4X9FA

Crystal structure of dscam1 isoform 6.9, n-terminal four ig domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
393
structure length
393
Chain Sequence
b'GGADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Down Syndrome Cell Adhesion Molecule isoform 6.9
molecule tags Cell adhesion
source organism Drosophila melanogaster
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
total genus 87
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA04
1YECL 3N85L 2LU3A 3LIZL 2QR0A 4WWID 4W81A 1U8LA 3PHSA 3OR7B 4M7ZB 1J05A 3QXWA 4TN9A 5JPNA 2OTWA 2G5BA 3CVHB 4X6CF 3SE4C 4PBXA 3NACL 4PRDB 3MLVH 3HRPA 5BMFH 4LASH 1BIIA 1OW0C 3PDGA 3QIWC 4QLRA 5GGRY 5I74B 3LN4A 1C16B 4Q9QH 4AEHH 4LPWA 3BQUD 4TTGA 3S88H 1A6ZB 1KXVC 4KKAC 1BX2A 3GHBH 4QTHA 1XGTA 3B5GA 3JWNC 2YKLH 4YHPA 1ZSDA 4MS8D 5C0CE 3QAZC 1CDCA 4AENA 4QXUL 3T8XB 3MRRB 5GRVL 5DD0L 4D0CB 3MYJB 5EU6A 2CDFA 1TCRB 4OAWA 1KJ2B 3IFNL 1ZK9A 4MJIA 1WGOA 4HJJH 5KSAC 1CBVL 2YPLB 1S7UA 1UB6A 1U93B 5FYJU 3S37X 1HILA 5IMKB 3QPXH 4K3DL 4HAGA 4KRMB 1LHZA 2F9BT 1HH6B 4D0DA 4FQ2H 3O3AA 1OSPL 1ETZB 5D7JD 3GNMH 4JE4B 5E4EC 4XPBL 3I84A 4L1HA 2OR7A 1F42A 5HHXH 1NSNL 3QI9B 1W0VB 1LO0L 3QJFA 2ZUQB 3U0TA 4JZNB 3SGJC 4OFDA 3AS2A 5JDSB 1NUFA 2G2RA 4YXLL 1JWUA 4NZDA 4JDZB 2ITCA 3A6BL 2YBRA 4PJXB 1R5WA 2EE9A 5J9PB 1KPRA 1FYTB 1IILE 2JJSA 3HFMH 4CVUA 3JTTB 2OJEA 1OTSC 3KPSE 3DO3A 5FV2A 3MR9B 2DTML 4JHWH 4L29B 1UA6L 2IG2L 5LGJB 3MBEB 2J8UF 1M7DA 5DJ6A 4HC1H 3LEVL 5EC1A 4L4TD 2X7LB 2EXWC 2OS7A 3IYLW 3RGVA 1NC4A 2EEBA 4X99A 4LVHB 3ZE1F 2XICA 5CZVH 1ZTXH 4MA3A 1B2WL 1K8IA 3RDTD 3IDMA 5JXEA 4C55A 5IK3B 3G6JF 4U3XA 1E4WH 4B0MM 3FQXA 1EJOH 5L88L 1RUAL 3KHQA 3O6MH 5HYQA 2HAZA 3KYKL 1PSKL 3GIZH 2F19H 1JGUL 4U6YA 4ZQKA 4K8RD 4ODHH 4ZO6A 3HMWH 4JEGB 4WI5A 4XPFL 3PXHA 4PRIA 5KSBA 4G3YH 4U6TA 5HGHB 3RNKA 3JV4B 3BYTA 5C0FB 1CICD 1T7ZA 3UAJD 1JWMA 2XTJC 3M1BA 2APXA 3RU8L 3ARGA 1IRAY 2P43B 5DD3H 5I8EB 2Q20A 1FCCA 4R7DB 3VRLF 4LSPL 2HT3C 2QKIA 1X5YA 4WEBL 5GRXG 3WNMA 2FR4A 4BFIB 3OQ3B 5C09D 5ACZA 4F7TB 2APFA 2YUWA 1T1YB 3AM8C 5FHAL 3KNBA 4YHMH 4TNWF 5A2FA 4LGRB 4Z7NE 1U8PA 4LHUA 4DKFL 4Y16D 5TPWL 4LARL 2B8OT 4PLJC 1INEL 2A9NL 4M7JL 3MNVB 4YE4L 4Y8DC 4KUZH 4NO5A 2F54B 5DQDH 5EOCH 3B9VA 4FQHB 5D70H 1ORQB 3BH9B 4NRYB 4P5KB 1IQWL 4RMTA 2BERA 2DJUA 3T2NH 4JFFB 1PLGH 3K3QA 4OD3L 4HLZG 1A3LL 3CZJA 1JNJA 3DIFB 4PJCB 4X4YA 1C1EH 1UADC 3SE8H 3V0VA 7CGTA 3LRGA 2P5ED 3NPSB 5ABDE 1SYSA 3GZKA 5DRZB 3OJDB 1S3KH 4R4ND 3BIKA 4WWKB 1ODAA 1MFAH 3P4LA 3AREC 4PLOB 4EQ3A 4GH7B 3AC0A 1WC7A 2ZCKL 2CRIA 4OCYH 2QQLH 4XMLL 4OGXH 3WJJA 1RUML 3VXPA 5C0CB 1AHWB 4XP1L 3ZKXC 5FYKH 3BMWA 4FXKB 3F62A 4JPWH 3REVA 1EH9A 4V1DA 4N0CC 1JHKL 2RB8A 5GRWA 1DEEA 2BNUB 5E1AA 1HXMB 2YUZA 4U1JA 4UQ2A 3MLZH 3RX5A 4LSVL 1RI8A 5CJQH 3GSNH 3B6SB 3D3VD 1D6VH 3GHEH 1FSKB 3Q2CA 4G9FA 5JNYA 2AGJH 5TE6H 3EFDL 5LGKA 1IQDB 2IQAA 1WZ1H 1S5HA 4XCCH 4Y4HC 2I07B 4QHNA 1E6OH 2JCCE 1QR4A 4Y4HA 4OZHB 5HPOA 2FEEI 4WO4D 3QDGA 3OJMB 1QSEE 5HGAB 3MOQA 2APTA 3BZEB 5IMKA 3HUJE 1EFXD 2XA3A 4JM2A 3MGOA 4KMLB 2ED9A 5CSZB 4DKDC 1V5JA 4UV7L 2NY1D 4EQ2A 3ZLQC 3MOAL 2JJTC 4OGZA 1YY9D 2DQGH 2EYRB 2W0FB 4KDTA 5MHSE 4NT6A 1YZZA 1J1PH 4M5ZL 3Q1SH 3FFCD 4JY6B 1X4XA 5I71B 3C6LC 5CBEB 3GSOA 3TBWA 3U82B 3AREA 4WUKL 3I3DA 5EN2A 5T3ZL 2EH8H 4LQFH 1JF1A 1OCWH 3JWOL 5AYQA 5BOZG 1FRGH 35C8L 4N1HB 4GXVL 2QSVA 4POZC 2VDKH 3CH1B 5F7EH 4ZFOB 4HEME 1EVUA 3L95A 4ZPTA 4X5WB 3CDFA 5DD5L 2A74B 4ELME 2B20A 2J8UE 4RGOL 2XY2A 3ARBA 3CFDB 4XXCA 3ZE0F 3CX5K 1AD0A 4NO0B 4WWKD 1H5BA 2XWTB 4AIOA 4QRPB 3U83A 1NCTA 3SCMA 3AB0B 4JFEB 43C9A 2V2TB 4QRUB 4R8WH 1GZQB 1RIHL 1I3UA 3AM8A 1S9YB 3QQ4A 4GBXB 3O81A 1CXFA 4U49A 5IJVB 4YHYC 4P2QD 3QWOB 3NFNA 1RUKH 1EO8H 5FB8A 5F7LB 5FDYA 4JFXB 3TN0B 2UYLA 4HG4K 1Q8MA 3SGDI 1OAYH 5FA4A 1RUKL 2DLFH 4LSRL 3RQ3A 4ZOCA 4JFDA 3SGDH 5SWZD 3O4OC 4L9DA 1A6WL 1JZ5A 2J4WL 3VXOB 5F1KC 5HGBA 4OJFH 5JW5A 4L4VE 1S7XB 4LVOB 2VABA 3IF1B 4XNZC 1E6JH 3C87A 1FLRH 4PJGA 3KHOA 3WE6B 1N2RA 5I18H 3EYOA 3U9UB 2O93L 3UTPD 1CDUA 4D0DB 3D0LA 2APWA 1Q72L 5JIIA 5IKCB 1LE9B 3SO3C 4PJXE 2EO9A 4MNHB 1ZS8A 4JANA 1SVCP 4HIJB 3GEWB 1V8HA 1FQ9C 4PJFF 3DUHA 3MA7B 2O5XL 3STLA 1IE5A 1VESA 2BFVH 1F4XL 5ID0A 4Y2DD 1YY8B 3UX9B 1FORL 1A2YA 1ZHBB 4PR5A 1I8KA 2AXJA 5H2BA 5DSCA 3BH9A 4NRYA 1KN2L 4OF7A 5FYLH 2XIDA 1BJMA 2V5MA 4MJ5B 1NMCB 1JV5A 1NAML 5H94A 4LRIA 4I0PC 5GJSL 3CXDH 2AJVL 3GJFA 2OZ4H 4MNGE 4UNUA 4XP4H 3CSBA 4NPYB 5FUZL 4K94L 4PV9B 3CZFB 1M4KA 2PNDA 1JNHA 3C6LB 3ARBB 3FQRA 3MGTA 1F3JA 2IMNA 3HPLB 4HJ0C 3F7QA 4EXKA 2E6QA 1KGCD 3REWA 2HVJA 1JI1A 3H9HA 5TE4L 3PWPE 1UH3A 2VDLL 4H8WL 1EDQA 2P8PB 2RIKA 4WGVB 2WBJD 3C8DA 2P7TB 4HWBH 3SKJH 5IVXE 4TUKL 2WBKA 3QNYA 2Z92A 3R1GH 1X44A 3E8UL 5CD3A 3ZT6A 5KSAA 4PJDA 3GBML 3NABL 5EORL 3O2WL 4HFUL 2BY2A 5E8EA 4NZJA 2GKIA 4KV5F 1WK0A 1OARL 2YSSA 5DEGB 4NQXB 3VXUB 4BFBD 1FNGA 3F8UB 3R0NA 1HILB 4HZLA 5KAQF 2QQLL 4XMLH 1KJ3H 3W0WE 1AGBA 2DQUH 3OB0H 3UC0L 1E27B 2FR4B 4WW1A 2GIYA 5IBLD 3FHQA 5JA8B 1YMME 2BXYA 1RZJC 3ZO0A 2H1PH 3DRQB 1T7WA 1FVCB 2FJGA 3SKJL 1BWWA 1IAIH 