2YOAA

Synaptotagmin-1 c2b domain with phosphoserine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SYNAPTOTAGMIN-1
publication title Phosphatidylinositol 4,5-Bisphosphate Clusters Act as Molecular Beacons for Vesicle Recruitment
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yoaA00
4MJJA 3DPDA 1HE8A 2V4LA 2B3RA 4F91B 3L9BA 3F05A 1UGKA 2ENJA 2YOAA 2FJUB 3F04A 4EZJA 3L54A 4WEEA 4V11A 3R7QA 3PFQA 4WWNA 3PREA 4LCVA 3F01A 2FK9A 4FJYA 4LDCA 2ISDA 4Y1TA 4LT7A 1RH8A 1RLWA 4GB9A 3QARA 2CM5A 1TJXA 2BWQA 3FDWA 4FA6A 4L2YA 5JHAA 4AOFA 2DMGA 4J6IA 2JQZA 3QAQA 2WXIA 1DQVA 3TL5A 4A55A 5CCJA 4GNKB 3GPEA 5JHBA 3ZIMA 2NSQA 4FADA 3HN8A 5H4YA 1RSYA 2QZ5A 1DJGA 1E8XA 4KITB 1QASA 1UOVA 2WXPA 3ENEA 3L16A 1DJIA 4TS6A 2K8MA 4ANXA 4ICXA 3NSJA 2WXMA 3FBKA 3KWTA 4WWPA 1E7UA 3L4CA 3NZSA 3KWUA 2WXNA 5H4ZA 2Z0UA 1GMIA 4KZ0A 4QJ3B 3W57A 4FJZA 2CJTA 3N5AA 2QZQA 3T8MA 3ML8A 3IBEA 1BCIA 4G11A 1V27A 2WXQA 1DJWA 3B7YA 3F00A 4HVBA 5CCGE 4F92B 3CSTA 3OHMB 3PYCA 5G2NA 1DSYA 2EP6A 2DMHA 3SD5A 2ZKMX 3APFA 1E8YA 1W16A 3PRZA 1E90A 4QJ5B 1K5WA 3HIZA 4F1SA 3L13A 3IM1A 3TJPA 2A4ZA 2K3HA 2K45A 3P2BA 4EZKA 3R7RA 2WXGA 3NZUA 4DK5A 1QATA 1WFJA 4QJ4B 3DBSA 2CM6A 4OVVA 3ZW3A 3S2AA 1W15A 3CSFA 5CCHE 5G55A 2WXOA 3PS6A 2RD0A 1E8ZA 4WWOA 4QAMB 2WXJA 3APCA 1E8WA 4DNLA 3ML9A 2N1TE 1E7VA 2D8KA 4URKA 2UZPA 4WAFA 2WXFA 1DJYA 4FULA 3QR0A 4OVUA 3JZYA 2LHAA 2WXLA 1CJYA 1TJMA 2X38A 4NP9A 4FLHA 3RDJA 2CHZA 2NQ3A 1UOWA 4ANWA 4XZ4A 1A25A 2CJSA 3MJWA 4NS0A 4PS8A 2A5UA 4L1BA 4ANVA 2Y3AA 2Q3XA 3RPBA 2ENQA 3OAWA 1YRKA 2R83A 2NCEA 3L17A 4KZCA 4F93B 5KJ7E 4NPJA 1BYNA 4TV3A 3QJZA 4PS7A 2CHDA 5EDSA 1DJZA 4BGDA 4L23A 1DJHA 3TWYA 5T8IA 4PS3A 3HHMA 4Y1SA 4JPSA 4XE0A 3ZVVA 3LJ3A 2WXRA 2WXHA 2ENPA 3M7FB 4HLEA 3QR1A 4NPKA 2Q0ZX 4IQHA 1DJXA 1WFMA 4ICWA 4ANUA 4EZLA 4FHJA 2YRBA 3QK0A 2KI6A 3APDA 4L1LA 4TUUA 4XX5A 3W56A 4AJWA 4BFRA 1BDYA 4IHBA 3L08A 2K4AA 2WXKA 2CHXA 2CHWA 4FHKA
chains in the Genus database with same CATH superfamily
3ECBB 4UMSA 1INDH 4XR8C 1BFTA 2P5ED 2QHLA 1R5VA 1X5XA 2DLFH 4IRJB 8FABA 3RLSA 4IMLA 1TCRB 2O1AA 1EZLA 3VYPA 1ZT1A 4Y5YA 4GJTB 1B2WH 3RGVD 1L9QA 4AYDC 2Y0SA 4Y1TA 3DROA 1TTAA 5B8CB 1GIGH 3MROA 2CBQA 3HNVH 5FWQA 4HEPG 3OGCB 3DOIA 5FYJU 2XIDA 2YJQA 3ARGC 3OXSA 1MIEL 1SGKA 2BW5A 2YR3A 1C9SA 4RFEB 3S3SA 5IVXB 3IDMB 2WZ0A 3EDEA 4G43A 3GMRB 2G2NA 3TT1H 3VXMB 3QDJA 1QFUL 2ZWZA 3DVNA 1NFIA 4BV1A 3SDAD 5E6IB 1M1XA 1RSYA 4JUSA 5H8DA 3OKDB 4R26L 4NWUH 3WIAA 3FOLA 2PCFA 1DBKL 1I8LC 4HJIA 3P3SA 2DH2A 4AV5A 3C6SB 3QJVB 4G8GE 3MOQA 4BCXA 5GZOD 1S7XB 2Z4TA 3D0AA 5D1QE 3WDHA 2P9RA 3ARBD 5TE6H 3RVTD 2V33A 4HUXB 1GC1C 2D3JA 5C2BH 5IJVA 1ZHKA 4R7DB 5HJ3A 3W11D 2YXMA 2VLRB 4PJXA 2E47A 4ODWA 1A8JH 1X5HA 3L4TA 3QFGA 3WKQA 2LV4A 2VUKA 3E1F1 1MOEA 5TE4L 5H35A 4L9LA 4GFXA 1I7RB 2FCBA 3SCMD 4JN1L 4JR9L 4PJDB 5AVTB 1HZHL 2YK1H 3VH8G 4P5MB 5DK2B 4FQ1L 1I3GH 3GPSA 4I77H 1MJ8H 4NQEE 4RGOH 3QHTC 3UYPA 3MV9A 3IMTA 2W1NA 3IU4H 4ZYKB 1G0YR 3L48A 4A04A 2EDYA 4K71B 4N0CD 5CEYA 2E27L 3GSOB 5HPOA 2GSGA 3VMNA 2CO7B 3UGUA 1ZA6A 3J27A 3ZKMD 4YE4H 4P46D 4XN7A 2W80C 1QABA 4ZSOA 1ZWIA 4MA1C 3FFCD 4F93B 5FYLL 1UWEH 5C09E 2NY5H 5IVXE 3KEDA 3ZYJA 4MJ4A 5IHZB 1BYPA 5ID0B 3ZMEA 3EOAB 5KUMA 4WFGE 3BJLA 3UGXA 2E9WA 5I1GH 2BNRB 4UDUB 3K6FA 1JHLH 5IWLC 3VFOA 1JSYA 1Y6KR 2GBVA 3SYCA 3LY6A 4W70A 5BNXD 4XNYL 5JMOC 5DJDA 4PV1C 4MJJA 3V0FA 1YECL 2VLLB 2YXWA 5LWYL 1RU9H 3MLTB 3T08A 2ICCA 3IDGB 5C3LD 4K9EC 5I26A 5EDXA 1EEQA 2VLRE 4NUQA 5EC1B 1WC7B 5LNGA 1L7TH 2EZ0C 1C5DA 4ZPTB 5JDSB 3X11B 1S5IH 2XWZA 3O2WH 1NGQH 2OMTA 1MCIA 4J2QA 1HHJB 1AGBB 4GQRA 1KYDA 2YWYA 3V0GA 2IO5A 5DZPA 4PJDE 4PRNB 5EC2B 5EO9A 4CAGA 2XTLA 1QNZL 5DHVB 2JCCF 4PSPA 1XZWA 2JE8A 4XBPA 4G7QB 5IY5B 3CX2A 1CD0A 3P9MB 5T1MA 1JGVL 1ED3A 1HOCB 1UXWA 1IC7H 1ZS8A 3RTQA 2UZIH 4HCIA 1J87A 4UV4L 1K4DA 1HZKA 1CDGA 4Y19D 3ESOA 4PWHA 5BVPL 1CUOA 2I9TB 3F83A 1P6WA 1MH5A 3DX7B 5AVVB 1CE6B 4P23C 4JJHA 2IOOA 2ICEA 1CL7L 2VN4A 4QY8A 2CK0L 3ECVA 1VERA 2X1OA 3EYQD 3GBML 3PGCB 4HVBA 3KBPA 4PJ8C 5CGTA 3LKQB 4L4VA 2A38A 1J1OL 2NY6B 3HI5H 1DQDL 1AD9A 1PAZA 3UZVA 2MCPL 5EA0L 2A83B 3QC5X 3D7PA 1J8HA 25C8L 1E5YA 1NMBL 2HT2D 3VI3A 5EEZA 1YEGH 2BNRE 3WY3A 1BEXA 1SF3A 1EFXA 1YN6A 2IWKA 3A6CL 4FQIH 2JLLA 1SXBA 2UVEA 4JFYB 3FO2B 2C3VA 1ERNA 4K15A 3G6AB 3FUIA 5TDNA 3GNMH 3SY0B 1JK8B 3ML9A 4XMPH 3ARWA 2CZNA 2AGJH 4GMTH 2DQUL 1HINH 1UA6L 2V5TA 1GZQA 1Z9NA 4PJCA 5KVGE 1UOWA 3QDAA 1RUQL 5MEND 1AS6A 4S1SH 3U30C 1RJZA 3G08B 1U3HC 3K0WA 1BZOA 3R18A 5T5FH 5HGBB 3VQ1C 1KXVA 1T6WA 3WXVH 1RUAH 3GS4A 5EDSA 2AJXL 4H0GA 3WN5A 1JZ2A 4Z8FL 4XCFL 2WXHA 1XBDA 4UOW0 5B1JC 4HLEA 4JRYB 4YIQA 1H9VA 1KCUH 3FT3B 2R0KH 1TQVA 5CU9A 4NQDB 5F7AA 3FN0L 4GY4A 5ITFA 2VLJA 1MWAL 4QRTB 3II3A 5BUAA 5EZIH 1BAGA 5GS0D 2CKNA 4WGKA 3F3HA 3TFKC 4YDKL 5D7KE 1TYRA 1SOQA 4G1MA 2IADB 3ZMRA 1WG3A 4WF7A 4LAJH 3DETC 3MRLB 4KQ4H 3BWZA 4NJAL 5D7LA 2B1HH 3UYRH 2OMVB 1NCAL 4X9FA 2O6CA 1QLEB 4FDWA 1A9BA 4LSPL 4M7LL 4PG9A 3M8OL 4EN2A 2NXZB 3N43B 1RJLA 3K6DA 4K23H 3I9GL 3X1BA 3LPWA 1NGZB 3MRNA 2XZAH 4HHGA 5JHDB 3WY2A 5HYSG 1JK9B 