2YOAA

Synaptotagmin-1 c2b domain with phosphoserine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN-1
publication title Phosphatidylinositol 4,5-Bisphosphate Clusters Act as Molecular Beacons for Vesicle Recruitment
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yoaA00
2WXPA 3FBKA 4FHKA 2Q0ZX 3OHMB 2WXRA 2CM6A 4BGDA 2ENQA 4BFRA 3CSTA 1GMIA 4ICWA 4KZCA 4XZ4A 4FADA 5CCJA 3QK0A 2DMHA 3PS6A 4F92B 4EZLA 3W56A 3L13A 3N5AA 2CM5A 3QARA 1E8YA 3ML8A 1BCIA 4F93B 3S2AA 4ANXA 2WXKA 3QJZA 3ENEA 4L23A 1DJYA 2WXNA 3PRZA 3HHMA 5EDSA 2WXHA 5G55A 2ZKMX 2NQ3A 4QAMB 2R83A 4FHJA 1TJXA 2A4ZA 4QJ3B 1RLWA 2ENJA 1WFMA 1A25A 2K4AA 2KI6A 2WXIA 3APCA 3F05A 4V11A 2YOAA 3PREA 4L2YA 4PS3A 3ZVVA 1RSYA 5H4YA 4XX5A 3ZIMA 4ANVA 4WWOA 3DPDA 4OVUA 4F1SA 4NP9A 1UOWA 1DQVA 4IHBA 4JPSA 2WXLA 3PFQA 2K3HA 2FJUB 2QZ5A 1WFJA 3L4CA 2ISDA 2A5UA 3QR1A 4AOFA 2WXGA 2QZQA 1BDYA 1QASA 5T8IA 4EZJA 4QJ4B 5JHAA 2CHZA 2Z0UA 2FK9A 2ENPA 1DJWA 1E7VA 1K5WA 5G2NA 4GB9A 3CSFA 4Y1SA 2NCEA 3TL5A 4J6IA 4TV3A 3F00A 3P2BA 4FULA 1W15A 2Q3XA 3KWTA 4LDCA 2V4LA 4QJ5B 3W57A 1UOVA 4WWPA 4NPJA 4FLHA 2Y3AA 2WXQA 1DSYA 3L08A 3IM1A 3SD5A 4EZKA 4KITB 4L1BA 4ANWA 5CCGE 4LCVA 3ML9A 3KWUA 4AJWA 3ZW3A 4WWNA 3L54A 2LHAA 1BYNA 2K8MA 4FA6A 3QR0A 1E7UA 2CJTA 4FJZA 2K45A 4WAFA 2DMGA 3JZYA 3DBSA 3RDJA 2D8KA 4XE0A 3L17A 3R7RA 2X38A 3OAWA 3PYCA 2WXFA 4MJJA 1DJIA 4HLEA 1E90A 1E8ZA 3LJ3A 3R7QA 4F91B 1HE8A 1DJHA 2NSQA 4DNLA 3TWYA 1DJZA 4PS8A 4URKA 4OVVA 2N1TE 4Y1TA 5CCHE 4DK5A 4GNKB 2RD0A 4WEEA 1DJGA 2BWQA 4G11A 2CHXA 3B7YA 3F04A 4FJYA 4NS0A 4L1LA 1CJYA 2UZPA 4ANUA 3HN8A 2B3RA 3RPBA 4ICXA 4NPKA 3F01A 1E8WA 3L9BA 3IBEA 3M7FB 1DJXA 2CJSA 2CHWA 2EP6A 2WXJA 3NSJA 4IQHA 4KZ0A 2YRBA 4TS6A 2WXMA 1YRKA 1RH8A 3L16A 2WXOA 4TUUA 3T8MA 3HIZA 3APDA 1V27A 2JQZA 4LT7A 1W16A 3FDWA 1UGKA 2CHDA 5KJ7E 3QAQA 1TJMA 3MJWA 1E8XA 3GPEA 4HVBA 4A55A 3NZSA 3NZUA 3APFA 5JHBA 4PS7A 1QATA 3TJPA 5H4ZA
chains in the Genus database with same CATH superfamily
5E1IA 4LRNL 1OTTD 2F15A 2ZCZA 4KOBA 3QORD 4IDJL 3QRLA 5H8DA 1DEDA 4WO4A 4K5OA 2JJVA 3TO4C 3BEWA 5KSBA 3UC0L 4KZCA 3GMOB 1NMAH 1J8HA 5BW7A 1T6VN 3QQNA 1DL7L 4MA8H 3O11A 2O5NA 4NZTL 4AE1A 1N6VA 2MJWA 3AU0A 4P2RE 3V8OA 3VWKD 1KGCE 4PWIA 5SX4I 1ZPUA 3VGBA 5C6TH 5G55A 3VI3A 1UZ6F 3OKNA 1NAMH 3N55A 3QHFL 1E2VA 1E6OH 1WFMA 4XXWC 1VPOH 5GJTH 4LGRB 4AYID 1A6TA 2EABA 1WAAA 5HTSA 2DBJA 1EEZA 3P0YH 4F7EA 2Y7OA 4KFMA 3BZ4B 4W9GC 2W0PA 2JCCA 4AQAB 4MDIB 4P59L 1SYVB 3CDZB 5AW0B 1EEUA 3QUML 4GRMB 3VFUB 5MEOB 3WIFA 3ARGC 3EYOA 3VDCA 5BZDB 1KJVB 2XKUA 3JUYA 4XN2A 3NIDB 4JRFA 1OP5H 2DEXX 4DQOL 3MNZB 4WWKB 5J11B 2WAHA 1AXSA 3D18A 4Y0GA 5ID1A 5EN2B 1BAFL 2ZOLB 2IBZY 4LQFH 2KHAA 3CZKA 1Z6JT 4U6HB 4X6DF 1VB9A 4OUUB 1MY7A 4HGWA 3MJGX 3W11C 3ZDYF 2A74C 1KNOB 1LJMA 1WAEA 12E8L 5IP4A 3UJIH 2EDWA 4XXWA 1OM3H 3QR0A 4Z7QF 2VN5A 3QEQD 1OW0C 3L17A 3FH5A 4CN6A 1XF2A 2O5YH 3LKOA 3OJMB 1MNUL 2JLPA 4QYOB 1CBJA 4E9QA 3ECBA 4PFEA 1J8SA 2HLEB 3OGCB 1CGSL 2Z7ZA 4FFWC 4PGEA 4YDZA 3D3VE 3LVEA 5J13B 1INDL 4UT6A 1GGBL 1R3KB 2DTSA 2VXQH 1JS4A 3AADB 4QT5B 5D2LB 5IWLC 3GUTA 5EOQL 2FQEA 1P7KA 3BPCB 4KQ4L 1NC2A 32C2B 3VW3H 2AJSL 2NZ9D 4P4RB 4YC2C 3MLYH 2VQTA 3V0VA 2YMXH 1IGIL 1MCWM 1GSKA 3C5JB 3FOLB 5FCUH 1BW8A 3EO9H 2Y7LA 3QYCA 4JHBA 3AXIA 5DD3L 1K5NB 3CFEA 3PNRB 2N7SA 2WINB 1AG6A 4WEUD 3ILEA 1OW0A 3BLPX 3LN4B 4JG0H 3WO4C 3DX8A 3KWWB 2FDBP 3KBFA 3V0WL 3M86A 3OZKA 3DJZA 2AANA 3RWIA 2X70B 1VFAA 3PCYA 3SE3C 2ZQKA 4XXCC 1EVUA 1IJNA 5IWLA 3AXLA 3SODB 3FT3B 3BMWA 3L9RB 4XPTL 4BH8A 2XT1B 5BO1H 5EC1B 2CBQA 2V9QA 3L3KB 5GS0D 3ZDWA 1E40A 4G8FA 3FQYA 1OTSD 5E4OA 5JZ7D 2YAHA 1F11A 2DTML 4QRQB 3FSVA 1KCKA 3L5XH 2ARJB 3O6KL 4GS7C 3WIHH 5EZJB 1X5XA 4TUJA 5GS0L 1WG3A 4ETYA 4IBYA 1YMHA 5BZWB 2BO0A 4FI6A 4AYDC 3LS4L 1JHKL 2VZ1A 3CVBA 3F8UB 3BDYL 3C87A 3KM2A 4N68A 5GS2D 4A7GF 4JFUA 4Y4FD 1DN0A 4I9XA 3SE3A 4FCAA 5TK2A 5FYJH 5IW6A 3I6LE 4PJFF 4BZYA 4KKAC 4TLTA 5EU6B 4YNYA 4YE0A 5FO2A 1IGCH 2Q76A 4I7ZC 5DRNA 4BFBD 1JGVL 2BXZA 3F5WB 2A9NH 3QJVB 3E8UL 3HVNA 2H45A 2E9JA 2XJLA 2Y3AA 4NQUA 4X6EA 2X4NA 4CSPA 3VXRD 3GXDA 5CCGE 3IF1A 2VLLB 2CQVA 1G4RA 4MA7H 1YNKH 3N42F 3SDXE 3S96A 2ZTBA 3RDJA 2K6WA 1TTFA 2VAAB 4KZDH 4ZFOB 1MRDL 5CN3A 3VFVB 1L9SA 1HE8A 2KQNA 5KW9L 1ZGLP 4ORGA 3DTUB 2R39A 1B0WA 4CW1B 2YGPA 5I73B 2OSXA 4OKVA 3T3ME 3LKSA 4Q9QH 2OJEB 3F58H 4PG2C 2BWQA 4LHJB 2E9BA 5L8KB 1FF5A 3EO1B 3IKKA 4NPYA 2WUCL 1FORL 4N2HA 5CD5C 3TS8A 4XP6H 5JW3L 5KVEL 4R7XA 1KBGL 3GMQB 1N6QH 1U95B 3GMOA 5GRVK 3SQBB 4BEIA 1HWHB 4TS6A 3KMDA 2YUXA 2E74C 1G7LB 4JL2A 4WWKC 5J11C 4M8UA 1TYJA 1NCBH 1TCRB 2NRDA 3MSPA 3S36H 5A6LA 4URTB 1PQZA 2BSBA 1Z1WA 3EGSA 4TXVB 3EDJA 4JY5H 3ARXA 2VCOA 2ZPKL 3RVXC 1R3IH 2BHZA 3P73B 1AD9B 4YDMA 4LL4A 1CVRA 4PJDF 3BZ4A 4HJEA 1VFBB 4AQAA 3FB5B 3O2WH 4MDIA 1W6WA 4N85A 1SYVA 4F93B 3CDZA 4RAHA 2VLRB 2DQJH 4XO4A 4NQQA 4GRMA 3VFUA 5ILTL 4ZXBA 5MEOA 3O41B 5J13C 5DT1L 4KXDA 5AB9A 4KMQA 1KJVA 1MN4A 4DGIH 3QDME 4DTGL 4PS3A 3MNZA 1PS3A 4WWKA 5EN2A 5AEAA 5T33H 5INCB 2ZOLA 3J27A 4P3CL 4A39A 2AQ1A 3N1PC 2WQUA 4AM0A 4PLJD 4OUUA 2FYVA 4B97A 3GZPA 