2YOAA

Synaptotagmin-1 c2b domain with phosphoserine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphatidylinositol 4,5-Bisphosphate Clusters Act as Molecular Beacons for Vesicle Recruitment
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords SYNAPTOTAGMIN-1
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yoaA00
2Q3XA 4FJZA 2K8MA 4KZCA 3JZYA 2CHWA 3F04A 3QARA 2UZPA 5G55A 3L9BA 3PRZA 2ISDA 1HE8A 4EZLA 4WWOA 3S2AA 1A25A 1E8YA 1V27A 2NQ3A 1E8XA 1QATA 1W16A 2FJUB 3TJPA 4DNLA 4ANUA 3SD5A 3R7QA 4NP9A 2WXKA 1DJGA 1WFJA 1E8ZA 4F91B 1BDYA 3RPBA 4J6IA 4KITB 3PREA 3KWUA 4JPSA 4MJJA 4ANVA 2DMHA 3APFA 2K3HA 2QZQA 2X38A 4FHKA 3ZVVA 2ENPA 4AOFA 3APCA 2CJTA 2WXIA 4WAFA 5CCGE 2CM6A 1GMIA 4FLHA 1DSYA 3N5AA 4IHBA 4EZKA 3L16A 3B7YA 4HVBA 4Y1TA 2NSQA 1W15A 5T8IA 2JQZA 4XX5A 4GNKB 4F92B 1DJWA 2BWQA 4LCVA 1YRKA 4HLEA 4QAMB 4XZ4A 4ANWA 3NSJA 1TJXA 3ENEA 4FA6A 2WXLA 2WXNA 3L13A 4LDCA 1WFMA 3CSFA 3L17A 4BGDA 2CHDA 3IBEA 2YRBA 2CJSA 3DBSA 3NZSA 4G11A 3F05A 4PS7A 3TWYA 4OVUA 3M7FB 4OVVA 5H4ZA 5H4YA 4V11A 2N1TE 2WXHA 3QR0A 2R83A 3F01A 2WXRA 3HN8A 1E7VA 1BCIA 3PFQA 3KWTA 3PYCA 4F93B 4F1SA 2QZ5A 1E90A 3W56A 2WXPA 2D8KA 2WXJA 3W57A 3HHMA 1TJMA 3L54A 2WXMA 3ML8A 3HIZA 1E8WA 3QJZA 1K5WA 3NZUA 4QJ3B 4TUUA 1BYNA 2FK9A 2WXOA 4L1LA 5G2NA 3LJ3A 1DJZA 4XE0A 3T8MA 4FULA 4NS0A 1RSYA 2DMGA 1UOVA 4ICWA 2Q0ZX 2Z0UA 2V4LA 3CSTA 1QASA 4L23A 3R7RA 4TS6A 1CJYA 2Y3AA 4Y1SA 4A55A 3L08A 4BFRA 2YOAA 3GPEA 3MJWA 4IQHA 4QJ4B 3OAWA 2WXQA 3DPDA 2CHZA 4NPKA 3RDJA 3TL5A 3ZIMA 3QAQA 2ENQA 5CCHE 4FHJA 4ICXA 4WEEA 5KJ7E 3IM1A 3OHMB 1E7UA 4DK5A 3ML9A 1DJYA 4L2YA 4PS3A 3ZW3A 2WXGA 3QR1A 4ANXA 2EP6A 4URKA 4KZ0A 4NPJA 2B3RA 2K45A 4GB9A 1DQVA 2CM5A 1DJIA 4PS8A 1DJXA 4WWPA 4QJ5B 2RD0A 5EDSA 5JHAA 5CCJA 2NCEA 4LT7A 3F00A 2CHXA 4AJWA 5JHBA 2WXFA 3P2BA 1UGKA 1RLWA 2K4AA 3APDA 2A4ZA 2ENJA 1RH8A 3FDWA 4TV3A 1DJHA 4FADA 2LHAA 3L4CA 4WWNA 4L1BA 4FJYA 1UOWA 4EZJA 2ZKMX 3FBKA 3QK0A 2KI6A 3PS6A 2A5UA
chains in the Genus database with same CATH superfamily
4NKQB 3G5ZB 5FR3A 1KTDA 4NFBA 5FM5M 4N25A 3GEFA 3HRPA 4MQXC 3C09B 4F3FA 2ZSVA 1EANA 1XIWD 5GS3A 2JKRM 1T20A 2R4SL 3GNMH 3PAZA 1Y6NR 2HVKB 2FJFB 1ZLUK 3VM7A 3NCCB 4UB0H 5CMAA 4XBPB 4XX1E 2QVIA 4Z7VE 3UG5A 3MLWH 5TF1H 3TZVD 3VXUB 2Y1ZA 3EG9A 4M48H 5GGRA 5HDOA 4V2BA 1QSFB 4HD5A 3RHWK 3U9UB 1QBMH 1BV8A 4JFYB 5J1TC 3HG1B 1L6XA 2KH2B 4NENB 3RILA 4FLHA 1OHQA 3PDOB 1AZVA 1DQIA 3KCPA 1W15A 1LP9A 5INCB 4XN1A 4W4OA 4R4ND 2NY1B 4Y4FC 1AKJB 4Z7UE 5HVHB 3L95B 1K5NB 1GGBL 4YXKH 2KZWA 3AQZA 3PHQB 4IKJA 1A1NA 1JVOA 3GLEA 5I0VA 3SYAA 1SLXA 4Q6KA 4QRQB 1M2VB 4LDCA 3S8WA 2P26A 3NCWA 2NY2B 1ED3B 5C3LD 2DLTA 4OJFL 1PZCA 4KC3B 1HHIB 1JZ3A 3DUHA 1DR9A 5IFAL 1B4JH 1VADB 1ZXKA 1A9EA 5T3ZD 2H41A 3D4YA 1PG7W 3BVTA 4HS3B 1E90A 4W4OC 2WBWB 4WO4B 4XMKL 1F86A 3WUWG 4G1EA 1OAUH 2EEAA 3K7UA 1E8WA 5BZDB 1HJBC 5D72L 1DCEA 3OPZH 5EDXA 4APXB 4UINL 3T3PF 1RSYA 3RL1A 3U7AA 3CN3A 1JWSA 5T1JA 1B4LA 4PVLA 5DJAA 1G6RB 1ZA3B 1YEIL 3S3DB 3FB7A 3H7BA 1IILE 4L4VE 5KTEH 1H6UA 3JT2A 2W80C 1JD9A 3PL6C 4RMUA 3ULUL 2ZG1A 1AKJA 1NSNH 1IX2A 3ZDXB 3ATBA 3EOAB 5DK0B 2N59A 3T1FB 1ZIBA 3QZNA 4JHWH 2GIXA 4MMXA 4N0YL 4WLCA 3VI4E 3SKOB 2MSPA 3CIAA 5I18L 1IVLA 2J3SA 1MLCB 4I1RA 4NNPL 1DQDH 5CLXA 3RWHB 3W3BA 9PCYA 5GZOA 5CFHA 1LEGB 2EKSA 2BHYA 5J13B 3V4PB 4IIZA 3S5LA 5BUPA 2FWLB 2Q76B 1C16A 1TJGL 2XFXB 4D94A 3W0WE 2OYLA 3STBA 3FFCB 1OB1B 4LSTH 3NSFA 2JB6A 2X4SA 3DWTA 2CIIA 1EHAA 4PLOB 3CCHA 3UMTA 4P4RA 2Z8RA 5J1AA 4NSKA 1BHGA 2ISDA 2EJ1A 4NO2B 4PWEA 4LAQL 2HJFA 5AVSB 2V9TA 2Y06H 5GGQH 1ZLVK 4S1RL 2O93L 3EDJA 3ULUC 5A6LA 3S2CA 5T3ZL 1WFJA 4KVCL 1F6LL 3K4AA 2IDQA 3QUMA 2ZCLH 3TO4D 2K70A 3B9EA 1A1OB 3FONB 1HHHA 3LRMA 1S7XA 4V33A 4YE4H 2ZQKA 5IJKC 2O5XH 5FW6A 4F37F 3L3IA 3UC0L 3CAFA 4N5EC 2YD6A 3WXWL 8FABB 4N8CH 1Z5LB 4WHTA 3APMA 3P0YH 3PJNA 4TSBL 4N24A 1JXFA 4Y5VB 1LO0H 5E4EC 4MCYB 2FIKB 1AR2A 3QQ9D 3R06B 1TYRA 5IK3A 1SJEA 3BAJA 3OAUH 1RFDL 3IDYB 4LZKA 3BAXA 4ODBD 4RDQG 4X5WB 3TCXA 2J73A 4IJ3C 2QSTA 5JW5B 4EBQH 2B1HH 2HTKD 4MNGA 2RH0A 4QHUA 1ACYH 1FNHA 2RJMA 3PWPD 4RISL 5T1LA 3BPOC 3N1MC 2RBLA 3F6IA 4I2XA 2FBRA 4ZW5A 5TJWK 2WXNA 1OTTD 3ASWA 3L17A 3UYRH 2Z1KA 2IV9A 4LLWA 3PJSA 1JGEB 3C08H 4YC2B 3LPWA 3P3YA 2LFEA 4Y1AB 4WUKH 4H8VA 4RLDA 4A2GA 2XG4B 3OLDA 4KMTH 3ZE2E 4YDJA 1F0LA 2XYCA 1AO7E 3N55A 4W9LC 4NHCL 4N0FB 3QJOA 1GZHA 2JMRA 2XN9D 4O02B 1Z9SA 3SE6A 4FXKA 1HH9A 1L6PA 4MJIE 5KJRL 3H6JA 3RVTD 1R5VA 1BAFL 3HA0A 4N2DA 4ESKA 5GS1C 2MCPH 3AS2A 1HWGB 3L7EA 4HV8A 3MJ9A 5DHXB 3DK2A 3GMRA 3PGFH 4U1IB 5F6HI 4AWJC 2W1NA 3B1TA 2NPLX 3BH9B 4OM0L 1DQQA 1AXTL 1JZEA 2Y7QB 3BAEH 1KTJA 3NDYE 1AHWC 4U3SB 3FU7A 5DJDA 2ED7A 3RX5A 4NC1E 5CWSA 3RGVC 3FUEA 3V7AE 2OL3H 4XMXA 4CSZA 3GRWA 2ICWA 4HS8H 3K6IA 3GMMB 3QNFA 4I85A 3WDIA 5K9OA 2CXGA 1NZRA 3RFZC 3LTVA 4YE0A 5E7BA 5FECA 3GUTA 4GP5B 5D7JD 3E8UH 4QMEA 2ZOTA 2HPTA 1NCHA 4UQCA 1DBBH 2VXVL 3SQBA 1OALA 2YXMA 3IAPA 3ZT5A 4MNQE 5L4MA 1ZS8A 1TKWB 4HCRL 4L9LA 2FR4B 3VU1A 1HH6A 4DPCX 4P2OB 4DQAA 4OFVA 1OB1A 4DEPB 2OMZB 4X99A 2ERJC 4PJEA 3WY2A 3OKNB 2X88A 2VB5A 4IBUA 