3UAJD 3AU0A 2IVFC 3BGAA 1XX9C 3LKPB 5A2JH 3HG2A 2KZ1B 4IRSC 1JMZA 1UQSB 2XVLA 4RCAA 3POHA 4R90L 3LN4B 1HL9A 4QDGA 2WLZA 3ARFB 1P1ZA 2XSKA 1RIHH 4J4PD 4LASL 2VDLH 1K72A 2QPUA 3NESA 4JLRB 4NERA 1EGJL 2VXVL 1TJGH 3V0VA 3PIQA 3EOBA 3DUUA 3CU7A 3JSSA 4L5FL 3FJTA 5CNHA 3FB6B 4OIFA 4NQQA 5CBAB 4JO3L 1CGYA 2YMXL 3L3KA 4F15B 3CZKA 3IRCA 4AL8H 5CAYB 5M95B 1VFBB 4JRYE 3IM1A 4ZDHA 4NQDE 1HEZB 2NY4C 3B7SA 5AVSB 1OARL 4FKHA 3SKNA 4ZS7H 2HXAA 3QDME 1KTDA 2J1WA 2HB0A 3PQYB 4I3RL 2HMID 1XEUA 1QA9B 2N3JA 5JIPA 4LPXA 3KVPA 4TPRL 2YAMA 5DO8A 1R34A 5DTFA 5AYQA 1T5WB 4XP9L 4ERSL 3DX4A 3AREB 4R2GC 4HJJH 1LEKA 1P7KA 3O9WB 2VDKB 4KHTL 4LHUA 4Z78B 3EH4B 3EHBD 4EUPH 3QO1A 1KJMA 3D8MA 4H5SB 4H8QA 3C5SA 1EXGA 1BZDA 3L17A 2DDQL 5JHDE 1LMIA 3EYOB 1A3RH 3AG3B 3D08A 2Z3FA 1FNLA 5J57B 5DWUH 2VYRE 4P05A 2GB2A 5IW6B 5AKRA 3R0NA 3JV6B 1ZHBB 4I9WE 1AY1L 3B5GA 3WMPA 4EI5B 4CA4A 1MQKL 2XN9B 4V2CB 3BN9D 3V4PH 5IMMA 1WK0A 1W0VA 4BA8A 3EZ8A 1EX0A 5CMAA 2BC4A 1A1NB 1DO6A 1A7OH 1YEHL 5DI8B 4CVUA 1OE1A 4NHCL 1FVDA 4PVBA 1G9HA 4WTZA 5BZWB 2H2SD 2PO6D 3B8YA 1K4CA 3WGUB 3NPZB 5I16B 4ZFGH 5I1IL 3MUUA 4YUEL 3OHXB 5AW6B 4XGZA 3BUYA 3VXRD 3IBOA 4MCZA 1YN7A 3SJVA 3GHEL 4MD0B 5GRYA 4NFBA 3BX7C 4F9PA 3CDGB 4Z7VB 4M7KH 1QMUA 2XWTB 5ICXA 3SQBB 1A0QH 3PQYE 1AD0A 4Q0XH 3V6FB 3C09B 1T21A 1A7RH 2QDWA 5KAQF 2NY0D 2ZPKL 3V52H 1JCKA 4KO9A 5DQDH 2NW2A 3L4UA 3HLKA 3B7RL 2ZYIA 4ABUA 3VXNA 4I0PC 2BSEA 3CXHK 2W38A 5GS1C 1YHPA 2ZP8A 2AXGA 1CF1A 3UAFA 3KPTA 2ESVB 2ORBH 3LXBA 2NT0A 2XTJC 3B7YA 3P02A 1P0SE 2DLIA 2R23B 3ZRSA 1ITBB 1DN0A 5KOMC 4KQ0A 3HFMH 4HBQA 1GGCL 4EIUA 4MNQB 2LQRA 3MV8B 4O2EA 1IMHC 4DGIH 5JPMA 1G9NH 4LCCC 2FSEA 4OLYH 4XN1A 2VE6B 5D7EA 2XN9E 1OTTD 3GGWB 4NXSA 4UU9B 1NGPH 3MNDA 2XNAB 3BESR 1N0XL 5EZPA 3NCFB 3TYGH 3MV01 2CMRH 3CX5J 3GKZA 2R0LL 4QRRA 1HL4A 2F61A 3T65A 4ECNA 5EOCL 1R0AH 1BF5A 4EIBA 2XXMB 4Y4KD 4EQ2A 4OUUB 1UT9A 1J8KA 2J71A 1LXMA 5FYJE 2CGRH 5CZVL 3U6RB 3UJIL 2ITFA 4WI7A 4Y2LA 2V37A 1K8IB 2MKWA 5BZDA 2M8XA 2PR4L 3IKCB 4XVTH 1XCTA 3ZZ1A 1A22B 4HPYL 4XODA 1OT2A 2ZX7A 1OWWA 3OAYK 4FX5A 1Z32X 4JFQB 5D7JD 5IQ9B 1B4TA 3WIHH 1TJIL 3H42L 3RKDC 3HAEH 4XMKL 4Z7VE 2BIOA 3GO1L 3HLAB 4JJ5A 3GXPA 1HCYA 3MHZA 5LCVL 1HNFA 1DEEA 4OU3A 3Q2NA 2DEXX 3HUJB 2Q7YB 1JCVA 2WLNA 2HA1A 3VFUA 3I50H 4D0DB 1BFOB 1MHEA 2A9MH 2E46A 4MQTB 3SE4C 3A4EA 4H8UA 1P4LA 3AQDA 3FQNA 5KUKA 3I6KA 2ZCLL 5C0FB 5ITBH 2JJSA 3BQUB 4HLZG 1FG9C 2QFPA 1YEJH 2AQ2A 2JV6A 3D09A 4WUUA 4F58H 1WV7T 4U1SA 5AG8A 1YNLL 3D69A 2ESVE 2F8OA 3RL2B 1CF8L 4TL5A 4YHKL 4J27A 4L4TA 3BD4A 2CNYA 3HVNA 3U48A 4G7RB 2YQGA 4FJYA 4LT7A 5J6HA 4G9FB 3QC6X 1AOHA 1E6JH 4MNQE 3WFEH 4YSEA 5BS0A 1T03H 3MV8E 2K78A 1MAML 4OZGB 2GY7B 4LGRB 4YDZA 4KOBA 1UC6A 2HTLC 3VFSA 2IAMB 3FUEA 3EJZC 2QPEB 3L4YA 4MMXC 4X98B 1DVFB 3B9AA 3X3FL 4BRVA 1FO0H 3QEHB 3LS5H 3WJLC 1DUYB 5LG1A 1IGMH 4JFXA 3L1OH 3TCLA 2X6BA 3T3MF 2JELL 3T77B 4F57L 1SY6H 4F9LC 4J8RB 4A6YA 3LQMA 4CL7A 5D8JH 2ARWA 4WI0B 5DD5L 1F4WH 3WNMA 1IZKA 2XUWA 2Y7QA 4KJWD 4ZPVB 4ADIA 1AO7A 1TPXC 2BVOB 4XTRD 4IOIB 3CSGA 1NPUA 4AGQA 4F3FA 3AUWB 2BW4A 1QTSA 1CICC 4ZUWB 2XFXA 4YO0A 3VCLA 3WHXA 3SPHA 5KOVC 2XQYK 2CLZA 3IFPA 4UM8B 5KTEL 4IU3B 3PXHA 4OZHB 5D1XC 5BZZA 2QQNL 1D5XA 4E9SA 3HUJE 2WMPB 5LB1A 1KDJA 3DXAB 3FONA 4FFTA 4RESB 3VMPA 4NRYB 4WHCA 2FO4A 1N3NB 1VLXA 4NENA 1N2RA 4GKZA 4LBEA 1IIKA 1DHKA 2A6IA 2BS9A 2WVVB 2A6KB 3WIIH 3KPPB 3COOA 4YC2B 4X83A 1HWGB 5AZEH 1ZVSB 3IFNH 4B9ZA 3T0AA 2VDQB 4G9FE 1U8OA 1FFTB 2P5WD 5E03A 3MGAA 2P47B 3QRLA 3RA7L 4OZGE 2NCEA 1QBLL 3DHJA 3O4LA 1VFUA 2DIAA 5HYJD 1QR4A 1NCWL 2H32H 3DNKA 1KJVA 3P4LA 5JNYB 5HHMB 1I3RB 2BSRB 2IGTA 3K46A 3KJ6H 5CWSB 3MZTA 2EKJA 2P8LB 2WY3B 4WO0A 4HZLB 3TEXA 4ZMAT 1CN4A 1OAQL 1E2ZA 2PXYD 2CPCA 5JW4M 3NIDB 3LNEA 3H8NA 1WAAA 4BK5C 3IJHB 3A23A 4X6EB 3N9GL 5KJ4A 3TOPA 4R83A 4ATWA 1D9KB 5SWZB 4EVNA 3FTZA 1UWYA 3O6LH 1T1XA 1YY9C 1ACCA 5C9JA 2IFGA 5DVMA 3REVA 4LLYA 4CADA 3JT0A 3UBXB 1RULL 2ZXEB 4PY7B 3E2HB 4PM1A 5K9JH 2DWXA 5L8LB 4H26B 3SBWC 2IG2L 4D0BA 3BT0A 4GBXD 2DYPB 3BOVA 3GMOB 1ETJA 2NCMA 3RUGF 4KZEL 1AFVL 3M1BA 5EEYA 3OKMA 5KYYA 4PVNA 4XPAH 1FIEA 3HMXA 4DUVA 1OVZA 4NUGH 4GRMA 1XGYH 3DXAE 2A6DA 1WZKA 3IXTA 5L4IA 3V55A 3MGOB 1OGSA 4GFTB 4PYHA 1OGAB 2LTQB 1NCJA 3CBRA 4FOMA 5DK0A 4FYQA 4HV8A 2C34A 1NMCC 3RI5K 2VIRB 4HDIB 5FB8A 1WAPA 2VWEC 3DUHA 1TZ8A 4RGNC 4X4ZA 3LN5A 1O9ZA 3TF4A 1A2YB 1U92A 3H4HA 4JZJA 4G6JL 3ZTJH 1E0OB 3WNKA 4DESA 1E50A 4XAKD 3Q7JA 1UHVA 4XMLL 1AE6L 3NK4A 4M6OL 3MBED 1G7JA 3F64A 4JM2D 3QI9B 3BVUA 2FWOB 1T20B 3EOTH 5FUZL 3T2OA 4EDWL 3FQUA 3ZE0B 3OWEA 4U1JA 5HHME 1EO8L 2DRUA 3OJMB 3RKPA 1I7TB 1MHHA 4G59C 3QIWA 5KZCB 1Z9SB 4U33A 4QF1A 1OAUL 5E5UB 4MSWB 4ZUUB 5G4NA 2Y07L 1H5BC 5A6MA 1ASPA 4LLQA 4PLKC 2O5ZL 3WKMH 3X1FA 4Q14A 4UV7H 1BF8A 2BM3A 4LP8A 3VXUD 2R29A 1WBYA 3EO1A 4FI6A 3QO0A 4LAQH 1FLRL 1TCMA 4P3DA 5DJ8B 4OJAA 1DE4B 4ELMF 1BZEA 1S9WB 3CD4A 1S78C 3C6LD 2RD0A 3L2LA 4R4ND 4HAKA 4XP4H 2VDLB 3KLKA 3Q5TA 4F7CA 2PYFB 3NFPA 1M7IB 4NQCB 2PYEB 1UACL 1HQRA 1R3LB 2FNBA 2EXWC 1IGFL 1KIPA 4X6DA 2QQQA 2X4QA 4X50A 1TT6A 5EU6D 4KKNA 5C0CA 