5DLMH 1R3JA 3CVHL 3T2LA 4JHAL 3ZE1B 4KMTL 1P69B 1JFQL 1M3IA 3KGUA 1SMDA 2ZUQB 4GSDH 4PLNC 2XWRA 3V6FB 1SVCP 1T5XB 1DZ0A 1ITCA 5EO9B 1U8JA 4C56B 2BSSB 5AUMB 1OM9A 2WCPA 1KB5B 2HJLB 3PLYA 3R18A 4TKWA 3AGWA 4FCHA 1XF5B 1SQ2N 4QYOA 4Y5YB 4JN1L 4U49A 3KWTA 3S6CA 3GHBL 1SZNA 3WDJA 3OGCA 3EUUA 2KDGA 2GJ6D 2OZ4L 4ZJ9A 3FQWB 3HCVA 4QLWA 4DP1X 3OJDB 1R3KA 1OAQL 4H8UA 3REVA 3GLEA 1JZ6A 2IO5A 1S9WB 32C2A 3QJOA 5ECJE 2G9KA 2VH5H 3FQ4A 3KBHE 3NJGA 4H8QA 4N8CL 4P4RA 3NDZE 3TO2A 2AQRA 3QO1A 1U8MB 3QRBA 5D7IF 4MMZB 2VLKE 5TDNB 4FGMA 3PPEA 2K3TA 3C5JA 3FOLA 5D2NB 3S4SG 4CDHA 3K71B 3CGTA 4UQIM 1A5FH 3CFMA 4DNLA 1ND0B 1K5NA 1F8TH 2D7QA 5E0QA 5L6YH 1TQCB 2JI2A 1ZK5A 2WINA 4JX0A 3LN4A 3KWWA 5EEWA 3TBBA 1PX3A 2X70A 1ILSA 4IGBA 2EC8A 5DZAA 2B5IB 3QI9B 4PJXF 1HXYB 3FT3A 3L9RA 3DI3B 2QQKH 3L9BA 4HUKB 5EC1A 1JZ8A 2UUDK 1KBWA 3K5RA 4HW6A 3M1CA 3L3KA 1CTMA 1IJ9A 1FBIL 4TUUA 1U9KA 1DQMH 3NCXA 3IMUA 5CZKA 1NCHA 1RHHB 1XD0A 4QRQA 5SWSD 2ARJA 4UI2A 3UG5A 1C12B 1Q72H 5EZJA 1KTDB 1J0IA 2UWEE 5INDA 3O6FA 1BG9A 4UQEA 1MRFH 3HG2A 4NUMA 2PWGA 1G7JB 3FKUS 5BZWA 4I48B 1O5PA 4N2NA 4X80H 5C7ZA 4JAMB 2YD8A 2VITB 2P5EB 3QUXD 4G8IB 4JMXA 4M7LT 1OAYH 1RERA 4L5FL 3HFFA 5BS0B 2ZYHA 4XP5H 2AMGA 3GXTA 4W9IC 4XR8C 5EU6A 5I73C 2GT9B 4W9CC 3ZKMD 1JCKA 4YGAB 4PN6A 2KPWA 4J5VA 2MCG1 1XO8A 3ARWA 4HKJA 5GS3A 5EIIA 3RLSA 3SCMD 4GUPB 5DO2C 1NCCH 3PV7A 2WHVA 3G6JF 3PGCB 4ZX3A 1UVQB 3NABL 3M17B 4OB5L 3T08A 5CEZH 4NQXB 5HHOE 5KVDH 3QHZH 1Z9PA 4Y1AE 5KVGE 4NN6B 3A24A 1MFEL 1JF6A 2VAAA 4RFEB 2UVEA 2VDML 2VW6A 5CMAA 3VFVA 1Q9LB 4WFHE 2MCPL 5DGQA 4L1DA 4G6KH 3LKNB 4MJ2A 5LGKA 3W0WE 4HOZA 5JHDD 2IGLA 3B83A 1N59A 4UF7C 4XPHL 2YXFA 3K2KA 1CXIA 1ZLUH 2PYED 2Y1AA 4WK2B 2E59A 1JVOA 3EO1A 2YMOA 3QEUB 2FT6A 1QI3A 2WXFA 2XN1A 3AS2A 2WUBH 3GMQA 1ET8A 5MI0B 5ABAA 3VE0B 5IMLB 2BIPA 2XY2A 1U95A 4XMKL 5EULV 1VCBC 3ZHLA 1FV1A 2KH2B 3LS5H 2BERA 5EF3A 3NCFB 1W80A 1OF2B 4AQEB 1A7OH 1G7LA 3KPNB 5J3HD 2IV8A 3JWDH 2OR7A 3VGHA 4I0PA 4JG1L 4LNVA 1CPUA 2OSYA 4H8WH 3N1MC 2H2PC 5EC2B 4Z3FA 4MA3A 4UNUA 4Z7OE 4BZ2A 2B3RA 4RGNE 4YDKH 2ZUQC 1XB6A 4XN8A 4ICXA 2W59A 5HXMA 2SODB 1IGTB 2NNAB 4E9SA 5CGTA 4PRPA 3P73A 1AD9A 2E7HA 5CILH 1ACXA 4M1GH 2F9BT 4ELDA 1BMZA 1CLYH 2QLVB 3IS0X 2CD0A 1Q0YL 4GXVL 4Y5YC 1QOKA 2CHDA 4A7UA 2VLRA 2CMRH 1RU9L 3IDXH 3O41A 5GGTA 5IMMA 5F9AC 2VDNH 3WD5L 1K8DB 5ANHA 5AW8B 4YWGH 5C0FB 1L5GB 4IMKC 2RQ8A 4KVCL 4YE4L 3FT4A 3MRDB 4KH9A 1QEXA 4JMNA 5INCA 2B4CH 4P2RB 4OF0A 5ALCL 1O6SA 2ITCB 3L13A 4MMZC 3MGTA 3NTCL 4OLXL 1XSOA 3DX4A 5D2NC 4H0IA 4PLKC 3TEUA 1P4IL 2V2XA 4UQBA 1DSFL 2ZSVB 3DHUA 3GSUB 3V6FA 3EZJB 4AG4H 1T5XA 4Q74A 1TQCC 1E3XA 3KYKH 5EO9A 3MBEB 4F9PC 4C56A 1INEH 2BSSA 5HDQH 3ABKB 5D1ZI 2AQ3A 2OR9L 1GW6A 4N2MA 2FR4B 4XNQB 4KRNA 2HJLA 1R33A 1MVUB 3I9IA 4RGMB 4HJIA 1XF5A 4Y5YA 3OAZK 1A4CA 1XF4B 4R4FH 3B2VL 4HD9A 2EE9A 4LCUB 1IBYA 3FQWA 4GXUN 4BA0A 5IBLD 3OJDA 1I7RB 1CGUA 2B5IC 1NM9A 3QI9C 4BV1A 4DFIA 2RMNA 1HU8A 2VDLL 5F7KC 2RH0A 4HEME 1BVKB 4HIXH 3FQTB 3SPCA 1QUPA 4IMKA 1ERNA 4EZJA 1YA5A 4LK4A 2J56A 3G5WA 5C0DB 4ZW5A 5LKNA 6TAAA 5TE4L 3P54A 1KCBA 1O6TA 5LBSA 4BYHA 1U8MA 4GBXD 2FO4B 4MMZA 5TDNA 5J0BA 3W82A 5D2NA 4NNPH 2VSKB 1QKZL 1UB6B 1GY1A 2DF3A 5JTWA 5DVNA 4FLOA 4BK4A 4N86A 2VGLM 3IGUA 3EAKA 4Y88A 4KTEL 2VRQA 3INOA 2ZWLT 3F7QA 2X4TB 3EIFA 4RSYA 4K8RC 4X7SH 3QQ9D 4JRLA 2ODIA 1UCBH 1Z2KA 3KR3L 2EUVA 1ZT4B 4JZNB 5B3NA 1SJMA 3E9TA 4JQVC 3AC0A 3OKOB 4QNPE 5HJ3B 5FYKU 3WBDA 3D50A 3D08A 2AQQA 1FL6B 4HLEA 2E7LC 3SBWA 2AEQH 4I0KA 4H2AA 5TE7L 1AHMA 1HXYA 2ZX6A 2PR9A 2Q6WB 2GK2A 1J10A 5B1BB 5HPMB 3B5TA 5C07E 1RHHA 4P23D 3WU1A 1XGPB 2RCSL 5DRWB 4EAEA 1C12A 1YNLH 3A23A 5LBVA 3FJTA 1UHVA 4R97B 3X3FL 1Z7JA 1G7JA 4TQEL 4DO5A 4R7NB 3TEXA 2K7QA 5KVFH 5KBDA 2MSPA 4NN6C 3CFUA 3FONB 3N44B 1QSZA 3N1GC 1CC3A 4JAMA 2VITA 2P5EA 3GXNA 5E9DD 4YHKH 1CGVA 5E6IB 3MV01 2B1HL 5BS0A 2E7LA 3P11L 3C8DA 1KGIA 2YD7A 2TAAA 2GT9A 4ODVL 1OF0A 3S35X 3F64A 4NM8H 2XX0A 4W9EC 1F6AB 4UM9B 2AW2A 4BUQA 3BVWA 3ZE2E 1CFNB 1UA6H 4K5PA 3TBYB 5GGRY 4C83B 4GUPA 4UILH 1H19A 6PCYA 5I16B 4HPOL 3QUYA 3DXAB 1KYFA 3PGCA 4XPFL 5MI0C 1UVQA 3OAUL 3D39B 1EMTH 3IETB 4AJ0A 2E5EA 3M17A 4XOCA 4DVRL 3ULUD 3HHMA 1OCZB 3H9YA 3LX9A 2NXZB 4HOXA 1S8DB 3MJ9A 5KSAB 4RFEA 1PZAA 4NCC2 5A2LH 1GIGL 2Y07H 4X4XB 4MCMA 1Q9LA 4JM2B 1ACCA 3EYQC 5I0ZA 3LKNA 4KI5D 6CGTA 5AW5B 1VZHA 4WVRA 4XNMB 2JK5B 1FCGA 4LRIC 3ZO0A 3VQ1C 2PYFB 3WHE0 4IRZA 3ZDZE 3ZE0E 1F6LL 1HJBC 1WICA 3G6JB 1HYSC 1F4XL 1K72A 3QEUA 4W9HC 1XEUA 1KEGH 1XCQB 2WWNA 3V0HA 1CF8H 3TCLB 3ZYIA 2XWCA 4OSUH 3VE0A 5G4OA 3D25B 2EEDA 5I0XA 3ULVH 5ADOH 3LRLA 4PW9A 4RA3A 1X9QA 4MQ7B 3SDXB 2YD5A 1T7WA 5DUJA 3PPSA 5IGXL 1PLGH 2DQHL 3QZLA 5CSZB 1OAUL 1QHOA 4YFLI 4EN3A 5EZLB 3STZB 3QEGL 3DGDA 3U1SH 2APBA 5EC2A 2AQ2A 2HH0L 1EJFA 4FS0A 2AI0H 3JZ7A 4C47A 3Q01A 5A43C 1EFXA 3LPOA 1FVDA 2UZXB 4KY1H 3TA3B 3X1BA 5K1NA 4LRIA 4EXKA 4Q0XH 4POZD 3MBEC 5HDBE 2YIHA 1F2XK 1OK0A 3IPFA 1SXAA 2QKIB 2XRAH 4GSQA 4RGMC 4E9RA 1JDCA 2WB7A 3PU7A 5BQDA 1IBGL 1OLZA 1CIDA 3BHBA 1ADQL 3MTRA 3VFMA 2G2NA 3B9KD 3LZFL 4MZ2A 3TA4D 5C71A 5C0FA 