1CVRA

Crystal structure of the arg specific cysteine proteinase gingipain r (rgpb)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
432
structure length
432
Chain Sequence
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GINGIPAIN R
publication title Crystal structure of gingipain R: an Arg-specific bacterial cysteine proteinase with a caspase-like fold.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase/hydrolase inhibitor
total genus 144
structure length 432
sequence length 432
ec nomenclature ec 3.4.22.37: Gingipain R.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01364 Peptidase_C25 Peptidase family C25
A PF03785 Peptidase_C25_C Peptidase family C25, C terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cvrA03
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cvrA02
3.40.50.10390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Gingipain r; domain 1 1cvrA01
4UUJB 4PJ7E 1YEIH 4ODWB 2VLJE 1AQKH 4OIIH 4UTBH 4XNZB 5TFSH 2W9EL 3TYGL 1TJIL 3BYTA 3HR5A 3PWPA 4GW5A 4APQD 8FABA 5KVFH 3GSNL 4P0DA 3QUXC 2CDGB 3TT3H 1WAAA 2F8OA 5CD3A 4FQHB 3F7RA 1NMSA 2VO5A 4M03A 1R3KB 2RQ8A 2BZDA 3O3AB 1AD0A 5T5NG 1L0XA 3G08B 3K7EA 4PJBA 5IBCA 5J12B 3K4ZA 3NAAL 4OQTA 2EO9A 7FABL 2B1AH 2F58H 3MA7A 5DF0A 4XMLL 2VN4A 1MCHA 2AQ1A 4PJ5E 5F1IA 3V0VB 3Q2CA 4Y1AB 4N8VA 2A6KB 4XBPB 4DKEL 1C7SA 3GKWL 3LN5B 4LPVA 5C0IA 3KPPA 4YH6A 1FSKC 5F71A 1RIUL 5EUKB 3UJIH 3MODL 4UQ2A 3U4EA 3DV4A 3AREB 1YEEL 3BISA 1HXMA 4OZHA 4ZPVB 3TLRA 3RWCA 4J8RA 3A6BH 3R8BB 1ZLUK 1WBYA 5F7FA 5L2JB 1RZ8A 1QKZL 4LQFL 2XPGB 1N3NB 1H3WM 4LMQE 2OMNA 4EBQL 4K7PX 4Y19B 3BP6B 1IAIL 3M45A 4OUUB 4QY8A 5ESAB 3W11D 1U8NB 2JJVA 4TRPH 1CXKA 1JHTB 4LCCC 3ITNA 3QIWA 3CFJA 3LKSA 4LSQL 2HRPL 1NAKH 4JPIB 5ACZA 3ORJA 3QXAB 1I7TB 1ACYH 3GBNL 5BO1L 2WWMC 3B9KD 3UYRH 1T1YA 4MNQE 1IQWH 3CGTA 1JYVA 1S7QB 3I6KB 1RJZB 1YECH 1NCWH 4WW1A 2BRRL 5E70A 2CDFB 4LSTH 1IAOA 4HLZH 3WXWH 3NPSC 1KCUH 1OB1B 1VDGA 2DIJA 1EBAA 4ZS7L 5TDOB 1ZA3B 5JORA 1YY9D 3MMEB 2XTJE 2CIKA 4XH2A 2BSSB 1KBGH 3VFSA 5E6YA 3FQXA 3DX7B 5IW1A 5KN5B 3VXME 3V6ZB 5IEKB 1ZTXL 5SWSE 1IAIM 4OGAC 2E9BA 1EX0A 2FHFA 4XBGB 2BY2A 4Y89A 3MJ8B 5CZKA 5HDOA 5ILTL 5TDPB 4FQ2H 3H9HB 4HPYH 1AXSA 3GJQA 1XIWD 2K7PA 3H7BB 4YBQC 3ARFC 1LE5B 1AJ7H 3V5KB 3VG9B 3FQTB 4TTDC 5D70L 3SBWC 1MHCB 4J6RH 1N4XH 3D6GA 4LCYB 4Z0XB 5B22A 3TO2B 5D1XC 3A6CL 1AO7D 2LABA 4KV5E 4DJMA 4Z7OF 5JDSA 5CGMA 2HTKC 2ZOLA 2VXTL 3CFKA 4OM1H 1HXYA 4EQ2A 4ZVRA 3VFUA 3F58H 5CGTA 3WXVL 1PEZA 3ILQC 4S1RH 3V9FA 4NQEE 1CDHA 4KJQD 5E5RB 1SVZA 3LKQA 1CICC 4HUWB 5I9TA 1OGTA 4KTEH 4ZNCD 3O4OB 5LBSL 4DCOA 5K20A 5BS0D 1BF8A 3UC0L 1NBZB 1DQDL 2CNOA 2IQ9H 3EOYG 4YNYA 3B3IB 2GUOB 1GGCL 2GAZA 2VDLL 3MV7E 1FL5B 3Q6GL 4R0LA 3SGDI 3FO2B 4PJDE 4F7CA 4TPRH 3QG6A 4YX2H 1B0RB 3OR7A 5JOFB 1OOAA 3DVGB 3P0VL 5I8CA 1TENA 4KZEH 4L1DA 1J8HD 5TE6H 1BEYL 1MCQA 4P3CH 1U8QA 2JKXA 3T04D 3CUPA 4P2QD 4HWZB 3VFVA 4WDIA 4Q2ZB 2A73A 3ARVA 1XGPA 1RZGB 4OJFL 1G6RA 4P5KB 3LDBC 2DWDA 4NQEA 1MCEA 4QHMB 3FB5A 4M1GL 2DBLL 2BVYA 2V7HA 1Z5LA 3T3MF 2H48A 3IDJA 4MJ6A 4U1LB 1S78D 3IXTA 2XXCB 1WZLA 2I9TB 2F8VA 3WO4B 2L4OA 3ZKMC 1N5YL 5KVMC 1JFQL 2EE6A 5L9DH 5ICZA 4TNVF 2DM4A 5TF1H 3X17A 3TWCL 4XX1E 4P2OC 4YFLF 1I8MB 2DMBA 1NGPH 3MV7A 2BP3A 1BQSA 3WJJC 4MZ2A 3CLFL 1QPXA 3TO4C 1XGYH 1MHPL 2MHAA 5A2IH 1XCQB 2JIXD 4Y4HA 4HVAA 2ZOKA 1KFAL 4GRWE 4JQVA 1IGYA 4RQQB 4RA0C 5GZOC 3ARSA 5I66A 1I8IA 1I1AA 2OYPA 4HJ0D 1JNNH 2DM2A 1TQCC 4H0GA 1WVZA 5DJCA 4W6XB 5DJ2B 1QBMH 5DC9B 5C0CD 1K6QH 1Z9LA 3FMGL 4BFGA 1UM4L 5DJYA 3IDYC 4MSWA 3H2WA 2BFVH 3LV3A 2QADB 1VGEH 3SOBH 4MQXD 4M9OA 4JEGB 1J8KA 5DJDA 1W72A 2CRZA 2VXQH 3SDDB 4WUUE 2OL3A 4PLJC 4PJ8B 1FPTH 5D71H 5FYLE 4O02H 5IVXB 5FHAL 4G6KH 5I71B 3CPLB 2ORBH 4PJFB 2OTWA 4OLUL 1QHOA 1XF4A 3OHXB 5IT2H 4W4OA 2IMNA 4DZ8B 2DQEL 2OSLB 3WHXB 2EH7L 3TZVC 1EAJA 1XH3A 3RIFF 3W2DL 5A2JH 2VZ1A 3F5WB 1LO2H 4HXAH 3MRKA 3BX7C 3C09C 1ULVA 4FXLA 3FO9B 3C2AL 1BBJA 5EU7E 2OX5A 1Q1JL 2X4TA 2FO4A 4DAGL 1P7KB 1IEAB 1ZT7A 5D5MB 1WF5A 4NM8H 5CWSA 3PWJA 1YEFL 3PDOA 3KPQB 5HJ3A 3EBAA 1S9YA 5AYQA 2DL2A 1DE4B 1JF1B 1F02I 3MJ9L 3AY4A 1B4JH 4BH8A 4YHYC 4F3FB 2XQYG 3BHBB 1EDQA 2R2BA 2X4OB 2P2CA 4WUUA 4Z78B 1AC0A 5FUZL 1NCDL 1Q9OB 4YBLB 1OSPL 1R3JA 3LS5H 5ISZB 1K3ZA 1F4AA 1YPZB 2C3VA 2NXYD 3QJHB 4U1NA 4Z95H 4P46A 1AP2A 4EIGB 3CFCL 2HMID 2D0HA 5A1AA 4QRRA 5SWQB 5ID0B 5I1IL 3D39B 4OFYA 5FXCH 4K3HA 5DWUH 2HTLD 3B9EA 3LRSA 3M8OL 3GNMH 3BESR 3NFSL 4BM7A 4XCNA 3WJLC 3NZHH 4FZEL 4HKJA 5DJAA 2YD3A 5ENWA 1L7TL 4XHQA 1J1XH 4LIQE 5BRZA 1MFCH 4GBXB 3VWJA 1NCTA 2DM7A 2EIDA 2OR9H 3LEXB 3T1FA 1BWWA 1EUUA 3GMOA 5EU6D 2QLVB 1IM3A 3HE6B 4YDKH 3QJFB 1CF8L 3CXHK 3NACH 5LU9A 3BP5B 5J57B 1KJMB 1NGZB 1QYGL 2Y36H 3PHOB 4Z7WB 3UPAA 1OCWL 1F6LL 5FKAB 5KVGL 3UTQB 5DUBA 2R4SL 2V17H 3WIHH 2RR3A 4Y4KA 3FAXA 5BVPH 1CIDA 4LVNB 1SBSH 1J11A 4BYHA 5C6WH 5DHYA 4TUKL 2E3VA 1RI8A 4XVJL 1CGUA 1KCSL 3PWVB 4EVNA 5GGVY 1NAML 1MH5B 4A2LA 3LIZL 1NFDE 5D93B 1FYHB 4JZOA 3ROOA 4MNGB 4ONFH 4GMSH 3AAZA 1A9EA 2NX5E 1R0AL 2ADFH 5KZCB 5SX4I 1JGLL 1OSZA 4MX7A 4D0CB 2IFFL 1BZ7A 5AG8A 2GJ6E 2I25N 3QNWA 3R0MA 2EDHA 