1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
b'YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINGIPAIN R
molecule tags Hydrolase/hydrolase inhibitor
source organism Porphyromonas gingivalis
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
4PV9A 3CLEH 1MPAL 2IGFH 1UQSB 3C5SB 4PJAE 3MJGX 3QSKB 1W0YT 4EI6A 5JXAL 2W65B 3H6JA 1HDMA 1HH6B 4RGNB 3EO9H 4CN6A 5TQ2L 1NAMA 3PWPA 2XRAH 3EOBA 5HHVH 2V2XB 4P49A 1H3VA 1NEZA 4ZSOA 4QUHA 3FB5A 2IJ0C 4UZGA 5ADOL 3CC5B 3NFPA 1NFDA 2HFTA 2OMNA 3ULUE 4X0KB 5J11B 1AI1L 2GCYB 1U3HD 1IGIH 3L3DB 4U1GB 4KVCL 5I1EH 5TH2A 1QVOB 5ITFA 5DD3L 4M9PA 4G6FD 5EBMB 2DAVA 5DQDH 3G04B 4NBZB 3TPUB 4K7PL 4BFEA 2FGZA 4R0LA 4MB3A 5T1MA 3KYNA 2PYFB 2XQYK 4EDXA 2P8MA 1VFAB 3CVIH 5IROC 4J3SA 4UDTA 4UV4L 4RFNC 5IUSA 4Y0GA 5L8JB 1IM9B 4WWID 4Y4FB 1WTGT 1JK8A 4NBXB 1BD2B 5AWNL 1KEGL 4JAMB 1U58B 1WZ1L 2NLJA 4D94A 4YGVB 5K9KA 4S2SA 1NGYB 5F7EL 4QRPA 3VGAC 3LB6D 1S5IH 3KYNB 5IP4A 3WIFA 4OCSL 1BP3B 2DQUH 2BRQA 3P30H 2YD6A 1CD0A 4HKJB 5HD8D 4YZFE 4N5DA 4DK6A 5BVJA 1IAIH 4TUJA 3S35X 4YDKH 5DUML 5GXBB 4MDIA 2VJXA 1DBJL 3QISA 4HWBA 1A14H 2R2EA 3TBYB 1PYWA 5TQ0L 4U6VL 4WI3A 5EZLB 2Y36H 1DN2A 5JLZA 2ZCLL 3FTGB 4TUJB 2P24A 1TZGH 3VH8B 2V7HB 3MLZL 5DHVH 4LQFH 4Z7QE 2EXWC 3IF1B 1WJ3A 3D87B 3I2CH 3EYFA 5ICZB 2MCPH 3RVTC 4CVZA 4TYUA 1XGPA 2VC2H 3OMZA 5ACZA 1SJHB 4ONGH 1JPSH 1XIWD 3MV7B 4KUZL 1YY9C 1G0DA 4KTYA 1DQQB 4YR6A 1FZOB 2KH2B 3ULVD 2IGFL 1K2DA 1TMCB 2DLFH 1FVCA 2G5RA 1AHWA 4XZUB 3RUGB 2UWEB 5HHMD 3FOMA 1RHHA 1YN7B 3L3GA 3MBEA 1XCQB 2BK8A 5TQ2H 4IRJA 1JGDA 4OD3H 3DRTA 4FFYH 4JE4B 4NCDA 3ULUH 3U4EA 4P5KB 2FYYA 1Q0YH 2IH1B 3SGJC 4F8QA 4FTVE 4WU7A 1QZ1A 2Z92B 3HKFA 4OT1H 1CDUA 3T65A 3R06B 4BQ6A 2X05A 1MWAB 1VGEL 3DGGB 5F1NA 5DUBB 4HIJB 2EDHA 3MV9E 5L88L 2GYSA 1GHFH 2P45B 4XPAH 1EUUA 1KTRL 1YPZA 3RWGB 3MA9L 3KPTA 1G7LB 4L4VA 4UV4H 3AREB 4NFBA 4HPOH 1PKQB 3R8BB 1JPTL 3WLBB 1QX3A 1OPGH 4JFQA 2VRAA 3UJJL 3B9VA 2FIKB 3SDXF 1CGVA 3LQZB 5LGHH 4U1JB 1TETL 3V4OA 4WJ5B 3ABZA 5K9JH 3HMXL 1BEYL 4OM0H 1A3QA 1A6TA 2A9MH 2YRLA 3G6JB 1MH5B 3V3KA 5JIPA 5J1SC 3DSNA 5FA3B 5D72H 4G8GE 4K3HA 1MAML 3HI1B 3K8MA 1JYNA 1LO5B 2VZ1A 1N0XH 2QSVA 3VG0H 1CXHA 3N1QC 1NGXA 3RBGA 4RFOH 1G7MA 1F4AA 5EN2A 3D0LB 3IKCA 3BRFA 5KZCD 4OZGE 5IBRA 4EOWH 3C6SB 3VGGA 5CUSH 1T4KA 4O58H 4F7EA 2PKDA 3QBTB 5FYLE 5KS9B 4TSCL 3QIUD 1KJ2B 2P24B 3QNZA 4H20L 2IWGA 2KL6A 1NUGA 3WKNA 1A9BB 1TXKA 4LHQB 2YZ1A 2IEPA 2GJJA 2DYPA 3OHXA 1B0RA 5M95B 4LSQH 1BFTA 4K7PH 4XNYH 4ZOBA 3GSRA 4FS0A 3CPLA 3IU3B 2HT4D 3OXRB 1MFAL 4X5XA 2QQKL 2OR8A 1XR9A 3WV0A 2DQGH 5IMKA 4F9LA 1S9YB 4XAWH 5HHXH 4O5LL 5EZJA 4G42B 1EPFA 4HXBL 4GBXA 5BMFH 2VZSA 3D85D 3TZVC 4IYRA 2VXUL 5INCA 3WE6B 4PJXE 4LSRL 4NT6A 3DMMD 4EEEA 5D2NB 2XZDA 4H26A 1FL5B 1EBPA 2NY2B 3VXRD 1N8ZB 3DV6B 2AI0L 1MI5D 5DTFA 1A14L 5IEKA 5DD6B 1XAUA 3FHQA 4PJIA 4Y4HD 4I1NB 2GITA 5IHZB 3V4VL 1QVOA 2DL9A 3VWKC 4PGDB 5FAAA 4OUOA 1NEUA 4NOFA 2FB4L 2Y5TA 3PABA 4BA8A 5LGHL 5MENE 1OAZL 5K9JL 3OB0H 5JZ7C 5IB2A 1AIFB 1YEDA 5KTEL 1BZ9B 3BZ4B 4JHBA 4MXQC 5E8EB 2VKXA 1ODAA 1B2WH 3O2DH 1AQKL 2VC2L 3EYUH 3M17B 1FL3B 1CFBA 3ECBA 4XPHH 4ONGL 4QOKB 3DXAE 1CFTB 3FO9B 4EIGB 5DEGB 1AY1H 5H8DA 5KVEL 1NH6A 4NSKB 1NAKL 4Z0XB 1CLZL 1NDMB 2XYCA 3QZWA 5I15L 2MSPA 4DTGL 3E0GA 4P2OA 3TM6A 2HYMA 3HFML 3T0EE 1ZSDB 5C07B 4QRSA 4XBPA 4NM8H 3C6SA 2AK4E 2FX7L 1Q0YL 1RWOA 5C0RH 4ZVPA 3O4LE 1RWMA 4ALAL 1YJDH 5I1JL 5ACMA 4ODXA 3IRZA 3MCLH 1D5IH 4QOKD 4Y1AD 3U2SB 1WUNT 2YPLE 4TUOA 1D3CA 1K3ZA 1IAMA 1PSKL 5JMOC 3WD5L 3QIBB 1EJ6A 3VI4E 5BS0A 5J6HB 1S7WA 3GJSA 1I7RA 2PYFA 3K74B 2B7DT 1PDKA 2QLVB 5C0IB 4KKAD 4S0SD 1I7TA 4JFFD 4HPOL 4R97C 4QGTA 1OOAA 3V55A 1MFNA 1OPGL 5C0AB 3P4MA 1NUDA 1KBGH 4PBWD 3RJMA 5BMFL 1NJ9A 1NCAH 4LSSL 3WNLA 2R8SH 1KACB 5E8PB 4BZ1H 4P3WA 2JJSC 4XP6L 3EDEA 1Y0LB 1TZHB 4DEPC 3MLSH 3MRPB 4ZUUB 4XNZB 2HLAA 3B9AA 3QCUH 3ARUA 5AYUL 5D6CB 4WW2C 1PKOA 2AI0H 4G3YL 5IW1B 5A3ID 5EC2B 1XGTB 3C87A 1I3RB 3U4AA 3T2OA 4PJBB 4TRPH 1J86A 2EICA 3BZFB 5C0JA 3G5YA 2DLTA 5DVKA 4AG4L 1AGCA 5J13C 1RK0A 1HDMB 4MB4A 4KKBC 1Z6JT 5EUOF 5SWZD 3QJHA 1ROWA 3SY0A 5KTEH 4G6AC 4NM4L 3OZ9L 3D9AL 1TVDA 4C56D 4KHTH 4YBHA 5JW4R 2M8XA 3ARFD 2F74B 3X14B 2CNOA 5C0EB 4UAOB 1FG2B 3G5YB 1Q9OA 1Y18B 4YHML 1AGFA 1FYTE 4ZVQA 1TQCC 2F8VA 4EVNB 4IIQC 4MJ2A 4XC3L 2R9HD 4TVPH 4JQVC 2C2MA 5I15H 5I9QC 4Z7NF 4L4TA 2VXQL 4NN5B 4NO2B 1F6AA 4WCYH 2UUDK 3UEZA 5KSAA 1JTPA 3ZE2E 2WNGA 4R6UA 3DV4B 4KJWC 3EJZC 2YS4A 4GS7B 4RMSA 4C83A 1FIGL 3ULVL 4PJHA 4P46C 4X6DB 4HDIB 1T0NB 4YDVB 3S36L 5ISZE 4XMLH 3L3JB 3SDYH 1QR1B 1RWWA 2OL3L 2CIKB 2ZCKL 3HCVA 3LQAH 3PHOA 3MOQA 5IBPA 3QQ4A 4HKJA 3VRIB 1JPFB 4WGVB 1TITA 4WUKH 1C7TA 5GSVB 2X4OB 2AV1B 4X6DA 2FP3A 1ZAGA 2ZPKH 3QIWD 5EORH 4JREB 2BNQD 4I3RL 4EKXA 5IW6B 1U91B 1W0VA 4F33A 4NBKA 2X6MA 2F5AL 3ARED 1AXSB 2H5JA 2YMXH 4G9FA 4IDLA 5I1CL 1K86A 4M93C 4JN2B 4KDVA 1KV3A 4N0YH 4PRBB 4HT1H 4OIIL 5IMKB 4NT6B 3U36B 1XR8A 3T2NH 1JUFA 5FKPA 1R3LB 1P2CA 4JM4L 3SJVB 3FFDA 3TJHD 2AABL 4I18A 1FGNL 4FG6C 5FF6B 1YYLH 2CDGA 2W92A 1CFVH 5J57B 