2WNWA 3MJ9H 2GTZB 1NIDA 3KDMA 4M6NL 4P0DA 3ULUH 3VUAA 1JWUB 1C7SA 2RALA 3P9LA 4JPIA 3OKOA 3UC2A 2P43B 3WN6A 1GYWA 4X9GA 1NBVL 4XXWC 2OP4L 5BV7L 5DUBA 3ZL1A 1I1YA 2V7NB 1CB4A 3L3IB 3HZMA 3HE6B 2EINB 1OGAE 1S7RB 2WO2B 3CVIL 3U1SL 3H2WA 4HIXL 3F58L 3SDXF 3GM8A 4K5PA 3TA3A 1MIEH 1LEIA 5F89A 2FHCA 2CHWA 1EAOA 3S6CA 1BBJB 1QFUH 4HWEL 5IHWA 3TIEB 2OMWB 3S88L 1JP5A 4X9IA 1XB8A 4NKDB 4R26H 1C16B 3L54A 4D7PA 2AK4B 3HI1B 3PFQA 3DUSB 5AW2B 5JOFB 1DBKH 1IGCL 4EUPB 3MTXA 3ZE0E 2MQ3A 3N55A 4KI5F 3QYNA 4LEXL 2DICA 1GTFA 3S36H 4AH2A 3N2JA 3EJQA 5FV1L 3TP4A 3GXUB 4OJEH 2MIZA 2ZONA 5GRJL 5BMFL 3GXTA 2CO4A 5KBNC 3DYOA 3M88A 5ESAA 1V3KA 2VQ1B 3H9SB 1N0LB 3QUMA 4P4RA 2B2XL 2FECI 5TE4H 3DRQB 2PYEE 3BEVB 4AL8C 4JG1L 4Y4FA 4KNQA 3C5ZC 1K2DB 4Z7UF 1BIIB 1KB9K 4JN1H 4JR9H 3ULVC 1HZHH 5DJCA 4NN7C 4L8DB 4X4MA 3EJUA 4OH2A 4PJ5D 4U1IB 4FQ1H 1G9EA 1I7ZA 4HYTB 1J1PL 3FCSA 3MA7B 3SD2A 2WANA 4FJZA 1KOAA 1QFWL 5IFJA 3ZKXC 3SGKA 1R3KA 4DZBA 1FL6A 4PIRF 3E1ZA 5JLZB 1O6SB 4DIXA 4FAAB 4KOCA 3VAEA 2E27H 3IVKB 2IH1A 4L0PB 1EPFA 4N68A 4CW1A 5BPPA 4BELD 4O02A 3L13A 5DJ6B 1D7FA 3T2QA 4UQIM 2CDFB 1SMOA 1M05A 2X5PA 4PJHF 2FT8A 4NKMA 4OF3A 5FYLH 2YD2A 4Z76B 3QQDA 3HKFA 4F7PA 5JO5B 4MNGA 1LO0L 4UQ2A 3EJTA 4YVUA 2B5IC 1E8ZA 2CIIA 3FO9A 4KGLA 4B27A 3SPVA 1KY7A 1AVAA 1S9KC 4XOAA 2AK4E 3BSZL 4K0OA 3BZ5A 4FQXB 1T7ZA 1VEPA 2VDPL 3GLDA 3THML 1E67A 4XNYH 4FZ8L 5F6IC 3CXDL 4IM8A 1BLNB 4I18C 2DQFB 2LFEA 1YECH 3CFDB 5LWYH 7TAAA 5BUPA 1BLIA 1KMGA 3IN0A 2FYYA 2W5PA 3LJ3A 4PWGA 3H9SE 3KPNB 5DHXB 1ZTMA 5K5YA 4OJDH 3KYNA 1HDMA 2E6PA 4S0SD 4YEEA 2GG1A 3ARGD 1UWGL 2HVJB 3ZHDA 4H0LC 1QNZH 5LGJB 1S3RA 1QPXA 1PZ2A 3OKLB 4A67A 3MRQB 4PRBB 1JGVH 3CVDA 1T4KB 3S5YA 1PLGL 3VXTB 3QISA 1U8LA 4UV4H 1TEYA 1IM9B 5HGHB 2AQSA 2FL5B 4WTZG 4ZO9A 5BVPH 2AV1A 4G8IB 3HHSA 3IDIB 3HI6L 5EOCJ 1LILA 1PZBA 4YXHL 1FGNL 4PJAF 1HHKA 5MEPB 2RBLA 3QEGL 3WUWA 5KYXA 1CL7H 1AR1C 2CK0H 4Y1AD 1M9WA 3GBMH 3S5LA 4QRQA 3U9PL 2JB6A 1J1OH 4PJEB 2WLJA 3GMNB 1DQDH 4F33B 5F6HI 2Z6FA 2GSIB 2MCPH 4R97C 4L8BB 5EA0H 3T1FB 5E4AA 25C8H 3EO9L 1NMBH 3EW3B 4KJPC 4OGXL 3ASOB 4P5SA 5ERWB 3T3PF 2F7IA 2GAZB 5T1KD 3DURA 3LKOB 1L6ZA 3A6CH 2HFEA 3AT9A 1QQDA 5FOBB 3O11A 1TLKA 1A1OA 4YWGL 2AQNA 1ECYA 3BD3A 1UM4L 3EDKA 1YPZB 3Q48A 3L6FA 3STZB 1K6QL 1IARB 1JFHA 2DQUH 4JKPL 1UA6H 4JRXA 4CGTA 3QAZB 1RUQH 1E9OB 5KSVB 5DRNB 1MFMA 3DX8B 4BQBA 2Y5QA 5E6SB 1EAPA 2HT3C 2BOBB 4HISA 2VXTL 2BS8A 1NH6A 3G5XA 3NT0A 3LZQA 3VRLF 5JW5A 2AJXH 3W0WD 5ACZB 1YZZA 3BZFA 2WKGA 5K93A 1OGPA 1O7DC 4Z8FH 3PWVB 4XCFH 3WUZA 1YVLA 2CA3A 3FYIB 5CJOL 3IDYB 5E70A 3OLEA 2OMXB 1R46A 3G6JF 1IRAY 1WH0A 2ITCB 3FN0H 5ABAA 4LL4A 3M86A 5EPMA 1MWAH 4AYMC 1QLFA 3BC9A 1FRGL 1YEWA 2FO8A 4E41A 3FH8A 2P4AB 3VFPB 4XMXA 3AACA 4YDKH 3KBHE 3EO0B 2DLHA 1IEBB 5A40E 5CEZD 4NJAH 1BXUA 2YLKA 3IS1X 1DVZA 1NCAH 1I1AB 5AVUB 4OBSA 4LSPH 4JW3A 4M7LH 3M8OH 1NIBA 4MNHA 4PJEE 2EZ0D 3ZVVA 4P04A 2B59A 3I9GH 3F5WB 4DP8X 1DDTA 2EDTA 3WFBL 2V9QA 3K7UA 3W5NA 2AEPL 1BM3L 3SGDI 1IBYA 1Q1PA 4FEIA 4IRZA 5HYIA 4APQC 1T1YB 4JKNA 4U6XB 3TBTB 3WS6C 3VWJA 1AZCA 3QH3B 4WFED 1OQOA 1UGKA 1H3TA 2VL5A 3D85A 3LKNA 4R90H 3TO4B 1AR2A 4C4UA 1XF5A 3DTXA 1IGJB 1YPZE 4KDWA 1NCUA 4LASH 1IT9L 4L3ED 1WDAA 4ZK8A 1EGJH 2VXVH 1DJSA 2H32B 1VACB 4ZXBC 4AVJA 4N2IA 4QT5B 1MQ8A 3MRFA 4L5FH 4P23D 2AF2A 5JHBA 3C08L 1KUMA 3QIUC 5J1TC 1HJBC 4R4BB 1WHOA 4JO3H 2W65A 2YMXH 3LD8C 5CP3H 1NKGA 1TVDA 4PJ8D 3CFCL 3GTVA 1KEML 4WI9A 1G6VK 2HG5A 4JPVL 1UENA 1PKQA 1OARH 4Z3HA 1QRNB 1T0PB 2XJLA 1CLYL 1JZIA 3RVWC 2NT1A 2PWEA 4I3RH 1G7HB 2Y7MA 3MYJB 4GAAA 3UZQB 4TRPL 1L7IL 2OTWA 4TPRH 1GGTA 2W60B 4XP9H 1UWFA 4ERSH 1MCWW 4LSSL 5HJBA 4P4KB 3SKOA 2BP5M 1U58A 4KHTH 1ORQA 1VPOL 4JPWL 3L95A 1I7UB 2H0FA 4KI5C 1LDPL 1U3HD 2X05A 4HWZB 2DDQH 4U05A 5E4IA 5F3BB 5FHAL 2ATPA 2HVKB 2NDFA 2C1OB 3T6QC 3BVNA 1J5DA 1E28A 5FKAB 2FJGA 2WQRA 3VFRA 3X13A 4A7VA 5DQ9B 3F12B 1DJYA 5EWIL 1AY1H 3CTTA 1UD3A 2NZ1A 1KLGA 2W88A 2CHZA 4TTDC 5AL8A 5IB2B 1MQKH 4JDVA 1ITCA 2H3NA 2EDEA 4Z7WF 4QHMB 2VC2B 3TBBA 3TFKD 1YEHH 3MFGB 2ICES 3FO0L 3MNVA 3B83A 3APMA 4NHCH 3DETD 1JVKA 4S1DC 3BIBX 3MV11 1T83A 5KG9B 1IM3B 1OWRM 4R96B 3X1EA 5I1IH 4R7VA 1FHNA 4YUEH 5AVRB 1X5YA 4WW2C 5E1AB 3KWWA 5I19L 4N2DA 1YNKL 2DM3A 2PW2B 1I85A 1TITA 2JKNA 1GS6X 3GHEH 5JIQA 3IGFA 4G3YH 4GPVA 1U8HB 4ANKA 1QRNE 3RL1B 1IAIL 1TUPA 4NSKA 1MLBA 4NRXB 4IRSD 2QADB 2EKSB 1ZSDB 3ZO0A 5TDOA 4EZJA 1USZA 3BI9X 5C0BD 4KGJA 2ZPKH 4WLCA 1PQZB 2F7QA 5JIIA 1TMCB 1GL4B 2FBRA 1Y6NR 3BKYL 4NAMA 5CLTA 1DEDA 3BWAA 1L5GB 1QSEA 3CQFA 2VLKB 2WB7A 4AMXA 1RPQA 2UZYA 2X4TA 3EBIA 1EERB 1ND0A 1LM8V 5KS9B 1SDYA 1XH0A 4IOFC 4DN3L 3IXAA 4P5TA 3QEUB 2KZBA 2XETA 1G6RL 5DEGB 1GGCH 3MGTA 5B38A 4X6BA 1IC5L 1MPAL 2AFNA 3H7LA 4HCRA 4MWFA 3GB7A 4F1ZA 1N7ML 4WWPA 1WEJL 3U0PA 4F7KA 2F7OA 2NY4D 1MI5A 1QEWB 2ZAIA 3R06B 2HRLA 2OYLA 3GJFA 3JUZA 3D9AL 1N0XH 3QFJB 3ARDB 2V2XB 1PZ3A 2R0LH 5DZLA 3QUZC 3GSNB 1A9EB 5EOCH 4KH9A 5I1AB 1OQXA 3CDCA 2QL1A 2X41A 3WTYA 2O93L 1AH1A 2X1PA 5CZVH 5F97E 4IJ3C 4L1HA 2DQTL 4XCNB 3UJIH 1RZIA 4R2GD 4XXDB 1KIQB 2PR4H 4OD3L 5DZVA 4FKKA 