2YOAA

Synaptotagmin-1 c2b domain with phosphoserine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphatidylinositol 4,5-Bisphosphate Clusters Act as Molecular Beacons for Vesicle Recruitment
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords SYNAPTOTAGMIN-1
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2yoaA00
3CSTA 4BFRA 1BYNA 3LJ3A 4KZ0A 1V27A 4A55A 3ML8A 3TWYA 4F1SA 1WFJA 2DMGA 3FDWA 2ENQA 3NSJA 4Y1SA 4XX5A 2FJUB 5H4ZA 1UGKA 3JZYA 4DK5A 1UOVA 2WXGA 2CHDA 2ENPA 3F01A 1TJXA 3HN8A 3NZSA 4NPKA 2WXNA 2LHAA 3L08A 3QJZA 4JPSA 2V4LA 4ICWA 4ANUA 1E8WA 3ZVVA 1DQVA 3P2BA 3KWTA 3W57A 3QR1A 4WWOA 3R7RA 1DSYA 4L1BA 3L9BA 4IHBA 4PS7A 4AJWA 2CJSA 2N1TE 2CM6A 1DJHA 2R83A 3SD5A 4TUUA 4MJJA 3B7YA 4L2YA 3FBKA 3TL5A 4L23A 1A25A 1DJXA 5CCJA 2Y3AA 4ANVA 4NPJA 1WFMA 3HHMA 4F93B 3OAWA 4ICXA 4Y1TA 1TJMA 2DMHA 3M7FB 4KZCA 4AOFA 4XE0A 2WXJA 2D8KA 4EZJA 2BWQA 2WXFA 4WWNA 2CJTA 2CHZA 3L17A 4FJYA 2Q3XA 4HLEA 2YOAA 2WXMA 4J6IA 5EDSA 2Q0ZX 1E7UA 1YRKA 2WXKA 4GNKB 2B3RA 3DBSA 2K3HA 4FULA 3QR0A 2WXPA 3APFA 4BGDA 4TV3A 4ANXA 4URKA 2A4ZA 1W16A 4QJ3B 1QASA 3APDA 4LDCA 5CCGE 2NQ3A 2WXRA 3F04A 2WXHA 5KJ7E 1CJYA 4WWPA 1DJIA 3HIZA 3IBEA 3IM1A 4FHKA 3L54A 3PREA 4XZ4A 4L1LA 2Z0UA 1UOWA 1HE8A 1E8XA 1DJGA 2YRBA 4FADA 4G11A 2EP6A 3OHMB 4GB9A 1K5WA 5H4YA 2A5UA 2ISDA 1E7VA 1E8YA 4WEEA 4FA6A 4OVUA 3APCA 3ENEA 2K8MA 4EZLA 4F92B 1BDYA 2WXQA 1RH8A 2CHWA 2RD0A 3R7QA 5JHAA 2KI6A 1DJYA 4QAMB 4PS3A 5G55A 4V11A 5T8IA 2QZQA 3W56A 3QK0A 3S2AA 2X38A 3GPEA 4FLHA 4NS0A 2WXIA 2CHXA 1DJZA 3L13A 5G2NA 5CCHE 1BCIA 2FK9A 2NSQA 4QJ5B 3F00A 1DJWA 2CM5A 3QARA 4ANWA 4F91B 1QATA 4OVVA 2WXLA 3N5AA 3PS6A 1RLWA 2K45A 3L4CA 3QAQA 4FHJA 4IQHA 3PFQA 3PYCA 4QJ4B 4NP9A 2QZ5A 4EZKA 4DNLA 2ZKMX 4LCVA 3ZW3A 3KWUA 3RPBA 4HVBA 5JHBA 3TJPA 2ENJA 3L16A 3T8MA 3ML9A 4KITB 2K4AA 1E90A 2UZPA 4FJZA 4PS8A 3MJWA 3CSFA 3F05A 3DPDA 1GMIA 1E8ZA 4LT7A 3RDJA 2NCEA 2WXOA 3ZIMA 1RSYA 4TS6A 1W15A 2JQZA 4WAFA 3PRZA 3NZUA
chains in the Genus database with same CATH superfamily
4LRIC 5TDPB 3CSGA 2NY4B 3IGUA 1IGTA 3HZKA 1JYWA 1PAMA 3M1BB 4H88L 5SWZB 5CJOH 5HYFA 4PLOB 2EVGA 4MB5A 1LD9B 2I60L 2C3VA 1J1PH 1T0NB 4RMSA 1A3QA 5E6SB 5CJXC 3FN3A 1IAII 1DVYA 3RY6C 2DLHA 4LLUB 3MN8A 1BXUA 1JE6A 1MG2C 2EE9A 3APMA 4ICWA 2NY1C 1NDMB 4X8XA 1WWWX 1F3DH 5BZZA 5JO5A 2V2TB 1DQIA 2IPKA 4OM1L 1OW0C 1DBJH 2BIIA 3GZQA 4O4YH 1FYHB 3C08L 3F2LA 3CZSA 1JAEA 4HW6A 2ZWZA 3V4PA 1G1CA 3D08A 1D5ZA 4JG5A 5IHUH 4WO4A 1SHWA 1MCLA 4NKMB 3V4VA 1PS3A 3L3JA 2CJ3A 3KWVA 2WTPA 1AQKH 3V7AE 5L9DL 1F4XL 4Z7UB 5GIRB 3L1OL 4XBMA 5F0JB 1RFDL 4XCNA 3RILA 3U9UA 2AMGA 1JZ4A 1WVZA 4DGIL 2G5BA 3FQWA 4DPRA 2HT4D 1AO7B 3EZJB 4JL2A 2ZAHA 4MXVE 4OBSA 2Y5EA 4EI5C 4HS8H 5C0JB 3CMOH 3QR0A 2H6PB 4IGBB 5HYJB 1JGVH 1R5VB 1IJ9A 2EC8A 4J1UA 4FQLH 1HQRB 4JM2A 2OK0L 3RWFA 1ERNA 4PR5B 4UV4H 1Z6JT 2BY1A 3K8MA 1HEHC 4AMKH 3VYOA 5ISZB 2Z6FA 3UTSD 5IBUG 2DLTA 3OB0K 5AENA 3CZNA 1DBMH 4OTXH 3CFEA 5KANI 3P9LB 3VCLB 4DW2H 1PD6A 4OV6F 3K72A 1JNHB 2KC0A 4WJ5B 1P5UA 4ZUUB 3O0RL 5DO8A 2IC2A 1GGYA 4DVRH 2DKMA 4XP6H 5ACLA 1MJJB 4H25A 5B8CB 2XJKA 1UASA 4AMWA 1NMAL 1SLWA 2P26A 4J3OD 4LF3B 4QRAA 1UD3A 3A67H 1A9EB 3NIGE 3D18B 3W5MA 1CL7H 1CVRA 3QCUL 4CA4A 1A9BB 1XDTT 3G6DH 4NBZB 4RFEB 1SOSA 3KPLA 3WFEL 1BQHG 4GP5B 4XGZB 3WFCH 3ZIYA 2YPVL 3LN5A 3N9GL 5IFAH 3NBNA 1YEHH 4WTXA 1CU4H 4Y9CA 3RAJL 4OI8A 2NUPA 3NT0A 4AUJA 5AVSB 5F1KC 4K3GA 1UQSB 4JVUA 1ITBB 1HIMH 3W37A 5GRVL 3I9IA 4KITB 2PW1A 4QO1B 4I5BA 1MCNA 1PMYA 3CSFA 5ICXA 4I0CC 2VR7A 1MCWM 4GUCA 2LAGB 4PSPA 1RZIB 4M7LL 1I7RA 1WBXB 1AC0A 2RHEA 3MUHL 4PJGE 3UYRH 2I07B 2WCSA 3ARWA 4ZMZA 5BW7C 5DYFA 3VD0A 2YD0A 5I0ZA 5HHOA 1LEIA 5H4ZA 3KCPA 4N2FA 1M3JA 4PBVC 1O6SB 2PYED 3FT2B 5D72L 5F7MC 1HXKA 3FOLA 5IQ7H 4P07A 3H2QA 5C08A 2I07A 4G8GA 4JRYA 2UZIL 2B7DT 4E42B 1KUMA 1E8WA 3QULB 2CG9X 2BWDA 1QUPA 4Z7OB 1OTUC 1T83C 5I1JH 2D31B 3QNZA 3RPIA 1HYSD 3W0WD 3L9YA 4I5BB 2VLJE 2N7SA 4IRSC 3V95A 3SQBB 4ATTA 2OQJB 2V3FA 4ZTEA 4IRSD 1Z9MA 2A6IA 1BOGA 4Y2LA 3QFDB 3ABKB 3SE6A 5EBMA 2YLHA 2K7QA 3NSXA 3DMMD 2Q3XA 3NCCB 4KTYA 4X7FC 2W88A 1Z3RA 3O3UN 4ZW6A 5T5FA 4Z3TA 4EDWL 2GBAA 1YEEH 1KLUB 4L1DA 1HNYA 2R69L 2UV3A 3MLVL 2ZP8A 3VFTA 1LO0L 3BVNB 1RJZA 1USQA 4IBZA 2KH2B 2PW2A 2X4UA 3E3QE 5JXAH 4XXWC 4BWWA 1OTSC 3ZE0F 5L6YL 1FZMB 4JFDB 1UCBL 4TN9A 4OLXL 4Q7DA 4PTUA 3RIAF 1FHGA 1ANUA 2VN6A 2AJVL 3B5HA 3AACA 3C5JB 3WI9A 1T2QL 1OQXA 1P1ZB 2DKUA 1G7JB 4NO0A 1W8EA 5E24E 4UI2A 1XAKA 3QUHA 1ZHNA 4UNIA 3HNTL 4RNRB 1ZVNA 4JDTL 4GFTB 1JTPA 5FB8A 4Y1AB 4BEIA 3MV8A 4KK9D 4O2CB 2EE6A 4R90H 3LZOA 3X14B 4KTEH 1WIPA 3QFJD 1FRGL 2G5BB 2RAMA 1NAKL 4X9IA 3QRBA 1E67A 4XWOD 5A2JH 1R3LB 3S5YA 4PJDB 1L6PA 3TH2T 4KKQA 5C2UB 4HGKC 1LP9E 2ZXCA 5EF2A 5CGBA 2YXWA 1J0ZA 4JDEB 4LESA 3T3PF 3ZL4H 1WLHA 1Y1DA 1LK2A 1NCWH 3QQ4A 3OR6B 5IHWA 3FONB 3ZL2A 2FX7L 2X1XR 2JWYA 2ZX8A 2V9QA 4LL9A 3NFPB 2ENQA 3HI1A 4NQEB 2C3VB 5DFVC 1JXKA 3MGTA 5CLZA 3ULAB 1MH5B 3SKMA 3G5ZA 3NFNB 3OKEB 3QG7H 4JKKA 1MHCA 2NNAB 5AW4B 2APWA 4WEMB 5HYQA 3HN8A 3RWDA 1I4FB 4BFJA 5I1AA 3MGOB 1YEFL 3QJXA 3UTQB 1EMTL 4I2XB 5TH2B 