2FECL

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport,membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
source organism Escherichia coli
total genus 41
structure length 211
sequence length 211
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecL01
2EC9U 3MODL 1T22A 5CIPH 3WLWD 3S8WA 3D3VE 4RA3A 3RNKB 1FFPA 1NSNH 2XTJB 4K9EC 5SWZE 2P5WA 1YNTB 4XMPH 2Z93B 3CFKA 5CSGA 5FO7B 2X1WL 1J0IA 4R90H 1D5MB 1UJTA 2AEIT 1T80A 4O51A 2V5TA 4QY8B 5BRZA 3GMPB 5EPMA 3T09A 2YPLE 3NCMA 2BNRA 1MCNA 2Q6WA 2VLRD 1DLHB 2BVEA 1KLGB 4OGZA 1FCGA 4HWBL 5L9DH 2J4WH 4EN3A 3U4BL 4S2SA 5FGBA 2DBLH 4D0BA 1H3PL 1LO0L 3HRZB 3CX5J 1NFDB 4P2OB 1UWEL 1A7OH 1ONQB 1T5WB 1U58A 1G6RH 1PD6A 2FJGA 4B0MM 2QQQA 1RUMH 4XCYA 4F37F 2PTTB 5FV2A 1BPVA 3TCLA 4NO2A 2MKWA 5DC0A 2VO5A 1SMOA 2QKIB 2J8UB 3M17A 3LKSB 2COQA 4X80L 1QA9A 3RA7L 1JPST 2AJYH 3SN6N 1FJ1A 3S88H 2E6QA 4GG8B 3S3SA 1J0HA 3WIIL 4PY8I 3S35H 3CZFB 4KZDL 1CDGA 3I2CL 1WT5A 4JLRB 1KCLA 2ICWA 1YYMH 2A83B 5GRJL 1UEMA 4Y8DC 2R1WA 1VFBA 3BT2L 2A9NH 5E94B 2A6DA 1UB5A 1D9KB 1IGIL 3U30C 4U4BA 3IDYC 4HDIA 1X3DA 5D7LE 4JHBA 2R1XB 3T77B 1IAKA 5DVLA 4MCZA 1RHHB 3MLTB 4QRPE 5EZIL 1YN6A 2IFFL 3FB5A 4NNYA 2YKLL 1QFPA 4U1MB 4F7EB 3K4ZA 4WENB 1J0JA 1ACYH 3AREA 3SY0B 3KG5A 5ALBH 3HMXL 2I5YH 4H1LH 3MJ9L 3ZT5A 5E9DB 4OB5H 5JHDA 4RGMC 1S9XA 1A0QH 4JKMA 5I76B 4JANA 1SJXA 2P8MA 4YDLB 3GKWL 1GGCH 3QUMH 5EIVA 1NBYA 5ENWA 5FFLA 4M93B 3CDCA 4JCLA 5DUML 3V0WH 1TPXB 4ISVB 5DJ6A 2EDTA 2BOBA 2DKMA 3V5KA 1UZ6F 4TPRL 4OM1L 1DEEB 1F42A 5DD5H 1YQ2A 5ITBL 4MMXC 4HIHB 3MRHB 4LSDA 2AK4B 2ED7A 3STZB 2YPVH 3PUCA 1MFBL 1KYOJ 1EK3A 3MUJA 2IWGA 5C0AD 3VGGA 2R4RH 3IVKB 3QI9D 4TQEH 5C9JB 4XMKH 5TPWL 4ZXBC 1X6LA 4POYA 2Y1VA 3BRDA 3REVB 1FSKC 1ZS8B 5J1AB 4ZTPL 