2WUCL 5DMYA 4MJID 3BAEH 5ANME 5D9SA 2CNKA 1KCKA 2NY6C 3VGHA 5DTFB 4RNRB 1MRCL 3EGSA 1MQKH 3SKJH 2A6DA 3U7YH 4PJCF 1TJGH 3L1OL 1YQVH 4MAUL 1BMGA 4NO0D 5H35B 4X9IA 1QBAA 1I8KB 1X5XA 3RWJA 5FF6B 1FNSH 1RJYA 3JSSA 2DMKA 5D1QD 1T80A 5DD5H 4FP8L 5EBGA 2PXYD 4OI8A 3GBMH 1RK0A 1T2QH 5D2NB 1D5IL 4RWYL 2XRAH 1NFDA 2YD7A 4MDJB 3TN0C 3KYMA 2BNRE 1BIIA 4PBVC 3RBGA 2H65A 2PR4L 4S1SL 3RL2B 5DRZA 2GJ6A 1P7QA 5C8JA 2WLYA 3QA3B 3EYFA 4G7VH 4TSAL 4LRNL 1IFHH 3FB8A 1LO0L 1CR9L 1FG9C 1NCBL 3EUUA 3MCKB 5GHWL 2XT1B 3WEXB 4TNWF 1C16A 1S7RB 3UDWC 3WSQH 2A83B 3PJSA 3V4VL 4CVZB 1E0OB 3QUYA 4F9PA 5F6HJ 3RL1A 2VQ1B 3NR2A 2NNAA 4PGEB 2WBKA 5EC2A 1KB5A 5DQ9B 5GRUL 5T1DL 1WT5A 4QRUA 5AAMA 4M7LL 2FSEB 1NGQL 3QQ9D 5DR5H 4X4ZA 5D96B 1U2CA 2FZ3B 1MQ8A 1T03L 3HHRB 3QFDB 5IB3A 3O6KH 3VFPB 3G6DH 1ED3B 1KPUB 3MXVL 4HK0B 2DQUH 3VFGL 3JTSB 4LPCA 3T3PF 4XB8A 5FEBA 3RVTD 2VERN 2PETA 5IV2B 1G84A 2ZSWA 4JCMA 4X98B 3RKDD 5CUSH 2BNRA 3TBTB 1J05A 2AK1L 4UNTA 3T3ME 3C87A 4JY6B 4F33A 3GJEA 2PNDA 3VG9C 5HHOB 1HI6A 2Q76A 4MD5A 1WWAX 1YYML 4GW4A 1T3FA 3O3EB 3DMMD 4LSVH 3BDXA 5IEHA 1BGXL 1SJHA 4QUEA 3JVGC 2EIEA 3INUH 4FRWA 4JRXB 5KW9L 3KLSA 5HVWA 4TULH 5CEZD 4JFEE 1QFUH 1PY4A 5T3ZE 1HEZA 4KK5C 2ZCKL 4Q9RH 2Z35B 2AGJH 1DN0B 4KZDH 3DUSB 3L3OA 5DGRA 1SC1A 2Z91A 5DMKB 4U1JA 4GKOA 4R4BA 2QLFA 4PJEE 3RA7H 1VESA 3KG5A 4G9FA 4F57H 4YAQA 1FG2B 5LQBL 1KIPB 3O4OC 5TQ0L 1K8IB 1IQDA 3F12B 3HMXL 3IJYA 4UIMB 3UBXG 3W39A 3K46A 1AGDA 4HFUL 2SEBB 2DTML 3HS0A 3NIDF 1BP3B 3H8NA 2HFTA 4BSVA 5F8QC 3U1SH 1MCSA 3CC5A 1EVTC 4I77L 1UB6A 4KRPC 1G7JA 5CZXC 4WV1A 2NTFA 2CJUH 3IVKB 4PRDA 3KPSE 3VRIB 3GBLA 4XP4L 2FIKA 4HPOH 4WI4A 2CK0H 3QWRD 1WTGT 4XAWL 2IH1B 4QOKA 2AJUH 1I9JH 3P9MA 3WS3A 2VLRE 1OTTC 2P5EA 3X3FL 1CT8B 3PP3K 3HR6A 2N56A 3MOQA 2Y07L 3QIBB 35C8H 4AK1A 2F74A 3FB7B 3QULB 4LLQB 1OAUL 1RZFH 3LHPH 4PJEA 3G6JA 1BZQK 1R5IB 1JZ4A 1YJDL 1TCRB 4JJEA 3UTOA 1GZPA 1FAKT 3BUYB 2DKUA 1IGTA 4NNYB 1DN2A 4KKLD 1IKFH 3QDGD 1FL6A 5CHNA 4F7TA 3S5LB 5CZVL 3H11B 1QVOB 1NAMB 4XPHH 3W9DB 4JFDE 1Z3GH 3G5VB 1AI1H 1TTUA 4NRYB 1CFSB 1F6AA 2VXSL 4HWNA 4YHNA 4XP1L 3CH1A 4A6YH 5IW6A 4YK4B 5FCUH 5DJ8A 4JN2A 3KPSA 1D5XA 4DQOH 4PJ9B 1U8JB 5IQ9A 3P30H 3RJDA 3KPTA 3KYKL 3MXWH 3DV6A 3A67H 4X99B 3AS3A 1IT9L 4V1DA 1WLHA 4KROB 5F7KC 5DUML 2BY3A 2ZUTA 1T66D 5FOBB 2V9QA 4J3SA 1RPQA 3V6OE 3T0EE 5D7IB 2DI7A 4TVPE 1A0QH 1UVQB 4XNUL 1RAMA 1IC5H 2EE2A 3S96B 3NCJH 1A6VH 4R96B 3VFNA 2CQVA 3EOAB 4OB5L 4NNPL 1PBYA 1ZLWH 5T1LB 2D0FA 5IMLB 1DANT 2VMFA 1ZGLP 3IFOB 5LUAA 4ZVPA 4PREA 5E4EC 5I71C 2FD6L 2P43B 3IFPB 2QHRH 4UAOC 1U8HB 5F70A 3RX5A 4ZAKC 4X4ME 1A1MA 3ZYOA 1QBLH 5E24E 3KPRE 3V79C 2N1KA 5FK9B 1L0QA 2E6QA 1A6AB 4MB4A 2H32B 4OGXH 2R2HB 4OM0H 4XCFH 4TUJB 1S9VB 1I85C 1CXHA 3SQOL 1A6PA 2UYLB 1F9EA 2IG2H 3C5SB 4YE4L 3EO1A 1FZKB 1NW9B 1U3YA 4JG0L 5DMJB 4IRSD 3T2QA 3NH7H 4BQCA 4JJ5A 4JB9L 4M1DL 3UJTH 5D8JH 1D5BB 3U46A 3LMJL 3BZEA 1JK8A 4NC1C 1UJ3A 5DEGA 5INCA 3C6SA 3WFDL 2V2XA 3RJQB 3ROLA 3BZFA 3GFUA 2OJZH 1NLDH 4M48L 3BSZL 3HI5L 2DD8L 4JJHA 5IR1A 4IRZH 4DGVL 4Z76A 3W0WD 2NY5H 1NCAH 4I18A 2VZUA 4PRPE 4ODVL 4DN3H 5KSAD 4YBLC 1F4XH 2W38A 1T1WA 3WD5L 1T0NB 5C07D 3AMLA 4XPGH 3KPRA 4NBYB 4QTIH 3RVVD 5F3BB 3C5ZC 4YHKL 3VXSB 4GXVL 2R0WH 2AAVA 4U6YA 3RTQA 3MGAA 1FFOB 4PJCE 4QUGA 3HAEB 4OKVA 2C3XA 2ITCB 1HH9A 3MLTA 2NLJB 3GMRB 3O8XC 3OKMB 4L1HA 4WNQA 1KGCD 2EKSA 3QQ3A 2O61B 1T04A 3CX5K 1ZLSH 5T33H 3VWKD 3MRQA 4FXKB 1P6AB 4PLOB 3QO0A 3CXDL 3VU2A 2FGWL 2BMKB 4G43A 2Q3AA 3WE6B 4HQQH 1U91B 3V4PH 2FWOB 5KVEH 3MBXH 1OP3K 5GGVL 5BXFB 3ARDA 4RX4D 3QUXA 1Q0XH 5EORL 5ICXB 5CKGA 5DQJB 3VG0L 5E8OB 1S9WA 2ZUSA 4WY7H 5L0QC 1MF2H 4U6XB 1SC3A 4PJGE 4KAQH 1KSRA 1M7IA 4P3WA 5C0BE 4PIRF 5J1AA 4U1SA 2DQJH 3QUZC 5HYFA 3VD5A 5I1GL 4PJIA 3MR9A 4PD4K 1QSVA 4LLAA 2YRPA 3KLAA 4E9LA 2WIIA 2W0FB 5BOZG 1XZ0A 5D2LB 2VZ3A 3ARTA 5LGHL 2H2SD 4QTHA 4JREB 1OARL 1HWHB 1AGBA 4YXKL 4G8FA 1P4IH 2X1QA 4LASH 2Q8BH 3MLRH 5M94B 5JZ7D 1RZKL 2DQDH 5DRWB 4QRSB 4KMLB 1QNZL 4P5TC 4QU8A 3T3PE 3QYCA 4WHYH 1HQRA 2D7PA 5I73B 1JRHH 4OCWL 3I6LD 4NUGL 4D94A 2HG5B 5FB8A 3HZKB 4I48B 4LARH 3IS0X 2NY0D 4TUOB 1CL7L 1KCVH 1CLCA 1Z2KA 1EFXB 1P84J 4PP1C 4Q9QH 5C0BA 5IAGA 4KJYA 3MACH 4GMTL 4LCCA 3O4LE 4X6FB 5HYSG 3D2UA 2CR6A 4X7TB 2R15A 5EA0L 1MCPL 2XA8L 5DURD 2VXVL 5DJ0B 3LN4A 4KJWD 4JFPA 5INDA 3ULVH 4PGDB 1MFAL 2X09A 4Z0BL 5JW5B 3QDJA 1QSED 3OKNB 4RMSA 3BMWA 1TVHB 3WUZA 4DGIL 4G7YH 2AJSH 4NZRL 3SDAC 4WWKA 3JBG7 1ZT1B 4JHZA 5IGXL 4OBRA 1DL7L 2HVJA 3C08H 4FTVE 1ZXQA 4PRYA 1HHIA 5HGHB 1V7NH 3D3VE 5KJRH 1XFPA 3AU1B 5TGBA 1WWWX 2I07B 3QFJE 4HWEL 1Q0YH 4KMTH 1YMME 1TNNA 3Q5OA 3TGXA 1XR8B 4APQC 1FFPA 2OP4L 1MPAL 2R39A 3GHEH 5HHVL 1FRGL 3QEQB 1MRFH 1QRNB 4Q6YA 3T65B 1WFNA 1A7QH 3OPZL 5FYJH 5L2KA 5HGDA 1ZSDA 1CZ8H 1OM3H 4NQDD 3GSVA 4M6AA 1MNUH 1G9NC 3BXNB 4OD3H 3X12B 1A6UH 1A9BB 2WUBL 4XRCB 2J88L 3ARUA 2WBJC 5C08D 4O2CB 5CCKH 5FO8B 2AEQL 4X7EC 3QIUB 1S7VB 3QXVA 3SBWA 3HNTH 4GQPH 2F19H 3T0WA 1YEDB 5JHDE 1C12B 2VLKD 1A6TA 5JLZA 4OCXH 4CW1A 5DHXB 3LKRB 5D1XA 1JP5A 3TESA 1S5IL 1BD2E 4XC3H 5I16A 4JFFE 5TDNB 5I0DA 2DIAA 1IC7L 5CEZH 3D25B 5L6YL 1S9XB 1X5FA 1WCBA 4Y5XC 