1PNCA 4XPBH 1NC4A 4PRHB 3DMMB 3NSYA 5CJ8A 2NW3A 1MFAH 3UTSE 1W0VB 3SB3A 1BD2A 2HN7B 4PRIE 4UU9A 1GW0A 2PYFA 5B1JA 3RLSA 5KUMA 5ADPL 3QWRD 1I9IL 2ICWJ 2Q7AA 1MI5E 4N8VB 5GS0L 4BELD 4Z7QE 4Z95H 1T0PB 2BSTA 2ZCHH 1H6FA 1ZVSA 3LZLA 5FA3A 2AITA 3Q43A 4RZCB 4AZUA 1WAAF 3QRFM 5LUMA 3IGUA 2FATH 3EYQC 3Q8EA 1YUKB 2R9HD 5FUOL 2PNDA 3CC1A 4RCAA 3WY1A 1YO4A 2J8UE 2A9MH 3NQKA 3MLZH 3RJOA 3VM5A 1EVTC 2G3ZA 3LPOA 3QPXL 4FFZL 5CUSL 2J1WA 2ATAA 3LV3A 1MEXL 2BNQE 4QY8A 5SV4A 2WUBL 3D0AA 2Y5TA 2ADFL 3IJ7A 3V5DB 2BRRL 1HIMH 1MHEB 2YS4A 3F83A 3GIVB 3MKGA 1WO2A 4PTTA 4ZX6A 1XD1A 4QTHA 4GKNB 4AVHA 1KULA 1K8IA 3Q2VA 5MEND 4U1NA 3ZKNC 4LOEA 2K6YA 1QFHA 1A4CA 4PJBF 5DURB 4HPYL 3W56A 4RISH 4GSRA 1WICA 1A9BA 2ZP0T 1JS4A 3QDMA 43C9B 1DBKH 2PXYC 2DI8A 5I8KL 4ZS6D 5JZ7D 5C08B 1KEMH 3QUXA 5DSCA 2EDKA 2QQKH 1G5GA 3CSTA 5INCA 2J5LC 1UURA 4JG0H 4Q6IB 4OF6A 5EO9B 5ACLA 5F9JB 2DWSA 1R75A 1WUNT 3B2UD 1AZUA 3B9KB 3GPEA 4Y16D 4OJAA 1WWAX 2VDQB 1D5BB 3FMGH 5F88A 4ZXBC 3IM1A 4JN1H 4NKOA 3RFZB 2ALAA 5F1KC 5TF0A 4X6EA 1BVOA 4L8CA 2C4FT 1O9ZA 1BPLB 3QC5X 3MN8A 4IHOB 2VOTA 4JANB 5JOPD 1QFOA 2DBJA 2D7PA 1KXHA 2WINA 3KHQA 5IHHA 2QLVB 1YNTB 3GMMA 3HC3H 3MXVH 4X5QA 5EWIH 1A2YA 2ICWB 1FFOA 5D7KE 5T5FL 1KGYE 4Y2OB 3TCLB 5CU9A 5EIVA 1S78C 4F3FB 2EYTB 3Q1SL 2CBTA 1ET8A 1PD6A 3ULUE 3OQ3B 1JDAA 1IGIL 2BSCA 4D9RD 1W6LA 3X14B 5DQ9B 2PN5A 2MCG1 4LL1A 1UZGA 1I3UA 2D0GA 4OZ4B 3SPVA 1N5AB 1HH9B 4IGBA 4NN5B 3P2DA 4XMWA 4PHXA 4KROC 4H5SB 3T9WA 2FO4B 1OP3H 4R84A 1PQZB 1JPST 2E46A 1EO5A 1G9NH 1SNRA 2EDTA 3Q05A 3P4MA 2Z4QA 3SO3C 2E4TA 1DBMH 4KNUA 4Z3TA 4E41B 2O30A 2I9LA 5FO8B 4XCEA 1NFDB 4OIBA 2PYEB 5A2JH 4FFYL 1T3FB 3FU8A 1E4JA 4J4PD 4L3FA 3TA3C 2AANA 4XTRC 2F53A 4Z0BL 2OZNA 4I77H 1WA0X 5DT1H 3GQFA 5HYJE 2K3TA 4DO4A 3ECBB 2L0DA 4ORGA 4ZOAA 5DHYA 5CN1A 3EO9H 1A7NH 1KPRB 4XNQA 5KUKA 2WK2A 5DDHB 4CRPA 3IU3A 3ABMB 3IDGA 1QR1A 4Y4KB 1V3JA 1WP6A 2Y7LA 3L6FB 3UIYA 4XWGH 1ZE3H 2HRLA 2QDVA 4MAYC 3QJUB 3KPSB 2OMTB 1EDQA 2HA1A 4NNYA 1J48A 2XN1A 1JV5B 1CFVH 2EH8L 1J1OL 2XICA 4O4YH 2DRUA 5FPIA 3FRPB 2Z4TA 2VDNB 2BJML 4UB0L 1OPGH 5D1XA 2Y7OA 4HUUA 4R4FL 5JO5B 3ZK0A 4MA7H 4IRSA 1ET7A 2UZIH 3AFLA 1QI4A 4KXAA 2J43A 5HDRA 3QCVL 4UQBA 1AANA 1FG9C 1FA4A 2IH1B 5GJTH 1C12A 2J88H 1QBML 3LQZB 3BUQA 1EHKB 5D1ZC 2ZKXA 3X3GL 5B7FA 4M3HA 5D2NA 2XXGA 2R2HA 4H8QA 4PJ5A 5HI3C 3PWJB 1F6AA 3CHRA 3I6GA 2J8HA 5D6DA 5ECJE 2DH2A 3REWB 4IBYA 1N3NA 5KJ7E 4MHHI 3DXAE 1BBDL 2PF6A 2NY6C 1FNFA 5T33H 4NQVB 4X0NA 4NWUL 3MFGB 4WEUD 5FYJU 2H7WA 3GRGA 5HY9B 2F15A 5MEQB 4MXQD 2BFVL 4EI0A 3FS9A 2JCCA 3DO7B 1C8QA 3ATAA 5KOVC 1I7ZA 2AVFA 4YJZL 1T2JA 1OSEA 3RWIA 1TQVA 4Z7WE 5IFAH 3EOAA 4X80H 4N2KA 5E1HB 4G6MH 3IKKA 3NDZE 2VISA 2EIKB 2XQBH 3S34L 1ZDSA 1GZHC 2EYSA 3QWOB 2BVOB 1INQA 3QVAA 1KBVA 3ZZLA 4DN3L 2G2PA 3ARDB 3CXHJ 4H0HB 2VE6A 3B34A 3V6BR 2DM7A 5F89A 4ATTA 4HYTB 3HC2A 2MEJB 4X8JB 3N1FC 4D0DA 1I9RL 4MAYA 1JI1A 1OARL 1AE6H 1IBFA 3MRQA 4ALAH 3VWJB 3KWUA 2ZKHH 3ZE2B 1ZGLB 5I30L 1JGDA 2ZPKL 2XWDA 4U6YA 1PFCA 4FNLL 1RK7A 4LEEA 3GJFA 1UM5H 2ENSA 3UAJC 1HYSC 3H56A 3RNQA 4OQTL 2J5LB 1T89A 5I1DB 3BC9A 5EU5B 4AMXA 3A3YB 1QSEE 5CZVH 4I3SL 4M6OH 3KD4A 1WIUA 4PJ9C 4FA6A 3MKKA 4YLQT 3HFML 4YSAA 5HSFA 1FZJB 1XHHA 3FU0A 1F4XL 5DHVB 4C83B 4U6VL 4KKPA 4LSDA 3QUML 5EIIG 2SEBB 3N9GL 3GZQA 5F3FA 2ZKYA 1J5CA 1YNLL 1HXYB 1IZKA 1TLKA 4OT1H 2HRHA 3MROB 4PP1D 2VXQA 4I9WD 3RWDB 3E6HA 1E5AA 3HLAB 3CMOH 4G6FD 5JLZA 5HYIA 2OR8A 3WAKA 5KVDH 1CZ8H 2B16A 5ANMB 4TS6A 5IFHH 4DEWA 4E0RA 3RTQD 3VRJB 1JZ4A 3BQUD 1ZGLP 4ZO7A 3EO1B 3UG3A 1QEWB 4MKTA 4YLBA 4MA7L 3NJLA 5D70H 3OZ9L 2Z3FA 4KDTC 5DJZA 1T5KA 1ZVSB 3DX1A 4N2LA 4IJ3B 3KPRD 1U30A 4UQ2B 3D52A 4NQDE 2CUHA 1DJIA 4I5BA 3FTXA 4IEFB 2OW7A 4XNDA 3WTUA 5C8JA 3T2QA 1E4WL 5JHBA 1J0KA 4OQTA 3H9SB 4N20A 2ZX6A 4R7VA 3I9AA 4H8HA 4JFDE 3WENA 5EBMB 1YLBB 2YJQA 3HE7A 4LL4A 1A7OH 4HG4J 4B97A 4FFTA 4WUUD 3C8DA 5D6CB 1L5GB 3ZDXE 4C54A 2ITDA 2Q2EB 4HCGA 3V0HA 3UFIA 3TXAA 3FH8A 3BWAA 4ES9A 5T3XL 3E7JA 3G6AB 3I75B 5F7EH 4KRPD 2R4SH 3CZGA 4QRSB 5DFAA 1RUMH 2O6EA 1BAGA 3KL0A 1OP4A 3C75A 2AJVH 1YN6A 2H1LM 1CFTB 3W9EB 1YNKH 4L29B 5I5JA 1KF9B 4ELMB 3DA0A 2V9RA 3RIKA 4X4KA 1PEWA 2VDRL 1YNTF 4M56A 2X3AA 3JV5A 2ENPA 1EFXD 5GISH 1S4IA 4E41E 1UXWA 5C0DB 5CEYB 4FZ8L 2C1PB 2ICEB 1FG2A 4LEXH 1DSYA 1KLUA 1S8DB 3ZUCA 3NIGE 5T1DH 1D9KB 5AG8A 4HS8L 1U93A 3BVUA 2EC9U 3ULUD 1YYCA 2H5UA 2CRYA 1QRNE 4KOCA 1NEUA 1X5FA 3GMRB 3QPKA 4U1IA 1JUFA 3QJHB 1I7ZB 2BVQA 3UTOA 4HAFA 4CN6A 2H2SC 4N3UA 5CN3A 4FI7A 4FP8H 4MA8L 1AYRA 1CLOL 3WFCL 4EE2A 1CO1A 5CHNB 4FMVA 3CFKB 4UV7L 3AAZB 3IMVA 1XGTB 2Q8BH 3FUFA 1NGQH 3O81A 2EDOA 1MCWW 4XNUL 3E9UA 5I26A 4QWWD 3CXFA 4LSQH 5I74B 3L9YA 5KYYB 5T1KD 1LO2H 3QFJB 3CFIC 4LLVB 3U25A 2D9CA 1BXUA 2Q20A 4LRIA 3QJZA 5AB0A 4L1LA 1KCVL 1I85A 2AV7B 4NZJA 3P9LB 5BV7L 2NZ9C 2WYZA 4N28A 1KB5H 1HZLA 2V4LA 2CBMA 3LMJH 2CLVA 5HPMB 2H1XA 4FL4B 2PPAA 2Y6SC 5EF1A 1A4AA 4F7CB 1UJ3C 1MREH 4U2YA 3C6LB 5ACZB 2CK0H 5C0GB 4IRZH 3K6FA 4BFNA 3EJUA 4Y5VA 5GS0H 4LQFL 4X6FA 2OTPA 5KYWB 3U0WH 5G4OA 5JW3H 4G83A 2QFPA 3OSKA 1QQDA 2UZXB 1TTUA 4DOHE 3B2VH 