58A 3QIBC 2CIIB 3EFDL 1EEZA 4ERSH 2HH0L 5F7FA 1AKJB 2HFTA 3MRJB 1GPOH 5I30L 4MNQD 5D7JD 5M7QA 4PJIE 4I1RA 5IC4A 5JPMB 3QH3A 4HIXL 4NGHH 4R4FL 3NA9L 2DM2A 4CU6A 4PJXF 4RSVA 1MWAB 4NNYA 1PSKH 5F9AC 1NEZA 1DQJA 3QIWD 2QHRL 2Y9RT 5LUBA 1W0WA 2FX9L 4G8GE 1T03L 2B8OT 4LP4A 1EHAA 1ACYL 4NFDA 2K9UA 1RVFH 4I0KA 2ATPB 4KU1A 4JHAL 5D2LE 2D4DA 1DBBL 4LP5A 1T7ZA 1NAML 2D03L 5I15H 5LKNA 3N1GC 1S78C 4DGVL 4HCRH 2C3WA 2BSTB 1T22A 3EO9H 3QIBD 1RWVA 4DAGL 1BFOB 1CLZH 3ZHLA 3NACL 3MNWB 2IFGA 3I50L 2PXYD 4RFOH 3S35L 2VLRE 4NYLA 5ALCH 2F5AH 2D0FA 3NH7H 5HGGS 4P2QB 1OAQL 2IPTH 3K80A 2UVFA 3I84A 4X5XA 4N0YH 5D72H 1ED3A 3DUHA 3VGAB 4JB9L 3PDOB 3EFFA 5GJTH 3VXRA 1QLEL 4OFVA 5FCSH 4HS6A 5DJCB 1GHFH 4KJYB 1MJUH 2P24B 4K3HA 3C6LA 3UJIH 3GJFA 3MXWH 4I5BA 3FKUS 3IDYC 1UB5A 5J6HA 4Y4HB 3D9AL 1AXTH 3OMZA 2VDLH 2VDOL 3QNYA 1Q72H 5D71H 1MCQA 4RDQG 3U0TB 2DM3A 5FO7B 5JLZB 4DZBA 3MV01 1T4KA 1MLCA 2GSGB 4GAJH 5DC4B 2D7NA 4WCYH 1LE5A 2LQRA 4AENB 4JFOA 5KG9A 3MBEB 4ZYKA 1C08B 2YZ1A 3HE7C 3M8OH 3VD9A 1QOKA 2BSRB 3V5DA 3F7VA 2G5RA 1F4WH 4JFDA 1JI2A 2E27L 4WENB 3BQUC 4R4BB 4LRNL 1J9CT 3WHE0 1OTUC 4JRWA 3QISA 4HWZB 4FQPA 3VH8A 1ZHNA 4X99B 1KCUH 4ZFZB 2NYYC 5BS0B 4RAUA 4OFKA 4NQEB 1F6AA 2OL3B 5GGSA 3ULUD 3WSQL 5I6XB 4YDJB 3QQ9D 4OQTL 1QLRA 1TPXC 3IU4H 3VXNA 2NY6D 2HTLC 3VRLE 3N9GH 1MCCA 1Q9OA 3WNKA 2G2RB 4PJDE 5C08E 1KB5A 4YK4B 1CU4H 1SEQL 4PRAB 4KHTL 4M7LT 1JV5A 4P5TA 5HHQA 5DD6A 1KJ2B 4G8GB 2HKFH 3MBEC 3VWJB 5CZKA 5SWQA 1VERA 1GGYA 2BJML 3EKCA 5EUKA 4OFYD 5I76A 1FNGB 3MRHB 2W59A 1JWSB 2B1HH 1CL7L 4P99A 4YLQT 1R0AL 3VXPA 1XF4A 2E9WA 4JM2D 2ADJA 5DJ2A 1KPVA 1SVCP 3MRDA 2BFVL 3K2UL 3S4SG 1H9VA 4NQSA 4LDOB 3BD3A 2Q3AA 4EBQH 4OCXH 3LN9A 1OSPH 2ADFL 5JNYB 2XQBL 2X4PA 4M1CD 4IRSA 4OJFH 3MOBL 3OB0K 1OQOA 4EXKA 5CUSL 2D0HA 25C8L 1JGEA 5I66A 3E2HC 5CEXA 4Q6IA 3T0EB 4MNHB 3C60C 1A7RH 2BY3A 3QR2A 3L5WA 4OAWB 5F7MC 3WXVL 5DO2C 3W11D 4PJEF 4ZPTA 5JTWA 5E5MB 2CO7B 1LEKB 4HGKC 4NZRH 4H88L 3MCKA 3QZWG 2D7PA 1RK1A 3OAYK 5SX4I 4J12A 5CZVL 2R23B 1FAKT 4JO4L 2AJVL 3CXDH 5C08A 2OJZL 3K8MA 4Y8AA 1H15A 5LGJA 3B5HA 4UMGA 4HWNA 3NN8A 3PWPA 4Z95H 1CFTA 5C0FB 3RGHA 2CIKA 1XIWC 3STZB 4CDGC 4N0CC 2IPUG 4P9HC 4LVHC 5IEHB 1FFOA 3VWJA 1KG0B 5DUPL 2GK0A 1EFQA 2O61B 3OV6A 3VGDA 3MRBA 1D5BB 4UV7L 3IXAA 4C59B 4X6CE 2XZAL 1C5DB 2YRZA 3IJSA 5E94B 5CAYB 3OKDA 4WEBL 5K9KA 2OTWB 35C8L 8FABA 1PQZB 1UWEH 3ARFA 3Q6GH 2DQIL 1I3OA 1SMOA 4XAWL 1C5DA 1WWCA 3EFFB 4UI2A 4G6AC 5DT1L 2N7AA 3TZVC 5GJSL 5EO9B 2MPAH 1T04B 4R7DB 2IBGA 3CFBB 1WBZA 3HZVB 4X4XA 4ZFGH 5D4QA 3JV0A 1UM5H 3BIKA 3SDYH 3FN3A 3DV4A 4XPTH 4X9HA 5LU8A 5KANG 3H3PH 2YRPA 2VDKH 3HUJB 3H13A 5E9DB 2V17H 4MXVE 4TTDC 3O0RH 3I3DA 2AEPL 2GAZA 2PW2B 5GISH 4K3JL 1I7UA 3MROB 2NY5C 1F3JB 4W81A 1M7IB 1SBBA 4Q6YA 4MJIB 4PJBB 3HZMB 4WNQB 3PV6B 2EDXA 4GAFB 1A3RL 3P45A 1NAMB 5J9PA 2WV3A 3HE7B 4HQ0A 2W9EH 4X5LA 3C2AL 2BOBA 1EDQA 2X1WL 4QOKA 3ZKSD 3VMOA 2YD3A 5L9DH 2YPKB 2DQTH 3P0GB 4JRXD 1DVFC 5C0JA 3QFJA 4JO3L 1OP3H 2XXMB 2LU7A 1CK0H 1HHJB 4LSVL 2GTZB 4N0UA 4QGTA 3QI9C 3IXAB 2YEZB 4XGZB 3QI9B 3WNNA 5DZOA 4B50A 5KVFL 4NBYB 4PJ7B 2R0LL 2EKSA 4PJGA 3RAJH 5BRZB 4RQQB 3GSOB 2NY3B 4XP4H 4GRLC 1U2HA 2O5YH 