3K6OA 4GRLC 3V6ZA 2FRGP 5F21B 3Q43A 1HSAB 4HPYH 4ODXA 2AVFA 4XE5B 1DQJA 3EADA 4MDIA 3QXAB 3FSVA 4JDEA 1TJIH 2JCWA 2JF1A 3H42H 4MMZB 3V7AG 4XMKH 4O58L 3GO1H 3KH4A 1HNGA 3MBWB 3CSYB 5LCVH 1RKRA 1CZ8L 1CS6A 1SN0A 3FUMA 4NO3B 5HI4C 3T9WA 3ULUE 1XMWA 3TNMA 4ZW5A 1I8IA 1UGNA 2PWHA 4NDMB 1NCBH 4PRPB 2GJZA 3V6OC 3AY4A 5KVEL 2GI0A 3HKZA 3B56A 1O9WA 1R3HA 2ZCLH 4XNUH 5ISZD 2N01B 5K39A 1MHCB 4IGBB 4WHTB 3S3DB 3KPLA 4X8CA 2NUPB 5KS9E 1YNLH 5DHMC 2AKRA 1CF8H 4YHKH 3GMPB 1X5AA 3VM5A 1IO4C 2YD6A 1F00I 1H8SA 4BGLA 4X7TA 1Z9MA 3TIDB 2Y9RT 3II2A 3OKEB 5ICYB 1MRFL 1N26A 2FR4A 1MAMH 3BLPX 3I74A 1OT1A 1MNUL 4TM9A 2AS5M 3HJ0A 1PFCA 3CDZB 4OCWL 5F44A 4RWHA 3X3FH 3V9FA 1IKNA 3MYZA 5CD3B 1TTCA 2X4SB 4M43L 3K8LA 3BW9B 4M3JA 1W8EA 3QFJE 4WKZB 4TQEL 5LNDA 2ZAGA 5J6GA 5D6CA 3QXTA 1BQ5A 3MOAL 2WP3O 2BWIA 1IKOP 3CZUB 4NM8L 2W0FA 2JELH 1NDMA 2ZWYA 2CSPA 5TFSL 4ETQA 4F57H 1JRHI 2OCCB 1NDGB 3OZKA 4I0PD 4NAQA 5IJCC 5DD5H 4FMVA 4JDZB 2GVYA 2BY2A 2F74B 4PTTB 1REIA 3KW7A 3UROR 4GKLA 4BD4A 5JXEC 2R1YA 4XP5L 1P69B 4Q74A 4A6YL 4NRZA 2O6DA 2UY7A 1M2OA 4PVMA 5IF0B 1JYXA 3OPZL 2XTJD 3UDWC 3O8XB 4OFIA 3LYRA 4UIKL 4FQQA 5BXFB 1T7XA 1F42A 2BVQA 2X4PA 5FA4A 5KTEH 4PV9B 5EN2B 4LLUA 2QQNH 3VWKB 3P77B 4ABQA 3CN3A 3UG4A 3POCA 1PDKB 1MW1A 1T0OA 1UD8A 4PRPE 2YAQA 4P2RB 4TUJB 4B5EA 5LXVA 2EJ1A 2WQSA 4WDIA 1SOKA 4OFPA 1NCCL 1SYSA 3B2PA 2JKIS 1N4XL 4JQVC 1YO4A 2BK8A 4PRIA 2WUCL 4G11A 2VMEA 1JZDC 3UP1A 3VW3L 4OI9A 1C12A 1OAJA 2XLLA 3SD5A 5IMKB 4OFQA 4NX0A 5IQOA 3FCUB 3FQWB 1DVTA 2F53D 3EGXB 4JGUA 5GPRA 3RA7H 1XVSA 4ZODA 1QBLH 5C0AD 1NCWH 3HC0B 3UIYA 3KLDA 1NAMA 3D39B 3CSFA 2ADIB 3RKDD 4CKQA 3NH7L 1U0QA 4QRAA 3AM8A 3JVFC 1S7UB 2E7BA 5E1QA 1NEZA 5D93C 3ZL2A 1OAQH 1M71B 4WWKA 4ZMQA 2CUHA 2HFFB 3ZXAC 5EZOL 5IMLA 1F4YL 3AAZA 3N9GH 3QUYA 3FPXA 3UTPE 1P5VA 4OGYL 3NIGB 2YUXA 2OMYA 3IWUA 4BXVA 2BINA 4PJIB 4YDJB 2EVFA 3MREA 3PHQB 2X9ZA 4L8SB 2Q76A 1RULH 2CNZA 2XJKA 3G5YB 3JWOL 3KCWA 3VD4A 3SKMB 3GEWB 3GJEA 2WC7A 2IG2H 1HCVA 3TVMA 4LRIA 4DP5X 4XMTA 1SM3L 2OA9A 4AEIL 4KZEH 1AFVH 1MRCL 5FUCE 2K6ZA 3LH8A 1IQDA 3HB3C 5BQ7B 1Z0MA 2HTLD 4P2RE 3EJZD 1WTGT 4FD0A 2KQNA 1E6OL 2VKXA 3CN0A 2GPZA 3RU8L 3ZK0A 4J5VA 4Q9RL 1TETL 5C0JA 1MWAB 3GXDA 4KKLC 4AQ1A 4PPTA 3ZZLA 4P57B 4MAZA 3N42B 1NUDA 2OJZL 5FLUA 3SBQA 3MRPB 4NBXB 5I71B 1WIOA 4LPTA 5D6DA 5A16A 4G6JH 1TU2B 4WTWA 1BOYA 3FT1A 3QXDA 1U3JA 1MELA 3UJTL 4W1TA 1EJFA 1MJUL 4XMLH 1AE6H 3PJSB 4M6OH 3WLBB 1N9PA 1ZHNB 2WINA 4XPFL 3KCPB 4EDWH 5KSAC 5FUZH 1OHQA 4MMYB 4G7SB 3IJSA 4M4RA 2UXFA 4CVXB 1WWBX 3D39E 1CICD 1EO8H 3WUWG 3CMGA 1OAUH 3AU1A 1QR1A 2Y07H 3S5LG 4FFZA 4QXUL 5D1XD 3MNZA 2O5ZH 5DO2C 1EIBA 5FF6A 3FU7B 1LE5B 2XXCB 4HS8L 2W9LA 3ABMB 4AY0A 5ESQB 2CE6A 2ZJSL 5B7EA 1P2CA 1FLRH 2OR8A 4J3TA 1AGFB 1GMIA 3NIGE 4ABWA 1CGVA 2C8NA 4PJIE 2R29L 4OFYD 1IFHL 3N1FC 1NUNB 1UACH 2D3NA 2HKHL 5CCGE 4M7ZC 5IOPB 1IGFH 3GTTA 1OLLA 1A4JA 2BFVL 2J4WL 2YGPA 3L8QA 2HPOA 4M6NH 4G8GA 4YK4B 3QJRB 4G80B 3VRJB 2FD6L 3G04B 4Q89A 1YNTB 4Z3GA 2OI9B 5D1QA 4MS6A 4WI2A 1NBVH 2OP4H 4DH2A 5BV7H 2FT6A 3EJSA 1F8TL 2XWBB 4K7PY 2YPVA 3CGTA 3K2KA 1SJEA 3Q8CA 1LEGB 2ZP9A 4PCTA 3OTTA 2SODB 3CVIH 3U1SH 3U6XA 4JVUA 1XXFC 4G71B 4HIXH 1YEIL 1T80A 3F58H 5L2JB 3WYRA 2P24B 4DTGL 1CJYA 1ZA3A 5D9SA 3RDJA 3HEIB 4LGSB 2OTUA 2VZSA 1CDCA 5LVEA 2EDDA 2WOYA 4I4WA 5DK3A 4Y5VC 1E9QB 2WLIB 2CLRB 3G5VA 1FNHA 3Q01A 1X4XA 1P4IL 2EC9T 3ECBA 4NQEA 4RX4A 3S88H 3FCBA 4K5LA 1YY9D 3S7GA 4IRJA 4LEOA 3L1EA 3RY6C 5FDWB 1QWNA 1IGCH 1BZQK 1TCRA 2YGQA 4Y8AA 4PCKA 4AIZA 5E9DD 2YMTA 1KWGA 4LEXH 3LDBB 4IOSD 5D2NB 3DECA 3ZRCC 4WGVB 4POZC 2BCKB 5B8CA 1F1DA 3CHRA 3H0TB 4AEIH 5HVHB 2EDBA 2YD5A 5DZ9A 3OGCA 3NIFF 4HCGA 2HZHA 5BMFH 5GRJH 2CHXA 4PVLA 4RFEA 1WA2X 4EF3A 5IVXA 3IDMA 4JO1L 4W9KC 5I23A 3VXMA 2VDML 3AVEA 3E6HB 3GMRA 3MVSA 4H8WL 2B2XH 3ATFA 5E6RB 5E6IA 3NDYE 3OKDA 4JG1H 4OLVL 3N06B 3OX8B 4YSAA 5JQ6L 3QUML 1MFNA 4RGND 4YR6B 2ZZUT 4NT6B 2CRZA 1NANI 2OJEA 3C6SA 3GK8L 2E74C 4CUCA 4O2CB 1S7XA 1J1PH 2G60L 2ZOOA 4AEEA 2BVUA 1QFWH 2LLGA 5EZJB 4HUXA 5E0QA 4R7DA 4G7VL 2VLRA 5D2LB 3IT8D 1F4XL 3F65A 3FQ2A 5IK3B 2VDRL 2EAEA 2LU7A 2Z8WC 4E9LA 3DDFA 1SN5A 4PLKD 4U4IA 4UT6A 1EO5A 2VR3A 3CLFH 3ECUA 3ZLQC 4DPAX 4PJDA 4O02L 3L4ZA 2W81C 5DT1L 1LO0H 12E8L 4P5MA 5DK2A 4JFFE 4R0LB 1S78D 1Z2KA 4WEBL 4KK8C 1JWMB 2DN7A 2F58L 2MEJB 1ZANL 3OHMB 3ZYZA 4ZYKA 2X2YA 1E43A 2EXWD 3BSZH 32C2B 4LESA 2XV6B 3QORC 4KY1L 3RG1C 1BIHA 2KYIA 2ZXQA 4HJEA 2VDPH 3THMH 5FUOL 2ED9A 3GSOA 1H3VA 2CO7A 4HPOL 4FZ8H 2VZ3A 3CHXA 3CXDH 2R69A 5D2NE 3RWFB 1A02N 2X44D 3UAAA 4WSJA 1QFHA 4LU5L 4N8VB 4QJ4B 3TWCL 3ZZQA 1AGCB 4WHYG 5E6UB 1X5JA 2AQRA 2BS71 4LCYB 2Z64C 3RFZB 5I6NA 5I1KL 5DFAA 1KCBA 5IHZA 4FHBD 5ID0A 3DMMC 1PNDA 3EOAA 3LRHA 4FXGC 5B3JF 1FG2B 1QNIA 4Z7NF 1XH2A 4HIQA 2BNRA 4NIKB 4UDUA 1UWGH 5GJSL 2CCWA 3DWTA 4NO0B 3QCTL 2W0PA 4QHKJ 3U4EB 1KYOJ 3NAAL 4FQCL 5I8KL 3KL5A 4J3SA 2VLLA 1PLGH 3MLTA 3H7BB 5DGRA 3QEQB 2JNZA 3IDGA 3RZCC 2XYCA 4G70B 3CLEL 3CZJA 5EC1A 1WC7A 4QRPD 4YGVB 5D2LE 3ZJAA 5JDSA 4ZPTA 5EB9A 1UADC 4NQCD 1ETZB 5AD0B 3HI6H 4BHUA 1HHJA 2FECL 2X89D 4HUWB 4YFLI 