4X9FA

Crystal structure of dscam1 isoform 6.9, n-terminal four ig domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
393
structure length
393
Chain Sequence
GGADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
molecule keywords Down Syndrome Cell Adhesion Molecule isoform 6.9
total genus 87
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9fA04
1U8JA 2NQCA 4L29B 2W60A 5C86A 4KRLB 4ODSL 2R1XB 4NO3A 1X44A 4JM2A 3T4YA 5TE6H 1INEH 3B2UD 3V4PH 3UROR 1HKLH 3C9NA 4ZUWA 1KJ2L 5E8PB 4FQLL 4IMKA 3LB6D 4WW2B 3T0ED 4XB7A 2OL3H 1QHOA 1VFAB 1MNUL 2IH1B 1Z9MA 2Z9TA 3FT4A 4UOW1 5CKGA 2HH0L 2D3VA 1IM9B 4WI5A 1GGYA 1KIRA 3MOQA 1IKNC 5M94B 3HRZA 3CFIC 2AK4A 4XBPA 2Q3AA 1YYLH 3UJTH 2AABH 5I75B 2G75A 1K6QH 1JMXA 2W65B 3QUML 5T5FL 4NC0B 4GT7A 5F7LB 1SMAA 4MXQC 5EIQA 3DWTA 4NO0D 1XH3B 5DFVC 1DBKL 3S34L 4PIRF 1RUAH 2VXUL 2VNCA 3VXRB 4TTDC 4LLMB 5D7LB 3H7BA 5K59F 2VC2H 1DVFD 3E6FA 1BM3L 4E41E 4JQIH 4XP4H 4LU5L 1JWUB 2C9AA 1LO3H 2XZAL 3PL6D 5JIPA 4ZO7A 2EE3A 5A2JH 3FMGL 2BY1A 3HA0A 4FQIH 2XTJC 3K80A 2UWEA 1DQDL 4K23H 1I7RB 1SYSB 3RNKB 1WCBA 3HC4L 1U42A 3RTQD 3VW3H 3SDAD 3RBGA 2VLRD 1Z6JT 3WD5H 4Z7NF 3D1MC 1Z9OA 2DQDL 4OBSA 2Z91A 4PJ8B 3WFDL 3ULSA 3FZUC 3VXQB 3U0WH 1KLGA 3TIDB 2OSLA 4FZ8L 3V6FA 3NPZB 1JGEB 3DX9B 1CFTB 1H15A 4MAYB 3DGGB 2C3WA 2HT4C 1WZLA 3GRWA 3BMWA 3MLUL 3H42H 4WHYG 4XI5D 3F12A 3P4MB 2CH8A 4AENA 4XWGL 4M62H 2V2TA 3WNMA 5IF0A 4O2EA 1WWBX 4Z7VA 3BHBB 3HCVB 3T3PF 4A2MA 2DF3A 2O5ZL 4KKNA 3NBNA 1SMOA 1DN2A 3NIGF 3V6BR 2B1AL 3C8KB 4F58L 1AD0B 3TVMB 4G6FD 3NTCL 5C0BE 5HHXL 4DVBB 4YK4B 3KPRB 1S9VA 1I8IB 5E8OB 4DZBB 5DHYA 1N5AA 3DBXA 1OAXL 4ZXBA 2DQTL 4H8WL 4JZNB 3R4DA 1P2CB 1CT8B 2J8UB 4KQ3H 1FDLH 3C2AH 2UWEF 1W72B 4GW1A 1NUFA 3DX6B 3M45A 1DFBH 1LEIA 2E5EA 5TF1H 3ZT6A 5IP4A 2N7AA 2WUBL 5DRNB 5C1MB 3IDNA 1AXTL 4GKNB 5JPNA 4M48L 2Z92A 2XQYK 4WTZA 5FUOL 5DGRA 2F53E 4ZUSB 4MD5B 4LCYB 1K6QL 4WTXA 3TBVB 1HH9B 4OZGE 2I26N 2H2PD 5H94B 3RWHA 4JRWA 1LDPH 3DPBA 3TIEB 1UA6L 3LS4H 1UQSB 5DK2A 3KS0J 4UILH 3BH8A 3LKRB 1MCKA 2AK1L 3MBEA 4N0FB 4QRRE 1ERNA 2F5AL 4PR5A 4JDTL 5C0AE 1RMFL 2ICWJ 1NQBA 4GQ9L 4NNXB 1P7QA 4PY7A 1LO3L 2XZAH 1G9ML 5ESVA 4X5WB 1PG7L 4C4KO 3C5JA 4QHKI 3QZWG 3BMVA 1HH9A 3AXLA 4BYHA 1EXUA 3IKKA 3RJDA 1QA9A 2FWOA 4UAOC 2AKRA 1FL3A 5F3HB 1UWGL 4XVSH 3QPXL 3K8MA 5IEHB 1M7IA 4FZEL 4LGPB 1K4DA 4RGMB 4UDUB 5CLTA 1HHKA 1CGSH 3CSPA 1IBGL 2X4OA 3WIHL 5TE7H 4TUJB 5GHWH 3U0WL 2OTUA 4L9DA 1KB5A 2DIBA 4EUPG 1E4KA 3IVKB 4X5WA 2BFVH 1JYNA 5DHYB 2K1MA 3BP4A 4Y19B 3EYSH 2ARJA 5JOFA 2FECL 5HHMB 3ULVL 25C8H 2HTLC 4PTUB 3TJEL 5AZEH 4HBCH 1FNSH 1T7XA 1MUJB 1G7MB 3QIWD 1T2XA 1U3YA 2B0SL 4MXVE 4KUZL 4K94C 1NGWA 1HQRA 5C09B 4PFEA 1CLYL 1T1YB 4NKIH 1C5DB 3GRWH 1MJJB 1E4KC 2A9MH 5DUMH 3CCHB 5JW4M 4LSSL 2CSPA 4PJDF 2Q7NA 3FRUB 2R1YA 4JHWH 3OKOA 5GZNC 4Y5XB 1EHLL 3DRQB 2RCSH 1NBZA 3L9RA 3QCUH 1CXFA 5ADOH 1G7JA 4HH8A 2UYLB 5HGBA 5IGXH 1PY9A 3MFGB 4XNZB 5KAQF 5LBSH 5GIRA 1FDLL 3C2AL 1Q9LA 4LVOC 5HY9A 3OKYA 4HS8H 4WI3A 4JG0H 4NQUA 1ETZA 4OCNC 4P9ML 3WNKA 3LKPB 4A6YL 2R9HD 5F6HI 1FFNB 1TJHL 5LJYH 2IPTL 4O9HH 4X98A 2WUCH 3FFCB 2CRZA 3GGWA 2B20A 3SE8H 1JZ2A 3ROOB 4O02H 3MJGX 3HPLB 3FQNB 4AL8L 4FN0A 3FFDA 1EAJA 1G7HB 3ARSA 3LQZA 1RK0B 2A0LC 3SO5A 3ZHKA 4XNQA 5KVDL 4PJCB 1KT2B 4NQSB 1YEFL 1HNFA 4NIKB 4MD4A 1Y18B 5FO9B 3P0VH 1CBVH 5I1GL 3OKNB 3G6AB 4U1GC 4F33B 1G6RL 1XCQB 3R0NA 4WFHE 3WDHA 4HKJA 5IMLA 1RZ7L 2C3XA 2WWMC 3UPRA 5DJ6A 3P9LA 3KPNA 4AM0A 5IQ7L 1N0XH 1IQDA 5HSFA 5IB2A 4IS6A 3MRRA 3N9GL 3ARUA 4G8FA 2FYYA 3U0TB 3D6GA 3MUGA 4UBDD 4E41B 1TPXC 1HHGB 4Q6IC 1ZHLA 4RAUB 4YHIA 4MWFA 4QOKA 4MB3A 4X83A 5FF6A 1FO0A 4LF3A 1H3GA 1I3RB 1NAKL 1F11B 3QWOA 4N8CL 3EYQD 3VG9B 3MFFA 3UBXG 1WUNT 2GAZB 3K3QA 4R0LA 4MX7B 4QRRB 4WDIB 2VXSH 2NY1B 2ED9A 4NT6B 4LLWB 4EI6B 4X7CC 2AJSL 2BRQA 1CQKA 4V2CB 4LDEB 1U41A 4NQTA 5CJOL 4PLKC 3GJEA 5C07E 1U3HC 1M05A 4P2QB 3ZT7A 1W72A 4QXUL 2XIDA 2HFEB 3WE6B 4ALAH 3CU7A 4G6KH 1S9YA 3CD4A 4LSSH 3TBYB 3WFBH 5F3BB 4RNRA 2Y25A 4JKPH 4RMTA 5CMAB 5EIIB 3RGHA 3LEVH 4ZOBA 1C5BH 1F4YH 2KQNA 4JG1L 4ODUB 3GMQB 1FNLA 5JHDB 5F7HA 1J7VR 1PZUB 4QTIL 1F3JB 4YHYB 3NCFB 1LK2B 1MIEL 4TQEL 2EDNA 3GSRA 4K3EL 4X4YB 1T21A 4ONFH 4PRDB 2AQ3A 3P11H 1RULL 4FFZL 1NDMA 3GBML 3IDIB 3ZYOA 1U6AL 3HLAA 2HTKC 1MAJA 1YQ2A 2UUDH 4O58H 3TBYA 5F3BA 3PUCA 5DJZB 5MP6H 5TE4H 5DTFB 1PSKL 1G9NH 5BCAA 1TQCB 5F7EL 3VXPB 1CDIA 3ZHLA 4HJJL 2P4AB 2V9TA 3L5XH 2FJHB 2NX5A 1KJVA 1WT5C 4KK8D 2X4PB 1T03H 2EEAA 1O5DT 3KYOB 2Q6WB 2YPLA 1LDPL 1E4JA 1GC1H 1Q0XH 3IU3B 1TNNA 1A7QH 1BZ7A 3L3GB 4JGJA 1LO0H 4RX4D 3PV6A 5I74C 1L7TL 4L4JA 1UH3A 1X5LA 3BGFB 3U9UA 2ZJSH 4HKXB 4J8RB 5LGJB 2AJZB 4KPHL 3KPOA 4LAJH 1Q94A 1CN4A 4YDKL 4KRNA 2HAZA 3E2HB 2MHAB 4JANB 4NWUH 3WUWB 2F54D 4PTUA 3FFCE 1GGIL 3WO4C 5IKCB 4ORGA 5T33L 2N4IA 3HG1E 1Q1JH 1GPOH 3QUMB 4XNXL 3TJHC 3TO4B 1PAMA 3BGMB 2EDYA 4KV5E 5ALBH 4H1LA 3CLFH 3DYPA 5D9SA 3B2VH 5T5NF 4FXKB 3C8DA 3MRQB 4WVRA 4D0DA 1ZV5A 3WJJC 1F4XL 5HI5D 4AG4H 2MPAL 1MHEA 1X5HA 5HYQA 5TF0A 5K9KB 1Q9WA 3QHZL 2C5DC 3MBED 4OI9A 5T3XD 4MNQB 3K7UA 