5E8DH 1A02N 1L5GA 2DIAA 3QDJB 4NDMA 5JHLL 3K0YA 3EADA 3MRDA 1E8WA 1LM8V 2IGTA 3BKJH 3H55A 4P2RA 1LVEA 2YZ1A 4QRRD 5C08B 2OZNA 2ITCA 2Z35B 3LQZB 3ESMA 3H56A 4R5TA 3DYMA 4DZBA 5IHBA 2E9IA 2EVJA 2EYSB 2GTWA 3T3PF 1LO4L 3WKYA 3T2NH 4EIZC 1Q1JL 3D9AL 2XLLA 4G8EA 5EG6C 3SDCD 1SPDA 2ZSVA 3GSUA 5JHBA 4MQXD 2C4XA 5D7JA 3TJPA 4PW4A 4IKJA 2PCPA 2JFCA 1N26A 3LZPA 3MBEA 4NBYB 1S2EA 3RU8H 3MNDA 1AGBB 5BNXD 2FR4A 4XNQA 1MVUA 2IAMB 4QXGL 1TETH 3VXRE 1BECA 2D0HA 3E9UA 4HETA 4LCUA 1HHIB 1AFVH 3SZ6A 1I7RA 4LKCA 5GZOD 3NJHA 3DV6B 5ES4B 1Z9LA 3GSRB 2Q8AL 1A1OA 4C4KT 1BVKA 4CU6A 3FQTA 3Q1SH 5FA4B 4M6MH 5C0DA 2WJ7A 4WY7L 4DN3L 4V11A 2OXGB 2OYLA 1JNHB 5KYNA 1UB6A 4M7JL 2DLFH 3RGVB 5KVEE 3GJEA 5B3SB 1ZGLB 1LE5B 3P30H 2EXSA 1P5VB 5F3FA 2AK1L 4R97C 2X4TA 3MBXL 1RHFA 4MJ5B 3DOSB 4M8QB 1OOWA 1QLEL 4IJ3B 4L0ZA 1JZ7A 5DFAA 2BH0A 3UGEA 1ZT4A 2ENYA 3HHSB 4XPBH 3RPKA 1L4IA 2B39A 4JZNA 2ENPA 1HOCB 3OKOA 3UG3A 1ZTMA 4HAGA 5HJ3A 2IANB 1MCPL 1RD6A 3BUPA 3DTDA 5E6IC 1I1CA 3RIAF 3ZSSA 1FL6A 3K6SA 1OALA 2Z4TA 1BYPA 3WNIA 1ASPA 4XTRD 1BV8A 2Q6WA 4J12A 4WI0B 2W0FB 3IU4L 4AJWA 1M05B 1J05B 2VLKB 2ZG2A 1XGPA 2R7EB 5DRWA 1ZLSL 2VC2B 1KXVC 3DPBB 4Q89A 2P43B 2GVYA 4FNUA 4O2FB 4MB1A 4ERSL 4R7NA 1QFPA 1GGUA 4W9KC 2NXZC 2AQPA 3MODL 3FONA 5KSAC 3RTQB 4J8RB 4U1SB 3RB7A 5E23A 4XP1L 1I3GL 4JM2C 4NM4H 5E6IA 1SBSH 5IB1A 2ORBH 1YEGH 1CI3M 1ULVA 2H6OA 2ZOOA 3BSGA 5CIPB 1KCLA 5DEGA 1I1AD 3A47A 4OFYA 1OSPH 1MNNA 1F6AA 1JFHA 1T1ZB 1YMMB 3RWCB 4UM9A 4DGVH 1BWMA 1ZVHA 3CPUA 1QABA 1A7RH 3TBYA 2R51A 1I8IB 3GSXB 2DQDL 1X5LA 3GKWL 2YQGA 3DXAA 1KXVA 1KXHA 2UWEB 4DPCX 2JKNA 1OZTG 3IETA 4M1CD 1KCSL 1JWMB 1NUGA 3APFA 4AZ8A 5FWRA 4U1IB 1HYRC 1XF3B 4LSVL 1S8DA 4UMGA 5KSAA 5IW3A 2OI9B 1OCOB 5F71A 4D9LH 3UCQA 3BP7B 4HJJL 2GJ6E 4HEPA 2HMIC 4JM2A 1G9NH 1X5AA 2EZ0D 3D09A 4QRPB 3FSZA 3KLLA 2AXWA 2PUQT 4J6RH 3EFDH 5ITFB 3KHQA 4NFCA 3GBLA 3TA3C 3VJ6B 4XNMA 3FO9B 5IB3B 4DUVA 3FO2B 5EF2A 2PYFA 3ULAB 5HI4C 4FQIL 2XIIA 4JQXC 3X1GA 1T89C 1ETB1 2QKIC 3DX1A 1KB9K 2L7EA 2LTQB 5HVHB 1RJZB 3AACA 1XCQA 4Y8DC 3VH8B 1CGWA 4JKPH 1ZHNB 1RURH 3IJYB 3TCLA 1SUJA 3GSNB 4YHPB 3D25A 1FGNL 3FHEA 3OKEB 3MCKB 5IOPB 1FN4B 3BZDA 2BIOA 4Y1AB 4M7ZB 4MQ7A 3SDXA 2I7SA 1A7PL 3OB8A 3WY2A 1E50A 5CSZA 1ZXQA 5EZLA 3STZA 1REIA 4PGBB 4LHUB 3I02B 4K3JL 5EO0B 4M5YL 1MPAH 4U6YA 2UZXA 3HE7B 4NT6B 3W0WB 2NXYD 3S8WA 1UGNA 2X6MA 4JQXA 2I60H 2MQ3A 2MOVA 3HBQA 2QKIA 5SWSE 4U3SB 2IAMC 2LW3A 4QMEA 4RRPG 4YHOL 1F90H 3ARDB 3ARBA 3IPBA 2CJUL 4MWFB 4L5FE 1QRKA 3DVFA 3PDDA 4MB5A 5HBBA 5ICYB 4LLDA 1RIHH 1OGAD 4JHWH 1MI5B 1I9RH 1M2VB 1U0QA 2BJML 2EIZB 3D2UB 4PJAF 1ODUA 1OE3A 5F7DA 1JK9B 2Z35A 3LQZA 1DVFD 2HLAB 2XBZA 4DK6A 2J5LB 1AQHA 3R06A 2EYSA 1A1MB 4OD2A 2OMYA 4W4OC 3KH4A 1SXCA 3RGVC 4Z7OB 4R96B 1WZMA 5AYUH 1LK2B 2DYRB 4GAYB 1YVLA 4HCIA 4IJ3C 3BP4B 1PD1A 3K8MA 1UOLA 2IAMA 1K2DB 3FH7A 3WE6B 4PJ7F 2Y25A 3JQOB 4TYUA 3GLZA 5EU4A 1HHIA 1DLFL 1EA9C 1OD9A 3SGKC 4N6RB 3CLFL 3QXAB 4Z7IA 4YH6A 3DV6A 4UZUA 3GSRA 3Q7JA 3VAEA 3QDMA 5GGSB 2MMXA 5FA4A 2Z1KA 3MYJB 2DEWX 2VXTL 3TEYA 5HVWA 3T3PB 3LRKA 2EVGA 2OXGA 3LD8B 4XMTA 4E9TA 2RQEA 1JNHA 4LESA 1FFNA 1NM4A 1ZGLA 1MW0A 5JHDE 4YXLL 1LE5A 1P5VA 4WUKL 2ZXGA 4YIQB 1JGLL 3FF8A 2R56H 2PYEE 1RSFA 3CFTA 3DOSA 4M8QA 2QGDA 2PPEA 5AVZB 1ZDQA 4KO7A 1FNAA 4UU9B 3RTQC 3HHSA 1R5IB 4B3EA 4XNYL 1HOCA 2P24B 3FT2B 2IANA 2XKSA 2PP9A 1AZNA 3BX7C 2J12B 3S0PA 4L2YA 5I1JH 2E4FA 3SGKA 4JRYB 3MLZH 4ZMXA 3VUAA 1BGXH 2UZYB 4QY8B 2FEJA 2Y2WA 5DJZB 4G82A 2HRPL 4OCMC 3CX2A 4WI0A 4FQ2H 4FZEH 4NO5A 4HWZB 4OZHE 3P4LA 2ZUWA 4Y4KB 1M05A 1CXEA 4ZX5A 2HLFD 5D7SH 1J05A 2A6JB 3KGSA 5D5MF 1W8NA 2VLKA 5GISL 3FUFA 1UADC 2R7EA 3TNMB 2LFGA 4LVOB 1CYWA 3DPBA 5CLYA 1BZEA 2BCKB 3P3RA 3IB4A 4OCNC 5LLIC 2HT3D 4ZOAA 1A0QL 5FAAA 3C6LB 5B8CB 1SOSA 5AVXB 4A04A 2BP0B 3D1MC 1XV8A 4FP8H 3T8XB 3FTVA 1EK3A 2OI9C 3RTQA 3UABA 3JT2A 3UGUA 3QE5A 3QORB 4U1SA 4WENB 3OBAA 4HH9B 1TU2B 2L0DA 4ZW6A 2ZXAA 4RMVA 4YMPA 2ADYA 5HY9B 5EPMB 2Y36H 1RZ8B 1WV7T 3MOBL 5LCVL 5CIPA 1MHCB 4G9FD 4P57B 1QTPA 3LNFA 2XWZA 1NFDF 2NUPB 1T1ZA 1YMMA 3KW8A 3O3DB 3QJUB 3RWCA 3VWKB 2CXGA 4HFUL 1ZANH 4LXFA 1MCOH 2LTQC 5HVHC 4Z3JA 1I8IA 4NHUB 3GSXA 3IJ9A 4U4IA 5J6SA 2J57A 2Q9OA 3J2PA 2UWEA 3GI9L 4M3KB 1FAIL 1BP3B 4DESA 1JWMA 2EDQA 2XFXB 1RP8A 1TSRA 3DIFB 4M7ZC 1LQBC 1AY1L 1D9KD 1AJ7L 3MC0A 2C34A 4JO4H 3H1ZA 1DQIA 5JDJA 1DSWA 4I89A 4K3DL 3UYRL 3BP7A 1IGFH 2X12A 1E5ZA 1YYCA 4I77L 4DPAX 4EUPB 2J72A 3JTTB 3PAVA 4FABL 5ITFA 4MTMA 3VJ6A 1TCMA 3HE7C 4J3BA 2EUZA 1QO3B 1YCSA 1MCKA 3FO9A 4TRPL 3ZZSA 3FO2A 3WEAA 1JHTB 2WLLB 1YQVH 2A99A 1D5MB 3O4OB 5IHZB 2WZ0A 3BWSA 4FNTA 2ADIB 1WIOA 4XOAA 1RJZA 4KRLB 3VH8A 5FOBB 3ARDC 1R24B 1T1XB 4JPVH 3NDYE 1ZHNA 3IJYA 1JZFA 4XCYB 3GSNA 4JZJA 2BHFA 4YHPA 2Y4SA 3OKEA 2XY1A 3MCKA 4PR5B 3QEQB 3DSFH 1FN4A 5IOPA 2DQEH 2UXVA 4Y1AA 4BFEA 5DXWA 3CFCL 4ANXA 3UJTH 1XEDA 3JV6A 4X6DE 3ZDYE 4XP4L 2Q86B 4PMEA 4KZEH 1I9IH 4LHUA 4PGBA 3DRQB 3I02A 2J5LC 4OUOA 5EO0A 1I9JL 3ETBF 1ONQA 3ECUA 5E6YA 1E27B 1QUNB 3HE7A 1A4AA 4I5BB 4NT6A 2E75C 4P9MH 4PJHF 3W0WA 1V3KA 3IMTA 4HGKC 5BZXA 1OANA 4GKSB 