1U8HA 2CM5A 2OSYA 1KBGH 2IGFL 4Z9KB 1TTFA 2EVGA 3EHBB 5K59E 4M7JL 2O6CA 4MCZB 5KSBF 2ADFH 3I85A 3VD5A 1TFHA 2CRMA 3B9VA 3HE6D 3Q44A 1G1KA 2NYKA 1MEXH 2WIMA 1X6LA 4OUUB 3HAEB 1TJGH 4M6NL 3TA3B 4BXVA 1XWVA 2ZE0A 5TDNA 1UB6A 5KVMC 3P77B 3LOWA 1AQMA 2ZWSA 2GPZA 2X1PA 1IM3D 1XSIA 1I8IB 1TQUA 4G42B 5B3SB 4N68A 4O2FA 1JPEA 2N7BA 4YXHH 2ID5A 2HVJA 2IJ0C 2PP8A 2XWJB 1UM6H 4Y4FD 3HS0B 3UZQB 4QXWA 4UT6L 4A2DA 5IJVA 3FT0A 4NQQA 3O8XA 4X4ZA 3V5HB 1OCZB 2C7FA 4DGIL 3RUGE 1ID2A 5D1QD 3QCUL 4K9EC 4PQXA 1NAMB 1AQKL 2HG5B 3QJXA 3Q2LA 2JI3A 4H25B 1Y1DA 4HDIB 3UYPA 2X4UB 1JGVH 4QRUB 4YSSA 2NSQA 1NCCH 4LL9A 3WIIH 4QRAA 3SKJL 4XZUA 5HHOB 4LCVA 4JRFA 2GTZA 1GW6A 4OLZH 3LHPH 5F7YC 2OYPA 3VE0B 2NY7H 4UCFA 1C1EH 4G71B 3BZFA 1S9VA 2ZXAA 1VFUA 4AQ1B 4N2MA 3NPSC 2Q87A 5FCUH 2NX5E 4MAUL 3UDWA 2ZXDA 4A7UA 1DCLA 2V8MA 1U8KA 3MODH 4Q7DA 3TFBA 3FH7A 3F01A 2VZ3A 4KK5C 4QHKJ 4Z7QB 2P8PB 2IGTA 4IU2B 4NEHB 4JKLA 4NZTH 4R5XA 3EYOB 1M2OA 3SPCA 5TDPA 4N2GA 2IAAC 4HJJL 4CC0A 4FQCL 4LCYB 4QJ3B 3WYRA 2B0SH 3EYFB 3LVEA 2Z35A 2AXFB 5LDUA 1A3QA 2O5ZL 4K15A 4LVHB 1XCXA 3GDBA 3GM8A 3DLQR 5TE7L 3QS2A 1XR9B 5CJ5A 4DKEH 1R5IB 3PQYE 1M42A 1W0WA 1KPUA 5DMIH 5GGSY 2PWDA 2QQLH 5EMYA 1OT2A 3WD5H 4JRXE 3K2MC 1RUQL 4WJG3 3PG2A 3C5ZA 2N01B 4FXTA 1IGJB 1CD9B 3ARDC 3D6GA 5GSVA 3LIZH 4ICXA 1IL1A 4M8QB 4DETA 4OY9A 2MQCA 1PYWB 4B9PA 1KCSH 1M05A 3CD4A 2TRYA 1NBVH 5F9DC 1JZ7A 3GZOA 2HUEA 4KDVA 3CHSA 3SOBL 5JNYA 3BOVA 3VFOB 1UH3A 4N2NA 2BCKA 2AI0H 4M1DH 3EJZC 2YMOA 4FADA 3STZA 1FNEA 5JDSA 5FDWA 3H9SE 4RFEA 1CT8B 4I9WE 4XXCA 1XCQA 2PPEA 1NCDH 4I7ZC 5K9QI 5BO0D 5HHXH 2AXGA 2B7DT 2RCSL 4O02L 2CHNA 2LFGA 4JO4L 3ZX1A 1JGLL 4MDRA 3DNKA 5EBWB 2XPYA 3JWDC 2W0KA 1X5HA 3MLRH 3TJPA 4A2FA 5SWZB 1RKRA 3L1GA 5LBSH 4R90L 3WL9A 3DTXA 4QHMA 3FTZA 4ANUA 4HH8A 4JDEA 3D06A 5JOFA 2VMJA 1HL4A 3PP3H 4LEBA 4ZD3H 4XP4L 3EFFB 4YK4B 2WYTA 4I3RH 1W8NA 3NCMA 5JUEL 4GRWB 2OMVB 3LKOB 4IU3A 5F7BA 4JZJA 3P9MA 4PRHA 5H35B 2Y7QA 1DQDL 1KCUH 1F97A 1USZA 5DVLA 1ND0A 1CE6B 1P6WA 5GIRA 3FL7A 4QXUL 3BSZL 2LU5A 4A2MA 2X4OA 1XBRA 4HVBA 3GZKA 1SF3A 3TN0C 4FG6D 4NO3A 1I3GL 3HPJB 5DD3H 1SEBA 3R1GL 1AQDB 4WUUE 1XB6A 7CGTA 4TM9A 2FL5B 1ZSHA 2GBAA 1XZ0B 3NH7L 2NUPA 3OZLA 1W0YT 3QIWA 1KCRL 5DJ8A 1UCBH 4FERA 4P57B 4AEEA 3G6JF 5SX4I 4ZQKA 3KXFA 4XP1L 4YDKH 1NKRA 4MDJA 4NBZB 3EYSL 1JZGA 3ZKXC 2VJ8A 2FUQA 2WANA 3D33A 4RESB 5I82A 4F2MA 4G8AC 1OD7A 3QR0A 3HN8A 4I4WA 1RHHB 4XRCB 2WXPA 4JM2B 1R17A 2O5XL 4UZUA 3ML8A 1V05A 3MRPB 3O2VH 4EUPG 1OARH 5JYLA 1VGKA 1ZT7A 2GSIA 2F5AH 2YO3A 4H88H 1W8OA 2WBJC 4K94L 1M7UA 4X5WA 5LAPA 3VX1A 4TRPL 4D8PB 5DYFA 5C07B 1ZVYA 3FTUA 3AITA 3MRIA 3R06A 1R0AL 2MFNA 5HI5C 4U7KA 1GHFH 2OX5A 4FFZA 4Y9FA 3T4YA 4KTGA 3ZSTA 1BLNB 1BQ5A 1YEEH 1CXLA 1IGTA 1GJIA 1MHPL 4HJTA 3DETD 1E3FA 1DQML 5EUKB 2XN2A 3KH3A 1DVQA 4WGWB 2H3XC 1OCWL 3K2UH 1R46A 5E9AA 1F11A 3VXMA 1UHVA 3LY6A 3MV9D 2QTVA 2P47B 3D85A 4XVOA 3SJVE 4JFWA 1NCBL 4ANXA 2C3XA 4ZQKB 2DQJH 4RNRB 2AEOA 5DJ6B 1KJ3H 4NKIL 2NQDA 2Y72A 4ZS7H 3VSUA 2BDNL 2XN9B 3O4LE 5HVHC 4UT9L 2CHXA 5I71C 5IMLB 2VAAA 2ZOKB 4DERA 1J18A 2ZOWA 4RGNC 2X70A 1YMMA 3CFMA 3U4BL 1T1ZA 4KQ4H 3Q5OA 4AY0A 4MCYA 3VX0A 1QEXA 5ALBL 2FQEA 3OXSB 3VB8A 2CU9A 2ZUQB 2BXZA 4GW1A 2XY2A 3TNMB 4DGYH 2HLAB 3WNPA 7FABL 2IPTL 4F8NA 4PJCB 1EO8H 3S36L 3HZYB 4EZLA 4GI6A 4OJDH 2ZNWA 2P8LA 3I6LE 2QGCA 3LDBC 1PDKB 3PWPB 3FAWA 3KLLA 3QCTL 3CX5K 4U6XB 2DTML 4W9DC 1JE6A 3PXLA 2HKFL 2PWHA 5I9QC 4MLSA 3SY0A 2OL3L 3MGAA 4L18A 3CE1A 1UZ8A 3WL9B 2VLLB 3SKMA 1EXHA 5C0EA 1SVCP 4NO2A 2ATPA 3L5WB 3QXTA 4X9FA 3KS0H 3L9RA 1DZ0A 3CVHB 5I1GL 3CCHB 3WEMA 3ILQD 3VJ6B 1GIGL 4HUXB 3ASOB 1MOEA 4QKXB 3GHPA 4X8XA 1I1AA 35C8H 1OGTB 2IH8A 3OLEA 4ZJ9A 2OQJA 5E8OA 4M1CC 1OTUD 2IQAB 5KVEH 2BY3A 3T0ED 3FQ4A 4QAMB 4D0CB 4KZDH 2VTFA 3CFUA 2NSMA 3CFJB 4XMPL 4LBEA 1TVDA 3VCLB 3LS4H 5IGXL 2FCBA 2JXMA 1RZFL 1WFMA 2B4CL 3TGXA 1TQBC 4UTBA 4LPWA 1DVFC 4PV8B 3EXJA 1MNUH 4UT9A 2Y9RT 3FUNA 4PGCA 3VFVB 1N0LA 3DBXB 5LLIC 1EO7A 1HNGA 3KGUA 3MNVA 5ANHA 4MKMA 5DI8B 2G75A 3IJSA 3MV9A 1MCEA 1MFDH 2DQ6A 4JGMA 5DQJA 2DYPA 3MMEA 4OZIA 2Q8AH 3JWNH 5D1QC 4KUZL 1JPSH 2AQPA 1S6NA 5F72S 5A2IH 4GG6F 4HKZB 4M6ML 3KCPB 5IEHA 1P7BA 1KYAA 1SEQH 4X4YA 2ICEC 5GJTL 3FCTB 3ZKMD 1PAMA 2J6EH 2OAAA 1F56A 5CIPA 4J27A 4CU6A 1ZHKB 2W65B 1LNUB 1YEFH 1HAUA 4WKZA 1A7PL 3NIGF 5I6XC 3HB3D 1GTNA 2JIXB 3CN0A 2F7QA 3OKDA 4JFZL 4YWGL 4P49A 4YNYB 4IS6B 4BINA 2V17H 1MPAL 1BQHA 1DJXA 3WJMB 1CK0L 2DM2A 3F7YB 3BEWB 3FF8A 1BF8A 4PJDF 5F6IB 3V6OC 1J1PL 2IAMA 5HYJB 1UADC 1D5XB 1UATA 4N22A 2ATPB 4OZGF 2PWGA 4DKTA 1TJIL 3BPLC 3ILPB 4NENA 2J20A 2CGRH 3MRHA 2H0JA 3QORB 5E8NA 1YYLL 1AO7D 2BNQB 2XWEA 2KT6A 5DA0B 4CBPA 3LIZA 1IQDB 4G8GB 4BCXA 4E9WA 1WYJA 2RACA 3HZYA 4ZRGA 3Q3GB 3IETA 1JTOA 1D5ZB 4AZ8B 5LVEA 2NZ9D 1TCRA 4PRBA 3V0VA 1A4BA 4EO5A 3WJLA 1BD2D 1XL4A 4ZI8A 2WO3B 1GGIL 1I7RA 1MRCH 2V2WB 4GEJA 1QFUL 2HT4C 3CVCA 4GY4A 4KPHL 5HHVH 4YDLB 1SXZA 1T89C 2BP0B 2VXUH 3IMBA 2OTWB 3RDTB 4J12A 5IFJB 2JKNA 4YH6A 3B7YA 4U6HB 1A5FL 1H5BC 2AERT 2BNRE 2ZXQA 1FL5B 1TU2A 5FK9B 2R0KL 2OTUA 1FCCA 2DEXX 5DJYA 2ADIA 1SHWA 3VXTB 