4ZXBB 3CZFA 1F02I 3LD8C 4HDIB 2CIIA 4GSDL 4GUPB 1T0PB 1LVEA 1UM6H 12E8H 2YXMA 2FH8A 5EH1A 1QEWA 1XGUB 3T65B 1QO3B 5K9QG 2R23B 5T3XE 4PJHB 3D39D 3MZTA 2DOCA 1T0MB 3RA7H 3MLRH 4KJWC 2O5XH 3DUHA 2EYRB 4U6TA 4IRSD 4PJBB 1AGEB 1DUYA 1S9WA 4YHPA 3PWNA 2VH5H 5EUKA 3MV7D 4PG9A 4YDIH 2JCCE 1A2YA 4OM0H 2VZVA 4UIMB 1RPQA 2YEZA 4K94L 4LLUB 3IU3A 3BE1L 1MCSA 1IGTA 1MJUH 1U8HB 1DQDH 4M03A 4G9DB 5AZ2H 3PABB 3QHFL 2YBRB 4FZEH 4A2LA 1XGQA 4JG0L 2GUOB 2UV3A 4RMSA 5TE7L 4PJDB 3T0BA 4G3YH 5LGJA 4MXWL 5KZCB 5TQ0L 4L9LB 3MXWL 1YEKL 1CF8H 4JCLA 1KJMA 3VFOB 2A73A 3EYSL 1AO7E 3TBWA 5FOBA 5CIPH 2ZCKL 4NPYA 1BWWA 5IB5A 3QB7C 4H88H 1FNSL 1RIVH 2CLZB 5FOJA 5HDQL 3T77B 4U1JB 1NGPL 5ERWB 4LMQI 3O11B 1OSZB 4WEBH 3TBSA 3SE3A 2OZ4L 4M8QB 5IG7B 4JO1L 3SKJH 3QIBC 1N59A 4X7FC 2VDRL 5DMIL 3WV0A 3HAEG 1W72L 2VLRA 2ZSWA 2O5ZH 4U1IB 2D03H 1ZLWH 3MFFB 1X4ZA 4POZD 1KB5B 2QQNL 2GTZA 3O6KH 2E8YA 4MAYA 1EH9A 1MFDH 5J89A 1G7PB 4N5EC 3TP4A 1N0XL 3WFHB 4HIIA 2DKSA 3A67H 1DVFC 4YBQC 2VIRA 3VFNB 2YPLE 1OB1B 5AWNH 1SHMA 2N7BA 5K59E 4PJ5D 4JY5L 1MUJA 2PF6A 3SDAA 1KLFA 4MQTB 4RFOL 2I9LB 3SOBL 3HCVA 4LLYB 4KQ3L 5ESQB 1I8MA 1YEGL 2BVEA 3TN0C 5T3ZE 4KKAD 5E4IA 5ICXB 3FQWA 2XTJD 3VI4E 1MOEA 3GI8H 1HINH 5CJXC 5EOCJ 1Q0YL 2P8PB 1MCHA 2NMSA 2VRAA 2HKHL 2IBZY 1U8HA 4ERSH 3UX9B 5L9DL 1TVHA 3MQIA 1R3HA 2VDQH 2IPUG 2N56A 4JZNA 5LGHH 3U7YH 4EN3B 1LK2A 4Y4HB 3TWCH 5KVEL 5GGUA 4YHZH 1HHJA 2ESVA 1Q72H 1ZHKA 3V79C 5L2KB 4FOMA 3CFCL 3T0EC 1NC2D 5DFWH 3BPOB 4MJ2A 1HHHB 5KANG 2X4QA 4I2XE 3V8CA 3ULVF 4OZIF 3QBTB 1F97A 3VFOA 4H0GA 5KW9H 2R4SL 1T22A 3C5SA 4BZ2H 1DQTA 1GGBH 3HC3L 3V7AE 4D9QD 3SBWC 3ARBA 4U1SA 5F89B 3SGDH 4WUKH 1OSPL 3MRGB 5DMKA 1X6NA 3T0EA 4I13B 5AYQA 2GJ6E 5CINH 5IQ9B 2LU3A 3QNXA 1A7PL 2EYSB 4XNQB 4XVUC 4Y0GA 3RVWD 3VRIB 2D31A 1CE6B 1J0HA 5ACZB 4JM2D 3C60B 1D9KC 1FZOB 1D9KD 3ARBC 5JXAH 4HFUL 2NY7H 4R2GB 5E8NA 3SKMA 3DI2B 2Q3ZA 5KJRH 2G2RA 4PJ7F 1A7RH 4JFPA 2ZCKH 4X9GA 4KC3B 2HJKA 4PJGA 1AQDB 3QUXA 4U1NB 5IFHH 4F7MB 3RNKA 2EKSB 1JCKA 1ZLUK 5C0NC 5D6DC 4HW6A 2FWOB 2DMBA 5ICZA 3WFCH 4R3SB 4XVUD 5FHAH 1FIEA 2GT9A 4JFZH 4YHKH 3LIZL 2VLKD 3MUY1 1CE1L 2ADGB 4JG1H 4LSPL 3ARWA 3UTQA 4PJXA 1BREA 2VXTL 2NW2A 5HYQB 1W0WA 3NCYP 1JYVA 3QUXB 1AQDA 4WDIA 3KPSA 1DQML 4MD0A 1DTUA 5D6DA 4LLAA 1KB9K 3UTSA 5F1IA 5GZOC 3P11L 3RIFF 3X13A 4PJBF 5C70A 1Q9OB 4HX1A 1MHPL 3IXAB 3ZDXE 2ADFL 1GPOL 3H7BB 2W38A 4HS8L 2QHRL 4LEXH 4YXKL 2DL9A 5E4EB 4Q0XL 5I1IH 4M61B 1SEQL 1F4WL 3CLFL 5BMFH 1TJHH 5F7EH 3DURB 1T5XA 1CLZH 3G5VA 4L4VE 2OM5A 1I9RH 1K2DA 1OTTC 1VCAA 2WINA 4P3WA 3U7YL 1MPAH 4J3XA 2W0PA 4OLWH 4PUBL 2X70A 5F7YC 3SO3B 5T3ZL 4LQFL 1JE6A 3KWWA 3L9RB 1NBZB 2VXQL 3KLAA 2X4UB 4W4OA 1LO0L 2XACC 4OQTH 4Z76B 2OR9L 4DUWA 5F70A 5IJVB 2BSED 2OZ4A 4YFEA 1BM3H 3EDEA 2Z92B 3QUKB 2H6PB 1R3LA 3GMRA 1DE4B 3VXRE 1C08A 4JFED 4NM8H 5F7KC 4FQIL 1AGDA 4LLDB 5BW7A 4ONHA 3TF7C 1DR9A 3MYJB 2ESVE 1UQSA 5C9KA 3H6JA 4RGND 2NY4B 2H2SD 2OJZL 2J5LB 5C6TH 5IM7A 4F2MB 2F8VA 3VFSB 3ZYIA 1QLFA 3MLTB 1I8LC 1W8NA 2PYED 1BEYL 1FFOB 4PGDA 1H5BB 3BEWB 5TDPA 4KZEL 5D7JA 3O2VH 5L2KE 2C1PB 4F9LA 5FA4B 1IQDB 1NAKH 3BQUC 3QCTL 2IH3B 4U31A 3RX5A 5IMLB 3NABL 4OCSH 4PJDE 3U82B 1T7ZA 1I1FA 4JN2B 1EO5A 5I9QB 2PYFB 4I0KA 4P5KB 1I8LA 3QEGH 1WWWX 2GKIA 1Y6NR 1MVUB 4CL7A 3S35X 2IMNA 4G8EA 1F2QA 2EKJA 2Y5TA 4F9LC 1LE5A 2FBJH 5F93C 4BFEA 3AS2A 4C56A 4IJ3B 2EXWC 3VDCA 1X5AA 3G5ZA 1NGYB 5EWIL 2PCPB 3U46A 4EIGB 4NUJA 3HN3A 4QHUA 4M7JH 4LLWA 4EI6A 5DJYB 2BY3A 2YD9A 3KJ4B 5ILTL 4KK5C 4P2CG 3IYLW 1RUML 1J05A 3LOWA 2PYFA 4H8WH 1P4LA 3D9AH 3O45B 1QSFA 2ZUYA 5HI5C 2DWDA 1J8HB 4LASH 4G9FB 2ZSVA 4D0BA 5I19L 4R26H 3I6KA 3GJEB 2PTVA 3O6FB 4OIIH 4LSDA 1CFNB 2VITB 4M48H 4KWUA 4P48A 1KYOJ 2HFGL 4APQA 3HZYB 4J3VA 4UQ3A 5HDLA 2HN7B 3TH3T 2NTSP 3MRGA 2D0GA 2YEZB 2UYLA 4ZPVA 4ZDHB 3B3IA 3A6CL 4XTRD 3SCMB 4YPJA 3T3ME 2LAGB 4LCCC 4ZFGH 4GG6E 5DFVD 4ZFZB 5ACZA 4P0DA 1A7QL 4K55A 3CFDA 4NNPH 3LKPA 3EBAA 4BFIA 1X5FA 3W9EA 3CDGB 1A6AB 1BQHB 1R3KA 5FA4A 4APQC 3IDIA 1XF4B 5BV7C 4L4VA 2FATH 3NCBB 4LKCA 1IKNA 2F5BH 2P5EE 2ICEB 3GBLA 3QULB 1H8SA 2RFXA 3PL6C 4KKCD 1ZA6A 1IGIH 1QTYT 3RZCB 3LMJL 1GAFH 2FZ3B 2VLJA 1TXKA 2MQ3A 3FTGB 4ZTOL 3IDMA 5CJQL 4NKMA 1LNUB 2J6EH 5B8CB 3BOVA 1QFWM 2X4PA 2AK4E 1G9NC 3B9VA 5T33H 2W65A 3CCHA 5FYLL 5BVJB 1FNFA 2ITCB 1OAZL 1ZHNA 2D7PA 3MRHB 5T1KD 2ZUVA 3RU8L 3SDXF 1N7ML 4BSJA 3AROA 5JHLL 4PREA 3BFOA 5GRYA 2EDQA 4K8RH 5J13C 2VDQL 4BQCA 3KPSB 2QQKH 4HUUB 3RGVC 1YEEL 2O5YL 3TPUB 1BD2B 4JM4H 4MGXA 2Z8RA 5HHME 2E6QA 3GKZA 3GHEH 2CDFB 5LCVL 4LK4A 4J1UA 1WIPA 5ESQA 1TVBB 3DXAE 3MREB 2AV7B 3B2UC 4NSKA 3L95B 2E7HA 4HIEB 1P84J 3I84A 1U3ZA 4JRXB 1F58H 2H32H 4X7SL 2JE8A 4XAKD 2ADIA 2P8PA 2XZQH 5C0RH 4GUPA 2GIYA 4X6DE 4JRYE 5CEZE 1YPZA 1DQMH 1UKSA 3O81A 1JNHA 1UZ8A 4UIKL 1Q9WB 5IROA 5IIEA 1T7YA 4UNTA 2RBLA 1MQKL 1PKQB 1PFCA 4ENED 3ZKND 4ZFOB 2BJMH 1NCDH 4GXVH 1AD9B 3U79A 2BMKB 5B39B 2I9TA 1IGYA 3VMNA 1K4CB 2NXZC 1SEQH 2NXZD 1FE8L 3QUKA 3QT2A 1R24A 3VRJA 4JDVB 1MWAA 4RA3A 5JORA 2DLIA 1BF8A 4R96A 4OCMC 4G6FB 3B4NA 3STZB 5IMOB 1BZQK 4CMMA 3GUTB 1ZXQA 