4X9FA

Crystal structure of dscam1 isoform 6.9, n-terminal four ig domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
393
structure length
393
Chain Sequence
GGADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Down Syndrome Cell Adhesion Molecule isoform 6.9
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 87
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA04
5DHVB 3KYNA 4FNLL 4HPOL 1U2CA 1BBJB 4E41D 1T66D 1F4XH 4RGMB 1WBXA 6FABL 1KEGH 2GSIB 1TJHL 3WHE1 2VZVA 2VH5H 3HE7B 4GO6B 4MA8H 1DSFH 2VSDA 3TPUA 4N8CH 4Q9QH 3L7FB 4Y1AA 4Y4FA 1TJGL 4PJ8A 4UAOB 5D9SA 1T21B 1FV1A 2C1OA 4NQCB 5T3XD 4JJ5B 1MCJA 2B39A 2L7UA 2IC2A 2WNGA 3KPQA 1N6QL 5GS0L 2J5LC 3I02A 1X5LA 5F6IC 4KK5D 4NN5B 5C86A 4XC1L 1T89C 4PB0L 3O3DB 4K8RH 4IHOB 4K9EH 4PGBB 3AB0C 1QSEA 5FDWA 4NQDD 5T3ZD 2EDYA 3HZKA 2ICWI 3U9UB 3IYLW 4DTGH 1A14L 2F58L 4L9LA 3BH8A 4ZUSB 4U1HA 4MNQE 2DI9A 3IXAB 3ZKNC 1D9KC 2YXFA 4PJBE 1I8KA 5I8CB 1EFQA 2NR6D 1XF4A 2V9TA 4PLJC 4XNXL 5J9PB 1TETL 5DSCB 2A73B 2A77H 5HY9B 1Q0XL 4RFOL 4U1SB 3JTSA 1CGTA 5GGQL 1NCUA 5FF6A 4AH2B 4X83A 3RAJL 1AGFA 3D85A 1R3LA 4M3KB 5JOFA 4KDTC 3QHFL 3QUKA 1FSKC 1GGIL 4FQQB 2DQTH 4KMTL 2QEJA 2XWBA 3ZHKA 4LLQB 1IQWL 4R4NC 5JOEA 3U2SB 4UDUB 2E3VA 4GKSA 5I8OH 4R0LA 5KSVB 7CGTA 1UVQA 5LKNA 4UI2A 3ULVH 1XGPA 1TZIB 1E4WH 1I8IA 1KLUB 2GK0A 3TCXA 3DUUB 4MB4A 5HDQL 3FCTB 5D8JL 3IDXL 4N0RA 5JHLH 4CVWA 5IMLB 1FZKA 1HHKB 2ATPA 3VRJB 2D9QB 3AUVA 1YDPA 2CGRL 5E6IB 2GJ6B 4R8WH 4NO5A 2NY1D 4YJZL 4K7FA 5IHUL 4NYLA 4G8EB 4JN1L 4J3VA 2HFEA 3TZVC 5ITFA 3IDYC 4U6XA 2EIZB 2JE8A 2Z4QB 4WO4A 4JB9H 4WDIA 3IDUA 1QSEE 1PVHA 1MCHA 3RQ3A 4JANA 4R6UA 1Q1JH 4OLYH 3VFRA 4CU7A 2NY5H 1Z9LA 3GHEH 1NKOA 4LU5H 4F33A 5HHMD 5IBLC 1WIUA 4L4VD 3TESA 3KWWB 4J4PC 3TYGL 3MLUH 1KEGL 4X9IA 2OK0H 4M5ZH 5D1ZD 3U1SL 2VH5L 4JN2A 3C6LB 2FEEI 1CFTB 1DSFL 5HHOA 2NX5B 4O4YH 4D3CH 1ZK9A 1NGPL 3KDMB 3QQNA 5C7XH 1F3DH 4NRXA 5EPMB 5K59E 2YA1A 3ZDXF 4X80L 2QSVA 1PX4A 1X5KA 1WBZB 1J0IA 3O45B 4K23H 1EHNA 1N64L 1OWWA 3ZDYF 2DYPD 4KKLD 4AIZB 1AR1C 4K8RL 4MJIA 3ESUF 1I3GL 2MKLC 4K9EL 3HNSL 1YMME 4JFHD 4N9GA 1ONQA 3O4OB 1MQKL 43CAB 4DTGL 1SY6H 5GGTH 4JFXA 1LP9A 5EZOH 1XIWD 3WD5L 4Y4HB 4WFED 2IANA 4BSVB 1MNUH 3MJ7A 5F3BA 2A9NH 5GZOD 5DURD 5C8JA 4H8WC 4NO0B 1Z0MA 5C07A 5DD5H 1AR2A 4OLWL 2IADA 4IEFB 1AHWA 3NPSB 3N85L 2C3HA 4M7ZC 1HHGA 2BXYA 3WFHA 5D70H 1ZHNB 2DQTL 1A22B 1NBQA 1NMAH 3NMEA 3BSZH 1FG9C 4TTDD 3G08A 5HGAB 1C08A 4KKBC 3CX5J 2W59A 2Q1EA 4W6WB 1E4WL 4Y5VA 3G5YB 1A6TA 3P4OB 2XZQH 4X7CC 4M6NH 4KK8D 4QHNA 3GJFA 4JM2A 4R97B 4L3CB 3OR7B 5ETUA 2NR6C 1EUUA 4RBPH 4YAQB 5HHOE 4D2NA 1B4JH 1FJ1A 4FTVA 1D5BA 1FQ9C 3PJSB 1F5WA 3VE0A 4NQXB 1A1OB 4O2EB 3F58L 3PP3K 4V2CB 3DGCR 3BN3B 3O81A 1RZFH 2DM4A 3QUZB 3TH3T 2BSSB 3AAZA 1UJ3C 5F89A 4M6OH 1P6FA 3VGBA 2BHZA 5BZWB 5K33A 2R2HA 3WHE0 3OV6A 1KIQB 3GMOA 4R90L 4PJIE 1UA6L 4WI6A 5GRYA 1ITBB 1A47A 3F7VB 4OLYL 3S36L 1T2QH 2X9YA 3BFOA 4LU5L 3H7BB 2ZWLT 4Z77A 4YWGH 4PP2A 5MENB 4P57B 2R2CA 1KTRL 3MLUL 3P77A 4M5ZL 2OK0L 4HWBH 4DW2L 3SQOL 3P73B 4JM4L 3LKPA 1IEBA 1LK3H 2NY1C 1XCTA 2ARJA 3IKCB 1KFAH 5C7XL 2P5EA 4Y88A 2DQUH 5D72L 3SOBL 3ZSSA 5EZLA 1CE1H 3SCMD 4UQ3B 1JZ2A 2HTLD 5EO9B 2X9XA 3D87B 4F37F 1NC4A 4Z76B 1OGTA 5JXEA 2X4UB 4X5WA 4MXVE 2HJKA 5FA3B 3DVFA 1TXKA 5ILTH 1ZLWH 3MLVH 5GISL 1ADQL 2HVKA 3S4SG 1Y6MR 1QLRA 3X13B 5GGTL 1FIGL 3KPSB 5D1ZC 3T1FA 5DJ2A 4B0MM 3PWJB 2XXCB 3OBAA 4U1MA 4FTVE 2AAVA 4X5LA 3QDMB 1LDSA 2KL6A 1WZLA 4PJHA 4EUPB 4PJ9D 5L0QC 1MNUL 2OTWB 1IBGH 4JPWH 3PGDB 5D7JD 2V2TA 1OP5K 4HJ0D 4X6DF 2NCMA 2QKIB 4P4KD 4EOWH 1QKZL 4Y16C 3AMLA 2R0ZH 5J89A 4JGMA 2ZCLH 1FFQA 1FZOB 3GSVA 4ZDHB 3W0WA 3QIBD 4KKLC 1JHLH 2X9WA 4AEFA 3P3YA 3WBDA 3BSZL 3TA3A 1U93A 3MRGB 3IDMB 2OZ4A 3D0LB 3OKEA 4M6NL 1MVFA 2IAMD 3WN5A 4AIXA 4F57H 5D96B 5E1HB 2X89A 4WUUB 3KYMB 3S98A 1JGUL 3VD9A 2QQQA 4P2RA 1HSBA 3NFPB 4I48B 5GZOC 1B4JL 3GB7A 4NQVB 2PW1B 4POZD 4P4RA 5FA4B 8FABB 2Z93B 1CN4A 4QTHB 2PR4H 3K81A 3OAYH 3RKDD 3L3JA 3V4UH 1NANI 1BVLB 5SWZB 1JGEB 2GCYB 4E0RB 4L8SC 1N0LA 5JPMA 3D0VB 4M6OL 5BQ7B 4TTDC 4UT9H 4WI4A 2IQAB 3SDXF 3KPTA 3ZKMD 1QOKA 5AYQA 5D7LD 4J7RA 2WUBH 3ES6A 4KK8C 1YNKH 1IC1A 1TVDA 1T2QL 1H5BB 2A6JB 1U91A 4FQJH 4ZS7H 3BVNA 3BDYH 4LGRB 1E6OH 5C3LD 3MLSH 4NHCL 4DKDC 3F5WB 1FYTB 2EDNA 5ECJE 2X70B 1LK2A 5EOCJ 4U1IB 3U4EB 5EC1A 1MLCA 4HDIB 2DL2A 3CH1B 4FQXD 1NBYB 1O5DT 3HZVA 3BKYH 3IFOB 4DGYH 4LF3B 2O26U 2YPVH 5F1SA 2E7BA 4N0YH 4OQTH 1SJHA 1TNMA 3JUZA 4WFGD 1S8DB 3H9SB 3OWEA 1DQQA 3MLVL 1DL7H 3BYTA 1AGCA 1OTSD 2XXMB 3FO9B 4UIMA 3BDBA 4OZGF 3PNWB 5IFJB 3EOBA 2XTJE 4YHOH 3ZHLA 3DUSA 1B3JA 1QLFA 3NH7L 3VXRB 5CUSH 4NNPH 5E2WL 4IRSD 3SCMC 4I2XE 4WV1A 3VFGH 1IBGL 4JPWL 1W72L 2BJMH 3MV11 5HHPB 4EOWL 4Q58C 4H5SB 1Y18A 2R0ZL 2EDOA 5JHDA 4WFFE 1KENH 3QCVH 3QIWA 3MJ8B 4Y2DD 1NL0H 2GY5A 3C8DA 3L5HA 5DFTA 1NCWH 3AS2A 1EO7A 3RI5K 3AC0A 4ZXBD 3FHQA 1NGQH 2DQFA 3MJ6A 3DOSA 5JMOC 3RDTB 5EUOB 1DBJH 4U0QB 2Y36L 4XWOD 1KIUA 4PJDF 3UDWC 4NQEE 4J1UB 3B9DA 2G5BA 5EOQL 4M43L 3TIDA 4F57L 2VDPL 4FP8H 3V0VB 3HR6A 4PJ9C 2W91A 4GLRH 4ONGH 