2GAZB 5IBUG 3TJHC 1I7RA 3LH2H 2F54E 2AJSL 5CLTA 4X80L 1BZ7A 4G8FA 2Y25A 4OZHE 3GMLB 2YD9A 2EC9T 4OB5L 1IQWH 1FFOB 5CZXC 4MSWB 4AT6A 1U9KA 1JRHH 2BVQB 4L3CB 3B83A 3BD4A 4NP4H 2X41A 5HHMB 4PJCA 4XX1E 4I0PA 1LO5B 3AREB 1SYSB 3NA9H 5DRZA 2GJJA 5IIEB 1DBAL 4XCNB 1KXQE 3HC0A 5D1QA 3RUGE 3JWDH 1I1AB 3X17A 1K2DA 5TH2A 4P4RB 2FNBA 2PO6B 5JW3H 2AEWA 3FFDA 1B0GA 4U33A 4AEEA 4XBGA 3VFWA 3I75B 1WC7B 2Y7QA 3BN9C 5L8KB 5CP3H 3TVMD 3OXSB 5E2WH 3L1OH 5FHBH 2GTZB 4JKKA 2DAVA 4QRPA 2OXHA 4NM8L 4XX1G 5TFSH 2X4PB 1U8OA 4JQVA 2WIIA 2J8UB 2CQVA 3O6ML 5F97E 3LAFA 1J12A 1VB9A 3BE1L 1IQDA 1F8TH 1UM6L 2AS5M 2CRMA 4NWTH 1DQLH 4HCRL 4XVTL 2IALB 5CEYB 5HGHA 3HZVA 4PJ7A 4ORGA 3VDCA 2Z0BA 4KJQC 4NQCE 3E6HA 5I9QB 3SDAD 2AJZB 1IM3B 3QDMB 32C2B 3GFUA 3LEVH 4DCQA 2JTDA 3S3SA 4YDKH 3KR3H 1PKQE 4NNYA 1ETZA 4WIQA 4QRTA 5IR1B 2DTMH 2DLFL 1P7QB 4LCCA 3EDEA 2NYYD 3MLZL 4YWGL 1MI5E 5I1IL 3NVQA 3STZA 4ZXBA 3CPLA 1EO8L 4Z5RA 3VFVB 4QHUB 4BYHA 2OMNA 4YGVA 5C0GB 3MV9E 4NBZB 3L7EB 1X5JA 2XWJA 2ZWLT 1YEJH 2W9DH 1ED3B 5D2LB 1FDLL 5HYSB 4XRCB 2ZCKH 1JJUA 1MWAL 5L8LB 5MERA 3MBEC 5BVJB 1NSNH 5I1AA 3EO9H 3QEHB 1XIWA 4RGOH 4W4NA 4KI5E 4PGBA 3W2DL 1YEKH 4I0PB 4KKLC 1LEIB 4MWFB 4JRXE 5F89A 3HB3D 3RVUD 3TZVD 1NMCC 1UKTA 3MLUH 5F7EL 1A3LH 2BSSB 4ZSOE 4P3DA 1X7QB 4BSVA 5CFHA 4K71B 4RBPH 4RGNC 4LLDA 5T1LB 1FRGL 1EBPA 35C8H 5ITBL 1GGTA 1HCVA 5EOCL 1SQ2N 3PQYD 3TBVA 3PWPB 5GZOC 3NAAH 1KCLA 5JUEH 5EIIA 4G6KL 5TDNA 3CCHA 3QCVH 5DF0A 4EIGB 2ZUQC 5EDXA 4P4KC 2V17L 4JCMA 5B22A 5FYJL 4JFEA 43C9B 3GMNB 5CINL 1VFAA 4I13B 4WEBH 4U1SA 1A9EB 5SX4H 3NCCB 2R29L 3DUUB 4IOFD 4U1KB 3HZYA 3OAZH 4XNYH 3P40A 5CD5C 4GRWE 4ZUTA 4MDIB 5IHLB 2UZXB 5J1TC 3LRSA 1CGYA 4IOIB 2MQ3A 3VFSA 2E8YA 3ROLA 3PIQB 4G3YL 3WIHA 4YK4B 4AMKL 1A4KB 1AGEB 5C6TH 3NBNA 1N5AA 4HEPG 1AP2B 3VXMB 3PWUA 1QLFA 1CDYA 3VXNB 3MODH 2FIKB 5DO2D 4L8CB 1R3KB 2AJXL 1MFBH 3IAQA 3O4OB 4LOUC 3KYKH 3IGAA 1RUAH 4H25A 2QKIB 4ZFFB 4J3VA 3STBA 2X6MA 2AGJL 1T0MB 3RI5K 4JO1L 4D0BA 5BS0B 2AK4A 4LLMA 4DN4H 5I74C 3BDYL 4LDOB 1T20B 3FMGL 4G8IA 1A1NB 1H3GA 1RHHB 4ODWB 1ERNA 3DYMA 5DRXA 4L3EE 4G8FB 2I24N 3PWVA 3TPUA 4ERSL 1RJLB 1KIRA 2Q1EA 1AR1D 3LEYH 5JOFA 1U8IA 1KJVA 4X5XB 4OGXL 1MI5B 4YNYA 1FN4B 4PS4L 1RFDH 5KOVC 4D3CH 1KENL 3IU4L 4X0KB 1A7RH 1S3KL 4KKCC 3JTSA 4FTVE 3EYFB 4BK5A 1NBQA 1FZJA 3HC0B 5GGSY 1AKJB 3MRJA 5CEXB 1ZHKA 2WSKA 3U4BL 3T2NL 2LFGA 5JXAL 5GRJH 4X7FC 1CLCA 1BFOA 2LTQB 1L4IA 1MH5A 4P5TD 4Q9BA 3HMXH 5JHDB 1I85C 2DWDA 1A6VH 1OSZB 3ULUH 4RNRA 3OXSA 1ZA3A 2R9HD 3MPCA 4FXGB 5FA3B 4PLNC 4FQIH 1REIA 3HRZA 4H5SB 4XP5H 5EO1A 3VXTB 3NFSH 4GG6F 1HDMA 3VXSE 5C0JA 3LVEA 2FX7L 2NPLX 5DWUH 4A6YB 5DK3A 4L8SB 4MD5A 4TSAH 2C9AA 1U8JB 4Q9RL 5C0RL 2XQYK 1T2QH 4KRLB 3RU8H 4OFYD 1UXWA 4JFZL 3SHSA 3ULVL 4PJGB 4XBEL 2A2QT 5J06A 1MEXH 1BEYH 1S9VB 5F9OL 1V7MH 2WNGA 4BELD 1ZXQA 1KIQA 3K8KA 4GW1B 4WEUD 4EDWL 4OZIB 3RDTC 3RL1A 4G6ML 2J8HA 2JIXA 2YHGA 3RHWK 2FIKA 4QNPF 4G7VH 2B4CL 3DVGB 3F7RA 1FSKC 2O26U 5GZNC 1CICB 1P6FA 1FC2D 2P5EB 1Z9LA 2GAZA 4AQ1B 3OKLB 4DUVA 1EJOL 4KI1A 1A6UL 4GAGL 1WZMA 2MCG1 2BCKB 3RGVC 4MAYB 5D7LD 5CZVL 1CI5A 3SDAC 4ZUWA 3KWWA 2FL5B 2NXZD 3LKSB 3QUXD 1KBGH 5DTFA 1FNSL 1N7ML 4RZCA 4YAQB 4JRXD 4HIXL 1RZGB 3ZDZE 1ADQA 4E5XB 5D8JH 1RZIB 4K23H 4YFDB 3CH1A 1WWWX 2IG2H 4YUEL 1NCAH 4JDZA 4QKXB 3QFJE 3L95B 3F6IA 4HS3B 3SO5A 4P23D 1UZ6F 2NX5E 2CR6A 3RWJA 1VDGA 3HR5B 2R2EB 1RZKH 4X7CC 4IHOA 4JN1L 1VGKA 3GB7A 4P57B 3CXHK 1T22A 5I1HL 1G6RL 1MUJB 4YQXL 1UENA 2BC4B 4HQQL 3K7UA 3OZ9H 1I8LA 5CWSB 4P2RA 4BQBA 3EO1B 4NUGH 3HE7D 2H2PD 3TCLB 1OB1A 3ARDD 2B2XL 5ID1A 2Q8AH 3H9HB 4R0LB 3PDOB 1HZHL 4PBVC 3SO3B 2R1XA 1LO0H 3L3DB 2UZIH 2ESVE 3FRUB 1FYTE 4XPBH 3X11B 4OI7A 1I1YB 5FUCE 4UIKL 1JK8A 4U31A 3VFTB 2BVOA 2GY5A 1UQSB 4C56B 5CKAA 3QA3B 1YEIL 5C2BL 3HPJA 5C08B 5I1LB 3BN9D 1T6WA 4CN6A 3B43A 5E2JA 3QAZB 2C5DC 5I16B 2OCFD 3DXAB 3M8OL 3PHQA 5F7HA 1OD9A 1IFHH 2Y07L 1FL6B 2XZCH 4HBCL 2V9RA 1LO3H 2WUBL 3E6HB 4OIIH 3IDIB 4Q2ZB 5I66B 3GSWB 3V8CA 3BWAA 4XTRD 2WV3A 3TO4C 1KJMA 4MNQB 5INDB 1HEZB 4RAVA 4BFIA 1EGJA 1Q0YL 2FDBP 4JY5L 5BMFL 1WBZB 2PW1A 2D31B 2HTKD 2NY2D 1T20A 4G8IB 5ISZD 4H26A 4M3KB 5D2LA 5HYSA 2NXYD 2HG5A 4L8BB 3ZL4H 1ZA6B 2YUVA 4EI5A 5T1MA 3IDUA 4I77H 4NQCB 3QG7H 3KPNB 4OM0H 4LCIL 5AZ2L 2NYYC 3DWTA 3IDJA 1I1CA 1ZHLA 5E2UH 1YEFL 1IZJA 3GSQA 3SE3A 4X4YB 4DUXA 5IGXL 3UP1A 3RWCB 4HUVA 2EYTB 3GUTB 1FFQA 4MXVF 1MHHB 3J7HA 2EDYA 1KC5L 4GSDH 4E42A 4NUJB 1MCDA 5ESVA 5IHUL 1LP9F 3HZMB 4Z7VB 4HUMB 1I1AD 2F8XC 1OAKL 3I2CH 2BVTA 2JB6B 3UDWC 1PX4A 4J3SA 4MYWB 1JFQH 4TTDC 5JPNB 5CLWA 4CUCA 5EC2B 4Z7UB 1TJIH 1C5CL 5IOPB 5EO1B 2B39A 1H0DA 4Y5VC 1Y18A 5C07D 4ZS7L 2ZUUA 1XF2B 1HOCA 1R0AH 1RVFH 1A7PL 2VAAA 3BZFB 3MV8A 4GQ9L 1HHGA 3MA9L 5BZWB 4BH8B 1C7SA 3QCUH 4OT1H 3X3FL 3VXNA 1D7FA 3RBSA 4LLUB 4WFFE 1IT9H 1SJHA 4ETQB 5D7LE 4J7RA 4U6VL 4UT9L 1DR9A 3K2UL 1BJ8A 4CW1A 2QQQA 1G84A 1NC2B 4JB9L 2X5PA 3C5SA 5BS0E 1I9RH 2FBOJ 1XR9A 1X5LA 4RMUA 1S7WB 1E4XI 1ZEAH 3Q5TA 4WU7A 1JGDA 5TGBA 2IFGA 5F7NC 1FGVH 3G08A 3LHPH 4N8VG 1CQYA 1GIGH 1O0VA 1P84K 2ATPA 2D0HA 2NY5L 4ZAKA 5TF1H 