3D34A 3MRKA 2KLTA 4X6BB 3ZU8A 5E9AA 5I1CH 2OMXB 4I0CC 1TR7A 4N4YB 5BQ7B 4U3SA 1FZJA 2YSTA 4XI5C 1XGTB 2GY7B 4MWFA 2P46B 4O4YL 3NJKA 1H5BB 4MBRA 4MNQD 2ZUYA 3UTPD 1SDDB 1U8NB 2P42B 4IKKA 4N90D 3SE9H 5FUZL 3WGVB 5ICYA 1EHLH 2VZ3A 1F4WL 4WSKA 2JJTA 3DIVA 1M2VA 2CO3A 2EIZA 3DJTA 1E42A 5FGBC 1HL5A 4OLZH 4AIEA 5E9DE 2NTFB 1HJCA 1JK9A 2B08A 4RISH 2A9MH 2HLAA 3LD8C 4MYPA 5GGUA 1A1MA 3QQ3B 3MV7D 4F80A 3G7TA 2XKNB 2EXWD 2BSDA 4R96A 4UUJB 3UBXG 1LK2A 4H0GA 4YHMH 4GAYA 3PYCA 4MJJA 3S5LA 5TD4A 2H3KA 3BP4A 3FXIC 1TTAA 5I26A 2VM9A 5FHAL 5I1AB 4J4PC 1JGUL 1K2DA 3WE6A 3MNVB 1ORSB 3LSOB 4WQOA 1GGCL 5LGJB 3ULUE 4N6RA 3QXAA 4AT6B 2E7BA 4Q14A 4XVUC 2ALWA 3IWUA 5GGSA 4JVPA 15C8L 5FGBA 3QBTB 3MYJA 4Y4FB 2V17H 5IW1B 4Y4KC 3W37A 2WLKA 2CUIA 4KI5E 2NSMA 3WOVA 2BS9A 3ARFD 1XGUB 4G9DB 4LVOC 3CX5J 2A9DA 3W2DL 3HMXA 4YIQA 2NPLX 3C6LC 3T71A 3NQKA 5B8CC 4M3HA 2XZZA 4PJ7B 3PAZA 1TJMA 4AIOA 3NJXA 4JO1L 2D3LA 4PS7A 4HSCX 4J4PA 1OTTC 1R5IA 3QORC 3D6GA 1G0DA 3FT2A 4L3EB 2XWEA 2B9BA 3MRLB 1PAMA 3SKJH 2V0AA 2APWA 4H1LH 2O93L 3D4CA 1BBJB 3DVGB 4IU3B 4P99A 2XN9D 4HEMA 2UZYA 4BFIB 3GFUA 3BO8B 4QY8A 2AQNA 5D6DC 4Z23A 4WKZA 2VMEA 3LEVH 4N2IA 3VWKC 4FZ8H 3GMLB 3ZMEA 3QAZB 4NQDB 1PZUB 4WHCA 2A6JA 2CLVB 2OL3H 1GS6X 3TNMA 4OBSA 2HKFH 1HCVA 2WQXA 2DWDB 1P6FA 2BCKA 4LKXB 3U2SA 3AITA 3GEWB 4BRJA 4PW3A 1G4MA 3C6LA 5B8CA 2BP0A 5DCCA 3B4NA 5F1KC 4Z9KB 1O9WA 3QORA 3N6YA 4HH9A 4MA8L 1JF1A 1TU2A 2I25N 2Y06H 4M61B 1RZ8A 3BGMB 5C6TL 1R3HB 4MD4B 1SLVA 1MHCA 1NAML 4P57A 3HS0B 3TFKC 5D6DA 4AENA 2NUPA 3O3DA 1E6OL 1S3KH 4QRRE 2P3YA 3TNNB 3VWKA 2KZ1B 2VUKA 1VPOL 3O4OC 5GJTL 3UX9B 3WXWL 2J44A 3I6KB 1KIUB 2DKSA 5F88B 4NHUA 3S3DB 1NMBH 1EZVY 3TTYA 2EAEA 3JV0A 4BIKA 4K71B 4M8RA 4YZFF 1ZGLM 1EWHA 2XFXA 5C8JB 2FAUA 1WBZB 3DIFA 1HQRB 2Y1ZA 3H9SB 1VFMA 1DVXA 2ODHA 3SE4C 2H0JA 2PPFA 3VXSD 3OXRB 3JTTA 3LQMA 1DJZA 1D6VL 3ISYA 4B27A 2BC4B 3FU8A 4LQFL 1A7QH 7CGTA 5JIPA 1QO3A 5JORB 2NY4D 1JHTA 2NZ9C 2X4UA 5ACLA 5EEYA 2WLLA 5C0NC 1UT1A 2J6EL 4QWWD 1OPOA 3SPJA 3UJIL 4DP5X 1D5MA 1OM3L 3WELA 2AJ3A 1QI5A 2ADIA 3MLUH 3LHAA 4FKEA 3VG0H 1FFOB 2IQ9L 5CR8A 2DLTA 3TV8A 1R24A 2O5YL 2V8MA 4ABUA 1DE4B 3FSWA 4XCYA 1H5BC 1T7YA 1T1WB 2BVUA 2ILLA 2WXJA 2XSKA 4OI7A 4PR5A 3QEQA 1QR1B 2NLJB 4YXKH 2VXQL 1J5CA 1DDTA 3CC5B 5GQBA 5SWZD 4I3SH 2Q86A 4GRWE 3SE4A 2J8UF 3AY4C 5CLXA 5ANMB 5I15H 3VW3L 3DRQA 3CXFA 3MLYL 3LXAA 4KV5F 1E27A 4XP9H 4QF1B 1QUNA 5LNDA 4I5BA 2YMXL 5AAWC 2COQA 1BFVH 1I1FA 1THAA 3QG7L 4GKSA 3EO9L 4HLJA 4P5RA 5FCUL 4X6BA 5JZ7C 2FJGB 2WPGA 5BQ7A 5L8LB 4JG0L 3WFDH 4CC0A 1XGTA 4S1DD 4LEOB 3T77B 1WCBB 1H5BA 3IE4A 3VMPA 1NCNA 2VDRL 1CFQB 1SDDA 1U8NA 5KOVC 4YEEA 1XGZA 3GJFA 5DDHB 4Y4FC 3CXDH 3PAUA 4HJGB 4AW7A 3AY4A 1KFGA 2AQTA 3T65A 2A4EA 3ZTCC 2BP8A 4YZWA 2V5MA 2ED9A 1F02I 2PWEA 2CUMA 2YD4A 4LFHG 3HVDA 1XSIA 1IAII 3QQ3A 5AYTA 3MJ6A 2XKNA 3AT0A 1UD5A 4PBVC 4HBCH 5AAWA 4UUJA 5JIQA 4ELMF 3IWVA 3WIHL 1G0XA 4U1LB 4ZO8A 4FULA 5JQIB 2YAQA 5FYJD 5I1AA 5SWSB 4QJ5B 4JFPB 3R4DA 5EOTA 5MEPA 3MNVA 1TQWA 4WGWB 4PJXE 1T7VA 3ULVF 3LSOA 2BZ7A 2IBGA 4F2EA 5LGJA 1A8ZA 2WN2A 1XAUA 2XICA 3CU1A 1BFOA 1VERA 3BKMH 4MZ3A 2BY3A 2H9GA 1A7BA 2BPBA 5DHEA 5FYJL 1RUPH 2ZUTA 4F37F 4BA8A 5TPWH 3S34H 1PG7W 4Y4FA 5DEFB 3W39B 3QAZC 1IGCL 3QUXB 5IW1A 3B9AA 4UV7H 1U93B 3MJ7B 4P8QA 2AAAA 1XGUA 4PQXA 4G9DA 2A9NL 4KROD 2HKHH 3HLAA 4CKVX 4GG8B 1CFMA 5CJXA 5CR1A 2EXYD 1HKLH 2O1AA 3DV4B 3AUWB 3SCMB 1ITBB 2MCMA 4MA7L 4G1MB 4NYLB 5ICZB 4PB9L 3VXRA 4X4ME 1MUJB 4L3EA 1UURA 4UANA 4KZDL 4NPKA 2XPGB 3MRLA 4YDLB 1GYVA 4P2OD 1BBJA 3DVGA 4IU3A 4ZAKD 1A3LH 1E9OB 4BFIA 3HS0C 1JNLH 3BO8A 5I2IB 2Y7MA 5KUKA 1V27A 3PP3K 3UERA 3GMLA 1JTTA 2GPZA 5HDOA 1IE4A 2EC9T 4Q9QL 5F7LB 4YHNB 1DQJA 1IMHC 2CE6A 2CLVA 3F58L 3PP4H 1ZA3B 3QCVH 5F0JB 2IH9A 1F58H 4Q4EA 4MXVF 1EVTC 1MFNA 1I8MA 4K71C 1JAEA 5JHDB 2KL6A 2DWDA 2ENQA 4XP6L 4BFRA 1GZHC 4NWUH 4HIJB 4AQ8C 3NEEA 2PYEB 5DRZA 4FKHA 1W91A 1N6QL 4L29B 2DQGH 1BCIA 2XWTB 2GQHA 5E8NB 2VW7A 4NZUH 2X4QB 1IEBB 1FIGH 2IV9A 1NCBL 4FHBD 5IUSA 3EBAA 5T5FH 4M61A 3BGMA 3R8QA 2Y24A 1OGAE 1R3HA 1X5GA 3A67H 4MD4A 3S36L 2CKBH 3HS0A 5HHQB 1GS8A 3H4FA 3TNNA 1P53A 4JY5L 3GKZA 4OZHB 3A6BH 2JKIS 3PY9A 1R3IL 1KIUA 4PLJC 4F8QA 1NCIA 2W81C 5F88A 3ZTJG 1DQLL 3EH1A 3T0EB 1HTYA 4EI0A 1GXEA 4AOFA 3O2WL 3VFSB 1NOFA 4YVUA 1YEFH 1FZMB 2GI7A 4YSEA 3MACH 2MIZA 1GZHA 2DQJL 2ZXEB 3EHBD 3Q48A 4V1DB 5IG7B 1WBZA 3ASWA 2D2OA 1HQRA 3GTNA 3HG5A 3SGDH 4A2DA 2V37A 4NKOB 3VRLF 1TQVA 2KZWA 1XIWD 2EO9A 1AS8A 3I9PA 5IK3B 3OXRA 2K0RA 3H7BA 43C9B 4DCQB 2ZG3A 3S35H 3SGDI 1XF1A 1DBBH 1MLCB 5E5LA 5DLML 5ABDE 1NBZB 5H37A 3H85A 4JFSA 2A0LD 2AJVH 2OMVA 2HPTA 3V0DA 3B9EA 4GSDL 2BS71 4N0CD 4PHXA 5TGBB 5B38G 2N3JA 1QSFD 3RIAK 1FFOA 3DECA 1OP5K 3P9LB 1E8ZA 2IWFA 4G7VH 1OARH 1DE4A 3HS8A 2OMUB 3CCHB 4M00A 1KOAA 2HG0A 1T1WA 2OZ4A 1B4RA 1JXKA 4HPYH 1QR1A 1CDJA 4F15B 4PVLA 1TMQA 3MUY1 1JZ2A 1SHXA 1G1KA 2C3GA 2PP7A 4Z7AA 5BVJA 1QA9B 3CC5A 2ZOUA 3FH8A 2JKTM 4WDIB 1R5WA 2BNRD 1IQDB 2GJ6A 2Y6SD 5CGYD 4XO9A 3ROLA 2VH5L 1UD4A 1OCWH 2AEWA 4TVUA 4QF1A 3WNNA 3TT1H 4QXUH 4RZKA 3G3LA 3O2DA 4QRAA 3E7JA 