1FGNH 1AGBA 1OAXL 2DAVA 2FGWL 4YXHH 2EEDA 3QEGH 1T2XA 2Y1VA 3PWPB 3DLQR 3L2MA 4N2HA 4XN2A 5EC2A 4PRNA 5K33A 4YHZL 4KKCC 1TKWB 3MLZL 3U9PH 2UX7A 2OW7A 5AVYB 3ARXA 1OSEA 1TNNA 5SWSD 5SX4H 4G82A 3IJ9A 2A7BA 4ZQKB 2IAND 3P9MA 3MCYA 4N2FA 1NBZB 4QHPA 1XO8A 3GBEA 1HOCA 1DZBA 3B9KB 5D5MF 5J12C 4DOHB 4PWIA 3C5ZD 1ML0A 2BVEA 3EO9H 3IYLW 3LH9A 4OGXH 4XN8A 4UT9L 3HE7C 1JGIA 3B34A 3MV7D 5BUGA 3ULVD 3QARA 4MBOA 2I9TA 4GIOA 5IVZB 2DMGA 3DX7A 2ZKYA 1OCOB 1E2VA 4YWGH 5BJTB 5CCJA 4ENZA 1CE6A 2Z93B 3NCEB 1UM4H 1K6QH 4M1CC 4MDJB 4ZMYA 3PGCA 1N5AB 4JKPH 4XT1C 4N8CL 1H3XA 2RB8A 2MPVA 4QRFA 3LKQA 3VTTA 2WWMD 4WUKL 3MJGX 1ZPLA 2A83A 2VXTH 4WO4B 5A1AA 4HGMA 4XX1E 1BD2B 4JFYA 2BERA 3FO2A 2W92A 1J9TA 1IAOB 3G6AA 2H9GB 4PJXF 3RWEB 3SY0A 1JK8A 1CWVA 3KJ4C 5CJOH 5TDPB 2EH7L 3CMOH 3NABL 3QEQE 4W68A 3BLBA 1I53A 1NC4D 3TN0C 3MRCB 1F11B 1FRGH 3ARPA 4JFDB 4JFOB 3WDIA 4GI6A 4F2FA 1SXAA 4BCYA 2IALB 3GINA 2QMJA 3G08A 3UGEA 4L9DA 2Q87A 2EIKB 1CGWA 4EI6B 2CM6A 3Q1SL 3PWPE 4NHUA 5HGBA 1KF9B 4UOZA 4N9GB 3GSQB 5DLML 1VZHA 3Q6FB 2ZG2A 3PL6C 4N0YL 4TQIA 1QWUA 2TSBA 5GZNA 4EN3C 4PQXA 1VFMA 4JRYA 2JCCB 3FT3A 3WFBH 4DOHE 3L3OC 4NQDA 1JGUL 2AEPH 1BM3H 3R8BB 3TXAA 3WO4B 4PP1C 4QRTA 5DHYB 3OAWA 4MZ3A 1PF3A 4IRZL 4QOKD 5FO2A 1GS8A 2IADA 1BQRA 1XD1A 1MCOL 2WBJC 3MRLA 4G72B 4LB8A 5AWNL 1ZRUA 1X6LA 3T71A 1IT9H 2OMVA 2F19L 4PJ9C 4X7EC 4GUQA 2WLHA 3U25A 5JHLL 4FC3E 1NGZA 1NM9A 4NLAA 4AQAB 5G5DB 1GTNA 5JHDA 3C08H 1JK9A 4RZCB 5F7EL 2EUVA 1TVBB 1OE3A 1AR1D 2EIMB 1BD2E 3LKPA 1D5IL 3AITA 4B9JA 2G0KA 1UQSA 3CFCH 2FEEI 4TVUA 2APWA 5EMYA 2L8AA 3LN4A 5DFVC 3UTSB 2F8XC 3ARFA 3BWSA 4WU5B 4JPVH 3UACA 5IFHL 4KJPD 1G9ML 2X4OB 4IBTA 4JLRA 4LHJB 1XF3A 4K3JL 1CLYH 2EC9U 5E00B 3QUXD 1KV3A 4JFDE 4GAFB 3SB3A 3IMWA 3BFWA 2EE0A 4BFGA 2AEOA 1AHWB 4TRPH 1NICA 1L7IH 1SJXA 5B39B 3W37A 3MRMB 1ZGLM 4KKBC 2JWYA 5BOZG 2R9HC 4FADA 5IP4A 3FB6A 35C8L 5CBAA 4LSSH 2IF7A 1QASA 1UOVA 4JGMA 3ULSB 1VPOH 4JPWH 5EU3B 4YDLC 4LEBA 2ZOUA 3FCTB 1VFBA 4YS4A 2JCCE 4MZIA 5B1AB 3LNDA 1HEZA 2HT3D 5FHAH 5C92A 3MU3A 2OM5A 4JO8A 3C60B 4ABVA 3PQYA 4N9OB 3RIFK 2IIJA 1T0MB 1QA9A 4UDTB 2WXQA 4UAHA 4W9LC 3QW9A 5EWIH 1ZVYA 3IB4A 1T5WA 1LDSA 3AREA 3PRZA 3O9WA 4Y9GA 1ROCA 3VQMA 1O7VA 3RIFF 4Z78A 2FX7L 2P45B 2YFOA 3UTOA 5IT2L 2H6OA 2WXGA 4H5SA 4O4YL 3VGAC 1MRDL 3FO0H 3KPMB 4IBSA 1SBBA 3P2DA 1FIGL 4PG2C 3EYOA 4C56B 5CKGA 3APCA 2Q9OA 1D5ZB 4Q6YA 5IW6A 1OTUC 5I73B 1CGUA 3JV6A 1ZHBA 5I19H 1YNKH 3LRGA 1NEZG 4LEEA 3UTSE 6FABL 3D07A 4G83A 3PXJA 4WV1B 1CXKA 4EI5A 4WI3A 1TZIB 4KVPA 2XN9A 1PY0A 3R19A 5D1ZB 4APQD 1S5HB 2DQIL 1IAIH 3S8GB 2WUBL 1A1NA 5EBLB 2IOIA 1SDDB 2R0WL 3FFOA 1PG7L 2XTSA 5BZWA 1R9FA 4FYTA 2GEQA 4CC4A 5I16A 2E0PA 3IGKA 4HJUA 4LSQL 3QUGA 3BKYH 3CBKB 3CFEB 4ANUA 1BW8A 3B1TA 3KM2A 3OHXA 4FNQA 1GY1A 3QQ4B 4QXTB 4FHJA 3A5VA 4AQZA 4S1QL 2FUQA 5CXPA 2A99A 3EGDB 4ZXBD 2OMNA 4KX9A 2TAAA 2BHUA 4MD0A 4HKBB 4DN3H 1FNEB 1UT1A 3QIUD 3CDGA 4Z7VA 3DA0A 3D4YA 2XWTA 5FO7B 1G6RH 1KT2B 4JQXA 3V6FA 1IC5H 1MPAH 3CZSA 4YX2L 1DVQA 3TC9A 3EDFA 1N7MH 1WEJH 5ES4B 2GW5A 2QR0B 1UM6L 4HCRL 1BAWA 3LZNA 3D9AH 3QJHB 2YAEA 2CIKB 5K1JA 3RVWD 1E5AA 3DVNB 1MZZA 1OM9A 4LOFA 3V0JA 2JB5L 4DKEL 3B7UX 3SDCC 4AM0B 2ESVA 3OKYA 1Q38A 5I9QB 3D3VD 4C56E 2DQTH 2R23A 2CBOA 4XB8A 1OPGL 4OD3H 2VKWA 4MNQA 3CSBA 5E6ZA 3L4CA 3MV8A 2F18A 5EF0A 4KI5D 3S8FB 4U3XA 1IX2A 1HHGB 2WYZA 3FTWA 3GZQA 3OVUB 5BV7C 2VE6A 2QPSA 2ATKA 3GGWA 4O58H 1XFPA 1SXNA 2XNAA 4MD4B 1CZ8H 3FUHA 2ZAHA 3PWLB 4OUUA 1ZLWH 4Y5YC 4WCYL 3DVFA 1AYOA 5KVEH 4N3TA 4TTDD 5DRZB 2YEQA 1QG3A 4F1SA 3P40A 2HRPL 5MP6L 1K8IA 4W9HC 3EJJX 1AHMA 3IKCA 2VGLM 2PWDA 5IBUG 2O30A 2NYZA 2R1XB 4JFQA 4P48A 4KUCD 2NZ9C 3GXMA 5IQ9A 3D33A 3DO4A 2EVGA 4I87A 5DURD 1E8WA 3HLAA 2ZE0A 3OLDA 4FQJL 5IFAH 1LP9B 1MRFH 1EMTL 4HKXB 2Q7YA 3HUJA 5GGSB 4D0DA 3NJJA 1MNUH 1BFOA 4OCWH 3E9TA 3ZOAA 1IGYB 1TENA 5E9DE 4M43H 5C0FA 1XB6A 1G7LB 3BQUA 1AC6A 5JXAL 2W9EL 4TQEH 5INCB 4P46A 3SY6A 2VDPB 3NRPA 3MOAH 5DJYB 1BQUA 2G2PA 4NM8H 3TWYA 1N18A 3RL2A 4FJ6A 5AAMA 5TFSH 5FA3B 2BP8B 2PCPB 5T3XD 2OZ4A 2L4OA 4PJFF 4NKIL 3TEZA 1KB5L 3US9A 5I5JA 4L9LC 4G9FA 3LRMA 2J25A 2ZXCA 5DZNA 1XV8A 4XP5H 3BZ4B 1ORSB 5FWRA 4A6YH 4OZGA 2Z8SA 2IAMA 3OPZH 4IOFD 4JFTA 5F9AC 4X98A 1DVFA 1KENL 3ALWA 4UIKH 3QEHA 3UBXI 3K6NA 3QZMA 1DUYA 5FYKL 2AQ1A 2DM4A 2IPUG 4J12A 5EFIB 1E65A 1JDAA 5AW0B 3KPRD 4L4JA 4GW4B 5EO9B 3T77A 1ZJAA 2QGBA 4J8RA 1NCCH 4FA6A 5C9KA 4WI0A 1YAIA 4OLUL 2ZX5A 2HX7A 1N4XH 4WENB 3UO8B 4F27A 4ZPVA 3GPEA 2BVOA 1TFHA 2WUCH 1UXWB 3QUZD 1SXZA 1USQA 4MAYB 4GKOA 3VW3H 4ZUWA 1U30A 3NP3A 4B9IA 1SFDA 1TSRA 4DAGL 4S1RL 4UM8A 1KYOK 1AI1L 4IU3A 4NZ8A 3VE0B 2DTML 2VZ1A 1LP9E 2VDOL 4GRLD 1D5MB 3OF6A 2WMPA 2WXNA 1IV8A 4MCYB 3DXAA 3TCXA 4YFDB 3FT2A 4QY8B 2EIEA 4NRYA 4JVWA 3NH7H 1N3NA 1L0YA 1QHOA 1WUNT 1WS7A 4UNTA 4ZTEA 5HI4D 3CSTA 1SYVB 3V0HA 4M7LT 1KV7A 1P7QB 5EZOH 3O6ML 2WVVA 2A6KA 2YGOA 2ZWNA 3O3AB 3KPPA 3MRJB 4AK2A 2BDNL 4DJMA 1ZVSA 1YN6B 4OGYH 4A7UA 3E8VA 3ETTA 3PFUA 1RAMA 5DCCA 4ZX3A 1A14L 2CO2A 2HRGA 1KXTB 3AG2B 4CVWA 3RVXC 3LAFA 3C75A 2KMWA 4N6QA 2AJVL 3JWOH 5JNYA 4ZAKB 