2CKBA 1OP5K 1VGKA 2FBJH 1AO7A 2X4RA 2PYED 3BZFB 1CLOL 3BGAA 4BSVA 3VXUB 1U8OB 1QFHA 4OIAA 4O9HL 4LSZA 3RWEB 4G8GA 5JW4N 4DKEH 4PJ9C 4G6KL 5BMFH 4YEFA 4Y16B 4F7CB 4H8WC 1KIRA 4I2XA 1GZQB 3RWEA 3BWAB 4B0MM 4FQHA 3WHE1 3VFPB 3KPQB 4OZGF 5E8PB 3GSXB 4LGPB 1NFDE 4APQA 4OLEA 2BX5A 3S3PA 3SGEI 4WU7B 4U1IA 3IRPX 3PNWB 4OLVH 3DX9B 5JW4R 4RWHA 4YXHL 2B4CH 4WEUD 5EU6E 5ERWB 1ZANL 1KN4L 5DZNA 4JJ7A 1IEAA 4NBZB 3R8BB 1NAKH 2VLJB 3TWCH 1WIPA 4P48A 4XBPB 2ZKHH 3QH3B 1BWWA 1V05A 4JAMA 2EDYA 3RUGB 4OUUB 3S37X 3BUYB 2A1WH 5GZNC 4EUPB 4X9FA 2V5TA 3QYCA 4JKMA 5AD0A 4PBWD 4PRYA 1UQSB 3QIBB 1BFTA 1LNUB 2O26U 3FQTB 1VHPA 2V2TA 3HFML 3HPJB 2ZOLB 1LO4H 5AWNH 4FZEL 3NIFE 4P2RA 5JW3L 4NUJB 2BMKB 2HVJB 3QXAB 3NABL 1VB9A 1RJLA 2KKQA 4KROB 4Y1AA 2V2TB 2I5YL 4M61B 2XZDA 2EC9U 4YDKH 4JVUA 5KSVA 4DOHE 4G6FD 4M4RA 3NTCL 4PJIF 1AO7E 4QTYA 2HT3D 1DN2A 1U8HA 2G75B 2R2CA 3BUYA 1QFWI 4G7YL 2WAHA 3VWJC 3ZKQD 4OD2A 3ARDB 4M7KH 1MHPL 3EO0A 3HCVB 1JGLH 4LU5L 3RZWA 4OGAC 4FNLH 2HTKC 4CDHA 4YFDB 4RISH 1E6OH 1MH5B 4KDTC 4KAQH 4NYLB 5LBSL 3CDYA 2VDQH 4PTUB 2KPNA 4DGYH 1U3YA 4Z7WF 4KPHH 4O4YH 5GRJL 5INDB 3KJ4C 2F53E 4UB0H 2IFFH 4HF5H 4X7DC 5T33H 5GSVA 1NBYA 3UDWA 3QHFL 4GRWH 1CE6A 2HJKA 4S0SD 1LEGB 3O6FA 3MV8B 2VQTA 4JFXB 1JN6B 4NFBA 3RX7A 1I1FB 1S9WA 4KFZC 5HSFA 5I1DB 4WWKD 5FKPA 5C70A 3DTXB 3L95A 1SY6A 4MVBC 5CWSA 4D3XA 1G6RA 3FT3B 3SCMB 1GCFA 1LNUA 1IBGL 5CEZE 3MACH 4J6RL 2J6EL 1ZLUH 3RPIA 4BQ8A 1IKNC 5D1QA 4OZHA 1H3VA 3HC0B 3WUWG 1UACH 2HRLA 2DMKA 3A67L 4WV1C 4YWGH 3TFKD 2P8PA 4X7TA 4QUGA 3NFPA 1C5CL 5IB4A 1JGVL 4JFDD 3KPRD 3S8WA 2C4FU 3MA7A 4HLZH 3QXDB 3TA3D 3BD4A 3ZDYF 1WT5A 4X6EA 1YPZB 3GMOA 2NY7H 2MCPL 1YNKL 3G04A 3IT8D 1N2RA 1HH6B 2QADB 2JCCF 1YJDH 4D0CA 2EEAA 4K94L 3FT3A 4Z7NF 4ZAKD 1P69B 2DWEB 2ITDA 1U91B 3G08A 1YEIH 1CICC 5GS0H 4X0KB 2C3GA 3MXVH 4DTGL 4D0DA 5IT2L 3B5TA 4PRZA 1Q9KB 5CEYB 2YPVH 5HYJA 4OD3H 1UENA 2HN7A 4EUPA 3IVKA 3V4PL 1NBYB 3HZKB 3GI9L 3GIZH 1JK8A 3ARDD 4M43L 3PXJA 3OGCB 3U2SB 1JHLH 1QR1B 1IC7L 4GXVL 2LTQB 4NJ9L 4JG0L 3UTSA 2Z9TA 3HC4L 2FR4B 1L0YA 2UYLA 3DROB 3P0YL 3L6FA 5E4EC 1ZTXL 4MB3A 3A6BH 4B7IA 1LILA 5AZ2L 1BJMA 1R3LA 5E4EB 4NPYB 1HSAB 4ZSOB 3S5LG 1RZIB 3PNWA 4N7MA 1ZHBB 3ZYJA 5IMKA 3HMXA 2HKHH 4PJ5D 5CP3A 4NKQB 5MERB 5C0DB 2F19L 4OIIL 3DARA 2DWDA 4XP1L 3VFGL 2FATL 1MRDL 3QXTA 4HKJB 1Q8MA 5SV4A 1NDMB 1H0DA 3QUXD 1MEXL 4HFWA 4YDVB 4G3YH 5TDOA 4HMDA 3WN5A 1ZA3B 3I02B 1IGCH 1NGWA 2X4SA 5KVMC 1MWAH 4G8FB 1TJHL 4LSTH 1MAML 1UQSA 5I1HL 4Q9RH 3RX5A 3GSWB 1BD2E 5CCKH 2R4RL 4WDIA 1CDJA 1XH3A 5FA4A 3JXAA 1U8JA 1EMTH 4FZ8H 4QHKJ 4N6NA 1OF2A 2WZPD 2ORBL 4LSRL 5DD0H 3RWIA 4PRNA 4OZFH 4PJ8B 1DBJH 4G8IA 2HTKD 3PWPD 2VQUA 4JZNB 5IVXA 2Q76A 3CVHH 3ARQA 4U7MA 3VWJD 43C9A 2X4PB 1PKQA 4BKLA 1AQDB 4U1KB 1V8HA 1WEJL 4NZTL 3VU2A 2YOCA 1BMGA 5DEFA 2EZ0D 1JF6A 5I66B 3UBXG 3VMNA 1CS6A 3O6KH 5F88B 1T2JA 1YMMD 2ICWA 2NYYD 4RCAA 4WW2F 15C8L 4I9WE 1QKZH 1A5FH 5JDSB 5D9SB 1R5IB 3LMJL 4P9HL 1XZ0B 5DQJB 4I3GA 5DYOA 3NIDF 4WI5A 2LVEA 1V3KA 2HAZA 3CDGB 5CD5C 1CTOA 1KJ2A 5GRVK 4O51B 3UYRL 1MVFA 3IDMB 3FFDB 3GIVB 1FZMA 2ZCKL 4E41A 1CGVA 3CDGA 5HHMD 3R7NA 4NHUB 4NQDA 3IDGB 1FG2B 2H2SC 1I3GL 4JR1A 1EZVY 