2ORBL 4YUEH 5D2LE 3LAFA 4OQTA 2NY5L 1NGPH 4RFNB 4UUJB 3B83A 5ITFB 1A7BA 4WEBL 2XV6B 5ITBL 5CWSA 1CGVA 4I3SH 3LH2L 1RJZA 3KXFD 4Z5RA 1JGDB 4BK5A 3MCG1 4NFDA 1A1OA 5E8EB 5C9JA 1J0IA 3IKCA 1AC6A 1WF5A 3U6RA 3O3AB 5DRNA 2YD6A 3MV9D 4HKBA 4WWKC 5JHDD 4PRHE 1P1ZB 5KBNC 3RIAF 3P2TA 2XWBB 1I1FB 3KXFE 4JN2A 3QO0B 5AEAA 4F80A 3ARFC 1GGCL 4U1NA 5CZXC 4X6BB 1JGEA 3A67L 5SWSE 5IW6B 4H5SB 1NUNB 1TJGH 3OTTA 2OCFD 3GSWA 3LPGA 1HKLL 4MMXC 1DUZA 5E7FA 1E6OL 2ICWB 3KHQA 2ICCA 4P2QD 5MENA 5E0QA 3AGVA 1B88A 4XPFL 3OXRA 3SGDI 3WIHH 3PHOA 1AXTH 1Z3GH 3X14B 4ZQKA 1HILA 4F37F 4LOUC 1ZGLM 2X1OA 3M1BA 2NY1D 3B9AA 3ZO0A 1ZANL 5DD1H 3LKQA 4WI6A 4MNHB 2HKHH 5JW4N 3OV6A 1IKFL 1ZTXH 3UXFA 1OAKL 3O4LA 1MCPL 5C0GA 3QUMH 3V0AC 3Q5OA 2VIRB 3VFNA 1MFCH 4GAGH 5FCUL 3EAKA 2UZIH 1C12B 2XFXA 3OG6B 4NQDE 3EDJA 4NN5C 5BO1H 2JK5A 3RVTD 2BHYA 4M1GL 5BS0D 2Z93A 4QNPE 3DROA 3T0XA 3GBNL 1MRDH 3GMMB 3CSYA 5EPMB 2JB5H 4WHYH 4KXZI 5IWLC 4DAGH 4JY6B 1YECH 3QDMD 5HGDB 2N1KA 3X11B 1IARB 4JO2H 5D2LF 4I1NB 5ITFA 1T1WB 3GJFB 4BJLA 3U1SH 1TETH 4AH2B 3QCVL 4O00A 3P4NB 4V1DE 5D2NE 1I9JH 2JK5B 4NM4L 3G5XA 5HHNB 4CMHB 4XBEL 5EU7C 4LSRL 1ZLSL 3S5LA 4XBGA 1IEBA 1S7TB 4N68A 5LXGH 1ZT1B 4JQVA 4LLMA 2DLFL 1OL0A 4OCRL 4N0UA 1AHWA 1UYWH 1JIBA 5ANMA 5DRXA 2FX9L 4IRSA 5C71A 1MY7A 1EO8L 4MHHI 2W07A 5IBTL 1E6JL 2YK1L 3IDYB 1TFHA 1OP5K 5HVWA 5DHVB 3FONB 3DMMB 5IR1B 2OBGA 3ARDD 3DTXB 4XWGH 5TGBA 3U9PH 3MRHA 4DK6A 4FXGB 5FHAL 1YNKH 1A6ZA 2B2XH 3I3DA 4YHKL 2R2BA 2A6JB 2Q86A 1P6FA 1VHPA 1A0QH 1IGIL 4FFVC 4TNVF 4X9FA 4UINH 4I77L 2MQ0A 1QLEL 3HRPA 2XTLA 1A14L 5FDWA 2HJKB 3AS3A 4Y2DB 2GY5A 5HHVH 1M6OA 3VCLA 2ZCLH 4KROD 1YPZF 4LPWA 5EO1A 3OX8B 4XWOD 4C57C 4EVNA 5A2KH 5DD0H 5ETUA 5B4MC 5JR1L 1RZKC 3QUXD 2RHEA 4I3GA 2D4DA 3ES6B 3F6LA 3G5ZB 4Y4FD 3QWRD 2LABA 2BDNL 4X0KA 4N5ED 2FEDC 4LCUB 1CR9L 2ADGA 2FHFA 4R4ND 1YPZB 5FV1L 3CC5B 4JFDA 3EYVB 5E5UB 3PP4H 4Q7DA 4MZ3A 1YN7A 4U1MA 4XPTH 1LEKA 1S9VB 2A9NH 1UA6H 1FVDB 4LBEA 4N9OB 5IB4B 4XNMB 3QFJA 5K9OA 3HR5B 3TT1L 3KPSE 2XY2A 5CBAB 5BO1L 1ZLWK 2P43B 1G6RH 3TEUA 2A73B 5EU6A 4XRCB 2H3NB 5DUPH 2F5AH 3VFVB 4OCLC 1A3LH 3UJJH 3LN9A 4UT6L 1JN6A 1MLCA 4U6YB 1BP3B 3QEUA 4EJ1C 1XT5A 3O6MH 2XZQL 5F7WC 1N64H 4Y4HA 4KRPC 1L7IH 2D7TL 1RZIA 3QXAA 5H35B 1IILE 3JXAA 3IDXH 5F44A 3MRPB 2BC4B 3EOTL 3NGBB 4K3EH 4ZUUA 2E9JA 4K3DH 1CFQB 5F1OB 1UJ3C 3MGOA 4WFGE 3FKUS 2B4CC 5GJTL 1HYRC 1F13A 4E5XA 2OMNA 3QDJB 4I0PB 2H41A 3QPQD 5CIPA 4EOWH 3W0WD 2H32A 2YA1A 3REWB 3GNML 2AJ3A 4KTEL 1PSKH 1KPRA 2VZ3A 4PYHA 5D1QB 1Z5LA 2PW2B 5DD5H 3N1MC 3L3IA 5A16B 5C6WH 3P9LB 4FTVB 2W0KA 1A1NA 3L5XL 1RIVL 4C56D 5EUOE 1I7RA 1SYSA 4LDLB 2HVJA 1XGRA 1VERA 5LVEA 1A8JH 1YY8A 3RWGA 4KZDH 2O61A 4CVXB 2NNAB 5D2NA 1CLYH 3TZVC 1FGNL 4WFHD 5ITBH 2AJXL 2YPKB 5I17A 2D03L 2H9GB 1C5BL 3CXDL 5I18L 1Z5LB 2PW2A 4QXGH 1EUUA 4DN3L 4UI2A 2BRRL 2IFGA 3X12B 4IRZL 1MRCH 1HCFX 1A14H 2EDEA 2RCSL 1NGQL 4PRBA 5DXWA 1MVUA 1G1YA 4RBPH 5HHVL 2FJHA 2W9LA 1I1AD 4RFOH 4U6HB 5SWZB 3O4LE 3Q3GB 5E9DA 4K8RC 5JPMB 2Q6WA 2OL3L 4L8SB 4PJFF 3OR6B 4H8WC 4RGNC 5FECB 1YEHH 4MDJB 2KUTA 4PJAA 5F89A 1Q0YH 1KC5H 3ZTNH 1PLGH 4JAMB 1QNZL 4LRNL 1UH2A 4RAVA 3U7WL 1QR4A 1P4LB 4PGCA 1DEEA 1PW3A 3EOBA 2JJUA 2F9BT 3I6KB 5EBMA 4IIQB 2R0WL 3G08A 1CD1A 1MI5A 5DT1L 4ZUWB 1K9TA 3A0OA 4WW1A 5TFSH 3QHTC 1RHFA 1N6UA 1MFBL 2G2RB 5EORH 5KTEL 3DO7A 1K8DA 4K71C 1DLFL 3MV7A 3RQ3A 3CH8A 3T2PA 4OUOA 1F90H 4EKXA 5JA9A 4OIAA 1BQLH 1I3VA 1K5NB 5CZVH 3TCLA 5C0BB 3U36B 5JZ7D 1KCSH 4OCWL 4QKXB 3IDXL 3D39A 4WI4A 4ZAKB 1V7MH 3I2CL 3ULVD 4HLZH 1QFHA 3OAZH 5IT2H 3AS0A 1HXMA 3GSVA 3QQ9C 3IJYA 3WD5L 1U58A 2J8UE 3FB6B 3RVVD 5AUMB 2AEPL 1CD0A 2XZCL 4NQSA 2DQDH 4Y5VB 3WFDH 3IJSB 5JXAL 3MRMA 3UTSD 2M2DA 1H0DB 3SDXA 1CYGA 2A74B 5EG6C 3OMZA 5HPMB 1JHKH 4R97C 3P30H 1U8IB 4JKMA 4GRWH 1CF8L 5C6PB 2APBA 2A1WH 3C09B 4AJ0A 1IVLA 5B8CA 4PRPD 1AGEA 1DUYB 2A77L 5ABDE 1J1PL 3NFPB 3BO8A 5T1MA 1FAKT 1OAKH 1NLDH 3NVQA 3V0VA 2HA1A 5E56A 4M4RA 1NL0H 1YN6B 5CJOH 1JPGB 1T2JA 5CLWA 3GHEL 3MRNA 4XCYB 2HG5B 1BX2A 4OZFB 2OMBA 3RA7L 3S36X 1A9EB 1GZPB 4HPYL 5DK0A 3U9PL 1JWMA 3WXVH 1FV1B 4LSPH 1UT9A 4LGRB 3X14A 2VH5L 3MRLA 3LKSB 1I85A 1JWSA 1JZ3A 2C1OB 4FTVD 5H37H 3MA7B 1YY9C 2YD4A 3UTTB 3DETD 3DNKA 1MFDL 1DQQB 5KS9E 5EZLB 1HXYA 1Z0NA 1MIEH 4TQEH 1QFWH 5JW3H 4NT6A 2F15A 5DQDH 3SE3C 1CVRA 4TYUA 3UO1L 3L5JA 4FTVE 4JHAL 3GSUA 3BRGC 4FMFA 2QHRH 2RIKA 1S7QB 3BKML 4PJ7A 2VDKL 2QTEA 1I85C 1TVDA 3D85A 4XBEH 1JHTA 1V3KA 3SKOB 4IBLT 4P2OC 1IAOA 2X9XA 3O3BB 3SE9L 3ZTNL 2DLFH 3CSYB 1RHHB 4OLWL 4X4YA 1PX4A 2ZOKA 3K2UL 4CU7A 1O7SA 1JF6A 3ARGC 2VZUA 3RWFB 1R3JB 3SE4C 4HV8B 4LSUL 5K9QI 3ZTJG 4XX1E 3TN0D 3UAJD 3QXDA 4KH2A 3QDJA 4L3CB 5E8DH 2AXGB 1KCVH 1UXWA 2APVA 1LWRA 4BQ6A 5HD8C 1MWAB 3ZKSD 3FO2A 1P9MA 4PRNA 3RDTB 3CFBB 2I27N 4BZ2L 1OT1A 1EUTA 4LOUD 4WWKD 4JQIL 2AV1B 2P48B 4XP4L 3GK8H 3CSBA 3R8QA 4B41A 4Z0BH 4LCYA 5CBEB 1ZT4A 5TE6L 1A6UH 1EZVY 4CAGA 3DX8A 4UNUA 1OY3B 3IFNH 1SYVB 3QPXH 1FFRA 1V7NH 4BZYA 4C83A 3HNVL 4EZMA 5EO9B 4TOYL 4KJWD 1WAAE 3B9KB 4P9HC 2YOCA 3FZUD 4RIRA 4RQQA 3VH8G 4CRPA 3T0AA 1T2QL 