2YRBA 2WKLA 3HG4A 1A5FL 1DVQA 4CUCA 1F8TL 4GBXB 4LT7A 4OGXH 5DYFA 5L6YL 1JV2B 4AL8C 3K0WA 2OM5A 3QAQA 3O0LA 2WZPD 4PBWD 4U1NA 2AJYH 1MCCA 3N3EA 3BIBX 5F89B 3QIUD 1WCBA 5F7WC 3UROR 3L9EA 4W70A 1CFQA 5HHMB 4XAWH 4V33A 4WU5B 2VR7A 1XCTA 2PTUA 3ROOB 5DDHA 4QHMB 5I0WA 3QUXC 2QQKL 1AGDB 4HJGA 1DQQB 5JOFB 3F83A 4UINH 1DQML 2QTEA 4MA1B 3UBFA 4A7SA 3ZKMC 4G9FE 3DOHA 3T4AB 4H8VA 4NKDB 1WYJA 5D6CB 4P5SA 1KJ2B 1N3NA 4B41A 1Q72L 2EYRA 1JOIA 3D5OF 4IKIA 4U1LA 2FATH 1C5DB 1BD2B 2CO6B 2VDKL 1SM3L 3SCMC 4P23B 3BT2H 5I9QB 5SWSA 3SQRA 4JFPA 2QELA 4XBGB 3KLKA 1I53A 3EFFA 4LCCB 2HSIA 2PTTB 5DQDH 1AE6H 4YDLC 2YBGA 4U05A 4PEEA 1S9XB 4PY8J 5F9JB 1OAYL 1NPUA 1VFUA 3B3IB 4XP5L 2FWOB 4A7VA 2OJ1A 2VDQH 5DEFA 5E9DB 3QUXA 3W39A 4GQ9H 1Y6MR 2D73A 3VGFA 4ZX6A 4NZ8A 4UYPA 1U93A 3MJ7A 1PG7L 1HXMB 4XPGL 3IM1A 4YL4A 1BYOA 4B60A 5IMKB 5T3XH 5IVXF 4GG8A 3H2WA 4PYGA 3CZGA 1NCCL 4HCRH 5MEND 4U1JB 1CK0H 2W1NA 2ZOWA 4PS4H 5CEZL 3SCMA 5KVDL 1AIZA 3QHZL 4G1MA 4QHLB 5I8EB 5ICZA 1MUJA 2EEFA 2IEPA 2K70A 3PQYD 2RBLA 3Q8AA 3IXAB 2WQRA 2XPGA 4H2CA 4N87A 2GC4C 2G4EA 3ZIYA 4A38A 1HZHH 1E9OA 5J3HC 1UM6H 1NGZB 4G6KL 2JXMB 2F74B 1OZUA 2UX7A 1OP9A 2IGFL 5IJBC 4YHNA 4Q58C 2QJDA 3ARQA 3KPLB 4N8PA 2ZAHA 3JXAA 3T0EC 4A7TA 4JPIB 2MOQA 4YUEH 2DJSA 5JHDA 5F1SA 4LPTA 2HFGL 2WUBL 3IBEA 5C0JB 2PYEA 2FNWA 3LS5L 1IC7H 2XWTA 1CB4A 3APDA 4C59B 5F21B 4YSTA 5E8NA 5EIVA 1A7OL 3ILQD 3VH8G 3FUHA 2WD0A 1IEBA 2X4RB 3EBHA 3JWDL 4MD0A 1NQBA 2FIRT 4MNQE 3UTPE 1ORQB 2AP2A 4H8WL 4N90E 3UPRB 3MV8B 2VT0A 4LSDA 2TRYA 1BVNT 1MFDL 3SKNA 3GMNB 5HHQA 4ABQA 4YDKL 4OGAD 3D8MA 3QK0A 4OZHA 3Q8FA 5EU3A 2P49B 3HN5A 1DCLA 5CILL 3N9GL 4NNYA 3T0EA 3MV7E 2WWMD 3NIFF 1CLYL 1T80A 3OWRA 2BW4A 3HNVH 1S7VB 1FZMA 4V1DA 5IG7A 4F15C 2CMRL 3LH2H 3IDXL 3SKMB 4NKOA 5D1ZD 3WJLC 3OF6D 5JIMA 1T04B 4YWGL 1RSYA 5JMOC 3BSHA 5IK3A 1QBAA 2G60L 1MCHA 3M07A 4JVWA 1PIFA 4LP4A 1KLUB 25C8H 3B2UC 4MDJB 5IBLC 43C9A 5KG9B 2B4CL 1N12A 2FWLB 3BZFB 3EGDA 5CN1A 1MLCA 3MCYA 2XWXA 4LBAA 4EDXB 4KK9D 1NBZA 4RCAA 3ISWA 4K7FB 3KVQA 5TQ0H 1L7TH 1QLRB 4KK5D 2CA3A 1Z0MA 4GBXC 4OFIA 4AG4L 1YJDL 3KYKL 5B39B 3BOVA 3P4MA 3L3IB 1INEL 4LARL 1GY2A 4YLCA 5HDQL 3W9DB 3P9LA 3VM7A 3SDCB 3RYMA 1EXGA 2OMUA 2ZAGA 3CCHA 2W0LA 4DEPB 1SJVA 4R4FL 1J8RA 1HN1A 2N0KA 3L6FB 3QQ9C 2LVCA 5IKCB 3WJLA 1QA9A 4JFOB 2HG5A 2WN3A 4WTZA 4WDIA 2D03H 4HIXL 1MWAB 1VJSA 1KPUA 4ZMLA 4AEIH 4MA1C 1HHGB 4AIZB 2XN9E 2F54D 4BKLB 2X1PA 5ACZA 3T4AC 5I6XB 4JR9H 2HWZH 2JJWA 2QPUA 4PV9A 4NNPL 3WS6C 4FE9A 3LN5B 4OAWA 1HI6B 4W9DC 5IHLB 4GBXA 4WGKA 4P23C 3D30A 5I9QC 1X5JA 1S9YA 1DJGA 2Z8WC 4X7SL 1RZFH 4UTBA 6PAZA 4CNIB 4LCCC 1YPZF 3L4WA 1UCBL 3X12B 1UYWL 5C0IB 2IH3B 1KCRH 4UZSA 4ABVA 4HKZB 4WU5A 3II1A 1K3ZA 2NZ1A 2HJFA 2VN3A 4H4NA 2BIMA 3BKYH 3ROOA 1JP5A 2DYPB 1FVEA 1AGDA 4GRWB 1FYTD 1DQQA 1N5YH 4A68A 4RH4A 2J8HA 4EMZA 4CVXB 5JOFA 1B2WH 2JMRA 3ECVA 3MJWA 5J1SC 5FM5O 1DTUA 4NKDA 2OSLA 5D6CA 1AZBA 1KJ2A 3DA0A 3WS6A 3BIAX 1PEZA 2EQDA 2ZKHH 5E2UH 3ZTNH 2CO6A 1MFAH 2KZBA 4I4WA 4NNXA 4GO8A 4P23A 1BJMA 3AWFA 4XBGA 5D4JA 3ZSTA 1IM9D 5KVFL 1E8YA 4Z7VF 1P7QD 2PTTA 3IYLW 2XVBA 4DP9X 3ULUC 4PJCF 4JHVA 1X5YA 2E4TA 4YHKL 1AD0B 1L9RA 2VE6B 1LILA 5D7HA 5EZPA 2NQ3A 5C0AD 3V55A 1NLBH 3B3IA 4HDIB 2FWOA 3VB9A 2BIIA 1BAGA 5KYYB 5HGBB 5E9DA 4NM8L 4OW6A 4X4YB 3DGCR 4GG6E 4X8GA 2EECA 3VFWA 1A3RH 2Y3NA 4KI5C 4E9VA 4E9XA 3TF7C 1HXMA 5LG1A 5A3ID 3CZFB 1DO5A 3RJOA 1UA6L 4BE5A 1BZ8A 5IMKA 1KLGB 4UILL 2AV1B 4RDQF 4R84A 4XWOD 5E5MA 1NLDH 1PZ2A 3VRJB 4U1JA 1EMTL 4ZS6D 4MXQD 3TH2T 3P3TA 3Q2CA 4QHLA 1RP9A 3L45A 3ZGIA 1LL1A 3BUIA 4AY0A 4G6FD 1P4LA 1F00I 1K6QL 2OMBA 5CD3B 1EZSA 2FTAA 2WSDA 2Y07L 4NRXB 2XYBA 4E0RB 3FU7B 4P06A 3BD3A 2DOCA 1SF3A 3EBIA 3IFPB 3L1FA 5CZXD 5SWZE 2P45B 1NGZA 1KXQE 2JXMA 3KWUA 2F74A 3MRGB 1BYNA 4ODSH 1CVSC 3NEOA 1IQWH 3CMOL 4ZX4A 5FM8A 1CL7H 1FYHB 4EUPG 1UXLA 3KPLA 3P77A 4XE0A 2ED6A 3VACA 2PW2B 4JPIA 3NCYP 4CN4A 5HI5D 3ES6B 1KEGL 1AI1H 4GMSH 3EH5B 4LASH 1CF8L 1OQOA 1CL7I 3PHAA 5MP6H 5C0JA 4OSUL 1H6UA 2WBWB 1U3ZA 3RBGA 2KS0A 3VFPB 2OQJB 2YAOA 2QBWA 3ULVL 2GITB 2OCCB 2J21A 3F12B 2DRUA 3BN3B 3RA7H 1B3JA 2DD8H 2X4RA 4H26B 3KDMB 4UNIA 2DQIH 1ZLUK 2HX7A 3FCUB 3K74B 5K59F 5AOZA 3UPRA 3MV8A 2YC1B 2AI0L 3GMNA 4HWBH 5I71B 4N6QA 4KY1L 3ASOB 2CHWA 2LAAA 3BW9B 3C5SB 3N91A 4Q0XL 3RWFB 4IRSB 2HTLD 3TIDB 3WDHA 2WXOA 4Y2OB 4J23A 1W72H 1TQTA 2JQZA 4FNSA 4NN5B 3SDCC 1KENH 3BMVA 2ZWSA 4MQXC 4DEPC 1ADQA 4S1RL 4LB8A 3NZSA 1S7VA 4TUOB 5KSUB 1ZOXA 1SXZA 1MCBA 1J1OH 5FYJE 2J3SA 1P6AB 3CVDA 2E6JA 2ZICA 4GI8A 5KBKA 2NY5H 5FO7B 2DBLH 4MDJA 5KG9A 1VF5C 3B9KA 3K2MC 3BKJL 4HV8B 4ORZC 3SD2A 3U7WH 5GZOC 2HRHA 5I6XC 3S2AA 1TUPA 1EBPA 3V0AC 1OGAB 4JFTA 4OH2A 4GKLA 4Q6KA 4O02B 5IQNA 3T2NL 4QRRA 1QLRA 3QIWD 2VKXA 3VU2A 3EKCA 1DVFB 1MLBB 3PREA 1IVLA 3L3IA 3L3JB 3OL2A 3DX6A 3RU8L 3W9DA 2QHRH 3SDCA 2R1YA 5FUOL 3TONA 5KS9E 1OTUD 1TETL 1MAKA 1A7NH 1DQVA 3F7YB 4ACTA 1ZLDA 2D7TH 1S5HB 4XOEA 3PJSB 4GW1B 4PJAE 3TCTA 2WXGA 3FT9A 4UDUA 1T20B 5AW4B 1N19A 5IROC 4JCMA 4JFOA 3OC5A 2D3VA 4PCYA 4NC1E 4ZYKB 4IBTA 4FMFA 3C60D 2A38A 4M6ML 3CPLB 4YLBA 5GZOA 