4NKMA 5ISZA 4AIZB 5FECB 2FATL 4LP4A 2VDRH 1WZLA 5IB5B 4JLRA 1G7MB 1MELA 4D2NA 5I2IA 3BI9X 2A6DA 1RZFL 4XCNA 1AO7B 3K1KC 1B9ZA 1CLZH 4JGJA 1SEBB 5ADOL 3D5OF 4WV1A 5HD8C 2H6PB 3FO2B 1KPRB 3NPZB 4L4TB 2VLKD 1GGBL 1RY7B 1TJGH 2NY4D 3ULVF 3FN0L 2BDNL 1NGXB 1R5VA 2OJZL 4M61A 4MAYC 4UQ3B 3WFHB 1LWRA 3PL6A 3OR7A 4E42B 1MJUL 3ALWA 4F9LA 1FYTD 5DJ0B 1XGQB 4PP2B 5IEHB 5A2IH 1K8IB 2F5AH 1T04A 3FQNA 4UIMA 1BLNA 4POZD 5D5MF 1CGUA 1CICC 1MEXL 4JM2C 3BEVA 12E8L 1WWAX 3S97C 3U79A 3UTSD 1K8DA 5HYJB 4FFVD 1UWGL 4NJAH 3O8XD 5IM7B 5D7SL 4JGUA 2IFFL 4ONGH 3T8XA 2X42A 3FOMA 1CFQB 1QFWL 3QDJB 2NY2C 4L8SC 1HHIB 1VGEH 3M1BB 3CLEL 4P2RD 2FYYA 4QY8A 4Y4HB 3BPLB 1AQKL 1VFOA 3MA9H 3PWNA 4ALAL 4BZ1H 3ZT5A 2R2CA 4M8QB 3ZMRA 1P6AB 3BQUC 3RAJL 4HLZH 4XNXH 1BQHG 2V7HA 3SKMB 2H9GB 2DI9A 4GG8B 2WUCH 4LU5H 3MUY1 1OTSD 1C5CH 4PD4K 4X5LA 5I8KH 4H1LA 5D2NA 1A22B 5F1SA 2VDPH 3B9KB 5IVXF 1S7TA 4PP1D 5L2KE 3L5WB 3LKSA 5C9JA 5DVOA 4K3HA 1XH3A 4CADA 3LEYL 5IHUH 3ME0A 3CX5J 4M5YH 3R8QA 1NFIB 1IGML 1GPOL 2ORBL 4P3DB 1JV5B 2MKWA 2FECI 3EZJB 1ULVA 5CEXA 3KPRB 3DROA 3VFPA 2GYSA 1HWGB 3GIVA 3TBSA 4WW2C 4CVZB 1F58L 2JIXD 4KRPB 2AEQH 3GUTA 4M93C 3NGBB 2DS4A 5J1SC 2I27N 1NC4B 2X4QA 2HLAB 1N6UA 4GO6B 3PL6B 3V6BR 5CMAB 2K1MA 5DJZA 4QHKI 5DFWH 1A9EA 1YJDL 2E9JA 5D96B 5IWLA 3X11A 3TP4A 5C0JB 4FHBD 4IOSD 4F57L 5GHWH 3P2TA 5GGVL 3S34L 1FYHB 4PRHB 1HINH 4KRNA 3ARGC 1Q0YH 1YDPA 2EDQA 4JFHD 4LVOC 1I1FB 3WJLC 3LKNB 5CJXC 5LVEA 5AWNL 2YRZA 4PRNB 5FEBA 3WFDL 1IGJB 2EDEA 2J6EL 1LO3L 4JFPA 4OIIL 5T3XD 4MD0A 4BUGA 1YYML 2B1AL 3QCVL 3BX7C 3U1SL 3PWNB 3SDCC 5JUEL 3M8OH 4YHYB 2C1PB 4JQVC 3LN9A 1XF4B 1GC1H 5IF0B 1Q9OB 5E03A 4MQXD 5MENA 1D5ZA 4NKOA 5SWZB 1F4YH 5I1GL 3QHZH 3S5LB 4MB3A 5MI0B 4AEIL 4ONHA 3WNOA 4PGEB 1IAIM 4HLJA 4NT6B 4OLYH 3VXQA 4BQCA 4AT6B 4M4RA 4YIQB 4YX2L 5C9JB 1LO2L 5T1MB 5J9PA 1FO0H 5FUCC 3IDXL 4GBXD 4N0YL 3E2HC 3SE9L 4DVRH 4YPGA 5F7FA 3RRQA 2CPCA 5B4MC 3DBXB 1WIPA 1GOHA 5E9DA 5CWSA 5TDPA 4Y1AE 4JHAL 4XI5D 1TPXC 2Q3AA 4YHLH 4OV6F 3QQ3A 3RZCB 3IJYA 3QHZL 4AIXA 3U4EB 4OCXH 2VE6A 1KCSL 3VMOA 5C0EA 5C7XL 2WAHA 1JE6A 2Y9RT 4NOFA 4XHJD 3CFBA 2EDTA 3BUYA 5D93C 1KBGL 1T3FB 4JN2A 2DQDL 3AS1A 5FOBB 3W11D 1HI6B 1U8HB 2C1OA 1BFSA 4ODVH 2XG4A 5DJDB 1BBJA 4P2RE 3QPQD 4G80A 1D5IH 3MLRH 5T1KB 1RJZB 5SX4I 4PJIE 3SQOL 4H20H 3KPSB 1OAZH 2XFXB 5TFSL 2B4CH 1DCLA 5HI4C 3MRKA 1A9BB 4KKNA 2ARJA 2EEAA 4O5LH 1B4JH 3JZ7A 1NGQH 3KXFA 1MOEA 2A6KA 1GL4B 3H2WA 2PXYA 1HINL 1UB5B 3S34H 3EYOB 3LOWA 4IDJL 1BEYL 1ND0A 2B4CC 3FO1B 1IC5H 4LSUH 2E6PA 1SJHB 3TZVA 4JFZH 4EEEA 2CK0L 1S7SB 1I8MA 2E7MA 2WWMD 4M7LH 2O5ZH 2EIEA 3FCTB 4MLSA 3MJ6A 4PBWD 1HH9A 4XMKH 1DQDL 5EZOH 4R4BA 2OTUA 1J1OH 4RMSA 4O2EA 3U7YL 4E9LA 1A2YB 1ZHBA 2XQYG 5DSCB 3ULUL 4POYA 3MJ7A 1IGFH 1YY8A 3QIBB 4LBEB 4DVBB 1ZHLB 3NCEB 1OM3L 5D72L 3O3BA 5JO5B 1TMCB 4ZXBD 1JZ3A 1PKQB 3QJHB 2D9CA 1WEJH 1ZGLM 1E4XH 2COQA 2AJSH 2FWOB 1U3HD 1G7HB 1FFPB 3MV7D 5T33L 5A3IC 5D1QB 2QSQA 4D9QD 1DN2A 2Y36H 4PJGF 3WUWB 2NTSP 3VD7A 3QXVA 5GGRB 1A7RL 3PGFL 3NIFE 2E27L 3LKQB 5C0ND 3SDAA 2XA8L 4F58L 3A6OA 1I9EA 3QQ3B 3D39E 4V2CB 4X9FA 2A83B 2QBWA 4KI5F 3W5NA 3ECBA 2BNUA 1U92B 5E1AB 5DEFB 3L9RA 4F2MB 5IG7B 4JFFD 1K6QL 1P4IH 3REWB 2OP4L 2P8MB 4XWGL 3EDDA 1QHPA 4OCRL 2YXMA 3D69B 5FA4B 1J11A 2XTJB 4KTDL 3T0EB 4JM2F 2GK0B 2ZNXA 3OKKA 1JP5A 2XACC 3CLEH 5KJRL 2FGWH 2CDGB 4RGMB 1NMAL 3DSNA 5CJXA 2BHUA 3EGSB 5T1KA 4Z8FL 5BVPL 4WJ5A 2IPUG 2BY0A 1RZJH 1U95B 2AJXH 5EU6B 2YSSB 5DEGA 4CMHB 3EAKA 4KZEH 3O0RH 4ZPVA 4BA8A 4FQCL 1AFVL 3MCG1 4MQTB 1KLFA 4PJEB 5D1QD 4XCFH 1QPXA 2DLHA 3HI1B 1NBVL 3MA7A 1OGTB 1T1WA 3BPCB 4NCDA 1C08A 1CR9H 2PUQT 1DE4B 2L7JA 1RK1B 5DMKA 4S1RL 3CLFL 4JZNA 2P5WA 3H9SB 2V9TA 5EN2B 3KPNA 2K9UA 1HQRB 4PJAA 3FN0H 3G9AB 3V2AR 1JRHI 1NMBL 5IW6B 1LQSR 4WNQB 4QF1B 5BZDB 5ILTH 3KLHD 4PD4J 1RK0A 3JV0A 5CAYB 4X8JB 2DLIA 3V9FA 2DKMA 3T0VA 1IAII 2PETA 2PTVA 3C6LA 5DHVH 4XPGH 1AIFA 2HMIC 3UPRB 4DAGH 2EE2A 1BGXH 5ESVB 1ZLVK 1UZ8B 4DN3H 1AXSA 1MFDH 4ODSL 1BIHA 3GO1L 5C92A 4ZOEA 5D2NC 5CHNA 5K9OA 5FM5M 3ZHKA 3NCYS 4P9HH 3BDXA 2HLAA 5F9WC 4I3RL 2CJUH 1R3HB 5F3HB 2VKWA 4U1IB 1KCKA 3FZUD 5SWSD 1DVFD 3WD5L 2XTJD 4JFEE 3IETB 2CDEB 3FB5A 1J8KA 5D71H 3EYSH 4KVNL 3ZHLA 5KSAB 5B8CC 1CYGA 2RFXA 2UWEA 2X4SA 3L3KB 5JORA 1QPPA 1RULL 2VZ3A 4YHNB 3VXRD 4L8SA 1DBBL 1KPUB 3SKOA 5FKPA 1D6EB 1YYLL 5BRZA 3LDBB 4Z78B 3WUZA 4UU9A 2I9TB 3IS0X 4JPIA 1IGJA 3WDJA 1IEHA 1HE7A 1NCNA 5IBUB 1Q9KA 3CFCH 4YPJA 5HVWA 3MRRA 1DQML 1P2CB 4P3WA 3DJ9A 4UT7H 1FPTL 3BP4B 5I19L 3WFCH 4KPHH 1KTLB 4IDLA 3P30H 1HHKA 4RIRA 4YDLB 5DFVD 4X6FB 2Q8BL 3DVGA 1ZLSL 2PYFB 5SV4A 1A7QL 3GKWL 2HTLD 3BJ91 5MEOA 2FSEB 4R97C 1G7JB 2R56H 1DQQA 1S7QA 1CG9B 3KDMB 1CE1H 2DQIH 3VDAA 1Q9WB 4MQ7B 3B2UD 1KC5H 2D0GA 2YD5A 1Z0NA 2NLJA 3MNVA 4U0QB 1ZT4B 2AJ3B 4NKIH 4PJ8C 3UZEA 5C08E 5GZND 3TBYA 4FQHA 1F13A 4L4VB 3MRIA 1JWSA 2FJFA 4TRPH 4WV1C 4HXBL 3T4YA 2P24B 4UILH 3RWDB 4Z7QF 1MLBA 3MLTA 3D25A 4LCIH 5F9AC 1TVHA 1MCNA 3MOAH 4TUJA 2JLLA 3BPOB 5LG1A 1CTOA 1U36A 3CCHB 3EBAA 4IEFB 1CE1L 2DQIL 2Y6SD 5F1NA 2BVUA 3EO1A 2QHLA 1HKLH 5K59E 1MLCB 