1YY9D 5ABZA 3T0AA 1S46A 3AXIA 3VI4B 4K7FB 1GYWA 1XTLA 4XMLH 2H2PC 3DX7B 1A7RL 1D5IH 3HC0A 1ACZA 4M7LL 2VRKA 3U2JA 3VXOB 5KSAC 3SPIA 1VACA 4HFUH 3C60B 1KBKA 1T04A 2G9KA 2A77H 1AOZA 4UDUA 3CFEB 4Y5YB 3EGXB 1KZQA 3CLWA 3M8OL 1OF0A 2G2RA 5E8PA 2J1XA 3LQAL 1GC1H 3ABGA 1FGNL 2EUXA 3KWWB 4GMTL 2Z91B 4XCYB 1LEKA 3V55A 5KYXB 5IB4A 4Z7AA 1A3LL 5EPMA 2QT6A 1Q9LB 2DKSA 5K39B 2GY7B 3D4ZA 2BSDA 1LP9F 4TL5A 2VERA 4L4TE 3RA7H 3ZZQA 3QPQD 4QTFA 3ZL4H 4Y1AE 3MZGB 4UUJA 1N0XH 2QELA 3BQUC 1CL7L 3GMQB 5IR1A 1Q9KA 4NAJA 2H9GB 1HYSD 1I1YB 1MWAH 3JWNC 5KBMA 3D09A 4JFQB 2J56A 4L8DA 3WNJA 1BEXA 1NDGB 5MENA 1JRHH 5FYJL 1JP5A 3V4PH 2NXZC 5FGSA 1VEOA 4JKNA 4B41A 3HPJA 4QJ5B 3UPRA 3FN0H 3MRRB 2PW2B 4OZIF 3N1QC 1T5XB 3TJHD 1FVDB 2EO9A 3TYFB 4C4BA 2W8CA 3QI9B 4G6AC 3HB3B 2VUOA 1BBJA 1FPTL 4ZDHB 1ICTA 5MENE 3K6OA 4KU1A 1C7TA 5DMKB 4HMDA 2HFGL 3EO0A 3UGUA 1JWUB 1CC3A 4I3SH 4AUJA 5DJ0B 3QE5A 2YR3A 1XGPB 4JDEB 1QP1A 5IBUB 2YARA 3F12B 3L3HB 1E8XA 3Q06A 4M29A 5FYKU 4KO5A 4GO9A 3RGVB 5ICZB 3K72A 3ZHNA 3CVDA 1P4BH 1HL9A 3KPMA 4FQLH 4G6KL 2DZEA 2B0SL 3VU2A 1FNAA 3T6QC 1KGWA 2F61A 4AYFB 4HPOH 4KROB 4OZIE 1INEH 2V3FA 3G6AA 3OPUA 2Z31B 5F7UA 1XCQB 2MHAA 3FSVA 3TH4T 1RZKH 2WQUA 3O4LD 3BAIA 1XEUA 4UIMA 3ZQWA 3AG3B 2YQBA 4MSWB 1WCBA 4G9DB 3KW8A 1UYWL 3TEUA 1CQYA 1L9SA 1ES0A 4BJLA 4J3OH 3K71A 5CZXD 2ZSWB 1IM3A 1HI6B 2Q7NA 4UTAA 4BFGA 2V7NB 3BEVB 5D7KD 4CNIA 4ZUUA 3O9WB 3EGSA 3TO4A 5I73C 2KL6A 3I6LD 3GMPA 5I66B 4DO5A 4MA3B 4UNVA 5F93C 5KBPA 5E9DA 3EBIA 2QLYA 3EOYG 3J07A 1IGCL 3CBJB 3MRHB 5C9JA 1B9KA 1GC1C 3SCMA 5BVJB 1I4FA 1XGRA 1NAMH 4IJTA 2OBGA 4ZNEA 1DLHB 2BIQA 3WNLA 1FYTE 1X7QB 1BIIB 3GRWH 4X4ME 2DMBA 4ODTL 4H8WL 3MBED 4F24A 1IV8A 2NY6D 3V9CA 3BVNB 3MLPA 4FX5A 4LXFA 3BZDA 4P2RD 1ZHBA 4LSUL 4A55A 2QQQA 4HPYH 4PRPA 5HI3D 3CZJA 3WMQA 4F8TA 3BHBA 3QAQA 4M6AA 1H9VA 2VMFA 4PWIA 1A3LH 1RXLA 4BK5A 5F7HA 1TENA 1NFIA 3KVPA 2PO6B 4UTBH 1ZDQA 5HYJD 3KHOA 3N04A 4MDIA 4YEEA 5HGAB 4C83A 3FO0L 1T0OA 3BSZH 3C5JA 5EU6D 4IYKA 4OLWH 4I89A 1HQRB 2WVUA 5GGUA 1N68A 4J3SA 2WJ5A 2B5IC 1VF5C 2VYRE 3HPLA 1MQKL 3LH2H 4RZKA 1N59A 4PJAF 3H42H 4R5TA 1LM8V 3MV9B 4ORZC 1BVZA 3V7AG 2X28A 2ZKMX 3LZNA 1RZKC 4F58L 1MY7A 3S8FB 2AV1B 2PR4L 2Z9TA 4FCAA 1I53A 3SDCD 3STLA 4B0MM 4UTCA 3HHSB 4PJIB 1HEZA 1ORSA 2CDEA 2P9RA 3D0LB 4K5OA 4DKDC 5BCAA 1RMFL 4DWHA 3K71B 1QUNB 3WNIA 4J3VA 3V0IA 4KAQH 1UT2A 2HFEA 4Y4KC 5TTRA 3KPRA 2QADD 4MJ6B 4ABWA 4A6YL 5HHQB 1VCAA 1O6SA 4MD4A 3T4AB 5IBTH 1FGVL 3A6OA 3EYVA 4HCRA 4U3XA 4TSCH 2BWDA 3BVVA 2ZWKA 3N5AA 3IE9A 4EZKA 1B0GA 2GC7C 3G5YA 3LB6C 1ZLVH 3RGHA 4JFPB 3ULVH 1PU0A 4KROD 1UWFA 4U33A 4M3JA 2HX7A 1E9PA 4I18A 1RZKL 4IMLB 4XH2A 2F19L 5B8CB 1KJ3L 1NC2B 4NKIH 3GBDA 5B1AB 2TSAA 3GKWL 1SYVB 1XEDA 5A3ID 2AZUA 4ZMZA 5CF3A 1TCMA 4ZAKD 1TQSA 5F0MB 3OJDB 1D7FA 4PVNA 1YEGH 3O6MH 2GFBA 2J6WA 3SDCB 4WRLA 5KS9B 2WZ5A 1FLRH 5C92A 5J3HC 3D07A 5EIQA 4PU2A 1U8NB 3HI6H 3MRRA 1EERB 1WQVT 1H3VA 5IHUL 4W93A 2EIZA 1IAOB 1XAUA 1WF5A 2BSEA 3X3FL 3U9WA 3KYKH 1A14L 4ODSH 3MLVH 3X1GA 3WFZA 4EVNA 3FQYA 4BZ1H 2W9LA 3T3ME 2Z7YA 1QASA 2NY3B 3KGSA 4J3TA 4HU8A 4Y1SA 2NY0C 5AD0B 4RNRA 2OL3B 2OMWB 4PGZA 2EDJA 5IHZB 4AE0A 6FABH 2HMIC 2QQLL 1ZE3C 4MQTB 1SJMA 4YMPA 4JFXA 4E9QA 1WGVA 1VHPA 3T8XA 1S5HA 3VD1A 4EPSA 1NC2A 4TTDC 1NGWB 3UPCA 2BP8B 3S8GB 3G5XA 1EHXA 4URKA 3T6WA 2UX7A 2OJZL 4AVKA 1QSED 2ZXWB 1S78D 3IU3B 1U93B 2GC4C 3L4XA 3F00A 2P7TB 4JB9L 1FG2B 3UO8B 1B4RA 3W37A 1ZJBA 4LSTL 2XBZA 2JCWA 3IN2A 4JMNA 4FNPA 3C09C 4JBSA 3DRTA 3UP1A 1NUFA 4YS4A 1BG9A 2EXTA 4PR5B 4NN6B 2X6AA 3U1QA 1MF2L 3DJ9A 4XCEB 2ZCLL 1F5WA 1YN6B 5IV2A 1Z0NA 4EQ2A 3O41A 1W2KT 4PJHF 3QZLA 3BDYL 1T2XA 4JKPH 2X2JA 3D39E 4WW1A 2CDEB 5AAWA 1GOHA 1IIKA 3DUUA 3MGOB 3MLRL 1HEZB 5JHDB 1FLTX 3ATFA 4MS6A 3UMNA 2FL5A 1KB9J 2VM9A 4YDNA 1H6TA 1FFPA 1J1XH 4FQJL 1MW1A 4OF8A 2WLYA 5TDOB 4JNXA 4ZOEA 1URZA 5JZ7C 1CLVA 4PWKA 1NL0H 1Z9OA 4Z7NE 4R4BA 4OM1L 1QMUA 5LXGL 2Y2WA 5AENA 1WV7T 2R23B 2WYIA 1GYAA 3HBZA 3LN5A 2DI9A 4GQQA 4E9SA 2GCYB 4PGDA 4Q9RL 1AMYA 2AHIA 3KPRE 4LF3B 1J12A 5FOBB 4IDJH 3DDGA 4K8RD 5BV7C 3ULVL 3FCUB 1MCHA 1AZCA 1OCCB 2LQRA 4XN5A 1AGCB 5E70A 1RZQA 2APBA 3OB0K 1NANI 4DSYA 2AJ3B 5FAAA 2ARJA 3B2MA 2OM5A 3CDYA 3QBTB 4LSPL 1JNLH 3WAJA 1CFQB 2HKHL 5CLYA 1TLMA 5EZJA 4ZBJA 4Y19B 4RA3A 3NZSA 1D5XA 4NJAH 4RQQB 2DS4A 2C3HA 3MYJA 3DYOA 5ANMA 5LBGA 2R83A 5FUZH 4GW4B 1LWHA 5G5DA 2NY2C 4N85A 3L4UA 2XPGA 3WXVL 2D3NA 1GGCL 2EE2A 1A02N 3OKOA 1G9EA 4PLKD 5F7FA 2OW6A 3ARSA 1KWGA 3OKDB 1Y7VA 3VFGH 4WW2B 4CW1A 3L5XL 2FQDA 5IP4A 4Y0GA 3KNBB 3DX6A 1WPCA 4DCQB 2OSLB 2Y69B 4HJIA 3DV4A 5CBAA 2V2XB 4Y4HA 1FO0A 2YAHA 4N8VG 5IW6B 1AD0A 1RK1A 1F1GA 4JPVH 5IKCA 4DVRL 2B15A 2D3VA 3RAJL 1XF1A 5FM8A 2V6HA 4WWKC 4PJFA 5EEVA 4YC2C 1RI8A 3EHBD 4RMQA 1UZ6F 1BZ7A 1V3LA 5ID1A 3ZYJA 4JY6B 3LNFA 3UTZB 3IGAB 1P5VA 1ZIAA 4JLRA 1UXSB 1SLUA 3BWSA 1QWHA 1YN7A 2DKUA 5FA4B 1D5IL 4KZCA 1D6VH 3MRGB 4HFUL 3RKPA 4GFXA 3F62A 1HK6A 5EEWA 3S97C 2C7UA 1ITBB 4RWYL 2L3BA 1IJ9A 1ZANL 3MLTB 3BKMH 3AW5A 4CVXA 2NX5B 4UU9B 5DFVC 2KLSA 3NJIA 5HYSG 1U8QB 1YMMD 4BWUA 4GFTB 2MOVA 4WFEE 2F54D 1VZGA 