3PWUB 5DC9B 5EBWB 3U9UB 1XF5A 5I8CA 3HC0A 3F7PC 2GI7A 3NPSC 5HVHB 4IS6B 1NLDL 3VI3E 1EXUB 1NAMH 4JO3L 3D3VD 5EOTA 4GS7C 4XC3H 2VDML 4Z7QE 3MCLH 5DMYA 4JM2C 4PGZA 2EYSA 3VFMA 4C4KT 2DQCL 4GRLA 3MLXL 2AJXH 3MLRL 4TTDD 1EAPB 4WU5B 1OP3H 2PO6A 4MNHA 3JWNC 3DUSA 1FAIL 1ZWIB 1ZKAA 4X0KB 3CNKA 3VGEA 3HMXL 5LGKA 5KANI 1KG0A 1JNJA 1B4JH 2ZZUT 1KLGB 4EN3A 1BIIA 3HC4H 4JO2L 3T0VA 4JFFE 3PWPA 3T0DA 4GRLC 35C8L 5FYJD 4U7KA 4XPHH 5D7IE 3QH3B 1OW0C 3RWEA 3H9HA 3OKKB 1BLNA 3C5ZC 3PQYA 3PV7A 3QEQA 4F15B 4M6MH 5DHVH 4HS3B 1ZWIA 3HUJE 4WCYL 5CBEA 3PL6A 1PLGL 2APTA 4FZ8H 1DBJL 2YD2A 5J1AA 2HJFA 1NUGA 1YJDH 2X7LA 1EEZB 3A6CH 4X5LA 5H2BB 4H88L 5CKAA 2MKWA 1RUKH 5IQ9A 4LSUH 4MS8D 4XCFH 4P23B 3SKNA 3ET9F 2R0ZH 4J3WA 1Y6KR 4L8DA 4JFQB 5F9WB 4NO0A 4FA8A 4YE4L 2NY5C 1HI6A 2QHLA 4GRMA 2G9HA 1IEAA 4OUUB 4GG6B 1CE1H 3ARPA 4P5TB 4WJ5A 3NTCH 3BAEL 1MWAL 4OSUH 1RMFH 2GITA 2H2PC 4D0CB 3S7GA 3MC0A 2I60L 4JR9H 2NXYD 4XMLL 5ERWA 3NFPA 4DZ8A 4KJPC 2VTFA 4M8QA 3NH7H 1J8KA 4TOYH 1BJ1J 4ONGL 5D8JH 3D3VB 2VLRB 4OZFA 4PGBB 4PG2A 1AQKH 1B0RB 5J4MA 4WU7A 1J1OH 2AERT 5T1DL 2A2QT 1KEGL 2IFFH 1KPUA 2V7NB 4TVSa 5DR5L 1JV5B 3AAZB 5FB8A 3UTOA 3O2VL 1HDMB 3D18B 1MPAL 4C59B 1TENA 2CIKA 4P9HL 2UWEB 4Y5YC 3C9NB 3B5TA 3KPMA 5HHOD 1HZHH 3LEXB 4PG2C 4YHZL 3PP4L 2HMID 1UADC 5D71H 4GLRI 5IUSA 4FQJL 2HWZL 3ARVA 1HHIB 4HUVA 4YC2C 1CG9B 1RK1B 4HJGB 3FQXA 1NKOA 1T80A 4K7FB 3UDWC 4CU8A 1WTLA 3VGDA 5SWZD 3MLVL 2A9ML 1WIOA 1HH6B 1BFSA 2OTPA 3BQUA 1P7QD 3BEWA 3DXAB 4JZJC 1MCWM 3IRPX 2Z31A 3HR6A 1ES0B 3PGDA 3DUUB 5F6HJ 5EFIA 4B5EA 1IM9D 3QNYB 5F1NA 4Z7WE 1OARH 3UDWA 2QBWA 1W0VB 1MQKH 2AXHA 1NFDE 4Y4FA 4JRYB 2F58H 4JHAH 3BP5B 4ORZC 5JMRA 3BKMH 3MBEB 5KSAC 4Y16C 4EBQH 3O9WC 4OZIB 3O3DB 1AI1H 1JN6B 2R8SL 3CVHH 4NCC1 1I3GH 2WUCL 3VXSB 3VD3A 1RAMA 3GMMA 5EPMA 3QFJE 2XWBA 3ARYA 1ZHBA 3MA9H 3HG1A 3NA9L 4H1LH 2AV1A 4D8PA 5FO7B 5FHBH 2OQJA 1ZT7A 4X80H 4XNYH 2AJUH 4Y4FC 1IM3B 1U8QB 1IJ9A 1UEMA 4BA8A 4ODHH 3NCMA 5C3TA 5KVDH 2RB8A 1T6WA 5GXBB 1FBIL 5IVZB 4MQXD 2MWCA 3MV8E 3VE0A 3FO1B 1S7XB 2DQEL 3D87B 2DS4A 3QWQB 4HGWA 3MJ8B 3IJYB 5I1JH 3BSZH 3GMOB 3LH2H 3VXQA 3SDDB 1IC5H 4S1RL 3R06A 3GEWB 2YD7A 4M5ZH 4PJHE 4UDTB 2JJTC 1JYXA 5LAXB 1KV3A 4M7JL 1FFNA 2VWEE 1D5BB 4GKZB 4I3RL 4W6WB 2DIJA 5ADOL 5L6YL 4PV8B 2H26A 2CLZA 4ZSOE 4CDGC 4KVNH 5EBLB 4U0RB 1DDHB 4JKWA 5FFLA 3MRIB 3MMEB 3VE0B 1QFPA 3VGHA 1R5WB 2OTWB 2YPKA 1MHPH 1X5IA 2AJYL 1YZZA 1R5VA 1NANI 3PE9A 3MUJA 5CILL 4RMRA 2P24A 5IK3A 1Z3GL 3SE8L 3VJ6A 4BFIB 3MYZA 1A4KA 1P7QB 1SY6L 5BVPL 2R0KL 3KLSA 5HHMD 3OKMA 3QA3B 4ZTPL 5IHZB 1UM4H 4TRPL 4ZS6C 1NMBL 3NACH 4U1KA 3DUUA 3GM8A 1BIIB 1SVCP 3F58H 4ZYKA 3L6FB 4MD0B 5FCUH 1PG7X 2VXQH 1MFAH 3DV6B 3LKNB 4Y4KC 3EOAA 5E99L 3VMOA 4ALAL 3EDDA 1T5XB 3DURA 3Q3GA 1BLNB 3PDOA 5FKAB 5JW4R 2DKUA 2F5BL 3OHXB 3H3PH 1X5JA 3O0RL 1K2DB 4NN7B 4ETQA 5BRZE 1FO0B 3MGTB 1IM3A 2BVPA 3BP6A 4Y19A 3G5VB 4NKDB 4JREB 4CN1A 4I48A 1DQLH 3N9GH 4FRWA 1LMKA 3T04D 1OCWL 4R90L 1TETL 2J8HA 4KRMB 1N0LA 2GJ6B 3DTXA 5BZWA 4G7YH 1OAZH 3ZDXF 2NLJA 3IJHA 4S11A 4N1EA 4NRXB 3CFDB 3BH9A 3WIHA 4NP4L 4O58L 4JFFB 4Z0XA 4MNGB 1G9EA 2M26A 5MP6L 2FR4B 4F33A 1G7IB 4KZEH 1IT9L 2YUXA 2P5ED 5C0BA 3U36A 5IJVA 5EZOL 2GITB 1I7UB 1JHKL 3BQUD 4HIEA 1YA5A 3C8HA 1ZA6B 3RVUD 5BOPA 4JM2F 2H6PA 4HXBH 2L7JA 1KGCE 1T03L 1Y0LB 4HGKC 4XC3L 3ISWA 1S9XA 3ELAT 3HS0A 3MRKA 1ZVSA 4P23D 4WV1B 3T8XA 4U1LA 2R2EA 3P73A 2F8XC 1OAQH 3LSOB 4UQ2B 2NX5D 2J12B 4WTZG 1IC5L 3CUPB 4S1RH 3BESR 3OG4B 3QR2A 3WHE1 4Q9RH 1FH5H 1FG9C 3VA6A 4JFFA 4Z0XB 2RAMA 4NO2A 3DHMA 1F58L 3SJVE 5IFJA 1WFOA 4FQXD 3GSNH 4DUVA 5HPMA 2WM0A 5F8QC 5CGYC 1SBSH 3HZVA 2ZKHH 1NGWB 3VXSE 1YN6A 1AXSB 3BD3A 2VR4A 5DRWB 2NX5B 2WBWB 4R0LC 4ONOA 4HGMA 1FFPA 4AIZA 3BPNC 1RZJL 4W68A 1IGMH 4ZFFB 1OD9A 1UWEL 2R29L 5DD0L 1OTSD 1YMMD 4NDMA 4R26L 2P45B 1ONQB 3OKOB 1KEGH 4WCYH 1D5ZA 3IU4L 1K8IA 5C0BD 2P5WA 2Y6SD 4XP5L 5H35A 1G0YR 3CU1A 3BYTA 2DL2A 3X13B 4YPGB 4YR6A 4QGTA 1OB1A 1KB5L 3C6SA 4HPOL 3QDAA 3LN5B 3HZMB 3TT1H 2GSIA 5C0EA 1A9BB 5HHQA 1BZ9A 4M9PA 4IM8A 4L3EE 3S34H 2HWZH 3FFCA 3GGWB 3WHE0 4MZ2A 1U8KA 2A6DA 3QUZB 2J4WL 2VLLB 2VC2L 1MLBB 1P69B 1N8ZB 2BNQA 1A7NH 1A6VH 4MCYB 4HAGA 5GS2D 4YDKH 5CHNA 1CDYA 1WEJH 1QLRB 4G6MH 4V1DD 4D0DB 1L7IL 2D7TH 3HUJF 4Z7OE 3L3JA 5CD3B 3VI4F 2CUIA 1KT2A 4QWWD 3QXVA 2GK0A 5KN5B 4M1DH 4IIQA 3VW3L 5DF0A 3NN8A 2ESVB 3CUPA 2IBZX 4RFEA 5DQ9B 5HGHB 3ETBF 1U8MA 2E7CA 3BIBX 3IS1X 3G04B 4JFQA 2OI9B 3HNVH 1J1OL 1YMHB 1HHHA 4NBZB 3QULA 2BNRD 3CFBA 1T3FB 3WBDA 4G3YL 4EBQL 1RJZB 1QBML 4MXVF 1DN0B 5DQJB 2UVFA 3S96B 3UTZA 5TQ0H 2R8SH 3PJSA 2EDJA 3QIUB 3KPOB 1C08B 1Q94B 3MV9E 3U30B 3GMQA 1I9IL 1FNEB 4QRTB 5GGVH 1NPUA 4GRLD 3D39B 2YC1B 4YXLH 2O5YH 1MCPH 4X5XB 4A6YA 3V7AG 1CQYA 3WN5A 3D0LA 4TVPE 2CKNA 3ZKNC 2B5IC 4J23A 5C0ND 1FZJB 4XGZB 1OAQL 2V2WB 5EUOB 2I07B 5D72L 4P99A 5GRVL 4NQCA 1EJOH 2ICWA 3SDXB 1RZGA 1LO4L 1VFBB 4UT7H 2KZWA 1WV7T 2X9WA 2XN9A 5A1AA 4KV5F 1A4KB 3AM8C 3T4AA 2MFNA 1YNKL 3VI3F 3D0VB 3KAAA 5GRUL 2J8OA 4ZO6A 1NGQH 2A6KB 5FUCE 3BZ4A 3ZE0F 5FGBC 3ZE0E 1R3IL 1AHWB 1L6ZA 1G7MA 3WS6A 