2D4FA 5IV2A 3JWOC 3MXWL 2VERN 1U3HD 3ARPA 1U8IB 1NUNB 3JV6B 1CGWA 4TVSa 4L4VD 2V2XA 4FFZL 2VE6A 4FOMA 4RGMB 4XWOD 3ZT7A 1HKLH 4G8IB 3I2CH 5BZDB 4HUNB 2DQFA 4RIRB 4KTDL 3OXSA 2W60A 2YD2A 2LAGB 3O3EA 4PR5A 4UILH 4URTB 2V5MA 1OAZL 4PJIA 3AREA 4RAVA 2WMPA 4UAOC 1EO8H 2FYYB 3NN8B 1S7XA 5EA0L 3SE3A 3U79A 5C0CD 4ENED 2X4NB 1C1EH 3BH8B 3U1SL 2SEBB 5EBGA 2EKJA 4Y8DC 4J4PA 1ZAGA 4LLDB 4P4KA 5BO1H 5ADPH 1TVHB 4OV5B 1AGFA 1MFCL 4H25B 4GAYB 1DP0A 2PO6D 1T0MB 3ARBD 3IKKA 2EDTA 1CZ8L 5IB2B 1DUZA 5IAEA 3PGFH 4QXUH 2HMIC 5IEKB 3PP3H 4F33B 1E28A 5IAGA 4ZTPH 5JUEH 4DVBA 3QRFM 4HMCA 4CMMA 4J2XA 4J3WA 1QO3B 4G8GD 3AS0A 4HK0A 1ZV5A 3VRIA 5C7XH 1B0GA 3V6OE 1L7IH 1QSEA 1KENH 2VLJD 4EI5A 4X4YB 2P47B 43CAB 4HK0B 5MP6H 2WIIA 5J1AB 5HI5C 4WO4A 1IGIH 3BJ91 1Q9LA 2AK4A 5KVGL 5MENE 1FO0A 3RJQB 5BXFB 1RZ8B 4U4BA 5CD3A 1P9MA 1EAJA 1G7QB 3SO3B 4RMTA 3RGVD 3QQ4B 4ODXB 1ZWIA 2ZNXA 5ANMA 1RAMA 1I9IH 3BXNA 3WL9A 3SIPA 3FCTB 2GT9B 4RMVA 1M6OA 3BP4A 1MNUL 4YE4H 3B9EA 4OF8A 3EHBC 5FYLD 4AIOA 3CPLA 3LDBC 3V95A 1RWXA 4HD9A 5FV1L 4QO1A 2NY1D 1XZ0A 5DYOB 5DQJA 3TEUA 1BOYA 5HVGB 1VEPA 5A40E 3UTTA 1A1OB 1OAKH 4L8BA 3TVMA 1NC4D 3FRPA 3FZUD 5LQBH 2B4CC 4K23H 4OCYH 1OHQA 1R3IH 2V2WA 4LEXL 5DK2B 5D1ZD 3V4OA 3OSKA 3D48R 1S9VB 4FQQB 4YJZL 1NMEA 1B6UA 2OL3L 5IVXB 3SGKA 4Y1AD 3O6ML 4BM7A 5IK3B 3QO1B 1B4RA 2APXA 4UBDD 4LMQI 2I60H 4WHCA 2WK2A 5TJWK 4J7RA 2VAAA 5DJ6A 4JRXE 4K3DH 1WCBA 1DSFH 4M1GL 3R06A 1D6EB 4D9QD 2ED8A 4M48L 4K9EC 4K8RL 1P84J 2BNRE 1V7MH 5C07A 3HNTH 3RTQB 1I1AA 4W6XB 2IAND 1T3FB 5HYSG 2VISA 1HH9A 2EEBA 1F6FB 3QHZH 5DHYA 2XZAH 5EZOH 2OZ4L 3D39B 1GRWA 5TDNB 2AAVA 2Z31B 3QDMB 2ICES 1NGYA 3QDMD 3QNYB 1FSKC 1NPUA 1UWEL 3DVNB 4HUUB 3ARBC 3UZVB 4TVPE 2AXFA 1F5WA 2HJKB 3OR7A 1T7WA 5TDPA 4LARL 5C0DA 2DIJA 3BW9B 4EHHA 3KXFA 3O41A 3QCUL 1UZ6E 3RFZC 3UPRA 5EOCL 4Y5XB 4HXAH 4DGVH 1AGCA 1CD9B 4KMTL 4M62H 3LKNA 3VH8B 1X5XA 3HNSH 1TNNA 4TVPL 2O93L 2D0GA 4ZUSA 1PG7X 2E7CA 2DQCH 3FAXA 4KROD 5LJYH 3PDGA 4OM0L 5GGUA 1AP2A 1NGZA 4L4TB 5IVXF 4KUZH 1RWPA 1UYWH 3KPRA 3ZE2E 4CN6A 3MUZ1 3P11H 3GJFK 5F6IB 4YDLC 5DTFB 1OARH 4ERSL 4X6FA 2J3SA 2NY2D 2PN5A 4HXBL 5B8CA 4KKLD 4XPHH 5DA0B 5TDOB 5IB2A 1FORH 1CK0L 4KDVA 1R5VA 3LS5H 2J4WH 4LSVH 7CGTA 4X4MA 1IFHH 1RU9H 2AGJL 2EYSB 4QRSA 2ARJA 1INQB 3F7RA 3KVQA 2CDFB 4IDJH 4KJYA 3SPVA 2DKMA 3U4BH 3GUTB 1IC1A 4U6XA 4AQ1B 1OY3B 2GCYB 3F7QA 3OKEB 1AP2B 5JIPA 1A21A 3T77A 3U82B 3REWA 5I1IL 4JFED 1CGUA 4K94C 3CK0L 3VRJA 4XNXL 2WW8A 3QUYC 5E5UB 3VDAA 1Q0XL 1R3LB 2Y5EA 3VH8G 3N0PB 1I8MB 4MJ5B 5JORB 3HMXL 3UTSD 1HKFA 3BW9A 4P23C 3O81A 3OKEA 2ZJSH 2DTMH 4K71C 3VE0B 5C6TH 1DBBH 4ZUWB 4NFCA 2BOCB 3QIWC 1JGEB 1AFVH 3ZMRA 1X5FA 3O3BB 3ZE1E 3VGHA 3M17A 3Q6FA 1J18A 3W9EA 5IM7B 3DTXA 3L95B 1CLZL 3P77B 2VDRH 4I48A 4D8PB 3O3AB 3U6RA 4GJTB 5HHOB 1C16A 4YPGA 3FQTA 3P0VL 1HYRC 5INCA 3LKQB 1I9RL 4EN3A 4X4ZA 4Y4HD 5E2JA 5M95B 4OQTH 4D0DB 3O2DA 2DKSA 3K0WA 5I17A 3CZJA 3ECBA 4MQ7B 4OLVL 1B4JL 3HG1E 1IARB 1IM9B 3GSQA 1KTKE 5C0BB 3TT3L 4KGJA 1OGAE 1J87A 5JW4M 3GMRB 4JFEB 3QIUC 2Y06L 1KOAA 2GFBB 1L7TH 2NPLX 2GJZA 2VAJA 3P4NA 5FAAA 4GLRH 3GBML 3BJLA 1WUNT 3QEQE 3IKCB 5KAQG 1P4IH 5FM5O 2VDLL 1CDYA 1UJTA 2OTUA 