4M7ZC 5I0DA 2NZ9D 3VUAA 4GI6A 2FX8H 2VJ8A 2VR3A 4XCEB 1XF4B 4MNQA 3SO5A 1UWGH 2XWTB 3HW7A 2CM6A 3MLYH 5C0CE 1BM3H 3HNVH 2OR8A 4QLWA 2HKHH 4AYMC 2Z9TA 2AEWA 4DKFH 2CO2A 4NFBA 2J21A 1ECYA 1ED3B 4JRXA 1PZ5B 4AV4A 4WI0A 4LU5H 4CDGC 4HZLA 1J11A 4GNKB 4P2QB 5LAPA 1KGUA 5M95B 4ZMAT 3R0MA 2NY1D 4JG0L 1Z66A 3II2A 1HCZA 4E9VA 1RJCA 3HCVB 3FT4B 1ASQA 5DUBB 4PD4J 2DWTA 4BHUA 4LBEB 4ODHH 4HJJL 3WHXA 3A6BL 3GHEL 2WWMC 4BFIB 3ZZSA 4PMEA 2AJZA 4KVNL 3MV7A 4HULB 3W1ZA 3MJ8A 4M4RA 4FTDA 2DEYX 2H32A 4FA6A 2K3TA 1Q94B 3N42F 3UPRA 4F92B 4LBEA 2VQ1B 4L3ED 5DVMA 1OP4A 7PAZA 1E4HA 2X4RA 1PAZA 1USZA 1BLNB 4UV7H 5DUBA 4EI6A 4HUMB 1J9QA 2LV4A 2YC1A 1BQUA 4PCYA 1LWHA 2VO5A 4S2SB 1MW3A 2ZKYA 5I1LA 3UGXA 2F54E 1F11A 2DWSA 3ZO0A 1J5CA 1QHQA 5LN8A 1KELL 1NBVL 1H15A 3OMAB 1E40A 4W9IC 4JRXB 5HDQH 4ONHA 3ZDYF 5EO0B 3HG1E 3MLUH 2BJMH 1KCKA 1YYLL 43C9B 2D3NA 2AK1L 2PR9A 1KTKE 3WN5A 3WDIA 1OGTB 2EXWC 5FYKH 4J3TA 3G6JB 4AGMA 2E7LA 2HJLA 4E5XB 1J18A 1I3RB 3RGBA 4IIQC 4WKZA 2G9HB 3KHQA 1IKFL 2YAPA 4M02A 4KKBD 4N24A 5T1LA 2GG1A 3ESMA 1AOHA 3Q48A 3BD4A 4XWGL 4CC4A 4OLYH 2YPVA 3D85A 4TNGA 2CR6A 5AW3B 1NC2A 1G9HA 3T0EC 4MVBC 2J44A 5FK9B 3ZHDA 4YVNA 1ZAGA 3D0VA 2PF6A 3G5ZB 3NFNA 3SKMB 5DRWB 4OV5A 5F9WC 3CTTA 1U36A 4GAAA 1Z0MA 2DBJA 2IDSA 3SDXA 3RDTD 1WHOA 2UWEE 1EH9A 1WAAF 4PW9A 3ROLB 3WUWB 4MDIA 4O2EB 5IB4A 4I9XA 5GGVY 3OZ9H 1JSYA 1U30A 1H8LA 1J87A 5BZXA 1XSIA 3IDUA 4YNYA 3TOPA 3Q3GA 1TZIA 4B3VA 3GUTA 2N3JA 3DIFA 3GYRA 1I8IA 4FCAA 4XP6L 2R2CA 1PG7X 2WWNA 4QRPA 4XO4A 2QGEA 5GXBB 3VRLE 4Y2OB 5J1SC 2IXQB 3V5DB 4E9QA 3K0WA 5HBBA 2CHZA 4Z0XA 3OWRA 1L7IL 2E6QA 5GGSA 3PWPA 2Y5QA 4LEOB 1A22B 3B37A 4OH2A 2OMZB 1AXSB 1X4YA 2DF3A 1D7FA 4UM9A 2VDRB 3I6LD 3BW9B 4B50A 4M61B 1PKQB 1NMBL 4LPTA 3TBYB 4OZGF 4NDMB 5D1QA 1ZEAH 1U3HD 1O9ZA 4HGWA 3CFQA 1FBIL 1TTAA 1EHKB 4NZUL 2OL3H 4PWGA 4QGTA 4EDXB 3BH4A 3K5SA 4WEEA 2PW2B 2GBVA 2P8MA 4JR9L 2VZTA 5DHYB 2L4OA 5E8NB 4WY7L 5HHOE 1OKEA 1XGPB 3ZGIA 2DTSA 4XMKL 4HWNA 2G60H 1A6WL 4ODVL 4JL1A 5INDB 4OD3H 4OZHF 4RIRA 2EDNA 1WSST 4JFOA 1FV1A 3QNYB 4F15C 5KVDL 3ZU8A 4OGXL 3TN0B 3VU2A 1DJWA 1WZLA 4UQAA 1RKRA 5DZNA 4F7PA 2H8PB 4HU8A 4JFED 3ES6B 5CIPA 3FYEB 3BESR 3LD8C 4X9YA 3X12A 5A2KH 5GISL 5FGCB 1YMMA 4ZD3L 2A83B 4FABL 5DQDL 4ZAKB 3VXOA 2YGQA 4EIZC 1LLAA 3LNEA 1SEQH 3EUUA 2DM3A 2CCLA 3ILEA 1FVEB 4KKZA 2IO5A 2WNXA 1AE6H 2HX8A 2F1EA 3FT0A 5DR5H 4XPGL 4CL7A 4O2FB 1L0XA 4YZFE 1G9EA 1UWYA 3V4VL 4K2UH 1EO5A 3L7EA 3GXMA 4N8VB 4YBLC 3TH3T 3VXME 4KK5D 4E36A 5IB2A 3F7PC 2VO8A 3MRNB 1R33A 1SY6L 1AZUA 4BE5A 3T08A 3P1VA 1I9JL 2BP0B 4L8BB 1DQJB 4L4VE 2Q8BL 4FQJL 5H37G 1MI5B 3WHE1 4APQD 1TR7A 3MRNA 4DHLA 4JPSA 5HGAB 2Y4SA 1SFDA 5JOEA 3RPKA 1WBXA 4KU1A 2YSTA 3H9ZA 3RBGA 3UPCA 3FAXA 1WFIA 1YNLL 5GHWH 4OLWL 5KOMC 3UDWC 2WAHA 2WO2B 3SY6A 2MKLC 3C5XA 3RTLA 4CMHB 1RHHA 1KB3A 2COQA 3IPFA 1KCLA 2JKTM 3GMNB 2D2CC 3EYUL 5DLLA 3BKJH 4LIQH 4N6RA 4WNSA 4AYFA 1QVOA 5FC9A 5AAMA 2QELA 1M2VA 2PCPB 3FUFA 3S4SG 4ES9A 4Z78A 2WTRA 2DQIH 3MO1B 1F3JB 1SJHB 1BAFH 4N3TA 3O2VH 1E2VA 3WKQA 2Y2YA 2UY7A 4C54A 1KB5L 1XGPA 5B1CA 2RCSL 4YLBA 2H1LM 3S8GB 2Z8SA 4RRPA 3SE8H 3WJLC 3LS4L 4W9JC 2YD9A 5F7EH 3QDJD 4WHYG 4MXWL 1DUZA 5K1JA 3BZEB 1HINH 1DJGA 1LEKB 3I6GB 4PJFA 4TSAL 4EDXA 1MAMH 1ITCA 3RWIA 3T0DA 3KCWA 3OZKA 4XAKE 4B7LA 2NX5D 5I5IA 4M29A 2WNKA 4G6KL 2XBTA 1SLVA 2ZOKB 3RTQC 3PGFL 1HI6A 2EABA 4NM4H 1K8IB 4ZX5A 2AMUA 4M62L 4NC2B 2DQEH 5T8IA 3BZFB 4N28A 2DIJA 1S7SB 2AK4D 3F6JA 5KANG 2XI9A 3O6FC 2AGJH 4JO3L 5A16B 1Y0LB 3GPSA 2CJUH 1EAQA 2WKGA 4GS7B 3FQRB 1E0OB 4XNXL 4KXZH 4I88A 2WNWA 4Z0XB 3WBDA 3TIDB 5D1XC 1IV8A 4D8OA 1NEPA 5F7EL 3JV6B 1GYWA 1P9MA 1D6EA 5I6LA 1E90A 3DA0A 4OU3A 4G3YH 4Y16A 3DIFB 2DM2A 1E5YA 1Y1UA 3HZ3A 2EYTB 4RWHA 3VGHA 1VZIA 3NSCA 1AR1B 3GXFA 1EX0A 3JUZA 1OCWH 3Q6FA 2H1XA 1HXYA 1KXQA 4FQ2H 1MRCH 4N0UB 3FSVA 4BFRA 3US9A 5DJCA 2DMGA 3I3DA 1MREH 2DJUA 3VFSA 2PCXA 1Q4NX 3PWPE 2EDMA 1FO0L 2VLKB 4PJXF 3X2QB 4FQXD 2F58H 5FM5M 2WXGA 4M8RA 1QBML 1ZLUH 3FPXA 3LRKA 5IQMA 4OLWH 2K9UA 5DXWA 1OSZA 4FNLL 5CEZH 1CE1L 3UGUA 1I1AA 2VMFA 4LKXA 3IJHB 1ZTMA 1J8HB 1ETJA 3G6DL 4KAQL 2BW4A 2ZG3A 3PAZA 4KRPC 4FFVC 1HXYB 5DMGD 4F7TA 2AKRB 5DHVB 1E43A 1OXYA 1LQSR 2EYTA 2VLJB 1IARB 2VXUH 4G8IA 3SD5A 4AUYA 2D7NA 5CJ5A 2E76C 1FYTD 2WUCL 3M6DA 1YNTA 3ECBA 1C8PA 1QFUL 2B8OT 2R7EB 1CN4A 4PLJD 3SE9L 2FWUA 4ZSOB 3MSPA 3ZL1A 3QBTB 5T1JA 1AHMA 4Z7NE 3MNZA 5TE4H 4Y5XC 2F5AH 5LXGH 1N12A 3T0WA 3ZTNH 2YXMA 5D1ZB 1D5RA 2KLTA 1AE6L 1HKFA 4WUKL 2KZWA 3TBTA 4QWWD 2IGFL 2FR4B 1HHHA 1R3HA 5D4JA 2FJHB 1MCPH 3IKCB 1Z2KA 3EYFB 3FQ2A 2F9BT 1Z9LA 2NQ3A 1HILA 1RK0B 3T0VA 3VD1A 1I8LC 1BAWA 1CICC 3FTYA 1UZ6E 1WBYB 2DJMA 4PS4H 4RFNB 3VXPB 4HQQH 3ZTDC 1PDKA 5HXMA 4HKXB 4N2CA 4ABVA 4P48A 3ENEA 1OHZA 1SEBA 1ZK5A 3LYRA 3V55A 4AEHL 1U8KA 3I50L 3FO1A 2R0ZH 4H5SB 4MDRA 4YSPA 4N2BA 4FG4A 2LQRA 3O2DA 1F6LL 3PLYA 3CVHL 2F5BH 2WKLA 4GXUN 4AG4H 2UXTA 5E99L 3TYGL 3MO1A 1U3HA 2B9BA 2DM4A 3DIDA 2WTRB 1IQDA 4OZHA 2BVPB 3RWHB 5F70A 4DVBB 1N2RA 2V33A 3D05A 1E9OB 1TTGA 3R4DA 4Q6KA 4Y4HC 2WW8A 2EYSA 4N0YH 4LOFA 3DX8A 3DMMC 3ULUC 1EGJA 1BJMA 