1U92A 2HT2C 2W9DH 4XNUL 5I73C 3GSNB 1N4XL 2WAHA 4L1DA 3HHRB 3DVIA 2ZCLL 4LEXL 4IHOA 1C1EH 1DANT 2JIXB 5F7FA 1T83C 2DBLH 2E6JA 4XVTH 2I5YL 2VN4A 3BT2L 4J8RA 5I6XC 3IU4H 3MV8A 5FGBA 1P6AB 1I9RL 3U7WH 3UTQB 5C08B 1EAPA 4PTTB 1U93A 3QDME 5FYKH 5C7XL 4M3KB 4MLSA 1DQQA 5IVNA 3SQOH 5KVEH 4AZ8A 4FQQB 1FQ9C 1G7PA 2GJ6A 3QRGH 3H8NA 3O2DH 4G9DA 1NGZA 2PXYB 1XIWA 2NY3B 3VXUA 3MRMB 1MFAL 3RI5K 1NEZB 2ZG2A 1X9QA 1JGUL 2JJVA 2NZ9D 2I24N 1PG7H 2AK4D 3PXJA 3ES6A 1G7HA 2ZUUA 3VXNB 5DJXA 5GGTH 4WUKL 3BZFA 3QI9A 1KCRH 3TZVD 4X6DF 4LP4A 3ZHDA 3B3IB 2DQJL 5GSVB 4HUMB 3PP3H 4QRPB 5F21B 2C3HA 4XHQA 3ULUH 4R6UA 2PYEA 3IB4A 4P5TA 1N59B 5KAQG 3H7LA 5ID0B 4S1QH 2EYRA 2AXFA 4EOWL 2BDNH 1EBPA 5DJ6B 4G8GA 1A22B 1NMBH 1A47A 1NC4A 4L9LC 4JB9H 4HK0B 3BZFB 1I75A 1OP9A 1IGTB 3SKUD 5IFHL 3RWJA 5I16A 4E41A 4Y2DA 1UJ3A 4XPBL 5J6HB 2RQ8A 3FO0H 1L6XA 1CDCA 2Z4QB 3FOLA 3LHPL 4XP9H 5E9DE 4KHTL 3L3DA 4YBLB 3T0EE 1A21A 4G80B 2Z35A 2BXZA 3W39A 2BX5A 5GGRA 4PPTA 4LSVL 3O9WD 4JJHA 5I8EB 5K9KA 4JJ5A 4JFDD 3CDCA 1WZMA 3SKMB 4F58H 1EHAA 1XR9B 2G5BB 4C54A 1N64L 5DMJB 3QP3A 2CIIB 4HMCA 4HDIA 5KOMC 1R3IH 5A3IC 3PDDA 2XQYG 5A16A 3BN9D 1BD2A 2F74B 3MBXL 4K3DL 5HPOA 4CNIA 4X99B 4LASL 2GEEA 1UZ6E 2UZYB 3OKDB 1PY4A 2PTTA 5GS0C 2FHCA 1PKQE 4OI8A 2PN5A 3MGAA 2IANA 4UBDC 1E4XI 4MYWB 5BRZA 3KGRA 3QI9D 3FQXB 2C7UA 4FQXB 2GY7B 4MA3A 1OTTD 3NCYS 4M3JA 5FYKL 5C7XH 5J11C 3CAFA 5GZOD 4MQSB 5FUOH 3R0MA 4I48B 5DURB 3F5WB 4XI5C 4Y1AD 3V5HB 4FG6C 2QQLH 4JRYA 4JY4A 4NQXA 3DECA 5C0AD 4IOFC 3AMLA 4EEEA 4LVHB 2PYEB 2R0WH 1ORSA 2Y36H 1IZKA 3HZKB 5F6IB 5I1JL 1AO7A 4M93C 1OPGH 1IEBB 1S7TA 3TNMB 3PP3K 1L0YA 1MCBA 3BPOC 4L8SA 1EPFA 4FQXA 1NC4B 5I18H 1FZMB 1ZT7B 2LV4A 5FYJH 2VXTH 3MOBL 4MDJA 5D1QA 4JRXE 4XH2B 3EJZD 5IB3B 2G75B 2HN7A 1Z0MA 3FB5B 1KTKE 4RWYH 4ZTOH 1KCRL 4PRHB 4XP6L 1DCLA 2D9QB 3QDGD 1V7ML 3G6DL 3JTSB 2DBJA 4OLZH 1PG7W 4ACPA 1YY8B 4L8DB 4X9IA 3RWGB 3DVNA 4ELME 1I7ZA 2OJZH 3B9EA 1A6ZB 3TO4D 2V5MA 4GG8A 2X4NB 3FL7A 2AEPH 5K93A 4MA1C 3ZKXB 4JJ5B 2BSTB 3DUSB 2GTZB 1V5JA 2BOCA 3GIZL 3O3AA 2HJLB 5D7KE 2F54B 4P4KB 4UDTA 1XMWA 3HMWH 3DVFA 3NACL 2VLJB 4QRQA 1TITA 4W81A 3WIIH 3F7YB 4KKBD 1JL8A 1XGTB 4OLVL 3VFWB 5EBLA 4YFLI 3GMLA 4HCRL 5DD6B 3WNLA 4G6KL 1MFBH 4HZLA 5F9JA 4PJ9A 3IVKA 5MENE 4ZQKB 3OF6A 3NAAL 3WS3A 1F4YL 3WXVL 4U1KB 5ETUB 3RAJH 1MVFA 3BVNA 5L8KB 3QAZC 2Q8AH 4MQ7A 2WW8A 3UTPE 4PB0H 1CZ8H 1B4JL 1RJLA 3SDXE 1RIHL 3TA3C 1KELH 3CVHA 4J4PD 2XA3A 3BRDA 1XF2B 3AUVA 4BH7B 4ELKA 3KS0H 2E7LA 1XIWB 4XNZC 3K8LA 2X10A 1QFWL 5JW3L 1O7VA 5ALCH 1T0NB 1LEKB 1P4IH 4AEHL 4M7ZC 5F9JB 1FZMA 5DSCB 1UB6A 1NFIA 4L8BB 3R8BB 1NMCC 1BX2B 4HXAH 3DO7B 4PJBA 5CSGA 1AD0A 2V9RA 4WGVB 1DBJH 3CXHK 2PCPA 2R1YB 5J1TC 1BQHG 3K2UH 4HHAA 3ABZA 4ODXB 4TSBH 4O5LH 1GC1L 1RUQH 5DEZA 4XXDB 5D72H 1J0JA 1MY5A 2BVYA 3LQMA 3EFFB 4OZFH 4F7CB 1M71A 1SBBA 2WWKT 2QV2A 3DLQR 4FFYH 4JN1L 1H0DA 2PKDA 1E28A 1K4CA 1BD2D 2UVEA 4FTVA 3EZ8A 3BDYL 4HULB 4D8PB 1AO7D 3KPMB 4RMVA 5ILTH 5E95B 3REWA 3IAGC 2NY0B 3ULVE 2DMCA 5HJ3B 2DLGA 4Z0BL 1RJYA 4KK5D 5IMOA 1ODAA 2VL4A 2C4FT 2AXJA 3LQZB 4JRYD 5DLML 5J6HA 1A4JB 3MO1A 4XNXH 1FVEA 4HZLB 1CFSA 1NJ9B 1NEUA 1L4IA 5CP7A 1IGML 1C1EL 1P5UA 5GRZA 3QG6A 4B7IA 5HYFA 3LSOA 5DR5H 1CK0H 2AXGA 3D3VE 2R2BB 3WFEL 3RU8H 1FV1A 4HKXA 1UB5A 1S5IH 2KZ1B 2VAJA 3QHZH 4JZJA 4OF3A 4PP2B 2ZWLT 4NQEA 4LCIL 1IKFH 1PQZA 4JB9L 5TH2B 2MCG1 4XX1G 1LD9A 1YPZE 2GJZA 3MNWA 3W5NA 1FG2B 4FQJH 5D6CB 4X6EB 2ERJB 4HQQL 3DX8B 7FABL 5D7JC 3H9YA 1B4RA 2EICA 2ED8A 4YEEA 5TFSL 2JIXA 3VJ6B 5ICXA 1VSCA 3UPCA 3O9WA 4Z7NE 4Y2DD 3L7FB 4XCEA 2CRYA 2XTJE 4Q97A 5GJSH 1WFTA 3Q5YA 3RIAK 4ELMB 4WEUD 3GK8L 5A40E 4RSVA 3BIAX 4MDIA 4NZRH 1N2RA 2C4XA 4HD9A 5I2IB 1GYAA 3DX7A 4BELD 5AZ2L 3STLB 1OARL 1BZ9B 4K3GA 1MQ8A 4UIKH 1R3JA 4PJIB 2FECI 3MV7E 3WNOA 3QUZA 4R4BA 3WEXA 1PBYA 3KYAA 4RZCA 4L3CA 1IAKB 3VGGA 4PGJA 1NCDL 3K4DA 4YDLB 4NYLA 4L4VB 3UZEA 5F71A 5GRVK 2JJSC 5HTSA 3AXLB 2A6DB 1AGDB 4LLDA 4U1HB 1T7VA 1NGXB 4BFGA 4X80L 3LPWA 3A6BH 1YEEH 3C6LC 5D7KD 3HB3D 5CHNB 4U7MA 1QR1B 1XEDA 1NAML 1WZ1H 5D1ZB 4YXLL 4XPBH 1QSFB 2BSSA 2FD6H 1NL0L 1RU9L 3PHQB 4WFEE 3O2DA 1NCBH 3P4NA 1CXKA 4X6DA 1DN0A 5DQJA 4RFEB 5JLZA 5AD0A 1AKJA 3OKLB 4MB5A 5FO8B 3V6ZB 3QIWB 4XC1H 1CFNA 4PLJD 4I18B 2ADJA 2BMKA 1I7UA 1P7HL 5BV7B 4RDQG 5ESAA 4U1GB 2J1KA 1XF3B 3BAEH 5L6YH 2IAMB 1IAII 1R24B 3RWDA 3FT3B 4LDOB 3E2HC 4CJ1A 4NPYB 3UTPD 4X6EA 3V4PL 4QLRA 1JPFB 4R96B 2QSCL 4I9WE 5FKPB 4D3CH 3VWJD 1ZVSB 1WBYA 3EYOA 3K74B 2Q1EA 4E42A 4ONGH 1A5FL 3PNWA 1VFMA 1JK8A 1XF4A 4NUJB 1E6OH 4I9WD 1HQ4A 4R7NB 1BVKB 3L95A 4PD4J 3RWIA 1RZGB 4NKOB 4Z5RB 5HYJD 2AVGA 3ZTJH 4N8VA 3MRLB 1ZANH 3IFPA 5DD1L 3TWCL 2WIIB 3C87A 4QT5A 3C60D 5INDA 5C07B 5KSAD 2ITDB 3C5ZD 4XCFL 3ZL4H 4KAQL 4X7EC 2ILLA 5GRWA 3K0WA 3LD8B 3S4SA 3H0TA 3RGVD 1JFQH 5BVJA 4NQCD 4PJEA 3CIQA 4GRWE 5E94B 1XGPA 5EC1A 1GVIA 4Z77A 5C8JA 1B0RA 2DD8H 4H1LB 4DVRH 3WUZA 3GBNH 3WJLA 4IRJD 4OKDA 3L7EB 3UZVB 4Y5YA 4FABH 3UEZA 4HLJA 4HEPG 1XFPA 4OZGA 2G5RA 3G6DH 1CD9B 1IGFL 1VGKB 3BE1H 4P46D 3V6FB 5KG9A 1E4WL 5D7JD 2DIAA 1C5CL 3QFJD 