2P52A 1G6RL 5ICYA 1KLFB 3QQDB 4IKKA 2E3VA 1EZUA 4OB5H 4ZDHA 1SQMA 4YSEA 2LLGA 4BKSC 3DVGA 1UENA 4FLOA 3ZSSA 5LN8A 3SKMB 3QJFA 3OAZK 1T21B 2OMZA 3LNIA 3SN6N 1TJHL 2OZ4L 2VABB 4JHVA 3SY0B 2ZNXA 1KG0A 1UJ3B 4IHBA 1BECA 3HRZB 4F7PB 5ESAB 3V79C 2XZCH 4Q9RH 3VQ2C 3ULVD 5TGBB 4RRPG 1CWVA 4LPVA 5ADOH 2BWQA 4KKRA 1NJ9A 3DX8A 3ARFC 1K6QL 2RHEA 1ESOA 3TEZA 4WK0B 1ZTXL 1YPZA 4JO1L 4AITA 1SPDA 5KZCB 3UEQA 1J5DA 3ULSB 1RZJL 1YEHL 4HXBL 2YD0A 1QRNA 1I8LA 4NOBA 1EEQA 3GSXB 3QQ9C 2UWEB 2AJZB 3VSQA 2W92A 2VXSL 1ZV9A 1KCWA 5IY5B 4MXWL 3BH8B 1EJ6A 3DX2A 2FBJH 1CXFA 1XGZA 1QZ1A 3P2TA 3HHMA 1OCRB 4FQ2H 4I0CC 4MNHA 3RKDD 1A1MA 1NIFA 1FF5A 4DAGH 2C9RA 4ZOBA 3VFMB 1LE9A 4NS0A 4GSUA 1E28A 2HRPL 4HH9B 2UY6A 3BWUC 4PJIE 3MRKB 4LVOC 4TVPD 4WJKB 4CSTA 4JQIA 4A68A 4AIZA 2VLJB 2KZ1B 4XNXH 5DMJB 1I8LC 2WXQA 3G5VA 2XJKA 3EF4A 4G59C 1BLNA 4ONFL 1EZVY 1QR1B 2ZCKL 3FB5B 2EVFA 4XVUC 3COOA 1NGZA 4HLZH 2EICA 2MKLC 1XBDA 3ILQC 3K2IA 3EDEA 4QLRA 3UTTB 5G4NA 4BWWA 4L2YA 4EN3D 5J9PB 1RJYB 2IDCA 4WV1B 4P8QA 4CILA 5M7QA 5F7DB 2QKIC 3QEQA 4GUQA 3GXPA 2FD6H 4HJSA 3NABH 4MMYB 1RZJC 4WU5B 3QXWA 4KWUA 2IEPA 3FSOA 4AYEC 1KJ2H 4I0PC 1M9WA 1CK0H 3X1NA 1PZ2A 2ZUVA 1AVAA 2PYEA 4UOZA 4PLKC 3VQ1C 2ITFA 3P4OB 1T1YB 2F74B 3OKLA 2CMRH 2R2EA 4N5UA 2AMGA 5DRWA 1QWUA 1AQ8A 3QYNA 1T1WB 3FCSA 4PG9B 4BK5C 4D9QE 4NQCB 4BE6A 1TCRB 2WLHA 2X44D 1MUJA 1QA9A 4MD0A 4ODXA 1PQZA 5DUJA 4L3CA 3ROOB 4KZDL 1H15B 1ZEAH 5F96L 4X6DE 1IE4A 4ELME 4POYA 3ARBD 4H5SA 5EOTA 3ILDA 3H1ZA 4TNVK 2EECA 3Q8AA 4KTDL 1LE9B 2F5BL 4FXGB 4ZXBB 5DC0A 4YQXL 4KO6A 1KIPA 1OCWH 1L0YA 1NLBH 5GQBA 3SZKC 1CFNA 5GIRB 1EAOA 4L8SB 2P80A 4EVNB 5JW4Q 2EE3A 1CE6A 3I02B 3GIZH 3OMNB 1OAXH 2BDNH 3G9VA 1HHKB 3IWVA 4AUYA 3NZ8B 5ICYB 4NCDA 2I9TA 4LPXA 2W60A 3VGGA 2NY2D 4YGVB 4YBLB 2AXJA 5MHSE 3FFCA 3WJMA 2FJGB 3QCUH 4MMZC 4GAFB 1OTSD 2X3BA 4DGUA 2Q76A 4U3CA 1MQKH 1LHZA 2WOBA 1WT5A 3NCXA 1CMOA 1GGYA 2OZ4H 2W65A 2O26U 1FAKT 4Q9QL 1WS7A 3CZSA 1GRWA 4X42A 4JHUA 1P1VA 4P23B 3FJTA 3KZ8A 1U36A 5GZNA 3DRQB 2V17L 4YHNB 1IKOP 2C4XA 3P11L 1G7LA 4ZPVA 3BP7B 3FPYA 3BJ91 3Q5YA 2E27H 3IJHB 4X98B 4HMEA 1ZTXH 3GS0A 3UO1L 4H20L 5EBGA 2AMUA 3US0A 2R0LH 2GKIA 1R3HA 2NXYC 3NRQA 5FDYA 1TJIH 4PJBE 4DGVL 2YC1A 2B9BA 4MB3A 2NLJA 1RPUA 4U1NB 2X4TA 4A7SA 1SN2A 2PXYA 3H0TA 4NQDB 3SIKA 4AQEB 4N0RA 1YJDH 3PY9A 3LD8B 1TQCC 2L7UA 2VUKA 2B1HL 5IVXA 2GJJA 4LLMA 1NM4A 4AGLA 3LB6D 1F3DJ 2JSFA 1XIWC 4FE9A 5B21A 4TL4A 3US9A 4XBGB 4N9GA 2YZ1A 1TF4A 1DLFH 3JV6B 5AW2B 3FQNA 1KXVC 2J8OA 4L4VB 1AMXA 4XO4A 3QNYA 3G6DH 1I1AB 1ERNA 1WAAE 3G08A 4AXWB 1TZHB 2ICCA 4TUOB 3V0WL 3ZRCC 3CVHA 2ZD0A 1WA2X 3MROA 2BP5M 4AQAA 1JF6A 1SHSA 4P2QA 5CEZH 2DLHA 1HZHL 4O00A 3MRCA 4PCYA 3B37A 2L8AA 4HPHA 1KEGH 3Q9PA 1JPSL 5EC2A 1G7QB 5B1CA 1J5OL 4WI5A 5IB1A 5SWSB 1O9WA 4R97C 4GG8A 3J2PA 3A4EA 5C0CA 3MLSL 1KXTB 4KJPD 3L1EA 2ZYRA 2ORBH 4Z76B 2X9ZA 5DO2D 4XZUB 3VXUA 1ZLSH 1R4XA 3D2UD 4ZUVA 2AK4D 4QRUA 3U46B 1EQWA 4DUVA 3OKOB 3IDXH 4AIXA 4A7GF 1DANT 3MLVL 4QXVA 2OMYA 5AOKA 5IJBC 5DGRA 2E7HA 2DMHA 4H1LB 3EZJB 4GLRH 4ZTOL 4B9JA 1PZAA 2ZWZA 2MWCA 4PCSA 3CFQA 3GK8L 4Y4KD 4FEIA 5C9KA 5JW4M 4HULB 2AJ3A 1KB5A 2WMPA 4QYAA 1MCBA 4FQIL 3VWJA 3LH8A 1RULH 5AB9A 3VD0A 5DEGB 3DX3A 1K2DA 3KM2A 1JWMA 4QRPD 1I8IA 4ELKA 4MAYB 4KKZA 3MCKA 1SN0A 4KQ3H 4ODWA 2P24B 3CN1A 2WBXA 2XLLA 3ZDYB 5HI4D 3QIBD 4CNIB 1BVNP 1F8TH 3HZKB 5IZ7A 3WUWA 5HDBB 2AVGA 1P4UA 1Q72H 1YMME 2R23A 3NZHL 3OKMA 4LRNH 3HG1D 2ZF8A 3AGWA 4HWBL 4YL4A 2P7TA 3TA3D 1B3JA 1QSFD 4ZUWA 3V4LA 1U95B 4WWKB 4J28A 2DQFB 25C8L 1MVUA 2CJUH 1RY7B 2ZAHA 5HHVL 2R2BA 5E6IA 3PE9A 1FPTH 4JREC 3QUZD 5E2VL 5E4OA 4UIKH 4EI5D 3RU8H 1BVLA 4BFIA 5LGHL 4UF7C 2VMDA 2R0ZH 2BW5A 5I0DA 3ZLQC 4ZAKC 3OZ9H 2VDQL 2H9GA 3F12A 3X11A 4OM1H 5LXGH 1UC6A 3S96B 2A0LD 4NN5C 2XRAL 5I17A 4PJAB 3VFUB 4GRLA 5AOLA 1BREA 3T0EE 3EJJX 4L1SA 3NJFA 2G9HB 2PTTA 2XTJB 3QJTB 9CGTA 5E6UB 3LKPB 2YPVL 1U8LA 2BSED 4EOWH 5K39A 2PYEE 8FABA 4CL7A 4U6TA 4JG5A 1AQHA 2R1YA 2XA8L 2X89A 3DXAD 5L4IA 2IAMC 4FJYA 1OL0A 3QA3A 4N86A 3KXFE 2HKHH 1JBJA 3GT6A 4GEIA 1LWRA 5KN5A 2OMVA 3LKOA 3U0PA 4MMXC 4PGBA 3C60A 2NY7L 5C0ND 4Q2ZB 1RJZB 4LRIC 4KX9A 4YE4L 5E24E 1I1RA 2DL2A 2DLFH 4KGLA 1B6UA 2IDSA 1VJSA 1OAKH 3LZOA 2ZUTA 1MWAA 3QUZB 5C08D 1LD9B 3KLKA 4KJPC 1KEGL 2VH5L 3UJJH 2HP4A 4OCMC 4LPYA 4P4RB 5F0PB 4QGTA 2C1PA 2ICEA 5HHOD 4NIKB 3OAUL 2C9SA 2IPUK 4JK0D 2BVPA 4O9HL 2J55A 4DH2A 1JCVA 4MD4B 2KLTA 4UZGA 5J06A 3T04D 1CXIA 1KY7A 4D9LL 2YKLH 1CFTA 5CN2A 3W9EA 5SWQB 3FB5A 1HNYA 3QEGH 4D3CH 4KUCD 2B39A 4GRWH 2WJ7A 1E2WA 1PG7H 1KCKA 2YAQA 4LSRH 1V7NL 2JJSA 1YC7A 3S7GA 3NSJA 3HHSA 1ID5I 3ENEA 3QG7H 5B39G 4LU5H 4MJ5A 4P5TA 4LMQI 4PGEB 4AQ8C 2LVEA 4GQ9H 3FQWB 4R83A 2YRBA 4ZUSB 3H9SA 3UTPE 5BV7H 3NAAL 4KHTH 1QZNA 3NCEB 2QSVA 1JPGB 3ZT6A 2VN3A 3MV8D 5HJGA 3ZDZF 2JFCA 2VSKB 2XTSA 2M1KA 5J6SA 2HKAA 2WW8A 3W57A 4LCYA 1H0DA 3CGTA 2OMXA 4M4PA 1YC8A 1OP3K 1MI5A 2X6VA 4RWYH 2VQ1A 4IRZL 5LHDA 3EYOA 1SHXA 4QHPA 3DYPA 5EN3A 3BKML 4ZFOB 3VXPA 5ITFB 2Q0ZX 3UZEC 5BOJA 2Q2LA 3KBPA 1VADA 3N2JA 3O2DL 3FCGA 3ARBB 4OFYA 1BD2E 4NUMA 5DF0A 3T71A 1IBHA 4QJ4B 