5D7JC 3W82A 3ME0A 3OAUH 4HJ0C 4XRCA 4K71B 4P4KC 4H88L 4P9HH 3P11L 3I6KA 5F88B 3QJFB 4DQOL 1ACYL 4X99A 1XF5B 2PR4L 3LN4A 3KYKH 1RZIB 2DDQL 3QIBC 4CVXB 4DFIA 2A6DA 1KJMB 2GEEA 5BVJA 4FHBD 3KNBB 1CFSA 5ID1B 3FAWA 4D9RE 2JELH 4EIZC 4YHYC 1MIEH 2JJTA 1LE9B 2WUBL 1YNKL 3HUJB 1R3JB 4ELKB 4LCWA 1A6ZA 4HK3N 4ZS7L 2VR5A 3RWIA 1E6OL 1S7QA 5T1KD 2DKMA 3K8KA 15C8H 3MLSL 4UZGA 4ZO7A 4POZC 3O6FA 4ODUA 4PJFF 1AGDA 5L6YH 1GIGL 3WO3B 4LLDA 1OD7A 3KHQA 3RKDC 3DGGB 1AC6A 1XR9A 5IQ9A 5DQ9B 3P4MA 1SVZA 1NC2A 2EC9U 2W9DH 3N1FC 1HILB 3BKYL 1CFQA 1KJ2L 5DJ6B 2F5AH 1NJ9A 4YHKH 3K7UA 1F3JB 1WAAF 2NW2A 3LMJH 4R4BA 1MY5A 2YPVL 5TE4H 3LKOA 4OQTL 4N0YL 4L4TA 5FECB 5DLML 2DMBA 2I9LA 3O11B 4H26A 1G7LB 1JWUB 1T1YB 5BV7C 2JCCB 3TYFB 1J8HA 1MFDH 3HB3D 4YHOL 2NY2B 4RFEA 3TJHD 3QISA 3OKNB 3HPLB 2ZUXA 4ELMA 4NNPL 4FQXC 3PGCB 1S7SB 5C9JB 2MMXA 3MGTA 1KOAA 2AEWA 2LFGA 1CD1B 3CFCH 4FMFA 1DBAH 4KK6D 4G43A 4Q97A 3QXTA 3SE8H 3QCVL 5ID0B 4D9QE 1NL0L 1T1XA 4LLYB 3L3GA 4OZHB 2A6KB 3DYMA 3FRPA 1MCCA 4XTRD 5E2UL 5DJXA 1NGQL 2W0FB 1OTSC 1RK0B 4IIQA 4LCWE 4XBGA 1JN6A 1ZMYA 5TQ2L 4X6EB 5E4EB 5AWNH 4HCRL 1IZJA 4Y5XC 4FP8L 5KSBE 1P7HL 4IRSC 4PLOB 1ES0B 2OMNA 4ONGL 2IBGA 4JDZB 4XAWL 3PWNA 3D2UA 2FYYA 4DUXA 5B39B 1CXFA 4UINH 2DI7A 3CX2A 1HHJB 2EDJA 3VFOB 4ZXBC 4H0IA 3BWAB 4G6KL 1FNEB 2IWGA 1RVFH 4PRIA 1BMGA 1J87A 4L4TE 4XWOC 2JELL 1S7RB 2FH8A 3QI9C 4OBSA 4F7TB 4ZTOL 4JREC 4BZ2H 4WHTA 1UT9A 1KG0B 1MLBB 2CH8A 3SGDI 1FPTH 4M93B 2ZNWA 2AKRA 4ERSH 5IVXA 1QRNA 2OS7A 1P7KA 2GW5A 15C8L 1QBAA 2J88L 3MUY1 5T5NF 3HPJA 5DC4B 3KLDA 5E4IA 2C3GA 3U0PB 1V5JA 4OD1H 3FB7B 3O0RL 3B6SA 2W65B 2W9DL 2C1PA 4HJJL 4RMUA 1P5VA 5LGJB 2F5AL 4LFHG 3T3PF 3EDFA 4MNHA 5K9OA 2F5BH 4QOKE 3LRSA 5IUSA 1HEZA 1YPZA 1IAIH 3O3EA 1R3KB 5TE4L 3HI1A 1KCKA 4FQ2L 1IT9H 1L6ZA 5C0IB 5DUPL 2FHFA 4S1SH 5ISZD 4U2YA 5C6TH 4KXZI 4OF5A 3VFUB 3C60B 4G6FB 1NEZB 2MTPA 1YNTB 2OCFD 1BLNB 4LPCA 5EBLB 2P24A 1MFDL 3PHOA 4KJWD 2CJUH 1BOGB 1OARH 3RUGA 3MLRH 2IBBA 3O6LH 1HH9B 4TUJA 2BMKB 4K94H 2QQKL 4R26H 5KTEH 1GL4B 2K1MA 5HHQB 1ACZA 2ESVA 3Q48A 2R2EB 1XGRB 3S9DB 3DRQA 5I18H 3CFCL 1CGYA 1D5MB 5FXCH 1DBAL 4TNWF 1DDHA 1T22A 3KS0J 1OM3H 1KUMA 1T80A 1JWMB 5I15H 3HR5B 4PBVC 5HGDB 3ARYA 2AV1B 5DUBA 5B38A 3KJ4B 4IJ3C 5I1LB 5E8DL 4JEGB 1WZMA 2PO6A 1EFXA 5C0AB 3HB3C 5AWNL 5IVXE 3QWRA 3OL2A 3KPLB 2YKLH 4TRPH 2ZG3A 1CF8H 4PJAB 5LAXB 3UZVB 4G6AD 1F4YH 1T7XA 5CSZA 1LO0L 5DJYA 1N5YL 2EYRB 1U8PA 2W0KA 4JCLA 3EO0B 4NPYB 3STLA 4KK6C 2MCPH 5SX4H 2JB6B 4X7SH 2UWEE 3CZFA 3ARGB 5EORH 1YPZE 5CLWA 3NIFF 4XTRC 4NM4H 4GRMA 1RVFL 3T2QA 4BZ1L 1FL6B 4JCMA 1PG7L 3DBXA 3CSBA 1ORQA 1Y0LA 2J1KA 1BX2B 5IT2L 4Z0XB 2LE9A 3F8UB 1K3IA 4R7NB 3RUGE 4P23B 2B1AH 1FDLL 4PJEF 4XZUB 5HD8D 1MFCL 4XCNA 3V5DB 3QQ4B 2CKBB 1GZPB 4J8RA 2H2PD 1VEPA 4OD1L 5F70A 2BRRH 5FIEA 4WU7B 3EFDH 3BH9A 2DLIA 3ZYJA 1CLZH 4OI7A 2C26A 5CZVH 5EC2A 2R1WA 1ZT4A 1P6AB 4LVNC 1T89A 2F5BL 1JZ8A 5D7KD 5BW7C 1DUZB 2Y7QA 4M7KH 5KBNC 3FQWA 2V7NA 4PB9H 3T0ED 1UXSA 2AK4D 5HGHB 1K8DB 2LU3A 4CMMA 3DTXA 2H32A 1D9KA 3JWOC 3MRNA 3REWA 1P9MC 2VLLB 1P84K 1UQSB 2CJUL 3AU1B 1OLLA 1OARL 2E6PA 2YR3A 2OZ4H 5D6CB 3O6LL 3A6BH 2OI9C 3FT4A 5J1AB 4K94L 1RZGB 4L3AA 5JR1H 1M6OA 5FUZH 4CUCA 2APBA 4ETQA 4Z7UB 4HXAH 4KDTA 4KUCD 5I18L 1CE6B 5HHXH 5E8EA 5CP7A 3SKJH 3MLWH 1C5CH 3MV8D 5JXAL 1SYVA 2F53A 3MNZB 4G9FD 4ZSOB 3PQYE 1OM3L 3TO4B 3VFVB 3WO4B 3LZFL 3HC3H 5IEKA 1GCFA 1F3RB 3P9WB 1G7HB 3UJTH 2H3NA 1N6UA 2NNAA 1I7RB 5B22A 3CPLA 3QUXC 4ISVB 1IC5L 1UEMA 4PG9B 4XPBL 1RZJC 4OFIA 4KJYA 5J57B 4KJWC 2HLFD 2Y5TB 1X9QA 3U7AA 4TRPL 4BELD 4PGEA 1ZVSA 2E6JA 5FB8A 5I66B 1A1NA 1FG2A 4EDWH 1PBYA 4JFPB 1F4YL 4FQCL 1SBBA 2CLZA 4U1KA 4NKOA 3KYOB 3FKUS 4QGYA 1QFUH 2APTA 5DD6A 2I25N 3LV3A 2MCPL 4OGZA 3TZVA 5MP6L 2ED7A 5EU3B 5DVOA 3CJJA 4X7SL 5EORL 2QBWA 1NLBL 4KQ4L 1FGNL 3QR2A 4P5TB 9CGTA 4QRQA 5KOVC 2VDOH 4DVRH 1A6VH 5E5RB 3D9AL 1JTOA 4J4PA 1Q72H 4G6AC 3T8XA 3FQXA 2B1AL 2M2DA 2XA8L 3P0YH 1D5XA 4AY0A 5D7IF 3RWJA 3WL9B 1IE5A 3X14A 4BQCA 3DX7A 1BFOB 3ARDD 4OJFL 4UILL 5FKPB 3RWEA 5LBSH 4WJ5A 4RX4D 5HVHB 1CLZL 3QP3A 3LEYH 3CDFA 4ZO8A 3MRLB 3X12B 4UOW0 1RUML 2YD1A 4YFEA 3VFNB 4JHBA 2X4QB 2VDLL 1RZ8B 4M7KL 3FN3A 4Y19D 5E94A 1CU4L 4S2SA 2F74A 1HI6A 3CU1A 3D3VB 3MCKA 1BFTA 4ZFOB 4Z7VB 3TBWA 2Y9RT 2H9GA 4U1JB 3F7QA 3UROR 2YC1B 3GJEB 4HC1A 2OZ4L 3QPQD 1FLRH 2YD4A 2H2PC 1P69B 3JWDC 4EI5B 1A2YB 4JLRA 1H3PL 1VENA 3OX8A 4N8PA 3AFLA 5ADPL 3FRPG 4HXAL 4HULB 4PRAB 5FGRA 4OZFA 3HZMA 3VG9B 3BKMH 1G6RA 5HHXL 3VXSB 3SKJL 1I75A 5D93B 1V05A 3VFMA 3OXRA 1X5YA 4HLJA 4GRWB 5JQHC 1ZWIA 3C5SA 1DANU 4NQDA 1ITCA 3HC3L 2CIIA 4QNPF 2P5WB 5EUKA 3T0EC 3UJTL 5HVFB 3R8QA 3O6KL 5D1QD 1ZLUK 3T77B 4N5EC 4XPTH 5EU5B 2GT9B 5C3TA 4FXKA 3EO1B 2Q76B 3VGFA 3H0TB 1VPOH 1IGTB 4EDWL 4NQCD 3IJYB 5F7FA 3ECBA 3QCTH 1M05B 1QFUL 3FAXA 2XNAA 2VUOA 3P30L 2HH0L 3CZJA 4BH7B 3K8LA 5IGXL 2WBJB 3D18B 3OB0K 1UJ3A 5KS9F 4F58L 3SE3C 2FJHB 1MPAH 4HKJA 2DWDA 3RL1A 2VABB 3VFSA 3VWJB 3CFIC 4DVRL 2HLFC 4IRJC 1MOEA 3RFZC 2UUDH 3P4NB 1NLDH 1P1ZA 3O4LB 5D1XB 2ARJQ 5KJRH 3VGEA 4I8DA 1YUHB 2NXZB 2X09A 