2K7ZA 2FEDC 4RFEA 3DVIA 3KXFB 3QB7C 2WLZA 3D0VA 3QO1A 5D1XA 3T2NH 3EYSL 1ZGLA 1MREH 5FYKD 2W92A 4I4WA 4KRPB 5EOTB 2BFVH 1OW0A 1U3ZA 1JWMB 1LGVA 2NTFA 3ROLB 2D7TH 1UCBH 4JPWH 3UEZA 5KW9L 4KDTA 4E9LA 2BRRL 5ELIA 3HA0A 1HE7A 4QHUA 3TC9A 2EDBA 5I75C 5IEKA 1JJUA 4PRIA 1CGXA 1A4KA 1IILE 2NXYC 1T89C 3O6FB 4NQCE 4PJHA 5I71C 1FYTB 5AEAA 1A14L 3PIQA 1A2YA 4G7YH 5C9KA 3T0BA 4JKKA 2WM0A 3FB5A 5HHMB 4ELMA 1JPSH 1P2CB 2X4NA 2UZYB 1KCVH 4NO3A 2WWMD 2B1AH 4UT7H 1FL3B 4JFEE 1HHKA 2OTPA 4KJWC 5CKAA 4N9OB 5HYJE 1JWUB 5EO1B 2F5BL 3ZDZE 2OP4L 5GZOD 5CBEB 4WWKC 4NNXB 1ZXQA 3FN0L 4QHUB 4PJ9D 4FQXC 3HLAB 2C3VB 1Z6JT 2ICWJ 2X9YA 1D6VH 1S3KH 3B8YA 3EZJB 5GIRB 3ILPB 5AUMA 4ELKB 2EDDA 3QSKB 3TIEB 1R6VA 43C9B 5HPMB 3BGFB 4Y4HC 1EX0A 1J11A 1RJLB 2GITA 4XCYA 3V3KA 4U1NA 3GSNL 3HNVL 5E9DE 2B1HL 3ARXA 4JDTL 5D5ME 5I1JH 2PO6B 4OLUL 5EO1A 1YEHL 5IFAL 3C5ZA 1O7VA 3TA3B 5IHBA 4ODWB 3EYFA 3HI1A 4U6VL 4E41E 1PEZA 4RWYH 5DUMH 5F6IC 3TPKA 1EA9C 4WJ5A 2CDGB 1HQRB 4N6OA 4HIEB 5DMGC 4EDWH 4O00A 2A0LC 4DFHA 4QU0A 5J3HC 5J56B 4KKLC 2X89A 2C1OA 1MFNA 3MLZH 3P4OA 1O0VA 4J4PD 4X6DE 3V4LA 4P4KD 1IMHC 2X1PA 1QDUA 4GKZB 3GJFH 5DVMA 3QT2A 3V6LA 4YAQA 1LEKA 3HTLX 4MQTB 1NC2B 3O4LA 5EZIH 3RVVD 3RWJB 3PG2A 3LKRA 5H2BB 1E6JH 3M1BB 3STLA 1F02I 3N50A 4OKDA 4DK3A 3T8XB 4YR6A 5A3ID 5C8JB 4M93B 3RGVB 4PJCA 2IWGA 3PWPE 1CQKA 2QQLL 1CXKA 2BHUA 3MLTB 3IKCA 5A2FA 2BVYA 3STZA 2A77H 1ADQL 3FB7A 4QRUB 3O11A 5L0QB 3TM6A 1AY1H 4LLAA 3HC4H 3CVHB 5K59F 1N5YH 1R3HA 2NY1B 4WO4D 3MRLB 1I8IA 5IFHL 3IXTB 1HI6B 1ZTXH 4JREC 1BBDH 1S5IL 1XFPA 3VFNA 2PXYB 4CUCA 3BP4B 3CVIH 3HKFA 3L3HB 4LLDA 4P4KB 4M6NL 1KGCD 3T04D 1JPFA 1KN2L 3CVHA 1FYTE 5T1LB 2CUMA 5F9JB 3DO7A 1HYSC 4XVJL 1UXWB 3T0WA 5FYKH 3TO4D 1ZSDB 1CLOH 5CS7A 1A6ZB 2Q7YB 3GMPB 1MFEH 3OXSB 4POZC 4IBLT 5J12B 1HINH 3KYMA 4GKSB 3I6GB 4Y4KC 4HG4K 1NGZB 3QJFB 4KQ3H 1QTYT 5CBAA 5EIIA 1WFUA 3CFIC 4N5UA 1TJHH 4LSTL 3VFOB 4QNPE 4S1SH 4HWEH 1NUGA 5GISL 1RIHL 3QCVL 3WN5C 3PWJA 1PZUB 1P6FA 2B2XH 3W11C 5E2UH 1ICEA 3MLSH 3OKNA 3PV6A 5KOMC 4CKVX 3CMOH 1NLDH 1Z0NA 1XCTB 5TE4L 3UO1L 5I1EH 2C3HA 1K8DB 1N4XL 1HILA 2W9EL 3CFJB 1YMMB 4JREB 1W72B 5I9BA 3LQZA 4XP6H 5HGHA 5BRZD 1F9EA 1NC4B 2DLGA 1FNAA 2UWEA 2BVTA 4G5ZH 3V2AR 4YO0B 4Z7WA 3LEVH 3TN0A 2VKWA 3DWTA 4HH9B 5DJDB 5L9DL 1GYAA 1QVOB 1BFOA 2C1PA 2FP3A 3R7BA 4EHAA 3RHWF 2FH6A 3L5XH 4HGMA 5B38A 1TQCB 4Z9KB 2J31A 1NGYB 4IJ3C 2H9GB 2EIEA 1AI1L 2EIBA 2IANA 3GDBA 1I1FA 1MCRA 1S9WB 3HI6H 3QUKA 4IIQC 1GQFA 1RD6A 2VLKA 3FT2A 2ED9A 2EDKA 2ZUQB 4TUJB 3IDJA 1DANT 2DBJA 5CZXC 4FDLA 2HBZA 4J3TA 4HUWA 2R2EA 3ZTNH 2DQDH 2Y0BA 3M17B 5FEBA 1BFVL 4EI6B 1LO2H 4JFYB 1I75A 4ODSH 2C3VA 5JW3H 5HYSA 4NM4L 4MAUL 3LN4A 3O9WD 1JMZA 1FYHB 2ZOKB 4S11A 2O5XL 3X3FL 4G6KH 5BMFL 3BGFC 5DD5L 4Y5XA 3O2VH 1C5BL 3SGDH 3NTCH 4V1DB 6FABH 3QDGD 4JG1L 5D6DC 4JFFD 4RMUA 2WQRA 1OTSC 3U30C 1G0XA 1GC1H 4O2EA 1FFNB 3L5JA 4YZFF 4XCNA 3NIGE 4P2OD 1U0QA 1KCSH 2WQ8A 4MDIA 1FZJA 4BZ2H 3AUVA 4F8QA 4RMQA 2E3VA 2X5PA 3QBTB 4YHOH 5F9WB 1QP1A 4KRNA 5B8CB 4MCYB 1UXSB 4M6AA 2X1OA 3X13A 1D5MB 3HAEA 4XMLL 3RWFB 4KVNH 3VFTA 4XP9H 3NMEA 1NJ9A 1EO8L 1KT2B 2DBLL 2J7LA 4Z0XB 2XYCA 1SHLA 3T0VA 1WLHA 5JW4Q 5J13C 4KWUA 