3CDGA 1UXLA 3BLBA 3JWOC 2AV1A 1ZT4A 1S7UA 4O5LH 3DO3A 4J2QA 1KXTA 4BYHA 3UC0H 2BNRD 2WVSA 4RA0C 3AM8C 2KYIA 3BQUB 3VFRB 5MEOB 1U3HC 4WNJA 1CU4H 5IEHB 1A6UL 4JZNB 1X7QA 1J1OH 4RFNC 1T7XA 2R0WH 3WFDH 1HQRA 2DWYA 2CPCA 3QUXB 4HGMA 5D55A 4AQZA 3I2CL 2NW2B 3J27A 3OHXB 4POZD 3GJFK 2A4ZA 5AW8B 5EB9A 4RRPM 2EE6A 1UOWA 2NX5A 4PJFE 2VXSH 2K7QA 3SCMD 4YNYA 4LVOB 4MX7A 1XSJA 5G55A 4MTMA 5AAWC 4DHLA 1TPXB 2F19H 3O9WA 5BZZA 3UBXA 3VI3F 1I9IH 5IM7B 2RA1A 1WAEA 5T3XE 4GAJH 1FN4A 4WI7A 5KJRH 4B3EA 3ZGHA 1YN7B 5IHLB 3ULUF 4NBXB 1U3NA 4HBCH 4D0CA 2VR8A 2ZSVB 4L4TD 2XV3A 1AIZA 3P77A 2CPUA 3N44B 4S1SL 4Y1AD 3AY2A 4HWEL 5C7XH 4HKXA 2Q3ZA 3HAEA 1U58B 4KJYB 4PJGF 3P3SA 4ZUSA 1S7TA 1UA6H 1X9QA 4OFQA 3UC2A 1NCCL 1RCYA 2BO0A 3UADA 3PXJA 1NTDA 4MJ5B 3VAEA 3UZEA 1G7IA 3RJQB 5JIQA 3L3HA 2OULB 1QLEL 3GHEL 2UXVA 4IDJL 3MOAL 3RGBA 3I9GL 3DX6B 3PDGA 3WNOA 1N12A 2AJXH 2VISB 2GY5A 1LO4L 5A2FA 1BVKB 2XI9A 1A65A 5DYOB 1D2OA 4K71B 1I9RH 4KRMB 4KXZI 4UIMB 4DZBB 1M4KA 4GQ9L 4OVVA 4MZ2A 4G2AA 1K8DA 1B9ZA 4HX1A 4YGVA 5D1ZI 1MFCL 4ERSH 3F7KA 2AEQH 3ZYIA 2YA1A 3UAFA 1GKOA 5SX5H 1GOGA 1SJHB 4PY7A 1VZIA 1GSKA 5C0EB 3ARWA 2VLLA 1RIUL 1IAIL 3WFEL 1E9OB 3CFCL 5I2IB 5TQ2H 3V6OE 3DKHA 1F6AB 3H2PA 3PHAA 4PGBB 5I15H 4KXBA 2BW4A 3S35L 3DPDA 2J8UF 4A38A 5GSRB 2DV6A 2P8LB 4LCWD 4L1TA 4HP5A 3CK0L 4HUWA 1Q1JH 3FQ1A 1Q9OA 2P5PA 3DPBB 3UTTE 2F68X 3L2MA 3R4RA 4XN4A 4ZO9A 3MUGB 4GT0A 3K8MA 1JUFB 3FCSB 4PG9A 1QFWM 4GSXA 1J8HB 5L88H 3JSSA 4GG6B 2AI0L 3QIWC 1RSFA 4JM4L 4X6CF 4PEEA 4U0RB 4KGJA 1T22A 3FT9A 3NIGB 1I1YA 4XP5H 5DFWH 1G1YA 3K0WA 5GGVY 3HI5L 1I9JH 3MUHL 3FO9B 3VGFA 4JN2A 3WG7B 1QSZA 2JJTA 4PVMA 5DHDA 4AL8L 4BZ1L 3SE4C 4HS6A 5IV2B 4TQEH 2Z64C 1MHHA 1F4HA 3RWEA 1FYTD 4K2UH 4B5EA 1AHMA 1AZZC 4C4UA 1LEIB 2OTUB 2XWXA 2HTLC 1TU2B 1IM9B 3PIQB 2VR9A 1J86A 4BFBD 4RGND 1ZA6A 3NIFB 4M1GL 4YZFE 2AQ1A 4OZHE 1ZLWK 1FFQA 5I1KL 1WIPA 2VT0A 2VDMB 1OOWA 3OC5A 5IHBA 1KCBA 5JHLL 1JG9A 4NO0D 4E41A 4PRDA 6PCYA 4UBDC 1YQVH 1A7NL 1EX0A 3QZBA 3GI8L 1ASOA 3L45A 2J1KA 4OJCA 2PYED 2NT0A 2WQSA 3QG6B 4IRJA 1BZ9B 4ABVA 3L3KB 4MHHG 1Y07A 2EO1A 1D5ZA 4ZMOA 4Y19D 1KLGB 1UACH 3M17B 2IH9A 5B39B 4IGBD 1HHHB 5JIHA 3GSXA 4JZJB 2ED9A 4X6DB 1NBYA 4HK0B 4ZO6A 3MOBL 5IHZA 2J12B 5FK9A 5ICXB 3GTVA 1U8IB 2QPFA 5CIPH 4IW4C 1PLGH 5F7EL 2HJFB 4NXSA 5C08E 3LSOA 2WQRA 1FYHB 5DS8B 1SEBB 4CAGA 2OP4H 3TT1L 5AEAA 4BDVA 4ONHB 2CZNA 1YEHH 2J1ZA 1TNMA 2VXTL 1GPOH 2R7EB 2AJXL 2J4WL 2F54B 4N90E 1W72L 3OPZL 3QEUB 4HCIA 1C16B 2C26A 1QNZL 2XFXA 3ZGIA 5HYQA 1VCBC 4MS8D 1MJUH 2NX5D 3TTSA 3RFZA 2UXGA 4JDVA 4NO0A 4PJCF 1NFDF 2NNFA 3JWOL 3T77B 1QVOA 3HG5A 4XCNB 4YHNA 3EFFA 3U6XS 5ISZB 1ASPA 1DVFD 2HJLA 1P7KB 4WJ5A 4Y16A 1R1CA 1HYRC 3IFOB 1AXSB 3GSUB 4NUQA 5E1QA 2MCPL 2BY0A 2MNUA 1Z9LA 4PSRA 4YFLF 1RPKA 1NICA 4AQAB 1IFHL 3N42B 3P0VL 1THAA 1AI1L 2YBRA 2VC2H 5K9JL 3CLFH 2X4QA 5IW1A 4Z0BH 3EYVB 4PJGE 1G7MA 3MV8E 1CUOA 4YHOL 1CGVA 4IS6A 3POCA 1DTUA 4H40A 4TVPH 4TLUA 3QH3B 5CO1A 1KGUA 5BZDA 3ELQA 3QFGA 3MV01 3QQ3A 4OSUH 2EH8H 4LLMB 3GJEB 5B1BB 3AABA 4Y5XC 5E2JA 3WFBH 1IKFH 3O6FD 1E65A 5IM7A 5A43C 2GAZB 3L9BA 3B3BA 4FQHB 4Y7MA 2X4TB 5F9WB 3C2AH 2Q6WB 3ZPDA 4IKLA 4R0LA 4LARL 3T2NL 4AT6B 1OGSA 2ESVB 1UOKA 2BRQA 5CXPA 4HOWA 1P84K 2JLPA 1RUKH 2E9JA 5LN4A 1PS3A 3JYBA 1NMAH 5DI8A 3L3OA 1N59B 4NQUA 1N18A 4JM2F 3CBKB 4BSJA 2Y3NA 2AP2A 3BGFC 4Z0XB 3D87B 2YQ3A 3ATDA 4YPJA 4D0BB 2K7PA 3MU3A 1F3JB 1MLBA 2HH0H 3VD4A 4NDMB 3RWIB 4K07A 4N8CL 1ZV5A 2FB4L 2IFGA 1H8LA 5E5UB 3ESMA 4MDIB 4ISVA 2ZX9A 1BW8A 4EIZC 2JTDA 5IIEB 2VM3A 4A6YH 4K3JL 4YBHA 3DOIA 3WKPA 3OVUB 4P5KB 3OL2A 5J6HA 5FUOH 3CDGB 4FQ1L 3NA4A 3T0EB 1G1OA 4FD0A 3A67H 4G8GE 1IBZA 3LDBB 1BX2B 5T3XD 5BJTA 1HH6B 1RIVH 2HVJB 1UACL 5DC4B 5FF6A 2FR4A 3KPQA 5DVPA 2WUBH 1FYTB 1L4IA 1MI5B 5EUOF 1PW3A 4EIUA 1H0DB 4C47A 3I74A 2IH1A 4Q56A 5CSZA 5HGHA 4G6ML 4NJ9H 3SPHA 3GUTB 3FFDA 2DQCL 3JXAA 3IN0A 1I4FB 1XGRB 4JDTL 4B60A 3D39D 4GO8A 1JGUL 4MYWB 5ELIA 5JHDD 4PRAB 1TG8A 3OC8A 4MCZA 1JK8A 1PDKA 3R8BB 4APQD 4AYDC 4FKHA 4GLRI 1DN0B 2HFGH 4GQRA 4XPTL 5D71L 3AB0C 4JFZH 5AZEH 3ZY7A 5DUBB 4BFRA 3D30A 3AG2B 3GXDA 1HHJB 3JWOH 3QXDB 3L3KA 4WW1B 3NA9L 5D2NE 5DJCA 3ESVF 3D9AH 3IMSA 1UD6A 4ODVL 1SBSH 5A3IC 4L9DA 4G42A 4M43H 3V4VB 5ACZA 5KVEE 5ITBL 1Z0MA 4PJBA 4PS3A 4O2CA 3B5GA 3VFWB 3VQMA 5KS9F 3T6XA 5GXBB 5KW9L 4L0PB 4EIGB 1ZJAA 1E30A 2VDLB 5E5MA 1PZDA 3D5OF 5FO9B 2Y5QA 3HMWL 1JF5A 4IOFC 4A7TA 4W9JC 1MWAB 3QUZA 3QDGD 4HGWA 3M07A 4DUXA 1E27A 1EAPA 1MJ8L 1FORL 5E8DL 3MTRA 1NEPA 3FPXA 2QADC 4AH2A 2GIMA 1RUAH 4UTAH 2E8YA 1AGBA 4ZPTB 4Q9QH 3C6LA 3CFNA 1UA3A 2JVUA 2IXQA 4NZUH 5IG7B 1FC1A 2NY6B 3ZE0F 3ECWA 4Z77A 5DQ9A 3QWRA 4BH7A 2GSMB 3P73B 3P9LA 2VDNH 2X4NA 2XWBA 4WCYH 2N4IA 3C8KB 3K6SA 3HCVA 4RVBA 3QZWA 3CXDL 3POHA 3P9MB 3B3IB 3HKFA 4ALAC 4JCMA 4GRLB 4S10A 3JT0A 2OS7A 1U8NA 1VLXA 5GS0C 1NDMB 2VR3A 4ONOA 2Y7SA 3KPLB 3MLWL 4FFYH 1YPZB 3TEWA 4TUKL 1J0ZA 3VGEA 2JKJA 4R7LA 2HTLD 2NUTB 5IUSA 1KYOJ 3X17A 1SLWA 4MCMA 3QO0A 1IM9D 2CG9X 1F00I 5SX5K 5I8OL 3FULA 4XH2B 5B8CA 3QDJA 3HRZA 3B43A 1KN4H 2KQMA 3H9YA 1CDHA 4R9HA 4JG1H 4RGNE 3T2OA 2MCMA 