1JNLH 2Y0SA 4YWGL 2R69H 3MLVH 2K4AA 1ZGLB 3HA0A 1UURA 3CLFH 5GGQH 4W9GC 4LMQE 3RHWF 3F05A 3HMXH 1QQDB 1EZSA 3PUUA 3MLTB 3REVB 1LK3H 4O02H 1V5JA 4UTCA 1MCDA 1TPXB 3SE4C 2OXGB 4S1QL 2EQDA 5DHVH 4BA8A 4J7RA 4DGWC 4I2XA 2ZCZA 4XPGH 1GHFL 3Q06A 1OSZB 4YHZL 3CX5K 2X4NA 3CXDL 4ESKA 3INUL 3OC8A 1ZGLP 4HH9A 2IWKA 2X2HA 4XMPL 5BRQA 1BG1A 5LG1A 2YKKA 5LGJA 2D03L 4XMWA 3D1MC 1FVCB 3DKHA 2QSTA 2K1MA 2JJWA 1IM3D 3ISYA 1JMXA 4IBUA 5TK2A 3D33A 1SVCP 3BN3B 2Z91A 2JJTC 3HFML 3ILQC 4XXDA 2IFFL 5D5MF 3HZYA 1PSKH 2KBGA 3NDZE 1QBAA 3ZDYB 5EUOF 3VQMA 2Q20A 4S0TD 5I16B 3UTZA 5IQ9B 1CLOH 1HZHL 2C3XA 1R3LA 3O4LB 1FJ1A 2AXFA 2DMHA 2XZQL 4HJSA 2BDNH 4TPRL 2IBZY 1YEDA 4HEMA 1Q90A 4DGVL 2VXTH 3OHXA 25C8L 2BOLA 5JLZB 1HL5A 4CMMA 1T2JA 4IBLT 3QNYA 5ABZA 3V4PH 4U6YB 1DE4B 1UD6A 2FBOJ 2C1PA 5ITBH 1XR9B 2A4ZA 1L6XA 3UP6A 2FL5A 3T09A 1JZ5A 3TZVB 3SB3A 2WZAA 4JG1H 3HE6B 1IGCL 4NZTL 3P0VH 3FQTA 3O6FA 4J3OC 4JHWL 4CN4A 4HUUA 4DF9A 5C3TA 1CI3M 3KYAA 4H13C 3U2IA 2AV7A 5L4JA 1FNAA 1FZMA 1J9CT 3LVTA 1BZQK 3I6GA 4PJFB 1LEKA 3P4NA 4TL5A 2A2QT 4H26A 1LDPH 4QLRA 1TFPA 1S7TA 3O6FB 4M61A 4XN2A 3SE9H 1BPVA 3BIBX 3H9SE 3RWEA 2ZXDA 4X4KA 4NUQA 2NW2B 3TZVA 4WI2A 1IAKA 2WLHA 4UZGA 2OMZA 1KJ2L 2R1WA 1JPFB 3LNFA 1DUYA 3U4EB 4TQHA 5E9DA 4H0IA 4F9PA 4N90E 3CBJB 1WTGT 4HPOH 4KFMA 1CR9L 4X4ME 4XVTH 5E1HB 3N5AA 5EBMB 3QW9A 1DEEB 1GZHC 2BVQA 5AW7B 1GOFA 1CT8A 3HS0B 1WS7A 1C7SA 1TKWB 4CU6A 1C1EH 3HZMB 2FEEL 5JPNB 5CJXA 3T8MA 2OQJA 3BVWA 3SQBA 1QI4A 4NJ9H 1JVLA 4NBYB 4UM9D 4JO1L 5EEWA 4K8RC 1Q9WA 1RVFH 3L6FB 5C0AE 4B0MM 3FYIB 1BAFL 1OOAA 3PWUA 1S8DB 1OW0A 5KYWB 4O00A 4XMUA 2VDPB 2W60B 3QUYA 2C9AA 1LTXA 5HI5C 4OCXH 1CICA 2XV2A 5FO8A 3ZR5A 4MQ7B 4IRJC 4KY2A 3FUJA 1JPSH 1OCWL 4RQQA 4OF0A 4XO8A 1CLOL 1AQKL 5L9DH 4GIPD 4R2GC 2NXZC 3IU3A 2HLAB 2Y7QB 4J3OH 4UT9H 4MBOA 2RFXA 2JCWA 2WUBL 4A2FA 3GJFA 1U92A 4GRLB 4PJDF 3WNOA 1LO5A 5JOFB 3D85B 4TUJA 3GSVB 4TSCL 3GSUB 1T1YA 2PMZA 3IFLH 4O2FA 2IBZX 5HHVH 4J3XA 1P7HL 4JFWA 3ARFA 4JN1H 4NRXB 3TO4C 5BJTB 4OLUH 3B43A 1E2ZA 4JHAL 3MLWL 3L5XH 3WS6C 3ZDZB 5K59F 4B9KC 4XE0A 1TMQA 3IFOB 4JKWA 2WXJA 1U6AL 1MFEL 4ZZKA 3KPLB 4RFEA 5HPMB 3IXTB 5F0MB 4WEBH 4OJEH 5DA0B 1NCAL 3SE4A 2XBZA 3D18A 5I1CH 5E6ZA 3C8HA 3J8F7 4OZHE 2NYZA 2ZOTA 1CF8L 1MCJA 3LS5L 4N4YB 3OKKA 3RVTD 1KTLB 4UDUB 3WKPA 3FTZA 5JMOC 3FO1B 1E65A 2FEJA 1F02I 1UXMA 1JZEA 3UPRB 4M1GH 5GRUL 2ATAA 1EXGA 1KB9J 1I8LA 1IC7L 3DNKA 3QEGH 1UFGA 1BZ9B 4Y5XB 4K15A 4IU2A 1G6RH 3GJFK 3US1A 1R17A 2BFVH 2AJZB 4JFQB 1SLXA 2BOBA 3OB0H 4MJ6B 4WHYH 2AQNA 4P2RE 4IOFC 1HE7A 3S48A 1YJDC 3FQUA 3L2LA 4FNQA 4JFZH 1HZLA 5KVFL 4UIKH 1AXSA 4KRNA 1QSFD 1FFPA 2FWSA 2L04A 1DL7L 3IMSA 4IGBA 5DVKA 3VFGL 1T20B 5HYJA 5HHPB 3FTWA 1WUZA 4LEOA 3DTUB 3L3KB 1IB5A 4KRPB 3PWPB 1H3WM 4AXWB 4OLXH 1MQKH 4EN3D 4YSUA 5J0BA 4QHKJ 5IT2L 5A40E 4F91B 1FG2B 5ITFB 5JR1L 1ZEAL 4G7YL 2FD6L 4TRPL 2E9JA 4KNUA 3HMWL 4LP5A 2L7EA 3U7YH 4EI5A 2WQVA 1YNTB 4IKLA 2B1AH 2GBUA 1I9JH 2HTLC 4G8IB 2FT8A 1NGPH 4XCCL 1ZTXE 2CBTA 2OMUB 2VW6A 2R4SH 3OPZH 4AQ8C 4LAQL 2Z7UA 3RL1B 1JF6A 3HBZA 4RGNC 2IPKB 1CD1A 2X3AA 4G8FA 1MCOH 3FJTA 4MDIB 2HJFB 4JRFA 5I5JA 4MCYB 5ANMA 3STLB 3CSYA 1YYCA 3EDJA 5HYQB 2PPCA 4XI5C 3SDXB 2YBRA 3NSJA 5I1AB 4JFEE 1R3JB 3WE6A 1MH5A 5DRWA 3HRZB 2H1PL 4LVHB 4MCNA 4OV5B 3BRGC 4LLAA 4QXUH 2VJ0A 1KBKA 2WXNA 3A6CL 3VQLA 1WIUA 3DROA 4BFNA 4QRFA 1DANT 5HGDA 2ZCKH 4OFIA 5KSUB 5E08L 2JELH 3FN0L 4YHKL 1IBHA 4XMTA 4GQ9L 1JK8B 4YXKL 4FNLH 5CEZL 2PYEA 4OCMC 2P47B 2AQTA 5J7CC 1JPEA 4GSUA 4ZTPH 4F7CA 1OGTA 2J1XA 3ETSA 1FO0H 4K9EC 5JW4R 2LU3A 43C9A 1DJXA 1F18A 2NY2D 3EYVB 5F7NC 1MFDH 2A9ML 4DN3L 4S1DD 1FNEB 4ONHB 2ENYA 3VMOA 3BXNB 1B0GA 4EE2A 3TIDA 1G7MB 3EH1A 4WU7B 4G83A 4YO0A 3EF7A 1QRND 1Y0LA 3MV8B 1DVQA 1AQDB 5IK3A 4W4OA 3NAAL 4U05A 4MA1B 3QEHB 3MRLA 4H1LG 1IEHA 3E1F1 2IV8A 3OF6A 3QORD 3VXSD 4U0QB 1BZOA 1XZ0B 5EMYA 3OMZA 1OE1A 4K3HA 1B4RA 4J4PA 3CVIH 3PREA 3T8VA 1UWEL 2VXQA 3KJ6L 4XN4A 4CC1A 4C4KO 1D9KC 5F9JB 3T6WA 1M1SA 3IJSB 3WO3B 2BZCA 4UU9B 3QQDA 5IVNA 2EDHA 3WHXB 3T3PE 2FO4B 4TSBL 3QUXD 4ZPVA 1JZJA 4CSZA 1X5GA 2FGWL 4MZIA 4DT2A 1MI5E 1X5KA 6PCYA 1KLUA 3C6LD 2CRIA 4K9EL 1GY1A 2BSTB 2B5IC 3LKOB 3ZT7A 3A47A 3QFGA 4GO9A 4G9FE 4KGJA 4QCIB 3AFLA 3BPOC 5T1KA 4TVPH 4YAQB 4S1DC 1M71A 2NX5B 1MDAA 3MA9L 2AQPA 2P46B 3QJTB 4NXSA 3S3BB 1CE1H 4OUUA 3FCTB 3WFHB 4AK1A 1QVOB 2OULB 2FEDD 3RY5A 1E27B 1BOYA 4JFTA 3V0FA 1S5IL 2BOCB 4UTAL 4G8EB 5F21B 1JZIA 5CD3B 3U25A 3JWDL 1P84J 1H8SA 1RK1A 1BQ5A 4Z6AT 5JA8B 4EIGB 3JWDC 3K2UL 3GMLA 4IBSA 4R4FL 4RMQA 3LQAH 3MROA 2IAMB 4FYRA 2WBJD 4E42A 2RGSA 3DUSB 2ITFA 3UTTE 1H8NA 1P4UA 4WDIB 1MFDL 3LPOA 1XQ4A 4P57A 4UCFA 1DQJA 1X7TA 3BGMA 4XI5D 3MXWH 2BP0A 1LGVA 4L8BA 4BM7A 5D5MB 5EEZA 3K1DA 2W8CA 3LXUX 5DU7A 3JSSA 3QIWB 4NQEA 4BELD 3CLEH 1LO3L 4O4YL 3BHBB 4KI5D 2YPVH 4ZS6C 4JUTA 5E23A 3HLKA 5CEZE 2ARJB 3H42L 3SYOA 4WFFE 4TVPL 1RZIA 2D03H 1M6UA 5GRXG 1QKZH 4C58B 1A4KB 3A67L 3CIQA 2Y23A 3WS3A 1RU9H 4L4TA 3RGVD 5K93A 4DP0X 1IZJA 4YSCA 1QRKA 4H8UA 3WXVH 1UQSA 5E0QA 4UDTB 2WSKA 5DGQA 4ZG1A 1YMMB 1DVFD 1OF2A 3L4ZA 1UD4A 5DJXA 1HNFA 3D4GA 4B9FA 