1CGSH 4X7TB 2ICEB 4RMSA 5B22A 4GMSL 1AJ7H 1Y6MR 4M8VA 1Q9LB 3GRWA 3HHRB 1MFCH 1PG7W 1H8SA 1OM3L 2XICA 1FO0L 3D39E 5LGHH 2MQCA 4KRLB 5BRZE 4Z76B 2VZ3A 1FZKB 4MQSB 3TBSA 4EI6A 2NXZC 3G5ZB 2P8MA 1OQXA 2AEQH 4JANA 3EZ8A 4PY7A 2E7LC 1EXUA 4DKFL 2DQHL 3X14A 3OB0H 4DN4H 4LLUB 1XGTA 4WFHD 3X13B 3RRQA 3T2PA 1RURH 3VGAC 3DXAD 3P2TA 3RWFA 3VFTB 2CNLA 1KC5L 5FUOH 1QFWM 4R2GC 1N6UA 3SE8H 5GGRB 5IFJB 4O2FA 4F57H 1FIGL 1MRCL 1WISA 3KS0H 4ZXBD 5IW6A 1F2XK 1VFAA 3JWDC 1KENL 1FJ1A 1GGIL 4RMWA 1VPOH 3L7EB 5FYLH 2Z91A 2CPCA 5C2UB 1JF1B 4K94H 1G1YA 3C6LB 4JO2H 2UWEE 4JRYD 3TNNB 1EJ6A 1NFDB 3KYNB 4I0PB 4EN3D 1E4KC 1VGKB 4N8PA 4E0RA 1HNFA 4KPHL 3SDDD 4G42B 3AU1B 2CLRA 4GAGH 1EXUB 3WLWC 4GG8B 4WUKH 1ZLSH 4HF5L 3TT1L 4QLRA 4WI4A 2IAMD 3GIZL 1E4XI 3QHFH 1DLHA 4I8DA 4P3CL 2VLJE 1JNHA 1U8QA 3OJDA 4P3DB 5HI5D 3VFOA 1V3MA 4GXVH 3VXSD 3O3DA 5EOQH 2NY0D 3PCXA 2BNQE 3DLQR 3KPLB 4H5SA 2Y72A 4N8VB 3A6BL 3OJVC 5MHSE 4WU7A 5AZ2H 2EH7H 2AJZB 2FJHA 2E6JA 4U6TA 1CFVL 1IGTB 5EFIB 2GW5A 4PLJD 2X10A 2CXGA 4JCLA 3JWDH 2DLFH 3ULUC 2OZ4A 4PTTA 3NPZB 3C6LD 1VACB 2YUWA 5DHXB 2DM4A 5GS2D 2YK1H 1DR9A 1H3PH 3TBTB 3KAAA 2XNAB 4CADA 4F7EA 1BMQA 1DN0B 3RL2B 1YEEH 1J8KA 1FPTL 1HDMB 4XNZC 4OT1H 3E6FA 2OJEB 1KBGL 5ETUB 4JJ8A 3DVFA 3BPOC 2A9NL 3D0LB 4D9RD 4CN4A 3AGVA 1EK3A 3VWKC 4DGIH 3W82A 1HHIA 3RY6C 4UT9L 4S1QL 3P30L 4MLSA 5KTEL 1FLTX 4H1LA 4OD3L 5C0BD 3JV6A 2NX5A 4WI7A 3RPIB 1D9KB 2EXYD 1QA9B 3LEYH 2VR9A 1FLRH 4LCCB 4MSWB 3ZKXC 3L9RB 2Y23A 3OF6D 4NC0B 1RE1A 2EICA 3QCTH 3UYOD 4C54A 3TBWA 4ORZC 5SWSD 3GHBL 5SWSB 1HQ4A 3BDYL 4GW4B 3RVWC 5BW7A 2EXWD 1FFNA 1C12B 1KLGB 1KJ3H 1RY7B 4XCEA 3C8KA 2FJHB 4HXAL 2XQYG 2R1WB 4QCIB 2NQCA 3OPZL 4ODXA 5DJAA 5J1SC 3CLFL 4P5TD 4JKPL 5ABDE 1LDPL 1RMFL 2HWZH 1D6EA 1F4XL 3LMJH 3DX6B 3IDYB 3O8XC 1A7NH 4LSDA 5J89A 2X4TA 2FD6H 5JO5A 3VFWB 1HHJA 4J3VA 5DSCA 2L7JA 3HZVA 4X4XB 1AD9B 5E8OB 4C83B 2NW3B 4UU9B 3FHQA 3VRIB 4G80A 3DEHA 3ULSA 1MCEA 4Y5VA 2W9DH 2XG4A 5JPNB 1ZVSA 3DYOA 5I1KH 1S7UB 4IRSD 1Z2KA 4UUJB 4IRSB 1RZKC 3FO0H 4ZTOL 4NOKA 4RZCB 4MJIA 4XB7A 1D5BA 1CFNB 4WEMB 1NMSA 4LASL 5FYKE 4WWKB 4YQXH 1FN4A 4NWTL 2YXMA 4ONGL 1AGFB 3LV3B 3VD3A 3BEWB 3CSGA 1FNSL 4WHTB 3QUZB 3TCLA 4XPFH 1A6TA 1DUZB 3F62A 5F6HI 4PYHA 3BRGC 4L9LA 3MV9A 3RU8H 4CVZA 3X17A 2G5BB 1BD2A 3MNZB 5EA0H 1HI6A 4LCIL 1WEJH 4Z7UB 2H45A 1WBXB 3MUJA 2FLBT 5E2WH 4MA7H 3WYRA 1QZ1A 5I71B 3H42L 1FHGA 3OXRA 3EDKA 5KZCB 4UNVA 5ERWA 1NGPH 2H54A 3KPTA 5TFSH 4U1MA 3FFCD 1SJXA 1DE4A 5I0DA 1MCPL 2DL9A 3KYMB 2NMSA 3BO8B 1QLRB 2EYTA 4KY1L 3P9MB 5GGVH 3TO4A 3VFUA 1CDBA 3TH4T 3IDJB 1K4CA 2YBRA 4LVHB 2QLJA 1IM3B 1S7SA 3VFSA 2YD5A 1FP5A 3U7AA 3W39B 3L3IB 3U9UA 3TT3H 1P7KB 1G7JA 3V6ZA 5FM5M 2AI0H 3OX8A 1J1PL 4LVEA 5F1IA 3RVUC 3L3OA 1INEL 5DQDH 1WBXA 2JJVA 3GMMB 1H5BC 2R8SH 1YMHA 1DQMH 1OGAA 3GM0A 4ELMB 4KRPD 1UWGH 5B39G 1ZMYA 3WFHA 5E2VL 2XN9A 4DVRL 3WFCH 4WJ5B 3KR3L 4QXGL 2X40A 3NA9H 3BKJL 3HR5A 5BRZA 1RUAL 2EE3A 1IVLA 5CEYA 4YPJA 3T2NL 5C3TA 2XWJA 5ESQB 3KLHD 2YBRB 1NBQA 4PR5B 3LRSA 2YN3A 1NGWB 3KNBB 4FQCL 2P5EA 4NO5B 5E7BA 3QDAA 5IM7A 2BCKB 2BRRH 5E4IA 4ZNCD 4KK5C 5D7KE 2L4OA 3AVEA 4HUVB 1KB5H 1HSBB 4J8RA 2N7BA 2RIKA 4F7TA 3TIEA 1GIGL 