1R5WA 2I9LB 2BXZA 1IL1A 2BNQB 3WS6C 1ADQH 1FSKB 1UT9A 2MKWA 3QH3A 1ACYH 3S96A 2A6IB 4NYLA 4X9HA 2CKBH 5GJSH 3CLFL 3FB5B 1QFWI 1FPTH 4ERSH 4K71B 3I6GB 3JV6B 3MRJA 4KZEH 5AD0B 1FAIH 3C9NA 1IGCL 1FYHB 5I1LB 4GW1A 1SY6A 1VADB 1LP9B 2ZZUT 2DBJA 6FABH 1OWWA 3DX7B 1UCTA 4UOJA 3PIQA 4QXWA 3GSWB 7FABL 3GJRA 1NANI 4K7FB 4M02A 2VDPL 3OX8A 4GKZB 4QU9A 4QHMA 1FFPB 1YMHA 2GTWB 4LSTL 1DN0A 5EZIL 1RUPH 2HFEB 3ZKQD 3U6RB 3D39E 5D7KD 1R3HB 3MLRH 5IMLA 4I9WE 2QR0B 4MD5A 4LSSH 4G8IA 1W0VB 8CGTA 4BZ1L 2FZ3B 4S1DC 3IDXL 4Y4KC 4QNPE 3S36H 4Y4KA 4IOFD 1IAOA 4LIQE 3O2WH 1ZK9A 3MOBL 3WS3A 4YFDB 2FJHB 3MODH 5IFJA 5FHAL 3G04A 1OQXA 4MXVF 3MGAA 2ZCKH 3LQAL 4TVPD 2RHEA 2X4RB 5D7LD 3KYKH 1M6OA 4JG0H 4HV8A 1WBYA 1SC3A 4YHLH 3T04D 1BVKA 3NACL 2I07A 2BC4A 3AS2A 1Z5LA 4YNYB 5JPMB 1TCRB 3EFFA 2P5EB 1ZA6B 3NAAH 4AG4H 5FCUL 1HQ4B 4HS8L 4Q97A 2DB8A 1K4DB 4NQXA 1T5XB 3IF1A 1IAKB 1F6AB 5GRVL 4CU6A 3OZ9H 3MV8D 4HUMB 2D0HA 4R4BB 4UIMA 3L5WA 1UJTA 4PP1C 1G1YA 4RBPK 4U1LB 2ZUUA 1CD8A 3K7UA 4MDJA 4JY5L 3O0RH 5AEAA 1QDUA 4M8QA 1ZS8A 4DCOA 3DHMA 1S8DA 1M7XA 1V05A 3HUJE 1NDMA 3QZWB 3IS0X 4JRYE 4UV7L 1I8MB 3C2SA 5GJSL 1MRFL 4PS0A 3WNOA 4GW1B 3WDJA 3QHZL 3VGDA 4U7KA 2H6PA 4XRCB 4KY1L 5DJ8A 3SKNB 1UM6L 4JPVL 1FAIL 3OKKA 4U0QB 1ZS8B 1EFXB 5ACZB 3CH1A 4S1QL 5ANMA 32C2A 2EE6A 3NS7A 3VH8G 2GW5A 1N5YL 2X1WL 3GFUA 3HPLB 2DIBA 4UQ3B 3KJQA 3THML 5I30H 3QDME 7FABH 3AM8C 4XHJD 3BO8B 2DLGA 3AFLA 5D7IA 4ODWA 3VXNA 1U93B 4HK3N 1I9IH 3MGOB 5D6DA 5DD3H 2HBRA 4Q74A 4N0CD 2ZUQC 4I3GA 5F89B 3NBNA 4NP4H 4M03A 1ZHNA 4MDIB 2IAND 5D1ZA 4F58L 5CBAA 5I1CH 4YDIL 1RE1A 1KCRL 2YEZA 2EKJA 1ORSA 5GIRA 2HT2C 3GSVA 1MRDL 3OSKA 3BIKB 2HLAB 1GVIA 5IBLC 5F7UA 1N5AB 4NQCD 4ZODA 2AJZA 2IFFL 5JPMA 5MI0B 5MERB 1JZ4A 1T83C 1MHHA 4JKPH 3SKMA 3RX8A 3O8XC 3Q6FA 4NZTL 4LEOB 4N0FB 1ADQL 3HC3H 3NACH 2XZQH 5C3LD 1S7RA 3OJ2C 2BVOA 4XCEB 5D5MB 5GZNC 3VFOB 3OBAA 4O4YL 1RV6X 4WW1B 2EIZB 2ADIA 2V5MA 4HS8H 3I50H 3MRQA 1S5HA 1FZJB 3H42L 5C07A 3MNVA 5J6HA 1BF8A 1RWVA 2J32A 4JPIB 2JCCE 3WMSA 4LLYB 1ZLUK 5DVOA 2OQJA 5C07E 1U8KA 4EN3C 4L3AA 1H3TA 1INDL 2FECI 2ZCLH 3U7YL 2P1YA 3BJLA 1KELH 3QUYB 4JY5H 3VFMA 3O0RL 3MLXL 4KJWD 3G5VA 3QO0B 3RAJL 4EVNA 3LZFH 3NGBB 1HKLL 4NNPL 3FRUB 4Y88A 1HNFA 4R2GC 2B0SH 1LMKA 1JNJA 3IGAA 4GXUM 2DLFL 4RMTA 5I73B 1BOGB 1OP3H 3AREA 1V7ML 5D5ME 1PG7H 3ZLQC 1L0XA 2VITA 1P7KA 1SMOA 1ORSB 4ODSH 1JF1A 4LFHG 3SCMD 2W0FB 2GK0B 3FRPG 3ESVF 3LEYH 4Y4FA 3QUYC 3ARQA 1LD9B 5I1DA 2J2ZA 1KJ3L 2AJZB 4JPKL 3C8KA 3DVIA 4M4RA 4ZFZB 5J6GA 1RZGA 2CLRA 3ULVE 2Y1LA 1Q8MA 1CD1B 1HN1A 4KPHH 1JF6A 2IBGA 5HGHB 2ED7A 3EYSL 4YDIH 3RL1A 2XACC 3MNWB 5D1ZB 3BUTA 3QG7L 3S88H 3A6BH 4LAJH 2J8UF 3D6GA 3EDJA 5H2BA 1A6VH 1JGUL 3MJ6A 5D9SA 4XCFH 5JQ6L 4MNGA 5MI0C 2BSTB 4OLXH 4CDGC 4CMHC 2K7PA 4ODHL 1YEEH 4PFEA 3TJHC 2NPLX 1NCTA 2VQUA 3NN8A 2AK4D 3NPSC 3HE6C 2VABA 2EXYD 4RFOL 5HHNB 5JIKA 2W0KA 3MUY1 5KS9E 1RIUL 4Y4FC 5EDXA 1H3UA 1FHGA 5CJBA 3MO1A 4IHOB 1G7MB 3U7YH 4U4BA 3QEUA 2IADB 1IAKA 5HDBE 2VDOL 3V4PH 1QKZH 5A2FA 5EU4B 3VWKA 4ZOEA 5SWZB 4F7EB 4BUHA 1P7QD 4ZXBD 2NCMA 1HEZA 4LPVA 2BY1A 2DKOA 1A5FH 3BXNA 1HHJA 5LBSL 3CFEB 4QXUH 4L8DB 1SY6H 4LSQL 4JN1L 1X5AA 3CU7A 3HZYA 2ZUTA 4KQ3H 1K9TA 5CKGA 3TNMA 2QQKH 2XICA 3B43A 1DVFA 2C9AA 1BX2A 5I2IA 1OT2A 1BF2A 2P8LB 1J7VR 1T20B 3WS3B 2PO6D 4GAGH 5I1IL 1BZQK 4PG2A 3FT4A 4X9BA 2C5DC 4NQUA 4GG6B 1YPZB 4FQJH 4TUKH 5JZ7D 4OKDA 4ODSL 2AXFA 2YK1H 1Y0LA 2ADJB 1J0YA 4M7LL 1WBYB 5CD5D 5IANA 2FIKA 3HN3A 4MA8L 3M07A 4XWGH 1F02I 2RBLA 3OKOB 4Z77B 3QNXA 3BMWA 1JPST 1JZ8A 3RWJA 1RK1A 3DX8A 3F6LA 3O3AB 2BDNH 2ZG3A 3UZEA 3ILPB 5D71L 5ESAA 4P2QE 2NY0B 4P3CL 3V6ZB 4RZCA 3WEXB 3FQXB 1KULA 1TTUA 1W0WA 3A6BL 1RZ8A 4QHUA 3UYRL 1RIVL 4WV1B 1FFPA 4XC1L 2VDQH 3SGEI 3DX6B 4YBQD 4Q9BA 3ARGC 2QL1A 4DKFH 2JKXA 4Y2DB 2DMBA 5EU7C 4JQIL 3I85A 4KTDH 1HHHB 2W38A 2R0KH 1NMBH 1PLGH 4MQXD 1SHMA 5B21A 3X3FH 5D6DC 5FB8B 4XP1H 2CIIA 5IR1B 1C12B 2Q3AA 3DECA 1WC7B 3L3HB 3V95A 3RY6C 3OKKB 1T2QL 1LO4L 5D1ZD 3EO9L 1IBGH 2IPTL 3AVEA 3D69A 2F8XC 1I4EB 5IABA 1F3DH 2E5EA 3MXWL 2DKUA 4PJDE 4YK4B 4AL8L 1KNOB 4QT5A 1VFBB 3QAZC 1W8NA 2AXGA 1INEH 3VH8A 1JRHH 5KSVB 3U7WL 2FIRT 3MCLL 4Q6IB 3D39B 3FB6A 2B4CH 5ICYA 1IGIL 4HS6B 1JCKA 3PWPD 2XIDA 4JM2C 5E1AB 4FQ2H 3S6CA 3C5ZA 4XP9H 5AD0A 2OM5A 5SWSA 3S37X 3S7GA 5I16A 1SY6L 1TCRA 5GRVK 4LSZA 4DQOH 1DLHA 4PD4K 3G6JF 5J3HC 1OP3K 4S2SB 3LKNB 3VFTB 4HKZB 3ITNA 5C08E 5T3ZD 2FH6A 5IW1A 1CL7I 4QXGL 1ZMYA 3KXFA 3P4OA 1LQSR 3ARWA 3B4NA 4F33B 4PYHA 5FM5O 3ZHDA 4JGUA 1KBGL 4KGLA 4DCQB 2VWEE 3RBSA 4FQJL 4TUKL 2P46B 5CKAA 2VR4A 1N5AA 4MWFB 5KG9A 1G7JB 1NMCB 4PJIB 1RHFA 1NC2D 4M7LH 3AROA 4XAKE 1R3LA 4KJPD 5F3BA 3WLWD 5GHWH 2DQHL 1YEEL 1II4E 4X6DE 5IB5B 5GS0H 3EHBD 4L5FL 5ENWB 1OB1B 3G08A 4PJCE 1M7DA 5IAJA 4ZVRA 1Y6MR 1TFHA 1PVHA 2AV7B 3EOBB 5A43C 4EJFA 3BXNB 4JREC 2BNRB 2V17H 5B22A 2CR6A 1RZJC 2J8OA 5DJ0A 1T21B 3RGVC 1NMAL 3DX7A 1WTLA 5ICZA 1RZIB 1FVDA 2A74A 2B2XL 2H3NB 3D0VA 5F7MC 4HVAA 3RWDA 1TZGL 5DRXB 2AW2A 3RWCB 1HHHA 3OJDA 1OAQH 1HNGA 2YRPA 4MLSA 4JRXB 3QIUB 3SQBA 2VLRB 3SO3B 