1T03L 4HG4K 4YHNB 5J1TC 4XNMB 3RWDB 3L9RA 5B8CB 1JK8B 2FJGB 4U3XA 4TUKL 4W6YB 2GQHA 2EE9A 3WHXA 1EAPB 4GAJH 4BH8A 1QSZA 2DTSA 3IDJA 1B0GB 1UWEH 2BNUB 3E6HA 1OTTD 4K7PH 2WINA 4K2UH 4N90E 2PTTB 3GK8L 3LEYL 3OKOA 3DHMA 3GSOB 3Q1SH 3GMRA 2X2YA 4HUXB 1AP2A 3D39B 4WTXA 1KJVA 2EKJA 3QXDA 2HJFA 4AEIL 3KJ6L 2G60L 5D1ZA 4UU9B 4S1DD 1TZGH 3IDGA 4RMQA 4G8FA 4Y4KB 4A6YA 3UTPD 3A6OA 2GUOA 2EXYD 5ALCH 2APVA 3L7EB 1MCFA 2GJ6D 3FOMB 5FO8A 3I3BA 1FFNA 1FLRL 3ARDC 5ESQA 1ZT7A 4DKEH 4GAGH 4NNYA 5DXWA 4Y16A 3U0WL 3VXUE 1ZSDB 3UPRB 2PCPB 1DBMH 3LN5B 5KVDH 5B38G 3BKML 3UTZB 4HPYH 4W4NA 3BW9B 3E6FB 5BMFL 1EEYA 5FDYA 4MCZA 3QDGE 4POUB 3MPCA 2DQEH 3SY0B 4EN3B 3LQZB 1MUJB 3KPRD 2BHUA 5IVZB 2FEEL 4U4BA 3WSQH 3CFKB 5CWSA 1JNHA 3ZZ1A 1INDH 2D0HA 5E5MB 3OJ2C 3ISWA 1VFUA 1T5WA 3WNLA 3PWPD 3GRWL 2Z31B 1WBYB 4K7PY 3S5LA 1VPOL 3BOVA 5H35B 2AJUH 4E5XA 1JHKH 5AG9A 3QCTL 3GGWA 3QH3B 4E42A 2IMMA 4BK5A 3U4BH 3HC4L 3O3UN 1ORSB 5DJ0B 2W60A 3QJHA 3PL6B 1MI5D 3HA0A 1NMCB 4WFHD 1EERB 1JPFA 2BFVH 4N1EA 4RGMC 5AD0A 2FBJL 2Q6WA 5IMOA 1GGUA 3QHZH 3ZDXE 2CLRB 1P2CA 3HE7C 2AJZA 1KSRA 1IEHA 3RIAF 1OAKH 3F7PC 1S9VB 1PZ5B 1T4KA 3B9KD 2FIRT 5IHZB 4TUOB 4UNVA 4Y8DC 1NLDL 3ZDYE 2P8LB 4UAOC 4IMLA 4C83A 5KJRL 2VSCA 3OG4B 3BZ4B 1U8IA 5DQJA 1KNOA 2O61A 4OAWB 5E8OA 5JPNA 4NN5C 4QCIA 1K5NA 2G75A 2IFGA 2I24N 4U1NA 4WUKH 1Q94B 1U41A 3FT3B 1JGLH 4CVZA 3KXFB 4K7PL 4MS8D 4K2UL 5CZXD 5EDXA 4X4YA 4LMQI 4Z7WB 4YXLL 4KUZH 3W5NA 3MCLL 5C0BB 1HZHL 3V2AR 1HCVA 5TGBA 3O2VH 4K3EL 4MX7B 1NANH 4ODVL 3CVHA 1S5IL 3MRFB 4CN4A 2K7PA 4MWFB 2YPLD 4AQ1B 2Q20A 3MRMA 5EU6E 4NSKB 3SCMA 4DVBB 2BNQB 3QUZD 4JHZA 1FVEA 4M8VA 3WS3A 1EHLL 4DKEL 4GUPB 4KHXH 3MUZ1 1RJYB 4IOIA 4QYOB 1UYWH 4XI5D 5KVDL 4YHPB 1T2JA 4HKXB 4HPYL 4O5LH 4QXTA 4R2GB 4QRUB 3UYPA 5CBAB 4OIIH 4NRYA 1G1YA 1MCIA 1T5XA 5DI8A 4MSWB 3K2UH 4X6DA 4FXGB 5CGTA 3WSQL 5MEND 3VCLB 4LHQB 2P1YA 3UDWA 1INDL 2EXYC 1CDYA 2DLFL 2BVTA 2P8MB 1CS6A 4HEME 4PJ9A 4XP9L 5D7JA 2VXSH 1A9EA 5IBUB 1XGUB 2HN7B 1CL7I 2AJUL 4P4KA 5E00B 2GTWA 1OP3K 2RBLA 3G5ZA 3U4BL 2XQYG 3QIBA 3VD5A 1SJEA 1JRHL 4HMDA 4XNQB 3T0AA 2HT4D 1D6VH 4JG0H 3M17B 2B7DT 1BIIA 4WU5A 5GGSY 2QR0A 1FRGH 5LJYH 4DZBB 3ROOB 3E3QC 3ARSA 3C6LC 3GO1H 5H2BA 2ADGA 5BCAA 3EOAB 1OAKL 1JNNL 1J1PH 1EBAA 4NC1C 4QF1B 3DRTB 4XMPH 4D0CA 3ZKXB 2FJFA 4TSBH 3OAZH 2BY0A 2PETA 2J8UE 4M6MH 4H1LB 3RA7L 3SDXA 5MEQB 4V1DD 3OGOE 3T2NL 2EDWA 1B0RA 5FKAA 5CJ5A 2H32H 4OFVA 1VGKA 2AJXL 3NCEB 2E9IA 4GW1A 4WUKL 1ED3A 4RDQF 3GNMH 1U6AL 1JGLL 2I26N 3I85A 4YXKH 4HWUA 2BY2A 3GKZA 2UYLB 2WP3T 3BN9D 3O4OC 4G8GA 3UTSD 4W70A 1A1MA 4JDVB 2R0WL 5E2TH 5D7LA 4P5KB 2V5MA 1KYOJ 2YA2A 2VDKH 5F9JB 4KUZL 4ODHH 2GK2A 4Y4HC 5DTFB 4PYHA 5C0JA 3NFNB 1KV3A 3IS1X 4AENA 1TVBA 5FO9B 1DLFH 1WZKA 1MHCA 3BEWA 3KLAA 3A67H 1JV5A 3BZDA 2Z91A 3MRBA 3LS5H 2E7CA 1EHAA 4X8XA 4L8CB 2DI8A 4OZFG 5T1LB 1OTUD 2YBRB 5DGRA 3NPSC 5IJVA 4ZFZB 5LCVH 4EQ2A 4FQXA 5AYUL 3E2HC 3LIZL 3R0MA 4MA1B 2VLJE 5CEZH 2OL3H 5C09D 1S7TB 4P9MH 4OZGA 5E8PB 3NCBB 3ELAT 4KVCL 3CCHA 5CZXC 4ONHB 5JA9A 1NUGA 4OIIL 3ULUD 4XNUH 2AXFA 4NKMA 1J88A 4KPHH 3K2UL 1QHOA 3HAEA 2DJSA 3O8XB 1TQBB 3BKCL 2I5YH 2GTZA 1A9BA 4QHKJ 1OAUH 4ZFGL 2VLKD 3B8YA 3IFPA 1LNUB 1FYTD 1R6VA 5AUMA 1NBZA 4Y5XA 1IAOA 2H8PB 4L3EA 3RY4A 3SDXE 4IRSA 3LOWA 5IM7B 3QUZC 5KG9B 5A16B 4M7JH 3BD5A 4O02H 3DX6B 1G9NC 2PTUA 5FM4A 2R69H 4M61A 4PJDA 4WENB 4ZOAA 4XI5C 4MQTB 1AH1A 2NY6B 1DE4A 4D0BB 3OHXA 1RHFA 4QXGH 4LPUA 4G8GE 2MQ3A 4MJ5B 1D6VL 4JG0L 1IARB 4QT5A 1IAKB 4ZXBA 1ZV5A 1KXTB 3QPXL 1KLFA 2VDNH 1F00I 4J3WA 4APQB 3H9SD 1FRGL 5IK3A 4MGXA 1UM5L 1IILE 4OF8A 5DO2D 3QI9A 4UIKL 1UC6A 2LVCA 3SPVB 4LAQL 4LGSB 2PYFA 4LSUH 3LCYA 4RAVB 1NFDF 2HVJB 3MLZL 3TNNA 4XMPL 1QQDA 2NTFB 3SDAB 3T4YA 4M6ML 5I0ZA 1BP3B 3OGCA 4MHHI 1FBIH 3H9HA 4U6YB 3CH8A 2A1WH 1PSKL 1T04B 2VZSA 1ROWA 1P4BL 1UWXH 4OTXL 3ZE0E 4L29A 1ZE3C 5ICXA 2O5ZH 1L9MA 1ZXQA 2AGJH 2HT4C 4HGKC 1NMBH 3GNML 5KVGL 1UKTA 4HUUA 1B88A 4YXKL 5TH2A 4HC1H 1YN7B 1MCWM 2RFXB 3BGFB 3NABH 3TH4T 1DVFB 2ZUVA 4H8WH 1NGYA 4PJFA 5T3XH 1UJTA 3RDTD 3SE4C 5A43C 3K4ZA 2EYTA 4OM1H 3G6DL 1QO3B 2VDKL 1CIUA 4NZJA 4ODHL 4L8BB 4OZFH 5ESAB 1G6RH 5FYKE 2FX7L 3HNTH 4I18B 5C0RH 5DJDA 3PV6A 1ZLVH 1DLFL 4LKXA 1BVKB 2A83A 2RJMA 3JVGC 3MFFB 3MRIB 3A67L 3IB4A 1MEXL 4WW1B 5T1KA 2Q7YB 3OXSB 5SWSE 3RZCB 2YMXL 4L3EE 1WAAA 5EUOF 2C4XA 4OCRL 3MV9B 2EEDA 2ZSVB 4F7MA 5LCVL 4CJ0A 3KLHD 4NJAL 4I1NB 5CBEB 1HK6A 4MNGB 5HTSA 3BMWA 1KBGH 2HFTA 4ODXA 2OL3L 1G7QB 5CGMA 4RQQB 4P9ML 1I7UA 3BN9C 3LHPH 4NNXA 3SGDH 1U8HB 5E7BA 4HK0A 1R5VA 4MCYA 1NCCH 5D96C 1YA5A 2DJ4A 4KPHL 2V7HA 4ODWA 2MPAL 3S5LG 4BSWB 1PY4A 2W0LA 2ZCHH 1NGXA 1OAUL 3RL2A 4U1LA 1OTUC 3FO1B 3QO0A 4XBEH 1LGVA 3UC0L 3ZE2F 2E27H 4DEPB 3H42L 3WNNA 2GAZB 3W11C 4GG6F 3C2SA 2FZ3A 4HS3A 4TNVK 3RP1A 4DAGL 4JFOB 5KVEH 2VXTL 4NZUH 4MDIB 5IJKC 2IPUK 3MV7A 4DUWA 5TDNA 4KXZH 4RZCA 2BVPB 1JTPA 1UCBH 4KI1A 4MA7H 4NM8H 2KUTA 3QFJB 5ERWB 4HUVB 4NQTA 1H5BC 1YY8A 2R0KH 3T65A 5IR1B 2VDNL 1G84A 1QTYT 4DGIH 1RJZA 3KR3H 4PJCA 4XCCL 5KVFH 5I1CH 3I6GB 4I0KA 4LGPB 2NY2D 2BOBB 1I1RA 1HDMB 2FX9H 5FYLD 