3VE0A 3ZKND 3NFPB 4FTVA 1VEMA 3D3VA 4OBSA 4AEIH 2ESVD 4ENED 1CICA 2NZIA 5B4MD 4HF5L 1JGUH 3MRHB 2EH8L 4KFZC 4KQ4L 5IB4B 1HK6A 2CO6B 5EOCH 4K3DL 1Y6NR 4KKAD 4F15B 1JPGA 1QPPA 2JCCB 2Y6SD 2DQCH 3QNXA 4R7DA 4J2XA 1X4ZA 4OFIA 2R0LL 3W11C 3C8HA 1P4LB 1XGTA 3O11A 4PRHD 5EZIH 4IIQB 3DVNB 4NRZA 3VFOA 2AK4B 4JZJC 3ZYZA 3TP4A 2D03H 4IHOB 3HRZA 3P4MA 3D0LB 5JHDA 1WIPA 3EAKA 3FQUA 2VXUL 1FYTA 4ESKA 1F58H 2CSPA 5KZCD 2FYYA 3ILPB 2ZUQC 4UOW1 2DB8A 2YK1L 2A9ML 4WFEE 1KTDA 1HSAA 2GFBA 1WK0A 4KVCL 5EIIB 2NTSP 2R1XA 4GFTB 3I3BA 1G1CA 2ICEA 3PQYE 1FZJB 3P73A 2VN7A 2BVOB 3MNZA 4UIKL 1D5ZA 1YY9C 3MA9H 1FCCA 3O41A 1E6JH 25C8L 1NUNB 1U95A 3JV0A 4UILL 5I2IA 1OGAE 3P0GB 3KPOA 4C56D 4QT5B 1QLRA 3BJ91 4NZJA 2G60H 4P2OA 4NKIH 2CLVB 4LVHC 5K9QI 2DQTH 4WU5A 5JQ6H 1XIWC 4S11A 3WJJA 3GSOB 4Z7QF 2VDQH 4U31A 4D8PB 1CL7I 3KJQA 4PTTA 1NDMB 5FA3B 1C1EH 1Z6JT 2CR3A 1F4WL 2BY1A 2NY3C 4U1GB 1GHFL 2XKNA 4FA8A 4Y4FB 1U8PA 4HQRA 3MLYL 5GGRA 3RVUD 5A2FA 2XOTA 3K74B 1K5NB 5GRXG 2D31A 4RFOH 3G6AB 5I1DB 2DWEB 2WBWB 4BFIA 5CILL 2H54A 4NHUB 4U1HB 5IB2A 5FYKH 4AL8L 2UZIL 4Z7VE 5BZWB 2VDRL 1LO4L 4JHBA 4ELMB 4KJQC 1SY6L 3PL6B 4L4VD 4GQ9L 4LBEA 4AZ8A 1C5CL 3PQYA 3V0WL 3EO0B 3T1WA 3EJYD 4NHCH 3O2WH 3MRFA 4MDIB 1JL8A 4PJ9C 4C83B 1E4WL 4XPFH 4WEMB 4R97B 4EOWH 3V55A 1U8MB 2JK5B 3UMTA 3VXNB 3O45B 1OGAA 2V2TA 1KJ3H 1KPVA 5CEYA 4AT6A 1MEXL 1ZLVK 1NBYB 4H88H 4ETYA 1JZ2A 5FGBC 3WCYA 1MFDL 2MKLC 2FEDD 5C09E 3ZKXB 4ZUSB 3TZVA 2ZG1A 1T22A 2HLFD 4D9LH 4EJFA 4NM4L 1WIUA 1IJ9A 5I76A 4ZXBD 4ZTOH 4JJ8A 5MERA 2PUQT 3T77A 5TH2B 5C9JA 5FM5O 1GZQA 1F11B 1RZJH 2H1PL 3SY0B 1Q94A 4LNRA 5IVXF 4HLJA 1U3HD 4PJFF 1V7ML 3H9SA 3QZWG 4RIRA 4UT6L 2OTPA 5FGCE 1ND0A 1S78C 1FL3B 4HS6B 2RFXA 4EI5B 2IALA 43C9A 1J0HA 1RHHA 1DEEB 3QHZL 3LQAL 2Q8AH 3TVMD 2PTUA 3TBSA 3H7LA 2EDWA 4R8WL 3VXPB 5CP7B 3BN9D 5DJZA 1BJ1H 4HH8A 3BUTA 3HG1D 3E1F1 1RHRA 5MI0C 5FGSA 1N26A 3M07A 3SJVD 2OTUA 2YD9A 5LUBA 4MHHI 5D5MF 1PYWA 4JB8A 1MWAH 4XGZA 4MQTB 5A2KH 1G7IA 1JWUB 4O5LH 3L5XH 4NQTA 5KSVB 1Q9KA 3ARYA 1F4YL 3QPXH 4B41A 5KTEL 1H3VA 5E8PA 3QEHA 4ELKA 3RZCD 1J9CT 4OF6A 5BJTA 1XGUB 4HJ0C 4HKZA 5JHLL 2F53E 4QTYA 4YXLL 3MLUL 5FUCC 4H1LB 3SE9L 1HINL 3UTTD 4Y7MA 3NCYP 5MENA 1PZ5A 2H26A 1E4XL 4XNQB 1B4RA 4NSKB 3CSYA 4C55A 5BVJB 2PW1A 1YPZF 3SKNA 3WFZA 2Z4QA 4HFWB 4HIEB 4M3JA 3KJ6L 3TYGH 1RURL 2V7NB 4MQXC 4CUCA 3HC4L 3OXSB 1UFUA 4DWHA 3HFML 1LP9A 1XMWA 1B0WA 1NMBH 3MRDA 1TZIB 1WIOA 3E6FB 3KWWA 5HGBA 5EBLA 4GKSB 3NAAH 4LLWA 1AXIB 4GAFB 1D7FA 3L3JA 4U0RC 5J4MA 1GJIA 1UACH 2DQFA 1E4KC 1LK2B 3GKWH 4LCUA 4LEXL 4FABL 3UO8B 1IGFL 3ZLQC 1ZHKB 2C1EA 4K9EH 2R4RH 4NT6A 5F1OB 1T5WA 1RIUH 3QBTB 3BIKB 15C8H 4R4ND 5D7LA 1M4KA 1XCTB 4JKKA 3GMNA 4FMFA 4MS8D 4HIXL 3IDGA 4X7SL 4LHUD 2VISA 2B39A 2Q6WB 3RGVD 2FBOJ 4QWWD 4MB5A 1BIHA 1IAKA 4Z7WF 1NBQA 5T5FH 3EYOA 4K3GA 3I6GA 4ZVSA 4WCYH 1AFVL 1QA9B 1NEZB 4X6BA 1QKZH 2PYEA 5A16B 4LPYA 3UTZA 1KEMH 5D1ZD 1X5YA 4EBQH 5HVHC 3GGWB 1DQLH 2XZCL 4JM2B 1ONQB 2C4FU 1NGWB 3GRWH 5EU5B 1DBKH 2YD8A 4U1KA 5I1EH 3DEIA 3R7NA 2VUOA 1CE1H 2NXYC 1I8LC 4XPBH 4WHCA 1Q9LB 2YHGA 4UU9A 3AVEA 4YXHL 3LD8B 3C60D 3L5JA 5BO1H 2AEIT 3QI9D 3DSFL 3DECA 3QNYA 5T1LD 3VGBA 5MEQA 5IBTH 3DXAD 1MWAB 4XMKL 2XICA 1SJXA 1T21B 4HS8L 4GLRH 2HTLC 4KDTC 1BLNA 3SO3B 1KTRL 1JWSB 3TN0A 3TNNB 4PG9B 2NY5C 3O6LH 4P2RA 4LF3A 3GJSA 4G6FD 1QDUA 3EDJA 5EU4A 2EIZB 3AGVA 5DK2B 3GMPA 1T1XB 1NPUA 5CJOH 3LEYH 1DFBH 1ZVYA 1ZTXH 3BZ4B 3UDWA 3O3DB 3EJJX 5ILTH 3TBYB 3S8WA 4OV5A 1I1YB 1UH2A 4HUXB 3IKKA 3VXTB 3W5MA 1OHQA 1Y0LB 3GI9H 3I02B 2GJZA 2GHWB 4P4KB 4U3HA 4RGNB 1RY7B 4X7CC 2C1PB 3OKOB 1KIQA 1K85A 1CP3A 2VSCA 4M5YL 3DETD 4NCDA 1H0DA 1DDHA 2H6PB 3A6CH 3K1DA 4NDMA 4G8GB 4M6OL 5KVDH 2DICA 5D72H 4FQLL 2P45B 3SDCD 1W8OA 3RUGE 3O0RL 1HNFA 1G9ML 2ZCHH 5EN2A 4DEPC 4GLRI 1T5XA 3HNSL 3IFLL 4RAUB 4NQCA 4IS6A 3WXVH 1N7ML 4LCWD 2YUZA 5DMIH 3VJ6B 5E1AB 2XA3A 1X6NA 2CPCA 4NWUL 1JF6A 4YWGL 1IAMA 4IDJH 5LBSH 2WDPA 4AENB 1SM3H 2X4UA 4J3TA 4UT9H 3KXFD 3JVGA 2HLAB 1BOGA 1DQDH 1QSFB 1QLEH 2G5RA 4L4TE 2GK0A 2MPAH 3WO3B 1GGCH 5FFLA 2APVA 4KMQA 4WHYG 3O6FD 2VITA 2QSCL 2X4SB 3QAZC 3Q6GH 3UAJD 1D6EB 4LSZA 1R5WA 1EMTL 3AC0A 1NCCL 3BQUB 3J7HA 4RRPG 2NCMA 4GKZB 1ZLUH 2EEDA 3PP4L 5D1QC 1A5FL 4ONHB 2QSTA 2PXYC 4LLDA 1N6UA 4PRAA 43CAB 2P5WD 3PHQA 4MQ7B 1Z9MA 2E6PA 1UQSB 3VDCA 1VEPA 1G6VK 4LSPL 5HHMB 1DBAH 3RUGA 1UCBH 4OJFH 1QLFB 3TH2T 3K8MA 3VXUB 4K3EL 1X44A 1K4DA 4YDVA 2VE6B 1CLYL 5GXBB 1J1PL 4WU7A 3UBXA 3ES6A 2P8MB 1BFOA 2QQNL 5BZDB 2A6IA 4OQTH 1C7TA 4WENB 1N5YH 1HN1A 2AV1A 4LPWA 4HJJL 4L4TA 1SJEB 4BZ2H 3MV9B 4HD9A 5FA4A 2BCKA 1HWGB 1C8PA 2WINB 1VADA 1XF3B 3KPMB 4WFFE 4KUCF 2C7UA 3JWDH 2JF1A 1MHPH 3FZUC 4NBXB 4ZNEA 5GSVA 3C8DA 2FX7L 4I1RA 2BOCB 1KFAH 1LGVA 4PR5B 1RULH 4QHKI 3RVTC 5HGAB 1NC4A 1S8DA 3BO8B 4CMMB 4E41D 4F58L 4HJGA 5SWZE 1DUZB 1MREL 2OZ4L 4LCIH 4R90L 4XXDA 3RY5A 4EHKA 1EO8H 4PJFE 4UDTB 4X6DE 4X8XA 5IJKC 3MBED 4JDZA 2PW2B 1W2KT 2Q7YB 1DQJA 3DURB 1I1RA 3GMMB 4U1GC 3DMMC 4OIAA 4QHLB 2VABB 3DX9A 4YPGA 3KYAA 2YSSB 4G8IB 1JPFA 4JO1L 3O3BA 1DQML 1MJ7L 3SE8H 1ES0A 1WEJL 1CS6A 2G9HA 4N1EA 2NW3A 1TZHB 3EYSH 3T2NH 1D6VH 4N6NA 4OLUH 2JELH 