3OX8B 5FHBH 2BERA 4IOSD 4XVJH 5C08D 3CXHJ 4DVRH 3BGAA 1QLRB 2JTDA 4QXUL 5D96C 2LTQC 3B6SA 2H4WA 1CR9H 4M6AA 4TVPL 3V0VB 4D0CB 3IGAB 1XGUA 5DQJB 2KPNA 4PR5B 1T2XA 4NOMA 1KJ2A 4PB0H 2BXYA 3BWAA 1NW9B 2V7NA 4IHOA 4G6KH 4TTGA 4FQCH 4O2EA 4WFFD 4CMMB 4Q9QL 1HHKA 3BD5A 1BQUA 4LKCA 4AL8H 4G6MH 2VXTL 2V9RA 3MRHB 5CILL 1M05B 3SDYL 1K5NA 1CGXA 5HVFB 4JR9L 1DDHA 2MWCA 3L95A 5CP3H 5IROA 4DZ8A 2P5WA 1WFTA 1ZTXH 1CGYA 3ROLA 5KSBA 3ZKSD 3B8YA 4DCQA 1IMHC 2BC4B 5ID1A 3CX2A 4P3CH 3WHXA 3T0AA 3V5HA 3TWCL 2FUNB 3BPNC 4D2NA 5E99L 3D6HA 3O2DA 1XEDA 4QCIA 4UU9A 1LEIA 1AR2A 2WWMD 5D2LA 1NSNH 2Z31B 3GSNA 4X8JB 1BJMA 1EO5A 4XBGB 3SIPA 5F3BB 3KPMA 4NBLA 4AWBA 1YEFL 4M9RA 3BPOC 3GHBH 4KKAC 4YC2B 8FABA 4MX7B 5INCB 2UYLB 2E6PA 1DLFL 1P4IH 3U4EB 2YSSB 2O61B 3RPIA 3STLB 5C0CE 4DEPB 4JFHD 2EO9A 4YAQA 1T22A 1GC1C 3FOMB 2UUDH 2X1QA 4OIBA 1BHGA 5DJDB 3TBTA 3GMOB 3JWDC 4GO6B 1JF1B 2NY1D 4R4FH 3RKDC 5DJYB 4ZNEA 2P42B 3VFVA 2IH1A 2PYEE 1Y18A 1DLHB 3TYFA 4JZOB 4UT9H 1YECH 1I8IB 3V0AC 4C56E 5DJXA 5I76B 3MLTA 4ZO9A 3C60D 1F4WL 3DIFA 1P4LA 3H13A 3RWDB 3VFSB 1SJEB 4HGWA 4GKSA 4LOUD 2R4RL 5JPNA 3QDAA 3NTCL 2R23B 3NIDE 1HHJB 1CBVL 3PWNA 4EDWH 2V6HA 4FTVD 2GJ6E 4XMPL 4Z7WA 2EH7H 4XNYL 4ZAKC 3DVNB 1JVKA 5JDJA 5SWQA 4OJFH 4XNXL 3FQTA 2PW2B 4DGVL 4HMEA 1KN2H 2XA8L 5KJRH 4MJ6A 2BVQA 4O5LH 5EZIH 4AIZA 2X4TA 5CZKA 2PXYC 4KQ4L 2J6EA 2XQBL 3VWKD 5MERA 1F2XK 4YHZH 2R15A 5JHDA 3FT2B 3I9GL 3IDXH 2CKNA 2ICCA 5CFHA 3CSYB 3NZHH 2NW2A 1N8ZA 5FHAH 3FB7B 4R7DB 3RZCB 1U58A 2EKSA 5BVJB 4WI2A 5LWYL 5ALCH 2MTPA 3LKNA 1G9MC 4U6YA 1MCKA 3NZ8B 3G6DL 1I4OA 4O2CB 2V17L 4HIIB 5EUKB 5JDSA 2Y23A 3PG2A 4E41A 3O6FA 1KCUL 1R24A 3O3EA 2I07B 2C2KA 2F58H 3BT2L 3Q3GB 2CDEA 3O3DB 5I1DB 1A6WL 4HG4J 4KC3B 4L8DA 1KYOK 4RDQG 3BHBA 5TDPA 3UTQA 3BQUB 4NZUH 4B53A 1D5ZA 4PRDA 5F21B 1KJVB 4W4OA 5FUCC 4WO4D 2OJZH 5SV4A 4LARH 5E4EC 5DJZA 4I3SL 1NAKH 4DKDC 5DR5H 2X4QA 5MENA 1PBYA 1JNNL 4G42A 1OAUL 1YEKL 4LLYA 1JPGB 4K7PX 1NBVH 2J4WH 1CLOL 5JMRA 3D69B 1LVEA 5IHUH 1OTUD 4WHTA 4YHKL 4Z5RA 4KY1H 3MRNB 5HVHC 3EUUA 3O41B 3X11A 3RVXD 3ZL4H 2YN3A 3GMPA 2XG4A 1D5IL 3LKSB 4WEMB 1FBIH 3C09C 4WFGE 3P45A 1RZIA 4OCNC 1LNUA 3WEXA 1NBZA 3BH8B 1EO8L 2YPKA 3P73B 1QTYT 1RUAH 1U3HC 2AEQH 4XMPH 3MRNA 2HBZA 1RK1B 3DX8B 4ZVOA 3S3JA 1CGTA 3EFDL 3QFJD 1CDJA 5D7LE 4YPGA 5HVGB 1MJ7H 2CDFA 3DRQB 4MXWL 3PXHA 4ODBD 3MXVL 1PGRB 3O3EB 5JO5A 4KWUA 5CBEB 5DURD 5D93B 1ZA6A 5DC0A 1PEWA 2BNRD 1I4FB 4FABH 4HD9A 1V3KA 3QCUL 5IB5A 2YKLH 5D7IF 3WBDA 4NZTH 3L7EB 1RZKL 3RZCD 4MSWB 4Y16A 5B39B 3H0TB 2CO6B 4FMFA 2Q8AH 5T33H 4PP1D 1N6QL 3UTTE 1KPUA 1KCSL 4HAGA 1CCZA 3IJYB 3NH7L 4P2RE 3E4CA 1QRNA 4U1SA 5E24E 3D9AH 2G75B 4XVUC 3TZVA 4KHTL 1UACL 4XWOD 5MP6L 3VFTA 3SIRA 5GS1A 2H9GB 1MELA 3R5KA 4NZRL 3LN5B 3MLXH 3QCVH 4PJ7F 3AB0C 3SKUD 1J12A 3GHEL 2VDRH 5SWZA 1ND0B 3UJTH 1WT5C 4JHZA 3KPSE 1IEBA 4NNYA 3HLAB 3KJ6L 1H3WM 4LOUC 3RP1A 4WO4B 3ZZ1A 3ARFA 4XPBH 1QPXA 2FDBP 3TV3L 3QH3B 2OTWB 1JPGA 1JHLH 1NBQA 5F88B 1K4DA 1S9WA 5JOEA 4F57H 1MVUA 5DS8B 4KRPD 4FQIL 5EU7E 2XWJA 1FV1B 1CDHA 1BQHG 5EOTB 4HX1A 1A6PA 2IMMA 5EPMA 4MA7H 1KIPA 4D3YA 3T0ED 3IU4L 2ZJSH 2WWKO 3DO7B 3VFGH 2UWEE 4Z7WE 4H26B 3SKMB 1YEGH 3FFCA 1BWWA 2DRUA 2AEQL 4MS8C 2PYEB 2DQCH 2R1XA 4HWZA 5ESQB 2L7UA 3VXPA 5SX5H 1KMCA 2ZCHL 4MCYB 3L7FB 4WFFE 4I3RH 2GSIA 1OAYH 1KCUH 4WV1A 1C16B 2HFEA 4PD4J 2FL5A 3D18A 3NFNA 3QO1B 2Z31A 3GSNB 4LHJB 4K8RD 5IIEA 4U1KA 1FLTX 5IBUB 5L9DL 1KTDA 4MHHG 3WIHA 4P4KA 4HT1L 3QG7H 3S88L 1A6VL 2UYLA 3O3AA 5ELIA 2XKUA 5ITFB 3ZDXE 5BRZD 5FECA 1KB5L 1O7SA 5JHDB 2YKLL 5ACLA 2APVA 4LARL 1CFVL 3NFNB 5IIEB 5CJ5A 3RY4A 3RUGA 5CJOH 5FIEA 1BVKB 3HCVB 1AKJA 3PHOB 3UZQA 5F7HA 1EHLH 4CU7A 4BH8B 4HUUB 3MV7A 1NAML 1EX0A 4RFNB 2ATKA 4YHKH 3PGFH 1X3DA 1BOGA 5CZXC 4AENB 3QEQE 1FC1A 2XYGA 2JELH 1LP9E 2YN5A 3INUH 4PTUB 4NOKA 2PO6C 4U1GC 4HGWB 4CJ0A 4YHNB 5CJQH 2VNCA 1RUKH 1T7ZA 5K59F 3MOAH 4ZUVB 2OR7A 1YMHB 3QCVL 2EDKA 1QFHA 3BEWB 3GHEH 5FKPB 4ZSOB 5F72S 4O02L 3VMOA 3TBYA 4PLJC 4M5YL 3IFLH 3CJJA 3LRGA 3QPXL 2W9EL 4OCXL 2C3VA 4X6CE 4HKXA 1QA9B 1ZT4A 5LGJB 4OZFG 5TE6H 4JN1H 1I9JH 5E6YA 2Y7QA 1IGJA 1QG3A 2QKIB 4L9LC 1IGML 3QPQD 5D6CA 1GSMA 1PKQA 1KN4H 3PWVB 4G8GA 4JRXE 1UFUA 4XI5C 3KLDA 4MX7A 4OF6A 5DJYA 5BCAA 1U8NB 2OP4H 1BD2D 1DANT 1F8TL 1JK8B 5TF1L 5LU9A 2L0DA 2QQLL 5GQBA 5C6PB 2JE8A 4MA8H 2Q7YB 2A1WL 2I24N 2GJZB 5T33L 1FIEA 1DQML 3QDJD 3U83A 2DTML 4PLKD 1N26A 3TA3A 5JUEH 4Q9RH 1UKQA 5E2VH 3EDFA 2G9HB 4PJBE 5IVXF 2EIEA 2FL5B 3D18B 4OF8A 4WTWA 5F9DC 1GGBL 1VPOL 2HJFA 3C08H 4X7TA 1IEHA 4DAGH 4Y1AA 2VDKH 4NZRH 4LBEB 1HH6A 3O3UN 3W5MA 1K6QH 4M7JH 2VLJD 1ZLSL 3ULUF 3WIHL 3SPVB 2OSLB 5SWZE 1ZLVK 4X7SH 1A6UL 3OTTA 3LEXB 4PY7A 1EHLL 5L2KE 4OGXL 3KS0J 5C09A 1TQBB 1JZ7A 4LPYA 4JFFA 4R8WH 2XZCL 5GRUL 4D0CA 4F57L 5GS0D 4LIQH 5DMYA 4Z5RB 1GQFA 3RTQC 5KSBE 3E6FB 4GXVH 1KCVL 1HSAA 4D9LL 1FE8H 1Q9LB 3FT2A 2A6IA 2R0LL 4NYLB 4PJIF 1UYWH 1DUZA 3ULSA 1J1PL 1R5IA 5HGDB 1Z0MA 4HK0A 5C09B 1WV7T 3THMH 3V5DB 5I30L 5IMMA 3R7SA 3U7WH 3IFPB 5T3ZL 5I1LA 4AEHL 1R5VB 1HSAB 4MDJB 4FQ2L 3O4LB 5TDNB 