4OZFG 1I3RA 2B3IA 2BSRA 4FQ2L 1EHLL 4PJCB 4X9YA 5KBLA 2ZXWB 5CWSA 2MQ0A 1UCBL 2P8LA 1SM3H 4IU2B 4HZLA 4PCYA 3FW6A 1MRCH 3DGGB 3EH5B 3MRIB 2Y1AA 4K7PL 3RTQC 2XN1A 1FZJB 1ZLWK 3IJHA 4LSVL 4X6EA 3R0MA 4XNAA 3Q0HA 1CLZL 3WKPA 4AW7A 2KS0A 1Q9OB 1K8DB 1JRHL 1D9KA 2NY2C 1E6OH 3RU8H 5SWZA 2YBGA 3RVVC 4Q9RH 4KXZH 3T3MB 1TETH 4NM4L 4TV3A 1U8JB 2ICEC 1S9XB 2RIKA 2OZNA 5I1CL 2OJZH 2FX9L 4PSRA 3UBXA 1FH5L 4PY7A 4M7JL 2RQ8A 1MG2C 4KX7A 1JZEA 2X87A 3HG1D 3WEAA 3K2UL 2TSAA 1FGVL 4H26A 2XBZA 5GSVB 3GMOA 3HS0B 3UJTH 1MJUH 1DTUA 5JXED 5HP5A 1Z3RA 5DS8B 3L08A 4YSTA 4XPFH 3W39B 3IEAA 1CLCA 1OK8A 4HD9A 3D87B 1SJVA 5KSUB 5J3HC 1TIUA 3FU8A 3MV7E 3MA9L 3IAPA 3MGOA 1OGAA 5F8RC 1NMAH 1CFSB 1BJMA 4QXUH 5FS5A 1IGIL 1EJ8A 3EXJA 1DLHB 1IBFA 1VAHA 2Z31B 1U8NB 4HS8H 2VIRA 4HDIA 1J05B 1EVTC 2ZJSH 1A2YA 3TJEL 2YOCA 4GUOA 1NM4A 3IGLA 4JHWL 4I0CC 1PS3A 5ENWB 5F9WB 5FYLD 4UIMB 4Z7QF 2R29H 1ZLVH 2OQJB 1IFHH 1OP5H 1KXVC 2HKHH 2R15A 3HPJB 4M93B 3QI9A 5J1AB 1SOSA 1T20A 1V7ML 1JPSL 2FWOA 5E8EA 1QBAA 3KAAA 5E1HB 3WN5C 1WGVA 1CC3A 4MA8L 2J4WH 2BFVH 2DKUA 4NQTA 4F8NA 4IBZA 1Z9SA 3VFTB 2FD6H 4ZUUA 3V0VB 4M29A 1KCLA 1GCFA 3AS1A 1UCTA 4TULL 1VFAB 1F8TH 1BFSA 2B8OT 4NBYB 2OCFD 4MQXC 1OCWL 2YPKB 3NCWA 5DJ8A 1DE4A 1S9WA 3T3ME 3L5WB 2PYFA 3QWQB 1M7IA 1PMYA 1YEIH 2PYEA 2YUWA 1R3LA 4NIYE 4DTGH 3B7TA 1MLCA 2C4FU 2GTZA 1JWUA 4OFVA 2ZIDA 1P4IH 2CJUL 3E3QE 3HTLX 3KYAA 4R4FL 3B9EA 3FRPG 3S2AA 3QPQC 5CCHE 3RUGB 2V7NA 1GRWA 2NNFA 2V5MA 4X7FC 4IJTA 3L3IA 3VSVA 3HE6A 2D7TL 4X8JA 2Y24A 4J3OG 1S7RA 1ZV9A 3VXOB 4QOKE 2P28B 1AMYA 2EH8L 3AS3A 1QEXA 3AY2A 3HB3D 3ARVA 3DVIA 3MCG1 2V7HB 4FG0A 4XOCA 2Q3XA 1CURA 4JO1H 5FK9B 5B21A 1DYZA 4YZWA 2VDMH 1ADQA 1BBJA 2LR4A 4KZCA 4P2CG 5E1GA 4H8WH 3TIEA 2OMWA 2JJTA 3WMQA 1ZCRA 4KKLD 4NKDA 4OLVH 1C16A 1GZHA 2ZCZA 1ZVHA 2AK4A 3HI1A 1JPEA 3DUSA 3QUMH 5JOFA 5JQ6H 4EUPA 4YL4A 4FNSA 4PWEA 3GK8H 2ZUSA 3F7QA 1G5AA 2G60H 2FLBT 3AWEA 1RK1B 4XNBA 4WEUD 4BKSC 1JPTL 4PBDA 5KSAD 1MW2A 1PJ9A 4G7VH 1K4CB 4L3FA 4GSRA 5EEVA 1F4XH 1CYGA 3CAFA 2VDRH 2VQ1A 4W6XB 3H9SA 1N0LA 5DVLA 2A9AA 3DRQA 3BEVA 1XGPB 5DO2D 4ELMB 1GJIA 5E7FA 2J8OA 4K07A 1K2DA 5T1LD 5I28A 1BIIA 1WFUA 5T1JA 4O02H 4HULB 4L8DA 5DT1H 4FGMA 12E8H 1NC2B 2W94A 1AD0B 3FB7A 3MA7A 4WEBH 4DK6A 2X9YA 2F58H 5AKTA 2FO1A 1ZANH 2OSYA 5JLZA 1O6SA 4KY1H 3RUGE 3W81A 4K3EL 1OALA 2YBRB 5IROA 5FUOH 4P2OC 3IVKA 4HPOH 3FBKA 4K8RC 4LU5H 4MXWL 5DJ6A 1QHPA 2A74B 1KBGL 2Y5TB 1G6RB 4MQ7B 2XWDA 3VDAA 2GI7A 1XT5A 2JMRA 3TWCH 3NJHA 2EE3A 2AQPA 2R69L 3RTLA 4Z76A 4W9DC 5JO5A 5I1KH 3SDXB 2AZUA 5F9JA 2ALWA 2VITB 3MRKB 4C8XA 3UBFA 2QSQA 5EOTB 1CBVL 4PBXA 4O9HL 2MTAA 4MA3B 3KBEA 2FSEB 4CVZB 2IH3B 3O6FB 4FQXA 1WYJA 5GJSH 3INOA 5A2KH 3QCTH 1YC7A 1MFVA 4R5TA 4WNSA 3NAAH 4FQCH 1BLNA 4JFZL 2DQFA 1DFBL 5I8KH 1E4WL 1MW0A 3ABKB 2XA8H 2VQ4A 4F9PC 3CFDA 4QD2E 2G3NA 1NSNL 4PJBF 3D2UB 4UQBA 3CLEH 3ZDZF 2E7MA 5CM1A 2IBGA 3S4SB 1PZUB 5TPWL 3KPNA 1J9RA 3BAJA 1UJ3C 4POZD 4TNVK 5JMRA 3BPNC 4BSVB 5KVGL 1OAXH 4ELME 2CJSA 2FGWH 5JOPE 3RDTB 2NSMA 3OKKB 4YHZH 2YKKA 3MLZH 4JJ5B 5LGJA 1EZVY 2EEBA 2X6AA 4Z7UB 3OKLA 4TXVB 3MRQA 4FFWD 5CFAA 4PRBA 4N0FB 3KLHC 1T4KA 3VXTA 4XBGB 2XIIA 4WQOA 3EYVB 1SUHA 4BA0A 4UT9H 4X5RA 1IM9A 2V6HA 5HGHA 2FL5A 2JJWA 4G8IA 3WIHA 3IDIA 3TYFB 4BUGA 5JPMC 1ZDSA 3QDHA 2OSWA 2IV8A 4X4KA 4C59B 3GF8A 5KN5B 1RZJC 1FPTL 2DL2A 3GI9L 5AVWB 4N6RB 4N8CH 2QJDA 3SDXE 4HEME 4PJEA 3DDGA 3GMNA 4PJHB 4WUKH 4F33A 2H1PL 1EANA 1LQSR 3BSGA 3PREA 1SQMA 5L2KD 3QRBA 2GSIA 3T1FA 3D0VB 4L8BA 2ZUQC 1N67A 5ERWA 5C97A 2GAZA 3LKOA 4UTAA 2VJXA 4OCXL 2EQDA 5FOBA 4JFEB 3DKHA 4F2EA 4KK8D 2EH7H 1YPZA 4KI5E 3VD1A 3NABH 4OLEA 3STZA 2WCSA 4NKQB 3N1MC 3QORD 4DGWC 4KV5F 2NX5D 1WBZB 1SEBB 5AUMB 2Q10A 1E9OA 4RMTA 5KSVA 3KWTA 1AO7B 2LLNA 5DRNA 3DX8A 2JKSA 1EXUA 4AVKA 2J56A 1I8KB 2BOBA 1RP8A 4Y4HB 3Q1SH 4YVNA 2DBJA 1M3IA 2EO1A 2JJSC 3HZKA 2Y06L 5DLMH 2NNRA 4OF0A 4UOJA 4N0YH 5ACZA 3APNA 4Z7UE 1OCRB 3PWVA 5KVEE 3NPSB 3P4MB 3Q05A 1HH6B 3DMMD 2OMXA 1O5PA 1SVZA 5DMGC 1JGUH 2ITCA 1E90A 5I1JL 3P0GB 3R1GL 3IAGC 3F6JA 2G3ZA 3EBHA 4KTDL 2K45A 4NENB 5DC9B 4Z7AA 1MN4A 3VFPA 3FQRA 5HGAB 4IRZH 1ET8A 1XIWB 4RMVA 3EO0A 4OCRL 2DLGA 4PGZA 1U33A 4M8QB 1MCOH 2FX8L 1AG0A 4TQ8A 5AWNH 2DKMA 5E2UL 3HBQA 1CO1A 2F19H 1I1AA 3RZCD 4FNLL 2DQMA 4PJAB 1UXMA 3D5OF 5JHLH 2Z0BA 2E76C 4PJHE 3LKSA 3UERA 3BRGC 4CU8A 3F5WA 4MB3A 2R7EB 5DQJB 1V7NL 5GS3A 3ZTDC 3OR6B 1CFNB 2YJLA 4HWBA 4AGPA 3AZUA 5F7EH 1LO5B 1OLZA 4CU6A 15C8L 1T1YA 1D5IH 4KKCD 4U6XA 3TBTA 3IPFA 1EO7A 3U4AA 3QH3A 4JFEE 3T3PB 3TO4A 1T7VA 1IGJA 2FEDC 3T4YB 2A2QT 5CZRA 5GXBB 5AAWA 5IFHH 2ENPA 1G9MH 3QR1A 1O7SA 4BQ6A 2DYSB 4K3JH 1RJCA 3HE7D 4XC1L 3TGXA 2VO5A 3AC0A 1HESA 5HY9B 2KI6A 2H32A 1VACA 2UXGA 3BFOA 5CFHA 2X0UA 4QT5A 4A2MA 2BH0A 1XGRB 3ULAB 1YMMB 1KGYE 5KSBF 4N1EA 4PWKA 1JZJA 2FAUA 3G9AB 4M1CD 35C8H 4R4BA 3RGVC 1DBML 1G1CA 1MCSA 3MLXL 2VSDA 1MFDL 3EBGA 3TU6A 2R56L 4U2YA 2P5PA 4H1LG 5I18L 2EIZB 1JZHA 4DKDC 2Q3AA 3NGBC 4O5LL 4UAOC 5IB3A 3TBCA 5C6TL 1QRNA 5L4MA 4K7FB 4FA7B 3G6JB 4JJOA 3T8XB 1G7HA 3O6KL 3MYJA 3UZQA 1YAZA 1QFPA 2NSQA 3L4VA 1HI6B 2W60A 