4HIJA 4QHKJ 1R3KB 2YUVA 3S37H 4OLUH 3REVA 3O4LB 4PJGE 5E94A 1CFVL 3ULUL 2CQVA 4IDJL 4N8PA 4EQ3A 5CBAA 2AV7A 4HFUH 4PRNB 4W4NA 1HHIA 1CG9A 5MHSD 2BNQB 4QYOA 3RHWF 1IEAB 3KDMA 1G84A 1VACA 2FSEB 2ZOLA 2YHGA 2JJWA 1OWRM 3NOIA 2Z93B 3U6RB 4HUXA 1HNGA 3RDTA 5MHSE 4N0RA 4YEFA 5D5ME 4WWKA 4UB0H 2FIKB 3MR9B 4J7RA 3AS1A 4LLUA 1CGYA 2FL5B 2JCCA 1RUQL 3REVB 3BDXA 3FB7A 4PJ5B 5C0CA 1V3MA 5GS0L 4TULL 4OGZA 3FN9A 5ID0A 3GDBA 2YBRA 4PGBA 1T3FA 3JTTB 3GJFK 5EBWA 4P46B 5EOQL 5MI0C 3TYFA 4YX2L 1U8IA 1JZ5A 5HHOB 1A1MB 4LSVH 3I50H 3OGOE 2AI0L 2ZCHL 4UOW0 1T7WA 1HEZB 1E27B 4M1CD 4N90D 5BV7L 5HI3C 4UINL 4Z9KB 5GS1B 4ISVB 3TBWB 3UTTE 4MSWA 3T2OA 3F7YA 3MBXH 4G9FD 5C92A 5JXED 2Z35B 1JVKA 1X6LA 3CK0L 3HI5H 3EZJB 5FV2A 1OGAE 2MMXA 5MERA 4NQCB 3MJ7A 2P5WD 1MLBA 5I1EH 5EOCL 1F4WH 2AJYH 2D7MA 3TCXA 3P0YH 5DRZB 3BPCB 3UTTD 1AI1L 3RTQB 3MUZ1 1YEGH 1NGYA 4CKVX 2VXVL 4WO4A 3TESA 4EI5B 1CK0L 3ARFA 2R1XA 5DJYA 1HINL 2NXYB 3BWUC 3TVMA 1AE6L 4MNQE 4HC1A 1EO8H 3E3QC 2QR0B 2EDLA 3VWKD 3VWJC 2YK1H 3VH8A 3Q48A 3WHXA 3CPLA 1P4BL 4UZGA 4PY8J 3FHQA 4G9FA 1Z9SA 1ZSDA 2V2XA 4OZHA 3BGMA 5GGTA 3BRFA 4CNIB 4RZCB 3Q6GH 5TPWL 3MMEA 2OR9H 3BPCA 4JQXA 5T3XL 1FVCB 4HIXH 4NHCL 1UCBL 3WL9A 2P49B 4RMQA 2J2ZA 2X4OB 2J88L 1YDPA 3WIFA 4ZNEA 3HC3H 2HJFB 1NGXA 3FQWB 1U8LA 3BKYL 4LU5H 5KSBE 1CICA 5EU4A 1OSPH 3SDYL 2XTJB 5SV4A 2NPLX 4IOIA 2V9QA 1JRHL 1U95B 1YEDB 3TYGL 4Y4KA 3H3BC 5CCKL 4X6FB 5E5MB 1A1OB 5E8EA 5C9JB 3MLSL 3HMXA 2DLHA 3OAYH 2VMFA 5T1DH 2X41A 1CICC 4K07A 1AO7B 4R2GC 1INDL 2R0KH 5D70H 3GNMH 2BXYA 4UIMA 3K4AA 1UCTA 5GS1A 1VKXB 1YQVL 5F7NC 5DJ2A 1BHGA 3RL2A 3MYJA 4CN4A 1JNNL 2R1WA 5D2LB 3U2SB 2VDLL 4LNVA 3MRIA 3U48A 4NKIL 1RU9H 2ZUQB 1KPUB 2WBJB 4ZUUB 2F8OA 5DUML 5J3HC 4EI5A 1AJ7L 3G6JA 2WZPD 3ULUC 4UNVA 3D3VA 4KJYB 1BVKA 1TNMA 5GJSL 1SJVA 3G6JF 4KK9D 2NY2D 4NRXA 5DWUH 3VWKC 4UT6H 1MI5D 1KJMB 2BSTA 4F7MA 2LU7A 1QSEA 3HC0B 3KXFB 5D96C 4IRZH 5IGXL 4YK4C 2LTQB 1GL4B 2ITDA 3IFOB 4HH9A 4N0YL 2ZKHL 2W9DL 3DOSA 2X1PA 4YDJB 5GJTH 1OGTB 5IB4A 2X6MA 4CUCA 2HLAA 1FIGH 3WLWC 3UP1A 2R2EB 3P73B 4NSKB 3PDOB 4ODTH 1A9EA 1A2YB 3RKDD 5EZOH 3BHBA 3HE6D 3VFVA 2BK8A 4PJFA 1C8PA 1HH6A 3HUJB 2BNRB 3SQOL 4EUPA 5HI4C 3MROA 3S6CA 2PR4H 2FD6L 1YEFH 4IOFD 1KB5H 3IS0X 5DEGB 4ESKA 2YPVH 2YZ1A 3OL2A 4I2XB 4Y4HC 4G5ZL 5IJKA 3AC0A 1CXIA 1FBIH 3T1FA 5T3XH 2DRUA 2IBBA 2AK1H 4QYOB 4LHUD 4Z7UE 2XKSA 3HRZB 2VITA 5DRXB 2H2SC 4ZPTA 5DC4B 3ARRA 3LDBC 3LMJH 3RWJB 2VQ1B 3H3KA 1WQVT 1U8NB 3CVIH 3QUYB 1K3IA 4JO4L 5GGSA 4MX7A 4QRRA 4UU9A 2GSGA 4FNLH 2VB5A 1EEYB 4K2UH 5H94A 4QRUA 1U3HA 2Y06H 4XMPL 4YPGA 4YR6B 4ODWA 5GGRB 4HWZA 2IBGA 5LAXA 1QSEE 2YA0A 3MNZB 5J0BA 1BJ8A 1MHCA 2FX8L 2G9HB 2MTPA 1F5WA 1MCOH 4QRPE 5CILH 5EU6B 1A3RH 3I85A 1KC5L 1D5XB 1B3JA 4FQCH 2ADJB 2XKNB 2ZUXA 4G7VH 2QQQA 2VABA 3V4UH 1E28B 3GSOB 2FJFA 5L88H 3QO0A 2A1WL 5E6IB 1I9IH 1U8NA 1BOYA 2YXFA 2IMMA 4Q9QH 5GGVL 5EO1B 3VXSD 1K5NA 1NBYB 1INQA 3EUUA 1VENA 1MCFA 5AZEL 4BSVA 1U3HB 5DT1H 3JSSA 5INCA 4UTAH 5SX4I 3KNBA 4BFBD 3LHPH 2P24B 1ULVA 1OGAA 2ITCA 6FABH 1NJ9A 4I5BB 5D5MB 1K4DB 2XWTA 5C3LD 5FECA 3AFLA 1QHPA 3KPPB 4U6VL 5T1LB 3HE6B 5I1LB 4JFHD 2NTFB 5TDPB 1WISA 2WQ8A 4X6CA 4LHUG 5CZVL 1ZGLB 3DXAD 3ARQA 4OD2A 1A7OL 4PGCB 4ONFL 1VB9A 5D2NC 1T5WB 4J3OC 3RVVC 5HBBA 4YBHA 1IZJA 3CZJA 3KYNA 2CMRH 2HLFD 1J0ZA 3GMLB 3TNMA 4P5MA 1CFVH 2GJZB 5M95B 4NQVB 4L4TA 4TN9A 3NZ8B 4PJHF 4ODTL 4Q2ZB 1QBMH 5CEXB 2H9GA 3AM8A 4YDVB 1TQCC 1RVFH 2EEDA 1N8ZA 3BVNB 3OZ9H 5DMKB 1MHHB 1EEUA 3BPLB 3DX7B 3FRUA 4ZUTA 1MH5B 1EEYA 4QY8A 4HXBL 4OZGF 5JQ6H 3HI1B 2A6KA 1DQJB 1QBLL 4PRDA 1J8HD 4M9OA 2G60H 2HVKA 5FYLE 1JF1B 3P9MB 4X6FA 2CO6B 2X1XR 3F65A 3TH4T 4Z7VF 2E9IA 1NBQA 4LSQL 4NHUA 4WI9A 2CRMA 1F6FB 1X3DA 1LEIB 3Q6GL 5BZWB 5TPWH 1T83A 2NY6C 1S78C 2PYEE 4BZ1H 4APQB 2Q76A 4PGEA 3MOBH 1K3ZA 4M00A 1RZ7H 2I60H 3OJ2C 4ZUSA 5JORB 4G8GE 4QRRD 4DGIL 2XN9D 1GSMA 1QYGL 1XF1A 4D94A 3QO1A 1GAFL 4ODXA 1SBSL 5FUCC 2C4FU 1Q1JL 1A6UL 4NC2B 5CSZB 3UO1H 2AAVA 5B8CC 2HT2D 3FO1A 3U4BH 1YEIL 4KROC 3MRJA 1MREH 3EO9L 2ZP0T 2BNRE 5FO8A 1NFDB 2FX7L 1SY6A 2EIEA 2IFFL 1QEWB 3CX2A 5T1LA 3T3PE 4OFDA 1HI6B 4X4ZA 3GIZH 3PWPD 4Y1AB 1OT2A 4KK8C 4R8WL 4EN3D 1N6QH 2C1OA 4K8RL 4P2QE 4XP5H 2VXSL 5FAAA 5EULV 1HXYB 1MJ7L 3SY0A 4G6JL 2NY3D 2VDLH 3OR6A 4GMSH 1SQ2N 4MCZA 3MCLL 3GSUB 3DYOA 1QLFB 3MLTA 5LCVH 4KKAC 4XP9L 2EO1A 3QQNA 3B9DA 3NCCB 2AEQH 5B38G 2FEEI 2NY0D 1KTLB 4S10A 4JPIB 1J1XL 1DP0A 3MLXH 4O51B 4P2RB 3GIVA 5FF6B 4HUUA 3QEHA 1DBMH 4GW4B 4PJCF 2BZDA 3FQTB 1KBGL 5BJTB 2RJMA 4NOBA 4TUOB 3CC5A 4JFDB 3THMH 3DSNA 3GHBH 2DQJH 5JNYA 1O0VA 4OLYL 1H15B 2A38A 3KJ4C 1V7NL 3FFCD 4LLQB 2QSQA 2Z8WC 1E4WH 1TZGH 4DW2L 3I6LE 3QDJD 1U8KB 3P4MA 1YNTB 1U6AH 1JZ6A 5I1DA 5LQBH 4HCRA 4OIBA 5HHQB 1R3LB 3QIBD 5E08L 3WL9B 4QF1B 1CXLA 3I6LD 4X6CE 1VA9A 3O6FC 4Q6YA 1I4FB 5BOZG 1BF2A 1EZVX 1MAMH 2ICWI 4MAYC 5A2LH 3F7VB 1MAKA 1V8HA 1JGLH 2UY7A 3MV01 4P57A 1P9MC 1MIMH 1DVFA 3CJJA 4JO3H 2ADIB 1HWGB 2VDMH 5GIRB 3SDAC 3EFDL 1NFDA 5EFIB 4OT1L 1YC8A 3LV3A 4PBVC 4OLXL 2JKXA 3TN0A 1JPST 4JFYA 5HHNA 4HJ0D 3AU1A 3BZEB 1FAIH 1AD9A 