2ZSVB 1ZLWH 3MRRA 1T3FA 5KANI 4YO0B 2H65A 1JZ5A 2WBJB 5TE6L 3WN5B 1IZKA 2XTJC 1AKJB 4JN2A 4CUCA 2DTSA 1EHNA 3MCKA 4EQ3A 3P9LB 3S4SB 3ROLB 5F8QC 1DBMH 1S7XB 4Y2DA 3U0TA 3EO1B 2BOBB 3GJFB 4QOKE 4TTDD 4QUGA 4X99A 1EZVX 1WVZA 5F1NB 4PGZA 2GCYA 2H32A 2CXGA 5E5RB 5EU6E 3SDCB 4RA3A 1MHEB 1MNUL 3V6BR 3RJDA 4C4KO 5GHWL 3O3BB 3GMNA 4R7NA 1A6ZB 4R0LB 3PNWB 1Q38A 3DUSB 3QHTC 2K7ZA 1CD1A 3K1DA 1U93A 4TSBH 1PY4A 3H42H 3NA9L 4P4KB 3MRKB 4M3KB 1RURH 2W9DL 2EKSB 3MRFB 4XTRC 1SJVA 4NJ9H 4B0MM 5CSGA 1F9EA 3BH9B 2P7TB 5BV7B 5IAGA 1RUKL 4RGMC 2BSED 4BJLA 3Q5OA 2C1PA 4PJ8C 4PRIE 1KELL 3U48A 4X4XA 3SE8H 4JGMA 5FGCB 4K9EC 1MJJB 5HGGS 5FYKH 4IRSB 4BM7A 3QI9C 3DRTB 2PUQT 3L1OL 2DD8L 3KPLB 4IRJB 2H45A 4X7SL 3C5ZB 3L5XH 3BYTA 3HZMA 5EN2B 3CK0H 4N5UA 1ZOXA 2B0SL 3ARBA 2XZCH 1FFRA 2BCKA 2ICEA 3FAWA 3MYZA 4FQQB 2DWDB 4YO0A 2D7NA 4O51B 1W72H 4MCZA 4Q9QH 4PJ9A 3U4BH 4G5ZH 4D9RD 5EO9A 5H35B 4AEIL 5TE7L 4PRNB 3D3VD 4G6ML 1YEJH 4PJFE 3RNKB 2JJTC 4PRHE 4WY7L 4N5ED 1HI6A 3IDGB 4K94C 2J8UE 4AEHH 3GGWB 5E7FA 4EI5B 4Z6AT 2A1WH 1M71B 3DROB 5C8JB 2OXGA 5KVGH 1CIDA 4PGCB 4UINH 4WNQB 4Y5XB 1DQMH 1I1AC 5IHLB 2DTMH 4KPHL 3BZDA 3JV4A 3ZTNH 3U0PB 5EZJB 2IALA 4P2QD 4Z7OE 3H7BA 4BQCA 4W4NA 1XZ0A 2J5LC 3HAEG 4ZS6D 5JR1H 4MB5A 3NVQA 3NR2A 4JZNB 1IEAA 5HHMB 4EIZC 3S4SA 4PGDA 5IB3A 1MCOH 3GHBL 4CAGA 1G7IA 1IGYA 5T5FH 3PNWA 1CXKA 2A73A 5GIRB 2OCFD 2Q7YA 1TPXC 2DF3A 3DV6A 4N8CH 3OJVC 2ITDA 1G6VK 1J88A 2XFXB 4ODHH 4UTBH 4MXQD 3TBWA 1MI5B 4WFHD 5JIIA 5F9OL 1QNZH 3SE9H 3OKLB 1FQ9C 2VITB 5FGSA 3WUWG 4R4FL 1IC7L 1AXTL 1FV1A 2XWJB 1ZGLM 4WFGD 4NJ9L 3SKJH 2R29L 5KSAB 4ZO6A 1OWRM 1LD9A 4Y4KD 4QRRA 4JKMA 4KV5E 4L3EB 1T03L 4L8BB 4PRHB 4KZDL 1CN4A 4PYGA 2QEJA 2KQMA 2NY5H 3RIAK 3S37H 5C0FA 2IAMA 2DD8H 2OI9C 4X9IA 1FNLA 4Y19B 4M6OL 4PJBA 2I9TA 1W72B 2YPKB 3UPCA 5DC9B 5DVLA 3CK0L 4ETYA 3VFMB 1TJGH 2EH7L 2QSCL 4PJCA 1N7ML 1UJ3B 4QRRB 2Y7QB 5HYJB 3QJHB 1F3JB 1OCWH 2QL9A 3U30C 4G8EA 4LRIC 5ERWA 2EDNA 4DGVH 5KJRL 1KN2L 2XA8H 5HGDA 5T1KA 3SDXA 3H2WA 3BPLC 4CADA 3MMEB 4KROB 4ODVH 3E2HB 1A3LL 5DD6A 1ADQA 5F6HI 5FYLD 1T1XA 1CL7H 5IWLC 4Z77A 4H0GA 1SHJA 3L3OA 1WITA 1EJOH 3B5GA 1NC2B 4MJIE 3QDGA 5A2KH 3MV01 5FO8B 1YNLH 4ISVB 4OFYD 2X4RA 1KGCE 4PY8J 3IJYA 4UIKL 5C1MB 5E1HB 2HFGH 5DI8A 4MAUH 3MV9B 1D9KC 1IEAB 1MI5A 2R1WA 3FONA 1A1MA 1ORQB 4OB5L 3P2TA 4Y7MA 2CQVA 3LN4A 4HJJH 4EHFA 4PRID 5CSZA 2Y25A 3LPWA 3GSRB 1GAFH 5J12C 4HIIA 5EUKA 5JDSB 3SE8L 4MWFA 2V5TA 3QUXB 4LMQI 5KG9B 1VFUA 3CDYA 5CP7B 4K3DL 2GI7A 3MCG1 3UPRA 1G7QA 2BMKB 1QBML 3S9DB 1YMMA 3SDAC 3TT1L 4BSVB 4UTBL 5I17B 1UKSA 1YZZA 4XPTL 2VXVH 4GT7A 5IESH 3WFZA 4M7ZB 5LG1A 5FFLA 3JUZA 1JNNH 1OAUH 4HMDA 2EIBA 5D7JB 2QADB 3MLWL 1U3ZA 3RQ3A 5M7QA 4KRPB 4PRIB 2K1MA 1J87A 1T2QH 3MRCA 1OHQA 3BEVA 1IBGL 4L4VE 4OI9A 3ULVC 2GFBA 3NN8B 5B8CA 4AEIH 5E9DB 5B38B 1BZ9A 3BZ4A 4HK0B 2C3HA 2EE3A 3FO0L 4P2YA 2AJUH 1INEL 4MNHA 4WY7H 2VLJE 2BHUA 5E8NB 4NQCA 2GAZB 1B4RA 3V6OE 4Y2DD 3UYOD 5C09D 5E6ID 1NFIA 3DSFH 3QWOB 5E00A 1K3IA 4QOKA 4PJEA 1CVRA 1NGZB 4R26L 5F1IB 3BEVB 5IQ9A 1ZEAL 3TYGL 2QSCH 4HSQA 2X4UB 3MRIB 5F9JA 3BPCB 1EEQA 2MMXA 1O7VA 3IXTB 4NQVB 3DPBA 2R0WH 3LSOA 3VD9A 4PJAF 1L0YA 4JO4L 1O5DT 3QEQA 5C0GB 4RRPA 3ZTJG 2VERN 5DJXB 4P99A 4C56B 1KJMA 4HIHB 3I3DA 1GIGL 4X8XA 3HG1D 5CMAA 5EBWA 3TNNB 4ZTPL 3VXSE 1KB5B 2BOCB 4L8SC 5ENWA 2WIIA 1RHMA 3HUJA 4D0BB 2ZSWB 4HWBL 1I8LC 4FABL 4NBYB 4I0PC 3P4LA 2IFGA 2PTUA 4XBEL 1A1NB 1J1XH 4QCIB 2EXWD 5C0CB 3TH2T 4UIKH 5A3IC 4LEOA 4N0FA 1NEZB 3GJFK 4PREB 5L8KB 4KHXL 2D7QA 4TULH 3O11A 2IMNA 4U1HB 5LQBL 2HFFB 1ES0A 1UWEL 1H3PL 1U2CA 4OI8A 2H4YA 3OKOA 1N6QH 3QIBA 3BP6B 1QLEH 3QCTH 4MSWA 4NWTH 3RWEA 4X6EA 4Q6IA 2B2XH 3QULA 1DEDA 5JW3H 4MJ5B 1GCFA 4M62L 5K33A 5FGBC 4PJ9D 4DGYL 2Z0BA 3CC5A 3I75A 4FN0A 5L6YL 4O2FA 1CICC 2YBRB 5BW7A 5ANMB 2QV2A 1T1XB 3K3QA 1HEZB 4Y4FD 4ZUSA 4X4MA 4ZXBB 2FATH 3MR9B 4QU8A 4JFZL 1ICEA 1H9VA 1IGJB 1JP5A 3F62A 4DFIA 1G0YR 3SGKA 3QDGB 1CR9L 4YZFF 1BGXL 1E4XI 4HK3J 4P57B 3KJ6H 3T3PF 4UQ2A 1FRGL 1P4LB 2XZAH 1JNLL 3GJEB 3IFOA 3LV3A 4TPRH 1MFBH 4ZPTA 4JR1A 3BRDA 4X7CC 1CICB 1UC6A 3GBML 3VXUD 2R2CA 4JFPA 2XYPA 4EHNA 3TCLA 4MNGE 3SDAA 1DL7L 1IT9L 4PJEB 1KPVB 3EZJB 1P1ZB 1BBJA 1XF1A 4WHDA 1NFKA 3P77A 1PG7W 3DSFL 2ZJSL 4KI1A 4NO0D 2C3WA 2E7LA 2UZIL 3RWGA 4D3XA 5BVPH 3KS0H 4PGEB 3UOAB 3S5LG 3DUSA 4BELD 1P2CB 1JWUB 1KXQE 1PYWB 4FFVC 3I6LD 3VFPA 2VE6A 3O6KH 3DOSA 2G2RB 4WENB 1TJIL 2YHGA 5GRXG 2BNQA 4JANB 4JO2H 3L7FA 2BNRE 1JN6A 1HQ4A 1BZ7A 1C7SA 2I27N 3DETD 4HWBH 1LK2B 3ZYJA 4PREA 3SO5A 3I75B 4XBEH 2D7PA 4UUJA 2VLJB 3VXME 2PN5A 1HQRA 4JAMA 1DDHB 1JV5A 4X6FA 4YR6B 1RJYA 4LRIA 2FO4B 3OXSB 1QR1A 1J0ZA 5LJYH 5DFWH 2WV3A 1TTFA 2NY2D 2QTEA 4YXHL 3OKMB 2J1KA 3VXRB 3DX9B 1KIQA 3JXAA 2WAHA 4YHYC 1XCQA 1RPQA 1T7YA 3KDMA 4POYA 1JYVA 5IMMB 3MRMA 4M62H 1F4WH 3SDXE 4JKLA 3L95B 1FNSL 4XHQA 3QEQB 4I0CC 4FXKB 5C0GA 4DGYH 3DMMA 4LVOB 5DRWB 3MGTB 5JFTA 4X83A 3RNKA 1JNHB 4M43L 1FNAA 1T1YA 3DTXB 3TN0D 5CJXC 5SWQB 4MHHI 3D25B 5H94A 3LDBB 1UZ6E 4YXLL 2J31A 1JIBA 1ZEAH 1YQ2A 3TYGH 1XIWB 3MYJB 4HWZB 3VXTA 