4OQTH 4S11A 2GEEA 1HHGA 4AIZA 4YGVB 3LRMA 4XTRC 1IU1A 1HESA 4PVNA 5E2TH 3ZLQC 2H3XC 3P3UA 2V5RA 1GH7A 3VG9B 2DLFL 3LN5A 1NANH 3P30L 1HI6A 3V8CA 5JNYB 4KPHH 2HFEB 2EDOA 2MNUA 3L54A 2VKWA 1WO2A 5F9DC 3UO8B 4BK5C 4CNIA 1G9EA 1DYZA 3EGXB 3X12A 2FYYB 4XPBL 5C0IA 2IH3A 3A4EA 1NANI 2HT4D 2VDOB 2Z1PA 5IB5B 2OBGA 4HKZA 2WOBA 4PPTA 3ZT5A 2MNWA 2XPYA 1GTFA 2AXFB 5L4IA 2QGCA 4NX0A 5BO0D 4FG4A 5BRPA 1RZKH 4F8LA 2CLZA 1GMEA 2UZIH 4WNQB 4NAQA 5DA4A 1N67A 4CVXA 2GJZA 1JZ3A 4RMTA 2WSKA 4AWJC 3WN5B 4MRCA 3V9FA 1WSST 5TQ2L 5B1JC 1GHFH 1TZIA 2AERT 3NSFA 3VQLA 4G7YH 2F6AA 3EXLA 2K6YA 2OTPA 4YQXH 4NZJA 3MOQA 3KYMB 1DJXA 4NOFA 1AACA 4H5SA 4HT1L 3A21A 2CK2A 4BK5A 5KWYC 4ZUWB 3QYMA 1IGYB 1TVDA 3ZZQA 2JTYA 4M5SA 1RIUH 4M1CC 4N0YH 4M5ZH 4X5QA 2GW5A 4D9RE 1AO7D 1JBJA 2E86A 2YD1A 1AD0A 2VE6A 2EDHA 4NM4L 3F65A 4PV1C 3UG4A 1SBSL 2ZF8A 3V4LA 3VXQB 1X5FA 2ORBL 3WY1A 1YEGL 5GGVH 5KYYA 5D5ME 5HGBA 3KPTA 1OSPL 3NCBB 2EZ0C 1Q0EA 4DGVL 2P47B 1S7UB 3CZUB 1MDTA 2J43A 4AC2A 3PDOB 1A7RL 3CZFA 3S9DB 1T03H 4G9FB 1TOXA 1I1AA 3HG1B 1KLGA 4ZMWA 2AV1A 4K94L 3UCRA 5EH1A 1VCAA 4F27A 3QXDB 3CSBA 3VRJA 1EXUB 1QSFE 3JWNC 4QJ3B 3OSKA 2ENJA 1ZPLA 4IU2B 3TYFB 1U4EA 2A6DB 5CD3A 2APFA 4D9LL 4NQEB 4NRXA 4R90H 3C2AH 1L9QA 4HX1B 4Y2LA 3VXMD 4E0RA 2D31B 3WYRA 4MASA 2QMKA 3IFPA 1D9KB 2ZNXA 4KJPD 2HN7A 5I71C 4J6RL 3EFDL 1ZE3H 2BNRE 3MRGA 3GZQA 1A47A 2X0WA 4IRSC 4KTDH 4Q9BA 1YNTF 2UUDH 3QRGL 4NFBA 4NN5C 2PW2A 4FTDA 3H7LA 4X50A 1TVBA 1E5UI 2CCWA 2COVD 4WI4A 4NQTA 1BVLB 1UWYA 3MBWB 2V3FA 4JKPL 4PD4J 5LVEA 1W8OA 3EJYD 4MCNA 4XNUH 1P1ZB 1NKRA 4KKCC 2VNCA 3MCLH 2GITA 4GUQA 4AYSA 4UT6H 4X4MA 2P7TB 3KDMA 3BP6B 4O58H 2D8KA 3FPYA 4YEFA 1U92B 1UQSB 1L9TA 2X38A 2P8MA 3LH8A 2E46A 2YC1A 2XIDA 3MRFB 1BF2A 1MPAL 3PL6D 1UENA 1ETJA 5TTRA 1VENA 3BW9A 3C5SA 3RWFA 1DVFC 5HHVL 4IRSA 3TIDA 4IBWA 3GM0A 4Y2OA 3C9NB 3V4VB 2I60L 3CDGB 1JZDC 4JANA 4HU8A 1OE1A 3L1OH 1QG3A 3BRGC 3QVAA 1R47A 1F90L 4TUOA 2XJKA 5KSUA 4F37K 3FTXA 1ETZA 3DHJA 4O2CB 1YEJH 2ZP8A 3I2CL 1GSMA 2WLIB 2BIHA 1RIHL 4JHWL 5FO7A 1I9RL 1U42A 4HV8A 2BVPA 5F7HA 3U1PA 1KMGA 3IRPX 1OGAA 5CSBA 4MZRA 5HGDB 5IQOA 2GUOB 4R83A 4NENB 3VG9C 4O02A 2YKLH 1DVFA 5AYUL 2BNQD 4PV8B 2AQSA 2WXRA 1DBMH 1MLBA 3TASA 4LLWA 1ZAGA 2R27A 3L3JA 4LCWE 4QXTB 2Z92B 4BHUA 2RJMA 4C57C 1U8IB 5I74B 4AE0A 4M7KH 3AJ7A 3F7YA 1D3CA 2LV4A 2ZXQA 1I7TB 1QWNA 3PJSA 4GW1A 1MIMH 5KOMC 3ALXA 1JJUA 4ZPTB 2MCAA 4XNBA 2XZCH 4ZYKA 2NQDA 3PQYE 2P48B 1U8OB 4ENEC 3E6HB 3GDBA 3CPLA 3MN8A 1F56A 4ZS7H 1E65A 1AQDB 3WN5C 3IJHA 2XA3A 4YGVA 1U8QA 2X9XA 3RWJB 1VACB 3QC5X 3COOA 2FX9H 1AZCA 2HLFC 2HFEA 5J57B 5ADPH 2R56L 2VMJA 3ARFB 1AQKH 1NCWH 3OD3A 3IDJB 2FYYA 1NEPA 2IPTL 4L1SA 2X53A 1KEML 1IZKA 2HT3C 3HE6D 1QZ1A 3P2BA 2EDXA 4JM0A 2A7BA 2HJKB 2J88H 5IB5A 2E27H 1E5YA 1G43A 1CGTA 5I1JL 2AXFA 1NH6A 2JJSC 1MCDA 3NQIA 3MLZL 2X28A 3AT8A 4Z3IA 3NAAH 1CQKA 3MRPB 3P3YA 4WNQA 1I85C 4MCZB 5DD5H 4FQ2L 2IDUA 4FZEL 1SY6A 5D7SL 3WN5A 5IV2B 5LN4A 1P7BA 3GBDA 5A2CA 1DQKA 3FNKA 2MPAL 2PWFA 2HUEA 1EHAA 1HVXA 1I82A 3KYMA 3EZ8A 1LO5B 1URIA 2XFGB 5DJDB 4AH2B 1VHPA 1TTGA 4URKA 5L9DH 4HHAB 3HKZA 4M5TA 3ZHFA 2ZYIA 4FP8L 1IGYA 4KQ3L 1FNLA 4EDWH 1OQXA 2GK0B 1TQBB 4W81A 4AMXA 4XCNB 5CUSH 1D9KC 5LCVA 3W81A 1UWFA 2NR6C 2JJSA 3VXQA 4EE2A 2GABA 1CFTA 1NBVH 3J07A 3Q2LA 1E4WH 3OB0K 1E67A 1FL3A 2J8OA 1I85A 1S7UA 2RACA 5FFGA 3PDOA 1YRKA 1ZANL 2PABA 3HC2A 3KPQB 1MCOL 4L8SB 1LGVA 3S3BB 3G9VA 4G9FA 2W88A 5FIEA 2ZXBA 5HJBA 3RL1B 1PJWA 1JPGB 2FX7L 1OO2A 3QXDA 1UH3A 4N0UE 1M71A 2C9UA 1SN5A 2XUWA 3PHSA 4JN2A 1EXUA 3EH4B 5EZIH 3U9UB 3VXUD 4DP6X 2TSAA 3V2AR 3UAJC 5GGSY 4XCFL 3ZN6A 3RDTD 2VZSA 4JO4L 1TFPA 1QYGH 2A6DA 3WTXA 1B9ZA 2VN4A 1CE1H 1IGFL 3FF7A 2D31A 4POUB 1D9KA 5EUOE 4Y9FA 4QGTA 1C1EH 1WS8A 2BVYA 4GW5B 1FNHA 3V5DB 3VXSB 5DUBB 3VDAA 4GG6B 4UWQB 1YQVL 4JFWA 2F54E 5IFAL 3T04D 4A63A 1BVLA 4UBDD 4JPVL 1H8LA 1SJXA 1X5KA 2ARJQ 4IK7A 4NP9A 4OZGE 1BXAA 2BOBB 1P1ZA 3KS0J 3DSFL 3MFFB 5J6HB 4HWNA 2DQEL 3V52H 3UJTL 4DPBX 3BP6A 1NGPH 2R0WH 1NGXA 1TTRA 1U92A 3M8OH 4KHXL 1I9IL 4IIQB 5DURD 4PSPA 3MRFA 1XGYL 1YEKH 5SWZB 2R15A 3HFMH 2XVKA 5I8OH 4P9ML 3SDAD 3RVWC 2WTPA 2ZAIA 3MO1B 4U0QB 2J25A 2ZT9C 1RJLB 2YWZA 2X1XR 3ML9A 3LZNA 3V4VA 1U91B 5KVFE 3QDHA 4XN5A 2EXWC 3G6AA 2XA8H 4I1NB 2ICWB 4FMKA 5I74C 3ET9F 4XMLH 3FTUA 2VDRB 1EAOA 5CM1A 1GC1L 2NYZA 4O2CA 2ZXCA 2NMSA 5AB2A 1HL4A 3DURB 3BWUC 2J8UE 3P9MB 2WLIA 5T1JA 2GC7C 3HZKB 2K9UA 1EHLL 1M7XA 2D9QB 1HQ4A 3BAKA 3MOAH 2JKJA 4KV5E 5IB2B 1MG3C 4MNQA 5DMGD 1FFTB 4OLZL 2IALA 4RMRA 3IKCB 5C0AE 3BE1L 3NSXA 4RISL 2A9ML 1KIQB 2VR8A 5HGDA 2GUOA 3OPZH 3SQOL 1IB5A 1HH9A 4RWHA 1MCNA 1UXWA 3CFNA 1I7ZB 4OF7A 4YHML 1IC5H 3ARFC 3QJHB 3U79A 4Y5XB 4QXTA 2Z92A 3MV7A 2O72A 4CDGC 2BFVH 1U8IA 1CTNA 1I7TA 4FA8A 1WA1X 4PG9B 2IQAB 1BQRA 2C4FU 2Z7YA 1HCZA 4ZPTA 3WFHB 5BMFH 2A6KA 2VYRE 3GM8A 4GI6A 1X3DA 2ZKWA 3E6HA 2XG5B 1X5HA 3K80A 1E5AA 1DP0A 3LKRB 2V17L 2Z93B 1AQDA 1SN2A 2Q7NA 3LB6D 3V0GA 4YAQB 2MPVA 4L0YA 4L8CB 1GYUA 4PJEF 3RWJA 4FQQB 1VACA 1XXFC 4U1MB 3JVGC 1TEFA 1KXTB 3QJZA 3TBVB 3X14B 5HYQA 3IDGB 3ULVE 2PCXA 3ARFA 4GQZA 