1FJ1B 4LPTA 2A2QT 3B43A 2DQEH 3S88H 2IGFL 3MRLA 4FFVD 4X80L 2OBGA 4NC1E 5F72S 3NOIA 5BV7B 2VZVA 5IKCB 2O5ZL 4LHJB 1U93B 5LG1A 1M7DA 4QF1A 2VDKL 2R0KH 3DPBA 3C2AH 1ITCA 5J6GA 4ISVB 3ZE2F 3JWOH 4DAGH 1CXLA 5C86A 1G7LA 4BSWA 4DGYH 4O2FA 5AYUL 1KG0A 4DVRL 1BQUA 3PWPB 4GW5B 5FO7A 8FABB 4ZAKA 5GQBA 1EZVX 5KSBA 2LFGA 3ZE0E 5CD3B 5JO5A 5GGQH 1QSZA 1F42A 3L95A 1AD0B 4W6YB 4PJBB 4KK6D 3BP7A 1X5ZA 4I3GA 1G0XA 5EO9A 5E7BA 3WFHB 2IPUK 5JMOC 1I85A 3DNKA 3MA7B 4MAYC 4NBNA 3P0YL 2DS4A 4HXBL 5FUZH 2F5BL 3WL9A 4N8VB 3MFFA 5C0IB 3KPPB 4PB0L 4OZGE 2UZXB 2GCYA 4PRID 5CSBA 5I1JL 4OLVH 3E3QE 2YXFA 3NZ8A 3UO1L 4BQBA 1URLA 3DV4B 2AEPL 4HWBL 5I1IH 2AXFA 5E4IA 4OZHB 5EZLA 3GK8L 4KKLC 3RWCB 4J8RB 1NMCB 5FV2A 4QUJA 1WBYB 5EDXA 2JB5L 4FZEH 4Z7WE 5EIVA 1L7TH 5F7WC 3PG2A 5HHXH 1RZ8B 3JWNC 2BC4A 4GRMA 3DEHA 4EIZC 3VD7A 3VXQA 1QD0A 4LMQI 1KIUA 2LTQC 2R8SL 3C5ZA 4QY8B 5IHUL 3FT4A 1MCDA 4GXUN 1CF8H 3QIWB 3CFJB 3LKSB 1AKJA 5J7CC 4OGYL 5JR1L 3BEWA 3O8XA 5ACZB 1QYGH 4YHMH 4GO6B 3ZZ1A 3MLZL 3DBXA 1OCWH 1T1YB 1KC5H 5KVGH 1B88A 1QACA 4OZGA 5KAQF 2R4SH 4MA8H 3KLHD 1SHLA 4JPKL 4PGBB 5ADOL 2P24A 2R2EA 4WW1B 1BBDH 1OAYH 4JHWL 1YEKH 2RCSH 4LVEA 4F8QA 1JXQA 3LIZH 5HDQL 2CLRA 2NY1B 2ATPA 2VLLA 3RP1A 3P4NA 3OMZA 2BX5A 2B4CL 2E7HA 5JORB 1XEDA 2X4RA 1PKQA 5D7IF 2CIKB 3NFNA 4XH2B 3VFSB 3FQXB 4XWGL 4YBHA 2ZPKH 1DVFB 5IW1B 4HV8B 2IFFH 5FYLL 3QUZA 4G6JH 3DI3B 2ED8A 5K9OA 2V5RA 5FO9A 3AB0C 2ZNWA 1QUNA 4PG2C 5D2NE 3MLVH 4MJ4A 4HUMB 1TQBC 1MRCH 2QBWA 1KEGL 4HUUA 2EEAA 2J4WL 4JPWH 4LSRL 2EDBA 2CKBH 3L1OH 4MAUH 1TTGA 4MNQB 4NUJA 2A1WL 3OXRA 4KDWA 3ZSTA 2HKHH 5C0AA 1RZJC 2W65A 4IRSC 1KN2L 5JDSB 3WFCH 2ZOLB 4DUWA 3CFKB 2HH0H 5FIEA 1HXYB 4P5TA 3V52H 2YEZA 2HBZA 3VFUB 3MZTA 5EC1A 5EH1A 3EFDL 3MRJA 3OAYH 5DA4A 4ZQKB 5IB5B 1U9KA 4NO3A 3RWIA 3S37X 3WIFA 3VXRA 1UEYA 3CFBA 3LKQB 1FAIL 5FHBH 1VGKA 1OGTB 1RHKA 3HNVL 5JW4R 2XTJB 3K1KC 3OSKA 4FFZL 1MCOL 5ITFA 5D2LF 5KSAC 1R5VA 5CLTA 2A74A 5DRXA 1F4HA 4YNYB 4TSAH 2OL3H 2D0GA 1IGJA 2GAZB 1J86A 4P9HH 4QNPF 5I15L 2VQTA 1PLGH 1CR9H 1NCBH 5HSFA 4R0LB 5I1LB 4F7CB 1KF9B 3F6IA 3QG6B 3OR7B 3V4VH 4K94L 4HKBB 4DN4L 5HYSA 3DTXB 2LAGB 4YDIL 5I8CB 1HIML 4M7LT 4OF7A 3SDAA 1RUML 5FDWA 3VWKC 1NGQH 1U8QB 1FNEA 3CUPB 4RGMC 5HYQA 1LDPL 5HHOE 4LIQL 4WDIB 4Z9KB 3ZT5A 2A73B 1XGPB 4DVBA 1G6RB 2J30A 4N8CL 1JPSH 4L5FH 1CDGA 3VFGH 2DWDB 4NQEB 3FB5B 4APQA 4JRXE 2V7HB 1Z5LB 1ZEAL 5IJVA 3IBFA 3GIVA 3IDJB 1EGJL 3CSPA 4MJ6B 5HI5D 3P4OA 3IXTB 1IE5A 2YZ8A 4OSUL 4Q58C 2NW2B 1LWRA 5ICZB 3QDHA 4U6VL 4P4KC 2IPTH 2CGRL 5EUOE 4PGJA 3B6SA 2HA1A 1YYMH 5F3HA 3TA3D 3MV7B 2EECA 2YS4A 4ZUUA 3QXDA 4PUBL 3WFEH 5KW9H 4TNVK 2H2SC 2MHAB 4X83A 4Z5RB 1AGFA 4Y4HB 2GTZA 3BT2L 4Y5XA 2ZOKB 3HE7D 4E42B 1TVBA 4P49A 5C0RL 1P4BL 5JZ7C 2X2YA 3FO1A 3Q48A 2QR0A 4FG6D 5I66B 1MELA 2FX8H 2H45A 1I8IB 1I1AB 4OCYH 4I5BB 2GSGA 3HMXH 4NO5A 5DT1H 2NY2D 1HHHA 4KHXL 5DJCB 1DBBL 4JY4A 1AQDA 1TIUA 2O5YL 1WUNT 1R3IL 4HFUH 2NY0C 3R7SA 1CVRA 4JFZH 1LEGA 5DJYB 5K59F 4MSWB 3LV3B 4FZ8H 4Z18A 4ODHL 3DRTA 3P11L 4JZJA 5DJDB 1W72B 2DDQH 2OL3B 4HS3A 4KJWC 5D7JD 5CBEA 5F7MC 1P2CA 4F7PA 4NKOA 3B9KA 3SGJC 2OTWB 1QR1A 1XF4B 4CAGA 1KCRH 2A38A 1MLBA 1T1ZA 5JOPE 2K7ZA 4ZOAA 1YNTB 5TQ2L 4ZFGL 1JHKL 1XH3B 4X6CF 1GGIH 3S4SG 3QDMD 1MHEB 1QTYT 4GRWB 4M1CC 1LMKA 3MRKB 4N8PA 4ALAH 1BBJB 1OAUH 5GS1A 2X4TB 2FO4B 4R2GB 1EEZB 4IYRA 3WDJA 3B9AA 2J5LB 5HDLA 3RX7A 1ZT7B 3X3GH 4HUVA 4RGOL 3ZE2E 1KXTB 2RHEA 5HD8D 2E7MA 3L3IA 5CWSB 2BJML 3PWJB 3PDOB 5HJ3B 3LN9A 3ULVF 2KZWA 1S9YB 4Q0XH 4ZD3L 1EXUA 4HMEA 5C1MB 3P3YA 4BH8B 4KY1L 3BH9A 3OKLA 2DLTA 1XIWA 2ADGA 3R1GH 1P1ZA 2R2BB 3DYMA 2XNAA 3FL7A 1YY8A 1TZGL 4WUUB 5I1CH 2BVTA 5CINL 1RFDL 1JBJA 4WTZG 4FOMA 1Z0MA 4I13B 1KENL 1X5GA 1LDSA 1R3JB 2W59A 2F54D 4DFIA 1AO7A 1J8HE 2C3VB 4GKNA 4I0PD 5DVLA 2J3SA 3MO1A 4U1NB 3QCTL 4YHLL 1AP2B 2I5YH 3E8UL 1A7NH 2V9RA 3DX8A 5DO2C 4TQEL 1GH7A 2DF3A 3NVQA 5DUMH 5ESVA 1V5JA 4QRRB 3ZKNC 4HKXA 1N0LA 5L88L 4N9GA 4S2SA 3LRSB 3CVIH 4ENEC 1MSPA 2QV2A 3JUYA 4XCNB 3WUWG 1M6OA 1XGQA 4HKJB 1FZOA 5DJAB 5ENWB 3BE1L 2O93L 3WNPA 1J87A 5BRZB 4NNPH 4KKAC 4PRBA 5BS0A 4EHNA 3VWJB 5J1SC 4GW1B 1GGUA 2Y6SC 3L5HA 8CGTA 3T1FB 3GMOB 4GAGH 4MQSB 5LWYL 4AMKL 1AHWC 5KS9E 3BPCA 2EC9U 5T3ZL 5EG6C 3W81A 3FHQA 5FGBA 3DUUA 4PY8I 5DEZA 1KB5H 4ELMF 4D3CH 1QRKA 3VI4E 5C6PB 4OF8A 5DUBB 1J8HA 4NZTH 1XT5A 3SQOH 5MEPA 3AMKA 4P2QA 4Y4KB 3LCYA 5DHYB 2GITA 2IBZY 2XV6B 2YC1A 3IFNL 1MI5E 4EVNB 2MTPA 3A0OA 3NA9L 3QRGH 1S5HA 5HYJE 5C0CE 4JZOB 5I9QB 3ROOB 2AI0H 3AAZB 1A9EB 3WFDH 1YMHA 4M7ZB 1FGVH 1DCLA 4N8VG 3VXSE 1YNKL 2MFNA 4M48H 3UROR 5D7IE 3WFBL 3PP3H 3QZWA 5IBPA 3VRJA 1KJVA 3E2HC 5D9SB 4R26H 4ZTPL 5ALCL 3HI1A 5KS9A 3WD5H 3JWDC 2FNBA 3EGSB 1CFTA 4M6NL 1FCGA 1RUQH 3QEUA 1DLHA 2A6DB 5K9JL 5AD0A 2Q3ZA 2HT3D 4RAVA 2JIXA 2B7DT 5F7DA 3CDGA 3D6HA 3HI6H 3RWJB 1RJYB 2JE8A 1NMCC 4DKFL 5D6CA 3NIFF 1AY1H 5E6ID 1SYVA 1A6WH 1RK0B 1FBIL 1B0GA 4HK3J 4LGRB 1UZ6E 3VI3E 1MFBL 1NFDB 2WV3A 1P84K 5C0CA 4WUKL 2Y9RT 5IFAL 3EJYC 3KYMB 5ECJE 1BIIB 3MLXL 4U1IA 4XVSL 5DRZB 4X4YA 3F7VA 3V7AG 2GJ6B 5HVGB 1P7QB 5C8JB 3EYFB 3CXHJ 3HB3D 3VG0H 3FB8B 4AQOA 3IRZA 5IP4A 2R2CA 4EN3D 1H3TA 5FM8A 3TPKA 