1RQ5A 4LSUL 2NPLX 3GSNL 3TO2A 1MFNA 2H1PL 3RWGB 4NBXB 3TH2T 2DBLH 2E7HA 2FLRT 1MHHA 2JCCF 1UADC 5I17A 1PY9A 1JHTA 1MJJB 4A6YH 3LPWA 2QHRH 4TSAL 4N0UE 3LKRB 1VCAA 2AGJL 1EA9C 3BP4B 1JI2A 5CHNB 2VXVL 5JORB 2HJLA 4HC1L 3VFTA 1C5BH 2Y07H 3NABL 1J0ZA 4YHIB 1AJ7H 2CO7B 3PWVB 4H25A 2RQ8A 1MRDH 1URLA 5DO2C 5EWIH 3T0WA 5BW7A 1A3LH 5DQDH 1K6QH 3BO8B 1S9YB 5H94B 5MERB 4YGVB 3VXPA 1T0PB 4GMTH 1G6RL 5C0RL 2E7MA 3HNTL 4PRDB 4PJGB 3P0VL 2NXYB 3S8WA 2IPKA 2W38A 1WTGT 4X6BA 3RNKA 1R24A 1P9MA 3GBNL 3SDCB 3OKLB 2Y25A 3VFWB 1DR9A 1ZANH 1KACB 5KSUA 2YOCA 1FSKB 4KI5D 5E24E 2D4FA 2VL5A 3D48R 3SBWC 4OCLC 3EJYD 1VFMA 1KBGL 3MV7E 4NO3A 2Q8BH 3RDTC 1MJ7H 1QSFE 5A2FA 4AEEA 1NDMB 1AQDA 1NCCL 4EDXA 3B9VA 4LMQE 1LEKB 3QUXA 2WIIB 3BZFB 4CNIB 5FAAA 2QSCL 2ZUYA 3WE6A 3SKOB 4AZ8A 5DJZB 1MJUH 1AGBA 2W9EL 1IGYA 4K71C 4JY5L 1V7NH 1A7BA 4LRIC 1CG9A 5KVMC 1KTLA 1HQ4A 4N1HB 4XH2B 5B3JF 2E27L 3JTTB 4HJGA 5BS0E 3KLHC 3G04A 1W72B 4M1GL 3X3FL 2BSTB 2AEIT 3CUPA 4TVPD 1JNJA 4YNYA 2XN9B 3U46B 3V6FA 5EBMA 4KJQD 4MQSB 3M1BB 4HZLB 5KVEL 3DO7B 3QAZB 5EG6C 4NFDA 1WIOA 3TBTA 4HFUL 1QR1B 2YD8A 4JFFB 2R2BB 2HMID 4LSDA 4M6AA 3WJLC 4LCUA 5IG7B 2D9CA 1UCBL 3U9PH 4MA7L 1I8MA 1LQSR 1I4FA 1NAMA 1II4E 2R0KL 3QWOA 4LPXA 4X4MA 1BD2E 3C60D 3KR3L 2R23A 5DDHB 5I1GH 5LG1A 1LD9B 1M1SA 5KVFL 1HIMH 5DWUL 3T3PE 4QRSB 4UQ2B 5L2KD 4YBHA 3WEXA 3MLYH 4QRPA 3V7AE 3V6OC 4OCMC 3X11A 2DBLL 3CSYB 3PWUB 3U7YH 3VJ6A 4JRXE 4MLIA 1J5OL 1H15B 3LQAC 3CVHH 2QHRL 2X7LA 4J3OC 4E41B 3GSQB 4ZODA 1E4XI 3Q3GB 3LKSB 1OSZB 1K4DA 5HVWA 4XB7A 1IGCL 5HGGS 1C5BL 3H3PH 4JHWH 5TDOA 3SE9H 1JUFB 1MHEA 1A3LL 1K6QL 5C0AD 3QO1A 2NY2C 5BO1H 2EDXA 4GMTL 4ORZC 5DD0L 4RRPA 3OR6B 3MODH 1U8JA 2QJDA 3LD8C 1LE5B 4OF6A 2BK8A 1JZ7A 2Z35B 4LSPH 1FZJB 4LHJB 3MMEB 5F1NB 2BNRA 5IQ7L 4M62H 1I8LC 4HHAA 4J6RH 1KJ2B 2CUIA 5SV3A 4PJAF 1Z5LB 1EXUA 5EBGA 3ARGD 4P0DA 5EO0A 3HAEG 1RHHA 1SVCP 5DRZB 1FVDB 1RJLA 3TT1H 2Q8BL 1SBSL 2R1XB 2VO5A 2AXHA 3G5XA 2L4OA 4Q6IB 4X4ME 5E4EC 1IMHC 5DS8A 3DJ9A 2VOTA 3EOYG 1BZ7A 2UY6A 3DURB 3T0EA 4XBPA 4ZPVB 4HIJB 4ODBD 3PHQB 4IS6B 4PG2C 4QRTA 4P23D 5IV2A 5F1OB 3FFCD 2WP3O 5D5MB 1YEJH 1MJUL 1I3VA 4F7PA 1RMFH 5DK0B 1EEZA 4QRPE 1RU9H 3NIFE 1V7NL 3BRDA 5K9KA 1E6JL 4KI5C 2VERN 2V2WB 4FZ8H 4U6VH 3O3BA 3WXVH 4MNQB 3EGSA 4YO0B 5GQBA 2BC4A 4I9WD 5LVEA 1QVOA 3MV8A 5ENWA 4MJ2A 4G9FA 4JFED 1UACL 2VISA 4PJEE 4OKDA 4HWNA 3S35X 4GSDL 3SE3A 4KV5F 2NLJB 2FGZA 4G9DB 3STBA 5IEHB 2Y06L 2VN7A 3NOIA 4GXUN 4M93C 3UAJC 3T04D 3K4AA 1A7RH 1J0JA 1D5ZB 2DAVA 5JTWA 4OF0A 3BP6B 2DLGA 4FQ1H 5I1GL 2ADFL 4IRJA 2NW3B 3GUTA 3UTQB 4S1QH 5DMIH 2BNRE 3RWFB 1KF9B 2X4NA 4KJQC 2VR4A 4P5MA 1N2RA 5IW1A 1PG7W 3P9MA 4P2CG 1TMCB 4HBQA 3U7YL 2QLVB 5BV7H 1FN4A 35C8H 3CIQA 5FK9B 2PXYB 2HMIC 3CVHL 3IDIB 5FCSH 4CAGA 1GOHA 4L4VB 3TO4D 1F6AA 4HGWA 1AC0A 1F4AA 2L0DA 3A6CH 3H3PL 4JHWL 4Z7UF 3MXWL 3HI5L 3C60C 4X8JA 1G7MB 5JW4N 5ANMA 2FGWL 2XZAH 5BO1L 3WXWH 1EX0A 4TQEH 3TWCH 5INDA 1H0DB 1QYGH 5KW9H 3HZKB 5BOZG 4HWEH 3GMNB 3CFDA 2EYSA 3HAEH 4M62L 2DYPB 3ARDA 3AMKA 5FYKH 5I16B 5MEPA 4KH2A 3U36A 1U8NB 3QIUD 2R1YB 4UUJA 4YDJA 4ZOEA 1WCQA 3OJVC 3CDGB 1BFVL 2VZ1A 2GHWB 4RBPK 2FO4B 4CMHB 2AJSH 3JWNC 5EBWB 3SJVA 3ZHDA 3BGMB 1XIWB 3TT1L 3KJ4C 3NFSH 4WI9A 4Z78A 5ICYB 4P5TD 1BZ9A 2DM7A 3MRCA 1ZS8A 3IU3B 1X7QB 5EOTB 1O7VA 4FFZH 5F7DA 1CWVA 1J05B 1BJ1J 4YX2H 2CUMA 1YEEH 1YEJL 1YJDL 3DPBA 3GSWA 1RMFL 1YMMB 3BZEB 1RU9L 1YY9D 1PLGL 4M48H 4L8SB 3R0NA 3LS4H 4MD4B 4U6VL 4M9OA 2DLEA 3B5GA 4P2YA 3NCMA 3TC9A 2AJ3A 3ARGC 4WGWB 3LEXA 1Q9OB 5GZND 5DHVA 3WV0A 3RIFF 5CIPB 5DJCB 3SN6N 3LKNB 4YDKH 5ALBL 1BBJA 5D7IE 3O6MH 4ZTPH 2C7UB 3BHBB 5I30H 5ANME 4I0PD 2GSIA 5E99H 2MQCA 3D3VD 3H3KA 3HE7A 4QRRE 4P23C 4G42B 4AM0B 4KGJA 1LO2H 3SDDD 3L7FA 4N8VB 3VA2C 1Q9KB 4S1QL 2DF3A 2DD8H 1T21A 4NQCA 5F7MC 4EI5D 4JJ5A 1ZLWK 4LVHB 1OPGH 3ARUA 5T5NG 4Z7VF 3VXSD 2X41A 1JF1B 3DV4B 4RAHA 4R7DB 3O3DA 4IHOA 3SJVE 4JG1L 1UB6B 3U82B 2M26A 4PGBA 1XGTB 3NBNA 3U9UA 2BOCB 2MNUA 4PFEA 4LP5A 2P5WD 4P2QE 4ZUSA 3IXAA 4S1RL 5I8CA 4YC2B 3OF6A 3IJSB 1MHPH 2XZAL 5CS7A 4O2CB 5J9PA 5DSCA 3QEQD 4GRWF 4ZPTB 2A73A 5HY9A 1L0YA 1MCSA 4LQFL 4TQEL 4KZEH 4N1CA 1P7QD 4PJIB 4U1SA 4TPRH 1VA9A 3PGFL 5EZIL 5KW9L 4AH2A 2DRUA 4HWEL 2MOVA 3NTCH 5CINH 4QNPE 1MCQA 5FYKL 4FQQA 4PIRF 3F7YB 4LLQA 3U2SA 3VMNA 2ICES 4UDUA 5KSVA 3TO4C 2DICA 2ICEB 3WO4C 5A2IH 4Y7MA 4JKLA 1TZIA 4PV9B 1KLUA 4KMLB 4L5FH 3WKNA 3NFSL 3DUUA 1AD0B 3Q5TA 3DVNB 1CDBA 4O58L 3OAYK 3FCTA 1KEMH 2CDFB 5F9OH 4XXCC 3Q6FB 4FN0A 1CK0H 2ZCKL 3O4LD 4OFYA 4QHUB 5D1XD 4BQ8A 5IMLA 1HHKA 4GRLB 2VQ1B 3VRJA 5KS9E 3JV0A 4YX2L 1YEEL 2NXZD 5E6IA 1J10A 2GJ6A 1WWWX 3LDBB 4G8EA 5JO5B 4M48L 2ADJB 2FATH 2H45A 3ARFB 3LS4L 3QA3B 1WQVT 2EIZA 1NFIB 3BGAA 2WWMC 1TPXB 2Z4QA 1CGSH 1D5IH 1SQ2N 5C0CD 3STZB 1TDQA 2D4DA 4WHCA 2IAMB 4LASH 3V6ZB 5DMKB 4P5TC 3F62A 3KPNB 3CFJB 5FYJD 5IF0B 2V9RA 3O6ML 3F6LA 1GGBL 3IU4L 3VG0H 3KWWA 5F96H 4WGVB 3WNMA 3BP5B 1PQZB 5E99L 2LAAA 3K46A 5GJTL 3O41B 4XGZB 3C6LA 4Y4KD 4NUGH 1CFTA 2NX5A 1A4KB 1X6LA 4ZOBA 2YEZB 3KDMA 1YY9C 3ZL4H 3L3HB 5EPMA 2DD8L 4PJHF 1GH7A 5L2JB 