1DEEA 2OSLA 3QWQB 3OAZK 3EFFB 3V6FA 4A68A 2CLRA 3GBNH 3VGAC 3EBGA 1AKJB 3ESPA 1FV1B 2A9BA 2CQVA 2M83A 4YEFA 2QQNH 4TV3A 1EEYB 1ZHNB 4XNBA 1ZS8B 1JVKA 3FQNA 4YZFF 4Z76A 4N2EA 2WBXA 4NO0B 3EO0B 1XH3B 1T1WA 2PABA 4HIPA 4G5ZH 1P5UB 1JCVA 4FFZA 2XJLA 3BQUC 2IDFA 4M43H 3TNMB 4JJ5A 1IAIH 25C8H 4IMLA 5F93C 4NDMA 2G2PA 4LEXH 2VDRH 2A3TA 4LQ1A 2ZCLL 1RZGB 3VTMA 4EIUA 3VFTB 1CGYA 6FABL 4OUOA 5FGBA 5DWUL 2HTKC 2JJUA 4NZ8A 3VX0A 1JNJA 4PCTA 2E3VA 4UT6H 3ILPA 3WDHA 1DE4A 1XB3A 1KEGH 2ICEB 1E5CA 3F00A 3M88A 1A3ZA 3AROA 4HQQL 5T1KD 3ZYOA 2WIIB 5T3XL 1RUKL 3WKMH 3QG7L 2PYEE 4BCXA 5FHBL 1MJUH 2WQAA 1UH3A 5AZEL 4CGUB 4GG6E 2G75A 3ARBD 3HZYB 1M57B 5AOMA 2NY4C 2ZUUA 1CFMA 5FX3A 2LU4A 3CU7A 3VDBA 1OAKH 4YGVB 1NLDL 2ARJA 2O5YL 3E8UL 5LBGA 1CTNA 1U6AH 4IOSD 4GSDH 4KV5E 4G8GB 4JRYB 1D9KA 2VITA 5FYKE 4GBXA 4YE4L 4MAYA 1RURH 1KGXA 3B9EA 2VR4A 3EW3B 1UWXH 2DWDB 5JXEC 5F7YC 2CK0L 1WITA 1A7PH 4P0DA 4P57B 5IR1A 3UZVB 2DM7A 1UUNA 2EDDA 1VGKA 3PDGA 2BHFA 3BKCH 2QPSA 2VDOL 5LAXA 3VAEA 3QJZA 4Z7IA 4IBVA 4TVPE 2OI9B 5E03A 3T6ZA 1NANI 3ZVVA 3O9WD 5IQLA 2YD7A 1CZ8H 4K8RD 1VGEL 2RQEA 1R3IL 3ZRCC 4MZ2A 1RK1B 3S8FB 1JZ8A 4PB9H 4XC1H 4X6CA 3WEXB 4QOKD 3QUZC 4KOBA 4MAYD 2AJ3A 3NG5A 1UXLA 2Z93A 4YQXH 2ZNXA 1JGLL 1XD1A 2OL3A 3ESNA 5F7HA 3ZXAC 3LPPA 4LEXL 4PRHA 4LDEB 3RLSA 2X87A 3BGFC 1UCBH 1GAFH 1A9BA 3AQXA 1QR1B 4X9FA 3NN8A 1WCBA 3VFPB 4NQCD 4B9JA 2H3NA 4BQ6A 4BCZA 2ESVB 3QXVA 2LU7A 4BXVA 3FULA 3L9RB 3HN5A 1W8NA 4CC4C 1BFVH 4RSYA 4GYBA 5GSRB 1JDCA 1CGTA 4Q9BA 3GRWA 4YLCA 2X4RB 3KYOA 4N2IA 3RJQB 1RUQH 4Y2DD 1M6OA 1CF8H 2FO4A 3GSOB 3CFIC 4G9DB 3NIFF 1TFHA 3P77A 2J43A 4UU9A 1BFSA 4HK3J 3V4UH 5BRPA 2EUZA 1Q72L 2AXGB 4P4KB 4URTB 5EFIA 3ZYIA 3AS1A 1EJ8A 4JQVC 2XWCA 1BIIB 1K3ZA 4ZUTA 3BUIA 4JBSA 3BSZA 4QIRA 1HWWA 3EOTH 1A7NH 2X5PA 4POZD 4PR5A 5DQJA 3ZE1B 1PY9A 3PQYB 4GQRA 3ZT6A 5IV2B 3FUEA 3K81A 1V3MA 5EZOL 1NLBH 5I1JL 2XHNA 4P2QA 2WXIA 1VF5C 4NAQA 2JIXD 4WU7A 2VRAA 3NRFA 2Y36L 4XX1E 2OZ4A 3C6EA 4FFYL 1PNCA 4WI0B 1G5AA 1A2YB 1PZCA 5C97A 1E6OH 2YFNA 3ESVF 1NIEA 5C2BL 3BRDA 4OF7A 1QTYT 4NKMA 4ONFL 2EZ0C 1D5ZB 5EIIB 4JDVA 2DIEA 3BZ4B 4GXFA 2F74B 3P02A 1TZOA 4X83A 2PYFA 5EU6A 2W9DH 2DQIL 2HG5B 4NUPA 5D7IF 3JTTA 1ZXQA 4W6YB 5EPMA 3UTQA 1FAIL 1KXVC 3KYKL 1ZE3H 1KN4H 5IROC 1EVUA 1MHCB 1AYRA 2NNAA 2WSPA 1MCRA 1PW3A 3L5IA 1TQCB 1VFAB 5FYKU 4TQIA 3BPNB 1UVQA 1U33A 2ZOWA 2P1YA 2KQMA 3WO4C 4YPGA 4KK6C 4I18C 5EBLA 4IK6A 2XACC 3NCJH 5E6ID 2QADB 3RKPA 5IESH 4NKIH 3VI3E 1MCHA 3LEVH 3SDDB 2NY1B 1NBZA 2NY6B 2OMUA 5IGXL 3NESA 4OIBA 1QZ1A 3BSZH 1ECZA 4NO5B 2HT2C 4QRRB 4F3FA 4W6XB 1NC2D 3QA3B 4EUPA 2VTFA 3JV6A 5FF6A 1U91A 2J7LA 3FQRA 2HUHA 4S1QH 2JQMA 2YOAA 5DA4A 1L0QA 3UTSE 3L5HA 4X80L 2VMEA 1A0QH 3TNNA 3RURA 4NIYE 1RMFH 2IADB 4ZFGH 1VRSA 3I6KA 3LPFA 3D25B 4NENB 1NCDH 5I5MA 1HI6B 3FHQA 4WWPA 2IH9A 4LVOC 3O81A 1KIRA 2L0DA 5CCKH 1UACH 1MWAA 2BCKB 2Z0UA 2WD0A 2WK2A 3KWWB 3UERA 4NUJA 1QX1A 4AL8L 2ZG2A 1ET7A 2J1ZA 3DRTB 4Y16C 1MW0A 3QDGA 1JGLH 4LIQL 4D0CA 2NY6C 4UWQB 1DBBL 4WJG3 3CK0L 4QWWC 1MVUB 3OKKB 3EDFA 2J88H 1M7DA 5HD8C 3N44B 1OCOB 5J6HA 5JW5A 4PB9L 4Q9RH 3FQYA 1Q9OA 5IMOA 2VDQH 2C9RA 3SCMD 1F1GA 4AJ0A 5IY5B 2GC7C 5HPMA 5JXAL 1CGXA 1T0MB 3P3YA 4A37A 2E8ZA 5I8KH 4OB5H 4XCYB 2NLJB 1AMYA 3MR9B 3VXSA 4ELME 1QSFB 4MYWB 3QRLA 2OMYA 2ZICA 3A24A 4BXSV 3OGOE 4UQCA 5LBSH 2EEFA 3Q2WA 2C9QA 3HPJB 2QQNL 3PWPD 1GMIA 1SY6H 2CIIB 5B7EA 4G8AC 2WY3B 4IYKA 4UMSA 3GLDA 3ZTNL 1UM5H 4BZ2H 5JIQA 1YAIA 3GJFB 1XTLA 4GRLA 1RI8A 5F7DA 4GAFB 5ERWB 1QNIA 4JFXA 4N87A 5AVWB 4HIEA 3RNQA 2Y7QA 4I7ZC 2HLAA 1DR9A 4C56A 1TJGL 1XGUB 4YX2L 5J11B 4AIZB 2F19H 2DQCL 4PY8I 2EUXA 4HX1B 4XX1G 4XMLL 2BO0A 2PP8A 5JR1H 5IT2H 4GY4A 1KCWA 3LXBA 4S1RL 3QUYD 5MENA 5CSBA 4AV5A 3B6SA 4Q2ZB 2PPFA 1HL4A 4U3HA 1O7VA 2VKWA 1UA3A 4QHLA 5IQ7L 1DQQA 5B8CC 3HNTH 3MMEB 4KHXL 2D9QB 4MA8H 3VXOB 3VD2A 2YGVA 4K07A 5IG7A 5D1XD 3WNJA 2VMDA 4ONOA 1P9MC 4GKLA 2E59A 3QUZA 3S96B 3SHSA 3L4UA 3SDYL 2IH8A 3K6NA 3H9HB 4LBAA 4ALAH 5LQBL 4X7TA 3VXUA 1S7UB 4KI5E 3OQ3B 1G6RL 5A2FA 3OJ2C 2NW3B 2R56L 4P05A 3BAYA 1AO7E 3TV3L 2ED8A 3W5NA 5GGUB 1JV2A 3BIKB 1TIUA 2JTDA 4JO1H 2W9LA 1NMCC 3BH9A 1E5AA 3MFFB 5JW4Q 2JE8A 3QUMH 3S9DB 1KACB 2BJML 2PO6A 2A6DA 5EC1B 3SJVE 5I1DA 1YEJL 5IFAL 4KV5F 5T3ZE 4R8WL 5MERB 3K72B 3NCYP 1F90H 4WJ5A 5FO2A 5IB5B 5MEPA 2WQXA 3CXHJ 4HGWB 2R9HD 4HP5A 2P24A 1YEGH 5JIIA 4YSTA 4J3WA 2MCPL 1M42A 2GTZA 3D0LB 2HYMA 5IMMB 1BVLA 2VM4A 5AQ0A 3RWFB 3FUDA 3VD7A 1TVDA 3ZHLA 1E9QA 1T80A 4LGRB 3WY1A 3F62A 4CBZA 3OJMB 1S3KH 5EA0H 1VFMA 4IOIB 1AKPA 4GQQA 3VFOA 2FZ3A 3OHXB 5JLZA 1ES0B 3AB0B 2H45A 4LVNC 3L3OB 3CFDA 1DCLA 2R51A 3U0WH 4UILL 1MF2H 3ZR6A 4ODXA 1FJ1B 3T4YA 1TYJA 2DH3A 5I1GL 3L16A 4H40A 2CBOA 5EN2A 3RWCA 3FU7A 4HS3A 5I75B 2XA8L 4GAJH 5SX5K 1MI5D 1KGWA 1MRFL 1X7SA 3L4YA 3GSNB 4PIRF 5IFJB 4YDIL 2DEWX 1SJMA 4CKQA 3H4FA 5IJKC 2IDCA 5HHQA 4WSJA 4I4WB 1VADA 4GT7A 2RQ8A 1TQTA 2ADFL 3MKGA 1HL9A 1AHWB 1QWNA 3ML8A 4G71B 3OKYA 4WK2B 3DVGA 3VWKB 5LVEA 4XBPA 4GAJL 1WF5A 2PCYA 1KFAH 4Y19B 2XT1B 2K0RA 4XNAA 3QWNA 5E8OA 3AY4C 3S5LB 4XVUD 3RAJH 2WZPA 2GSIB 4YBHA 