1XF1A 2GI7A 4C56D 2YWZA 4AYFA 2AXFB 3HNTH 3PV6B 1F3DJ 2C5DC 3H7LA 5CGMA 2RB8A 1LEGA 1FNEB 2YA0A 3TWCH 5F9WC 1U95B 3BISA 4NO3A 1QFHA 35C8H 5T1KA 3UC0H 2XA3A 5C6PB 2YWYA 3L5HA 5J56B 3BGAA 3QRGH 4JO4L 4DQOL 4HFWA 5HVWA 5IG7A 1A3QA 4LCYA 5FUOH 2B4CH 3KHOA 1J0ZA 3QDMA 4N8CH 4X6DB 4BFGA 5J3HD 5HYSG 5A2KH 3ULUL 1MCPL 3RWFA 3HFML 4OCYH 5E6ID 1FC1A 1I7RA 1DQML 3NFSL 5I18L 1CK0H 4AM0A 2AGJL 1DZBA 3VFVA 5C09A 3L9RB 3E0GA 3HAEA 4HS6A 4LPTA 3BEVA 3KPRB 3TNMA 2HKFL 2BFVH 2X89D 3EOAB 5B3JF 1J8HE 3V4UH 5D2LA 1U9KA 3T0EA 2UYLB 2VDLH 2GHWB 2IPUG 5GGQL 1D5ZB 5BOZG 4RIRB 4ZFZA 4M61B 1B4JL 3EOYG 5I2IB 1J87A 2D7TH 4G6AD 5ID0A 4RNRB 4Y2DB 5EA0H 3ZYIA 2LE9A 4Y4KD 5LG1A 3IDGB 3U9UA 5CIPB 3JWDL 4MD5B 3SDDD 4BZYA 5CP3H 3D87B 1RUQH 2I9TB 4ODHL 1IBGL 3VFNA 3RVVC 2A6JB 3GEWB 1T6WA 2D7NA 4POZD 1KCSL 3HZYB 2D9CA 4HS3A 1FZOA 3V6ZB 2EE9A 5I8KH 5K9JL 2E9WA 2Z35A 1R0AL 4LDEB 5DSCB 1S7XB 3HC3L 4WHDA 4TUKH 4KKBC 3FQWB 5BZDA 3R4DA 3DHMA 1IQDA 2XG5A 5EZJB 4XB8A 2I26N 4WW2C 1GZQB 1A1NA 3MRMA 5EIIA 3L5JA 1K3ZA 4L29B 1BIHA 3DVNB 4QHUB 2ADGA 5F9AC 1Z9OA 5DTFB 4HMEA 5MERB 1MJUL 5HVFB 1IGFL 2EDBA 4HH9A 4ZUSB 1QKZH 1G6RB 1GHFL 4I13B 4OLWL 1WC7A 3FRUB 1DBAL 4R26H 3BRFA 4GOSA 2XRAL 3HI6L 3O6KL 3S9DB 4XGZB 2NTSP 1I1AB 4G80B 4F80A 1ZTXH 3L6FB 4JFDE 3FO0L 1XF4A 4ETQB 5C0FA 2GEEA 4WGVB 4Y5VA 2O61B 5GPRA 4B7LA 5CS7A 4Q58C 4Z95L 3VFOB 4F9PC 1I3RA 4QOKB 2VE6A 3WD5H 1A9BB 1QNZL 1VERA 4JZJC 4YH6A 3WBDA 5DR5H 3O8XA 3K0WA 5F1NB 3S36L 1EEQA 3DVIA 4HUWA 3UTSB 2RR3A 4FXLA 3T0WA 3B43A 3TBWA 4JO1L 2O5YL 3FT2B 4GRLD 4HUUA 2HRPL 1JHTA 3RI5F 3LRSA 2XPGB 1X6NA 3VXMA 4M9OA 3BZFB 2VLKB 2ZSVB 4GAFB 1GGYA 2R56H 1ZAGA 4R97C 3RQ3A 1CFQA 1T0MA 1SEQH 4JO3L 2VLLB 3IJYA 4MXWL 3AUVA 5CLWA 2VC2H 4DOHE 2D31B 1DUZB 2IMNA 3W0WB 1I7UB 