3O6FA 3T2OA 3PWJA 4CDGC 4V1DB 2W92A 2N4IA 3WFZA 3CJJA 4MCYA 5IG7A 4M8VA 4Y19A 4OB5H 4JG1L 4ELMB 5CBAB 1H8SA 1WZ1L 4KPHL 3SDDA 4W68A 3HC3L 5DFVC 1BECA 5DJAB 1D6VL 1FVDA 3OBAA 5CJQL 1AY1L 1G7LB 1M71B 4HUWB 4NHUA 3V6FA 1FO0B 3HPJB 5C08A 2NXYB 1YYLH 4RFEB 1D6EA 4Z78A 3DX9B 3G5YB 5D1ZC 3VG9B 4HUUA 3NCBB 1G6RB 3JV4A 4FQQB 4ZFFA 1NLBH 2BRQA 3GMMA 5D9SA 5D71L 2R1WB 1I3RA 1MPAH 2CUHA 5HHQA 5E4IA 3DO7B 4G5ZH 5LAXA 4KMTH 1LK3H 2ADFL 1MCPL 5DJ2A 5E5MB 4HMDA 1KIPA 1ZT7B 5I73B 2Z8SA 3EYVA 1N4XH 3FCTA 3GM8A 5DRNA 3ARED 4UB0L 3JWDC 2XQBH 4ZO7A 4F7CB 1BQHB 3SKNB 1CG9A 3WFEH 4FABL 1PYWB 2C3GA 4HQQH 1RU9H 2ITCB 4TNVK 5GS2D 4F3FB 5EPMB 1P5UA 2W0PA 2VSDA 1BD2D 1TQBB 2QHRL 3U48A 5A2JH 3NH7L 5CIPB 4XBPB 4YE4H 4N0CD 4E5XA 5BJTB 3LKPA 5A16A 4ZDHB 3GM0A 1NGZA 5HI5D 3QUZA 5K9QI 5EA0H 4YHML 4HPOH 2VXVH 2EDHA 4LMQI 2OZ4L 5INCB 4FS0A 4PLJD 4QOKD 4A6YL 4KHXH 1TQCB 1A0QH 1QVOB 3FB6A 1S7RA 4RBPK 2VLMD 3HE6A 4F7PB 3CFDA 2H8PA 3BSZL 5ESQB 3EDKA 4I9WE 2BSRB 4Y4HD 3GJEB 3VXSA 3LCYA 1GOFA 2NY4B 3O6KH 1R24B 3GSXA 2VLKB 5GXBB 1H3PH 1T3FA 5HHMD 2D7TH 3A67L 5GSVA 3TO4A 3D3VA 4MHHI 1AFVH 1J8HD 2AJUH 2N7AA 1FH5H 3BRGC 2Q86A 3L5HA 1NDGB 2DLEA 4KZEL 1B0RB 2JB5L 4U1MA 1WUNT 1PSKH 3B6SA 1RZJL 3KPPB 1DQTA 4D9RD 3VFOB 2EDRA 2D4DA 1LP9E 2R4SL 1H8OA 3QUXB 4L8DA 5DS8A 3QNZA 4NQSB 1JPFA 1I7ZA 1ZTXL 3V8OA 1T2QL 4N0UB 1OP5H 4TSAL 4AEFA 3ULVE 4NNYB 3C09B 2HWZH 4MA8L 2VDMH 1FLRL 4LCCB 3ARWA 4I4WB 4S1SL 2F5BH 5EO9A 4N90D 5DYOA 2VR5A 3VI4E 3ZHDA 3BHBB 2APVA 3SGKC 2R0LH 1Z9SA 5ETUB 5FUOH 3CMOH 1W0VA 3HMXL 3JV5A 3U46B 4H8WC 1QLRB 3UBXB 1JGLL 2CSPA 4APQC 4HAFA 1KCUL 5BVJA 1L6XA 3KLAB 4LHUD 5E99L 1LP9A 3QG6B 4EKXA 2ADJB 2EDWA 3DSFH 2AKRB 2OQJB 5FYLD 2BK8A 3BH8A 4JQXA 2NY1C 4D8PB 2FWOA 3QDJE 4PY7B 2NNAB 2DWEA 4FFYH 5KSVB 3DMMC 5HHXL 4U1HA 1SEBA 3UYOD 3EIFA 4RDQF 4ODXB 1BQSA 1NLDH 4UI2A 4RRPA 4EN3C 1G7PB 3VXPB 4GS7B 3CSPA 3IFLL 1I3VA 3MOBL 1BWMA 4S1SH 3QUYD 4I48A 2AXFA 1PGRB 3IJHA 3ILPB 3R06B 4OZGF 3B2VH 3HPLA 3MV7B 3FMGH 2O5ZL 4EDXB 2YMXL 4G7YL 3DGGB 4HMCA 1C16A 1RZ7L 1AI1L 5IFHL 4LSUL 1VEPA 5I6XB 3PWJB 1DFBL 3CSYA 5F44A 4G8GA 5EO0A 5IFJA 1P1ZB 2AK1L 1D9KB 2P1YA 3QUKA 4NYLB 1N59A 2CDEA 1UVQB 4I0CC 3NCMA 4JO3H 3RDTA 4N8VB 1MRCL 1RQ5A 2KKQA 1OAXH 4Q9QL 4LRNL 5EOTA 1A9BA 4CN4A 3TFKD 1BM3H 4MAUH 3FOMB 4HWBA 2UUDH 2D4FA 2A0LD 5F1OB 3WO3B 4Y4KB 2GQHA 1QFUH 4DZ8B 3DYOA 3G5YA 4ODVL 5DGRA 1K3ZA 2PTUA 4FQQA 3QIUA 4Q6IA 2VC2L 2YEZB 4K3JL 1CQKA 2OSLB 1A1NA 4IRZL 3LS4H 5FYJH 2D03L 3KYNB 3GHEL 2I26N 1NC2A 2CGRH 3VGAC 4Y4FC 4WHDA 1RAMA 5FO8B 1MWAA 2VL4A 1VEMA 4NO5B 4G6KH 3TH3T 3P9LB 1S7QB 1IM9D 3VMNA 4NFCA 1JWUB 1MI5A 2IAMD 1JHKH 2GJ6E 5HI3D 1BQHA 4JKPH 1MCBA 4PJIA 5JW4M 2QQNH 3HUJA 4L3CA 3IDJB 1V05A 2P8LB 1FIGL 2VDNL 4GG6B 1JPSL 1MF2H 2PW2A 4TPRL 1G7MA 3OB8A 1MJ8H 4N0YH 5DMIH 3RWJB 5GS0D 1YEKL 2P42B 1FFPA 4KK8D 1KEML 5D7JA 3C8HA 1WWBX 4WHYG 1KFAH 2DKUA 4WFGE 1CLOH 3BAEH 1FC1A 3QUYA 3IDYB 4JPKL 4EZMA 1SM3H 2CKBH 2G60H 1G0XA 4B53A 2VKXA 3W81A 2DM4A 4HF5H 4MJID 3MNZA 5I1GH 4C54A 4PJAF 1RZ8A 2R23B 2NR6D 4G9FE 4KAQH 1HHJB 1MCFA 1ZVSB 1NLBL 3DV6A 3ILQD 2JJTA 3V0WH 1BOGA 5L2JA 4JKPL 3DTXA 5B39A 1GC1L 3AUVA 5DQDL 4AH2A 5ELIA 4ZUSA 5KW9H 5TDOB 1INEH 2A9NH 4M7JH 2X70B 4U7MA 3DI3B 3BQUA 2B1AH 5B38B 4HWNA 3KS0J 3G5ZA 4Y19B 4L9LB 1IEBB 1XGRA 2Z92B 4DQOL 5JIPA 3H7LA 1UVQA 3ZT7A 5IB3A 3PWLB 2VAAB 1SVZA 1WT5A 3OHXB 1IC1A 4L3ED 1QHOA 3RY6A 4ORZC 5FGSA 4QXGH 1NL0H 4IM8A 4HMEA 1I1RA 3BD5A 5GGVH 1N3NA 1W72B 3TYGL 4DW2L 1PG7L 1F8TL 4WO4B 3TT3H 1P7QD 3G5VB 4XPAH 3IS1X 4ODBD 1KN4L 3ELAT 1E27A 2VLJE 4RAVB 1HH6A 4XWOC 1SYVB 3EO0B 4M6AA 3N9GL 3UTQB 4PUBL 3OKMB 2SEBB 1C08B 5DUMH 5K93A 3O11A 3H7BB 2AV7B 3RWGB 3G08B 1WJ3A 4X8XA 3TA3B 4M7KL 4RISH 1PYWA 5TGBB 3WJJC 3CDGA 1E4WL 4PR5B 2OLDA 1C7TA 5I1CH 1Y0LB 1YQ2A 2EE3A 4M62L 4PG9B 1DVFB 4OZFB 4Q74A 3LD8B 4XRCA 1N26A 5GGSB 5J13C 4Z9KB 4U6HA 2VQTA 1WAAA 1EMTL 3BUTA 4P2OD 2QADC 1IGMH 4HHAB 3GSQB 3MRHA 3W0WA 5E2TL 4PJFB 5AYUL 3MNWA 4HC1L 1XIWC 2R56L 3UBXI 5J12B 3VXSD 1KCRL 1NLDL 2H6PA 3FO2A 4HK3N 3HE6D 4O2FB 1H15A 2XWTA 1GGIL 2Q8BH 4OCLC 1QLEL 4P46B 4OD2B 2X40A 1Y6KR 1LDSA 5KVMC 4Y4KD 5DZNA 3HR6A 4Y4FA 4XXDB 4BH7B 4UAOC 4C56D 1ORSA 4RFOL 3HN3A 3VH8B 3T0BA 3PG2A 2P49B 2VIRA 4NQDA 4KH2A 5CZKA 2FEDD 1QFWI 4O9HH 1FZKA 1GGCH 1MY7A 1QSFE 4PJBE 1F00I 4OQTL 4DWHA 2VERN 1UGNA 1FHGA 2IQAB 1LMKA 1S9KC 2IH3B 1QKZH 3FB7A 4WTXA 4MD4A 4PY8J 2F5BL 4QY8B 1V3LA 2AAVA 3O3DA 5L2KA 2VDML 3KPSA 3EOAB 3ABZA 3GGWB 4LLUA 2R1WA 3GBMH 4ELMF 4W6XB 2CLZB 1PBYA 5C0AE 1I8IA 1A3RH 4GAYA 5JPMB 3LKRA 4QXWA 2X9XA 1F4HA 2DQFB 4KWUA 4U0RB 2PW1B 3GI8L 1XCQA 2JB5H 4RMWA 5EBMA 3S88L 1F3RB 4OV5B 4QXTB 4GMTL 4AEHL 1I9IL 1WQVT 4X4ZA 1S9XB 1FNHA 1UM5H 2BDNH 4JKLA 3WBDA 3SDDD 4PGEA 4GMSH 2R0KH 2FHFA 4YDVB 4Y19D 1QFOA 5T5NF 4Y5XC 4WFGD 3TESA 2EDJA 2Y4SA 2QSTA 4OIBA 3BSZH 2XI9A 3O6FD 2JJSC 3C8KA 1XIWB 1MJJA 2QJDA 5KANI 3UMTA 1SBSH 4MJIE 4ZFGH 3S5LG 4PJ9B 4RCAA 4CVZA 1CK0L 3NIDF 3DX6A 1QNZL 4OF8A 5KS9A 1UKQA 1DUZB 3BISA 5DFTA 3NCJL 5TF1L 1U58B 5J6GA 3HE6B 4F7PA 3DHMA 1CGXA 3GIVB 2VTFA 4S1DD 3AU1B 3GJEA 3VXSB 4WHTA 