4DP6X 3FO9B 5AOKA 6TAAA 2E4FA 1L9NA 3V0WH 4HISA 1XR8A 4XMLH 1MZZA 1A3RL 3W9DB 2G9HA 2VC2H 4XHJD 5EZOH 3QCVL 2ADJA 2XWJA 5B38A 4RAUA 1I9IL 3NQKA 1A7BA 5ADPL 3B5GA 3KPRB 5DLMH 3HKFA 5C0GA 1Q9LA 3ETBJ 3L4VA 2L8AA 1A7NL 5I1HH 2V7HB 1GIGH 5CMAB 4FZ8L 4Y1TA 1GHFH 2OJEA 2DLIA 1P5UC 2DQDL 2VRQA 5KYYA 1IQDB 3RVWD 2A0LD 4J6IA 4GXUM 4IBWA 4YVUA 1KTCA 4HCRH 4WU5B 5T33H 5F7UA 5EOCL 5JTWA 2MQCA 1CFTB 1VFBB 1BLNA 2BSSB 4P4RA 4EI6B 3AGVA 4YWGH 3HS8A 1U8KB 3INOA 3D3VD 2YPKA 4L8SA 4ZOBA 3P30L 5T3ZL 4UNVA 5SWZE 4MJ2A 1BYOA 4GBXD 4WGKA 5A6IA 5FA3B 4FTVA 4EI0A 1KWKA 2QL1A 2EIZB 3ZZLA 4BFIA 2G2NA 2Q86A 3NDYE 4I48B 2OMXB 2DICA 5TDOB 4KQ4L 4MMYB 4DEPB 3MV8E 1JN6A 4LDOB 3ARBA 4M93C 4BFOA 1MELA 3FO0L 4Y89A 4ZI8A 1RZKL 2KZBA 3LZNA 4X5WB 5GJTH 1DSFL 3FT4A 4ZTPL 3OBAA 4ENZA 2CGZA 4JO5A 2VAJA 1C12B 2ZIDA 3WJJA 3U4BL 3NJFA 4X98B 1JHLH 4HZLB 3MACH 2CM5A 2XKNB 6PAZA 5J11C 3H7BA 3O8XC 3R19A 4FN0A 3GK8H 2ZOLB 3LH2L 2ERJC 3K80A 2DYPA 2W5PA 2BK8A 4GXVL 2VZSA 3FFCE 3NQIA 4HOMA 2MCG1 1JTOA 4BUQA 1OLLA 1WISA 4L4TD 3RGVA 3CN0A 5ISZD 3HC3L 2XV0A 4MNQB 4QXTA 2ENSA 4PJIB 5GZNA 4PGZA 2FB4L 4OJCA 1N7ML 3IAQA 4MSWB 4WEBL 4N0CC 1JPTH 2C7UB 1MCOL 3DVFA 1I1AB 2IMMA 4LKXB 4P9HC 1ZT1A 3AG4B 3MGOA 4MYPA 2AQSA 2CBPA 3EO9L 4P9HL 3NH7H 1GIGL 1P4LB 4E9YA 2ARWA 2WV3A 3OKEA 2VR8A 4GRLC 2YAOA 5JDSA 1ODAA 2P5EE 5GGQL 2VLKA 1NAMB 2UZXA 1W0VB 5KYXA 2PETA 1YY8A 2VMCA 5LWYL 5D4QA 2OMVA 4JB9H 2ZKHL 1IT9L 4DP5X 3FU6A 2X4OB 1PVHA 3H42H 4QYOA 3T3MB 4KQ3L 5D1ZD 1PGRB 3EH5B 2R0WH 4CBPA 4ZMPA 4KPHH 3HUJB 1BG9A 3U1QA 4GKSA 2BLFA 3QJQB 4KDWA 1U3JA 4JFFA 1T5XA 2NQCA 3SODB 4JANB 2G60L 4ODVH 4YDJA 3NA9L 3Q6GH 4Z7WB 5KSAB 1HZKA 2J5LB 4MD4A 1D6EB 2QMJA 5LLIC 4QDGA 4A7QA 3IXAB 4PJDA 1GOHA 1BEXA 2QVMA 1M7IB 3U7WH 2EXSA 3LQAL 4ZFOA 2XQYK 2HH0L 2X4SA 4HWUA 3FQ4A 3WLWC 2K3HA 3HG2A 4O58L 1EWHA 3K5RA 1URZA 4XNMB 3APDA 2NYYD 3CFNA 1TVHB 3F7YB 5DEGA 5IJBC 4KDTC 2WLMA 1CLCA 4LOUC 1BZEA 2JI2A 5T1MB 1B4LA 1ZLVK 1P1ZA 3PWJA 5F9OH 4DGYH 5HDQL 4EQ3A 1IIKA 3KW7A 3ELAT 4LL1A 4CSTA 1NCAH 2CDFB 3PXHA 3IMVA 4JFVA 5C92A 3GRBA 5AVQB 2W94A 2GJZB 4FZ8H 3V5KA 2K4WA 2VABB 2Z65C 3L5XL 3I2CL 4R2GD 2RD0A 4HFUH 5IFHL 5HDBB 4RLDA 1FFTB 1Z9SB 2RIKA 1COBA 3CBRA 3N41F 4O9HL 4X7DC 3C12A 3SKNB 1I9IH 4KMLB 4IRJD 5F7LB 4AYSA 4ODUA 5J6SA 2AVGA 3BFWA 3HG1A 3OKOA 3CUPB 3RIFK 5IJKA 1YC8A 1VDGA 4HHGA 3DMMB 2GUOB 4OTXL 1A1OA 4ZNCD 3CD4A 5FDWB 1YSOA 4OLEA 3ZKQD 2P5WD 3DK2A 2IH3B 3NCYS 4IQHA 5D1QC 3QUKA 4BIKA 4N6RB 4A7SA 3HI6L 4JG1L 1KBWA 3O41B 4JM0A 3C6LA 3TJHD 4MJ5B 4G7SB 1BV8A 4IW4C 1JTTA 4UQDA 5IQOA 3UJTL 4R0LB 1NFIB 3OKDB 4GFXA 5DD1L 5I74C 5HVGB 5BZDB 4BFBD 2P5WA 2NCEA 1KTDB 5I24A 5IB1B 1IM3B 1NCHA 3OXRA 4OZFA 3TWYA 3T77A 3T1FA 5FCSH 3AAZB 3CIAA 2DQUH 4QF1A 2BIQA 4Z95L 4CU8A 4NUGL 2N0KA 5DZJA 2VN4A 1IM9D 3CU1A 4JFPA 1BF8A 2WZ5A 3KDMA 4NCDA 3O4LD 3C60A 3H53A 4I1PA 1FL5B 2FQFA 3IF1A 3FU5A 5DS8A 2YLKA 2P80D 3TA4D 1PFCA 4N8VA 1DQVA 2Y36H 3OAYH 1Q8MA 5FKPB 1AIFB 4YHIA 1RHFA 3FN9A 3QYCA 1MRDL 1N64H 1IJNA 4L0PB 4U4BA 3KH3A 5EA0L 5EZIL 2EUWA 4NNYA 2B77A 2XFXB 1MCCA 5E9AA 3KM1A 3L3DB 2DMBA 5FFOA 3IN2A 1NGZB 3RHWK 1JWSA 3AXLB 4D0BB 4NQQA 1RJYA 4KY1H 4P5TD 3LEYH 3UBXB 3TO4A 2HPOA 1R1CA 4L3FA 1NGYB 5L8LB 4KK9C 2YKLL 5EU4A 5HJ3B 2E7BA 2CMRH 5EDSA 2BSBA 3TN0A 3DHUA 4WFGE 5GZNC 3JTSA 3LRSB 1A9EA 4AKQA 4Q6YA 4PCSA 2GI0A 1EZUA 2OW7A 4AW4A 1H3UA 4LF3A 3T0EE 1F1DA 1W16A 2YJLA 1VAHA 4M5TA 5DC4B 5AZEH 3X1BA 3SGKA 3PGCB 5D7IB 5E8NA 5JA9A 5ITBL 5CUSH 4Q6IA 5FYLH 3ZMNA 4JPKL 1G7HB 1ZE3C 2ZUVA 4I3SH 4LSVL 1RPUA 1KNOA 4JY4A 3AG2B 4NNXA 5DZVA 4NRZB 3GKWH 5D7JC 3QXAB 1YUHB 4OVUA 2R1XB 1YZZA 2EE3A 1IAOA 4IIQA 1CD9B 2OZNA 4HA1A 3ZE0E 3NACH 4GMSH 1AH1A 3T8XA 3JV4A 4HJTA 5I0YA 4J1UB 2OFQA 2KS0A 3GUFA 4L3CB 4OJDH 3MLYL 1K4CA 1VIWA 1CLVA 3ARZA 5BXFA 3GKWL 3OKLA 1G84A 3QFJB 5ICZA 3K2IA 3WJLA 3FQWB 4UIMA 1NQBA 3V5DA 1KZQA 3EFOA 1T2XA 4Y5VC 3RGHA 4AL8C 2NXYC 1ETB1 3PYCA 2V8MA 3I74A 1Z1WA 3QXDA 4H7VA 1E9PA 1HYSC 5FO7A 4E41B 3ML9A 5AOLA 4M6MH 4JS7A 4LSSH 1FZJB 1DFBH 4LSTL 4N68A 1N3NA 4B9CA 3B9AA 2F0CA 5T33L 2WB7A 4BV1A 2XTSA 4QRUA 5DJ0B 3QHTC 5ADOH 2ZONA 4NNPH 4ONGL 4O2EA 1OP9A 5E6RB 1NDMA 5JO5B 1MEXL 4EIBA 5C07D 1HESA 3LZFL 1A4AA 4O02L 1U8QA 3RWGA 3QNFA 4FP8H 1YYMH 5FM4A 1SJEA 1HDMB 4FLSA 1DBAH 1UZ8A 3QEUB 3BKYL 4U1LA 2VL5A 2BVTA 1TZHB 3KL5A 2N56A 3E6HA 4XNDA 1OF0A 3D0VB 5SWZA 5EZIH 1B3IA 4JLRB 3JBG7 3ABLB 1DN2A 2E0PA 2FWLB 2IQ9H 3U30B 2NMSA 2ICWA 3CFBB 5TTRA 35C8L 3T6QC 1NIFA 2X6BA 3II3A 1BXAA 4HWZB 4WWOA 2YD1A 4RBPK 4YIQB 4AM0B 1T1ZA 4PV8A 4WO4C 3J27A 3N0PB 2GJPA 2JKJA 2QADC 1UB6B 2HRHA 1DYZA 3VJ6A 4RGOL 5AOIA 4YJZL 1KY7A 3Q2NA 3M1OA 4KH9A 2A73B 4DO5A 3TL5A 5D7KD 3CV5A 1JZ2A 3FO0H 1J1XH 1EZVY 4LHUG 4GLRH 5ILTL 3MCKA 3W11D 4IKJA 5BS0D 1TLKA 4G80B 3NGBC 4N3UA 3TBVA 3L7FA 3HG4A 1QI3A 2D3LA 2LLNA 1I1AC 1N8ZB 1UM4L 2R59A 2JB5L 4FULA 4KK8C 4U3XA 4D9RE 5E8EB 3TPKA 5B39A 4A63A 2AXJA 3CC5B 2QSCH 2CKBA 4F8TA 4OLVH 2C3GA 5KSVA 1NGWB 1WBZB 3J2PA 1C1EL 3QQNA 1G9MC 3H1ZA 4KRPD 3GSRB 3VVVA 1DBKH 4HK0B 4L9LA 1D5IH 1YPZF 1A7QL 3MA9H 4ZDHB 3MJ8B 4W9ZA 4OFVA 2P7TB 2HFGH 2XQYA 2QFRA 