3LKOB 2IANB 4WI2A 1H8NA 2X42A 2XA8L 3HG1B 1FL5A 5ANME 43C9B 4ODSH 1VACB 1MWAH 4UMGA 4WWKB 2AI0H 2KBGA 2ZCHH 5ACMA 2AK4B 2X09A 5EA0L 4IRSB 1T66C 1M7DA 2QADB 3RWFA 2ENYA 4Z7UB 4G8EB 4HUXB 5DLMH 1OAYL 1JUFA 2O61B 4TSCH 2FIRT 5IOPB 3TBSB 1A6TA 2E7MA 2CLRA 1N4XH 4GKSA 4F7TA 1AGBA 1MNUH 2WBJA 3TN0B 3L3DB 3EHBC 2EC9U 1F42A 2FX8H 4Q6IB 4M6ML 3P0YL 4LIQL 5GGVY 3GI8L 4J4PC 3LKOA 1TZIA 4P59H 4IRJB 1CLOL 4K7PH 2I5YH 4CU6A 2IF7A 4MNGE 3SBWA 1FSKC 1MCRA 4PRPA 2PUQT 4NRZA 1JGDA 3X12A 4RGOH 1QSEB 4PJ8D 3O4OB 4TNWF 4NQDD 3ULUD 2EEBA 5EBGA 5EU6E 4Q9CA 3SHSA 5CSBA 4Q9QL 4FS0A 2E7BA 1DDHA 3RGVB 3QYCA 5J57B 2CLRB 4F7TB 4U6XA 5FK9A 4YWGL 5MEPB 2R2CA 3H9HB 1LGVA 1RFDH 3HZYA 3EO0A 5HYJB 1UCBH 2YR3A 4GG8B 3MSPA 1YEJH 3HAEA 1IAIM 5TDOB 4XP6H 5CZKA 3OKEB 4DAGL 5C0JB 2IPUK 4FQHB 4OQ1A 4K94H 4OAWA 4W6YB 1RIHH 4Y1AE 1MCLA 4YQXH 3LKQB 2VZTA 3VXMA 3G08B 1TZGL 4IDLA 4LNRA 4UV7H 5L2KD 1M05B 4E41D 4Z78A 3QHFH 3DV4A 3CZFB 3LEXA 1ORSB 4KFZC 3AU1B 4WW2F 1YDPB 3BJLA 1S9WB 3PWNB 1K8DB 5C8JB 1IT9H 3UC0H 2XRAL 1XF3A 4U2ZA 4LSRH 3QNZB 1SM3H 2CRIA 4O2CA 3BN9C 2DI9A 4P9HH 4U6YA 1JPFA 4KMTH 4FXLA 1VESA 3QIUD 4QCIA 3WIIL 4JGMA 5JW5B 3HE7B 2NW2B 4EDWH 2VL5B 1A6TB 5DJ8A 3PWPB 2E7LC 5JQ6L 1NCWL 1FN4B 4YHLH 3JV5A 2A0LD 3DBXB 4QRUB 3JWOH 1FGVL 5I71C 3GSQB 3UTSE 4JO1H 3SKJL 3IDGA 1TMCB 4HUWB 3RAJL 5D1XA 2B2XL 3HPLA 4NO5A 1EV2E 2DTMH 2BNUA 2VISB 4ZODA 3G5YB 3RRQA 4PLOB 2Q8BH 3DGCR 43CAA 3VFRA 1QYGH 5JOPD 4YLQT 2OQJB 4W4OC 1U8OB 1ADQL 2GJ6D 1UWEH 4OF5A 5KVFH 3WLBB 8FABA 3IFLL 4RAHA 1PEWA 3SOBH 4YXKH 3H2WA 1MREL 5DD6A 2E8ZA 2X4UA 4B50A 3OQ3B 1A02N 1KTLA 2AGJH 1IEHA 4I5BA 3FCTB 5BS0E 15C8L 5EC2A 5I17B 4WJ5B 5FGSA 4G80A 4M4PA 4KJQD 1FNGB 1KXVC 4FXGA 5C0IB 4DKEL 4OZFG 1HEZA 4L3AA 4ZTPH 1C7TA 3MV9B 3TV3H 2A6JA 1EK3A 4XZUB 5SX5H 2OR7A 4O2FA 3QJHB 2Z31B 3ZL4L 1I8IA 5E8OA 2CKBA 2IANE 1AIFB 2XKUA 1HSAB 5HYEA 2HLAB 2QQLL 2PR4L 4OZ4B 5IROC 1I8MB 2CK0L 1QRNA 1K85A 4G6JH 4GBXC 4CGTA 3ZKMD 4HX1B 4YDJA 4ZXBC 4GG6F 3FT2A 3BP5A 1JHTB 5J12C 1CDBA 3BWAB 4AEFA 1OTUC 2PTTB 1X5XA 1EHNA 5GS2H 3O6LH 3BDYH 2J8UF 2EDXA 4HUNB 1D5ZB 2E3VA 2EH7L 4S1SH 4ZOEA 2XPGB 1OP3K 3R1GH 4CN6A 4POUB 3O8XC 1KCSL 5L8LB 3MACH 4MD5A 2WINB 4YHOH 1CFTA 4JFOA 1H3XA 4I2XA 1IE5A 4JZJB 1TCRB 4G8IA 1OCWH 3P9WB 4UV7L 1OAUL 5DI8A 3U4BL 4JPVL 3N06B 4DTGL 1WGOA 2CXGA 3S37L 5A3ID 4PJEE 4QXTA 4KQ4L 1LD9B 3VFUA 1BEYH 3FN0L 3E6FB 3LKNA 4PB9L 5I1AA 3R06B 5I76A 1G0DA 1P1ZA 1KTDB 3MBEC 2COQA 5TDNB 2GW5A 5J6GB 2HRPL 1NUDA 2A77H 3RVXD 1B0GA 3HMWL 4UT9L 1LE9B 1S78D 5HJ3A 1MELA 1MJ7H 3U4EB 1NCCL 4YFDB 3VXME 1IGCL 3ZDZE 5EU6D 3RKPA 1WICA 1R5IB 3JWOL 5IMMA 5FM5O 1U8MB 1F8TL 1GHFL 2V5YA 4L4TD 4EXKA 2CGRL 3VRIA 2XXCB 3M8OL 5CP3A 2JELH 2YRPA 3IJSA 3DO3A 3X3FH 5F8RC 3I50L 4MAUH 2C1PA 2CPCA 3S96A 4L5FH 1JTPA 4AEIL 4CW1B 3OKMB 3QA3A 3QCUL 3BP4B 1MRCL 1PGRB 3PGCB 4YHNB 5BZDB 1T6VN 4Y2OA 2EDWA 4QHNA 5B3JF 1TZHB 3BYYA 3EOYG 4G7YL 4LCCA 2YN3A 1CGWA 1OTSC 4YNYA 3FOLB 4U0RC 4ZNEE 1T1YA 5INCB 1ZOXA 1B9ZA 2AGJL 4JVPA 4U7SA 4CVXA 3BT2H 5SV3A 5EU5A 3QWRA 5IVOA 4WW2C 2FEEL 5L8JB 1LP9F 1OGAB 2X9YA 4LIQH 5DVNA 4F57H 3FAXA 1BMGA 4ETQB 1CLZL 1G0XA 4GKZA 4BUHA 4ZO9A 3T0WA 3RZCD 3PG2A 1KJ2B 2AJVL 5IV2A 3OB0K 3BN3B 3SJVA 3QRGL 3RY6C 1P4BH 4K3JH 4LNRB 4KAQH 4LCCB 5E2VL 4LLQA 1OGTA 1NCBL 2VLKA 1R5WA 2OTWA 4I8DA 4Q2ZA 5CEXA 4PJAB 1JFQL 1QFWI 1D3CA 4PRAB 1UENA 4E42B 2J4WH 4MVBD 3JWDH 2XA8H 3O3BA 1B0GB 3FOMA 3E0GA 1DLFH 2DD8L 4X8JB 1UWXK 1OM3H 2P47B 3QDMA 1P7KA 5HYSB 1TVHB 5EA0H 3RBSA 4Q74A 4BH8A 5F7DA 1I7TA 1A64A 5F72S 5I66B 1CD1B 1MI5B 4OCWH 4NQXB 1BQSA 1I1YA 4OB5H 3BKCH 4NZTL 4NNYB 3JWDC 5SWQB 4M1DL 3O6FD 5F9DC 1D5IL 3L3HA 4CBPA 4WV1A 2NY4C 4Z7VE 1UH4A 4OLUL 3MLSH 3HB3C 3S4SB 5JLZB 4OZIE 2CDFA 1T22B 2XICA 4P59L 1RURH 5FCSH 1D5BA 2LU4A 4WHTB 3ULUF 2R15A 2R69L 1ZLVH 4NRYA 3ARBB 4RGOL 2NY1C 4PGEB 2F54E 4HUKB 3QUYA 3OWEA 1WC7A 1F4HA 1NC2B 1AGCB 1EERB 3IETB 4JPWL 3FO0L 5MEND 4NWTL 2CGRH 1NLBL 4J6RL 5J9PB 5KG9B 2E27H 1FRGL 1UACL 1LHZA 2PETA 2BOCB 4IJ3C 3SQBA 1ITBB 1F11A 5BS0A 5EWIH 4X7SH 1Q9KA 4G6ML 5ISZB 3S35L 4FABL 1MRFH 4AIXA 4ZMAT 2DTML 4YHYC 4F7PB 1KN4H 1RY7B 2MOVA 1EO7A 5FEBA 1NC2A 3GHBL 4FFZH 1KXQE 1D6VH 3BO8B 5T1MB 4S0TD 4XNUH 3GUTA 2HFTA 4P2QA 4GXVL 3ALPA 3CK0H 3OKNA 1FL6A 2V2WA 1UVQA 4P9MH 4PJ9B 3MREA 5FYKD 3UC0L 1IAIH 2VXVH 5CJ8A 2VDOL 5I8EA 4WHDA 3ROLA 4M7KL 3CVHB 4POZC 1RZKL 4I4WB 1RUKL 1EA9C 3MGOB 1ZE3C 3I9GH 5DS8B 5GGQH 2C3VB 3MZGB 1E27A 3QDGA 5EO0A 3NIDF 1MCQA 3ARGB 2PNDA 5IEKB 3KYNB 4BKLB 4KHXL 5DVLA 1JMZA 1IAKA 1EVUA 4YE4H 1FL6B 1WLHA 5GS3A 3QUYD 4NNPL 5MERB 2V17H 4YGVB 3SDCB 3RPIA 4F9PA 3IDNB 5BRZB 2FJFB 4X8XA 1H3UA 3DETC 5IFAL 5GRUH 3SKOA 4DEPB 3MLPA 1VEMA 4O2CB 3PL6B 2OX5A 4J12A 4HSQA 3TBTA 3EW3B 5D93C 3IXTA 1TJGL 5E24E 4OB5L 3HI1A 4BUGA 4HIHB 3B5GA 1R5IA 1SEBA 4YJZL 4ZPVB 3VXRD 1S7XA 2FL5A 3MOAH 4HGWB 4JFEE 4M8VA 1S7VB 4MNQA 4DFIA 4F9PC 4NO2B 2OL3A 3LN4B 2V5TA 1XH3A 4P2YA 1XCQA 4JHBA 5FYLH 3RVWC 4GH7B 3PHSA 4PR5B 4YBQD 3LY6A 5ESAB 1I1AB 3HG1D 4YAQA 3GMRB 4HS6A 2DQUH 2FLBT 4WY7H 4PV9A 3RY4A 5D70L 1WTGT 3VG9C 4M5YL 4LKCB 3MRRB 