5I19L 3IFLL 2VQ1A 4LCIL 3D39A 3OPZL 5IJKC 2F53A 2YD9A 1CP3A 2C7UA 1NCCH 2HTKD 4JQXC 4QRRD 4KKCD 4IMLA 1G9ML 3EYQC 4P5TC 3RVWC 1PZ5A 5GS0C 5KSUB 1RZFH 3KPLA 3R4DA 4YHZL 4JLRB 4WRLA 5F7WC 2BNUA 4YNYA 3TYFB 5BZDB 4DZBB 3RWFA 4PRIA 2NLJB 5K9KB 1BVLA 4LEXL 1WISA 2FWOA 2C2ZA 4HIEA 1L7IL 2J12B 3E8UL 2LVEA 5KVMC 5HYQA 1DQDL 1MVFA 4UDUA 2KQNA 3S97C 1CG9A 2VUYA 4E41B 1E6JL 4HZLA 1OM3L 5HHQA 2FX9H 1T04A 1XF5B 3MV9A 4PS1A 4P2RB 4X7DC 2VZVA 4YDJA 5CEXA 4OLZL 4HC1A 2FD6H 2CGRL 1AFVH 3RWJB 1E28B 3P4UA 3P0YH 2HLFC 3O6KL 1EAJA 1QLEL 1R3HA 5IMLB 2F54D 4CRPA 4E5XA 1T0PB 4LLQA 3BT2H 1PX3A 3D2UA 4MNQB 5HYJE 3EAKA 5CSZB 4OZHF 1BM3L 4YPJA 3L5JA 3AUVA 3V6FB 1N2RA 4LVNC 3BIBX 2WIIB 4YXKH 1K4CB 2B4CC 3E2HC 2DLHA 1GGBH 3CFJA 3DXAD 3OGOE 4DFHA 1JN6B 3S34L 2JJTA 3C08L 2X1PA 3Q1SH 4WGWB 4HDIA 4JJ5B 1IE5A 5FK9A 2FHCA 4QO1A 3KPMB 4PJ9C 5ICXB 1K6QL 3X13B 2CJUL 3QUKB 2AJYH 5LXGH 4FQ1L 5E6IC 4XPGL 4G9FE 3UTSD 5F8RC 4LLUA 4LU5L 2J8UA 3QXAB 3FQRA 4IEFB 4JFOA 1NCBL 3NA4A 4PGEA 3S36X 4Z78B 2AEPH 5D7IB 5DXWA 4RA0C 3VXNB 2APFA 4YGAB 4GMTH 4DKEH 3MFFA 3IRPX 1RWNA 2Q86A 5EU5B 1FE8L 1DVFB 1Q1JL 2R0LH 4M6ML 2NW3A 3PP4L 1LO0H 2A0LD 1NDGA 1FZOA 1NC2A 5L7XH 1R0AH 5E5UB 2HKHH 4PG9A 4NN7C 4XXDA 4LLVB 3RVUD 5TDPB 3UTQB 4XB8A 5KOVC 5DSCB 4O2FB 1RMFL 3LV3B 5K20A 2OL3A 3EFDH 5JPNB 5IBCA 4L4TE 3GIZH 1TPXB 1AH1A 3V9FA 2UY6A 1NLDH 3STLA 4LSVH 3Q6FB 3S35L 1OVZA 4A2LA 3X17A 3GI8H 4BH7B 3T09A 5DK2A 2EYRA 4OKVA 4V2CB 3QDJE 4DOHE 2I9TB 2E9BA 1N64H 3WJJA 2VTFA 1BJ1J 5D7LB 4X98B 4XX1G 1A6TB 1OGTA 1DQDH 2DI9A 5JNYB 5I8CA 3DMMB 4M6NL 5DRWA 5L0QB 1T1ZB 3H7LA 5INDA 3QEGH 2XTLA 4OZGB 3HB3D 4KK5C 2D4FA 5D1XB 1UH4A 4ODTL 3FO1B 3VXMD 4PJGB 4HBQA 5F7DB 4YDJB 5CEXB 3GMMA 5GGUA 1LHZA 3K2UL 1IKNA 4UMGA 3GMNB 3C6LC 4QRTA 4EHDA 1S7WB 5IKCA 2OYPA 1FL5A 4YXKL 4Z95H 4Y16D 4X80L 4RISH 2CMRL 2ITDB 5C07D 3VFPB 3GK8H 3SDAD 2A6DA 4AT6B 1G9EA 3UZVB 5BZDA 1A7OH 1NGQL 4Z7VF 1R3IH 1SMAA 1S9WB 4ZAKD 3QIBD 5GSRB 3RTQA 3DEKA 1WBZB 2W0FA 3ARYA 4G9FD 3ZSSA 4MAYD 1CGUA 2YUZA 4Z7VB 3C2AL 3ET9F 1UB5B 5IVXB 4RX4A 1SC4A 3PV7A 3TCLB 4FQHB 1VEMA 2CK0L 4F15B 5HYSG 3CUPA 5C0FB 1T0NA 4YDVA 1I85A 2IQ9H 3C6LB 2DMCA 2XYHA 3GMRB 5I75B 4QUAA 1QLFA 3BKML 4KAQL 4F9PA 4LEXH 1PJ9A 5CHNA 4DGIH 2NY4B 3MUZ1 3SQOL 3MACH 4YHNA 3VXQB 3VFGL 1J9CT 5DHXB 4EUPA 5JLZB 1MCJA 4F7MA 2KBGA 1E6JH 1OM3H 3MX0A 2FNBA 2FQQA 3HE7C 2F5BH 3LPFA 1C5DB 2DQDH 1Z9MA 4JB9H 2NXYC 5D1QC 5L0QC 3T0EA 4YWGL 1JMXA 3OQ3B 2NY6C 4OZGF 4LDEB 1SQ2N 4EZMA 2R2HA 5FUCE 4Z7NE 4LLUB 4FA8A 4Y2OA 2CDEB 3O3DA 1QSFE 3OJDB 1BM3H 1Q9KB 2NY0D 1F4XL 5GGSA 1V7NH 2VAAA 5EOQH 5J56B 3NCJH 3VXRE 2Y5TB 3PABB 3SGKC 1EK3A 3L3KA 1ZA3A 1N64L 3FFDB 5DJ0B 3RIFF 3S34H 5I8EA 1ZV5A 4KRMB 1NCNA 2NZ9D 4IOIA 2APXA 1JWMB 3VRLF 1KJ2H 1Z0NA 1KSRA 4K94H 2HVJA 2HTLD 4MA3B 2CRYA 4OQTH 4P23A 1HINL 3N9GL 2P7TA 2NZIA 2DQJL 4GRLA 3O4LA 2V5RA 4YAQB 2X44D 1S7VB 3NIFF 3L3JA 5TDNA 3EJYD 4OZFA 3TO2A 5CEZH 5JQHC 1HYSD 4AW9A 3QNYB 3I84A 5BRZA 3MSPA 1XGQB 5I71B 4Y5VB 2VIRB 5ESQA 3SDDB 1MCSA 1OT1A 3S98A 4YE4H 1SBSH 4RFEB 3DV4A 1ZWIA 3VRIA 1OP9A 3VFNA 2ICWI 1QSZA 3C8KB 3IJSA 1F3JA 5CAYB 3I3BA 3RGVD 2LV4A 1LO0L 2ID5A 4E5XB 3HZKA 1KENH 4JY6A 4H0HB 1I9EA 4HKXB 1FNGB 2Q6WA 4KZDH 2UVEA 4ZUWB 3T4YB 2YD3A 4J6RH 3HMWH 5CZVL 1U3YA 1V8HA 4D9RE 2ICWA 3O4OC 1LE5A 2DQTL 4A2MA 4AMKH 3GIZL 1SVCP 5DUMH 3PL6A 2VL5A 4JZJC 4E41D 3OGCB 4JDTL 1IEBB 2W0LA 4NNYB 4HIXL 4PRPD 1AGFB 2FGWL 2XWTB 3D2UD 4NKMA 4N0UE 1NGZA 5F1IA 2GSGB 3U36A 2C1PB 3VGEA 5J4MA 3S96B 5KN5A 4FQXD 3WL9A 5D7KE 2B5IB 3FQXA 4WTZG 4WI6A 2A38A 1NUNB 3TA3B 4JB9L 2YSSA 4FFWC 1YNLL 1G7QB 2QHRL 3CMOL 2NXZB 5C6TL 1CFTA 3KR3L 5DD5L 3DEHA 1FCGA 3N1PC 1QFPA 5JXEA 1YUHA 3M8OH 2VB5A 1KFAL 4GRLB 3D25A 1NFDF 4UT6H 2AEIT 4S11A 5JW4M 5B3NA 3ES6A 3ROOB 2LAAA 5C0AD 3UTSB 3NCJL 4MAYC 4FZ8H 2CMRH 4X98A 1RQ5A 4OB5H 3I02A 1A2YA 3BVNA 3KGRA 1WK0A 5DD0H 4FFYL 1LILA 1ZXQA 2NY7H 5DMKA 3PWVA 5I6XC 4JJ5A 5DDHA 2VDKL 2GT9B 4HXAL 4FFZL 3JTSA 4PJIE 4M7JL 1A7OL 1ZLSH 3GSQA 4NCC2 4MQXC 4TUOB 4NUJA 4MA3A 4V1DE 4NC0B 5EUOB 4ONHB 4RNRA 5CEZL 4U3XA 5DUPH 5JNYA 1RHUA 1UENA 4QT5B 3BQUD 2VSCA 3JV4B 4R8WL 4OFVA 3PD1A 4P9HL 2IBBA 5C2BL 5C0IA 4OSUH 5B3JE 2W59A 3IBFA 4LIQL 4IM8A 1P84K 2WM0A 4F3FB 1AR1D 4HX1B 5HBBA 3V5DA 3MLYL 5EULV 2CUIA 1RAMA 4MJ6B 4AIZB 1MFCL 1OLLA 1J8KA 5DQJA 2CNLA 4J23A 3SQOH 2DKSA 4CVUA 4XCCL 3P4OB 5HYQB 3FO0H 2YC1B 2DM4A 4ZD3H 2B1AL 1JWUA 3HTLX 2Q20A 4UI2A 5D72L 3HMWL 4L1DA 1UM4L 4ZUWA 3P4NB 3T4YA 2ZUYA 4ZYKB 1HOCA 4M7KH 3UTZB 2B5IC 3PD0A 1AGBA 2DQTH 4AMKL 3SE3A 3J7HA 2KDGA 5DYOB 3H0EA 4ZSOE 1RSFA 5J1TC 4QLRA 1A64A 1C1EH 3O6ML 1LK3H 1X9QA 4NKOA 1QLFB 5DHVA 5A2JH 4EHAA 1SYSA 1AGCB 4LBEA 5J0BA 3SDDA 3P4NA 4KMTH 5EBGA 1XIWA 1E4KA 4PS4H 1UB5A 1GIGH 1DBML 4JZJB 4ZQKB 2XQYG 4YHOL 3BKYL 1GFWA 3L3HA 4OF7A 2D2OA 3PGCB 5KVDH 3BD4A 1FVDB 4KI5D 2BNQE 3H9HB 3U79A 3MRKA 3UYPA 2XTJE 4DUXA 4W68A 3WJJC 2E3VA 2DIJA 4WFHE 5F7DA 1H15A 3ZE2F 3MRQB 5EIIA 1XR8B 4M1DL 1G1CA 5EBMA 4LRNH 4ZS7L 4OFIA 1H3PH 3KJFA 1CG9B 4XAWL 5HHXL 2J88H 1I3GH 5B38G 2JIXA 5F6IC 5BO1H 2QQNH 4N9GA 5FDYA 