1C16B 1KXVC 3WKML 3PJSB 5IFJA 3QUYB 3W82A 3B5HA 3RL1B 3R7BA 2FEDC 2NNAB 5EC2B 1KB5B 2HLFC 2J8UF 4N7MA 1E4KA 3RQ3A 4QRUB 1DLFL 1VHPA 2Y06L 4TVPL 3N0PB 2NXZB 1L9NA 2W0KA 3RAJH 3NCEB 4ZXBC 2CD0A 5DJ6A 5IB3B 1T83A 2FEEL 2IAMD 3JWOC 1HQ4A 5E8NA 1TJHH 3RWEA 1RZKH 5F7UA 1DBMH 4LVOC 2ZSWB 4D9QD 3HC0A 1W0VA 3OQ3B 3KHOA 2BNRB 1R24A 1J05B 3RWGA 4GAJL 5EU6E 3CDCA 3U30B 5F9WB 2CNLA 3IKCA 3QRFM 3WLBA 4F33B 1NC2B 3ULUH 1HKLH 2EDRA 4L8BA 1FORH 1ZHLB 1HI6B 2FBJL 2Q76B 4NCC2 3TYFA 3TVMC 5T3XH 4MD5B 4L4JA 5GGTL 4GW4B 4XPTL 1T3FB 3BN9C 1SJHB 5I6XC 5ABDE 2OK0L 2XN9D 5IBUB 2G5BA 2J6EL 4WHTA 1FN4A 3RWDA 4YHZH 1I8LA 2LE9A 4CU7A 3BPOC 1MCPH 1D9KD 3QHTC 2FB4H 2XA8H 2YPLD 1TVDA 4RDQF 1HEZB 3RZWA 3HZMA 1MFAH 4MNHA 5E2VH 5K33A 4C59B 3O9WD 1MAML 4U1JB 2K1MA 4X9HA 3GJFK 1QQDA 4R4BB 1CVSC 1QRNE 3DGCR 4G9FB 2IAND 4K71C 3UJJH 4YAQB 3GM8A 3U0TA 4QXGH 3RZCC 1EERB 3D9AH 1IQDB 4W6WB 3IJYB 2WLZA 3HN3A 2NY4D 3W39B 4JM2F 1AGDB 3KJFA 1OVZA 3HS0B 4JR9L 1JNLH 5E00A 4HWEH 2WWKT 5EU6A 4BSVB 4LLUA 2Q86B 1DZBA 4UB0L 5K59E 1JJUA 3CC5B 4ZPTA 1UB6B 5FAAA 1G7JB 3OPZH 2NTFB 4ODTL 2VDML 2FIKB 3QR2A 1KLUA 4EJ1C 2WUBH 1A4JA 2Y0BA 4JN1L 3RNKA 4QOKB 5ETUA 1CU4H 3P9MB 3WS3B 2P5EB 5KOVC 4LHUG 2J1KA 1SHJA 1CD0A 4JHAL 4PJHF 1E28A 1OP3H 4PV9A 5C0FA 2NYYD 1S5IH 2DYPD 2VLJD 2YPKA 2F74B 2DBJA 4JO4H 4KI5F 4NRXA 4RFNB 2DLFH 4PJEB 3G6JB 4AJ0A 2JCCE 5L6YH 4R4NC 4MS8C 5F96L 2WMPA 3RGVC 1GZPB 4QWWC 1A3QA 3DHMA 1A7PH 1IGTB 4HULB 5DSCB 5KANI 1N5AA 1CGSL 1CLZH 4M93B 1FL6B 3LS4H 3VXOA 5CHNB 4F7TB 3VRLF 4HF5H 4KQ4H 3LQZA 4MJIA 4NZDA 1RHMA 3ULVE 2VH5L 3S8EA 1F6AB 3FT3A 4K3JL 5C70A 3S35L 4PJ5D 4DZBA 5I74C 4YHNB 4Z8FL 3CH1B 5LAXA 3BEVA 5IW6B 3HA0A 2VC2L 5DJ8B 4JN2B 5H37H 4FMKA 3KPSB 3OB0K 2R0LH 1OLLA 4MA1C 1D5XB 5GGSA 5IQ9B 4NO0A 3QEGL 2XWJA 3DV6B 4V1DB 3C60C 4L3EE 1MVUA 5D1QA 3QI9C 2FIRT 1I3GL 4V2CB 2IMMA 2PXYA 3K8LA 2VXUH 4XCYA 4CADA 2I60H 4K7PH 1BHGA 3T08A 1DVFD 2ZCLL 2QQKL 4HC1L 5FYJE 2F5AH 3U2SA 3V4OA 3VFRA 4PS0A 1DEDA 3VFNB 2GT9A 2FEEI 2IQAA 2RIKA 3S3JA 3MV01 4PREB 2E9IA 1D3CA 2KPNA 3H1PA 2MQ3A 3L5WA 25C8H 3L9RA 2DL9A 3P77A 1A1MB 4UILH 2ZKHL 4MNQD 3SPVA 4MXVE 5CEZE 5IABA 2FR4A 1MOEA 2CRIA 4J12A 4WFHD 5CIPH 2FJHA 4I2XA 2DQIL 1M72A 2YD4A 3MCLH 5EB9A 3MREA 3OZ9H 5C0EA 3RPKA 1XF5B 3MV8E 3SCMD 2XZAL 3EO1B 2FJFA 3DETC 3EKCA 5D7SL 3DVIA 5I1AA 5HPOA 5I75B 5JW4N 4QUHA 1FNGA 2XFXA 4JJ5B 4Z6AT 4ODSL 5F93C 4FQQA 3U46B 3O2DL 1A02N 2RAMA 1JK8B 3SDCC 3B5TA 3VXMD 1UJ3B 5DEGB 5INCB 3C6SB 5SWSD 2V2XB 4AL8H 3ROLB 3EZJB 3BZFB 3HPLA 4M62L 3OD5A 5IJKA 4QHNA 2CMRH 4XC1H 5GSRA 4GQ9H 5IR1B 1C5CH 3V0WH 4LP4A 5E08L 1FC2D 4Z76B 3L3DA 1KTKE 2VDOL 4I18B 4HMCA 3DMMA 1E4WH 5DZLA 1T1WB 2ZNXA 3NA4A 4POUB 2X05A 1D5MA 2GIYA 3C2SA 3KPRB 4P46C 3K4AA 3MCG1 3MLPA 1OAZH 3O6FC 3PGFL 4P59L 4JQIL 3T0XA 3NPZB 3UAJC 3RTQB 4C4KT 5I8OL 5IOPA 1MCWW 3U7WL 1HH9B 3MLTB 4ODWA 4WNQB 1SJVA 3CU1A 2EKSB 4S1DD 5J13C 3QQ3B 1T04B 3GKZA 4NM4H 1FLTX 1AE6L 2DM3A 3MRQB 5LCVL 5IHZA 3L3GA 3QO0B 3NIFE 4OFPA 2EDXA 3FQRA 4J3UA 4YPJA 3QDGE 4G43B 3G08A 4F80A 2H3NA 3QUMA 3NMEA 4IOIA 2HVKA 3BP4A 4P5MA 1EEQA 2H1PH 3MGTA 4OT1H 3F6LA 3ARDB 3QUXB 4Y1AA 3IETB 3P2TA 6FABL 4NPYA 2A6KA 4XBPA 1S9WB 3LN5A 3OBAA 1WV7T 4PRPB 2DQGH 4QTXA 1M7IB 1U41A 2Y7QA 5J1AB 3V3KA 4U1SB 5EO0A 3IJSA 3QHZH 4H8WL 2V6HA 3QWRA 3ZDZF 2G75B 4L3AA 4XMPH 3V6LA 2FX9H 3MR9B 4KDVA 2MCG1 4MXWL 2BERA 5AZEH 3KLAB 3MRGA 5E9DD 5FYKE 5BOPA 2WIIB 1IBGH 1BFSA 4LGSB 4QEGA 5L2JA 2XYGA 1FSKB 3RIAF 4QTHB 2Q1EA 1PFCA 1AGBB 4G8FB 1DP0A 4XVTH 1WAAF 3CU7A 2Q87A 5C6TH 4OD2A 5IG7A 4UT7H 3QDGA 1U8NA 4PJBF 5KTEH 1HQRB 2HKFL 3L6FA 2IBBA 3C6LD 3I75A 1ZAGA 5FB8B 4NJAL 3O3UN 1WFUA 1HINH 5K9KA 3MBEC 5IMOA 2IEPA 4FFYL 2GJJA 4KTYA 3OR6A 1AD9A 2ID5A 4WW2C 3LRHA 5C0BB 1PYOA 4KJYB 3EYUL 4LCCB 1MJJA 1DSFL 3HC4H 1NGXA 2C4FT 3D2UB 4DKAA 1OTUD 3LN4B 5INDB 4JFPB 1GQFA 3B8SA 5E2WH 1LE9A 4OZHF 5JXED 3WLWD 2GK2A 2H4YA 2H5JA 5F9DC 3CX5J 3KR3H 1F3DJ 5DYOA 1RZ7H 2YUWA 1KJ2L 5HTSA 5I0ZA 4FFVC 3PUCA 2G2RA 3STBA 1IBCA 3RU8H 3DX7A 1U6AH 1CLOH 3V6ZA 3TJHC 4QU9A 3CZFA 3C8KA 5JPMA 2EDEA 5C9KA 3NABL 2HVJB 4JKMA 3H9HA 2B1HL 3NPSB 5TGBB 1NMAL 4HIXH 4C57C 4GOSA 5JA9A 1Q9WA 1YEGH 2A0LD 4LU5H 1ZLVH 4HH9A 1FFPB 1L6ZA 3SKUD 1YNLL 5FYLD 4BZ1L 4UOJA 5C07E 5L2KB 5HGDB 1ZSDB 3VW3H 3GSVB 2BOBB 4KK6C 4C54A 3CVHA 5DUPL 4PD4J 4PG2A 3ARFB 3H3PL 3PF2A 1LVEA 5DD1L 2KBGA 3I85A 3TH3T 4JFOA 1KGCE 2BRQA 2D7QA 5FUOL 1ADQA 4MWFA 3R5JA 1A6TB 5JLZB 2HFEB 4EUPH 4CW1B 1RHQA 5D1XB 4HUWA 4IRSA 5I16B 1IGIL 3OJDA 3FFDA 4GG8A 2B20A 3MLWL 1CK0H 1KYOK 2YD5A 4O2EB 1AXTH 2KUTA 1WCBB 1S7UA 3H6JA 1YEJL 4KI5E 3VE0B 4QRPE 5IBUG 1WBXA 1LO5B 5ALBL 4G5ZL 4FTVB 4LLMB 4Y16D 5CGYD 4LPUA 2NZ9D 3U36A 3D3VB 1RWOA 1ERNA 4DW2L 2VR9A 1CICB 2E5EA 1RIHH 4RA3A 2X89D 5TPWH 5FGRA 3W0WA 1UXWA 4O51A 1UJTA 4MA7L 5KSAA 3VRLE 3ME0A 5AWNH 4IJ3C 3DROA 3HLAA 4EXPX 2W92A 4MVBD 1JPGB 3ARGD 4ZUVA 5C07A 3DX6A 3GSQA 3QNXB 4R7DB 4RGNE 5MHSD 4YHIA 3OWEA 1XGTB 2ZJSL 3O11B 3LH2L 3MRRB 4IM8A 3CMOH 4NRZB 4HWZA 2C9AA 3VFOB 4Q2ZA 3L7FA 4ZVTA 4UOW0 3STLA 4G8GE 3HRZB 3P4MB 5I1HL 4LOUD 5JFTA 3QP3A 3RDTD 1KPRA 2XI9A 4QHMA 4B7IA 5JHDB 4Q9CA 1ZWIA 1HDMA 3VWKA 5FKPA 3FQUB 