4K9EC 1BF8A 2V2TA 4Q58C 4MJ4A 2VDQL 2O5XH 3OKDA 4GW5B 3ALPA 2X7LA 3QT2A 3D85A 4GKZB 5GS1C 4YZFE 1KG0A 4RSVA 1EO7A 4K3EL 1NGYB 3CIQA 3QRFM 4CMMB 4CU7A 1LGVA 3UYPA 5LWYL 2CR3A 2PYED 1AGFA 5ICZB 4LHUG 4LIQL 3OR6B 4EN3D 1P69B 1ZSDB 3CSYB 3WHE1 1X5HA 3TA3D 1QBAA 3VA2C 1HYSC 3MFFB 2C26A 4M6ML 5HGBB 1BX2B 1A7PH 5E94A 4ZS6C 4J23A 4RFNB 3JSSA 1G9MH 3LRSB 2Z35B 3TVMC 4ZQKB 4F7MA 5KVGL 4QRQA 1EEZA 1MPAL 4POUB 5IV2A 2AERT 5IUSA 4UINL 1AKJD 1MRFH 2FX8H 5ADPL 2VYRE 4K7PH 4PGCA 1X5XA 4N9GA 1M05B 1H3VA 1NKRA 3WL9B 5I8EA 3BKJL 3GK8L 1I8IB 1KJ2L 2R69H 5EU4B 5JPMA 4XAWH 4D0BB 1IC4L 4M1DH 5F9JB 1E4XL 2XWJB 3HC3H 1ZWIB 3IFOB 1WFNA 4JO4H 5BRZD 3HE6C 4ZOBA 2BY1A 4F37K 4XI5C 3V4PL 3KLAA 2R2HB 4HS8L 4F8TA 7FABL 4U6XA 5JMRA 3VMPA 3IAGC 4PJ9C 1IM9B 2HT2C 5DD5H 4PGBB 1QACA 3ARDC 3QH3B 4X9HA 25C8L 3GSVB 5SWSA 5BW7C 4WHCA 4GRLA 1U41A 1QYGH 1MFNA 3DROB 3U0WH 2XNAA 3T0EE 1IKNC 4J3XA 2IH1A 2VLRA 3EYQC 1ITCA 1QSFB 4NC2B 3FO0H 3ZL4L 4L29A 1ZLWH 4H88H 4NJ9H 2N7BA 4HXBH 2HVJB 2J2ZA 1EZVY 1I4FB 4Y4FB 4NKIL 3UTTB 2VB5A 5ID1B 3BP5A 3WS3A 4QRUA 1AXTL 4Y1AA 2GY7B 3MRBA 5CEZL 3O9WB 4FNLL 3W5MA 1S5IH 4U1MB 3RVTD 4NN6C 1FFNA 3IETA 4GG6E 3Q6GL 4LLWB 1IAOA 2FRGP 5IB3B 3D48R 4KUCF 2Y07H 5D1ZA 3OGCA 5E7BA 4MNGB 1AJ7L 3VXMA 3F5WB 1WBYB 5EBLA 4L4TE 2IH3A 3EYUL 3QFDA 3H0TA 3DXAA 1NGWA 3PHQB 3U7AA 1NQBA 1FPTH 2QQKL 5MEQB 2GUOA 5F21B 5IROA 2DJSA 3RL1B 1A4JA 4I5BB 2XKUA 4MJ6B 5E70A 2ZG1A 5IBTH 3MRNB 3O2VL 3VGDA 5CD5D 1KTLA 5CJ5A 1DBBH 2HVKA 5IP4A 3SDYL 3UJJL 2G75B 4MNHA 4EOWH 5D1XB 2FH8A 5A1AA 3M17B 4P46C 4PB9H 4HWEL 1QBBA 4X6CA 1G6RH 4NNXA 3VE0B 4JVWA 2YUXA 4OFPA 5F6IC 5DJ8A 1LDPL 4EN3B 4LSQH 3LMJH 5D6CB 3BH8B 2L4OA 5E00B 4N68A 4KFZC 2DWEB 4JFFA 4GAJL 5GGUA 1CFVL 2BNQA 1FZJB 1PW3A 2Z31B 4MJ5A 5HDQH 1VHPA 1PLGL 4OD3H 5D7IA 4YDJA 3LEXB 3QEGL 3QDMD 4B41A 2FGZA 5FFLA 1I7UB 2O61B 5GRUH 4DKFH 1CT8B 1A3QA 1T4KB 2OK0L 2YN3A 2PYEE 1FAIL 5KVEH 1BQUA 1VFAB 4KJQD 3TFKC 1CXHA 5E08L 5FHAH 1QG3A 5C70A 1N5YH 4RX4D 4JVUA 4PRHD 4LCWD 4ODUB 4NN7C 1YEGH 2R1XB 3ROOB 2IJ0C 3NZ8A 5B3JF 4GKOA 2PTTA 3UEZA 1L7TH 3KGRA 4NQED 5EUKB 5J11C 2MSPA 4EDWH 2NCMA 2AXGB 2WWMC 3UJTL 1K85A 4JZOB 4N5UA 4HKZB 4Y16B 4F57H 3WCYA 1ZGLB 2OI9B 4NIKB 1JYXA 1L7TL 4KK5D 5EULV 1A6TA 5FF6B 4NN6B 3BZFA 1YEGL 5D2NE 3NFSL 5B8CA 4OZGB 2A73A 2ZSWA 2YEZA 1BFVL 3O3AB 2PXYD 1N5YL 3KXFD 4Q6YA 1NGPL 3N50A 1GHFH 4PJEA 3KYNA 3RVVD 2XRAH 3L3HB 2HVKB 4F9LC 1DSFH 3FQTB 1XR9B 2NY4C 5ALBL 4X98B 1S7VB 4LIQE 1X9QA 5HYIA 4H26B 4HS6A 3TIDA 2MQCA 5FCSH 1LNUB 1QSED 2NLJB 3C8KB 3BP6A 4OZFG 3JTTA 1KENH 1EK3A 3BIAX 2ZPKH 5F70A 1RFDL 1LDPH 1IBGL 5C0AB 5CIPA 5BJTA 4Z7QE 4PS4H 1T22B 5GGUB 2Y36L 4JCLA 3GI9H 1UZ8A 3HNSL 4ZNEA 2E6JA 3LKQA 1HSBA 5CGYC 5MHSD 1L0XA 1Q1JL 4ZAKC 3MACL 3T09A 5E9DD 4FXKA 5ALBH 5KAQG 4FP8L 1JIBA 5D72H 1ACYH 2NW3A 2R1YB 1CFSB 5DMJB 3WIFA 2XZAH 1EZVX 1MVUB 1JN6B 4I18A 5FB8B 3QQ4B 4GBXA 5HI5C 4OKDA 1NGPH 5KSUB 4FTVA 3FB5B 4OI9A 3MODL 3IKCA 5D7SH 1OLZA 3CDCA 4CAGA 4LLQA 2IGFL 3WSQL 5BXFB 4XVUC 4M6OH 4AMKH 2AABH 1V7NH 1UWEH 5D1ZB 3QCTL 3DV4A 3FQWA 4NKDA 3UJTH 2KUTA 3FQUA 4JFOB 4IRSC 3SDXA 1EXUB 1NGQL 1EEZB 5DA0B 1ZLWK 1NBZA 4K7PY 4XNYL 3SBWA 4DCQB 4P2QE 1OT1A 1YNTA 5KVFL 5J7CC 1I3RB 1XGUA 2DQHH 3UTQA 2F53E 3D0LB 3K81A 3KNBB 3RIFK 1OTUC 4JJHA 1PEZA 1JBJA 4MLIA 2EYRA 2W0FA 1RURH 2QEJA 5SWZE 5HY9B 3CDYA 2AABL 1NCWL 1I7RB 4F9PA 3TPUB 2IGFH 1IAKA 4L4VD 4GS7C 2CKBB 1XFPA 2E9IA 5DC0A 1CTNA 3QIBD 3G6AB 5IFAH 1RZGA 2WK2A 3GMRA 1FFRA 4XCYB 3WHXB 1QYGL 1OGAD 5E0QA 1IKNA 1HHHB 5EPMA 2Z93A 1LP9B 3QDME 4X4XA 4OF0A 4YHLL 2ADJA 3BP6B 4J4PD 2HKHH 4OLEA 3EO9L 3UJIL 4NQVB 3F7YB 5DURB 3V4PH 2BNQB 4NKQB 5A43C 4OQTA 3VFRB 3ARDB 4HFWA 1JTPA 1ZANH 1YEJL 2W9DL 4PRHE 4M6NL 3GI9L 1GZQA 1FO0L 2Z9TA 1VFMA 3SPVA 1AR2A 2X89D 2ZUTA 1VENA 1X5FA 4M02A 1QRND 2WZPD 4GQ9H 5JHLL 2P7TA 1ZGLP 2BMKB 2D9QB 5JTWA 2YK1H 2M1KA 5J1AB 1C12B 4YDKL 1G0YR 4K94C 3W9EA 2CIKB 4R3SA 1IGYA 5CGMA 3UTTD 1G7LA 3GMOA 4EI6A 4JRXB 2I9TA 2Z35A 3V7AG 1S7XA 4OKVB 1OTUD 2WW8A 1Q9LB 2EC8A 1Q9KB 3Q3GB 3RVXD 4ZFOL 1X6LA 1KT2A 4KRPD 2XXCB 3QNZB 4NQSA 4OCWH 1OAKH 1ZGLA 3KYMB 1KGCE 5IT2H 1GHFL 5ANMA 2BX5A 1FVEB 3SDXB 4HX1B 5HHPB 4CU6A 3BE1H 3RPIB 4WFHD 1S5IL 4CW1B 1DLFL 1R3KA 2EE6A 4E41B 1GAFL 3MJ8B 2XYCA 1QO3A 3O4LD 3HI1A 4LSTL 5HJ3B 2H32H 4YBQC 4MX7A 3MV01 3T0WA 3RY4A 5ETUA 4Y0GA 5IGXH 1YEFH 5FDWB 1TQCC 4ZODA 1CDIA 1SHMA 4NNXB 3VE0A 1SJEA 4LDEB 3FQTA 1R3LB 1BMGA 5DRXB 5AZ2H 4NQCA 1CFNA 3G6AA 3UTSA 4PJ7E 1EAJA 1JWSB 2FJFB 3O3EB 3WHXA 3HG1A 4GLRH 5I30H 3P9MB 4ZFOA 1HIMH 1K9TA 3I6KB 4LPUA 3TV3L 1TIUA 1WWCA 2J5LC 4BZYA 1OLLA 3LD8C 2YD1A 2PW2B 2WIMA 1FYTA 5EU5B 5F6IB 2YPKB 1B6UA 3PL6D 5GRUL 2XN9E 4HK0B 1LVEA 2NY0B 4I3SL 4R26H 4HS8H 5EBWA 3CVIH 4HIIB 3TA3C 3ARQA 1J9CT 1GPOH 3QULB 3C08L 1MRDH 4MHHG 3MROA 4M5YL 1AE6L 2OL3L 4NRXA 2VLKA 5H37G 1IAIL 3WIHH 1NFDE 1NDMA 1U8OB 1KJ2H 3NZ8B 4U0RC 3UYRL 5F93C 5ICZA 1FFNB 5B39B 4ODUA 3E6FB 4RMQA 5I8KL 4YHNA 2G9HB 4NZTL 4S0SD 4YXKH 1BBJB 3JVGA 2Y6SC 1YDPB 4WDIA 4EUPA 5M94B 2ICWJ 4P5MB 5I8CB 4HPYH 1A47A 1M7XA 3H0TB 3WJLA 5C09B 4XPHH 3EKCA 3SDYH 4OQTH 5JIKA 