3MLYL 2D03H 1F2QA 1A14H 1IAOB 1BP3B 3HPLB 5IW3A 4R0LA 1IKFH 1QPXA 1RUQL 3GI8L 1J86A 1RZIA 3UTTB 4PJFB 3T09A 2R56H 4F33A 2ZPKL 4IHOB 4OV6F 2E6QA 2GFBA 3I50H 1VFBB 5JUEL 4TRPL 3QNXB 4U7SA 1CFQA 2UZXB 2F5BH 3B2UC 3DX7A 5B3JE 3KLAA 1K5NB 3BKYL 2PKDA 3PF2A 4NRYA 3LQZB 5HGHB 2VLRB 3GSUB 1I8IB 3HMWH 4C4KO 1N59B 2VC2L 3LKSB 1CFNA 4U0RC 5DJXA 5ENWA 4LKXA 1ZA3A 1T2QL 3I02A 4HUUA 5C6WH 2FIKA 2XIDA 3ILQC 1DL7L 1AO7D 1R3JA 5DTFA 3MBXH 1DDHB 1RULL 2AJSH 3QHTC 2AK4B 3ROLA 3U6RB 2YR3A 2WBJA 5HD8D 1JRHL 3X12A 3D18B 4BQ9A 2VDNH 4PS4H 1IJ9A 1MCKA 3VXRB 2LABA 3LZFL 3V4UL 3MRMA 4XNUL 3DO3A 4P2QD 3V79C 2VDOH 5D71L 4OI8A 1KFAH 1VESA 1P4LB 3AAZA 2HBYA 4EXPX 3L6FB 1LMKA 3PL6B 1KJ2H 4ZUTB 2VABB 4EDWL 4MJ5A 2R0ZL 1ZS8A 4NQVB 2CNOA 1IQWL 1YEKH 1SC4A 1F4WL 5DJYA 4LQFL 1WF5A 4F7EB 5FCUH 5H0IA 4EEEA 5L88L 3CX5K 3DBXB 4EHLA 1CF8L 1LO3H 2J30A 1I4EB 3V6FB 3S4SA 3LAFA 4L3AA 1YJDC 2F74B 4UOW0 5TGBB 4TVPH 1WFOA 1CT8A 4JJ5B 2JK5B 2QSVA 1MFDH 4HFWB 1ND0B 2O5ZL 4YDVA 1R5IA 3QI9D 2OL3H 4L4VB 3D1MC 5D7KD 3OJ2C 1Q1JH 2Q6WB 3MRQB 1CD1B 1J0ZA 3NOIA 3J8F7 2XKNA 1CICB 2M8XA 3DRQB 3EOAA 3GMNA 1UB5B 4M48H 4P2RD 5D7LB 3WLBA 1QFWH 1PZ5B 4KHXH 2Q1EA 1WWWX 5IABA 4U33A 4P23B 3QZWA 5CILH 2XY2A 4Y4KD 2DF3A 4YC2C 3DV6A 5EB9A 4NZUH 2E7BA 4FP8H 2BJMH 4PRNB 4MJ2A 4LCYB 3SHSA 5GRZA 2JJTA 4HUXA 4M6ML 3LKPA 3HE6C 4X5XB 4QTHA 3SDDA 3QZWB 3THML 1CL7H 2CXKA 4LHUB 5ID1B 5EU6A 1BWMA 3VXPB 4WV1B 2EYSA 2XTJD 2EDOA 2W0FB 4QT5B 4HBCH 4HK3J 4BFGA 4BH7A 5DI8B 3GUTA 1J12A 1Q0XH 3CFEB 5KVEL 2GJ6E 4PRHD 1V3JA 1TQBB 1B2WH 3T3MF 1HINL 2RB8A 1MI5D 1CBVL 1A4KB 25C8H 2QQQA 4ZVRA 2YA0A 1CDUA 4JFHD 4PGEA 4U1SB 2MTPA 2ESVE 1XR9A 1W0YT 4D0CB 3VJ6B 2IEPA 1U8KB 1HHHB 5JMOC 5K9QG 3RUGE 3P0VH 1A9BA 4L8DB 3Q6FB 5ANME 2OX5A 5FDYA 4PG2C 4XTRD 4U1GB 3QUZC 4DUWA 2BP3A 1PDKA 3WNOA 1U42A 5C0IA 4XNQA 1T2XA 2BVQB 3CFKB 3HC0A 1DQLH 3QXVA 2P2CA 2Y06H 1JCKA 4HXBH 3P73B 3NIGF 2BNRB 3L5XL 4WI8A 1W8OA 2W38A 2LAAA 1R5VB 2CMRL 3ZE0F 5K9JL 2W07A 3SQBA 3SEPA 4HW6A 1WC7B 1NANI 5HY9B 2CDFA 2VITB 3GMPA 3BWUC 4QHMA 4WTZA 3F58L 3RKPA 4ESKA 3U4BL 1ITCA 3VXOB 5HPOA 1X44A 2XZQH 3MLWH 1RZ7H 4H26A 3Q6GL 5DMKA 4BH7B 5HHOD 2AQ3A 1MELA 5FECB 4NM4H 1UCBL 2YZ8A 1RZFL 4I1NB 5DEZA 2COQA 2DB8A 5E1AA 4NRZB 3CDFA 4F2MA 2ZJSL 4KRMB 4MS8D 5E6YA 1N0XL 1U8QB 3OJDB 1JHTA 2P44B 4GXUM 1F4HA 1XCTA 4OGYH 3BIKB 3ARDA 3H3PL 4XNMA 1P7KA 3HCVA 2ICWB 5JO5B 4U1JB 1JPSL 1BFSA 5HI3D 2N1KA 3MV8E 2P7TA 4HJJH 4R8WL 1OAYH 1I9RH 3BIJA 3QQ9C 3WMSA 4YHLH 3S35H 4XZUA 4JKLA 1S7TB 2DIBA 2ED7A 2OR9H 4XBEH 1DE4B 1QSEB 4Y2DB 1OAQH 2IPTL 4X5WA 5HVHC 2P46B 3N1FC 2MNUA 2DQEL 3TBTA 5FB8B 1RZJH 3MRKA 4N0RA 4PJ5A 1CG9B 4U1HB 1BJ8A 4DKAA 3IFOB 5TF1L 4ZQKB 4JFXA 4NQDB 4O2FB 4Q74A 4U6HA 3RWHB 1JNJA 1IKNA 3WLWD 1G0YR 1GGUA 3TBYB 1CGSL 2AV7B 2WP3T 3MFFA 3QUXA 4ZFOL 4IRZH 4OZGB 4AYFA 1VKXB 4IOFD 4HIXH 4MJID 3ARYA 3ESVF 1BAFL 5JOFA 3SKOB 3CC5B 5F7WC 2CSPA 4H8WL 3WIFA 4BUHA 1S7QB 4PJ7E 4V1DA 1IGFH 4OBRA 1A1NB 2FX9H 4HS8L 3NFPB 3ALPA 4GLRI 4Y5VC 4PJGB 1BD2D 2AEIT 3UBXA 4YBQD 2J8HA 4O9HH 4W70A 3CMGA 4L5FL 5IB3A 3LN5A 3BO8A 1WAAE 3OGOE 5IVOA 4NKMB 2P8LB 4AQOA 4DUXA 1MFBL 1I1RA 3HE6B 2NXZD 1WGOA 3AB0B 4JY5L 3FFCA 4U6YB 4OZIB 