4YBLB 2WK2A 4N3UA 5IUSA 1X5KA 3PUCA 4B60A 3LKRB 4P4KA 3TN0D 4PJAE 1CPUA 4PJ7F 1OSZB 1HX0A 3BKML 1RSFA 4XNDA 1H6EA 2DQGL 1KGIA 1I7UA 3ETBF 4OB5L 1DBJL 3EAKA 3NJVA 4O4YH 5C70A 1MRDH 3JVGA 2VDKL 4JGJA 1JZ7A 5H4ZA 4HWZA 1FIGH 5F1OB 5F3BA 2WVTA 4WY7L 4HGWB 2HVKA 2C1OA 1SHWA 2Q7NA 5FKAA 4EO5A 1L9MA 4Q2ZB 2XVKA 3PL6D 3DRTB 3MUZ1 3T3PE 4MKTA 4EN3D 2F8VA 3GUFA 5DQ9A 3F12A 4ZOEA 6FABH 1LMKA 1CE1H 2PPEA 3EDJA 4NN6B 5IB2A 4PP1D 2H2PC 1AXIB 1MW3A 2XV2A 2DQIH 3VFNB 4QHMA 2CD0A 1XH1A 2WUBH 3Q2CA 2E8ZA 2ZNWA 5DLLA 2R0WH 1KIPB 1IGTB 1YMME 4LRNL 2WBJD 3E0GA 4U6HB 1PG7H 5IV2B 1XAKA 5F88B 1IM3A 5KG9A 3V9EA 2GTWB 4PJ9D 2QGDA 4R96A 4ZW6A 4LSQH 2Q2LA 4WAFA 6TAAA 3B2DC 5FYJL 1D2OA 1KCSL 1A5FL 4S1QH 5TF1L 4EXKA 3VRLE 4Z3FA 1BP3B 2PW2A 4JZJC 1NPNA 2YPLB 4OZ4B 3DIDA 2EYRA 2BZDA 1U8HA 2P8MB 5C3IA 5CLWA 4C58B 5I24A 3RL1A 4YN3A 1E4XL 3G6JE 4GUPB 1I3VA 4NRXA 2EKSA 1ZSDA 2WP3T 4YX2H 3MJ9A 3IPBA 2CUAA 5DFVD 1PQZA 3FXIC 4CU7A 3QIWC 3JWNH 1UM6H 1HILB 1NOLA 5E9AA 4HCRH 4UWQB 4QUOA 1L5GA 1TZAA 3W56A 5D7HA 2Y7NA 4BFEA 3O41B 2VLKA 4NOFA 4NGHL 2JB5H 3MODL 3KXFB 1GHFL 3FSAA 4FCAA 4Y9FA 4DKEH 2NY7L 5KS9A 5BO0D 3FOMB 2WZPA 4KKBD 3QEUA 2R9HD 3STLB 4GLRH 4LMQE 4WJ5B 1OPGH 4HK3N 5DEGA 4K4KA 4N2NA 1SNRA 3T04D 4AK1A 2CBMA 5SX5H 3L45A 2GBAA 4JO2L 4M1DL 2AXFB 1QEWA 3R06A 1HCZA 2GJ6B 3TT1L 3BCFA 1HFUA 3QFJA 2C9XA 1CI3M 2LU5A 3ARDA 2V2XA 3OZLA 1QAWA 5F3FA 4CSSA 3WEOA 3O4OB 4FFYA 3GSNA 1A9EA 3QHZL 4MHHG 4NWUL 4TLTA 1DBAL 3GD1C 2PTUA 4Z7WB 3WE1A 4X5QA 1A3LL 4WCYH 1DJIA 2C7FA 3QWRD 4XCNA 3NSXA 4TLUA 2HRPH 5HHVL 4XXDA 5MP6H 2CG9X 1KIQA 2AJYL 4BWTA 2CJ3A 2D7PA 1HSAA 3TA3C 4AKQA 3QXAA 1FL6B 2VDRB 2YPLE 4HJGB 5IJBC 3QJOA 1IBGL 1BPLB 1K3IA 3NJXA 4MMZA 3ML8A 4ZX6A 5EU4B 1NIAA 2K70A 3LNHA 3CSYA 4FQJH 4J3BA 4NO3A 3I6SA 3IAQA 1OTUD 3MUJA 4O02B 3FU5A 3HG0A 4QNPF 5E2JA 3U7WL 3QWNA 3WO3B 1AP2B 1EMTH 1TQUA 2KDGA 1CL7I 3L7EA 4NDMA 3ZQXA 4PRPA 2KHAA 3CHOA 4EZKA 2APVA 1KN2L 2IAAC 1HH9B 5JXAH 3BPLB 2W9EH 1MHCA 4IGBA 4WHTA 1WFJA 1RIVL 4DEUA 8CGTA 3KXFE 5IKCB 3G5WA 2NUPA 3UTTD 1T1WB 3IGAB 2FSDA 2CO3A 2IQAB 3NFSL 2PPCA 2X7LB 3GMPA 1UD6A 2JK5B 4ALAC 4RSVA 2FZ3B 4NKIH 3TIDA 1KB5H 4AM0Q 2K7QA 3OKEA 4Y4FC 5C86A 5ICYA 2OZ4L 5E08L 2HN7B 2YMOA 3NTCH 1FC2D 3CDZA 1CFVL 4EKJA 1FZMB 1CFMA 2C9VA 1KENH 5CD3A 2J1YA 2X4SA 2GJ6E 5FYKH 4WKZA 3SGKC 5D96C 3X1GA 3WNOA 1X5IA 4U3SB 4Z6AT 4N90D 2NYYC 4JANB 4Z7WE 2JI2A 5BW7A 5ALCL 5GS0C 1NDGA 5IVOA 4A66A 4EUPG 2GHZA 4OLUH 4JDZA 3RWCB 1BDYA 2F74A 1CXLA 2BNQD 4PTTA 4YHIB 4KKQA 3OQ3B 1NFAA 2HUEA 3VH8B 1IKFL 3SDCD 2DIEA 2VABA 5IF0A 5EN3A 3O8XA 2Y69B 4NC1E 2WQVA 4MRBA 4UILL 4DAGH 4S1RH 4V11A 5BXFA 1AI1H 4JO4L 2ZOTA 2DTMH 4PV9A 4RQQB 3CFUA 5EN2A 2VDOH 2H6UA 3P77A 3VWKA 1XR9B 2D7MA 2X9XA 1U3NA 1BQHG 4RVBA 1HZLA 3KS0H 1PDKA 2CM5A 1MUJB 4P2RA 4TUJA 4BK4A 2OYKA 1GXEA 4RETB 4H7VA 3NN8B 4IBYA 1Q90A 3TH2T 3GJFK 5I8EB 3I6LD 3MR9B 1CI5A 4J4PC 3O6MH 4TUKL 1TQCC 2VQTA 3HR5B 4FFVC 2BDNH 5IMKA 4Q4EA 2E9BA 5DMJB 3FQWA 1E7UA 1A14H 3EGXA 2EO7A 2A0LC 1HAWA 3W9EB 3SZKC 2DZEA 2RTTA 3DX9B 5I2IA 3HOGA 1XD0A 5I1HL 3MCKB 3SN6N 3T6VA 1TYJA 2NZ9D 2AJVH 2VDQL 3HC0A 3IK2A 4KC3B 4OD2B 3TZVB 3D39A 5A7EA 2YSTA 5C6PB 2ADIA 5DHDA 5LJYH 1IU1A 1HYRC 1EHLH 2XQYG 1KYUA 1RZGA 1KLUB 3QDJD 3GWJA 1S7UA 1UCBH 4B9CA 4DPCX 4M6AA 4K7PH 1TQBB 1M71A 1B0GB 2HFFA 2PETA 4XN9A 2IXQB 2I9LB 4LSVH 3A24A 2BOCB 4KVCL 5IR1B 1CLZH 4L3CB 1JRHH 4PJIA 4UZGA 3VG9B 2P3YA 1O0VA 4NM4H 5C2UB 4YDJA 4F8OA 4E5XB 3PHQA 1IZJA 5I1CH 4OW6A 4QAMB 2FX9H 4L8SA 1FH5H 3G5YA 4M7JH 3ME0B 2AQQA 3P73B 4HUUB 2OR7A 3BZEA 2AGJL 3ABGA 3PF2A 1YLBB 4IMKC 3HJEA 3K2UH 1FGVH 3QJTB 5E51A 4E41B 3MRHB 2W59A 2KZWA 4NP9A 4A39A 4FLHA 1BQLL 4RNRB 5FHBL 4QPEA 4GXVL 2Y7OA 1BBDL 4XNQB 2YEVB 1TYEB 4NZRL 1SLXA 2XZCL 3MA9H 4G1EB 4XZUB 2CHDA 4GAJL 2IBZX 2YSSB 1MWAA 2ED7A 3MV9D 2XHNA 2ZKHL 1IGIH 2XG5B 4M5ZL 3EH2A 4P57A 5LAXB 4Y9CA 3JYBA 3MRPA 3HS8A 3TJEH 4M61B 1SXSA 1TU2A 3VFGL 4JHWH 4DP9X 1IBDA 4JM2F 3DV4A 1J5CA 3SKJL 1HSBB 2VL5B 3PJSA 4A2GA 3WLBA 1ZHNA 5KVFE 3F84A 2VR9A 3HAEG 3KCPA 3NJIA 1V7MH 1ZT4B 5GRXG 3X3GL 1J11A 4CVXA 5F7HA 4MA8H 2HJLB 4N85A 1GW0A 1T2QL 1KCKA 4YHML 1XZ0B 2HFTA 4HU8A 3L9RB 4KQ3L 4YHYB 1F6LL 1RH8A 3FU7A 1LE5A 4LP5A 4TULH 5A2LH 4AZ8B 3T2LA 2RACA 5ESQA 3SE3A 2ATAA 1OCWH 3SPGA 3R8QA 1AGFA 1TMQA 5MI0B 5HHXL 2BSBA 2P1YA 3C2SA 1AOZA 1MF2L 1RHFA 3WKYA 1MG3C 4TN9A 4Y2DB 5IOPA 3CCHB 4JPQA 1UUNA 3T4AB 1KGUA 3GRBA 2VQUA 3VRJA 4G80A 4HMDA 1WBXB 1TJGL 1WAEA 1YNTA 3G04A 4PJ8A 4HMEA 2CJUH 3NQIA 4P2QB 4A7TA 4R4FH 4ZS6C 2WIIB 5CP3A 4QKXB 3RVXD 5E23A 2XWBA 4XCYB 5DXWA 3VWJC 3FCGA 1LK3H 1LEGA 2X3AA 5KYNA 2ROXA 1ASOA 2QGCA 3MNWB 3ARTA 3RTQD 4NNPL 5L2JA 2EH8H 2P24A 3KJ4B 2DM2A 1PL3A 2WVSA 3R4RA 2VUOA 1HL5A 3FN9A 4OY9A 3U46B 2V2WB 2Y6SC 3WG7B 4D9RE 1E28B 2NR6A 4JFFA 3D34A 2NY2D 1E9QA 2WLIA 2CLRA 4A7SA 3RVVD 1H3WM 3N91A 4RAHA 3EFFB 3PS6A 4QRBA 4WWOA 3W5MA 1ADQL 1ZE3C 5FDWA 3QG7L 4DNLA 1HS6A 4ZMLA 1A21A 4L4VD 4MXVF 2CU9A 2GUOB 3BDBA 2X70B 3ASWA 1S7WB 1H0DB 5AAPA 1T1ZB 5D2NA 4E0RB 5L0QC 2BCKA 1J8HD 3FRUB 2AV7A 3H0TA 4TVPD 5KYWB 5C71A 1JPTH 1EFXD 4XN4A 3FSZA 1AC0A 