5EORH 4XP6H 1CIUA 4FZEH 2B7DT 1JZ6A 1ADQL 4FQXD 3I85A 1VGEL 4U2YA 5C3LD 4MD0B 1N6VA 4FFVC 3SGEI 4XAKE 5IWLC 1UYWL 2RJMA 4R7DA 3MV8D 1YMMA 3EYVB 5E8PA 1I85A 3ZTJH 1D5MA 1V3MA 1SYVA 5C07A 5A3ID 4S1QH 4L8BA 1X5IA 4ODWA 4JRYB 3TT1H 3P0YH 4XXCC 5FUZH 2CKBA 2C4XA 3VXUE 3T77A 1BF2A 4NWUL 1ITBB 3D2UA 4OLWL 5CUSH 4WUUA 3I6GB 4FQJL 3RP1A 1NUNB 2R2BA 3I3BA 4OZIE 5J12C 2YBRB 2DQCL 4PJDF 2XTJE 2BSSA 4BFEA 4M1GH 1KCVH 1I1AA 3DIFA 4PJ8B 1MCCA 3MNWB 3UZVB 1HCFX 4NJ9L 4NQVA 4XBGB 4UQ3A 3MV9D 3G6DL 5JZ7D 43CAA 1ONQB 5DUML 4GMTH 4QGYA 1JNNL 3BESR 5IW1A 4A2LA 1Q38A 2G5BB 4LNVA 3RTQC 3VD4A 1BIIB 3MRBB 4FFWD 1MCWM 3GRWA 4WCYH 5KSUA 4G6JH 1T7YA 4EBQL 4KI5D 25C8H 2ZSVA 5I1EH 4I18B 3VU2A 1TZIA 1RMFL 4OCMC 5J1AA 3K80A 1Y18B 3TWCH 2YWZA 3NIFF 5F7DA 4F33B 3D1MC 4JAMB 2BOBB 1E6JL 3VI3E 1KELH 1QBLL 3RKPA 1A14H 1QTYT 2MWCA 4QYOB 4M1DL 1IM3A 1INDH 4U6VH 4UT9H 3IVKB 2NTFA 4KV5E 4JGMA 4NO0D 3T1FA 4ELKA 2MPAH 5T5NG 3G6JE 4WI6A 1D9KC 3VFNA 1I3GH 3QCUL 3NA4A 3FQUB 4JFOA 3AY4C 3DURA 3KPQA 1U3HB 3GGWA 2VZ1A 2HJKA 4NGHL 4WUUE 3ZE0E 4L9LC 1R0AL 4GAFB 1KIPB 5ADPH 1TLKA 2DYPA 2X4RA 3DX7A 5ICXB 3FB8B 2F53B 4R8WL 2ZCHH 2XT1B 4BQ8A 3MRDA 4CRPA 1CD1A 3NN8B 2AV7A 1OQOA 4Y88A 5DR5H 4MAYA 3RWGA 5T3XL 5DJ8B 3VH8G 3INUH 3R8BB 1KEMH 4E41E 5DHYB 3PHOB 3I2CL 1MJ8L 4ESKA 4XCYA 5DVLA 5LWYH 4KQ3L 4KU1A 3T77B 3UO1L 2IPTL 2NY1B 1A5FL 4IS6B 4JFDE 3O9WD 4LF3B 5D7JB 5E2TH 4YXHL 3A6CH 3MXVL 2V2WA 4LQFL 4P4RA 5T3ZH 2YPVL 4LLDB 1N8ZA 1YUHB 3HE7A 3HHRB 1S78D 4APQB 1J0IA 1MIMH 1I7UA 4QO1A 2MHAB 2O61A 1FNFA 2YPKA 3O8XC 2WQRA 1BFOB 1PDKA 1XF1A 4JVPA 4M7KH 1TVBB 2J1KA 5I1DA 5MI0C 3RIAK 3SKUD 4PUBH 3BGMB 2W59A 4ONOA 4MA3B 2VC2H 5J4MA 2WINB 4P23A 2ZCLL 4OLUL 5TDOA 1IL1A 3ULSA 4X99B 2J8UA 3CFEB 4LCCC 3EOTH 1QRKA 2D7PA 1DDHB 3B3IB 4ZSOA 1NGYA 5CEZD 4K55A 4ZUSB 5I0DA 2UVFA 3EOBA 3IKCB 1YEHL 4Z7WB 1MREL 4CN1A 3O41B 2HT3D 1I1YA 4HIEB 1NJ9B 4XP9L 3VI4F 5EOTB 4GKSB 4AENB 2BVOB 5JORB 4RGMC 2RBLA 2CDFB 4JQIL 2XN9A 3IDGB 3GI8H 3B5TA 3NIGE 4JPVL 3BVNB 2ITDA 2CO6B 1N3NB 1W72A 3IF1A 1DZBA 2J88H 1YQVL 2HLFD 4OGAC 3MV9A 5IV2B 4TVPE 2A1WL 1WFUA 1BD2E 1MIML 1XGUB 5DURD 3VGGA 3TZVB 1XZ0A 5HHPA 4UAOB 1Z9OA 1A6AA 4PFEA 5ITBH 1R3JA 4ZS6D 3VXUD 4F7TA 2B1HH 5J3HC 3S36L 3MLUL 5D5ME 3L6FA 4KAQL 2ZOLA 1RUMH 4QOKE 3RUGF 1Y0LA 4AG4L 4YAQA 3SDXF 3TIDB 3FL7A 3MRPB 1SM3L 2CKBL 4I9WD 3EOYG 2ATPB 5DR5L 5E6YA 1GGCL 3B8YA 4U6XB 4Z0BH 4D8PA 3UTSB 2DICA 3DHJA 5LQBL 3OPZH 1YPZB 3I6GA 5ANME 3VD3A 4Y8AA 2LABA 4ZO8A 1KCUH 2P24A 3QUMA 1NANH 1W0WB 4I0KA 1JHLL 3K8MA 1S8DA 1CDHA 3MJ9H 5D70L 5HYSG 4D9RE 4Z7OE 4APQD 3P3YA 4HZAA 4DOHE 5DVMA 1OB1B 2DD8L 2NMSA 1JZ8A 4UOJA 1ZMYA 1R5VB 2R0LL 3QULA 4U1NB 4KY1H 3L9RB 5D8JL 3RVWC 2YA0A 4KKLD 1QA9B 2EYSA 1D9KD 3TBTA 4B5EA 4P3CL 1CD9B 3DMMD 1ORSB 2MTPA 3QFJD 4LSPH 5FM4A 4WO4C 4Y1AB 1DEEB 1IGYB 3QWOA 3ZYJA 1CL7H 4HJGB 3MO1A 1AGFB 2CXGA 2EZ0C 2AV1B 5IOPA 2X4UA 3C09C 4MAUL 1B3JA 5ESAA 5K9QG 4PJCE 5F7DB 4F33A 2OL3A 4HKBB 1DBJL 2YPLA 4JO3L 1AXIB 4G6MH 4JRYE 4NQXA 4OZHA 2XKNB 4GKNA 1BZ9A 1LEKB 1H3PL 1PG7H 1XF4A 4DW2H 3HUJF 5IVZB 3QIWA 2HJKB 3QDJD 4RAUA 3TO2A 3FT2A 4M1GL 5D7KD 5CIPH 3RNQB 4L5FL 4G8EB 4BSWA 3ZE2F 1BP3B 1PQZB 2OTUB 3TC9A 4LHUB 5DWUL 1R3JB 3PUCA 1G9NC 3BO8A 1FGNH 2AI0L 3HG1D 3IAPA 5A2KH 1UFUA 2Q76B 4FQIL 5KSBF 1PY4A 3IDYC 3TT1L 1DLHA 4PRIE 3JXAA 4QCIA 3MZTA 2BVQA 3I6KA 1DN0B 5EG6C 1RK0B 1PY9A 1YMHB 5E1HB 5IB5A 5IQ7H 4IS6A 1MFEH 1JPST 4XBPA 1T1XA 2XWBA 2XPGA 5IVXA 5DHVB 4O2FA 1MLBB 2XNAB 3FAWA 4HIIA 3VG0L 5KG9A 1J7VR 1N0LA 1UKSA 4HWUA 1CFBA 1NGXA 4PPTA 4M43H 2JK5B 2ZZUT 1F4WL 4IRJA 5IMMB 5TQ0H 4U1IA 5FUOL 4U1NA 4CNIB 1JPSH 1MF2L 1Z5LB 4YR6B 2B1HL 3S36H 4XMPH 2LU4A 4MXQC 1L0QA 4QGTA 3DNKA 4BM7A 3VFTA 4K3GA 2HWZL 4PV8A 2GTWA 4OKVA 1XF2A 4IRSA 5GQBA 3ALXA 4N5EC 3T1FB 3V5DA 1YQVH 4WJ5B 2J88L 3TGXA 5EU7C 1FO0A 1CXIA 2NXYC 3ARGB 3B9DA 1ZAGA 4ENED 3TM6A 1I7ZB 3WMSA 3G5VA 4AQOA 1EAPA 1P4BL 3U4AA 4OLVH 1FH5L 5FF6A 3QHTC 3H42H 5IQ9A 4XP9H 1HEZA 5C6TL 2VISA 1XF3A 5C0BE 4I5BA 4MJ6A 5GJTH 5F9WB 5DK2B 4DEPB 2DM3A 4IMKC 3VWKA 2AJVH 3U36A 5ICXA 2ZUSA 1NUDA 2CLVB 1FL5A 4P2OB 1OGAA 3TNNA 2YN5A 1BZ7B 2D7MA 1A7NL 5ACMA 4PJGE 4YH6A 3UBXA 2VXQH 4PJEE 5CINH 1GRWA 2D3VA 3LSOB 1LEGA 1CWVA 1A1OA 1H3UA 5KOMC 4O00A 4QRPD 2OR9H 4TTDD 4OD1H 3NOIA 5BS0D 1RU9L 3B9KC 4PJBF 4WHTB 1K2DB 5TH2B 4NUJA 2BP3A 2AVGA 2I60H 2UVEA 3GSUA 2NQCA 4MS8C 1P9MC 4R0LA 1FNLA 5GSRB 2M26A 3BW9B 3V79C 4UBDC 2X05A 3O2DL 1Y6NR 1FZKB 4G5ZL 4ELMA 5CBAA 2GW5A 2B0SH 1NFDA 4UT7L 4FMKA 4KTYA 4PGDB 3ORJA 3DLQR 4XPTL 5HTSA 5IEKA 4WI8A 1W0YT 4LFHD 4TNVF 3TO4B 2WIIB 4JFDB 4WFEE 1PG7X 3O45B 4F7EA 1GOGA 4UMGA 2V2XB 3D18A 2IQ9L 4JPIB 1UT9A 4R90L 3S8WA 3BT2L 2AV1A 4AJ0A 4GT7A 5HHOE 4L8DB 4M48H 3KR3L 2V9QA 2BNQE 3GMMB 4NN5B 3MYJA 4XC3H 5D7KE 5C0CD 2WM0A 2W65A 1LE9A 1NBZB 8FABB 2VLJB 3DETD 3UTSE 3HNVH 3DX8A 5IR1A 2PKDA 3WLWC 3V7MA 3G5XA 1G7JA 4RAUB 3RTQA 2ZOLB 4AK1A 5DI8A 3VCLB 1QSEA 3QDGE 3T3ME 1RIUL 5KSAD 3U0TB 3JWOH 4GFTB 4PLKD 2JCCA 2VNCA 4WUKH 5JOFB 2R2BB 4J2XA 2AQ3A 2PO6C 3N1PC 3BXNB 4C56E 4J3UA 2D7TL 3A67H 3L5JA 1NGZB 2Q7NA 4MDJB 3QHFL 1TQBC 