3UOAB 1FFRA 5EZPA 1CTMA 2NQCA 3KWWA 5JUEH 1H8OA 2WVVA 5A40E 3NZHH 3PFQA 3FUDA 2CR6A 5JNYB 5BMFL 3MO1A 3SY6A 5FWRA 3TBWB 2FSEA 2HLFD 4S1RH 1C5CL 4Z7VB 3ARGC 1JZHA 3P3UA 4ZW6A 1N8ZA 4Y19E 5I8CB 2G0KA 4WFED 1GJUA 3I9IA 2PR4H 5CSGA 2X9XA 2X6MA 1JZ2A 1J5OH 4O51B 3V9EA 2R15A 5D2LB 4K3DH 4OGQC 2R59A 4XMKH 4ZAKA 4PRNB 1NMCB 4HKBA 1COBA 4BSVA 1WLHA 4UQ3B 2XN0A 5ILTH 1A6WL 1NCWL 4KTYA 4AYSA 4KFZC 4PJIA 1LQBC 3EDKA 1P5VB 1NWPA 4K8RL 4JFDB 3ELAT 5DVOA 2XCMC 4LE8A 1OANA 1E5BA 3QC6X 2I60H 3S3JA 1CG9B 4AYID 1XDTT 4N2OA 2A9BA 2VO8A 4KO9A 1A9EB 1PJWA 4ZMWA 5FA3B 3Q3GA 2VC2B 1AY1H 4TV3A 4WI4A 4CKVX 5KG9B 3NN8A 4E42A 1OD9A 3WGUB 5AALA 4WEMB 3QZWG 3JWDL 3MJ8A 2X3CA 1TQBB 4HEPG 4Q58C 3GXFA 5DQDL 4ETQB 1NFIB 1TTGA 2YMXL 5CGTA 2XBTA 1W0VA 2DYSB 4HUCA 1PBYA 1A25A 4JRLA 4NPYA 2WZAA 2Y6SD 5KVGE 4OZGE 3TH2T 4NZUL 4G5ZL 4R7DB 5TQ2L 1VESA 5INDB 1M7IB 3T6VA 3KJ4C 1TZHA 4JRXB 4KITB 2P8PA 4KNSA 3SBRA 4JFEB 4KNQA 1AFVH 2C9XA 3LCYA 3ZVVA 3QDJD 2ITEA 3CVHH 5HJ3B 4WI9A 5GGQL 3C60D 4HZLB 3PUCA 3KYKL 4NERA 1CFQA 3NSXA 4H1LH 4P5TC 5T3ZH 5LGKA 4JO3H 2OR9L 1FCGA 3UTSA 1G9ML 3L81A 1EHLL 5EULV 5AB1A 1PIFA 3BT2L 1S9YB 4HLEA 1P4IH 4NYLB 4NQEE 1FVEA 2W9EH 1PG7L 5BRQA 4W6WB 1KFAL 2VQUA 1OT4A 3SKNA 3V2AR 1TJXA 1UASA 5A7EA 4AUUA 3JYCA 5FOBA 5I1IH 2XRAH 3H9ZA 1B2YA 1ZVNA 2O5NA 3ARRA 2Y2YA 2DTMH 4H25A 2EYSB 5DHMC 2MTAA 3OJMB 4XVSH 1R3IL 2X4PB 4KJWC 1MCNA 1YECL 1WCBB 4KHXL 4L5FH 5AW3B 4F15B 1XGQB 5IB3A 3HR5B 3F5WB 4KTEL 2EEDA 1KIRA 4FEMA 2UXTA 5EU4A 4HIEB 3QEHB 4P23A 5ESVA 1JGDB 2JCCB 4FULA 4EI5A 1LJMA 4DP7X 1N64L 1KXQE 3NCBB 5LG1A 1M1SA 1L7TH 2CO2A 1QBAA 1EXGA 1DVXA 3CJJA 1KIQA 1KMGA 5DCCA 3ZQXA 3RGVA 2CDFA 1KENH 2CRIA 4IIQB 1QSVA 2YD3A 4XN2A 3O6FA 4J6RH 5C0CD 1XGUB 4CU8A 1HHGB 2AF2A 4F58H 1P5UB 4DK3A 3FCBA 2CCVA 3OGOE 4KH9A 4CC4A 1LD9A 2VLJE 4BRVA 4J23A 2EYRA 3DI2B 1E5YA 3MR9A 4XNMB 4CDGC 1UZ8B 2VR6A 4P3DB 1GYUA 1NINA 5IROA 1XF2B 2ZJSL 3F7VB 3MREA 4X6FB 3D39B 4KDWA 1YEDA 3HC4H 5L8JB 4QXTB 5JHDE 4J5VA 4MLIA 5KN5B 5I74C 3S34H 1X5MA 2OJ1A 3RU8L 1O75A 4LSRL 3IRCA 4BQBA 4MAUH 2GQHA 4JFQA 4L8DB 4XXWC 4XO5A 3QAZC 5CEXA 5AZ2L 3DYMA 4LGRB 4GMSH 3IFPA 1NPNA 5HHMD 3L6FA 3VXRD 2YMXH 2DI7A 2IDTA 4YHIA 3D25B 2AABH 2PTTB 2QDWA 4DP0X 4L3EB 2CALA 5EF3A 1ZXQA 2WLLA 2EIZB 3PAVA 1OAZL 4MQSB 1HOCA 2IG2H 2GTQA 5AW9B 4IKIA 3A23A 1D9KC 1LL1A 1I8MA 3BWZA 4YUEL 3QEQB 1UM5L 3NPZB 3BW9A 3AREB 3O6LL 3ZT7A 5BVPH 3BMVA 1CGUA 1CTOA 3S5LB 4H0IA 1BJ1H 3S4SB 2VJXA 3OAYK 5AYUH 1LEGA 4G82A 2H47C 5BRPA 1BVLB 1WCQA 3V0GA 1M7XA 1T04B 2ZAIA 3D39A 3L4ZA 3RX7A 2A74C 1S7RA 4FXLA 4HIEA 4K5NA 1EEZB 1AGFA 2IOOA 4P07A 3BT2H 2VLRE 2FO4A 2FEEL 4HWNA 4XT1C 3SOTA 4UAHA 2VITB 4WWKA 4C55A 5I0XA 1B0GB 4JQIH 3NIDE 3BGMB 4OD2B 3ZN6A 2M26A 2N0KA 1SFDA 2COQA 2X0UA 2X1WL 2XUWA 2XTJE 5CCKH 1XH1A 1AR1B 4M8RA 4R26L 3GSWA 1UKSA 4JAMB 3T3PE 4Y2NA 4BFFA 1O0VA 4BXSV 5JIKA 4HUVB 2CDFB 1BLIA 2UWEA 1I1AC 2D3LA 3MUY1 5IROC 1JN6B 4L29A 4R7NA 1BFOA 1CURA 4Y5VC 3QI9C 4PRIB 4HIXH 5DEGA 3HJ0A 3V5KA 4R90H 1WWBX 3V0VB 4JFOA 3IDYC 2A9NL 2L04A 2WINB 3G6JE 5J7CC 1G84A 3DIVA 3QEHA 4L4VD 1I8KB 4LESA 4ZSOE 3WFEH 4HSAC 1E5UI 5B8CC 2DWTA 1X5JA 5I75C 1M2VA 1XH3B 2CKBL 5C2BL 2CAKA 5C0FA 1XF5B 3PP3K 4FQXD 3TYGL 4C56D 4K3JH 3FW6A 1MW2A 2K9UA 4UANA 2X87A 4WSGA 1SYSB 1OWWA 2UY7A 2WXGA 3AT9A 4LHUB 2VL5A 4Z7UF 4D2NA 1Q38A 4F2FA 1G6RH 1W6WA 4F8OA 3L5JA 1N26A 3EH1A 3KH4A 4HWEH 5HXMA 5K33A 4YDVA 1R3LA 4WWPA 2V5MA 5E08H 1QYGL 5EOQL 3I50L 5D1XC 1WBXB 3W0WB 2YZ8A 4TPRH 3QAZB 1RZGA 4C4KT 3HG1E 3RWCA 4IHOA 1FZJA 3O8XC 3S37H 5HI4C 1QEWA 2WLIA 4QHLB 1QFWL 1TQCB 3BT0A 3T0DA 3KBHE 3WKMH 4YZFF 1H9DA 1XGYH 5AW0B 5SX4H 4MASA 5I73B 1XCTA 3FBQA 1VPOL 5L2KE 5BXFB 1SY6L 2DWDA 1TZAA 1M7IA 4ODUB 3ATEA 4QRPB 4MBOA 3ETBJ 4NQXB 2LAAA 3HNTH 5EO9A 1GHFL 4DVBB 2WC7A 2YN5A 4G7YH 3DTUB 3TNNA 4QHLA 4QF1A 1UH2A 5DZOA 4IK6A 4TRPH 1Y6MR 3QUZC 2OZ4A 5HYFA 4HA1A 5GISL 7TAAA 1P2CB 2XXFA 1CLYH 3B7SA 3HEIB 4WFFE 5FFGA 5IVZA 2DD8H 3T8VA 3OLGA 2NNCA 1NCUA 3DGCR 3U6XA 4ZAKB 1JHTB 2B1OA 2F7OA 2DIJA 2Y5EA 4P2OC 1EAJA 4E42B 5IKCB 4UMGA 5K5YA 4AQOA 3SDDA 5GPRA 1R3JB 3FZUD 3L3JA 2YPLA 2E7MA 15C8L 1L7IH 2BINA 4LKCB 3CBRA 4KQ4L 2CIKB 4G6JH 4JZOB 3CWGA 4TNGA 1UWEH 1TZGL 2FHCA 2WLKA 3KXFD 3KYAA 3MPCA 3EYFA 4HHGA 3A6BH 4UAOB 5FHBH 3HMXH 5IROD 4PJEB 1K9TA 4KV5E 2CO1A 1I8KA 1U21A 2VSDA 4NGHL 5BQ7B 3HAEH 4KVNL 4XN7A 1U8KB 2FWSA 1JNNH 2ADJA 5E99H 3QO0B 2VXTH 3T2PA 1KJ2A 2C9QA 4ZYKA 1T2QL 4UT7H 4HGKC 4XAKE 3FN9A 5CLWA 1IQWL 3KR3H 4NHUA 1Q72L 2DPKA 4X8JA 4ACTA 1JHKL 3RUGA 1KGCE 1UYWH 1J8HD 2XKUA 3ARDA 2IIJA 2WNWA 2Q9OA 3MJWA 4FQPA 1MJJA 2GTZB 4N6RA 4GRLC 3TBWA 4NQED 4OAWB 5DLLA 5I1GH 1DHKA 2WLJA 3HCVB 2O5YH 1WBYB 2CR3A 2EAEA 1VSCA 2XZZA 1HSBA 1CFNB 3TBVB 3NJVA 1G7JA 5JHLH 1CDCA 1A0QH 5IG7A 3B2VL 3WEBA 3B2DC 4EEEA 5D1XD 3NGBC 5DD1L 4G3YH 2D7MA 2XZQL 1GTFA 1E4XI 4WNQB 2CGYA 4YSDA 1SLVA 2IOIA 3BAKA 3H3BC 4QO1B 3AU1A 5H94A 4GQPH 2N56A 3CQFA 5D7SH 4W6XB 1IBYA 4PB9H 4NRZB 1JXKA 1B0IA 1G9NC 4QLWA 2XZAL 1C12B 1NFKA 1P4LA 1UFUA 1BFVH 3ISRA 2WB1A 1V27A 4JQXC 4XMZA 3UTSD 4Z3JA 5GRWA 3CU1A 3T2NH 3SE3A 4PRID 3S5LG 2EUZA 