1RURL 5I19L 3IAPA 1WBZA 5HVHC 1OPGL 3O45A 5GZNC 5HYEA 4NKIL 4AIZA 4C4KT 1PAMA 5M95B 4OQ1A 1TVHB 3REVB 1GGTA 3IXTB 1X5XA 4EN3D 2X1QA 1G9MC 4RRPG 43CAA 4DWHA 4NQUA 4RNRB 2O5XL 4Z8FH 5F71A 5HI5D 4JKMA 1DZBA 2YUVA 2FSEB 1FH5L 4NUJB 4XMLL 4Y4HA 1H3GA 3WLWD 1CL7H 5C2BH 2NMSA 3AS3A 2Z31D 4BSVA 4PGZA 4OZIB 4QWWD 4NO0A 3SHSA 4EI5C 4TTGA 5CILL 1KN2L 4NC0B 3HMXA 2RIKA 3VG9C 5CINL 1RZJH 1Q0YH 3QDJE 2SEBB 4LK4A 1ZHNA 5D93C 3GKWL 2VLME 3NAAH 1KPUB 2YD9A 3PL6D 4P46D 1A6WL 1A64A 3QYCA 5HGAA 5AZ2H 2X5PA 1T1ZB 3G5YA 3P4OA 4FABH 4L3CA 1P4IH 4CADB 3OR7A 3BE1L 1KEML 3E3QE 5F9OL 4YAQA 2NX5E 4LLUB 1FO0B 2AK1L 1CK0L 5F8QC 4JPKL 5GRJL 1W8NA 3PJSA 1I1AB 3CK0L 4MMZC 3B3IB 1F58H 4M7LH 5TDPB 1NAMH 4NQXA 1A1OA 4O2EA 3L6FB 4RWHA 1ZLSL 3VU2A 1C5DB 2VLRD 4Y2DB 4MHHG 2D2OA 4CU8A 2PTVA 2OP4L 1QFWH 1CFNB 3QUZA 2BSSA 2WBJC 2R4SH 4OCSL 2O5YL 4Q2ZB 4GW4B 1Z0NA 1UFUA 5BZWA 1WUNT 2F8XC 1KCRL 3KXFD 5JQ6L 3QEGL 2YN5A 4LCCC 5DUML 1KIQA 1J0YA 1BQHB 1WFUA 4LASL 4I2XB 3F7VA 3VWJC 2DIAA 2PYEB 2APXA 3Q0HA 3H7BA 5C0BD 1J7VR 5MENA 4P57A 3EHBC 4X7DC 3CGTA 5D1XC 5BRZD 3VH8B 1KTKE 1JYWA 1RV6X 2NXZC 3P73A 4Z7WF 3UCRA 1ZHBB 3PIQB 1FE8H 3IKCA 4Z7QF 5B8CC 2ATKB 4UQ3A 5GS0D 5J06A 1E27B 1J8KA 2YRZA 3MYJB 5EO9A 1OQOA 3MZTA 4LARH 4NQEB 3VRLF 1AKJB 1Q9WB 3O9WB 4Z76A 2X4UA 4K07A 2ICWB 1PKOA 5FA3A 4YFLF 2ZZUT 3CXDH 2KPNA 3RU8L 2IPTH 3GM0A 4I0CC 1JFQL 2CIKB 4MDJB 4P48A 4W81A 4BFBD 2RR3A 2HWZH 3JWDH 1BHGA 4I5BB 3SE4A 5DF0A 4XCFL 3X13A 4G8IB 3CVIH 3KPSA 3PWJA 4GKZB 1U8MB 4Y4KC 2WLYA 3HKFA 1DQLH 1CL7L 2HG5B 2DTMH 3QDMA 4WY7H 1RZKL 3JVGA 5C2BL 4EUPA 4O2FB 3WIIH 1MREH 2OTWA 3PGDA 3CU7A 3PDOB 2QKIA 1G1CA 2R0LL 4XVTH 1H3UA 5J13B 1YN6B 2YD3A 4XVSL 1FZOA 4ZDHA 5F9DC 3UYRH 1RZJL 1I3UA 3NAAL 5IB2B 2VWEE 2VAJA 3BD3A 4EN3C 2NTSP 5DR5H 1BWWA 3MRGA 1FP5A 3IDMA 1RJCA 1A7QH 3D0LA 5HI5C 3T4AB 1IC4H 4X6CE 1FL5B 4MZ3A 2HLAB 2EH8H 1OAXH 1P4IL 3DXAE 1OGAE 4XWGH 3WLWC 1FNSH 2ZG2A 4JY4B 4WUUA 3KYMA 1LMKA 2AABH 2Z31C 4PD4J 3NFPA 4I48A 4QWWC 1NDGB 5LWYH 1OCWH 4NQVA 2PW1A 4Q9RL 1OWRM 1L7IH 1ZHLB 1SJXA 5FA4A 8FABA 2Z93A 4QTHA 2UVEA 4EQ3A 4LSVL 1BVLA 5SWZA 2R15A 3RGVB 1JGEA 4G3YH 3WKMH 2GCYA 1XAUA 4E0RA 3Q2CA 2R4SL 3PL6C 3D0VA 4U2ZA 3L5WB 4N0FB 5BQ7A 1EGJA 1HWGB 1OP3H 4M5YL 1NMCC 3TPKA 4X6FB 1ZT1B 5IJKA 2IQAA 1YEGH 2AV7B 1RK1B 1I9JL 1OVZA 3ZT6A 2YK1H 4MMXC 5A3ID 1B2WH 1H5BA 2A6JA 3KPSE 3TF7C 1K4CB 1RIHH 1IL1B 4TOYL 4JRYD 3EO9H 4U05A 3QDME 4WWKD 3F5WA 4NDMB 1FYTA 4KKNA 5HGBB 4PRHE 1S7UB 2X70A 1MH5B 4U1IA 5T1LD 1BAFL 1BPVA 3U4EA 4HDIA 3CH1A 1N5AB 1NBYA 4ELMF 2OTPA 1C8PA 3IFOA 4DZ8B 3GSRB 1T0MB 2XKSA 3O3AB 2DMKA 4IM8A 2F8OA 4XMKH 1L0XA 4LF3A 4J3SA 5IB5B 4XP5H 1VFAB 1QZ1A 4K8RD 5KSBB 4PY8J 3CXDL 1HHIB 2R9HD 1NCDH 4FOMA 3V4VL 1G9EA 2IPTL 5GHWH 1S8DA 3H9SA 3JWDL 3FO9A 3JXAA 3O8XD 3ULVE 3CVIL 4WUUE 3PNWA 5IFJA 1G7PB 1YC8A 3EW3B 1DQLL 4U7SA 5I1IL 1IM9B 4MA3B 2DTML 3VXRA 1EJOH 4UV4L 3WIIL 5GIRB 1EZVX 1MREL 2HT3C 1CGWA 1SM3L 2F54E 5HHPA 5MHSE 3N9GH 5GS0C 5SWZE 4H5SA 2ZUWA 3RVXD 2Z8WC 2XT1B 3SBWA 1E28B 3G9VA 3MJ8A 3UYRL 4R2GC 1MFBH 2IG2L 5ISZB 5F8RC 2G2RB 5C08E 3ZYZA 1C12B 4APQD 3RDTA 5EUOA 5DVKA 1YYMH 1IC4L 4J1UA 5FUCE 1QBMH 1IM3B 5HYQB 2V17L 1YEDB 2HA1A 1MAJA 5DHVH 1CT8B 3V0VA 2FX8L 2Z8RA 1FYTE 2I27N 2YZ1A 1LO3H 4QOKB 5LWYL 2NY3B 1EVUA 4QXWA 2KZ1B 4V2BA 1OCWL 4IDJH 5EFIB 3SDAD 2H26B 3ZLQC 4KQ3H 4JO3H 2R4RH 1F4HA 1L7IL 1AI1H 4LRIA 3QJFA 5F88A 1AE6H 3KLSA 4K3JL 2RB8A 2PW2B 1XF5A 1XEDA 1KELH 5FUOL 1TIUA 1RZIA 3WFDH 4CVXA 1RUAH 5HDBF 3MNVB 2E5EA 1I9RL 1KJMA 4XX1E 3N0PB 2H2SD 3AY4C 4UTAH 1KCSH 3U30B 3KNBA 1DVFD 3RZWA 1NFDE 5ID1A 2EDQA 3WJLA 1YEGL 1VFBB 4BK4A 1LE9A 1NGWB 1JYVA 3HUJA 1OAYH 2BSRB 1B2WL 1R3JA 4ELKA 1P5UA 5D71L 2BXZA 4GBXB 1KYOK 3L3OB 2WZPD 1S78D 5L88L 5HBBA 3ZKXC 1J9CT 3VXRE 5KN5B 3EO9L 3RZCD 5A2LH 4UDTB 3MV9D 1A5FH 5F7EH 3DGGA 1F4WL 4P3WA 5FHBH 5DQ9A 3V6OA 1HILA 4PJ7B 3ET9F 3C5JB 5DJ6A 3MX0A 1CFVL 25C8H 2OQJB 1F3JA 3VI3E 5T5FH 1CTNA 4XP5L 2XZCH 5EUOE 2XRAH 1NCDL 5FECA 3MJ9H 4XPFH 3O11A 3FRUB 5I73C 1G7LA 1JWUA 1T1YA 2JCCA 3IGAB 3TYFA 5E1AB 3SGJC 4FFYL 5INCB 3EYFB 3VXQB 3MOBL 2UWEB 2FB4L 3O2WH 3OKNA 3HPLA 4MQXD 1EJOL 2MHAB 3PGCA 1S7SA 4HD9A 5KSAD 5C9JA 4MA1C 4JQVC 1T3FB 3I3DA 5HYJE 3EYSL 3N9GL 1YNLL 4Z18A 4HH9B 1CD1A 1I8LA 5TE7H 4C55A 4QLRA 3TP4A 4LSQH 1T20B 1PX3A 4K8RC 3VXME 5ID0A 5JDJA 3EDKA 5JW5B 4LLYA 2EIDA 5LGKA 4OZHA 1MFBL 2ILLA 3FB8B 4OLVH 3WFEH 3QFJD 5JW4Q 2A6KA 2AK4B 4LCIH 2W0FA 4OSUH 3ROLB 1WGOA 4BSJA 1RK0A 3O8XC 1TQBC 3WFBH 4O51B 4X6EA 2B4CC 2NZIA 4GG6E 2D7QA 3JUYA 1SHMA 2FL5B 1VFOA 4BKLB 5E9DE 5E2VL 5GGSB 1ZGLB 3QEHB 1KB5B 4PG2A 1HXYB 1ES0A 2VE6B 4IDJL 4JDZA 1AI1L 3V6OE 5B39A 3TJEH 1E4XH 1KELL 1S3KL 1KN4H 2NY6C 4X7EC 2B2XH 1SEBB 3WFDL 5JLZB 2JIXB 1HHJA 2CPCA 3VFOA 1J86A 1IJ9A 4B5EA 3QEUB 3BWAA 1FNEA 1AXSB 1OD9A 3ULSB 4HAFA 5DD3H 1AQKL 1KCSL 4APQC 1J0HA 5DVNA 1FL3B 3H6JA 2G5RA 4C56E 1S7RA 1ZGLM 5ICZB 2DKUA 1E4KC 4F7TA 5J11B 1OAYL 1BQSA 1KG0A 1MLBA 2NY0B 1FAIH 5JW3H 3H9ZA 2J6EL 3SDAC 3WCYA 3BPLB 3SDCD 4RMVA 3PQYB 5DMYA 1QNZH 2IBZY 1VEOA 2XG4A 2EDLA 1A5FL 3U0PA 5F7EL 2OJEB 4A2MA 