1T2JA 4BUQA 1OGTB 2CDEB 5J3HD 3QNZB 4ZMXA 5DSCB 3E6HA 5D4IA 4ETYA 1S7SB 2A9BA 2YAHA 3NSCA 4PS3A 4DHLA 2D7OA 1Z3GL 4FNUA 5LN4A 4YR6A 4NT6A 5IBTL 2O72A 4O2CA 2E7LA 4CNIB 4XI5C 4P2QE 1AIZA 2AJSL 5EZJA 2AK1L 1V3MA 2X2UA 5E5RB 1UD2A 4K3EH 2VR6A 3KYOB 1NLDL 5D2LA 2DJSA 4YNYB 4GKNB 5IK3A 3UZEA 1OOAA 2QVKA 4MXWH 3KHQA 3VXSB 4A37A 2AAAA 1KBGH 2CXKA 2VLJD 3NCYS 2ID5A 2BVYA 1QVOB 3TO2B 1CIUA 2R69H 1Q4NX 4L2YA 1TQWA 2NZIA 4MQXD 5K1NA 4GIPD 4OR1A 5FAAA 1J8SA 3QPXL 1QSZA 2X6MA 3LS4L 1MCFA 5FM5M 4R0LA 3UO1L 2FDBP 2LVCA 3WTUA 4LCWB 3ZU8A 5LBVA 1JWMA 2CUIA 1CBVH 1T83C 1WGOA 1ZVNA 4PBVC 4O9HH 5D7LD 3BO8B 3OKNB 1TTFA 2NW3B 32C2A 3HPLA 5D55A 4XPGL 5I75B 2R39A 1TZGL 1AKJB 2GQHA 1P84J 2OCJA 5E6YA 4KFMA 3RWFA 1CGXA 2GIMA 4JFZH 1I85C 5C7ZA 1WZAA 1DFBH 4N20A 2MPAL 2VT0A 1RD6A 4S11A 1JD9A 5H2BB 4KROC 1NSNH 2V5RA 5EU7E 3SDYL 1AGCA 3QPQD 1VCBC 3RFZA 3UP6A 2D0HA 4LCYA 5JZ7C 3TEWA 3TEYA 2E9IA 4MAUL 3NIFB 3CK0L 5TPWH 1A6AA 2IEPA 2RHEA 1LVEA 4Y7MA 3VQ2C 1RCYA 3A4DA 4ODXB 1BMWA 5ILTL 1FG2A 5KVGH 4WRLA 4E9QA 3ZTJG 1EWHA 5DD0L 1OO2A 4KJYB 4BQ8A 3TBSB 4G9DB 1NANH 4NO0A 3U4EA 3SE9L 3ZDYF 3QQ9C 4PV8B 1XQ4A 2Z91B 2JKWA 4QTFA 2UX6A 3P3UA 2ADFL 2Y2TA 4P5TC 1NPJA 3REWB 1FVCB 2F1BA 3H7BA 4LXFA 3A67L 3QEQA 2VMDA 4HOWA 4BXSV 2GJZB 2RA1A 5CINL 3ZTEA 4YGVA 5F7KC 4YLCA 4QYOB 1A7QL 4JHZA 4UYQA 1ETZA 5AD0A 4BK8A 4EKXA 4RBPH 5CKAA 1OB1B 3VXSE 1ACXA 4HUWA 4ONHB 4V1DB 2FH6A 3WIHL 1SZNA 3PWPA 4UQCA 1AS8A 1FPTH 3GI9H 1TKWA 3A6BL 4X7TB 5F1NB 1N8ZB 2H1PH 2PCXA 2AW2A 2PXYC 3JWNE 4LCWE 4ZQKA 5IHUL 1NBZA 3B9KA 4LF3B 2VB5A 3N50A 4JREB 2I27N 2AMUA 3D0LB 5I66B 2NY1C 4KVNL 2BXYA 4PRAB 3QRFM 1C5CH 4LHUD 4OCXH 4ZO8A 5L6YL 5IVZA 3TONA 5EBMB 5BJTA 1RZKL 4FF9A 2Z93A 4UTAL 1KCWA 1HE8A 2F54B 1KB5B 2FLMA 2OKMA 4LQFL 3Q8BA 4ELDA 3OSKA 3MJ6A 4Z95L 4OIIL 3QCUL 4MDJA 5L4FA 1UA3A 1U42A 2C9AA 3V0AC 1N5AA 1F18A 2O5YL 3ZE2F 4X7CC 3NIFE 1ZKAA 1OD9A 2IBZY 1C8PA 2ZKWA 1XF2B 1DFXA 4ORGB 1VEMA 2EDQA 2XXFA 2BIHA 2XVBA 3AY4C 4QYAA 3RNKB 4WO4A 4RAVB 2Y06H 1BD2A 2R4RL 1FSKC 3FQXB 3EJCA 1IAOA 3QXWA 5E24E 2H9GA 3RWEA 3SDDB 1NQBA 3ARYA 3KWXA 5TDPA 4Q6IC 3P4OB 2IOMA 1N6UA 3CV5A 4B53A 4EOWL 2GC4C 4P3CL 4WIQA 1DL7L 2ZSWB 5I1JH 3R1GH 3MRCA 4DEPC 1F11A 2IQ9L 4BFIB 4JFOA 4JFDA 4KTDH 1NGYB 1SDAB 3SJVD 1SLUA 2IALA 1HWHB 1M9SA 3OGOE 4OCRH 4YHOL 1NGXB 2DQCL 4POUB 2FX8H 4V1DE 4EI6A 1OXYA 1IKNC 2A4CA 1Y7VA 1BVKB 4Q56A 5E2UH 4KRPC 2VDOB 4PD4J 2C4XA 4FNLH 4N9GA 3GSQA 3JV0A 3SO3B 1K9TA 3Q6FA 3FH5A 2BP0B 1SHXA 1FNSL 3CVCA 1V7NH 2JCCA 1JUFB 1CU4L 5JYLA 1AIFB 4DQOL 1BGXL 2QFRA 15C8H 5D5MB 1CDJA 1OPOA 2BSED 5DHYA 2X12A 4XVUC 3D25B 3VA2C 3RBSA 3BRDA 4HWBL 5A43C 3ZW3A 3DK0A 3N85L 3UG5A 2ZWSA 4QWWC 4E36A 2F54E 4C47A 3KLHD 2YHGA 5HYFA 4NJ9L 4YSRA 1P5VB 2YXFA 4XC1H 1H15B 2B4CC 3WLWC 3CE1A 5D1ZI 1RZ7L 4L3AA 4HXAL 4AQAA 2L0DA 5G5DA 3L4WA 4B7LA 4L37B 4RZCA 1TVBA 5DYOB 4NUMA 2EDJA 4U1HB 1DBMH 2XQBL 3A22A 3MLXH 1MFDH 4QRRD 3WGVB 3L3GB 4Z7NE 4FXKB 1OD7A 5I18H 2R56H 2EILB 1I9RL 3BDYL 2IMNA 3UTSA 2VRQA 4O5LH 4WU5A 4TF4A 5ETUB 1PZ5B 5LNEA 2X4OA 5C6TH 3T0VA 5CGMA 4K9JA 1U8CB 1R47A 3KGRA 2ZX8A 5E00A 5LG6A 1GPOL 2WGXA 4FI7A 2XZQL 1KN4L 3O6KH 4RBPK 1TTGA 3L3DB 1AHWA 1F56A 5GGUB 1QLRB 1MFCL 4FA8A 4U1KB 5B39A 3DJRA 3MRMA 3LB6C 1NIFA 1LNUB 4I2XB 1BYOA 2F15A 4PRHB 3LXUX 4JKMA 4H0IA 3HZVB 4PGEB 2FHFA 3ULSA 3QXDB 3BKMH 3P2TA 4WWKC 3HN5A 2DQGH 2EXSA 2J21A 5EU3A 4OB5H 1DBJH 1NUGA 3FCTA 1XL6A 3DX6B 2OK0L 1EDQA 1E4KA 2VDKH 2Z7UA 1V54B 2VN5A 1NOFA 2YO3A 3QG6B 3QUYC 4RFOL 3ZT6A 5J0BA 1E3XA 2P26A 4WY7H 2WN3A 5CR8A 5LBGA 3UH8A 3PWUB 5D5ME 3C60A 2IDSA 4WUUD 4BWUA 1Z5HA 1T0MA 3NJMA 4UDTA 2R59A 3FUDA 3BD5A 5I74C 1JJUA 2V3EA 4L4TD 5J13C 5DMGD 4B5ZA 1ONQB 3TVMC 4LRIC 3NSJA 5E5MB 4NLHA 3SE8L 2DQEL 2BWDA 5BS0D 4LVOB 3VMOA 1SBSL 2X53A 2XC8A 3LQAL 1JXKA 3WFZA 5HHOB 1AZUA 3KPMA 4LRNH 3EIFA 2VC2L 4FTVB 4C56A 3K5SA 5DYFA 1D5ZA 1M6OB 4AQ1C 5IQMA 1RVFL 2J1KA 5FYJH 1OKEA 1KCSH 1A5FH 4RMUA 2F2HA 2JJUA 4XMUA 1E8YA 1MCDA 1P5UB 3NEXA 3PGFL 4YSDA 1B9KA 4WV1A 2TRHA 1TZIA 4PJXE 5CJBA 3N44F 5B22A 3R7RA 2NXYB 2B39A 1DUZB 5D1ZA 1S5HA 1JNJA 4J3OF 1AO7D 3AXLB 3LEVL 1E4XH 4JG5A 5EBLA 2ARJB 1SDDA 3V4UL 2FEDD 5DC4B 4GG6F 4I2XE 3QB7C 3DSFL 4PRHE 5CLZA 1JHKL 4ONGL 3CFEA 1KGCD 4QXTA 3QQ4A 4Q97A 4NGHH 3KPSB 3SO5A 3MODH 1XSJA 1GHFH 3EGDA 4W93A 4YFLF 3FTSA 2NY7H 4LEOB 5EH1A 3X17A 5IMOB 4HKBA 2QQLL 1FNEA 5ABDE 3QHFL 4AIZB 1J18A 4MFHA 4XWOC 1DCLA 2GCYB 4UM9B 5FO7A 4X42A 1KT2A 1N5YL 3QGVA 2ROYA 4NO2B 1CDUA 2FWUA 4KKPA 5EIQA 1W8OA 4R9HA 4M1DH 2QR0A 4JO2H 5C09B 3H4FA 5DD3L 2DD8L 1LLAA 3DV6B 3QJHA 2CIKA 3IMVA 3Q13A 2M2DA 3Q44A 2L3BA 4PTUB 3O4LD 1QWHA 3EJRA 3OB0H 3QHZH 3ZKQD 5HHOE 4AM0A 1DBAH 1TZHB 3ATBA 1A3LH 4FTVE 1MFEL 2RGSA 2OJEB 4FFYL 2PPFA 3GSNL 3C12A 4HUKB 1KTLB 3F01A 5HHVH 3AG4B 2AJYH 3S36L 3UTZB 1OANA 1HHGA 2L7QA 1IBGH 4R7NB 1G7QB 4PYGA 2AJUL 4Y16B 3ETBJ 4MD4A 4IRJC 4P9HC 1TJHL 1PCXA 3U7WH 2CO1A 3PWLA 2APXA 5HHNB 2K8MA 4LARL 1F1AA 1KCVL 5DRZA 2EE2A 5SX4I 5B8CC 1KN2H 2H2PD 2YD7A 3NQKA 3JYCA 4PJGF 2R8SL 2Q3ZA 3T2PA 3UEQA 1GW6A 1RIVH 1O6TA 3OQRA 3KPSE 4HT1L 4NZUL 2WTRB 2R1XA 4OKVB 3NFSH