2RB8A 1NGXA 1RJYA 4WV1A 2IOMA 1F58L 1DVSA 2Q8AL 3DV6A 1TSRA 4KUZH 1GKEA 1FSKC 5H37G 5L88L 1E67A 4EMZA 2FIKA 2AXWA 1QHQA 4NNYB 1UWYA 1P7QD 5D1ZB 3IMTA 3KPSA 5KSUB 2F58L 3VXNA 2V9QA 3D85D 2A6IA 1NKOA 1S7WB 3FQ2A 1A4KA 1Z3RA 2I07A 4QRBA 1KCLA 1T83A 4NOFA 2Z31D 3MRKA 3NACL 5C0GA 4CVUA 4PRAA 4CN1A 5C86A 4XB8A 4OCYH 3RPKA 2EUVA 3ARBC 4ORGB 2LABA 4QOKE 4YLCA 3MBWA 1FGNH 5ICUA 4JY5L 1U8MA 2YEQA 1C1EL 2H26B 5FCUL 5HHME 3VXRE 3Q2NA 1CBVH 5IFJA 2MKWA 3BH8A 1P4LB 2UXFA 1NGPH 3L3GA 1EVUA 2CIIB 2WP3O 5IJDC 2QZ5A 3VRLE 4RIRA 4UOW0 4Q4IA 1FHNA 2WXJA 4NZFA 4WF7A 2GFBB 1GAFL 3SDCA 2AZAA 5B1JC 4KVNH 1ND0B 2BOLA 4BH8A 4XWOC 1BF2A 1A6ZA 2GW5A 5GRZA 2B9AA 2ZCKH 2WXOA 3RPIB 4ZX4A 3RGVD 2HZHA 5K93A 4RH4A 5IIEA 2HFTA 3BPNC 4LPTA 4WW2C 1ZPLA 3H2QA 4XPTH 1VEMA 2R4RL 3FHAA 3II1A 4BFKA 2CHZA 2X4RA 3ZOAA 2VLRD 3EOTL 4XVJL 5IMKA 1NFAA 5D72H 2IH3A 2WSDA 1MRCL 3MLXL 5MERB 1RZ8A 3UACA 2D03L 1JZDC 4NSKB 4OAWA 1HEJC 1YHPA 3PV7A 1MJJB 4K7PX 5JOPE 2EP6A 2ZIDA 4N2CA 1S7VA 1PKQA 4JO3L 3A4FA 1TZIB 3OX8B 1KCSL 2E75C 1TZOA 3VH8G 2ZAGA 2GK2A 2GTWA 5IHUH 3JWNG 2CMRL 4FTVE 5HHPB 1IGMH 3GSRB 2ENJA 3VNYA 1HDMB 4EZJA 2P5WE 3QFDA 5JW4N 3O3EB 2ZUSA 5KSAD 4UOJA 4D9RE 2KLRA 4F7TB 2Y5TB 1RULL 1D5BA 4ISVB 4F15C 1FV1A 4GUPA 5DHVH 4GSDH 1IL1B 5DD6A 4CDHA 1OP5K 3RQ3A 4WWOA 3ARFD 3NIDB 3VFTB 3KYNA 2ZKWA 4JZOA 3HG2A 1WVZA 2KKQA 2BNRA 2RIKA 4C56E 4FDWA 3NK3A 5D8JL 5L8LB 1OPOA 4CC1A 1MCWM 3RVTC 1MAJA 4WTXA 1Q94B 2QKIB 1J0JA 4JY4A 1I3RA 1JFHA 2BSTB 1GZPB 1MCKA 5EZOH 3TVMD 5JR1H 1BQRA 4JPIB 3LZFH 3U6RB 1RK1B 1ZY9A 2FLRT 5CP7A 4UMSA 3MJ6A 3RZWA 1JHTA 5FEBA 1DSWA 2VDOL 1OT1A 1OB0A 3QISA 4OLUL 1KEML 3FC8A 3BI9X 5FOJA 2P1YA 3LEYH 3VCLA 1BD2B 4PJ7F 5DXWA 4J3OF 1KGIA 3L2NA 2C34A 5M95B 3PL6D 3AQXA 4WW2A 1FIEA 2RTTA 1DSFL 4RFOL 1PCXA 2Q86A 1UCBL 2H0FA 1U2YA 2Z92A 1NDTA 1PFOA 4QRPA 2OQJB 5E8OB 1J0HA 4FAAB 1G7MB 4M43L 3NEOA 2XT1B 2R7EA 4NB7A 2FJFA 3CSYA 1S7QB 4TSBH 1Q9WA 1Y1UA 3RZCC 1JAEA 2CHDA 3L95A 4PRNA 1T20B 5I0WA 1KPVB 3S88H 4QR7A 4KKLD 4O51A 3AWEA 5F6HJ 3MFFB 5EZJB 2Y25A 3HC3L 3MXVL 4WFFD 1UM6L 2VL4A 5T5FH 4H26B 3MRNA 4X4XB 5E9DB 3TVMC 4HK0A 2YXFA 2NW3B 2UV3A 5J4MA 1XX9C 4B9KC 2BIOA 3FO0H 3U7YH 1UD3A 1ML0A 5IJVB 4J1UA 3ZE1E 3AREC 3TNMA 3ZMRA 3KLAB 4FTDA 1SYSA 1U0QA 3ALWA 3A67L 1RHFA 2HVKA 1PGRB 3KPPA 1F2QA 3H9HB 4GAYA 4Y9BA 2CXKA 2OK0L 1BXVA 5I9QB 3EYUH 4A7QA 3S98A 3H54A 4KY2A 4EKXA 2WUCL 2A9CA 2C4FU 4O9HH 3HI1B 2ADGB 3IVKA 4RMRA 1VFAA 4OM0H 2JCCE 3EF7A 5BOZG 4K0OA 5MP6H 3DURA 3FU7B 2LHAA 1T1XB 4KKAD 2X89D 3OXRB 4OTXH 3ETSA 2ZXBA 1KGCD 1C08A 5K1JA 3TN0B 2CLZA 1J8HE 4XMVA 2YAEA 5KYWA 1KYUA 3Q13A 2DJ4A 4BBWA 4P2AA 5K1NA 3QQ4B 4FC3E 3ULUH 1RZIB 3FTGA 1YYLH 4XP5L 5B4MD 1SJEB 1MW0A 5DTFA 1E50A 4F7CA 1AGBB 1BBJB 4ZPTA 5FYLH 1IZJA 4LVNC 3L48A 4D9QD 3Q9QA 5CR8A 1EEZA 4HIXL 3VVWA 1OE3A 3VXQA 3ZL2A 3DO7A 3TBYB 1OCOB 2J5WA 2O5ZH 2W59A 4I4WB 4JPSA 3WE6A 5HYSA 2CJ3A 4J8RA 4LSUH 4YHMH 4Y7OC 3PJSB 2X53A 5D1XE 2ROYA 4LK4A 4Z7OB 3RBGA 5BW7A 1F6FB 5BZXA 5DHEA 2ADGA 3BIKB 3MRLB 4KFMA 4PJEF 3B83A 4NC2B 5T8IA 3ZYZA 5ADPH 3QIWB 1FZKA 3AM8A 1XZ0A 2A4CA 3NMEA 1MJ8H 4RWHA 4K73A 5E8DH 4NM8H 1N8OE 4O2CB 1ODAA 1TO5A 2WLLB 3MLUL 3VUAA 5E08L 3I3EA 5BRZE 4JQXA 3TF7C 2JB5H 1QYGH 3IFLL 3GGWA 3T6ZA 5MHSD 5I6XB 4JL2A 4HUUB 5JO5A 5HYJA 4MA1C 5CJOH 3MJ9H 1JCKA 3QXAB 3VO0A 4MB4A 2FQFA 1XGYL 4JHAL 2HVBA 2WB7A 3QIBA 4P9ML 3S37L 5GS0D 3O4LA 1QFWH 4I88A 3VWJD 2GBVA 4XP9H 5F6IC 4KHXH 1AY1L 4L5FL 1F3RB 1KWKA 3OR6A 1TR7A 1E9PB 5FX3A 3CLEH 1HXMB 1U6AL 5D2LF 2OXGA 4I8DA 1SJHA 4NN7C 4PY7B 3VW3H 1SUHA 4POUB 1O7DE 1X5IA 4JRYE 3U7YL 5IOKA 2VZUA 4KX8A 3AS3A 3RDJA 4N26A 4QOKD 1PPIA 3FB6A 3K1DA 2H32B 3FOLB 3H4FA 5AZUA 2DF3A 5CSBA 1NOLA 1O6SB 3ZL1A 1FH5H 2QBWA 2GJ6B 3FQTB 3WKNA 1MPAH 4NQDD 2Y6TE 4M02A 1DVUA 1L9QA 4R4NC 4AMKH 4YBQD 5DZNA 1JNJA 1MLCA 4HS3A 4FNLH 2WN2A 2VN6A 3MA7A 3Q01A 3TT3L 3DDFA 3UAJD 2O6DA 2P5EB 4KMTL 4JFDD 4JN1L 3RVVD 5IMMA 1U8JA 5CP7B 3IPEA 3QULB 1ANUA 1Q4NX 2HJKB 3REVB 2X2UA 5HGDA 4FL4C 3EYSH 4MNQB 3PRZA 1OO2A 1B2WH 4MJ4A 5EEXA 4CJ0A 3OMAB 1C7SA 3LXUX 3PWVA 3ZE0E 3EUUA 1BQLH 2ZUWA 4HJGB 1H3PH 1W72A 4JZNA 4FLSA 3AZUA 3ZRSA 3F7PC 1R0AH 1ETB1 1BDYA 2AABL 3VFRA 1FDLH 2P42B 1HCZA 1HQ4A 4PWJA 3RP1A 4LIQH 1OAZH 3E6HB 3GJEA 1QHOA 1H8NA 1A64A 2P45B 4WY7L 3HN5A 4X6CA 1UB5B 2Z93A 5HHPA 3IPBA 4X6EB 1A6AA 2B59B 1OSZA 4LBAA 2NY5L 3DI3B 3K91A 4MXQC 2AQTA 5IFHL 3CFBB 3DO4A 1ZLWH 4P06A 3E6FA 5DHVA 4WQOA 2DH3A 3UJTL 3V8CA 3CQPA 5C09E 1A0QL 2WAHA 5JXEA 4NPYB 3ET9F 4F7EA 2EDHA 3KBFA 3DHUA 3PWVB 1JJUA 1E3ZA 3BQUA 4BEIA 3RTQA 1BXAA 2G75B 3IJSB 3H55A 4HXAL 3VG9B 3D08A 3MNVB 3T4AC 1QVOB 3DVFA 3NQIA 1QHPA 1CDYA 4FQ1H 1T7WA 3MLUH 4XCNA 5ISZA 3EAKA 4ZMAT 2UUDK 2GJZB 1CF8L 1F90H 2QQNH 4R97B 1QUPA 1ZWIA 3DHPA 5EG6C 4J39A 1HINL 3AS1A 3ARBA 2F54A 2Q3AA 2F18A 3LRGA 4E9LA 2VR5A 2X0VA 2JH2A 4PRIA 4WTZG 3BPLB 1V10A 3ARDD 3MRQB 2JJWA 3D3VD 3KCWA 1BPVA 2ZG2A 5AVTB 4FQXB 4C56B 2QPDB 1GIGH 5T5NF 4FABL 2BVPB 4CA4A 4JFVA 3BVXA 3QDGB 5IQ7H 1PLCA 3MA9H 3CLEL 4I9XA 3SDCC 1IUZA 4LVNB 4YHPA 3RJDA 2WLNA 3BD4A 4MZ3A 4DOHB 2TSBA 1W8EA 3FN0L 4UBDD 1DEEB 4HIJB 4YUE