1FYTB 4U1LA 3CSGA 3WNOA 3KLHC 3GB7A 2FYYB 4PB9H 1DQTA 2ENYA 4M7KL 1KTDB 1HSAB 4M5YH 2GFBB 3FN0H 5ICYA 3I6LE 3LDBB 2R1XB 4KPHL 3J8F7 2Z8VC 3GSNA 2CDEA 2ICEB 1QSFE 1CFNB 4RX4A 4WV1C 4FQLH 4XCCL 32C2A 3P73B 1A1OA 3O0RH 2BNQD 5I30L 3MNZB 2X4NA 2P1YA 1D5ZB 3MGOB 4DUXA 3O41B 4K8RL 3UPRA 2VDNL 4WWID 5IHBA 1RU9L 2PN5A 3AS0A 1U95B 4UBDD 5I2IB 1T7YA 3KPOB 3OJ2C 1QLRB 1L6XA 4FQXD 1UWXK 4KV5F 4P2OB 4CJ1A 3DYOA 2APFA 2HJLA 5ID1B 5IC4A 1NGYB 1UA6H 4WU5B 5GJTH 2FATL 4OLYL 4U4BA 1CFVL 2X42A 1JUFB 5EU3A 5BMFL 1QSEE 2PO6D 4PTTB 5DEFB 3MRBA 2EDNA 5HHME 2LAAA 2D7OA 2QSCH 4TOYL 3VXUE 4Q74A 2P8PA 4D9RE 3MUGB 1U8PB 1RZKC 2NX5D 3MRNA 5GGRB 3WHE1 2W0PA 4DK6A 1OF2A 2D31B 3RNQA 3PP4H 4BFIB 1MLCA 4ODXA 4N0YH 2VL4A 4OLZH 5IB2B 4NWTL 1MCWM 1TQCB 4HT1H 3OKEA 1BVKA 3LY6A 1NJ9A 4LBEB 3PQYB 5IVXA 1N6QH 3IDYB 3CK0L 3S36L 1GL4B 1Z9SA 1RV6X 3MRFB 4NQDE 4MD0A 1CLYH 1MFEL 3ZKQD 4XNXL 1J1PH 1OGAB 1T4KA 1PG7L 2ZG3A 2VJXA 2V2TB 3MJ7A 2QQNH 1FLRL 1GAFL 1KPVB 5CEYB 4JCLA 4BQ8A 4AT6B 5DQDH 3FO9A 3I2CH 4QXUL 4S1QH 2VLKE 3CFEA 4OZIE 1AQKL 4OIIL 1QSEA 4UTBL 1JYNA 5TFSL 4O4YH 3TZVB 3O81A 2V5YA 1T22B 5KVFL 1X9QA 4PY7A 3MPCA 5I76B 3C09B 5MERB 2AERT 4N5UA 2ESVE 1NC2D 1ZANH 3TIEB 2AJVL 2FX7H 5C9JB 3TCLA 3N50A 1GZQB 3S4SA 3ZDXE 5FECA 1Q94B 4F58H 4LNRB 3NBNA 4Y2DD 3P45A 3H9SB 4RIRB 2XXMB 4HBQA 1MREH 1B6DA 1ND0B 2GY7B 3Q3GA 2RFXB 2IALB 43C9B 4NQDA 1RHHB 4B50A 2YN3A 4PRHE 1O5DT 4YHYB 4NP4H 2H4WA 3UJIL 3MRIA 5C08A 1XGRA 3TBSB 1PSKH 1ZHBA 4GRWF 3VGEA 3TA3C 5GS3A 5SWQA 5DJZB 1UH4A 1I9IH 2VLKA 2XWBA 3A6BL 1CXEA 4OZIA 1YC7A 5ADPH 3V4UH 2OTUB 4MA3A 5C09B 1PYWB 2C1OB 3HE7C 4XGZB 4XNYH 2CK2A 1G7IB 3NS7A 2GSIA 1ITBB 4F9LC 1Q9KB 2IGFH 2UV3A 3B9VA 4FG6C 4O9HH 4XVUD 5HHQA 1WAAE 4TRPL 4OLXL 2J8HA 2ESVA 5H37G 2DLGA 5E8PB 4ELKB 2OLDA 4LPXA 2A77L 4JR0A 1FO0H 1ZT4A 3BP5A 4EXKA 4HKZB 3GSWA 1NAKL 2O5ZH 4PJBE 2NY2C 5DGQA 1I51A 1KJMA 3ARBD 5CMAA 2VDKH 4UNVA 4OCMC 2D7MA 2J7LA 3H3KA 4C56E 1PZ5B 2H26B 5MENB 4RISH 3UYRL 3CSYB 5FGCB 2PW1B 3SKNB 5FKAA 2Z4QB 3WUWA 2X41A 5AYUH 4DVRH 3RTQC 3P9WB 3P40A 1T7VA 4JFED 2EDTA 1AHWA 1HOCA 4PRHA 1YECL 4ZUTA 1NCWL 5T3ZD 1LD9A 1O0VA 3R6GA 1MRDH 4I4WA 4LSTL 1LP9B 3B2UD 3MRDB 3NN8A 5D7JC 4GRLD 3KWWB 3Q5TA 5HGBB 1CQKA 5EBLB 1KCUL 4MNGA 5B3JF 2QSVA 3L3JB 3RPIA 5HHPA 3P0YH 3T09A 4HXBH 4P9MH 1MIEH 2DQFB 2JJUA 4PB0H 4JKWA 1A6ZA 4I3RH 4FQ2L 3ARDC 4NT6B 1T5WB 4HPYL 3SKOA 4KVNH 4L4VE 5D7LB 4BA8A 3GMNB 2BSED 5TJWK 4QHKJ 3IDGB 5I19H 2FH6A 4HBCH 2VISB 2F53B 1AJ7L 3BGFB 4MXQC 3GEWB 5HD8C 2HWZL 1IAKB 1MVFA 3EYOB 3RHWK 4JFQA 3X14A 4C56A 1N4XL 3I6GB 4CRPA 4FXGA 2JB5H 3DLQR 1FIGH 2VLRD 4X6BB 2PYEB 2NY6B 4OM1L 3F58L 5I17A 2ILLA 3V7AE 4XBEH 4NQVB 2R8SH 3CJJA 2E27H 3WDIA 1M05B 4JM4L 4NOMA 4U1KB 1CG9A 5F7EL 4PFEA 1U42A 2Q7NA 4I0PC 3SIPA 4KTEL 4UU9B 4WO4D 4LP5A 1A3RL 2Y5TA 2UY7A 2OCFD 5MEQB 3QNYB 4N0UA 4QCIA 2IQ9L 4MYWB 3MYZA 2LQRA 3OB8A 3N85H 4JFDD 4P3DA 4JPKH 5IMMB 4L4VA 2AVGA 1BLNB 2P48B 3TN0B 2YRLA 1VCAA 4TPRL 4HUKB 4OD1L 3Q5YA 4LF3B 4JHWH 2JTDA 3T0VA 5HDQH 5EU4B 4AEHH 5B38G 3GMPB 2AXGA 4KZEL 5L7XL 4RCAA 3QQ4B 1BQLL 5TE6L 2ITDA 1C5DA 5DJXA 4XWGH 3HG1E 4OAWA 3VFPA 4BSJA 2FCBA 3T0DA 5CJ8A 1ED3A 4JLRA 5E1HB 3SJVE 4MMZC 2O5XH 4MJ5A 1TPXC 4WWKC 4XI5D 1NFDF 3T0ED 4TVPD 2IADA 3T4YA 3FQWA 2GJZB 4ZXBA 3VD4A 1A1NA 3OAUH 3FT2A 1KIQB 1H0DB 2A1WH 5GS0L 1DDHB 4Z77A 3VCLA 5TF1L 4HZLA 4NDMB 1L7IH 2OS7A 3QCVL 5DVMA 1NGPL 3IDIA 1U3HA 5EN2B 1T5XB 3MJ9A 4NQCB 1JF5A 2LV4A 4IS6B 1QOKA 3EFDH 2AKRA 2R23A 1RWXA 4KQ3H 4ZODA 2CXGA 1AGCA 3LQAC 4BUHA 3TVMA 3UBXI 4H20H 1MCOH 3EYQC 2X4UB 1KNOB 3HG1A 4DTGH 1NFIB 3G5ZA 4Q6IC 1BOGB 1J12A 3SGEH 4ZSOA 1FG2A 3L5IA 1BZ9A 2GK0B 4JG1H 4OFDA 3SJVA 1S7TA 1FNHA 2VITB 2HT3C 1FV1A 1BM3H 3I50H 1QBML 1TETH 1K6QL 4NZUH 1IZKA 3QWOB 1H3XA 3ECBA 4DN4H 1VGEL 2R69H 2R56H 1R3HA 4N6OA 2ED7A 1UB5B 3RZCA 5E6IC 4LLDB 3RI5F 4PRAB 2B5IC 3MFGB 3PHQB 3EOBA 4XP5H 3QISA 3QDAA 1IM9D 4PRPD 3UTTA 5D71L 1LDPH 1MCLA 3VRIA 4O02L 2P49B 3TV3H 3OG6B 3RUGB 5IT2L 3D6FA 3K4DA 1K4DB 5EPMA 1VFAA 4P4RB 2VKWA 4YDVB 1FVEA 4WU7B 1I1FA 4KRPB 3ES6B 3UBXB 2APWA 2F15A 1BFOB 5IK3A 3HB3C 1LO2L 3FFCD 4HXAL 4HGMA 5JW3H 2VAJA 4DK3A 4OSUH 3QXTA 4EN3C 3QUKA 2D7NA 5J89A 2AV1B 1O7SA 1UKTA 1KOAA 4L4TB 5HVFB 1RJLA 4W68A 2BCKB 3GI8L 5FA4B 3MYJA 2QL9A 5GGUA 3K0WA 1VADB 3QG7H 3DXAE 2C7UB 1QVOA 1NAMA 4JGUA 1CE6A 3CNKA 2DN7A 2PCPA 2FECL 2IAMC 1B4JL 5GSVB 5I18H 4OCSL 4XB7A 4LHUA 3RGVA 5K93A 1P4BH 1S8DB 1FGNL 4HJGB 4M6MH 3IDMA 4R9HA 4A2MA 2FL5A 3QO1A 1MCIA 4M9RA 4XXDB 4K07A 1J0IA 1I7RA 3BIBX 4BH7A 4EUPG 4Z95L 4JDZB 5L8KB 3WDHA 1R3IH 4NFDA 5D1ZA 1DQJB 1VERA 3FHAA 5AZ2H 4M8VA 3QH3A 3LPWA 4NJ9H 2CKBA 4YIQA 3DX9B 4YPGB 4PJEF 3G6JF 4XCEA 12E8L 3T2OA 1JPFB 4Y5YA 4NOJA 5F8RC 1ES0B 3IDXH 3NZHL 1D9KC 2G9HB 2NW3B 1FNLA 1J1XL 3C60A 4R96A 1MFCL 4UQ3A 3QI9A 4PV8A 5T1LA 1UM5H 3DXAA 3LEVH 3O9WC 2PTTA 2OR9L 1U3JA 2ZUXA 3G5XA 4N0RA 5GS2D 5TE7L 4NOFA 1Y18A 5LVEA 3MRCA 3MRLB 5ITBH 2AP2A 5TQ2H 4ZFGH 3FRUB 4YDKL 1O7VA 2XWTA 4HHAA 3NACL 1JNJA 4OGAD 2VDPL 3THML 3R0NA 1K9TA 4LCWE 1M7DB 4QF1B 4JJ7A 5IF0A 1VSCA 5J6GB 2EDYA 5CP3H 4IRJD 2X7LA 3JV6B 1INQA 5F6HI 5SWZB 3G5YB 4EHFA 3O4LD 1G7LB 4BSWB 3UYOD 