3FB7A 5FHBL 2W65A 1AFVH 4GKOA 3EOTH 5E6ZA 5LGJA 5T1DL 2H2SC 3OPZH 25C8L 1KB9J 1UKSA 4F15B 2YD5A 1ETZB 1DVFC 4J3XA 1EEUA 5T5FL 3VFPB 3GBLA 4RMTA 1R3KA 1AY1L 1H3VA 3HMXH 3CAFA 3QXWA 2XRAL 5C0IA 3OQ3B 2CMRH 4RDQG 3MJ9L 4I18C 4XPFL 5DRWB 4NKQB 4EUPG 4CN1A 3QFDB 3K74B 4JO1H 3WNOA 3VFUA 1S78C 3C60A 1NEZA 2VQTA 1YNTA 1BLNA 5EBLA 3RZCC 1X5FA 1BOGA 1YZZA 1EPFA 1OHQA 3O2WL 1HH9A 3RBGA 2BMKA 3BIKB 3FONB 4PGDB 1JPTL 3P40A 5HHQA 1MAMH 3X17A 4B7LA 3V52H 2R2EA 1XGRA 3S35H 4B53A 2OSLB 5ABDE 1D5MA 5JIPA 5I1HL 1BJMA 3RHWF 4JFFD 1D7FA 4Y19B 3MRHB 3RVVC 3UBXB 3UTTB 1I1FB 2EE3A 4OLVL 1A0QH 1BFSA 2HT2D 4LRNL 1JWMA 4WIQA 1XMWA 3HR5A 4LSSH 5HGDA 1CXEA 5B3JE 4GT7A 4LCIL 2AV1A 5I1LA 1G9NH 2MJWA 1SMOA 3WFBL 3HMWL 3S37X 5C0AA 5I75B 2IGFL 1CZ8H 2X05A 3KPLA 1NCNA 4JFDE 4PJAA 4MXWH 5LAXA 4DEPC 2BERA 4MQXC 1JZ6A 1MFEH 4HUWB 3VD7A 4FQIL 1SEQH 4C59B 4N9OB 2Q86B 5IEKB 2EYRA 1KXQE 3EO0A 4NPYA 1QLEH 5I9QB 3TJEL 5LQBL 5JMRA 2JB6A 2OL3B 4NHUB 2B2XL 3QUMB 2P8PB 3ARGA 2UUDK 5EOCL 4OI8A 4X4XB 4Y0GA 1EO8H 1G0DA 4QHKI 5AAMA 3QBTB 5DD3L 4ZUVB 4AEHL 4PBXA 4RGOH 5D1QB 1IEAB 1FL6A 4PJ5D 4CKVX 1BQLH 2HKFH 4ZUTB 1MWAH 3T0VA 1BX2A 4Z0XA 5I1EH 1FORH 3FN0L 3L5XH 4KVNH 3ETBF 1GYAA 4XAKD 4R7NA 5JW3L 4P23A 4XZUA 1GHFH 1IGMH 3V5DA 3QQ4A 3E8UH 1IRAY 2CKBA 4XX1G 1GZPA 5J3HD 5IHLB 2CLVB 4RFNB 4WU7A 5JDSB 3EOTL 3U7WH 1X3DA 4EUPH 3IT8D 3ALWA 1F97A 3BQUB 5FGBC 2X6MA 1N4XH 5GRUL 5SWQB 3H2WA 1DUZA 4LHUB 4JO1L 3FT2B 2NXYC 2YUWA 5CMAB 4OB5H 5HGHA 1HE7A 1K8DA 2ERJB 4IRZH 4XNZB 3BPOC 4PJAE 1B4RA 5ESVB 4NOBA 2VLLA 3SDCC 4D9LH 1UQSA 3AU1A 3HN3A 5D6CA 3GSNB 5J1AA 1RZGA 4JPVH 5DRXB 1MAML 4MQ7B 5I2IB 4R4FL 4MNQD 4Z7UA 4ALAH 4BM7A 3U4AA 1CE6A 3LEVH 5D5MF 4NRZB 3S34L 4PRBB 5HPMB 1XCQB 1Q38A 3MNZA 4ZSOA 5HJ3B 4K3DL 5DHYB 3TO4A 3VFVA 1WFOA 3Q5OA 4QTIH 4LSSL 1G7HA 4KTYA 4Y1AE 3G5VB 4YFLI 1I7RA 1OY3B 4ISVA 4PG9A 1EGJH 3T0XA 4X98B 4ZO9A 2Y5TA 1WLHA 2AEPH 4XXCA 2VYRE 4OLXH 3OB8A 4MXWL 3W2DL 4JFPA 2EDKA 3MBXH 5IFHH 3WIHA 2ZUSA 4KV5E 3KYOA 2AQ1A 4CVUA 5LGHL 4KROB 1N8ZB 4CW1B 2XV6B 3QAZC 32C2B 3GM8A 4CRPA 1UM4H 2PXYD 5EU3A 3DECA 4Y4FD 3MGAA 3KPRB 4ZNEA 1F4XL 4PJ8D 3IDNB 4MAUH 5J1SC 2FLBT 3BUYB 3T0BA 1EO8L 5HHVH 5I71B 4MA8L 4RGOL 1W0VB 3GMPB 4UT6H 2FR4B 4P5TA 4ESKA 1BQLL 2HKFL 1MWAL 3PWPB 4N8CL 4Q9QL 3VXUB 5I1EL 1FORL 3QDAA 4MAYB 4U3CA 4OLUH 1W0WB 1QSED 1U42A 1JZ5A 5AZEH 3QDGB 3WL9A 1GHFL 1IGML 4PV8B 1BFOA 4WI5A 4S0TD 5FKPA 1MI5B 1T66C 3DIFB 5J6GB 1UB5B 4ZSOE 3N1QC 1S7VB 5C0EB 3MRLA 3X12A 3D85D 1WSST 5DD1H 3VFNA 2X4QA 1RZ8A 3B9KB 4HIXH 1CI5A 2D0FA 3V5KB 4HIIB 3CC5B 2A77L 4XCEB 1E0OB 4MVBD 3D3VA 3KS0H 4U7MA 2QHLA 1SMAA 1I7ZB 4ZFOA 4Z7VA 1YMHB 4KK5C 4W6XB 4U1JA 5K59F 1FFPB 1YMMD 2YC1A 3E2HB 3GJEA 2FRGP 5J3HC 3MNWB 3SGEI 4Y2OA 3ZTJG 4EI5A 1A2YA 5I8OL 3FB6B 1UXWB 4L8DB 3ULVL 4PRAA 1U8KB 4OCWH 2HFGH 3HNVH 4N0CD 3VXSA 2CDEB 4F7EB 4HF5H 5FHAH 2BVOB 4Q6IC 5IWLC 4KZDH 3GSUB 1G0YR 4XNYH 3VGDA 3QB7C 4LIQH 2J7LA 4QTIL 4L4JA 1A6UH 4HIHB 5JHLL 2P5WA 5F1KC 4EI6B 4PS4H 4LNRB 4YXHH 4WO4D 3T77A 1DN0B 1A6AB 2YPLB 2GJZB 4R8WL 5EU4B 5EU5A 5IROC 5B39G 2GT9A 3S96B 1WC7B 5E8NB 5GGUB 3EO1A 4OLXL 2Q76A 1J1XH 4GAYB 3I75B 4U3HA 3H0TA 5DJ8B 1IGTA 3L3IB 3IJYA 4ZUUB 3WLBA 4E9LA 1I1CA 4MJIE 2D31B 2W9LA 2WWKO 3WIFB 2BX5A 1M05A 4JB9L 2VNCA 3WUWG 4HSQA 5GGRB 3EAKA 4BH7A 5HHOD 2WBJA 3D18A 1Q1JL 5DK3A 1UM4L 2NY5L 3GHEL 1LP9E 2FJHA 1FC1A 3MLPA 3K4DA 4HKZB 2VABA 3OAZK 5HHVL 2IANE 5TQ0H 5EU6B 4UT6L 1HYSD 4XPGH 3I6LD 3VWJA 4O4YL 4D3CL 3Q5YA 5AAWA 5C07E 3D3VE 4HX1B 5DGQA 4YEEA 4YK4B 3P4NA 4Z7VE 2CD0A 3O4LA 5D1XA 3QQ3B 1VACB 2F8VA 1AD9B 1YUHA 4MB3A 1LILA 5AZEL 4MD5B 4K23L 4YHNA 2N56A 1UKQA 1T7VA 4XNMA 3RWDA 4HXBH 5B8CA 1JK8A 2FJGA 3DWTA 1EAPA 2XG5A 2D7MA 4YDLB 2IJ0C 2PXYC 4LEXH 4Y4FC 1B0GA 3EYUH 3GMLB 2BNUA 4PJ8C 5FYLH 4PJIF 3D1MC 3EYVB 2PTTA 2R29H 1SY6L 4GRWE 5EA0H 1QA9B 2ZP0T 5EZOL 2QADD 3GSOA 5DD1L 2FWOB 4HUXA 3D39A 3G6AB 3PDDA 2DKSA 3L3DB 5C71A 2DLHA 2A6IB 2A9NL 2H41A 5E5UB 3KPOB 3MRPB 4UU9A 3ZTJH 3AROA 5DD5L 4V1DB 4Y4KA 4GRLD 1L0QA 3L7EA 3FOMA 3MO1B 4UTBH 5D70L 4JM2D 1NMAL 3ARFD 1ZA3B 1RD6A 3QZWB 5SX5H 3RHWK 4DFHA 3VGGA 2D7OA 1P53A 1ZSDA 2P7TB 3MRQB 1BIHA 3BEVB 3UTSB 3UPRA 2PCPA 1I7TB 3LN5A 4CMHC 3S36X 4FTVD 4KY1H 2CXKA 3EYOB 3UTZA 3BW9A 2OR9H 3E6FA 5IVOA 4HF5L 1XIWC 5FHAL 2XZQL 4UMGA 3MRKB 2E7LC 2PN5A 3MXVH 2J8UB 2WANA 3SY0A 4EN3A 2XQYK 3LQZA 4XNYL 4YIQB 1MUJA 1NH6A 5IVZA 1A6UL 5IMKB 3CFKA 1HHHB 2P5EE 5E5MA 1S9WB 2Y72A 3HZYB 4ZFFB 3PXHA 5A2JH 2Z31A 1RZFL 1BBDH 2J3SA 1WBYA 5C09B 1J1XL 5H35A 4CU6A 4GS7B 3QH3A 5JUEH 4XC3H 4TYUA 4QY8B 4N0CC 4Z5RB 4U31A 1ORSA 3FQUB 5DJ0A 3PL6A 4JAMB 3TCLB 1WEJH 4YWGL 4AYFA 5CAYB 3D39E 1U58B 4X5XB 4TVPH 4PJHE 5TQ0L 2VLKB 4HWBL 4XPGL 2CLRA 2VLJB 2Z0BA 1UWGH 1LK3L 1S9VA 1PZ5A 3SKNB 1UWXK 1KFAL 5IHZA 3BRFA 2DQUL 2WV3A 4TUOA 1CE1L 4IOSD 2XY2A 2P8LA 5F7UA 3W0WE 1PJ9A 3TBSB 4LFHD 3BZ4A 4M3JA 2VAAB 4LVHC 5JNYB 4OAWA 1CLYH 4HXBL 1U8OB 3MA9H 1JF6A 2E9JA 3P2TA 4FA8A 1Q94A 3FT3A 4OZIF 4LEXL 5ILTL 5I1KH 3EYUL 1XF3B 3MRRB 3KXFA 4UB0H 5CEYB 1ZLVK 4H0HB 3HRPA 1EAJA 1X5IA 4R9HA 5AG8A 4Z7WA 4P2RE 1MQ8A 