2X7LB 3VXSB 1B3JA 5FYLL 3NACH 5JW5A 1NMBH 5L2JB 3EOBA 3MRPB 1MLBA 4XI5C 5HGBB 3IU4L 4GAGL 3HG1B 1ZT1B 2FJFA 4OFDA 5EZJB 1YMMA 5D72L 3QA3A 3PHOA 4APQD 1T1YB 3CFDA 5IMLA 3TCLB 4HGWB 3TN0B 2APWA 4FTVD 2Z8SA 1DQDL 1KJMB 4K9EL 4S1RL 3X3GL 4MB5A 4OSUH 1SEQH 5CJBA 2YSSA 4YBLC 4DW2H 3ZLQC 3BOVA 3H9ZA 3D6HA 2A1WL 4EI5C 3DGGA 1RIVL 2XN9D 1AXTL 3WS6A 3BT2L 5J6HB 3FO2A 4BUGA 4HG4J 2QL7A 4M6NH 3AM8C 1Q72L 5GHWH 3W0WE 4Z0BH 1NGQH 1NSNH 4DFIA 1NCCH 5MERA 4GQ9H 4H1LB 3WXWL 1ONQA 1QQDA 4JFZL 4NQTA 3IB4A 5ESAA 3TIDB 4UU9A 3C87A 4YBHA 5DUML 2EYTB 4D9RE 3L7EA 3C6SB 1A7OL 3NABH 4RGNC 1CI5A 3KYKL 4UDUB 3RNKA 4IS6B 2EDLA 3O9WC 4JO1H 3MCLH 3PQYD 4L4VA 5DF0A 4Q9QH 5K20A 2APVA 3MMEB 3CDCA 4PJXB 1MCOH 3O6LL 5TPWL 2AW2A 2C2OA 3MNZA 2UWEB 3CSYB 4PJFF 2H6PA 3D69A 1MUJB 3GMMA 2EDEA 3SDDC 3BZFA 2W1NA 4WHTA 2DLEA 3TP4A 3IFLH 1H8NA 5DUBB 1E6OL 5HYJB 1R3KA 4BYHA 5CKGA 5KTEH 3LKQA 1SBSL 5JXAL 4ZPVB 3UJJH 4HQQH 2FJGB 5KSBF 2PO6A 4HEME 1K4CB 1SMAA 1R5WA 3VWKA 4BFIA 4EHKA 4UDUA 2HT4C 1T1ZB 1P7HL 3L3IA 5F7HA 2Z31C 4QRRE 1LDSA 3RL1B 1NJ9B 2H1PH 4G80B 3PWNB 5JR1L 2HKFL 1AD0A 4M4PA 3EOAB 4AWBA 1ZHBA 4AJ0A 2AVGA 2NR6D 4JB8A 2PNDA 2IPKA 1R0AH 2X09A 1IBGH 1BVLB 3MGTB 3O6FD 5D5MB 5E5RB 1C7TA 5IKCA 4Z7OE 35C8H 5IW1B 5DK0B 1SM3L 5KSBA 2VTFA 1QBLL 5FYKL 3QP3A 4YHZL 1BJ1H 2D31B 3D2UB 3QDJA 2AK4D 1OP5H 4HEPG 1N6VA 1XT5A 5IBUG 2D7OA 1K6QL 2XQBH 3KG5A 4MD4A 1QSFA 3BGMB 2ZSWB 2L0DA 3HI5H 2ENYA 1ZWIB 3U4EB 1X3DA 3BYTA 3I9GH 1EBPA 5I18L 3U0WH 3N85H 1A7RL 1J8HD 4X98A 4Q6IB 4PV9A 5AG9A 5I1KL 2VZOA 2AEPH 5F8RC 1LD9A 1T80A 2DWEA 2ITDB 3BN3B 3FO0L 3G08B 4ZTOH 3DETD 5C07E 5TE6H 1I1CA 2NTSP 1ZLVH 3TVMD 3MJ8B 2GTWA 1N5AA 4NQSB 2OQJB 3GB7B 1M71A 5JPMA 3UTQB 4N5DA 3FONA 3ZYZA 5HYQB 1KEML 2P5WA 3I3BA 1TLKA 3CH8A 4KVNL 4DQOH 5DJAB 3KJNA 5DUPH 3VCLA 2DQUH 4LKXB 5A1AA 2XYHA 2E6PA 5HYJD 4LCIH 1JK8B 4GMTH 5D1QB 4B5EA 3TPUA 5HHVL 3NZ8B 4GMSH 4UV7H 2E8YA 4MA7L 4BH8B 1J10A 1CFQB 5TFSL 2R0LH 5M94B 1I7TB 3LEXB 4CJ0A 1LWRA 5EZJA 5CSBA 1QUNA 1YUHA 4W68A 4ZUVA 1RHQA 4MAUH 3U9PH 3DMMB 4CU7A 4UQ3A 3DEJA 1MRDH 2NY6B 4TTGA 1NDMA 3ELAT 4P5MA 3SDYL 1YDPB 5CIPB 1IGCL 1B0RA 4EOWH 3O3BA 2JLLA 4JFPA 4U05A 4X99A 3S34L 4NN7B 5HXMA 3V5KB 1GGIH 4J3UA 4DAGH 3FQXB 3ULVF 4ZDHB 4P3DA 5CSGA 5H37H 2Q3ZA 1ZT4B 1ZT7A 3B9KD 3ILQD 3U2SA 5C0EB 4UTAH 1CFTB 3QUYA 5DQ9A 2FO4A 3U48A 2FZ3A 3UXFA 1IM9A 3GSQB 2IADA 2AQ1A 3CFCH 1NFDA 1F97A 3HAEB 1MIMH 4HPOL 1L0XA 4JB9H 4TSCL 1DBJL 3TJHC 3OKLA 3QXAA 1NAKL 2CNKA 1QRKA 5DD6B 3F6IA 3T3PE 4Y1AB 1IL1B 3MRGB 1XGUB 5FB8A 2BERA 5BOZG 2YKLL 3T4YA 3BRFA 4UUJA 2F8VA 4L4TE 2ZUQC 4ZQKA 4GRMB 3VXOA 2GAZB 3SJVD 2EH7L 3L7FA 1UVQA 3L3JB 4WFGE 3RTQD 3FTGB 5E95B 2JIXA 3RTQC 4BKLB 2NXYB 2DD8L 1QKZL 5IJKA 4XVSL 3RUGA 4PGBA 4LHUA 8CGTA 4EQ2A 3WIHA 3WCYA 1MCHA 1RZ8A 5F3HA 2IMNA 2HP4A 3DIFB 1HYSD 4WTZG 2B0SH 4JQVC 4Y5YB 4KDWA 4MNGB 2VXSL 3QG7H 5D70H 3UYRH 2WBKA 2YD4A 4NM8L 2C9AA 2E7MA 4EHDA 4XNMB 4WI6A 4JFEA 3REWB 5SWSE 5IBTH 1AGBB 1U8MB 3LRGA 4LHJB 5E9DD 4AMKH 3FQNB 3WS6C 3G6DL 5KAQF 2HVJA 4OGXH 1X5LA 4JZOA 3NPSB 5FKAB 4JVPA 1UVQB 4U7KA 5IROC 2BOBB 1T4KB 1AC0A 1F90L 1EH9A 5TDNA 2VJXA 1FVEB 2PTTB 4F80A 4PS4L 1XAUA 4E41D 4UT9H 1KGCE 3EAKA 2OK0H 