5E4EB 2XQBL 1I7ZA 4N5DA 4YBQD 3ARFD 1GPOH 4O2FB 1KG0B 3PV7A 4RGOH 1QR4A 4UAOB 4RZCA 4X6DB 3EDRA 2V17L 5FO7B 3WIHL 3EZ8A 4ZAKB 5BVPL 1SBSL 5KSBB 5JO5B 4X6EA 4ZD3H 3L95B 2EC9T 1OT1A 1YA5A 3MUZ1 4J3VA 4LSSL 3BP7B 3MUJA 4QRRE 5EO9B 4BQ6A 2FUNB 3PD0A 1BAFL 4HWUA 2ADFL 5E7FA 5B3JE 3WL9B 3MFFB 5DD6A 5B39G 3PGDA 2NYYC 5BRZE 3QFJD 4HDIA 4LLYA 2GCYB 1YMMD 4Y0GA 4YHPA 1WWBX 2RB8A 3EFFA 3SDCA 1G9MC 3NZ8B 4GT7A 4Y88A 4TQEH 5IESH 1EEYA 3U0WH 3BKJH 4LCWA 1X3DA 2AXFB 3SKJL 5EZLB 1TJGL 4M43H 1J0ZA 4I0CC 3AROA 4D0DA 4OQ1A 3BKYH 1MCCA 4HGWA 1FNSL 2BC4B 2ATKB 3KXFA 4GRMB 5DD5L 4TSBH 1YEHH 3IDUA 4WI2A 1KTLA 1T2QL 2E8YA 3C5ZB 1HYRC 4UV7H 1BD2D 3O6FA 3FT4B 4JFFD 2AJ3A 2XRAL 3V8OA 4I9WD 3MNVA 1KN4H 1AKJB 5SX5H 5FV1L 3BEWB 5F97E 3O8XB 2FWOA 2EDKA 1QFWH 3N9GH 2Z31D 5E5MA 4LAQL 3T0AA 1I9RH 4ERSH 5EBWA 2DI9A 3DBXB 1JCKA 4QYOB 3HMXA 3WN5C 4OZGB 5DZOA 2P5WA 3FQNA 1IFHL 3BPLC 5E8OA 5C2UB 5GRJL 2F9BT 2P24B 2R2EB 4WTWA 3IGAA 1HZHL 3WSQL 3IFNH 2COQA 4J4PD 1GOFA 5GJSH 1U58A 2CLRB 5T1KD 2FECI 4JFXA 4JPVL 2ATPB 2VLLB 5IQ7H 3GSRA 3P4NB 1IKNC 2X4RB 5L0QB 1PKQB 2W0FA 3I9GL 5DR5L 3BMVA 3NFNB 3TO4D 1G9NH 5D2LA 1S7XB 3TM6A 4QUDA 3O6KL 2DJSA 1FVDA 5LKNA 4JDVA 1EHAA 2AJYH 3QUZB 3G6DL 3WFBH 3CLEL 2DQUL 3W5NA 1LNUA 5K9OB 5FO9B 4WFED 4RWHA 3BFOA 1IZJA 4HUUB 4ZVUA 4JFHD 5CUSL 4OZFH 1A4KA 3OV6A 2HG5A 3KHQA 4GSDL 1TLKA 4CN6A 1KLGA 3SCMC 3Q1SL 1UWEL 4NUJB 2DJ4A 3OJMB 3BGFC 3OXRB 2DKSA 2W65B 1OAQH 1ETZA 2UWEA 3DHJA 3OAZK 3VD9A 5IVZA 4E41A 3EYVA 4P5TB 2YEZB 2H51A 5F1NA 4TVSa 5EC1B 1JMXA 3VGGA 4X5XA 4MB3A 3MRJB 4TULL 4NO3B 3RWIB 3WIFB 3VXRB 3MBEA 3CFBB 4HZAA 5LGJA 4WUKH 5T5NF 1FQ9C 1VGKB 5JQHC 4KZDL 1OAKH 5JW5A 5ITFB 3X11A 4J3XA 4PTUA 1R5VB 4WW2A 2A74B 2HT4D 2ICES 3DGGA 2CJYA 5DRXB 1T6WA 4L8SC 1WITA 5IW3A 1IGJB 1UKSA 4ZO8A 1NMQA 1JGDB 4LDLB 4MD4B 3TBVB 3D85D 5EWIH 3C9NA 4PY8J 3AU1A 3UTSD 3WKMH 2P47B 5IB1A 1T0MA 5HYSB 2I9LA 4PRIE 4S1DC 3HRPA 3MOAH 3KNBA 3SDAB 5FDWB 2BVQA 4TVPH 2XG4A 3BKML 1FNEB 2CJUL 4FFWD 4FQCL 5HYQB 4PJGF 4KRLB 4D0BA 4HPOL 2ADIA 4DVBB 1QEWA 2AJUL 4QRQA 1VB9A 1MCFA 4CMHC 4APQB 5KBNC 5IJVB 2AR9A 1NKOA 1MY5A 4CJ0A 3GIVB 3P4OB 1RMFH 4EDWH 2R29H 4ODBD 35C8L 1G7HB 3WS6C 5C09D 4WGWB 1RZFL 3LHPL 5C0JA 5JW4Q 4P23D 2WBJB 2FBJH 2ZG2A 5CEXA 4WEBH 3B6SB 4UTAH 4G9FE 5GGTH 5E56A 5F3HB 3MNWA 3OKDA 1BQHG 1IKFL 4ZUUB 2J6EH 3RWHA 5I8KH 5IWLC 2NY7H 4XPHL 5E6ZA 3HKFA 4LSDA 1Z3GL 1H3PL 4PRIA 2CJXA 1AGFB 1AI1L 3K2UH 5EZOL 2GTZB 4X6CA 4Y5XB 2J31A 1TVBB 4A6YL 1MAMH 3FO1B 1PDKA 2QR0B 1J1OL 4JRYD 4AM0A 4DQOL 4UINL 2E7LC 2FQQA 3C6LC 2GSGB 3PWUA 5CBAA 4NO5B 2JB6A 1HHHB 3A67L 4JY4B 1AQDB 4YUEL 4NQXA 5A43C 4QOKE 1LEGB 2EYRA 3D0LA 2P5EE 3SKMA 4XAKE 3JV4A 4Y8AA 3EO9L 4JY5H 4OLWL 3WV0A 1A0QL 4W70A 4JZJB 3KYNA 6CGTA 1FZMA 5EUOB 4RFEA 2GEEA 5EIIA 1HHJA 1OTUC 3G6JE 4HS3B 4JE4B 1CDBA 3NCBB 3NCJL 4YFDB 2VDMH 4F7PB 4NKOB 5JXEC 1QR1B 3WLWC 1CTNA 4LSUH 3T8XA 1MLBB 4DKDC 1T1ZB 2MMXA 2F53D 4QHUB 3UTPE 2ZUQB 2FP3A 4KUZH 1CBVL 1RWPA 1G0YR 1KT2B 4YHOL 1NCNA 3ULUE 4Y1AD 5I1KL 4OGXL 5T3XE 4OM0L 5F96H 4HUVB 4K8RD 9CGTA 2A0LC 2YMXL 3H9YA 4PJAE 3L3IB 3REVA 2IG2L 3TIDA 3ARED 1W8NA 4V1DE 1EXUB 1GGBH 4G9DA 2VH5H 4LVHB 3UJTL 3BH9B 3OKLB 4K3JH 3O6ML 1XIWB 2GTWA 2OXGA 2ADGB 3S35H 4MCZA 2DWEA 4Z8FH 3BIJA 2XNAB 1S7SA 1YY8B 2A6JB 2V9TA 2VC2H 2OJZL 1NLDL 3FJTA 2NY3B 4ELMA 1JPTH 5EU7C 3PL6A 4NGHH 3QEGH 4AEFA 3VGAC 4Y19D 1AO7B 4IRZL 4GKNB 3MO1B 3MRPA 3QXWA 2NY5L 1G7PA 1NCAL 3IU3A 3I3DA 1JZ5A 2PKDA 1F4XL 4JR2A 2UY6A 3DX8B 1I3GH 5ESVB 4PP2A 2QKIA 3KGRA 4XPGL 4HKXB 4QTIL 5CGYC 4N9GB 5GS2H 2NZ9C 1F8TH 4S2SB 4HSQA 1QTNA 2R0WL 1M6OB 4N0FA 1FZOB 2Z92A 2OI9C 1BX2A 1FFQA 4OI9A 3DOSA 4PJAA 4PRBB 4ZFOA 5BS0B 4MVBC 5CJQH 1G7MA 2CRYA 3ARGC 1JYXA 5DRNA 1ZLSL 5T33L 4JO3H 2KKQA 4CU8A 3QHFL 1PX3A 3ULSA 4WRLA 3MC0A 4HQQL 3GJFH 1N64L 3V4PL 4K94C 2ZKHH 4RMUA 3DUUB 4LOUC 4UV4H 5KVEL 3ETBF 3MBXL 3RDTC 2J33A 4LFHG 3KLDA 5D7KD 4NNXA 1J8HB 4NFCA 1C5BH 5MEPB 4WY7L 1MF2L 4P2QB 4KAQL 4HMDA 2GITB 2XZAH 2YC1B 2DQJL 2BSRB 4NCC1 1UCTA 4LAJH 1FE8H 1S5HB 4ODSH 3VXPA 1F2QA 4XTRD 2VAAB 1YMHB 4MLIA 2XKUA 4KXZH 1A47A 5TE4L 4H0HB 4UBDC 4JZNA 1PZUB 1ODAA 1P4IL 4FQXC 1INEH 3VH8G 3HMWL 3MLRL 3QZWB 4PGCA 5EO1B 3TA3A 3M17A 1KJVB 3VRJB 1MIMH 2DQDL 1JWUA 4HIIA 3HI1B 1B2WL 5KS9B 4FQ1H 4KK9D 3VD3A 1RUAH 3KS0J 1MHHA 5MI0B 1LK3H 2VLME 3VDAA 3R06A 3QEUB 4Z7VF 1DLHB 1XGUA 2PO6C 2C5DC 5AD0B 4DUVA 2JIXB 3PGFH 4P59H 4AWAA 2J8UA 2BDNL 4LARL 3HE7A 4O58L 4S0SD 2ERJC 3B9DA 1N6VA 1EJ6A 1KCVL 4F9LA 1BMQA 1NSNH 5DS8A 4Q9QL 3GMQA 2MCPH 5D6CB 1IGMH 5E2TL 1SYVB 1MI5B 1DBJH 1HYSD 5LCVH 3CMGA 1B0GB 1SQ2N 3SDXE 5HYJB 2VQUA 1RIVH 1N0XH 3NTCH 5C0CB 3ULVL 3E6FA 4A6YB 3RY4A 4PJIE 4U1IB 1OTTD 5BQ7A 2EEBA 1K2DA 2BY0A 3F7VB 4G7YL 2AJSL 6FABH 4KXZI 3E4CA 3GIZL 4KRNA 3SDYL 1MCBA 2A9NH 5D7JA 1MJ8H 1V7NL 1JV5A 4JVWA 3MROA 5IFJB 3MRMA 2MQ0A 4U0RB 4KMTL 1Q0YL 4UZGA 2Q6WA 3V95A 4MXWH 3GHEL 1SYSA 3HUJA 3VFMB 1T7WA 1MRFL 3QDMA 1SEQL 3DI2B 1A7QL 5FYJL 5GIRA 1CZ8L 5DJ6B 1OM3L 5DK0A 4L3CA 3HPJA 1MNUL 1HQ4B 1CFQA 3V6FA 5E94A 1A6UL 3PDGA 4HQ0A 5E8NB 3RWEB 5CCKL 3SDXA 1KELH 1LP9F 3FOMA 4IMLA 1Y6MR 3HC0B 1S7WA 1W0VB 2F19L 3UPCA 4Y2DC 2HJKA 2AW2A 4WFGE 