3O45B 5IVOA 3U0TA 1A22B 2VERN 5EO0A 5BO1L 1NAMH 3FB8A 2XTJC 3ISWA 1U8QB 1DQJA 1FP5A 4UQ2B 5DC9B 1HXMA 4GAGL 3TO4D 5J6GA 4C4KT 4P5TB 3NA4A 5IM7A 3HPJA 5DFTA 3C5SB 4PRIB 5KANG 5F9OH 3GUTB 2XTJE 5GRXG 3B2VH 2IQ9L 1JYWA 2DQDL 3O9WA 1XH3B 2AVGA 1D6EB 5DJZA 3TM6A 3GMNB 2HJFA 3MRIA 5JOPD 3W2DH 1EH9A 3QUYA 4RDQG 4OGYH 1CD1B 4P2OC 1LP9A 2R9HC 4WFHD 1A7NL 4Q2ZA 3D85A 2KL6A 4CMMA 1G7QA 3ULVD 5D9SB 1OTUD 4PJDF 5C0GB 5MEQB 3BXNA 2UV3A 1NFDE 5D7IA 5FYLH 2XNAB 1DR9A 4HK3N 4XNXL 2X4NA 4LDOB 1CI5A 4NKDA 2LTQB 1FVDB 4X0KA 2JJSA 3WL9A 2X1OA 2UZYB 4X9BA 5F1KC 2F54A 3BP5A 3CSPA 2J8UE 4MZ3A 4KDVA 3DXAB 1I9RH 3BPOB 1M1SA 1RFDH 2P8PB 4NM4L 3JTTA 4LLUB 4B53A 3IFPA 3MJ7B 4HHAB 2XG4A 4X9HA 4F8QA 3OAZK 3EKCA 1CFTB 1D9KC 4XNMB 1YNLL 4M5YH 1BZ7B 3NAAL 5HHNA 3GHBL 3I85A 3MO1A 3TA3A 4ONHB 5CEYB 4DW2L 1QFWL 2EO9A 1HQ4B 5EBLA 1NCTA 3MMEB 5IOPB 1T04B 2DQGL 1FAKT 3FRPA 3LKQA 4M6ML 1CDHA 1CFVL 3OKLB 3E8UH 4JRXA 4JKLA 2H8PB 4IDJH 4OM0H 3GMMA 5CEZL 2FATL 3ZTJH 4UNVA 2ADIB 1EFXB 5CFHA 2CR6A 4XNZB 4WI6A 1X5YA 4U1IA 5T3ZD 4YDLC 1P4IL 3T2QA 4UB0L 3OXRB 4P5MB 3TVMA 4QHNA 4KJQC 4U0RB 3I75B 1MCOL 4MAUH 1MCQA 2A0LC 2VB5A 4M93C 5I1IH 1TPXC 3MYJB 3UPAA 1T2XA 2CXGA 4JFZL 2MQCA 4ZFGL 1EMTH 3IDIB 5CAYB 1A6PA 1L0YA 1CD8A 2NTFA 2D2OA 1DUYA 2EICA 2V7HA 3DI2B 4NJAH 5B38B 5CD3B 1IVLA 1EJ6A 3RU8H 5JLZA 3O6ML 4ZTOH 5EUOB 1IM3A 4LHUA 4EZMA 4F7PB 3RZWA 3KPOA 4D2NA 1MAML 3FN9A 1N64H 3R0MA 2X4RB 1A6UH 5D93B 4Y7MA 4LLWB 3CC5A 2AK4E 3EJZC 4XMLH 2X42A 4J1UB 4DTGL 5ELIA 2OTUB 4KGJA 3GGWA 3SDXB 5C92A 4DGIH 3U2SA 4NO5B 1HH6A 1V7NH 5GJTL 5DMJB 32C2A 1MIEL 3EOTH 1A7BA 1PX3A 2NY1B 3EJJX 2W65B 5FB8B 4YBQD 3TCXA 3CSBA 3FONA 3QEGH 1BQHG 2W9LA 4ZUTA 5IBTH 1J05A 1H5BA 1IGYA 3RBSA 5E2VH 1NJ9B 5DT1L 2H2SC 3IFNH 1FCCA 3V0VA 3CMOH 