4EIZC 2FO4A 1IEAB 3DXAE 1DVFC 1LK2B 4MXQD 5BV7C 6CGTA 5FYKD 3LZFH 2PR4L 1F3DJ 1XGPB 3ARXA 1UM4H 1BAFH 2DOCA 2DRUA 3CUPA 1JNHB 3ARFB 4GW4B 2KQMA 4FFZH 1JYNA 4M9OA 5GS3A 1JGEB 3HA0A 5DMGD 3VFWB 3HKFA 4YHIB 3V5KA 3P77B 3SDAB 1UWEL 1T4KA 2X4QB 1ZV5A 5GSVB 1KTRL 2H3NB 3C9NB 4NDMA 4ENEC 5C0AD 1CDGA 2BNRD 4IMLA 3TN0A 1FV1B 4NQEA 2B5IC 2VR4A 4XCCL 3BWUC 5DT1H 5I19H 4WHYH 2C7UB 4MMZC 5IROC 1M6OB 4Z8FH 3OGCB 3EFDH 3OAYH 4JZOA 3QXDA 4LCWA 2XQBL 1VEOA 4XWOD 1HOCB 1ADQH 3U0PB 1G1YA 3RKDD 1U8JA 3RWHA 2VLRE 1UXWB 1WLHA 4FP8H 4D94A 2VXSL 2HT4C 3LV3B 5FO9B 3NZHL 3QDMA 1F11B 3T0EC 4LQ1A 1P7KA 4C4KT 3MBED 4U2ZA 1A6AB 1FVCA 1YNLH 2FJGB 4OZFH 5DJXA 4OCYL 1TTGA 4Z18A 3WD5H 1EERB 2F74B 1KTKE 3MLXH 1T1ZB 4JFHE 3PGFH 1ZT1A 5DJYB 5DRWB 3E8UH 2VH5L 3EDFA 2IBZX 5DUBA 4G8EA 4BSWB 3SKNA 5DLMH 1FL3A 2DI8A 1OGTA 4HXAH 5SWZA 5T33H 5HYFA 3QI9A 5C09E 3H3BC 3FRPA 3WXVH 5JZ7C 1I75A 5HHOA 5I1AB 5FXCH 4O58L 3QH3A 4HKXA 1MRDL 1JYVA 4NC1C 1QZ1A 5DMGC 1T7XA 2DKSA 1PVHA 4P2QA 2VWEC 3V6OE 4GRLC 1FN4A 2JJVA 3MLTB 3FTGB 5ILTL 1WISA 1WF5A 4X8JA 4G42A 1AQDA 5LCVH 3U7YH 5E2VL 5EU3B 3VGEA 5I1DB 2P4AB 1VADB 1UM4L 1CR9L 1CFSA 3OKEB 3OKYA 3LQMA 3VXMD 4J8RA 4YO0B 2ADGB 4ZNCD 3K4ZA 5DD6A 3SGKA 1FG2B 4F2MA 1MCLA 1JPGA 3V0AC 4HGKC 5EUKA 5JOPD 4IMLB 1R5IB 4GRWF 3WDHA 1JGUH 3K4DA 1GAFH 3WXWL 3T0AA 4Y1AD 1OY3B 2XN9B 4FZ8H 3QA3A 1N5AB 1XEDA 1HHIA 3O3UN 3C5ZB 1VA9A 4EUPB 5KS9E 2Y1VA 3SKOB 2ARJB 2Z91A 3VFSB 2GJZB 5H37H 1VKXA 2NXZC 1S7UB 1UB6B 4Y89A 1AGBB 1ZLSH 2Q3ZA 4GKNB 5I17A 3S35H 4I4WA 1T0MA 5C7XH 3WFCL 2CLZA 4FQLH 3Q0HA 4WO4A 4U7SA 5HDQL 3PP3K 4RGNE 4TVPL 3L7FA 4GRLD 1DQMH 4KY1L 2XZQL 4ACPA 3LQZB 1D5ZB 3JBG7 3FO9A 2YK1L 4KKCD 3MFGB 2AQ1A 1ZT1B 3KVQA 3U36B 5ERWA 3MJ9L 1NEUA 5JDSA 3V7AE 4K7PX 5I1KH 5DVNA 4S1DC 4KVNH 3EYSL 4OLXH 4K2UL 3DMMB 1KULA 5I1JL 1MCEA 2DTSA 4HWEH 1RZKC 5LQBH 4K71C 3J8F7 4JM4L 1QRNB 3MMEA 1LO2H 5C0AA 1KNOB 5SWQB 1YEEH 2EDLA 3VFPB 3RWEA 3UBXG 1LK2A 3U30B 2DF3A 1EGJH 2DQJH 3D25B 3FB6B 3CFJA 1G7HA 4DN3L 4O02L 2N56A 3TF7C 1WAAF 3KLSA 2QQKH 3SPVB 3ETBF 5IJKA 2EECA 2DIJA 1OSZA 4PJBA 2AP2A 5DJCA 5IFAL 4DK3A 1WVZA 1MH5B 4XZUA 3BUYB 3D3VB 5DD0H 1IC5L 3BQUB 4PJ5E 3OMZA 1U8QA 4KK9D 1J18A 15C8H 4DUWA 2OMBA 2VXQL 3SBWC 2Y06H 1H8NA 4UOW0 2QTEA 4XGZA 3V6OA 5J6HA 4Y16A 4AL8L 3CNKA 3LKNA 1U6AL 4HKJB 4UV7H 2RQ8A 4PRNA 4ZUVB 5E94B 2V5TA 1MREH 3MLRL 1W72H 3DARA 3EGSA 5C09A 3PJSB 4Q0XH 2A6KB 2MKLC 5E6ZA 1QR1B 2Y5EA 3MLYH 3LIZH 3FO0L 1WAAE 3SQBA 1D5XB 1EFXB 4OLVL 3ARGD 2YD7A 2Z4QB 1WZKA 3VA6A 3P0VL 1E4KC 4NFDA 3VWJA 5BVPH 4P9HC 5D96C 3OAZK 1KCSH 3FN3A 4LHJB 1DE4A 2HYMA 3S5LA 1ZT7A 1H5BC 1NH6A 5FDWA 1QSEB 1Z6JT 1N0XH 4JHAH 1VCAA 1ZLVH 2Z8VC 3FFCB 3MACH 2NY3D 3HE7C 3P9MA 4JPWL 1X5AA 3I6LD 1S9WB 4PTUA 4XP1H 3QWRA 5K9KB 3F7YA 3RX7A 5KVDH 3D6GA 1FZOB 1T21A 5J3HD 3U2SA 2MJWA 4X7TA 4F58H 1HK6A 4NQEE 5FAAA 2H26B 4L4TA 4W4OC 3HE7B 1DUZA 3CFJB 3CX2A 5AZEL 2WUCL 2NW3B 5F6HJ 4C57C 2VRAA 2VN7A 1F3JB 3WFHA 1GVIA 3TCLA 3PGCB 1BQLL 4XNXL 4FXGA 1UC6A 5DJ0A 1DSFL 5E56A 5JQ6H 1YNKH 4M6MH 1OQXA 2ZUXA 2FIRT 2HFFB 1HI6A 1NBYB 2IPKB 1KPVB 2X4SB 4HUXB 3BPNB 1U8QB 3QSKB 1J87A 3P4OA 5FYJE 1INDL 5HYEA 3ARTA 1BFVH 2RFXB 2YOCA 3N06B 4K3EH 3WFDH 1A14L 1QBLH 4JRWA 4MA7H 3QFJB 1FCGA 2IFFH 3E0GA 3MRKB 5M95B 3CC5A 1T7VA 4JY4B 1A64A 12E8H 4ELKB 2FEDC 5SWSE 3UTZA 3LKRB 1XCTA 2HT2D 5HJ3A 2EDOA 1FE8H 2E7HA 1GGYA 3BKML 3N1FC 2GJ6A 4P4KB 1K4CB 3HMWL 3W0WD 5F71A 4OZGE 5EU6D 1N6QH 2VZOA 1FL5B 4NQUA 4P2OA 5F96L 1A7OH 3NIGF 3VXRE 4J12A 4Y5YC 4MQ7A 4RA3A 1GJIA 4KXZI 4D9LL 4QT5B 1DQQB 1ORQA 3BPOC 1HQRA 4P5KA 4PJIB 1JUFA 2AEPH 1J8HB 2X4NA 4F7CA 4FQPA 2F54D 2P8LA 4U6HB 2BSTA 3GSOB 3TBWB 2YA1A 4HS3A 2C3VA 1DL7L 4FQJH 5JW4Q 4N0UE 2XY1A 4LF3A 4KK6C 4TUJB 4IRJD 1UA6H 3V6ZA 3EJYC 1F6FB 5EC1B 4FRWA 5DQJA 1HHJA 4PV9A 3IJSA 1A21A 1B0GB 3DV6B 5JHDA 4I2XA 5GPRA 3D39B 4Z7WF 5CILL 3QYCA 1TZGL 1JNLH 3HZMA 4Z7VA 1FV1A 4NQEB 4RWHA 5J8OA 1WFOA 5L7XH 3QZWA 1UEMA 4YX2H 4Q6IC 3AAZA 3QEQE 1JPGB 4F7EB 4OQ1A 4XPHL 3MQIA 2F15A 4PIRF 1F2XK 3TYFA 5IBTL 4AEIH 3CVHL 3BEWB 3RFZC 4ZS7H 2DM7A 1YEDB 2BNRB 4M7LT 1QFWH 3OSKA 5GGTH 3CFKA 4XNZB 5SX5K 4RMRA 1QLEH 3BGFC 3QDJA 3U7WL 4HJJL 1CBVH 1CGSL 2ITDB 3MV11 1MVFA 3IFNH 2GK2A 3E3QC 4OF5A 5FYKU 3HS0A 3HLAA 4UUJA 5TF0A 4Q6IB 4O2CA 4ODTL 1AE6H 5C0BA 2YKLL 2F5AL 2YPLD 2GSIB 3WO4C 4B7LA 3L7FB 1V3JA 1QUNA 1CD0A 1SJEB 1YC8A 3C5SB 3NGBC 1Y6MR 3WKMH 4F37F 1PQZA 4Z5RB 4KRPC 4I3SH 1FIEA 3AB0C 1WIUA 4WU7B 3MRFA 1MI5D 5CJBA 1BBDL 1IM9A 5H2BB 5I75B 1JF5A 3HCVA 4QRRA 2E7BA 3MRPA 1M7IB 2JELL 3GSVA 4D9LH 2UY7A 4W6YB 1SMOA 1QEWB 4PRBB 1NC2D 4QRSA 2VN4A 3DMMA 2DBLL 1N6QL 4FFWC 5EZLA 4YFEA 5B38G 5DMYA 3LRHA 4L4JA 5E00A 1VGKB 3ZDXE 2MHAA 1YN6A 1FE8L 3X12A 1FNAA 3QIUD 3AVEA 1DBKH 1S7RB 3RWEB 2AEQL 4TSCL 4UV4L 2DM2A 4APQA 2IANA 4QXGL 3VW3H 1NDMB 4LPVA 2ZOKA 4JB9H 4YXHH 4WGWB 4YHZL 1J5OH 5FYJD 3WIFB 5IW3A 1UJTA 4ODTH 4DQOH 3OJ2C 2IPTH 3WIIH 2Y72A 3UO1H 4QHKJ 3MUGB 3ET9F 3TBTB 1MHPH 4G8GD 3O4LE 3L5XH 1UJ3A 4OT1L 5IB4A 1B90A 1NPUA 3INUL 4JN2B 3X3FH 4C59B 5GIRB 5KW9L 1EFQA 4QHNB 3O6LH 4PB0L 1AO7E 2DL9A 2AXGA 1MAMH 4LLQB 