1DQJB 5I0DA 4I77H 4YC2C 5C0BA 4N5UA 2WW8A 4PR5B 1H3XA 4JFZH 4GW5B 2ZNXA 3DNKA 5CJQH 2HTLC 2ZSWB 4MX7A 3TA3D 1I1AD 4XCYB 3MRFA 4S11A 2ZCLL 4MWFA 5FCUH 1BEYH 2XZZA 4NSKA 4UTBL 5TPWH 1JHLL 4DVBA 3HS0B 1W0YT 2BNQA 2B8OT 1ERNA 2X89D 4FQHB 4GUPA 4KC3B 1RJYA 2XTJD 4I13B 4QYOA 3S3PA 3WDHA 3TGXA 4YHPA 4HKXA 2DQCH 4QRUA 5CBAA 1Z9MA 1FAKT 4MSWA 4YDVB 1ODAA 2PYED 1BM3H 4FXGA 3EFFB 3MRJB 4WFFD 3VCLA 4GRLC 1VADB 3CFEB 5F9WB 1S7WB 2P8MA 3V4UL 4WW2B 3LDBC 4K94C 1U9KA 1XGUA 3ARFC 2HN7A 5TFSH 4XHJD 5E00A 4AG4H 4UT9L 1JGVH 4NQED 1AKJD 1TPXC 4OM0H 3O9WD 2OM5A 5JUEL 3PWLB 4P3DB 1PYWB 4LLWB 4XNQA 5DEZA 4Z7NF 3EYQD 5SWSB 2IAMC 4BQ6A 5IKCB 2I9TB 3M17A 1WEJL 3NIGE 3AY4A 2CKBH 4FQJL 1U8LB 1F11B 1Z3GH 3BDYL 4Z7QE 1NQBA 1OW0C 4DZBA 3ZYIA 4D0DB 4O9HH 3ROOA 1UWGL 3EJZD 3EOAA 4XB8A 4QF1A 3W39B 3OZ9H 4YZFE 3DRTA 7FABH 2YSSB 5JOPE 5JHDE 3VXTB 1GOGA 3FFDB 2LU7A 5ADOH 4D9RD 2ZJSH 4H1LA 5MEQA 1JZ4A 1S9XB 3FZUD 1KGCE 2BNQE 4MD0B 4M8QB 4DGYL 4EVNB 1BZQK 3ZKMC 1CLYL 1CICB 5J0BA 2N4IA 5D2NB 2BVEA 3KPPB 2NZ9D 1FNLA 2X40A 5BVPH 4YQXH 3K0WA 2UYLA 3PDGA 4UB0L 1DL7L 4QXUH 4MJ6B 4U0RB 1JP5A 2C3XA 4JDVA 1FFOB 1XZ0B 4P5KA 4X7TB 3R1GH 5F9JA 4U7KA 3OG6B 4JFQB 1U8QB 5DTFA 4XVUD 4YHLH 1M7XA 1R3HB 3NFNA 3LD8B 5CUSL 1JL8A 4PY7B 5FO9A 4KDVA 3VFGL 5CJQL 2BJML 3SGJA 2QTEA 4L8CA 5IESH 4XT1C 5T1LA 1QFHA 2YBRA 1KENL 1PKQB 5FCUL 4ZFZA 5E56A 3OKKB 4JQIH 5TPWL 3RGVD 1V3KA 4JQVA 1NCWL 3MROB 5JA8B 3GMQB 1S7TA 3UYOD 5IW6B 5E8PA 1DBJL 3UJJH 2X1PA 4ONHA 2BVUA 2DQCL 4A2LA 3WIHH 4L9DA 3GI9H 1RIUH 3UJIH 1NCTA 4F2MB 4LQ1A 1BM3L 1WF5A 2EO1A 3O8XA 4CGTA 1I1YB 3OAUL 2KDGA 1B6DA 4P9HL 1I1AC 4PJCF 4N0UB 1LNUA 3QUYB 1OT2A 3VRIB 3NCJH 3KYKL 2H8PA 4YGAB 4Y2DC 5BZDB 5IM7A 4H0GA 5KG9A 5A16A 3DUHA 4LCWD 3DX6A 2WAHA 4ZO6A 3BD4A 4OM0L 3K1DA 3G6JB 3WFZA 3HE6B 4D0BA 4KJPD 1MIEL 4MJ5A 2JJUA 1IAKA 1J8HE 1D6EB 3OKDB 2BHYA 2CKBL 4APQA 1S7XB 4ELME 3TN0B 1E4KA 5L6YL 2J4WH 3LVEA 4F37K 4WVRA 1IM9D 3F6IA 5EZJB 3SPVA 3OZ9L 4RAVA 2HVJA 1A3QA 4L4TD 1QSFB 2NTFA 3SDAA 5ADOL 1G9MH 2ZJSL 4YHKL 4U6YA 5HHNB 3O9WC 1T04A 2KH2B 3LMJL 1IQDB 2X42A 4NGHH 3EYQC 5EIQA 4JPIB 1WIPA 5CSGA 3D69B 4Y8AA 2X4RB 4XP4H 5BVPL 1YN7A 3TV3H 1RUPH 2RFXA 1Q8MA 4QXUL 1DVFA 3INUH 4HKBB 4ONOA 2EE6A 4Z0BH 2VB5A 2YZ8A 5BS0B 1UH2A 1QO3A 3R1GL 3V5HB 1EMTH 4L8BA 5ESAA 2HKHH 5L2KB 3EJZC 3CFBB 3L1OH 4YHLL 2IALB 4I18A 4AT6B 3C08H 5K9QG 1BVKA 3MFFA 3MRIA 4IOFD 2Q7YA 3GJFH 4WW1A 3CMGA 3OXSA 4QOKD 2NY3D 4GRWH 1QUNA 3RZCA 1WJ3A 3DMMB 1OAZH 1G7IB 1U0QA 5J13C 3TBVB 3FZUC 3MV9A 5IESL 3IVKB 2ZSVA 3SE8L 5EIIB 2VTFA 5HDLA 4PRIE 5CBEA 4MNGA 1I9IH 1BD2B 5FO7B 4X9HA 2NZ9C 1G7QA 4RQQA 3I9GH 4Q6YA 4JZJB 4U6TA 3RWCB 1OF2B 2G9HB 4HQQH 1LEIB 1U8HA 1YEHH 2A38A 4FFVD 3D25B 1QRNE 3TJHC 1ADQA 1M4KA 1RULH 3UJIL 5GGTA 2BRQA 4JRXB 4BSWA 1MCPH 4GBXD 3L5JA 1XFPA 5HDBE 4UBDD 1X5ZA 2Z9TA 1WFNA 3FO1A 4KKAD 3ARBB 3N1GC 4UINL 1V3MA 4J3UA 4PRNB 3RGVC 4LLAA 2GAZA 2DQGH 5C0GB 2I07B 3VGAB 4JFOA 1JYNA 1MIMH 4MDIA 2HTKD 3NIDF 3K1KC 4JZNB 2BVPA 3F12B 4ORGB 4BZ2L 4HUVA 3QFJA 4QHMB 5ERWA 3C6SB 1RIVH 4PJ7F 1FPTL 5C0DB 5IR1A 1DQDH 4ERSL 3HLAB 3FFCB 3P0GB 1R3IH 2NY7H 4JR9H 2ESVE 2ZPKH 3I6GA 2J4WL 4RIRB 3SGKC 2BOBA 2ITCB 1AGEB 1HDMA 2DWEB 4OT1H 2J2ZA 4G6MH 5FYJH 3RWGA 5CP3A 2EEBA 3HCVB 3QXAB 4MNGE 2LVEA 5IB3B 1WZ1H 5FOBB 4YHMH 1NCAH 3NGBB 3GI8H 2H6PB 4JFEB 1MJJA 1IAIL 4KJPC 3B83A 4GG8B 1CBVH 2JK5B 3LKRA 3RVWD 1IT9L 4KMQA 3BP4A 4H20H 4S1SL 1N7MH 1U92B 5CHNA 5JORA 5C6TL 4NC2B 4WNQB 1RUPL 4JGJA 5FGBA 1KPVB 3INUL 4YHIA 5DMGD 3PWVA 4Z0BL 1JI1A 3ZDZF 3BIAX 4GFTB 2KQMA 3BO8A 3WFCH 3C5ZB 1S9YA 3QULB 1T0NB 5H94A 5MERA 3MLRL 4YGVA 2HKHL 2WUCH 3L1OL 3OJMB 4PRDA 4PJGA 3C08L 4R26L 5KTEL 3VMPA 3QNYB 5I1AB 3LPFA 2X1WL 1ZOXA 3RKPA 1A3RH 1DLHB 4PJEB 3SDCA 1OAZL 3OKLA 1K2DB 2IMNA 3VFWA 4KRPB 1JPGB 2C3VB 4BQBA 5HI3D 5C0FB 4XHQA 1CGXA 1XT5A 5HSFA 3QWRD 4KRNA 2AERT 2JIXD 2BZDA 1FNFA 3MBEB 5I15L 1XF2B 1PG7X 4I3RH 4PREB 3WYRA 4KUCF 5JIHA 2B20A 1KIPB 5ACZB 4HQQL 2EIBA 1QEWB 4AMKH 1YEHL 2ZOKB 1DBBH 2YKLL 1NDMA 4GXUM 3ARZA 1CF8L 3HHRB 1IGFH 2NY0D 3LPGA 4IOFC 5IBUG 1LEKA 1MCPL 4CNIA 2WIIA 3BZFA 1NUNB 4HV8B 2NY3C 3SKOA 5DJZA 2X4PB 1FGVH 5FM5M 3PQYD 4XH2A 4WEBH 2VXQH 3QIUB 4UT7H 3JTTA 1LEGB 1W72A 2BSTA 1JZ3A 3QNZB 4OD2B 2E8YA 1WVZA 2XN9A 2Z92B 3U46A 1HOCB 4EEEA 3M1BA 4NM4L 4HZLA 3DO7A 1CD8A 2WBWB 1MIML 3D6GA 4D8PB 3U30C 1QR1A 4JFFA 2R2BA 3NZHH 3LKQB 3LRHA 4ZAKB 3TT3H 4JGUA 5IG7A 2VC2H 4FFVC 2P48B 4WHDA 5DEGB 4YH6A 1OOAA 3MREB 1CDUA 5T33H 3CSPA 4RA0C 4GBXC 5CJBA 3FB5B 5GPRA 3AM8C 3UZQA 5DDHA 1LD9A 3U0TB 2NY7L 2ZPKL 3LSOB 3MTRA 3QT2A 4QRSA 4UQ2A 4KKAC 1S5HB 4HPOH 2BRRL 3FO2B 4OT1L 4JVUA 4G6ML 3EFDL 1ZGLP 2F53E 1OSPH 5CZVL 3F7RA 3VXNB 4U49A 3CSYA 3PWUA 4YHML 4B41A 1NCAL 5CJXC 1H15A 1CBVL 3C2AH 4E41A 3GSQA 1N0XH 4LKCB 2ENSA 3UTTD 1WWBX 3Q3GA 4H20L 1UZ8B 3LKSA 1FNAA 1OSZA 5CEZE 1N7ML 4Y5YB 4I0PB 4PB9L 3ZE1F 3RX5A 1N6QH 5GS0H 5GJSH 1JUFA 1KPRB 3SDDB 5HD8C 2EECA 1UM6H 4PB0H 4HUKB 2WUCL 2BVQB 3A6BL 3RVTD 3OR6A 5JR1L 2AS5M 1ZKAA 3DV6B 5FUZL 1LE5A 4RMSA 1NGZB 2Z35A 5JIIA 1FZJA 5L8LB 1A3RL 3MMEA 4FMKA 4I3GA 5F1NA 2F58H 