2V9UA 1AZBA 1ZANL 3EOBB 4LP8A 2FJGB 5L2KA 1OAXL 4LHUD 4PP1C 4MQSB 5F3BA 2R2HA 2DI9A 4YFDB 4OLUL 4M8VA 2EDXA 2A9CA 5LUMA 5DO2C 2WCGA 5I9QB 3EHBB 1Z5LA 4XB7A 1LDPL 4F5CA 4ODBD 3TJHC 1Q72H 1A14H 2V2XA 2XXCB 3MLRL 4QXGH 1BFTA 4J2XA 3KGTA 3CZLA 3BCDA 4TNWF 1B0RB 4N5ED 1CFNB 3PF2A 1J05B 2Q2LA 4YC2C 4JFFE 4KKLD 3LEXB 3IMRA 4NQSB 3IE9A 3DVNB 2Z7YA 4HUNB 1EXHA 4M48H 4GP4B 1IBYA 1SYSA 2NUTB 4G6ML 2NZIA 3TWCL 4O02B 5FM8A 4GAGH 2Z8RA 1JPSL 2Q3ZA 3U46B 4WV1A 1GAFL 2I32A 5TH2A 4DZBA 2JK5B 1EXUB 1QO3B 1OCCB 4PRPB 4RFOL 1IE5A 4KNSA 4TPRH 5IM7B 2BNUB 3VU1A 4CVXA 3QDMD 3SDAA 4BQ8A 4C4BA 5JUEH 3OX8A 4WI7A 3WNIA 5JORA 3F64A 4G6JH 2Z35A 4OCSH 2Y7OA 4PJ8D 5AW1B 5L0QC 3AG1B 2O5ZL 4F37K 2YA2A 4LCUB 4NAMA 4R4ND 3QQ4B 2C1OB 3DX3A 5CILH 2CZNA 1A14L 2QQLL 2ZWKA 5DURD 4JB9L 4JFEB 4L8CA 5FYLE 1S4IA 4IRSA 1ZSDB 3MRFA 4PJCA 2R83A 4RBPH 3K2MC 1Q38A 1SOXA 4YDNA 4HUVA 4FXTA 3WG7B 2BMKB 4AVHA 2VSKB 3P4OA 1JFQL 2AERT 1SUHA 3PL6B 4GG8B 2X05A 1JUFA 4PJ7A 4LE8A 5E94B 4K5OA 1KG0B 4MRBA 3L17A 1UEMA 2HFFB 4UBDC 1B2WL 2B08A 2SEBB 3C5ZD 4XCFH 5B39G 4O2CA 2V2WB 4FZEH 4UQ2B 1PTZA 1INDH 3MRBA 5D1XE 1DZ0A 3QJFA 1HS6A 4AQZA 1IGML 3NP3A 4P9MH 3D48R 2WXRA 3L3HA 1MCKA 2MSPA 4YXHH 2Q7NA 3AS2A 1SN0A 4OF8A 2ADGA 3MRHB 1BBJB 4W4NA 4YDLC 3RA7H 3T6VA 4ZMTA 4UTBA 5I8EB 2QR0B 3IDNB 3FCSA 2AJUH 3MACL 4U7KA 3VRIB 4FFZL 4DERA 1O0VA 1ND0B 1S7XA 5ICYA 1QSZA 5ILTH 3HBPA 3IS0X 3FUMA 5LCVL 3H0TA 2XLLA 3IJ7A 1NDTA 3KJ4C 3CK0H 1ORQA 4MX7A 4HBCL 1WZKA 1GCFA 2D7TH 3I9GL 1T1XB 2XNAA 3DURA 4XH2B 5A2LH 4PGDA 3HI5H 2FBJH 3MRJB 3O6KH 2VXQH 4TQ8A 4A7TA 3PWLA 5CCHE 3VXMB 4J23A 3TBVB 4S1RH 1DP0A 1HNGA 2FQGA 2KYIA 5EORL 2Q5BA 3PL6C 1QATA 4HD9A 5C9JA 1X44A 2XICA 3ESOA 3EBHA 1A6UH 3HRZC 4LVHC 2GY5A 2A6IB 5CNHA 5C6WH 2O5XL 3S5ZA 3ULVC 1ZLWH 3NCFB 1M9SA 1P2CB 2Y7MA 2FIKB 3AWEA 4KHTH 4TNVK 2JCCA 5B22A 4QTHB 4X8GA 3BUYB 3RKDD 4WNQA 4XMVA 3DXAE 5CKGA 4A1RA 3MV9A 2XTLA 5JZ7D 4U6TA 1IC1A 2YSSA 2JKRM 3B9VA 4F57H 4OGYL 2EYRB 4JG9A 4KZ0A 4DCQA 4IK7A 5DR5L 4AQ1C 1UA6L 4WKXA 4B27A 4LSUL 1HH6B 2J55A 1TEYA 2PWEA 4NYLA 5AVZB 1GZHA 1RZ7L 3ARDA 1MJUL 3QGVA 5D55A 1SJEB 4MNQD 5HHOB 3PUCA 2EKJA 1XGQB 4HXAH 2PTTB 4MCMA 4L4TE 1JZ3A 1BJ8A 2B3IA 5JHDA 4XE5B 1FRGH 4C57C 2FWOA 2MQGA 2JNZA 1VACB 1QTSA 2ZCHL 5DSCB 4LFHG 1YMHA 3DETD 1E50A 3PAUA 3FFDA 1KB5B 1INEL 1CFBA 5GS2D 2ERJB 4MJID 1N70A 4FKKA 2APSA 3RKDC 4FL4B 2NUPB 3ISWA 1Q9KA 3VI4F 2IG2L 3WIAA 1GL4B 4XGZA 3POCA 2AQ3A 4XAWH 4XHJC 1N5YH 5J1AA 5SX4I 2LTQB 2YMOA 2WXKA 5IBTL 4M8QA 4EQ2A 1V7MH 4L3CA 2GSGA 2ED7A 3MLSL 2XQBH 3ZY7A 2LLLA 2W0FA 2C26A 3FUKA 3EJQA 4JRXE 2FIRT 7PCYA 1RP9A 1S5HA 3CFJB 5BO1L 2XIDA 3OC5A 1P4BL 5F8RC 2OX5A 3ZRFC 3P9LA 3MRKA 3GSXA 4JREC 4X0KA 5DJZA 4AJVA 1REIA 5KBNC 4PREB 1YPZA 1ZPLA 4J27A 2OKMA 2BC4B 2GPZA 5HHNB 2JSFA 1NIDA 5SWZD 1C7TA 1U8CB 2MQ3A 3PGCA 2C4FU 3VDCA 4N8VG 4HXBL 4N20A 1HQRA 4JM2B 4F27A 3CBKB 1G7PB 4WW1B 2OTUA 1MHPL 1CYXA 2J73A 3DDFA 5FW6A 2L3BA 3DSNA 5DJ8B 3V6ZB 3QYNA 3RI5K 4OIFA 3VXTB 1XT5A 3CDCA 1AP2A 3KJ6H 4HV8A 4BH8B 3TESA 4QYAA 3AM8A 2GK0B 4JHWH 1W72A 3MRGB 1UM6H 5CKAA 3IDYC 4M7KL 1K9TA 3E8VA 3L3JB 2CCWA 3CNKA 4KVPA 5KWYC 2WINA 3IDMB 3DUHA 4FI7A 1BF5A 4A7GA 4PRBA 3DPDA 3V8OA 3FTUA 1KN2L 3MUGA 1Z5YD 1IL1A 3S3SA 5I73C 1R6VA 3G6AA 3PRZA 4FQPA 1MCIA 3A5VA 4DUWA 1ZDQA 2R9HC 2W1NA 3QXWA 1UWXK 3T2LA 3I9PA 1OSYA 1EJFA 1UJ3A 4MASA 1E5BA 2XA8H 3ME0A 1MIMH 3GHPA 5F44A 3NA9H 3QNXB 4YZWA 5IVOA 2VC2B 4I85A 2FJFA 3WTVA 1DO6A 3QJRB 1CU4L 2IIJA 3RG1C 4B9GA 4E9LA 5K9OB 1XFPA 4YDVA 1R34A 2B0SL 4JFUA 2P8PB 1K72A 5LBVA 4I18A 3TBWB 5I66A 1KTDA 2DTMH 2XZAH 3MOAL 2X40A 4HEME 1WH0A 4QXUL 4PB0L 4IM8A 2WQRA 4JZOB 2CO4A 4HF5H 3VB8A 5BUGA 1IM9B 3E9TA 4OKDA 4PVNA 4U1JB 3TP4A 2YRPA 1FNLA 4OI9A 4JX0A 3E0GA 4KKLC 4PV9A 3MV01 3V4UL 1ROWA 1NCWL 5EOQL 1E7UA 1FNGA 2HVKB 2B3RA 4L29B 3TZVC 2GITB 1F41A 3CXHK 4WGVB 3APFA 4BSWB 1WHPA 3FUIA 3JWOL 4M5ZL 1ADQL 1T3FA 1OPGH 2UX7A 3IJYA 4RGNB 3TCLB 1T04A 4P06A 5B21A 3ZRSA 1JNLL 4F8QA 1KPVA 3U4AA 5C0CB 4AQEB 3EXLA 1AG6A 2JLLA 3TYFB 2HJKA 5DK3A 2ATKB 2CKBH 3F83A 2NOYA 4FE9A 4GIAA 4ODTH 2ZSWB 4PP1D 5H2BB 5IF0B 2MWCA 1ZT7B 1ZY9A 3H3KA 3KPQA 5J5EA 3Q1SH 1A1MA 3B1TA 4Y2NA 2UY6A 1WD8A 2MPAL 3B3BA 1KJ2B 3LSOB 4J4PD 1HCFX 2ZKXA 1RZKH 5DRXA 2WHVA 3Q6GL 1F2QA 4L2LA 4MJIA 3MLXL 3TO2B 1TCMA 4GOSA 2E74C 1DTUA 2DLEA 1BVOA 5AOJA 1OOWA 4QUOA 2JB6A 2CCVA 4KTGA 5JHDE 3NIGF 1ZA6A 1N59A 4ZQKA 1FPTH 5IHZA 1YQVH 4PW4A 5D7LE 5EO1B 5EWIL 1FYTA 2BMKA 3SCMC 3V0DA 3W11C 5JNYA 1KFGA 4XWOC 3MREB 3JWOH 4M5ZH 4WQOA 2XRAH 5HD8D 4QNPF 4PJDE 2X44D 1RMFL 3PHOB 3IDGA 3DHJA 4LSUH 1NWPA 4JFEA 4NC0B 2CBQA 2Y06L 4GSDL 2QADD 3CPLB 5I1EL 2K6WA 4D3CH 3F3HA 1N0XH 1Y6NR 5DRZA 2FO1A 1GRWA 3VGFA 5AW8B 2ADIA 5E8PB 3SGEI 1YY8B 1FNFA 3RVUC 4ZMYA 4HHWA 1EAJA 4ZOEA 4Y1SA 4PJ9C 1ZLSH 3PIQB 3VI3B 4MLIA 4LSPL 1Q0EA 1DLHA 5SWSE 3WKML 3DO4A 4BWUA 2VW4A 5CSGA 5DS1A 3BLKA 2VXVL 1F4WL 4KMTL 2TAAA 2JLPA 5D4IA 3LIZH 3P2BA 4HIIB 3KPMA 4JFDD 3TTYA 3U46A 2O5ZH 3SQOH 4E5XG 3FOMA 2FBJL 2UWEF 3O6KL 1DQMH 3PHOA 4QEGA 2NUTA 3K6SA 4HMDA 1DJHA 5FKAB 5KG9B 4W70A 4Y4FA 4J6RH 2XQ0A 1DSFH 2X7LA 1PNDA 4AGPA 