5BXFA 3VXUA 4NO2B 5E8EB 3FOLB 2CRYA 5BZWA 2FHCA 2MNUA 3IU3A 3DURB 3KPQB 5D9SB 3H9ZA 4LAQH 4V2BA 2A6IA 4MJIB 3PQYB 4NGHH 5HGDB 3RAJH 4JM2B 2YA2A 4JFPB 1U93A 1T03H 1KFAL 2CLRB 5EU4A 3BPNC 1JFQL 4DJMA 5IQ9B 3HS0B 2B2XH 5EO9B 1EHNA 4UUJB 5KVDL 5DDHA 1WBZA 5DMIL 1JNLL 5DYOB 1TZGH 4O2CB 3GMLA 3ZE2E 2NZIA 5CILH 4KKBC 1S7TB 3NIDE 4JRYA 1MIEL 2HG5B 2W0KA 2A6JB 2A9ML 2DJ4A 5HHOB 3RA7L 3P4MB 4GXUN 3SEPA 1AHWC 3X14A 3TNNB 5F8QC 1E0OB 1MJ7L 3VJ6B 3CXHJ 1RMFH 1B4RA 4AY0A 2HN7B 4NO3B 2Q6WA 2BSTB 2ICES 4PRBA 5GGSA 3VFGL 3LS4L 3W39B 4MZ3A 4LCYA 4JG0H 1S9WA 4B7IA 4Y5XA 4I77L 3QRGH 2GT9A 1JNNH 1ONQA 3AS0A 1I7TA 3MLYL 5EZIH 2YZ1A 1GH7A 1UCBH 2GFBB 5E9DB 5TDPB 1YA5A 2BSRA 3QPQC 2JELH 4TQEH 4WU5B 4GOSA 2GTZA 3D85B 3I75A 5DK0B 3IJSB 1TTFA 2DQHL 1RZ8B 2R23A 3F58H 5GRVK 5L8JB 4LRNH 1A7OL 5K59F 3CFEA 4I2XB 3F12A 4GUPA 4XNQB 2RHEA 3WKML 2HJFA 4BH7A 2H32A 3O9WA 1DDHA 3B3IA 4ZSOB 3FONA 1TZIB 3BKMH 1N59B 1T80A 4LKXA 3BYYA 5F9OH 2D7NA 2MFNA 2O5YL 1A3RL 2Z8WC 4M6OL 4S1QL 1IFHL 3O45A 5GIRA 2VABB 5C0RH 3RDTB 4G6AC 3U7WH 2FBJH 3K0WA 2IALA 4HSQA 3PWLA 3VD5A 3HZVB 4PJ7B 3MV9B 3KPRE 5I8OL 1S9VA 1UYWH 4XP5L 3PWUB 2R8SH 4QOKA 4LNRB 4RQQA 5D5MA 4ZUUB 2DQJL 1G9NH 3CMGA 2OSLA 1LEKA 5E6IC 4GBXC 4FZEL 2CLRA 2YRLA 3O6FC 4X7DC 1OP9A 3RL2B 1K4CA 3DSFL 3EO0A 1BD2A 1TETL 3P11L 3PF2A 4LVHC 3HNSH 4K2UH 2BCKA 1TPXB 2BY3A 2LTQC 4HH9A 3ARBC 3QG6A 4K7FA 4KHTL 4D3CL 5L9DL 3RBGA 5HDOA 3LSOA 1M7IA 3LS5L 4NOBA 4PG9A 4OTXL 5L0QB 1T2XA 1KB5B 4UDUB 2Q6WB 1NCAL 3WIHL 4KROD 2Z93B 4K23L 3S98A 3GMQA 2R0ZL 3MUZ1 2NW2B 1KUMA 3O4LB 2G5RA 4M1CC 3W11C 2P45B 1DL7H 2FEEL 2AXFB 5IVNA 3BDYH 2NX5D 2IEPA 2J3SA 2CXKA 4N0FB 5HXMA 1F97A 4TUOA 2UWEE 4R2GC 4G8GE 5E2UL 5EIIB 4P2OC 5GSRA 3TV3H 1A6UH 2W60B 3MRCB 3OKDB 4GW5A 2MMXA 3H8NA 4GKZA 1JCKA 3MCLH 4U1GB 3WO4B 1ZA3B 4H1LH 4WUUD 1AO7D 4U1LA 5E4EB 5FV1L 3KPLA 2C1OB 5DJDA 3VGBA 1LE5B 1SBBA 2P8MA 4XGZB 3LN5B 4XCEA 3E6FA 1MSPA 5HYQB 1F6AA 4OM1H 1M6OA 3PIQA 3L3KA 1WBYA 5EBLB 3TYFB 5I15H 1W72L 3BGFB 3FQWB 4HD9A 3AFLA 4XBEH 3RJQB 1CXLA 3O6KL 4YHPB 1FNEB 4E41D 2A73B 1BZ9B 2NY0D 2ZSWB 4KJPC 1Z0MA 3OXRA 4LKCB 4KHXL 3KYMA 4OBRA 2C1PA 1MCSA 4X6DA 4YBLB 1FVEA 4LCUA 1K4DA 4FQXA 5BCAA 1NAKL 5LGHL 3PP4L 4LEOB 2VQ1A 3ZKND 1D5BA 1P7KB 5IVOA 5KVEL 2P47B 2SEBA 3FO1A 1CGVA 1T89A 1MCWW 2F74A 3QEUB 3NAAL 2W38A 1XT5A 4M93B 3LKOA 1D5MB 1CL7I 2AEIT 5GRJL 1RJLA 3L5WA 4R2GB 2XV6B 4ZO9A 5C2UB 1KYOJ 4YIQA 3HUJB 3WXVL 1CFVH 4UIKH 5GZOD 1K5NB 5EFIB 1DN0A 5AZEH 2X4TB 4PJAB 3ILQC 4OFKA 4UBDD 1HNGA 5JHLH 5JLZA 1HZHH 2GCYA 2VLJD 4LGSB 3T0DA 2C3HA 2V5SA 5EZLB 1LK3L 2ADFH 2DMKA 4X6EB 1MJJB 1OAUL 3ZTJG 1YNLL 3MRJB 4YHKH 4TPRH 4N9OB 4OLXL 3OZ9L 3VFMB 1OAQH 1NANI 1ES0B 1ZANL 3WUWA 3TNMA 4EOWL 1ZVSA 5AUMB 3RGVB 5DJ6B 5I1IH 4G6AD 1BOGB 5L2JB 1U2HA 1N0XL 1G9MC 4IMKA 5GS0H 4DN4L 5EOCJ 2HFFA 2YD6A 5CSBA 3DUSB 2CGRL 2XZQH 3OWEA 2E7CA 4FOMA 5FOBA 3ISWA 5CSGA 4LPCA 5DUPL 4KJYB 4HIXH 1HXYB 4JG1H 4NQCD 3D18B 5EC2A 5E95B 5TQ2L 3DETC 3FT3A 1MCJA 3FB7B 2P46B 3WNLA 3W82A 4U6YB 2VJXA 1QFUL 9CGTA 1RURL 1KIQB 2AQ2A 32C2A 1EXUA 3JVGC 4JO2H 1EAPB 4FFZL 3UZQA 2V6HA 1KIUA 5CEZH 5ECJE 4C83A 5C07E 5SX5H 4Z6AT 3GSWA 4G7VL 3ARPA 1Q0XH 3V4UL 1G9EA 5IF0A 1F11A 1QSFD 4LVEA 5HHQB 4GAYB 3UDWA 15C8L 2V17H 1V7ML 3QCTH 4ZUWB 1S7VA 1RZ7H 2JCCF 5IFHH 3RL2A 3ZDYF 5DTFB 1MQ8A 4Z95H 4Q9RH 1MAJA 5F9JA 4LLVA 1NCCH 5DHXB 3JWDL 3U30C 4MJ2A 3NN8A 5F1IA 3C2SA 5KANG 3RZWA 5IB2A 4DVBA 1E28B 1QSZA 4J3OC 2HA1A 3IDNA 4R2GD 4HHAA 4MDJA 4OZ4A 5DVKA 2OX5A 3MRGB 1EGJL 3ZYIA 1A7QH 3GKWH 4NP4L 1A6VL 4FN0A 1QRNA 3MMEB 3PQYE 4DTGH 2W0LA 1NCBH 2X89A 1UH4A 4HK0A 2GCYB 5I75C 2DLGA 2EDBA 3DVFA 2ESVB 2VZVA 2NW2A 2BVYA 1Q1JH 4UT6H 4X80H 1NFKA 1IC4H 5A40E 5CGTA 3UPRA 4HXAL 2IBBA 5DLML 3FT4B 4FA8A 1CDBA 2H32B 4Y19E 3IU4H 4J4PA 3GMPA 4MGXA 3C60D 1LD9A 2BVPB 2XOTA 1KJ3L 3CMOL 1MRFL 1OF2B 2FX8L 1BJ1H 2GTWB 5HBBA 2ZSVB 4XPTH 2YR3A 5I1LA 2H2SD 1U0QA 2IMMA 3NZHH 1K8DB 1NDGA 5FKPB 2FD6H 5HYJA 2UWEB 3L3JB 3C5ZC 3NTCL 2WLZA 3Q6FB 4HFUH 4I3RH 3FOLA 1FVDB 4KZDL 1NAMA 2ZUWA 1M71A 4NHUB 3V6FB 4PREB 3C5ZA 3PP3H 1UM6H 3MJGX 5C1MB 4P99A 4C83B 5E8OA 5DT1L 3MJ9A 1U3HA 3N1QC 5ACZB 1OW0A 2GSIA 4K8RL 4TSBH 4HC1A 2AJUL 4EUPG 4ZOAA 3SJVE 3L1OL 2D31A 3BHBA 5E2WL 5FHBL 4CKVX 3LQZA 1UWXK 1ACZA 1ZA6A 4FG6C 4IBLT 4MCZB 4EI5B 3RHWF 2ARWA 3LKOB 1CK0H 1G7QB 1HN1A 4RGNB 5MEPB 2EKSB 3GSRB 2NY6D 2X1XR 5IW6A 4FTVD 2W1NA 3ESVF 1R5WB 2W9LA 1WFTA 4NKMB 1RJYB 4ZFZA 3W0WB 1U3YA 4OBSA 1GCFA 4GRLB 2WWKO 3OF6D 3KPMB 2GSGB 4OLZH 3NA9L 2R0KL 5E08H 2KDGA 3MREB 4AM0B 4P2QB 1RD6A 1YN6B 1FORH 3KPOB 2FH6A 5EA0L 4IHOB 5EUOE 5KS9B 2A74A 3LB6C 3ZKQD 3VFRA 3RWIB 1RUPH 5I71C 4N0RA 1JZ4A 3EHBC 2BHZA 4Z7UE 4FQCH 4X6EA 4EXPX 1FZMA 3RWCA 3MROB 3TBSB 1KF9B 1RUQH 5GS2H 1A1MB 4O51B 2E3VA 4F9PC 5JW4N 4XNMA 1FLTX 2I25N 2VIRB 5HDBF 4GAJH 5E6IB 4PRPA 1FG2A 4ONFL 2ENSA 1W2KT 4F80A 3BD3A 4MB4A 3HB3C 3PGCA 1EHLL 2VH5H 1CXEA 4LSQL 3MLXL 3SDCA 4KTDH 3T0EA 3QXAA 2DQUL 4ZG1A 3T0ED 3SDCD 4EI6B 1FDLH 3GDBA 3P73A 3UXFA 1P4IL 1NEZA 2V7NB 3MO1B 4WY7H 1T5WA 1DQJB 1O7VA 1URLA 1EPFA 5KSBB 1A6WH 1VSCA 4M48L 3HMXA 4LSRH