4IMKA 1IM9A 3KPSB 3TLRA 4U6XA 4Y5VC 5FYJH 3CGTA 3BDXA 4RMRA 5DMKB 3WLWC 3IXAA 5KVFH 1DUYA 1UH2A 4XH2A 5IFHH 1PYOA 4BH7A 3BUYA 3K80A 3IDJB 4ODWB 4QXTB 5L2JB 1I3UA 3AU1B 4GQPH 5GISL 1ZT4B 4OGYL 2HVKA 1X7QB 2CUHA 3HLAA 1M05A 2DL2A 3GNML 5E8DH 2XXMB 1EBAA 2Q3ZA 3ZYOA 3BN9C 1TDQA 4Z7WB 2FGWH 2FHBA 2Z8RA 2JK5B 3MLYH 2XY2A 3OAZH 4LLMA 2JCCF 4JFEA 2EO1A 2K7QA 1QSED 4HZLB 3VXQA 1PQZB 4XGZB 1UA6H 1I75A 1PY9A 1B2WL 1NC4D 2EDXA 3MNVB 1AQKH 2YUWA 1FG9C 3HE7B 4RX4D 4Y19A 5DHYB 1MJJA 3SE4A 4UINL 4KDTA 4DW2L 3FJTA 3GO1L 1ZLWK 5KVEH 5EFIA 3LKRA 3QIUA 3GKWL 2P8PA 2GTZA 1BFVH 3GMQB 5IW3A 1LK3L 5E2JA 4B41A 4EUPH 3SGDH 4KUCD 2HTKC 3QDJB 4DOHB 1T22B 5I75C 4FZ8L 1UCBH 2HH0H 5E8OB 3NMEA 4C4KT 4N90E 4EDXB 4XP5H 3QR2A 5D5MF 2CLZB 4L29B 1A0QL 2YPLB 4HLZG 5EC1B 3KAAA 2NYYD 4NZJA 5ESVA 4JANA 5T5FL 3MUJA 4MS8D 3WFDH 2IQAA 4JY4B 4MJ5A 1ORQA 1VSCA 3GJFA 1P7KB 5IVOA 3AAZB 1RWPA 4K23H 3GSXA 5IEHA 3QXDA 1CE6A 4M1DH 4LSUL 1AD9B 4PGCA 4YXHH 4GLRH 4QGYA 1DBAL 1TCMA 1A2YB 2YXFA 1E4WL 3C09B 5DEFB 4OCYL 4KK9D 5C0BE 1WZ1H 3IDGA 1JGVL 2DQFB 4L3EE 4P23D 1X5GA 5D7JC 2WBJA 4BZ2H 3CH1B 5JW5B 2B1AH 4GOSA 4I2XA 4Y4HA 3S37L 1VCAA 4Y5XA 4Z0BL 1OAKL 3VXSA 5D1XC 4TOYL 4PG9B 5DVMA 4HS6A 1NUFA 1RZGB 4PJFB 2VLLA 1HXYA 3H3KA 4QHNB 3CFKA 3DMMC 3LRHA 1A21A 3H9HA 1LNUB 15C8L 1CTNA 5K9QG 4ZFOB 4X0KA 2HTLC 5JXED 2RJMA 4HKBA 3UBXI 3B9KC 4F2MB 3X11B 3U9PL 4JR2A 3N85H 4QYOB 2NY1B 1CDGA 5GS1B 4GJTB 3QFJB 4YHOH 2DWDA 1XH3B 5SX4I 3RI5F 1BQLL 2IH3A 4LQFL 1B88A 4NM4H 2FJFA 4BSWA 3EBAA 4GKSB 5JHDD 4ELMA 5LAXB 3NIGE 1VADA 4JVUA 4YBLC 5ETUA 2Z91A 3AY4A 3IJSB 1U8MA 4HQRA 3CDGA 4YHMH 4G6JL 5D7SH 3GO1H 1DFBL 3UPAA 4MAUL 3BZFA 3B9KA 5D5MA 3BQUA 25C8H 5E8EA 1BIHA 5DEZA 2XA3A 3BH9A 3UP1A 5MENB 3JUYA 4QRTB 1U8PB 1I85C 3BMVA 3V2AR 1T7XA 3ULVH 4OCWH 5CMAB 5EBWB 5K9QI 3GIVB 2PXYB 3KNBB 4X7TB 3L3DA 1YJDC 2EDBA 2JB5L 2EYTA 4JZNA 2P8LA 1VGEH 3WNPA 5F97E 3FN3A 4UOW0 5D2NE 4OGYH 2O93L 1BBDL 3QULB 3KXFD 2P8MB 5DRZA 3HZYB 3QQ3B 3LEVL 3MA9H 3FQUA 1A9EA 1HCFX 5IW6A 4DUWA 5HYIA 2Y07L 2HFFA 1TENA 2Z8VC 3OKNA 3P73A 3RZWA 1RWKA 4PJHB 4N1HB 2AEPL 2ORBH 4BK5A 3P0VH 2EE9A 3F65A 4HS3A 1B0GA 2FEDD 1BEYH 4OM0L 4LDOB 4NNXB 4U1IB 5JXEC 1XGRA 4N9OB 2R0ZL 4MJIA 5FYKU 4CVXA 3EYQD 4GMSL 4P5TD 4KKCC 3HE7D 2HKHL 1CICA 4NPYB 1AO7B 4R4ND 2XNAB 3EDKA 4RMUA 5ETUB 4HF5H 5EU3A 3FRPA 1QRKA 4C56A 5IVNA 1RWXA 4HEPG 1IQWH 5DHVB 3B5HA 4QRPE 4BYHA 2BVTA 5I74C 3V0WH 5DT1H 4JO3H 2JB6A 1REIA 4EOWL 3EZ8A 4AJ0A 4Y1AE 1BLNB 4IOFC 4XP5L 4BQ8A 2DQEH 4DN3H 5DVNA 4YC2C 4BQ9A 3C9NB 4XPFH 4JM2F 4IBLT 1B0WA 2J7LA 5T3XH 4IRSD 4KZEL 4JZOA 5MEPB 1RZKC 1EVTC 1QD0A 1B4JL 4K8RL 1WC7A 1UZ8B 4I4WB 1Z3GH 1WZKA 1WAAE 2YOCA 3HRZA 4LVHB 1JYXA 3QEQD 1K8IB 3BPNB 3LQZA 1EEYB 4NC2B 1I8LA 3QUKA 3AGVA 1MSPA 3LH2L 5JOFB 4S1RL 4DKAA 1SYVB 4KGJA 1QR4A 3MJ9A 3REWA 3QHFH 2A2QT 5GRZA 3RX7A 4N68A 4L8CB 1JZ2A 1IC5L 4AK1A 2WBKA 2NY5C 4X4ZA 1D6EB 4U1MA 4LSTH 1KTDB 1EH9A 3I6LE 2G2RA 3MLRL 3VFWB 1XFPA 4HCRH 4LNRB 3TIEB 2FR4A 2DBLL 3HNTH 5F89A 4P23B 2R69L 2VWEC 2QL5A 5ESVB 5E70A 4Z95L 3V6LA 1WWWX 3SKOB 4KRLB 3O2WL 4GH7B 3GIVA 3MODL 4LFHD 2NY3C 2ZUWA 3ARSA 3Q5YA 1DQJB 4UTAL 5BQ7A 2CDFB 4NUGH 5EO1A 1QSFA 3L6FB 1EAPA 2KUTA 4RGNE 4IRSC 4HJ0C 4LNRA 3GSNL 3MBXH 4B5EA 1BGXH 15C8H 3FCTB 4Y19D 3LEVH 5DYOA 1A7NL 3KLAB 2XZAL 4JVWA 4NN6B 4HKZA 2QL7A 2Q76A 4P2QA 4RGMB 3MLVH 3DYPA 4ONFL 2ZSVA 5BV7C 4CADB 3GBMH 1E27A 3N85L 1TNMA 2H32H 2WK2A 3AMKA 4PJ5E 1TVBA 2CK0H 1OAZH 1FNEA 1LGVA 4V1DB 4HEME 3PF2A 4NOJA 3BESR 3HAEH 3BKMH 1GC1H 3BX7C 4KAQH 1MLBA 3U1SL 3C60B 4XVTH 3EOTL 3N1FC 1QHPA 3QIWC 3SJVD 1CDBA 2GFBB 5B8CB 4PJFA 5EA0L 4QF1B 3SDCC 1AY1L 2Y06L 3EDDA 3P11L 3TPKA 1OB1A 1ULVA 2F8OA 5IG7B 12E8H 1Q9OB 4F2MA 3MREB 4BUGA 4PRBA 5I1GH 4F7MB 2OTWA 2X4QB 3C60A 5HGAA 5FM5M 1TJIH 5T5NG 4QXTA 5L2JA 5ISZA 1NGPL 2DQIH 4Y5VA 5H0IA 2Y5EA 5T3XL 1ZHLB 3KPQB 1YJDL 5E2TL 5I1JH 1P7HL 1MHCB 3NPZB 1GGIH 1Z3GL 3BVNB 3DVFA 4AEFA 1T89A 1ONQB 2ATPA 4RIRB 3KXFB 4OLYH 5IB2B 3AU1A 4K94L 5HI4C 3E6HB 2H8PA 5GGQL 5MEOB 3HNVL 4PJDB 3RGHA 4D0BA 3KDMB 1FYTA 5IOPA 3V6OC 4JM2B 4FXOA 3UMTA 4KH2A 3GBLA 4C57C 4OGAD 2Y1VA 3L5HA 3OKLA 3SKOA 4M48L 4G8FA 3G5ZA 3MV7D 2P48B 2YEZB 4OZFB 3VD4A 3QAZB 2DM2A 1Q72H 1MLCB 1RFDL 4UT7H 1BX2B 4E9LA 1Q0XH 2VL4A 5I2IB 2R8SL 2ZKHH 4YK4C 2V2TB 1E4KC 1WFNA 3QUXD 3IXTA 4U33A 3RVVC 5C7XL 3DVGA 5EIIB 1GZQA 1SEQH 4HUVA 4UTAH 2IAMC 1FFQA 4NQED 1NBZB 3BH8A 4P4RA 4Q0XH 5CZVH 3FQTB 3RDTA 3W2DH 3DI2B 2I5YH 4RWHA 5IQ7L 1FNFA 5D1XD 2DWEA 1KTKE 1CD9B 3OAUL 4PJHF 4JFXA 1RZJH 2WBJD 4OCLC 2CPCA 3M1BA 5IQ9B 1CZ8H 1FDLL 2JJVA 3ARGB 1FO0B 4KK8C 4XPFL 43CAA 2NN3C 1IVLA 2SEBB 3FL7A 1B6DA 3EKCA 3MJ8A 1ZLUH 1GC1L 1KLGA 3GMOA 4K8RC 3U1SH 4RAVB 3SBWC 3W9DB 1FVEA 1SVZA 2P44B 4LPWA 1LE9B 3VXOB 1HKFA 1TJHL 1INQA 1M1SA 3A6OA 4XNQA 2PF6A 4KROD 4J3XA 3TGXA 1B0GB 4HS3B 1JYWA 1JJUA 1KPVA 2H48A 2W60B 4NQXB 2FBJH 4L3CA 1X4ZA 1X5KA 1G6RB 5GGVL 5JIHA 2QHRH 3CMOH 5C6TH 2X4SA 1N2RB 4MD4A 4WEBH 4RMVA 1NCDL 3KYAA 3KPSA 3SDCA 3F12A 5FDWB 2A0LC 1AGEB 5E0QA 4OIAA 5IR1A 3GSOB 1OF2B 1NGPH 1KYOJ 3HRPA 2R1WB 1I9RH 