3I75A 5KS9F 3LB6C 2HRPH 3D25B 5E2TL 2DI8A 5GISL 2HRLA 2QQKL 5ELIA 1YNLH 3E3QE 5I15L 1QFOA 3C09C 2AJSH 1UM6L 2J3SA 5D71L 1NCCH 4KK6D 4LFHD 3CFKB 4J6RH 1GH7A 2Y07L 4LF3B 4PJXF 3L3KA 3CFEB 1QRKA 2JF1A 3QXTA 3MTRA 3NAAH 2JELL 1IC7H 2BP3A 2V7NA 2W1NA 5B3JE 1JNLL 4XB8A 2VLJD 3QQ4A 2NY2B 3MACL 4QY8B 2IWGA 32C2A 5DS8A 5L7XL 4JRXD 3L6FA 1EGJA 4X9BA 4TTGA 3Q1SL 4XHJC 4P49A 5CAYB 4Q58C 5CCKH 1T1XB 3VFWA 2Y5TB 4PJ8C 4H26A 4PJIE 5GZND 1GZPA 1OWWA 1QUNA 1HYSD 1INDH 4C56E 5TE4L 4MS8C 3N1PC 5LXGL 2W60B 2XRAH 5HHPB 3TBTB 5KVGL 1LEGB 4MJ5B 4OCRH 4D9RD 1SM3L 5HYSA 4HJJH 1RZKH 4OD3L 3OXSA 5CSZA 4WGWB 2BOBA 1I1YB 1XR9A 2G5BA 2OL3B 2CJUH 1CIUA 4K3JL 1Q9OA 2YWYA 4N5UA 3W2DH 2D7NA 2EO9A 1Q0XL 5B39A 4K7PX 4L3EB 2NLJB 3W9DB 3M8OH 1IFHL 5DMIH 4POYA 3DX6A 3K1DA 5F9WC 3OKDA 4HS3A 4PJEF 3O2WL 3IF1A 3RY5A 4XBPB 4OZIA 3LEYL 1KJVB 3D2UA 1A6WH 4BM7A 3CDYA 4ZO8A 4PS4L 4OV5A 2IAMD 4KI5C 4MJIA 4I77H 4F8TA 4KVNL 4HK0A 1JHLH 4RX4A 4B0MM 4JY5H 3FB7B 3CVIL 5EUOA 4LPVA 4EUPB 1BBJB 1WWAX 4XMKL 2Y06L 5I0ZA 4GG6A 5E2JA 5D8JL 3ZKMC 1ZVHA 2XYCA 4PJ5A 5C0CB 2EDTA 1U2CA 1QSFD 1A3RL 2GQHA 1QRND 4PBWD 3QI9C 5E2UH 2OYPA 3VFGH 1BOGA 5DUBB 3D39E 3F58L 5I15H 4HKBB 3OJDA 1IL1A 4D0CA 1CXEA 4XPTL 3EYQC 4HH9B 5FKPA 1KOAA 4S1DC 5E2VH 3MUGB 43CAB 3MJ7B 3VFRB 3MRDA 1NDGB 4HT1H 2BCKA 1VDGA 12E8L 4JFHE 3H9SD 4GKSB 1XR8A 4OF8A 2W59A 4HCRH 5EC2B 5FB8B 4YH6A 4OKVB 5KW9L 5CEZL 3MLZH 2AXFB 5IHUL 1GGBL 2CO7B 4NN6C 1LP9E 5FYJL 3O6LL 2YSSA 1MEXL 3OR7B 5CIPB 5DZOA 2J88H 4R4NC 5A43C 3FB8B 4WO4B 1I9EA 1YECL 1IL1B 5DA0B 3KPQA 2H8PA 1PQZB 1YMMB 4OZHB 3ARGA 3QIBA 1C12A 2DM2A 4PJIF 4LEOB 4O2EB 2D0FA 1OAUH 1QQDB 3SE4A 1NBVL 5ISZE 5B4MD 1HQRB 2EC9T 3RPKA 4LMQE 5I1KL 2FO1A 1XGPB 5LQBL 3HFMH 1MCOL 2R0LH 3S36H 2OK0L 4QOKD 4PYGA 4KGJA 5ICZB 2YS4A 2YSSB 3OR7A 4N1HB 5ISZD 3BISA 3W5MA 1ZLVK 2EXWD 4H25B 3T3MF 1IRAY 3L7EA 3QDMB 5FM8A 1KG0B 3S3SA 4MMZC 5KVMC 2BHZA 2F19H 1YQVH 3I6GB 3RKDC 4X6CB 4XNYL 2CJUL 5GGSB 3AB0C 3ZDZF 3MRCA 1IGCH 2A6IA 4BSWA 3WLWD 1ZAGA 2GUOA 5L0QB 2CR6A 1MFEL 4KDVA 3WFCL 2BVUA 2FLRT 1ACYL 5BQ7A 1F8TH 1GHFH 1W0VA 1JRHI 1YYML 4MLIA 3LS5H 5FGRA 5CJ5A 3LIZH 1BGXH 1KXTB 5GRJH 1PVHA 3D25A 5JPNB 1OLLA 5H2BA 2DQTH 2L0DA 1QR1A 2V7HB 2CDEB 5ANMB 1AGCA 2VLRE 3IETA 3HS0B 3U4EA 3W39B 4NJAL 1EGJL 2WSKA 4L8SC 3KPRE 1F3DJ 1KJ2H 3GSQA 1A5FH 2XWJA 1KTRL 3EO9H 5BQ7B 6CGTA 1S5HA 2NW3B 4WU5A 1P5VA 1A6AA 1BQHA 2APXA 3DMMA 3EFFA 4KKBC 2VDOH 1VGEL 1IQWH 4NGHH 2QKIA 1CVSC 4OGAC 3W0WE 1J5OL 3AREB 5ICYB 4R8WH 2BNUB 1XAUA 1FYTE 1S5IL 2Q20A 3I9GL 5ESVB 4F7PA 3TJHD 5F1IB 1NCAL 1D9KA 2NZIA 1MJ8L 2VR5A 3WLBA 3V5DB 4D9QE 4YWGH 1UC6A 5E9DB 3NIFE 3CFCH 2Y07H 4KKCC 5EIVA 3OXRB 1RUAL 2VDPH 3RI5F 1CDUA 4DJMA 4QCIB 1A3LL 2X7LB 3MROB 1OM3L 1GGUA 1CGXA 5C0CE 2OTUB 3Q2CA 2YKLL 4O2FB 2B7DT 3MRCB 1X7QA 4Z7WB 8CGTA 2VLKB 2EKSA 4XTRC 3KG5A 4KRPB 1BBDL 3N1FC 1C5CH 4FHBD 1YEIH 4AMKH 1A7PH 2K3TA 4K2UL 4L3EA 1OOAA 4RGMC 1YUHA 2MNUA 1G9MC 1JF1A 1N3NB 4IDJH 3O4LD 1BAFH 5IVXF 1U0QA 3V7MA 3QFJB 1G1CA 4WUUE 2ESVD 5ID1B 1LE5B 2NY7L 1G6VK 3DRTB 3C8KA 4PRAA 3LRSB 1JWMB 1U8LB 4G7VL 1A7RL 3KPRA 3KYMA 4CADA 4RISH 5KSVB 2XN9E 3ARDB 1PD6A 1SJXA 2JCCF 2B0SH 2WBJD 4ELKB 2QLVB 3DMMD 1I7ZB 4BH8B 1JNHB 1BBJA 1UZ8B 4NCC2 5FA3A 5DQ9A 1HXMB 3GSVB 2GSGB 4HMDA 3ILQD 1MCJA 3GB7A 2C3GA 1IC7L 3WKNA 4HWZB 1FGNH 1X4XA 2HJLA 2I9TB 2VABB 3B6SB 1UACH 1JNLH 3KR3H 3L3IB 3MV9A 5DYOA 4NZRL 2VQTA 4CADB 3S35H 2ZNWA 5KSVA 3KYKL 1FPTL 2DM3A 2V5RA 3MXVL 2NYYC 2ZOKB 3ZYZA 4FFWC 1CL7L 2DMKA 3BUYA 1R6VA 3G6AA 4XMKH 5I1EL 2I07A 2MKLC 3LV3B 2NNAA 3QXDB 4MD4B 2ZSWB 4J2XA 2IPKB 1AR2A 1J5OH 2VLME 1AE6H 3A6BL 2DN7A 3K1KC 4QHUB 1CDGA 3UJIL 4GRWF 5BS0B 4HF5H 4LIQE 2X4RA 3PGCA 4QRSA 4HG4J 4P5MB 5AAWA 4LEOA 4OT1H 4RA0C 3JZ7A 4HPOH 5I74B 3BUYB 4QOKB 1QBLH 2DWDB 3GSNA 4HT1L 3BGFC 1JUFB 4MAYD 2GTWB 1YNTA 1JGUH 1HHGA 1S7UA 1KTDA 5I8KH 3TC9A 5MENB 2MCPL 5F97E 4HK3J 4X4ME 5KSUB 4MA3B 1ZHNB 3MLZL 3PQYE 3QEQE 5C0FA 3VXTB 2E9WA 3R1GL 3RZCC 1FYTA 3EOBB 1TZIB 3WO4B 1X5ZA 2YD1A 4R7DB 3OAUL 2BOBB 4JPVH 4U3HA 2HFEA 5D6CA 3F6IA 3WSQH 5IT2L 1TCMA 4P3DB 4ETYA 3NGBC 2Q76B 5I1KH 3QQ3B 4NOFA 2XZCH 1MCNA 2R0LL 3ESVF 1VPOL 2AW2A 4XRCA 3TLRA 4U3XA 5JHLH 3U46B 4TVPD 3EYFB 1I8KA 3SJVD 3KLHD 5J13B 2XXMB 4NKDA 3QIUC 4XHJD 2DQGH 5HVHC 2BVTA 3KVQA 5I66A 3QDHA 3LCYA 4GS7B 1EDQA 1CFSB 2CXKA 1YNLL 1S7SB 3C6LB 5IM7B 3G04A 2ZUSA 3RX7A 1X5KA 4G6AC 4OM1L 1NCWH 2XWJB 4GMSL 3VXMB 2CUMA 1OW0A 2CDGB 2DQCH 2JJSA 3UYPA 1PKOA 2BY0A 2FGZA 2IH3A 3QIUA 1RUPL 2BY2A 1HQ4B 4J3SA 1YYMH 1ORQB 4RCAA 2R56H 1J88A 3TZVB 1W2KT 4DOHE 3CSGA 1JYWA 2VDNH 5C0RL 5DTFA 5F1SA 4WUUB 3TT3H 4Y5XC 3MXVH 1KENH 3QISA 3VGAC 1TQBC 4XGZA 5INDB 3KLHC 4J3UA 3UBXI 1KNOA 2R1WB 1NMAL 2BSSB 3EOAB 4Y16D 1UKQA 1OP5H 2J6EA 4X4MA 3V5DA 1KPVB 4Y8AA 3HE7A 4XPHL 3OB8A 3OHXA 3IFLH 4L3ED 4OGXL 5IBUG 5DEFA 5D5MA 3DIFB 2B1HH 3EJYC 5F7MC 3CGTA 5D1XC 2FB4L 3FQTA 4Y5XA 3V6OA 4P4KD 1IQWL 3HAEB 4RRPG 5TDOA 4PJXB 2PO6B 1I7TB 1KCUH 5CS7A 3L5WA 1KIUA 2F19L 3BP7A 5HHOA 4AL8H 1YJDL 1E4XH 1JGLL 2ZPKL 2BVOB 3G5YA 4WFFE 4XPAH 2YPVL 5B21A 5CZXD 3IXAA 1HWHB 3O2DL