4MAUL 2F8IA 1KCUH 2JXMA 3QP3A 5IHZB 4YHYC 4FNUA 2HT2D 4PJBE 2AC0A 3QS3A 3MXVL 3VG9B 2H9GA 2KPWA 2OMWB 1JBJA 4J8RA 2R2BA 4XNZC 4TNFA 1JWUA 3OVUB 1DFXA 1GYVA 4LVEA 1IU1A 5GRUH 1L5GA 2W91A 1DVFA 4PEEA 1I8MB 5HYSB 2NY7H 4E9SA 2E4TA 3CFCL 1JOIA 1OB1B 1Z5HA 4XP4L 3KEHA 3HE6D 1FIGH 1OT1A 1OPGL 3N43B 1ICTA 2YARA 3ZMEA 5FUOH 3Q13A 3QUMA 2X1OA 3VW3H 3HB3C 3DXAA 1NEZB 5AALA 3PQYE 4M3HA 1KYOJ 3NVQA 3WFEH 1F6AB 3AY4A 2ZPKL 5JHLH 3NFSL 5JQ6H 3QZMA 3PP3H 5IROD 1X9LA 2CJUL 4A2DA 5JHLA 3RTQA 3QISA 4QHUB 5HYIA 5ID0A 5CO1A 5GGTA 1KMGA 1TCRA 4B9IA 3KE0A 3HZVB 4YHPA 2ICEC 3GGWB 2VKXA 4LCYA 4EOWH 5D4HA 1CGWA 3VD4A 3RX9A 3AS0A 1N8ZA 4QRRE 3SPVB 1IBZA 3VQ2C 1KCVH 4K94L 2J8UE 4R7NA 3BZDA 4PWKA 1UOLA 5ISZE 1GVIA 4XT1C 4PRNA 1A6VH 3KNBB 5DD3L 4P2OC 3KXFB 4PRIB 1XCWA 1KB9K 3Q01A 1Z3GH 3ZE1E 2ZXEB 3D3VA 3WTSA 1LE9A 1MLCB 5B4MD 4AEIL 3QEQA 5B38B 3U4KA 3UTTA 4POZC 3QDAA 3FO2B 4AH2A 3U82B 1T22A 4GRWB 4NKDA 3W2DH 1BREA 1KN2H 1SM3H 2GSIA 2J1YA 3NIGB 3QJHB 2ZSVA 3D30A 5TDNA 2EKSB 2X4TB 3UJTH 4HWEH 2EEAA 1IEAA 4NJ9L 3QORA 4B5ZA 3K4DA 5C2BH 3EJPA 2EO1A 3QYMA 3RL2A 3T9WA 5CFAA 4QOKE 4IBYA 5IHHA 3R0NA 5F1SA 4TNEA 2XV6B 2D3VA 1T66C 5DK0B 4GI8A 3U0WL 4HCIA 3MV7D 3Q05A 4QXGL 4XNXH 2X4PA 3OR7B 1KCVL 4TULL 1VKXA 3ZTJG 2WQUA 3FO2A 4LKCB 1ZHBA 3VO0A 3VRLF 1NFDA 2V9RA 2XPYA 1K5NA 2DQEL 4AGLA 3GWJA 4A7UA 4G7RB 4UV7L 5EN2B 2JKSA 4MAYC 3QXDB 5C1MB 2HT4C 2PPAA 1CDYA 1J0YA 1XO8A 2J8OA 1XMWA 4HV8B 3LTVA 1IE4A 4EEEA 2OYLA 4HS6A 5EBWB 1ZA3A 1M53A 2W9EL 3GTVA 4TSAH 1A9VA 3OKLB 3P73A 1THAA 3O9WC 1C16A 4HT1L 1P6AB 2OTUB 1QFWL 2GEEA 4M93B 4PRDA 4LCYB 3L95A 4L1HA 4ODWB 2OXHA 2LE9A 2OTPA 1J5OL 1NBQA 1OGAD 4F7EA 4P4KC 1FYTE 1TETL 2DL2A 1EZLA 3IDIA 3QH3B 3WMSA 2Q6WB 3O8XA 4N9GB 1IGIH 5MEPB 2ESVE 3BMVA 1KNOB 5IB5A 3D9AL 2VXTL 2ZE0A 1T89A 1GW0A 4F7MA 5BQ7B 1F13A 4FD0A 2X09A 4Y4HB 1KGCD 1XCXA 5BS0A 5I1DB 2WXQA 2J88L 2YQGA 3ELQA 4M1DL 5T3XD 3ZE2F 1R75A 1CTOA 4ODWA 5E1AB 5ACZA 1PG7H 4PRDB 4QAMB 1V3KA 3ARBC 3FUNA 1WZMA 4KKCC 4FCHA 4LOUD 4GRWH 4OZIF 1A21A 2V5YA 1L5GB 2VERN 4NT6A 2NYYC 1VJSA 5KUKA 4QT5A 4GUQA 3LN4A 4J8RB 3X3FH 5HJ3A 2CDEA 3H9HA 4GEIA 3X11A 2Z0BA 3QUZB 3F5WB 4FQJH 1E5ZA 1L9SA 1SBSL 3C60C 3P30H 4QRPD 5T3ZH 2Q8BH 4MA7L 3MBEC 1JWSB 4IRZH 5CN1A 2WGNB 3D39D 1QFWH 5KG9A 5TQ0L 3IGAB 5CZVL 32C2B 3SPHA 5KVGH 5LO7A 4P9HH 1AS8A 1FH5H 5C0RH 1FSKC 3JTBA 3MDJA 4YHML 3B2XA 1ETZB 4ZSOE 3NJJA 4K2UL 3CE1A 3CSTA 5KYUB 2XBDA 3BVXA 3HNSH 3K8KA 3U1SL 5D1ZC 5BZWA 5TQ0H 1AACA 2J4WH 4U1KA 3L3IA 3HR6A 2YUXA 3RNQB 4HIEB 5ENWA 3ZDXB 3PIQA 1OALA 2CHDA 2LABA 4H0HB 3WD5L 1XGYL 1EHLH 4X9BA 1BD2B 1PLAA 3WL9B 1A3RH 3FU0A 3KLDA 4GRWF 4JM2F 4KJYA 4OLZL 3OXRB 4X6DE 2O6CA 4Z3GA 4KI5F 2YGOA 1MAKA 5LGHL 3GB7B 4NN5B 2C3WA 3SY0B 5A43C 3MV9B 5DUJA 5CP7A 1WAAE 3K4ZA 3UC0L 3SBRA 3C2AH 4OF5A 1RIHL 3GFUA 4Q6IC 2JCCB 2UWEA 3D3VB 1LE9B 2QJDA 5LB1A 2GJ6A 1EJ6A 3ESUF 5DHEA 4JKMA 1URIA 4NHCH 5D7JA 3UAJA 1MJ7H 5GGVH 1A1OB 4ATWA 1CF1A 1A3LH 3NCXA 4R7NB 1S7WA 2OS7A 3ZTCC 3CUPA 1Q9OB 3FCBA 5CS7A 4YHOH 5IMOB 3ARYA 2JTYA 2H26A 4KI5C 4NOBA 5CJQH 4M48L 5EBGA 4G3YL 3HTLX 2BW5A 5K9KA 3GJFH 3X1NA 5GS0L 5ICYB 1ZHKB 3MLZL 4HKJB 5EEXA 1RZFH 3HLAB 2CDGB 1ZIAA 5E4EC 3GS4A 4X0NA 1EFXA 2X6MA 3V8CA 1FG9C 1OAQL 4U0RC 2KQNA 2ADGB 3F58H 1KIRB 4IKIA 4PRHD 3UCRA 1RH8A 5I6NA 1GC1L 3IJ8A 2C9PA 1QPXA 3GO1L 4HUKB 1DSWA 1QZNA 3LQMA 3KLSA 3RY6A 5K9KB 4TTGA 4FYSA 4CJ1A 3MRCA 1VESA 2VDLB 5F1NA 2IADA 4APQB 1NOLA 2PR4H 1UFUA 2HFGL 2YA1A 4WCYH 4ANWA 5CXPA 3LZPA 1P7KB 5FYKD 2QHRH 4R8WH 4G9FB 1JUFB 1X6NA 3MLZH 4HALA 5E9DD 3DC0A 1AD9A 2YMXH 5J56B 2ZKMX 2O93L 5E5MB 5MP6H 4N26A 4KKRA 2AQRA 3DJ9A 3SGJC 1JGEB 5CJQL 4JZOA 2X89A 4NO0D 4G1EB 3LKSA 4BRVA 2KLRA 1U8LB 3QXUA 2BH0A 5K39A 3HBGA 2WWOA 2WO3B 1AR1D 2WXOA 5I66B 2HT3D 3IMWA 3QRGH 4NC1E 2GSMB 5HHME 3NZUA 1A64A 2VLKE 4YDVB 4JE0A 3FKUS 4TNVF 5EBLB 1TF4A 1PD0A 5E56A 3L1OH 1GGIH 2DYSB 4K71B 4PJEA 4D8PA 5L8JB 5ESAB 5KYXB 2BIHA 2JKLA 4AJYV 3ARTA 3MBEB 5AW6B 3CFUA 3DX0A 4LEEA 2XKUA 2QTEA 4KNTA 5DCCA 5D6DA 4M7KH 1XF2A 4CSSA 4OFDA 4BK4A 4F2MB 3MJ7B 2YMXL 5F2FA 3CLWA 3PPEA 4Z77B 3FCUB 2JK5A 3JQOB 1YDPA 3DOIA 1CR9H 1QFOA 1XF5A 2AF2A 1IL1B 2OPCA 4XVTL 2VXVH 3DK0A 1L9TA 4WI8A 3S98A 3MRMB 1SDDA 3RB5A 4HKZA 5CGTA 4XPBH 1WWAX 3AS3A 3VGEA 1CO1A 2AK4B 4PJ9B 4ENED 4U1NA 2BSRA 1A2YA 2IALA 4XPHL 2ZX6A 3H7BB 5F0LB 2BSCA 2XKNA 1P7BA 4JQXA 2F15A 2X70B 4N2OA 4JAMA 3ABMB 4DWHA 2Y24A 3JWNE 2JCCE 1U8HB 2JJTA 1FH2A 1HOEA 1FF5A 1U8CA 2ZX5A 1FPTL 3G04B 3QZWB 5DVPA 5DZPA 3SGEH 4O58H 4X5QA 4U1SA 3WNKA 1N68A 4U3SA 5EUOB 4P4KA 3CAFA 5EFIB 4KX7A 4D2NA 4B9YA 1MUJB 3MRKB 2ZT9C 3D8MA 4N9GA 2IPTH 2IQAA 2VDQL 2YWYA 3IN0A 1AGEB 1WA2X 2CBMA 2Y7SA 2E86A 5FUCE 2A77L 4RGND 5D1QE 1OO2A 1NGWA 1WBZA 1G4MA 2P8LB 5D8JH 5KW9L 4Y9FA 5KTEH 3IJYB 3Q8FA 2EXTA 2ZCLH 2G2RA 5E8EA 2VR6A 3KPOB 3WYRA 5B7FA 1EBPA 3EIFA 4L29A 2CD0A 1NKOA 2X6CA 3HMXA 1FGVH 3QG6A 1QR1A 1J8HD 2FQEA 5EBWA 3WHE0 2YD3A 2YUWA 3EOAA 3CFMA 2CKBL 2GTWA 4HOZA 5LG6A 1PZAA 4FHJA 4KUZL 1YEFH 2DBLL 2EH8H 3DPBB 3N43F 1OWWA 4FEMA 1URLA 5CMAA 3PU7A 3B7SA 3BDBA 1H6FA 4PG9B 4WVRA 5FYJU 4HT1H 2YWZA 3LZFH 