4NKDA 2BZDA 3I2CL 5ISZE 1Y0LB 1QBMH 4L1DA 2F8XC 4G6JH 1JWMA 2NTFB 1BGXH 5E0QA 3BP5B 2NX5B 5FUCE 1YN6A 3HB3C 3ILPA 5AUMB 3BZ4B 4ELKA 4FFVC 5C0IB 1XR8B 5L8JB 5LCVH 4H0IA 3EDJA 4OKVB 3TA3C 1U8MA 2BNRA 4F15B 4MA3A 4PJFE 3RX8A 5L88H 2R2BB 3AREB 12E8L 4MNGE 5ADPL 2IAMB 4BFBD 5IBUB 4R90H 2NXZB 3U36A 3MACL 4J6RH 3UPCA 1RJZB 4TQEL 5CEXB 2MJWA 4NQUA 1RHJA 1EVTC 2IQ9H 3QNWA 1DN0A 4YFLF 5BVJB 4ZS7L 1YEJH 1YEEL 3ARBA 1TNMA 3QEQB 4OB5L 1UH2A 3KPQA 2R1YA 4N90D 4JR2A 1P84K 5C7XL 1QLFB 1HEZA 3OR6A 2A6IB 3DSNA 3T2OA 3U4AA 3FB6B 4Z7QF 1P6AB 5JOPD 2ZUVA 1L4IA 4ZFOA 3NFNB 1ULVA 1ORSB 1YJDL 1JGLL 5GGRY 1I7TA 3LEXA 4KKCC 1RQ5A 4NZRL 4DGIL 4RISL 4S2SB 5KVGH 2IH3B 4KAQL 2AK1H 3C5ZC 4QULA 1UFUA 3P30H 3G6JE 1QSED 5BXFA 2VLJA 4EI5D 5GRJH 1YQVH 2CDEB 1RIUH 4JDVA 4ZNEA 2XFXA 3D85A 3C5SA 1RHRA 1FLRL 4NUGH 2IAMC 2IPKB 3F6LA 2EXWC 1II4E 3RZCD 4FTVA 1B0RB 1A3LL 1KXTB 1P9MC 3TO2B 3BI9X 4LLVA 4JDVB 4CMHC 4WU5A 4PV8A 4XWOC 4LCWD 1KJ3L 4LKCA 1JRHI 3TNNA 4FQXA 4GKNB 4OZFA 2D3VA 2Q6WA 4HZLA 4CGTA 3U0PB 4HLZG 3H42H 2BMKA 4APQB 5KBNC 4O2CA 4KMQA 4X7CC 1WZ1L 1Z9SA 1UB6A 4GOSA 1S8DB 2NR6C 1T1WA 1FBIH 4Z8FH 4Q2ZB 1YEFH 4O58H 1E4WH 3Q2CA 1FCGA 2A9MH 3RDTA 1CVSC 4YBQC 2WP3O 3IAPA 4GAYA 4H25A 1JGUL 3C5ZD 3LKPB 4XPTL 4KJPC 2MCPH 2NY7L 4M1GH 4ONHA 2VDKL 1M71B 2QR0A 1V7ML 1MAMH 3BEVB 4MJIE 2CMRH 2PYEB 5K59E 4PJBE 5K9JH 1ACZA 4P4KC 5F1SA 3MRJA 3OAYH 3KLDA 5EN2B 3MODH 4NCC2 3ZKNC 5C07D 1YNTA 4LVOC 3LQAH 4MYWB 1NGXA 2A6JA 1NEUA 1GL4B 2XKNB 3MJ7B 1P7QB 3MO1B 1IGYB 3PDOA 2ERJC 5LXGH 1VEMA 4FQ1L 1JHLL 4LLWB 4MZ2A 3LD8C 2VUYA 3RWJA 3HR5B 2QADD 3KJ4B 4NJ9H 2IC2A 1A6AB 5ITFB 3ZTJH 5KN5B 4O51A 1FZJB 4N9GA 4Z7VB 4TUOB 1MHCA 2F15A 2OXGA 5IWLC 5LGKA 1XIWA 1IQDA 3D2UA 1CDHA 3BXNB 1DQQB 1P2CA 2DIAA 1OAUL 4LQ1A 4ZYKB 2AK4E 3O6KL 5MENA 3HNSL 3O11B 1FAIH 2GSGA 3KXFD 1A0QL 4IEFB 2NNAA 1UKQA 3DYMA 3KYOB 4ZUSB 5I1GH 3MRLA 2VAAB 5DJ6B 5TH2A 4PLJC 3BP7B 1F4YL 3MPCA 5DDHB 4KUZL 3INUL 2VOTA 2XY1A 2NY1C 5FIEA 4PGDA 3QO0A 5B3NA 2FX8H 1W2KT 4C58B 1QSZA 3SE3C 2DQEH 5F6HJ 1LO5B 5F1KC 4NRXA 5TF1H 5IB3B 5DK2A 4U3HA 1J8HA 3ULUF 1ZGLM 5I1HH 2Q86B 4MJ4A 2GJJA 3GMLB 1NKOA 3B43A 3H9HB 4IRZL 5ESVA 3U83A 4XWGL 2PETA 3FFDA 3AC0A 4L4TD 1XH3B 5JZ7C 5SX4H 3MRFA 1T0MA 2F58H 3F5WB 1XGYH 2R0KH 3V52H 5FO8B 4JQIL 3CLEH 4NO3B 2J8UB 4BQCA 4PB0L 1INQA 3OAUH 5JQHC 1SEBA 4PRHE 3E4CA 3CVHL 3MRFB 4MXQC 1OAZH 1T1YA 3ULVL 3MJ9L 2JKXA 3PQYB 4XPBH 4N5EC 2XACC 4NZTH 3KGRA 4BQBA 1PX3A 5CSZB 5D7JA 3TN0D 5BO1L 5GGSY 5KSUB 4XCFH 43CAA 1EHLH 3HFMH 3FO9B 1F3RB 3TNMA 5H2BA 1LO4L 3GSRA 1PX4A 1CZ8H 3TJEL 3BDBA 4P2OC 2RFXB 1N7MH 5J0BA 2VLKD 3OKDB 4ZTPL 3BEVA 1WIUA 1B4JH 3VXQA 1BVKB 4LPTA 4PIRF 5ESQA 4JZNA 4JCMA 2J88H 2BXYA 2IJ0C 1JZ3A 3B9VA 1GZPA 4Q9CA 1DL7H 3BQUB 5GRXG 5DK3A 3MRCA 3S3SA 2BSED 4HIEA 3MRIB 1GOFA 2VZSA 3H9SB 2W0PA 4WHYH 3B6SA 5CILL 3IDXH 3D69B 3KDMB 3SQOH 4P5KA 1HHKB 3GBMH 2ZUTA 3TPUB 1RWNA 1QFUL 1S8DA 2H48A 2A74A 2HT4D 2HFFA 3MLVH 1M1SA 5EUKB 4PPTA 4RNRB 5FA3B 3V0WH 3KPOB 1UZ8A 2GKIA 4PJDA 1A7QH 1IM9D 2A83A 3ME0A 3PJSA 3W39A 4JHWH 3KJ6L 4F58L 2JJSA 5D93B 1PAMA 3T0ED 4N8CL 4JM4H 4YXKH 4L8CB 4FGUA 3BE1H 3EBAA 4XVTL 1AHWC 2Q87A 1WWAX 5DEFB 2C2MA 5FV2A 3VXRD