3IF1B 4PY8I 5D7IB 2XN9E 3V7MA 3MLWL 1C5CL 4XXDB 3ARQA 5DK2B 5HYSB 1KJ2A 4QRRB 3RVWC 4HG4J 1Z5LA 1Q0XH 4RFOH 3LRGA 2HFFB 5DRZA 3RAJH 1FVDA 2FNBA 5DMGC 2R1XA 1DANT 5AEAA 4AMKL 4Q6IA 5IWLA 1DBBL 5I76B 4AQOA 2CR6A 3QEQB 4Q9CA 4RGNB 3HC0B 3V95A 4TSCH 1G0XA 3DURA 1P7QB 3ZT5A 2CRIA 4ZPVA 4HIJA 3PHQA 4IS6A 2X4TB 1EO5A 3N1PC 1MELA 1QPPA 1DN2A 5D5MA 2ICCA 3MR9B 5IROA 4LLMB 1HNFA 1Z9OA 3JBG7 1FGVL 1JNLH 2GFBB 3W9EB 5HI3C 2EICA 2VXQL 4UT7L 3PUCA 2V2WA 1QRKA 3NCYS 4P2QB 4YPGB 4MNQA 5HI4D 4GXVH 4LCCB 4YO0A 1NKRA 4E41E 1ZHKB 4LBEB 3BQUD 2CGRH 2FIKB 3NZHL 1U95B 1TZHB 3TT3L 2VDOL 2VC2L 1CQYA 1A6VL 4LHUD 5E95B 2NLJA 5J11C 4BUGA 4QO1A 2ID5A 4G9DA 1Q72L 2NY0C 5IEHA 5T33L 3ILPB 2X4SB 1D5ZA 4HCRA 3P0YL 1UENA 3BP6A 1IGJB 5T3XE 3DVGB 4NFBA 3SGEH 3BPLC 2NW3A 5DYOB 1AR1D 3U48A 3UTQA 4C58B 1MY7A 3RNQB 3TVMB 3RWFA 1NEUA 5LBSL 1CXHA 1YECH 4JY6B 1OSPL 1HXMB 1PW3A 1TITA 3TYGH 1R5IB 4GKNB 5C0CB 1CVRA 3U1SH 4M7LT 5F93C 2VKWA 4NQDE 4F15C 5T3ZE 2PKDA 2NQCA 5FK9A 2PXYA 5CZKA 1NGPH 3C2AL 2W0PA 3IDIA 5C70A 5KS9B 1CQKA 1N0XL 4L4VA 3IRZA 2VKXA 4KRMB 3JV6B 4X80H 4NWTH 1X4ZA 4IMKC 5GJSL 1R5WB 2DQHH 2YA0A 3BT2H 1G7MA 2FH6A 1N64H 1UM6L 4HEPG 3ZKSD 1FNGB 3DI2B 5D5ME 2QL1A 1I3GH 4N90D 3GSXB 3HNSH 4M4RA 4TNWK 1MVUB 4OIAA 3C8HA 1H0DA 2OJZH 1MQKH 4KKBD 4RMWA 2EH7H 3GMNA 4KROD 2DYPA 3WD5H 4YUEH 3KPMB 5GS1B 4UNTA 2B4CH 5I16A 1GGCH 1FZMB 1U8NA 2R1YA 4M1CD 3QNXB 3CDGA 3MUJA 2FO4A 5IMMB 5EBWA 1RAMA 2FBOJ 1T6WA 4JO2H 3BGMA 1XIWA 3OKYA 4OLWH 2WMPA 3N85H 5ICYA 2E7LA 4XPTL 1UZ6F 1A6PA 3IU3A 5I75C 1X7QA 5EOTA 3VXUD 3QPQC 3RVTC 4TSCL 1J05A 4MAYD 1QP1A 3MUGB 1FNHA 4HS6B 1GGYA 3QDGD 1YMMA 3RI5F 3BZEA 4Y89A 1JNLL 4F3FB 5I9QC 3BMVA 4L8SA 3ZT7A 1MCKA 3KAAA 4MD4A 4P46B 1N59B 2PUQT 2NY4B 1A4JB 4GXVL 4B7IA 1P4LB 1MPAL 12E8H 4PRPB 4NT6B 1Q9OA 5HHME 1AIFB 4L4VE 3W9DB 5CIPA 5D1QC 3F58H 5DJCA 3LKNA 3FQRB 4HMEA 2C7UA 2ED9A 3BHBA 4ODTH 2FEDD 3VWKB 1HN1A 1GZQB 3QDJB 4GMSH 1MCOH 4G42A 4AM0A 2DOCA 2VLRB 5DJAB 4R90H 4UNUA 4Z6AT 1UA6H 4N8VA 2ADIB 1Q9KA 2P45B 3S36H 1OB1B 4GAJL 2HRLA 1UWEL 4RFNC 4XPAH 3PABB 5HI4C 5DC0A 1YECL 4NO2B 5F1IB 3HG1B 3FTGB 4JFHE 1W8OA 2YS4A 1FC2D 1YQ2A 4DW2H 2YXMA 3BQUC 3Q1SL 1INQB 2XWTB 1JF1A 3DV4A 3SQOH 4R7DA 5KANI 4JM4H 3BYYA 1UB6A 1FYHB 3P9LB 5D72H 3SOBH 1XGTA 4WFEE 4X0KB 2WBKA 4HIEB 5FEBA 4NWTL 2UVFA 2BOCA 4I4WB 4PJXB 2ZG1A 5BRZB 1TZGL 4Y16D 3M45A 3EZJB 1JJUA 3TLRA 5D6DC 2DQHL 2ERJC 3IJHB 5ALCL 4AIOA 4XNZC 3BT2L 1XGQB 1NPUA 3IJSA 4O2CA 4ZPTA 5C2UB 3RTQB 4W4OC 4GAGL 4PJIA 3WJJC 2OJZL 5GISH 1ADQH 1OTTC 3TBYB 2EH7L 3DSFH 2EDEA 1DBML 2XY1A 1TFHA 1FIGH 4YUEL 3MA7B 2B4CL 1GGCL 5EH1A 3F7YA 2DQEL 2ICEA 2OTUB 3NA4A 5CD3B 2XFXB 4JO2L 1QHPA 2VZ3A 4S1DC 1QFOA 1QKZH 4PV9A 5EU6D 5F72S 2JF1A 1AD0A 3DVNA 2AXGB 2CDFA 2XTLA 3Q6FA 1F6FB 4QHUA 1AXTH 1JHKL 4GRLA 2VQ1A 1N3NB 3QQ9D 3BP7B 4WEMB 4KROC 1YQVH 3WDIA 5JO5A 1ZEAH 4K7PX 2ADJA 3ARFA 3QA3A 4M1CC 2EDBA 1JGUH 1NFIA 3CLEH 1WCBB 1DEEB 2BFVL 4DK3A 3OKMB 3K8MA 12E8L 1F42A 2FECI 3QHZL 3VDCA 3STZA 1BJ8A 2F19H 5I71C 2EEAA 5CP3H 2IAMA 3V6ZA 5DMKA 1VERA 3KPNA 3CFJA 4F9LC 5IF0A 3I6LE 1DEDA 4ODTL 1L7TH 4MAYC 5CEXB 1OW0A 3JV4B 3BP5A 1PQZA 3O41A 1GC1C 1MCOL 4GMSL 4XGZA 4LL9A 1A4KA 2LQRA 2YEZA 2VITB 3L3HA 5ITBH 5L2JA 3DX8B 2XWJB 4X6CB 4XPAL 1QFWI 1HH6B 4LLVB 4NHCH 4BFIB 3DXAB 1OGAB 2XA3A 1QBLH 3GMMB 4X6DE 1C16B 1G7JB 2IH3B 3CX5K 3RPIB 4EJ1C 4YR6B 5I73B 1TVHA 4JFYB 3B9KC 3IXTA 3REVA 1JWSB 2FEDC 4RNRA 1KTDB 3IETB 1CYGA 3O2VL 4JRYB 4BZYA 4WWKB 1MWAB 2FSEA 3C9NB 4NUJA 4LPWA 1HKFA 4LVOB 5J6HB 5F3HB 3QCUH 3R06B 2J8UF 4OZIA 2EXWD 3IRPX 1SYSB 4FXLA 1JRHI 4KHXL 1IAMA 1KIRB 1KLGB 2VIRB 4OLEA 4MS8C 3L95B 2YD6A 1UYWL 3DSFL 1AO7B 4EZMA 1BJ1H 3THMH 4O5LL 4RAUB 2DN7A 2SEBA 4KTEH 4XVJH 1KPUA 3NH7H 4ENED 5E2WH 2YRLA 4PRHB 2A74B 2E9WA 1W72H 2D03H 3MACH 1T1ZA 1LO4H 2YUXA 2IEPA 2VLJD 4R3SB 4CADA 3ULUF 1T1WB 5A40E 3IAQA 3FOLB 2VXSL 3BIBX 4GQ9H 4LLUA 1FO0A 2UZXB 1AXTL 1I1AA 3B3IA 4C54A 5TDPA 3L6FA 1JGDB 2Y36H 1C5DA 4Y2DA 2KQNA 1YQVL 5EO1B 5EOQH 1JPSH 1IKFH 4M43H 1ZEAL 1CFNA 3SO3B 3V9FA 4Q2ZA 2VDPH 2DQJH 4GW4A 5I74B 5D7LE 3CLEL 4X9GA 3PHSA 1G6VK 3AS1A 4H88H 1BQHA 2IQ9H 3AVEA 3P11H 2F19L 4DQOH 3TNMB 1ACYH 1QR4A 2BCKB 4I2XA 3GO1L 5BJTB 1BREA 2F54B 1J1PL 3O2DA 2DDQH 4GJTB 2PYEA 1KT2B 4YK4C 1Y6KR 1L7TL 1XR8B 4TSBL 5DFWH 4L1HA 3VH8A 3QQ9C 4G80B 4OZIE 4G8GD 3MLTB 2YUZA 2XPGB 5DMJB 5C08B 1ZHBA 5GSRB 3PIQA 1HQRB 4OZGE 5EN2B 5ITBL 2ATKA 4YDLC 2GKIA 1E27A 3MYJA 4DOHE 4LCYB 4NQEA 1AKJA 1Q9WA 3O9WA 1ZA6B 2DBJA 1EIBA 5E2TL 2ICWA 4WFGE 1TENA 3GHBH 4LPYA 3RX7A 1GIGH 1M71B 1QBLL 1LO5B 2X4OB 4TN9A 4KAQH 2CIKA 4MDJA 1U2HA 4I5BA 1KJ2H 3LS5L 4HWZB 4G8IA 5F7NC 5T3ZH 4GKZA 4Z7OF 1U8MA 1HSAB 2MSPA 5J12B 2EKSB 4F7CB 2HG5A 3QCUL 2JLLA 3DI3B 4PJDE 4O2FA 5CEZL 3H3BC 1NFDB 1BECA 1J11A 4PLKD 5DLMH 3PDOA 4LDOB 1YN6A 3ZE0F 3TEUA 4L1DA 1DUYB 5FYKD 3OJDB 3THML 3RBSA 4G7YH 4KTEL 4WW2F 4LEOB 5C6WH 4XNUL 2MQ0A 4XVJL 5SWSD 3RPKA 5IB2A 1VKXB 3HRZB 4L3ED 3H9YA 2XICA 2D03L 4PGCB 2I5YL 3MACL 4YE4H 2PYEE 5GSVB 1LO4L 3T4AA 4HFWB 1FL5A 2HLAA 3W5MA 2EE2A 4Z95H 1BOYA 4JY4A 3HUJF 5KSAB 1KJ3H