3QWRA 3PGDB 3L81A 2HG0A 1FZOB 1XH1A 4UT7L 1XR8B 5D2NA 3NJMA 5TE7H 3PJSB 3SSGA 4LSQL 5DHMC 3U36B 3BDYL 4G7VH 3KGRA 1TZGH 1FH5L 4UAOC 4WLCA 1JFQH 3WDJA 4R7XA 5I19H 1OQOA 4LSTH 5E8DL 5DMYA 2DDQH 4ZW7A 2DWDA 4WFHE 1A6AA 2X4TA 2A74A 4GXVH 5IJCC 1HHGB 5DEZA 2EH8L 3NZSA 1D9KB 2VITB 1OV8A 2HUEA 1QP1A 5T1DH 4DEUA 3PJSA 4ZMXA 5IFJA 2Q10A 1T22B 3B3IA 5C9KA 1EANA 4DGUA 2CUMA 3BN9D 4OD3L 2N1TE 4OZIE 4ELKB 1ZVSA 4LCIH 1DL7H 2H47C 1R24A 3NJKA 3PAYA 4HBCH 4PJXE 3B2UD 4JZNB 4M1DH 4R83A 3DJZA 1AANA 1MJ8H 2DQTH 2ICES 3DARA 4X5XA 4DUVA 2Y5TA 4KQ4H 2HMIC 3DYMA 2CRYA 4FFZH 1LM8V 3P0YH 4PRNB 3VG0H 4EKXA 2FHFA 4IOSA 4XO9A 4PAZA 1YAZA 5E6UB 2Y22A 3UAJC 3VFOB 4DQOL 1NFAA 5GS1B 3VE0A 4GMTL 5DJ8A 2IJ0C 3MRJA 4JFDE 4BKTC 5DD1H 5J9PA 3IJEB 2IDUA 5C09E 3WN6A 3EFDH 5CZKA 4FNRA 2EDBA 4IIQB 2UYLB 3MLUL 4IJTA 3U48A 4A2MA 5CINL 4UZUA 1MF2L 2AVFA 1TO5A 1YUHA 2GABA 2ICWI 5C0BD 4K4KA 2P24B 2GIMA 1AR2A 5DTFB 1TQUA 3GSXB 4GB9A 4NNXB 4X0KB 1LE5A 4P4KD 3X13A 3AG3B 2P52A 4JO8A 3AW5A 1NAML 3JYCA 3W9EA 5BVPH 4Y4KD 4HG4K 4O9HH 4E41D 3P4MA 3WXVL 3D51A 5I76B 1Y6KR 1ZS8A 3FQNB 5BUAA 4JN1L 4R6UA 2GSGB 5D6CB 4JAMB 3QUXA 4G59C 1AZZC 1U9KA 3U0PA 1H3PL 3JTSB 3LRSA 3OL2A 2R2BB 4PWJA 2G3NA 4H1LH 3K7UA 2COVD 1NKGA 3ZDZF 1OM3H 2DQMA 2OMWA 4OFYD 3GHEH 1WAAA 4U1NB 3LXCA 5DWPA 3V6OE 3WIHH 3TO4B 1PZBA 2PXYB 3QQ9C 4C59B 7FABH 4NUMA 3T0XA 2AXHA 5I71B 1I7UA 2NY0D 5DEJA 1E28B 1OWRM 2WOBA 3MCLL 2YRLA 2X9XA 2VYRE 2OBGA 3CZKA 1UM4H 4XNYL 1E3FA 2FSEB 3BEVA 3TLRA 2ZXWB 2M8XA 4JN2A 4OCXL 5E9NA 2KLSA 4D9LH 5EO9B 4YK4B 2WVVA 4PGBA 5DMKB 2QQKL 4FF9A 3FRUB 3I6SA 4KJWC 1QOKA 5AVTB 3SYQA 1YYLH 1QSEB 3IU4H 1I9EA 3FMGH 2JKWA 2ZXBA 3ECWA 2OLDA 3IBOA 2R4RL 2EYRA 2B2XH 2CRZA 3D85D 1F1AA 4W93A 2H7WA 4KXAA 5F8QC 4BYHA 2OSWA 1IC4L 5EEVA 4PJHF 4CDHA 4EVNB 4NQED 1MCFA 3ZT5A 3U9PH 2BOCA 1XXDC 3VSUA 3LEXA 2FBRA 3JVFC 3MR9A 4LRNH 4AEFA 4NWUH 1N59B 1T03L 5CIPH 1QPPA 4WUUD 5I71C 3H56A 1NAMH 1ZHLB 3H9SB 4MB4A 1P7KA 4TTDC 1JGUH 2JB6B 3CHRA 4KZEL 2FCBA 4H1LA 1KGIA 5JIMA 4ES8A 3ETBF 1FP5A 2J8UA 3DBSA 2WLYA 4ODUB 4Y8AA 5E0FA 4JE4B 3DURB 1QASA 1HSBB 1FIGL 3HBQA 5CJ8A 3DHMA 2OK0H 1SBSH 2XYCA 4DSYA 3VI4A 2Q7YA 1CUOA 3LH2H 4NQVA 1J5IA 2A74C 1ZT7A 3KPQB 3OHMB 2APTA 3KWWA 2H6UA 3U4BH 2DQFB 2LAAA 4GPVA 3TYFA 3WY3A 1JMZA 4WW2C 5A3ID 3NTCH 2OAAA 4WI3A 1TEGA 3HKZA 3Q8BA 2DOCA 4FQ1L 1E2WA 3TXAA 4PS3A 4OZGE 4KX8A 4AVIA 3C5SB 4AVJA 2GTQA 4JY5H 5I8CA 3IGKA 5KBMA 3KBEA 1OGAE 2NQDA 2V2WA 3Q1SL 3L7FB 3GTTA 4KDTA 3FH8A 4H1LB 5C0EB 3K4AA 5TGBB 2BSDA 4OY9A 4Y4HD 1F45A 1KG0A 1M7IA 3MCKB 1ZHLA 3H9SA 3PDDA 1B6DA 4QJ4B 5KN5A 1MW2A 2NY0C 3A4EA 3LX9A 4UAHA 4NJAL 4OI7A 2LT9A 2I60H 2A73A 5DC2A 4C56D 3WIIH 4NPYB 5LDSA 1F58L 4FZEL 3GSNH 1NUGA 4DP2X 1I75A 4F33A 4XPHH 3ZUNC 2O6FA 3FS9A 3NOIA 4AENA 3QPKA 5AG9A 2OMVB 4YPGB 1QSEA 4DOHB 3TBCA 2Z35B 5HVHB 3V0IA 1R5IA 3L4TA 3QEUA 4A7GF 3DBXB 1AZNA 1VCAA 2I85A 1UJ3B 4L5FL 1FO0A 2BNUA 3VXRB 3RU8L 1E4XL 1TJIH 5KYUA 1L6ZA 1CTMA 3MCYA 4MCYA 5ANMB 1RD6A 3KH4A 3SKUD 2CH8A 2HG5A 2B2XL 4UAOB 3MUGB 4P5SA 2OYKA 3VA6A 4CW1B 1CK0L 3ZMRA 4PJFF 1CIUA 4JM2C 1HEJC 3IGAA 5D93B 4OCYL 5F96H 5AOZA 3FC8A 4QRTA 4BSVA 4PLJC 4XP9L 1E28A 2WIMA 2ZUWA 4NQSA 5F7BA 5J12C 5D8JL 2Y07L 4BGLA 5JW3H 4EKJA 4M6OH 5CGYC 2PXYA 1QMUA 2F2HA 1FFNB 1OE3A 4OGAD 3M7FB 1FCCA 1TSHA 3BYYA 4D9QD 1FG2A 2WXFA 1D5XA 3QFJA 4ZTOH 1IGIL 5ICZB 2DLFL 4WWID 4FFVD 2MQ0A 1MRFH 1OM9A 3DSNB 3MV8D 3O3AB 5DMGC 7TAAA 1ZWIB 1CQYA 1MXDA 1K4CB 3MRPA 5I1IL 3IJ9A 4GUOA 3GRWH 4WW1A 4DAGH 1UOKA 5AKVA 3X3GL 2ADYA 1J5OH 4G6AC 5I76A 1J10A 2CWRA 1IAOB 4OJYA 1T7WA 2HTKD 2ZP9A 1YN6A 1EO7A 3UBHA 2ICCA 1AY1H 2BC4A 4FQHB 4RAVB 4ZMLA 5EF3A 4FNTA 3X13B 2YRBA 3WTXA 12E8L 3CPUA 2M2DA 2J3SA 2E46A 1B0WA 2XX0A 4ZDHA 1E3ZA 4XPFH 1JG9A 3EUDA 2ZNWA 2PTUA 3O3DA 3MLWH 4G72B 1M1XA 2YAFA 3BQUD 1PY0A 3S2CA 4ODSL 1MAJA 1PLCA 4UQ3A 1H3VA 2APVA 4BD4A 5JMRA 3PNWB 1DCEA 3II1A 2FJSA 3GXUB 1J0JA 5KVMC 1UYWL 2BXZA 4P3DB 1PZSA 2XY1A 3LPWA 4AIEA 4L3EE 1KV7A 5MEND 1BECA 3A22A 4KO9A 1F00I 2QBWA 2WANA 4PRHB 3GEFA 4EJ1C 3T3MF 2OL3B 3P11H 1GSMA 1DEDA 5EZJB 3T71A 1LNUA 5CWSA 2J2ZA 4UQBA 3AM8C 4HVBA 4UT9L 4NKQB 1U2CA 1Q9LB 3TIEB 3HE7C 4UOQA 2YEQA 4DAGL 1ZVSB 4XNQA 1M2OA 5ESQB 3ARQA 2WYTA 1T1ZB 2YPLE 3MRQB 4X6FB 1KCRL 4YDMA 5KS9F 5MHSE 1E4KC 5FKPA 4FQIL 4WAFA 2B5IB 2BNRB 2ZYRA 3RZCD 1DANU 3P0YL 1QRNB 3ATDA 5FV1L 5C0AA 1LO5B 3B7UX 3GXDA 1EEUA 3H3PL 3VWKD 3IF1B 4FG2A 2WYZA 2V6HA 5C0NC 5JW3L 2R29A 4K7PL 3TJEH 4JFPB 5E8OB 4AEIH 3QORB 1SYVB 3ARDB 3PV7A 2VE6A 3IU3B 3JZYA 1NCCH 1HDMA 2LGNA 4PQXA 3F01A 1N5AB 1MOEA 2F8OA 2ZSVB 3VNYA 3CQQA 1MVFA 5C0AD 3OB8A 4IS6A 3GMPB 4IDLA 5D7KE 1PYWB 5DJ2A 2V4LA 5IMLB 1HQ4B 1IM3A 5D2NB 4WI4A 4QI3A 4PWHA 1FZOA 3BVTA 5HHXH 4L4VA 3GXIA 4L1BA 5BS0E 4QRUB 3K6OA 4JFHD 3BUYA 2VUYA 4PJHA 2EDQA 4WNJA 5LNEA 2E9GA 2FIKA 3EJZC 2QPFA 3C6LB 1P2CA 3B7TA 3EH3B 3UPAA 2WIIA 4XXWA 5I6MA 3OTTA 4AQAA 1D2OA 3CFDB 2D8KA 4OGYH 2FEDC 4K3EL 2VZVA 4YHMH 4DFIA 2ICEA 3QIBC 5CF3A 3QG6B 4E0RB 5DJAA 4AT6A 4LAQH 4OCRL 4YHLH 1AY1L 5FGCE 4K8RH 3CVIL 4U7MA 5DJ6B 3HMXL 3KPOA 3FRPG 3P0VL 4QJ3B 3JV4B 1KYOK 4U1IB 1ACXA 1A6Z