4I13B 2IOMA 2IF7A 4KROB 3FC8A 3HZ3A 4B6ZA 1I1RA 1B6UA 5KS9B 1WIUA 3K2UH 4D0DB 1KGUA 2D4FA 5F7NC 1TQBC 3FCGA 4EI5D 3SKJL 1J5DA 4FQXD 4AQ1B 3T6XA 1GRWA 3UEQA 4U7SA 2Y7SA 5CU9A 3MRPA 3LEVL 4F24A 4MCZA 1ED3A 4P2OB 2CHZA 4L8SC 5FYLD 3LQAC 5M7QA 3CFJA 2XN9A 3MNWB 5IV2A 9CGTA 4AGPA 5E7FA 2HKFL 5DFWH 4K0OA 3JVGA 3SN6N 1F0LA 1V3LA 2WXQA 4ZK8A 5DJDA 4JHUA 2LU4A 4LVEA 4G80A 4KKLC 2HTKD 3U2JA 5C9JB 4RFOL 4R9HA 3P69A 2GK0A 1CD8A 4D7BA 4XCNA 3IPEA 2Y06L 5F6HI 5T5NF 2O6DA 3KLAB 1E90A 1MJUH 3TF4A 1HSAB 1T5WB 3NSDA 1IM3D 4BZ2H 4OF6A 3P02A 2E8YA 4L8SA 1ZIBA 3KPQA 4K9EC 3M1BB 4I88A 3RL1A 3RY4A 1JPGA 1NMBL 1HEZB 1S5IH 4QWWC 4TUKH 2VJ0A 4NJ9H 1SOQA 3DHPA 3U9UA 3N50A 1CLZH 5E03A 4CBZA 2CNZA 3HKFA 4CC4C 4PJ5B 1HINL 2BNUB 3EHBB 4L05A 5JW4M 4IIQC 1JG9A 5C0GA 4AGQA 1DBAH 2XN2A 5E2VH 4ZFFB 2E6PA 1W16A 1A7QL 4XCCH 4GW5A 2J6EA 3V5DA 5K39B 4NJAH 3VXSA 3FL7A 5DUBA 4GG6A 4QYAA 2DWSA 2F7OA 4FXKB 3MLUL 4IBLT 3VG0L 5IIEA 4YSCA 2XV3A 3VRLE 1KB5H 4PJ8D 4P5TD 2BOBA 4KUZH 2VLJB 3LNHA 1KGWA 1D5BA 1AZUA 1QSFB 4JY4B 3VFRA 4UV4H 3D2TA 3WV0A 5HDLA 3MFFA 5B39G 5J6HA 3T5WA 4S1DC 3MMEB 4YXKL 4GJTB 1A6UH 4GRLD 4I3SL 4OCRL 3RIFF 7TAAA 5F7UA 1QFWM 2KUTA 2XXCB 3I9AA 4F8OA 1EZLA 3CLWA 1JZGA 2XCMC 5SWZA 4FNRA 4Z95H 1KXQA 4XP9L 3FHAA 2BNRB 4DKEH 1D5IH 2WLMA 3MO1A 3BXNB 1RJLA 1SN0A 4RMWA 3V9CA 5DZVA 3PFUA 3ARED 4Y5XC 5G4NA 1JGEA 2FZ3A 1JWSB 3LV3B 2H1PH 4LOEA 1RLBA 4FOMA 1PSKH 1I3RB 1KIRB 2ICWA 2MQCA 5FF6A 4NKIH 4GP4B 1HIMH 5IM7B 3DI2B 3WFDL 2AABH 2BMKA 4FDWA 1ICTA 1XMWA 2XTLA 3U0PB 3DURA 3P9MA 5CP7B 4Z8FH 3ORJA 1FPTH 3HZKA 4PRNB 1BZ7B 1P0SE 4NI3A 4YFEA 1V3MA 2Q8BH 5IB2A 1GYAA 2OJZH 4KDTC 5DU7A 1AO7E 3IKCA 3T2QA 4QTIH 3HBGA 4XMPH 3DHMA 1KIQA 1KPVB 1HILB 1M4KA 5E6RB 2CCVA 2DKUA 5KYWB 1KCWA 1JE6A 1HEHC 3E8VA 5C0EB 1NIFA 3UBXI 4HBCL 4OJEH 1N70A 2VDKB 1WA2X 2WQWA 3LJ3A 3QJHA 1XSKA 4Y5XA 4KROC 4QAWA 3II3A 4RETB 1YY8B 4K8RH 2PP8A 3DUUB 2R29A 5HYSG 4XMZA 4PBXA 3EYVB 4WLCA 1A1NB 2IQAA 4AQ1C 4C4UA 5IHUL 3II2A 3FN9A 2GCYB 4GQQA 3WFHA 1EO7A 1RUPL 5C3LD 4P5MB 1ZWIA 3FTSA 4KDTA 2XG5A 4P2OC 4UT7H 3S34L 1G7QB 3VXME 2X9ZA 2WBXA 3LKRA 1OV8A 2RIKA 1TENA 4UV7L 4YAQA 4L8CA 4FQQA 2NYYC 4U1MA 4CL7A 2HKHL 4IRJD 3KPRD 5IQ9B 4ZZFA 4YBLB 1J48A 1KXTA 4HHGA 3TBVA 3IDGA 2DL2A 1JSYA 2EIEA 2WO3B 1QATA 2X3AA 3RURA 4A2EA 1HKLL 1RK0B 5KANG 4AEEA 1F4AA 4MZIA 2EC9U 5KS9A 4D0DA 5L7XH 3MLRH 1CDIA 3MJ9H 3H9HB 5MENB 3IS1X 5LDSA 4L3AA 3OKDB 1U8KB 4BD4A 2HUHA 4L8BB 4NC2B 4YDIH 3V4PB 1E5CA 4AQ1A 3WAJA 3ZL4H 3RZCD 3C75A 3NFPA 1A3LL 3BVVA 1JNLL 1X9LA 3PQYB 1GTNA 5F7MC 5DJAB 4RLDA 1JWUA 2AVGA 4P2OA 1Q94B 3RVTC 4IRZH 4ZAKA 3MNWA 3ZKQD 3PP4L 3QCVL 4KKPA 5J7CC 1F58L 3EJPA 2AKRB 2V2WA 4PVMA 1T2QH 3VXPB 1ZV9A 2J1XA 2VIRA 1SMOA 4NWUL 3RNKB 4GY4A 2G9HB 3CSPA 1FWXA 1CIUA 2YR3A 4HS3B 2FD6H 3U4EB 3O3UN 3EHBC 4ZD3H 2DQTH 4NZUL 3N04A 1BBDH 2M83A 1FIGL 1A9VA 2OS7A 1J87A 2HRGA 3O6LH 3TWCH 5C2UB 3JWNG 3KLAA 4MD5B 2FB4L 3KXFD 4APQB 1HSAA 1A9EA 3SE8H 2CKBL 1AGEB 2F68X 1Z5LB 3A6BL 2H32B 2IFFL 4FXKC 3V9EA 3N2JA 3M1BA 4N2KA 1HEZA 1UKSA 3BAEH 4N0CC 1B90A 1WK0A 2BNQE 2Y9RT 3OKKB 4LPUA 1YEFL 5GRJH 2EIDA 2YO3A 1U41A 1E2WA 4J3UA 4OZIF 3KCPB 3NJIA 5IJDC 1FZOB 4HIPA 1DJHA 1X7SA 2VL5B 1G9MC 2BNUA 3A6OA 3CQQA 4KBPA 3TWYA 4PP2A 5FC9A 4NCDA 5D1ZB 4LVHB 4ZFFA 1XIWA 4U4BA 3S35L 3VI4E 5CAYB 1DBBL 3EBGA 3RQ3A 4D8PB 5CGYC 5GRUH 5K39A 4NS0A 3NIFE 5D55A 5I17B 4AZUA 1KG0A 4IMLB 2AJVL 4FXKA 5E0FA 3ZRSA 1QWUA 2W38A 3OG6B 3D3VD 2J4WL 5ISZD 4YDVA 4G7VL 3X13A 1VDGA 3QO0B 4BGLA 3L5JA 5KSBF 3WFCH 2VLJA 4JO2H 4U2YA 1QSFA 4JY4A 4HPYL 2I9LB 2WY3B 1UM4H 5G5DB 3MMEA 3MRNA 5I1IH 5HGAA 3U82B 2X2IA 1CYGA 2VL4A 3N40P 5JYLA 3WNMA 3VI3F 3H3PL 3VVVA 1GMIA 1OCWL 5EUOB 3DSNB 4G71B 1UFUA 2BNRA 2IXQB 3TT1L 4QXUL 4KXAA 2B1OA 3BXNA 1N8ZA 3MUHL 3HB3D 1SBBA 1WAAF 4HUXB 5EBMB 4Z6AT 1MRCH 2OYKA 1JWSA 2F54B 4WI6A 4OGXL 2Z31D 1I3RA 1KIRA 2JCCF 1MJ7L 3TBWB 5IM7A 2AJYL 4E5XA 3T1FB 1LWRA 4OZGB 2HX9A 1CQYA 2FSEB 5CP7A 4XAWL 3ZL1A 4PRNA 1BZ7A 2X4SA 4N2CA 2ITEA 2F8XC 1L7IH 3QIUA 4H8PA 3QPKA 4JJHA 5C0RL 4KMLB 1S7QB 3NN8A 2IWEA 1KPVA 1HILA 3RPIB 4UINL 3U30B 3ZHKA 1A4JA 5KSVA 4YBLC 1TJIH 1YAIA 5C0EA 4JKLA 1FYTB 1GS7A 4LLUB 3TYGH 3ETBJ 3F00A 3I3BA 2FQGA 3FZUC 1YY8A 3CU7A 5E5RB 1UXSB 2QQNH 3B2PA 3DUUA 4PJ9D 1CDCA 4UDTA 4U0RB 4F58L 1PGRB 1A1NA 5TF0A 5DQDL 3L5WB 1AE6L 1AP2B 1N7MH 3PV6A 1A3ZA 3JZYA 3FQXB 4I85A 3LCYA 2GCYA 4BZ1A 1EZUA 1P7QB 4P5MA 2EDLA 5T3XD 3U83A 4ZZKA 2QQLH 4NGHH 4X9FA 4GQ9L 4D3CH 4JCWA 3TU6A 1R0AH 1UA3A 1KBPA 3PXJA 4LEXH 1USZA 2D4DA 5JO5B 1XGRB 5AFAA 1H6EA 5T3XL 4LQ1A 4D0BA 2ZKXA 4Z7VE 4JGNA 2CRYA 4HCRL 3FN3A 5C0CD 1FA4A 2C5DC 5FKPB 1CK0L 5GJSH 3F84A 4PS4L 4PJ6A 2Z7WA 2WWOA 3QNFA 1GYCA 4TSAL 5MENA 3FOMB 3SGJC 5AW7B 4OM0H 3OKDA 1U8KA 4X8JA 1A21A 2OFQA 2DM3A 4APQC 3ILQC 3IU3A 4G6FB 3PQYA 3TT3H 3Q8CA 5DJAA 2KLSA 1LO3H 1Q94A 1QSEE 3WFBH 3QZBA 1CICD 2E3VA 2D0FA 2YLKA 3OHMB 1GKOA 2CGRH 5CN2A 3DX2A 4OGAC 2AKRA 4YUEL 5KBLA 4G2AA 4D9QD 1BQSA 3VXPA 3FRPG 3Q6FB 5JDSB 1NOLA 2CM5A 1Z9MA 1PLCA 1Z3GH 1CFSA 3NT0A 3OM3B 3RNKA 4PJIB 2G9HA 4RDQG 2FIKB 5KZCD 1F6FB 1M42A 1UKQA 3FUKA 2DI8A 4WCYH 