2NQCA 2R69H 2VLLB 3EO1A 3X13A 1MREH 4KRNA 2B8OT 2NXYD 4LVEA 1D5ZB 3AS3A 1T7VA 4PRDB 3DHJA 1T20A 4NJAL 5HDOA 2XXCB 2EDTA 3S8WA 5F7KC 5E6IA 3RRQA 4OLYL 4CNIA 4MJID 3QXAA 4O9HL 3LEYL 3KJ4B 4UU9B 5SV3A 1MF2H 1LEIB 4JR0A 4I5BB 3B3IA 2VKWA 3DXAA 5CEYA 3CFCH 3T1WA 3W5NA 5EORL 5SWSB 5I16B 5I18L 1CXFA 4GAJL 2EEBA 4MLIA 3VXPB 2WP3T 1D5XA 4DKEL 1P6AB 2WINB 4GRLC 1T5WB 1PW3A 4GKNB 1Q72L 2P43B 2O5ZH 2E8ZA 4AIXA 2O5YL 4NKOB 5EWIL 1MCHA 1GGYA 3EGSA 1L6XA 3PP4H 4ZVSA 3IDMA 3VDCA 4ZFFB 2GK0A 5HVWA 2IPKA 3HI5H 2AABH 5CGYC 5IFAH 2IPUK 4NPYA 1JTTA 2ILLA 4JZJA 2EDLA 4ZQKA 2ICES 4HPYL 3NCYP 3EJJX 5LUBA 3PL6C 4IJ3C 1FL6B 3TO4B 2GJ6D 1JNHA 2D7OA 2FLBT 3P30L 5AUMA 3FFCE 2ICEB 5I8OH 5DK2B 2D03L 3OF6D 3OAUH 5CHNB 5FM4A 1JXQA 3RKDD 1KLGB 4FXLA 3GJTA 2P8PB 1FNEB 3ARXA 4NKQB 4MCZB 3TZVD 3UTZA 2DQIL 3GI8L 5CSBA 4KROC 5FA3A 4RBPH 3BPLB 3FZUC 3V7AG 3SGDI 3W11D 3GJQA 4KJYB 1WIUA 4LHUB 3DO3A 4W70A 3HE7A 1RJYB 1OL0A 3U30B 4RGOL 4LF3A 3VD3A 4JRXD 3BHBB 4ZVTA 1FZMA 3QDMA 4PS4L 5LCVH 3VW3L 2IC2A 1S9XB 5DRXA 5I9BA 4UUJB 3UJIL 4IRZH 4OAWA 3MV8B 3OJMB 3V4PL 2NX5E 1LEGB 1HXMA 2BY2A 2OI9B 2BMKA 3VRJA 4KVCH 4LPUA 3MRCB 1ZT7B 3HI6L 4ELMF 1JPSL 1EGJL 3Q2CA 2NZ9C 5DQDL 2ZUXA 5H94B 5HI3C 4U2ZA 1X4XA 4W81A 3TIEA 1A1OA 3CVIL 4OBSA 4JHWL 5I71C 5EUOA 1Q0XL 4FXKA 2RGSA 1C8PA 1BQHB 1ZHNB 3VDBA 4APQC 1G7IB 3FFCD 2D0GA 1S7UA 1WLHA 1B0RB 4G8GB 2VDLL 2MNUA 1LDPL 5FYJL 5BRZB 1HWGB 5IV2B 3MGOA 3GSXB 1IGTA 4OT1L 4O9HH 3BE1H 5MEOA 4MZ2A 5GSVA 4LL9A 5DGQA 2VQTA 3QA3B 4Q0XL 3WCYA 5D1QA 1U8QB 1BVLB 3MUGA 1IAIL 3MRBA 4YDKL 4GAJH 5TE4H 1MJUL 2MPAL 3VGFA 2EEAA 4Z7QF 1CZ8L 1FDLH 2HT3C 1HIML 2VLKD 2EIDA 3CVHA 4P59H 4Q7DA 5ADPL 2UV3A 3F7RA 1MCLA 2Y6SC 3F7QA 4OGAC 3RPKA 2CDRA 3UDWC 5HHOE 3HG1B 3IJHB 3MROB 1A7RL 1MQKH 5FV2A 4H88H 3HHRB 2VZUA 3W0WE 1UA6L 4Y5XC 5EU5A 4HPYH 3OKEB 2Q86B 32C2B 2MCPL 5DK3A 2EIZA 5I8OL 5DK0A 4NRZA 2BZDA 1D6VH 2D03H 4JFXB 1VENA 3HMXA 1CXIA 1PLGL 4NHCL 2VDML 3PL6B 3GKWH 5GSRA 2HWZL 3AY4C 1W0WB 3B6SB 1UM6H 2AEWA 4ELMB 5EO1B 2VSDA 3VJ6B 5FYJU 2X9WA 3QQNA 1SBBA 3S3SA 4HWNA 4FQHA 1KG0B 3VD5A 4FGUA 1NGYA 5JHLL 4JFOB 4HLZH 3D3VE 5C3TA 3GI9L 4P48A 3RHWK 2OR9L 3TO2B 1KJ2L 4XX1E 3OD5A 3IDMB 4ZFFA 1FORH 2AK1H 1EAPB 2JIXB 1XCTB 3BSZL 1FNHA 1ZKAA 2EYTB 3SPVA 3NCYS 3Q3GA 5HGBA 5FYKD 1WWCA 5ISZD 5DMIL 1EGJH 1MHHB 3Q6GH 3UPRB 5JW4N 3IXAB 4ZTOL 4FP8L 3QQ3A 4XI5D 5IBLD 2N1KA 3WFCH 3VXRA 1F11B 5D1XA 1I1FB 1KCRH 1MWAA 3VFOA 1DBAH 2KZWA 4YFLF 4NUJB 4NCC1 4QUEA 1C5CL 3F12B 5GGUB 1N59A 4HXBH 3RWHB 3CIQA 4X7FC 3U0PA 2VDLH 1BVZA 1E6OH 3TIDB 3WLBA 4P2RD 5DDHB 3VI3E 2VXUH 4JKPL 4CDHA 4NKDB 5E1AA 4GBXB 2EYRB 4OKVB 3TVMD 3MMEA 4FMKA 2VXSH 1G0XA 2JB6B 4I0KA 4RAHA 4MNHB 1NMQA 4FRWA 3IDNB 4NRYA 5CS7A 2C4FU 4O4YH 4GSDH 1MIEL 1OGTB 4B7LA 4EN3D 1W2KT 3PWPE 5KW9H 5ADPH 1FO0H 2SEBA 4PJEE 2AP2A 4Z76B 1VFMA 1S3KL 2G60H 3OKEA 5C92A 1BLNA 4M9OA 5CUSL 2NTSP 4RGOH 4UIMB 4P2OD 5C0EA 1U8HA 5BXFA 3ZE0E 4S0TD 3ZT6A 3ARFB 1NFIB 3WN5C 5A16A 4I18C 2MQ3A 2WW8A 1OD7A 1Z9SA 1K85A 4H8WC 2OXHA 1F13A 3IFNL 3VWJC 4ESKA 4WI8A 3ILQC 5E2UH 4HUKB 4BH8A 2FECL 3SE4C 5ANME 5J9PA 1U6AL 2H6PB 2NMSA 5BS0D 2JF1A 2HWZH 3R7BA 1CLZH 1IM3B 4E42B 3EDQA 2Z9TA 4R3SA 1M7IB 1AQDB 2A74B 1UGNA 5F6HJ 1X5JA 4L4JA 2JJWA 3HFMH 4G6KL 1F6LL 4LCWD 4OF0A 3N1GC 3ZKMD 5SWSD 1QQDA 4Y4KB 4EJ1C 4W6YB 1U2HA 2FEDC 4I2XB 2OR9H 3W11C 4HXAH 1J8HA 4R4NC 5IWLA 4LLAA 4RMQA 2Q8BH 4PRZA 2AK1L 2FCBA 2HG5B 4JPKH 1I51A 3WSQL 5ICXA 4NKIL 4MMXC 4K3GA 1QRNB 1AXSA 3ARZA 4YIQA 4ZTOH 5ID1B 3QI9D 5I9TA 3CDCA 1MUJA 1YNTB 1HIMH 3FT4B 2D9QB 3OF6A 4PJ8A 3CXDL 4IS6B 2X70B 5HSFA 2NY6D 1S7VA 3HC0B 3C6LD 5D2LE 1CLYH 1GL4B 4K55A 5ICYB 3FN9A 1F4HA 3QQ4B 1JGUH 4NQVA 5CWSA 3BPCA 5IAKA 5AAMA 2C1EA 4FNLH 1KG0A 3R0NA 3GUTB 4N8VB 2R0ZH 4GAFB 3LN9A 3UO1H 1MVUB 5AYUH 5JHDE 1D6VL 4M7KL 3IB4A 3GGWA 4HGKC 4CVWA 3STZB 4KJPC 4N0UB 4EUPB 3CLEL 1X5HA 1OSPL 1WCQA 3EIFA 3MJ7A 3HAEB 4NO0B 5JA8B 1KIPB 1NEZG 2XY1A 1C1EL 3O6MH 4IDJL 4XVUD 3UC0H 3CFEA 1RIHL 5HJ3B 2R39A 4PJDF 1S7QA 3C60C 2EDDA 4MA1C 3CH8A 5J1AB 4Y16C 2YRZA 3T0WA 5JW5A 1AD0A 5I1AA 1XIWC 3H9SA 4M93B 3GJFH 2G75A 4ONHA 4RNRB 1SM3H 5A16B 4J3VA 3D48R 5BZWA 1FORL 4YDLB 4J1UB 2WINA 5DF0A 1OGAA 1EXUA 1Y6NR 1IGYB 3ARBD 3LKSA 2LU4A 1PSKH 4RMWA 3Q48A 1ZHBB 3BKJL 3WD5H 3LN5A 1CBVH 5C0BD 5F7FA 3UBXB 1OGAE 5DA0B 2VIRA 3WO4C 3TCXA 4EBQL 4ZUTA 3HNSH 3H9SE 4JRXA 1F5WA 2XN9A 4TVSa 2ZOKB 1G7HB 4ZG1A 2LQRA 2XZZA 1R3KA 1MCCA 2HJLA 1GH7A 3GZKA 2BHYA 5J89A 4P46B 2WSKA 4H1LB 1FIGH 2Y6SD 3ILQD 4NRXA 5SWSE 1P4BL 4AM0A 1HHIB 1FN4A 3MLSL 5KVFL 4YHPA 5IFHL 5HGBB 5DJCA 4G80A 3MNZA 2VXSL 1A1NA 3VWJA 4DUVA 3JWDH 4WUUE 5E9DE 3ISWA 4WDIA 3K4ZA 3G6AA 1U36A 4LLQB 4GSDL 5L88H 1GHFL 3GSNH 2E7LC 4KI5C 3WN5A 3BW9A 5F7NC 5CP3A 1G7JA 4L1HA 3D1MC 4QRSB 4XBPB 1U8PA 2X9YA 4XNQB 1WIOA 4Z7UE 1RIVH 2VL5B 3PGCA 4R3SB 4J3TA 4PV9B 1HI6B 4FNLL 4G7YL 4N0YL 1EA9C 5J06A 3NCBB 1QA9A 5EFIB 4PJXA 4W4OC 4UILH 1OTTD 3L3OB 1QSEE 4KTDL 5I74B 2A83A 2WUCH 4WNQA 3RWIA 5FUZL 5BOZG 4QUBA 2H9GA 3O4LD 4KUZH 4L3CB 2XKSA 3TVMC 5A1AA 3BZEA 2FJGA 1NMCC 5LUAA 3JWOL 3MJ7B 2FJFB 