4N0CD 1KB9K 1R24B 4OCXL 1GC1L 1MJUH 1PJ9A 3I3EA 3PWLA 3Q6FA 3RWGB 2WIMA 3V2AR 3IKCB 4XC3L 5CIPA 4YDLC 1Q9LA 5CEZL 3QDJE 4L8BB 4R6UA 4R4FH 5IAEA 5HVHB 3TYFB 1P7HL 4AEEA 3FO0H 3KVQA 3MLSH 1JGVL 3IAPA 4W4NA 3EYUH 2Z93A 1U3ZA 2G5BB 1GOHA 4AEIL 2F54A 1FN4B 3RWDB 2QADD 1M1SA 2NXYB 1CXIA 4I0PA 3S34H 1XR9A 3N1PC 4FQIH 2XZQH 3HZMB 4TSCL 4MNHB 1NH6A 4PJHA 1G0DA 5SWZD 3SDDD 2DQCL 4PJ8D 3CAFA 5CSZA 1QQDB 1SY6A 1MY7A 4GG6E 2K7QA 4XVUC 5FYJU 1E27A 5L2KE 1V3KA 5EZIL 3U0TB 3FKUS 4Q9BA 1F2XK 3O3DA 4G8EB 3KJNA 3NABH 4RBPK 2D03L 3ARBC 1H5BC 1AR1D 2W91A 1AIFB 2WNGA 2X40A 2ICWI 5IC6A 1NMAH 5E00B 5TF0A 1OW0C 4OZ4A 5EU6B 4XXCC 1JI1A 4LLUB 4Z7UA 5JPNA 1SMAA 2WZPD 3IJHA 1RUKH 2JJWA 1H8OA 4ZPTB 2X6MA 5B38A 1INDH 4BZ1H 2BXYA 2H2PD 4F2MA 3AXLA 3B2UC 2ADJA 2C3GA 4GRLC 1KLUB 3EJZD 3H13A 1NDGA 3V0AC 1A4JB 5DUPH 3RNKB 5ETUB 3BGMA 3MA9L 4HCRL 4YQXH 2GYSA 5DFWH 4E0RA 1E6JL 4CNIA 2MWCA 1PW3A 4PJXA 5GS0D 5E1AA 1EHLH 1E28B 4G42A 1A7RH 4PV9B 1JRHI 1IGIH 4NRXB 4GG6A 4NKIL 1OPGL 4X9BA 5ISZD 2BNUA 5F88A 4DEPB 5JQ6L 2YPVL 5FM4A 2VDQL 1P69B 2X9XA 3MSPA 2ICWB 2WANA 1N5AB 2EXWD 3VXOB 4OZFG 4L8CB 5C71A 2VNCA 3LQZB 4MJIB 3D39D 1RWKA 4MA7H 4IDLA 3FT3B 4DZBB 4RFOL 4Q6IA 5F9OH 1FYTE 5LAXB 5HPMA 4C58B 3BEVB 1UYWL 4ONHA 5FYKL 3U82B 4F8TA 2W60A 3NGBC 5GGSB 3S97C 4GBXD 4MQ7A 3QAZB 3FAWA 4NO0B 4QO1A 2YUVA 2XWJB 2NMSA 1UZ8A 4NHCL 5DA0B 3O2WL 3HE6D 5F89A 4WO4C 5IFHH 4XPFL 4N1HB 1MVUB 5D1QB 1BJMA 4D3ZA 5E6IA 2PXYB 4Q97A 4CADB 3IB4A 3ET9F 1CN4A 1WZKA 3B8YA 3QUMH 3BRDA 2H41A 5EOQH 1QFOA 4H88L 3ZL4L 3U2SB 1MUJB 2EDFA 4OIBA 1F90H 3VFRB 4KPHH 2GT9B 1SJEA 5IUSA 2IQAB 1NLBL 2R9HD 5IVNA 4XCCH 4D9LL 5IARA 2WINA 5I30H 4QU0A 2VDNH 3B9KC 1RU9H 1HNGA 4EN3A 3L9RB 2XN9E 2P44B 3P77B 2BVEA 2LU4A 5C7XL 3SPVB 2BOCA 3MUY1 4PPTA 4PR5A 2YPLE 3V6OC 5FYKU 3ALWA 4XI5C 3T0EC 4JKPL 2FJHB 1SBBA 3H42H 4L8DA 4I2XB 1X6LA 4CMMA 4OLYH 1CFVH 3RUGF 1SEBA 4N7JA 5J6HA 5BMFH 5GS1C 3MREB 2ZUVA 4L3EB 2IANE 2IAMA 1C08A 3B83A 4UDTA 4TOYH 1ZHNA 2FJFB 4WI7A 1KIRA 5I1AB 2XFXB 2Q8AL 5KSUA 1T6VN 3TT1H 4F7EA 1U8IB 3S3SA 4OF0A 1FVCA 1P53A 3ZE1E 1MCNA 2HJFA 3GMLA 4QHNB 1BECA 1YN7B 5F6IC 1FH5L 5GSRB 1X7QA 2XY1A 4M4RA 2UVFA 1MWAL 3P9LB 4M5ZH 4S0TD 3CK0H 5EOTA 3EDDA 4KTDL 3DMMB 4M7JH 4O5LL 3L5XL 1RVFH 4X0KA 1MFEH 2XN9A 4EUPA 3QPXL 4ZO7A 1RZIA 1PG7H 1D5MB 2FDBP 2VR5A 3HC3H 5HBBA 1D9KA 1FLRH 3VGFA 2YPLA 4G6AD 2NPLX 5DD0H 1WQVT 1ZVSA 4MLSA 5IOPB 2RGSA 5FOJA 3L7EA 3O9WA 4Y5VC 3S37H 1Q72H 1ZGLA 4OCRH 1IC4H 1DQQB 2IANA 3H9SE 3MV8B 4X4XA 1S3KH 4XNMA 5IHZB 3F65A 3GHBL 3PABA 3VFTB 2ZP0T 3L3GB 3GO1L 4ZUWA 3FQRB 1NMBL 3FN3A 2H3NB 3QUMB 2AJVH 4IOIB 2HVKB 3BP4B 4P5MB 4P48A 3O2VH 3WFHA 2WBJD 5CLWA 4AWBA 1V3MA 3MGTB 4LDEB 3WIIL 2OXHA 1UACL 5E03A 4NPYB 4U6TA 4RMWA 4K9EL 5HHNA 2R4RL 5LXGL 2Y7QB 3CVHH 3T0BA 5L8JB 15C8L 5EO0B 1HHKA 3IJSB 1UM6H 3E0GA 4K55A 4HIHA 3G9VA 4MAYB 4HW6A 1H8SA 1ADQH 3LKNA 3PIQA 5T5FL 5HHOD 3MRGB 4K2UH 4PJ7A 2DYPA 2VLJA 1J0JA 2VRAA 4WCYL 3MJ6A 3BDBA 5MENE 4X6DF 2ZZUT 4JRXD 1KEML 4PLNC 5KSBF 5IAJA 4EDXA 4NN7C 5B39A 4XZUA 5DLMH 4OD2B 2KZ1B 5IG7B 2L7UA 1DQLL 3QDGB 3RIAK 3GRWL 1UWXH 4OLXH 3V6BR 1DBKL 4ZVOA 3L6FB 1LP9E 5CD5D 2A77H 5I1EL 4KHTL 3I75B 1CE1L 2XTLA 4XPBL 4NYLB 1G7QA 1U8KA 5K9KB 4EI6A 5IMOB 1UWGL 3OF6D 4PJ5A 4X7FC 5IBTL 3OR6B 1AD9B 2LTQB 1GFWA 4YGVA 1ZMYA 4KUCD 1B9ZA 4WFHE 1MJJB 5J56B 4PGBA 1NGXB 4OFKA 5E0QA 4DFHA 3O6LL 4O00A 2AJZA 5D7LE 4OF3A 1LE9B 1NKRA 3WN5A 5DYOB 4IOFD 4ORGA 2G2RB 5CJOL 3LEYL 3U6RA 1DFBL 1DVFA 1IEBA 4HV8A 3CZFB 2W9EH 3C8KB 5JPMB 3PWNA 1H15A 3ZE0F 3CFDA 1TJIH 5IROC 2PYEE 1XF2A 3GSNH 3LPFA 3SGDH 4IRJC 1YC8A 2GY5A 2APBA 1IKNA 3QIBD 1EFQA 3MV11 3GI9L 3LKPA 4N1CA 1Q9WB 1VA9A 4HH9B 4MGXA 2HWZH 7FABH 3SGKC 2NY3D 1F3JA 4XMLH 3CDFA 2UUDK 4MNQA 5A3ID 4OZGF 5JOPD 3FONA 4G3YL 4FEAA 4DKEH 3AB0B 3JTTA 5KVDL 3CVHB 3S35X 5D72L 4I1NB 1TQBB 3ZYJA 2ZCHL 1T83C 3RHWF 2E7BA 3D1MC 4NBLA 3K81A 4JFOB 4UI2A 1CDIA 4JM4H 4ZQKA 3MODH 5DMIL 5IB5A 3SCMA 4MWFB 3KJ4C 4H5SA 1KMCA 5F7EH 2CLZA 4P2RE 3ALPA 1YEEH 4IRSB 4PRNA 3OJDB 4IDJL 3FFDB 4GG8B 1EV2E 1SM3L 1A3RH 1GSMA 4PJ9D 1HHGA 4UT9L 3VXMA 1S7UB 4N90E 2OZ4A 4LLVA 3OKKA 2R0ZL 5SWSA 1WBXB 1H3UA 1QLEL 4LQFH 2MPAL 4L9LC 3E6HA 3U36B 3BWAA 2EYSA 1ORQA 4KROD 1IAIH 5I1LA 1GIGL 5KOMC 3W0WB 1UXWB 4OD1H 4O51B 1OP5H 5KSAB 4HKBA 3DROB 3HLAB 3DTXA 4LSQH 1F00I 2HRPH 3DVFA 5BV7L 4L8SA 4ZUVB 5C07B 3DX6B 3GSQB 5L7XH 3EOTL 1F6FB 3GBNH 4YHIB 1BQLH 2HMIC 2Y4SA 5E9DE 1DBAL 1UCBL 3L7FB 3STLB 2Z31C 4LDOB 1KPRB 3HZVA 4L29A 2BRRH 3CH8A 4NQCE 1FO0A 1ZWIB 1HDMB 4LRIA 3VWKB 5FKPB 1JZ7A 2IH3B 2ED9A 4GS7C 2ZSVA 3GB7B 4RGMB 1DTUA 5B8CC 4NOBA 4ZS7H 2YA1A 3BD5A 4OQTL 1QZ1A 2NW2A 5GS0H 5ICYB 4QRPB 3G9AB 4J4PC 4ZYKA 4ZFFA 1VENA 1EJOL 4BZ2L 3GSNB 2CDEB 2MJWA 1QFPA 3QCVH 2FGZA 32C2B 1A1OB 2X4NB 4PJDA 3ZTNL 4NKDB 3JWDL 3UPRB 1DR9A 3VFWB 1CQYA 3WS6A 1IAII 4WI6A 5F9JA 4X9GA 2BK8A 4H8WC 4Z5RA 4E42A 5CSGA 5D70H 5HI3D 1RULL 2HJLB 3T2PA 1WICA 5E9DA 3WHE0 4DCJA 3IAQA 2WQ8A 1GGTA 1IVLA 1M71A 5IWLA 5EU3B 1CGXA 1HSBA 2VXTH 4I5BA 4LCIL 1MI5D 3H3BC 3MRBB 4YO0A 4HEPG 1EO8L 2UZYB 2P8PB 3BYYA 5HYJD 4BK4A 3BPNC 3X13A 1KYOJ 1BQHA 3BH8A 3MRNB 4HWBA 3AFLA 5F1KC 3VXSD 1OF2B