1L6PA 5D1ZC 4MYWB 3GXMA 4LVHC 3F05A 2DWEA 1X44A 3ZTJH 4MD5A 3EXJA 1NCJA 1AGEA 3QNZB 1YJDC 3V6OE 1OAJA 1ZKAA 1R34A 4NERA 4AI7A 1Z5LA 2H32A 4HAKA 1XL6A 4HWUA 1GAFH 4HGMA 2DWYA 2CK0H 5F8RC 4P0DA 4KK5C 1ZJBA 3ME0B 5E99H 1CFVH 2OCJA 3BCFA 3TURA 4BSWB 3LH2L 3UC2A 3KCPA 3P1VA 2R2BB 1KY6A 1FZOA 1WUNT 4ZTPH 4AUUA 3NBNA 2VL5A 4X7CC 3WL9A 1G87A 1S7SB 1T66D 1VEOA 3WY4A 3VDBA 3CFDA 2FE0A 25C8L 3C5ZD 3WS3B 1M9WA 5D1ZA 1I4FB 2NNCA 3OF6A 4MBOA 4WWNA 2YQ3A 3I9GL 1L3WA 4MVBC 4D8PA 3NJFA 3VXOB 5I17A 1U8HA 2AITA 3QZWB 4A2FA 4IMLA 2QFRA 5DZ9A 1E3FA 1ZVNA 2Z8RA 3S3CB 3MRBB 5L4MA 4HJUA 1CFBA 3ZDXE 4RAVB 2BY2A 4TLUA 3QIWB 5D72H 4N0UA 4FF9A 2EE2A 4R26L 2A9AA 1WPCA 3BIKA 3AT9A 4JFXA 2I9LA 2VXUH 1ZV2A 2QMJA 3NESA 3H0TA 4UNTA 3N85L 1FQ9C 4AVKA 1Y0LB 2P5WD 4NXKA 1M1XB 4N5EC 5DA0B 5DFTA 4AEIL 2ZP0T 5EUOA 2GSIB 3KYOB 4H1LG 3DSNA 3U30C 3ABMB 3G08A 4KAQL 2OPCA 4JR9L 4MCYB 2HWZL 5DQJA 1RFDH 3HIZA 1PZCA 2CXKA 1AMXA 5EBMA 3CHQA 3FMGH 4FQCH 4F2ME 2F54A 3WENA 4HVBA 3H2PA 1MW3A 1RZFL 4HD5A 4MLSA 5D1QD 5DSCB 2EDJA 4JFHD 4U0RC 2LGNA 4OZGA 2FSEA 3O11B 4WW1A 1KCRL 3NIDF 3QUKA 3FAXA 2ZOKB 5AALA 2DW5A 3B1UA 3OKNB 5JQ6L 3BKYL 4Z3GA 3KLHD 1HC1A 3K8LA 4NUPA 4B50A 3LKPB 1S7QA 1RUQH 1A65A 5EDSA 2YA0A 1M1SA 2ZKMX 1GW0A 3P2DA 3GTVA 3RPIA 1B2WL 2CDEA 3ZUNC 2MNJB 1D6EB 2F53D 3B2XA 2XTJD 3WTWA 2X5PA 2KT6A 4F7EB 3E2HB 1FYTA 3KEDA 4LLUA 4ZPVB 5ICUA 2VC2H 2JCCB 3ZKND 1IFHL 5E2UL 3ZTNL 1KWGA 2AXJA 3HPLB 5A3IC 1MFAL 3WIFB 3PDGA 5F1IA 3EYOB 4IKLA 2A5UA 3MRMA 2ID5A 3QR1A 2VZOA 1IUZA 4U1GB 3L5WA 2DZEA 4ZS6C 1AP2A 3ETSA 2XU9A 3IAPA 3D18B 1AXSB 4MXQC 3KM1A 4MNHB 3VD4A 2F2HA 3FQXA 1IM9A 1NLBL 2L7JA 1P7QA 2BVQB 3TJHD 2TRHA 2WCSA 4K7PL 1AO7B 5CIPH 3APMA 3NZHH 5I1KH 3NA4A 4NPJA 4DKFH 3L7FB 1OLLA 2OYMA 5L4FA 5CZXC 4TL4A 5CJQH 3V0IA 1A3RL 1GPOH 2QDWA 4WFEE 3HUJE 2R0KH 5FHBH 1XGRA 3LKOB 2IC2A 4A6YB 5JO5A 3VMNA 4Y7MA 3SIKA 1NLDL 4LL9A 2XZQH 3BUDA 4FXLA 2R59A 4M48H 2G2PA 5I6NA 2YARA 5BV7B 3US9A 3GUTB 3OAYH 3FOMA 1UZGA 1P7KB 3RHWF 1YY9D 5C9KA 3X1NA 4RQQB 5LDUA 4OIBA 2YAMA 2ARWA 3ARSA 3LIZA 4G11A 2XQYA 2F7QA 2VERA 4LSRH 3HI1B 2LR4A 2R9HD 3IJEA 4ODSL 2DDQH 1IQWL 1CL7L 3S88H 4J3OF 4DK3A 5ITBL 4EO5A 3CFEB 5LXVA 4HG4J 2YOCA 3DX8B 5I8CA 1AI1L 4GFXA 2HTLC 4GMSL 1F97A 3Q6FA 1G7IB 1U3HD 2QLYA 3H53A 3HC3L 4LASL 5DVKA 1YECH 2WNKA 1GJUA 3GSNH 5DK2B 5IVOA 3RWIB 3UZEC 1OWRM 4PJIA 3F7RA 4Z7NE 2FIKA 5A7EA 3W9EB 4MB3A 3UAFA 3RA7L 4GAJH 4LCYB 2F0CA 5DHVB 4RGND 2KBGA 4B96A 3A6CH 2DQIL 2L3BA 5I8KH 1I8KA 3N0PB 1AR2A 2IDSA 3QNZA 3OLIA 4HWBL 4X6CE 5DJ0A 5DUPH 1CR9L 1N64H 2JVUA 1DANU 1GGTA 3I6SA 1OOAA 3C8KB 2B2XH 1WFNA 4ALAC 1BF8A 1W72L 3VD0A 2JNZA 1YMHB 2ESVE 1KENL 3QIWC 3UTZB 4L2LA 3ME0A 5AOIA 1AS7A 1CD1B 3LRGA 4IOFC 2C9RA 3K7UA 4NQCD 4BFKA 4BSWA 2VMCA 3UZEA 3CSYB 3LN9A 2R2BA 4YS4A 4DGYH 1HFUA 1OTUC 5DFVC 4C55A 5CP3A 3V7MA 1S7SA 2NY5L 1WFOA 2DBLL 2RGSA 3L4CA 2WP3O 3WS3A 3U7WL 1I4FA 4KJWC 5CWSB 4OQ1A 4PCKA 4Y9GA 5DRNB 1KSRA 4CGTA 3VXOA 1OGTB 3V6ZA 1AR1B 2X4NB 2AV7B 1NINA 2EDKA 1RXLA 3IF1B 5TDOA 4XVTH 2F5AL 3MRBA 3IGAB 2YA2A 4ZO9A 1KULA 3KPRE 1OSZB 4DJMA 4RAVA 3PGDB 3QUZD 3QIWA 4PWJA 1NDMB 3S96B 2Y5TB 1A7NL 2BOCB 3N41B 3K2IA 4EVNB 4L3CA 3UO1H 2D7TL 1HNYA 2C9PA 1RIVH 4WU7A 4F8PA 5GRVL 1F3JB 3S3PA 2HT4C 2EEXA 3V0EA 4NP4H 2X89D 3ESVF 1Y0LA 1M1XA 1WIPA 4OQTL 1BQLH 2GSIA 3KYOA 3NFSH 3VI4B 2V9TA 1VA9A 5CJBA 1FNSH 3E2HC 4Y1TA 4MCYA 3C60A 4OJFH 5E2TL 2NNFA 1B88A 5E8OB 1E4JA 1G6RL 1ES0B 3HMXH 4OR1A 3B7YA 4KPHL 5L88H 1JXGA 1MFCH 3JWOC 2VR5A 3T8VA 5DSCA 4U1GC 3CUPB 5GGQH 2EVIA 3V0JA 3O9WD 4YL9A 1L9MA 5I6MA 5F7EH 5CFHA 2ZOKA 1VLXA 1KN4H 1ZE3C 4N25A 5C07D 1TO5A 4WFGD 1RZKL 1PQZB 4PWFA 3LKPA 4Z7WE 3EGSB 1XD1A 4M43H 5KVMC 1IV8A 4LOUD 1Q90A 5C2BH 2Q20A 4K94C 1D6EA 3ZE1F 3KXFE 4PGCB 5AL8A 5DJXA 1UTDA 1EGJL 2CKNA 2JB6B 4QKXB 4Q8BA 4ZPVA 4IDJH 1GHFL 4JUSA 1QNIA 3ELAT 5A16B 4G7YL 2BWDA 4RESB 3UC0H 3HPLA 4YQXL 4ZXBB 4TLKA 2EIBA 4ZG1A 2VJ8A 1QFOA 4PBDA 5CEYB 1SOXA 3C2SA 5BV7C 1PKQE 3AFLA 4IDLA 1RIUL 4M5ZL 4MNHA 4YHLH 2J2ZB 1PX8A 2VXVH 3D4YA 4AM0B 2BVQA 4ZW3A 5GGVL 1WVZA 3AQZA 3EYFB 3U4BH 1R3JB 1AO7A 2WGNB 4I2XE 3L7FA 1T22B 1UOWA 3DETD 2IBZX 8FABB 5LWYH 1FZKB 4DO6A 1A66A 2DH2A 1JHLL 3TO4D 1U8JB 2GYSA 2KDYA 5B3JE 1T03L 4P59H 4A6YA 3L4UA 1W0VB 1WZKA 4YN3A 1CUOA 43CAB 4XMXA 5DZNA 3RIFK 1UOKA 4I1RA 2P44B 3HCVB 5C0BE 3BSZA 3IRZA 5ISZE 1E30A 1PZ3A 4KH2A 3REVB 2RALA 3EJYC 3VXUB 4BELD 1BAFH 5L2KD 1R9FA 4R90L 3RY6C 4EUPH 2RA1A 3C2AL 3TO2B 3MNMA 1I3VA 4RQQA 3QO1B 3RGHA 5I30H 4ABWA 1KJ3H 2B16A 2VABB 4GP8B 3RWDB 5E1QA 3FFOA 2DMGA 3HI1A 4QEGA 5CSGA 3V7AG 3VXMA 5I1DA 4YBHA 4KTDL 3HR6A 1PCSA 1MNUH 4QHKI 2B0SH 3ARGD 4HOWA 4ZTOH 4ZW8A 2NY0D 3AAZB 2X09A 1G7IA 1VEPA 2HZHA 5DK2A 4IGBB 5HI3D 5IJCC 4XNUL 3MCLL 2QSCH 3W9EA 4FKKA 3BVXA 5F1OB 4UT6L 3UZQA 4M29A 4LCYA 5DHVA 4HALA 3IAQA 4O58L 3RY6A 3RX8A 2AVFA 4NQSB 3OMNB 1F42A 3L4ZA 3GXUB 2ZUXA 1AR1C 1EEYB 2X2UA 3JT0A 3S5ZA 4L37B 3C8KA 5INDB 3O6FB 5AOMA 4ZDHB 5HYFA 1KYOJ 2VDPB 2WVTA 3UTZA 3SDAB 1CD1A 1XCXA 3HZMB 2ZCLL 2DQUH 1I7UB 3NJNA 4H20H 3NCCB 2CM6A 1JZ5A 1QFUH 3CSYA 5I19H 1YEJL 5T1LD 3HOGA 1A22B