3UC0L 4BSWB 3KYMA 2UZXB 4S1DD 1HOCB 2J4WL 2CKBL 5F96H 1U8HB 3V0VA 1LP9F 1U8IB 5BV7L 1CE1L 1M4KA 1DUYB 3ULUL 3DNKA 5HI5C 3AXLA 4PJGF 5K93A 3WNNA 2W0PA 4L9LA 5AAWA 1TVHB 1P5UA 5FKAA 1SM3L 1YC7A 5GZOD 4MJIB 4FQQA 4E0RA 4QRQA 3HZVB 4ELKB 1GGIL 4AT6A 1DBBL 2B4CL 5DWUL 3RKPA 3FKUS 2Z35A 3MRMB 4YFEA 3TVMA 3ORJA 4G80B 3UTTB 2H41A 4XPAL 5TFSH 3G5XB 3TP4A 1MFAH 1EFQA 2VDPH 5JTWA 3HNSL 4KXZH 3CXDH 3CAFA 3P9MB 4HMCA 2D31B 3G08B 4QWWD 1CLYL 1RUPL 1I7UA 2F5AH 3PWLB 1BIIB 4DVBB 2VISA 2XT1B 3OR7B 1JGVH 3ZO0A 4Y19E 1KIUA 1T83A 3RNQA 4FG6D 4Z0BH 2YPLA 1S9VB 4NFCA 1YYMH 8FABB 5C9JA 2BVQB 4FXGA 1INQB 5GS0L 3KYKL 3VG0L 2FSEB 2GKIA 4EHHA 3K2MC 2VISB 3QXTA 4Y2DC 5ABDE 4M1GH 1QEWA 4IDJH 2NX5A 2X4UA 3CSYA 1D6EA 5IQ7H 3UDWA 4YBLB 3FT3B 2Q8AL 4B50A 4LLWB 4PGBA 2F53D 5GS2D 4ZYKA 3U9PH 2B1HL 3WFBH 3KWWB 1KCSH 4P2RA 4OQTA 4ERSL 1A4JA 4NQDB 4HFUH 1M72A 1U8MB 4JCMA 5HY9B 1H8NA 1OAQL 3ARBB 2VAAB 2AJ3A 4U49A 1R3JA 2NY1C 4H20H 1FVCB 5FHBL 5KN5B 5HGAB 1IZJA 5IMOA 3EYUL 3LKQB 3BZEB 1TJHH 4JFEB 1HZHL 4XPHL 3RDTC 2L4OA 2ZP0T 1ND0A 4DVRL 3S3PA 3MYJA 4FQLH 4HLJA 4F7PA 1FZJA 3VFVB 1DFBH 4TNWF 3DTXA 3JWOH 2W60A 2JCCB 5CD3A 1ZVYA 4JQYA 2AVGA 4GXUN 3PHSA 4FQCL 1OP5K 3STZA 5HVHB 1A6AA 2ESVD 5I1HL 2FX7H 1D5MB 4HFWA 1NCUA 3B9KD 4ORGB 2M2DA 4DWHA 1KXVC 4KKLD 4JR9H 4OZGA 4NJAH 1BECA 4X4XB 2R1YA 3JWDL 4N5EC 5DTFB 4MQ7A 3V6OA 1ZGLB 3DETC 1D9KA 1JFQH 4JG0L 3FB7A 4R7DA 3RDTB 4YHLL 1YEHL 3JWNC 2O61A 3NCEB 3DURA 3BQUC 3DYMA 1JRHI 2FJHA 3IKKA 5IB3B 4ORGA 3QT2A 3UTTD 3L3KB 5ILTH 5E99H 5HTSA 1AR1C 3K46A 4H1LA 5C2UB 1T04B 2A6DB 5C6WH 5FM8A 4HBCH 1KTLA 3CFDB 4KVNL 1NCAL 3RZCA 2FR4B 2OL3B 1YEFH 4N6NA 5IKCB 3GSUB 4MNQD 3NPSB 2GTZB 5EO9B 5H35A 4QTHB 3BKCH 2GSGA 2A6JA 3AXLB 5C70A 2O26U 2EC9T 2EDFA 3FQNA 4I9WD 1OP5H 5FUZH 2R1XB 3G6JE 3RI5K 3QYCA 3LKQA 2E9IA 5JOPE 1UG9A 3HAEA 5FXCH 4G3YH 5C71A 5FYKE 4F7CB 1LE9A 2APBA 1OTSD 2GTWA 2Z8SA 4UV7H 3KPRE 3V0WL 3WXVL 1MCIA 3EYOB 5IGXH 4DJMA 1UZ8A 1MRFH 4I4WA 4Z18A 1CICD 4UT9L 3PCXA 3QHZH 2PR4H 4GRWB 4LAQH 4QF1A 4N8PA 1OAXL 2D9CA 5C0RL 4Y4HC 3EOYG 3HPJB 4M3JA 5EH1A 5KBNC 4W6XB 3D0LA 2Z93B 2AJ3B 4FQPA 4J1UA 5CJQL 5DWUH 2V7HA 4ZAKB 1N5YH 2X4PB 5IM7B 4IRSA 4Z7VE 1AGDA 4S1RH 4PP2B 4F3FA 4XC3H 1CT8A 4GRWH 1QFWM 1JHTB 4HJGB 2GY7B 2BFVL 4XWOC 1FC2D 4P5MA 3GUTA 2K9UA 1G9NC 2AKRB 2FO4A 4PY8I 1N59B 3RWHA 1I8KA 4NNXA 5FO7B 2DDQL 4PTUA 1OGAD 1PEZA 1KN4L 4AM0B 4XP6H 3CVHB 5MEQA 4V2BA 1U95A 4R2GB 3U0WL 4N8VA 3QFJE 2AGJL 5CBEA 3TVMB 1J1OH 3BGMB 2OP4L 5CIPA 1VA9A 2M26A 4NUGL 5INDB 2Z31D 3NGBC 1IFHL 3BE1L 4BKLB 5F1OB 3KHOA 5FO7A 2EDEA 2QQLH 3NABL 4QRQB 4Z7OF 3EJZD 2RFXB 3QRGH 5FO9A 1KCLA 4IMKC 3HUJB 1TTGA 2ZPKL 4KK8D 1J8HB 3BAEH 4YX2H 1B6UA 2Z31C 4HIHA 3P9WB 4KVNH 1HILA 1KIRA 3DUUB 2QR0A 1K8IA 2PYEA 1AKJD 1X5YA 4JRYA 4NQCE 4PJCB 1VPOH 2ZSWA 1HHGB 3MREA 4NZUL 1INDH 1WQVT 4D3CH 3VRLE 1GJIA 2YA1A 3RWIB 1CFQB 2QBWA 4LHUA 4N0RA 2HRLA 5FCSH 3VRJB 1MI5E 3WIHH 2V2WA 1J10A 1IKFL 5T1KB 1CF8H 1A6UH 5HXMA 1DE4A 5E8NA 4OGXH 2VXQH 3W9DA 4G7VL 4OUUA 2NTFB 4TNWK 5GRUH 3KPRD 2XNAA 4ZDHA 1FPTL 5DEGA 4LAQL 3VGAB 4OZIF 5IK3B 3J8F7 5T3XE 4GRWF 5JXAH 4RCAA 3BIJA 4ETQB 5MHSE 2ZUQB 2VDNH 1FBIL 1QOKA 4QU0A 2XKNB 4JG1H 3UTOA 3WO4B 3VXUB 3VGBA 1ED3A 1FJ1A 1FZKA 5D96B 4LSPL 1JFQL 3V5KA 1IARB 3FMGL 4D9QE 2CLVA 4C54A 1QKZL 1NC4B 4PJ8B 5GGRA 3SJVE 3EYVB 4LSDA 1T89C 2X1XR 4YDLC 2CNKA 1FNGA 2J8UB 4GRLD 2WWKT 4X9GA 3K7EA 3MC0A 3MRGB 2NX5D 3T4AB 4KQ3L 4Y16B 3E1F1 4PJAB 4MXWH 2HJKB 1S9YA 2EDYA 3MGTA 2H2SC 2XN9E 1M6OB 4BSVA 4O00A 4H8WL 3U0TB 4U1NA 5C7XH 1ES0B 1OD9A 5TGBA 3TA3D 4F37K 3TF7C 1J1OL 3EFFB 1H15B 1YYLL 3WFEH 3BWUC 2QKIA 1RY7B 1LEGA 3VCLA 1G7HA 1P9MA 3QRGL 1X4YA 1AP2A 3QIWA 3H3PH 3K8KA 2NXZC 3R6GA 2R1YB 2X4NB 4U7MA 1JWMA 3TA3C 1U8OB 1DBJH 1JHTA 2H51A 4U31A 3EOAA 5I8KH 1OAXH 5HJ3A 3HE6A 1FO0L 5M94B 4OM1H 4APQA 1IILE 1MCWW 1NLBH 1LDSA 1P69B 2WANA 3OR6B 1UACH 5MP6H 5IMOB 3UO8B 4ZO8A 3HZVA 1XH3A 6FABL 3D85B 1QYGL 1AD0B 3RUGF 2VDQL 3GB7A 4NOBA 4V1DA 5DFVD 2VDOH 4GKZA 5J8OA 3I2CL 3UJTL 1KLUB 3R0MA 2W91A 3ECBB 1S7QB 5T3ZE 5GGVH 2IAMB 2BFVH 4PJXF 4Q6IC 1A5FL 2EYSA 2BVOB 4TTDC 2BCKB 2NY3D 2BRRL 3RTQB 2VYRE 3RU8L 3PWUB 1J5OH 2AERT 3DUHA 1DANU 1PQZA 1QSFB 3L6FA 4KK9C 4FXGB 2J33A 3DLQR 4GLRI 4PBVC 3WIIL 3GBNL 1W72L 1DR9A 1MREL 4MA7L 4CW1A 2R4SH 4BQBA 1MAKA 2VDNL 3MOBH 4OD3L 1CVSC 4KDWA 3RNQB 5TE7H 4JG1L 2DQFA 2DS4A 5CWSB 1JRHL 3FMGH 4TNVK 2OZ4A 1RVFH 1A1OB 4YHIB 2ADGA 2QJDA 3NABH 3MNZB 3VWJB 1UB6A 2HA1A 3CFCL 5T1MB 1T5WA 1CXEA 2PNDA 5KVGL 5BS0E 5ITBL 3PWJB 4Z7UA 1A8JH 3LOWA 4O2CA 4I18B 3RA7H 3BAEL 4QTIH 1IC1A 2CJYA 3NCFB 2X4OA 4GAYA 1HQRB 4U6XB 4H5SA 4JFYB 2EDQA 3GSOA 3FONB 2QLJA 2FWOB 1E28A 5GS2H 1TETH 1U91A 4D3CL 3HMXH 2PTVA 1KB5H 3OHXB 5SX4H 2GJZA 5E7BA 4DKFL 3VXMA 2X10A 5HHQB 5EOCJ 4JQIH 5CJOL 1H3GA 4N8CL 2XZQL 1ED3B 4N7MA 4GBXC 1XF4A 2VR5A 5B8CC 4AH2B 1T80A 3TT3H 1XZ0B 1NAMH 1RUMH 2ATPB 3I6KB 3JV5A 4NSKA 3PGFL 3I50L 4L9LB 3ARTA 1FZMB 5DHYA 1SJHA 4JPVH 3KPQA 2XWBB 5EO0A 1CQYA 3G5VB 2A83B 3OL2A 4HFWB 1LO4H 3SKJL 4GUPB 1HHGA 2IPTH 1NMAH 1HXMB 2E7BA 1WGOA 5GZOC<