4NQED 1QZ1A 1T2JA 2OZ4L 4D0DA 2XZZA 3C6LA 5F89B 3UTQA 1FVEB 1KCVL 1SYVA 2VLJD 2EIZA 4M7LH 2FSEA 4YWGL 3MLPA 4X6DE 4IS6A 5F7EL 3RTQB 4F37K 5ACZA 2OI9B 1QBLL 3VG0L 4BSVA 1TZHB 2AJ3B 4UZGA 4Z77A 5C0JA 1SY6L 3TESA 2CRYA 4K23H 3P0VH 1BZ9A 3GSUB 3HE7A 3A67H 4RGND 3X3FL 4DVRL 1FFNB 2VXQH 3CAFA 1P7QA 2WUCL 4ZUVA 4EI6A 5LJYH 2X44D 3CD4A 4FZEH 2OS7A 3VD7A 2MHAA 5JMOC 4PGEA 2VDQL 4N1HB 5MEOB 2RCSL 1CGSH 3KPRE 4Y2DC 5SX5K 4Z5RB 5SWSB 3OMZA 8FABB 4XVJL 5KSAA 2VISA 4NDMB 5T1LA 4CN6A 4EUPH 1UYWH 4LP4A 3S4SB 4PD4K 2IGFH 3TZVB 3KPPB 4M00A 1CGVA 4E9LA 1I9IH 4HW6A 5AUMB 4LVHB 1MRFH 1AQDA 1XGRB 5IGXH 3REWA 3O4LB 1PZUB 4NUGH 4QYOB 4Z7VA 4YUEH 1EO8L 2JB5L 3PJSB 3X11B 2CO7B 3PWUB 3U36B 2OTPA 1CR9L 3GJFA 3LSOB 3WJLA 4PRPB 1MFDL 1OCWH 4X7SH 5DJXB 1U6AH 5IR1B 3SJVE 4KH2A 4JQXA 4O9HH 4QCIA 1U8KB 1G7JA 3RWDA 1I4FA 1YECL 2J7LA 2CKBH 1TTUA 3IFLH 3AXLB 1FZMA 4X5XA 4ZO7A 4JO2L 1I1AC 2FLBT 4PS4H 5IB5B 3BH8B 1HDMA 1LK2A 4I0PA 4X7EC 3OKNA 2D0GA 3TIDA 2ZUWA 1MAJA 1JVKA 1R3JB 3CDGA 1JHLL 1JWUB 5I1JH 3VW3H 2ZNXA 5FF6A 5C08B 2WNGA 1T7WA 1JHKH 2AK1H 2YA2A 4M7KL 4QOKE 2X7LA 5GGRA 4P23A 4PTUB 5EZLA 5SV3A 1J1XL 4CKVX 2P5EA 3WCYA 1IKFL 3CLEH 3CPLA 4IM8A 4OT1L 1R3KA 3UTSE 3QDGD 3UTZB 3C5JB 4MJIE 3MRQA 5GZOD 2R69L 1NC2D 3KLAB 1DFBL 5E2JA 5I17A 1BIIB 5KN5A 4PP1D 2V2TB 3TO2A 2XOTA 4LSRH 3MUY1 4G7YH 1EO7A 4WO4B 4KI5F 4NM8L 3NZ8B 1FE8L 4YZFF 1T7ZA 5JIHA 3BQUD 2FX9L 4WFGE 3EO9H 4JFFD 1DQQA 3RIFK 2ED9A 5FCUL 2GJZB 1FNFA 3C60A 4PJGF 4U2YA 2W9EH 4P5TC 3BH9B 2Y07L 5TE7L 3VI3E 3W0WE 1U91A 1X5ZA 1KG0B 2A6IB 4J8RA 5DEFA 3CCHB 4R7DB 5IW3A 2P42B 1DVFD 4R2GD 2NX5D 1EGJA 1MQKL 3KHQA 2E7LC 5BW7C 4PRIE 4R0LB 1J18A 3OBAA 4N5EC 2ID5A 1VDGA 1TETL 3FO9B 4NQXA 1BVKB 4FQQB 1MFAH 1VFUA 1B9ZA 2H2PC 1MLBB 2NR6D 4Y1AD 4HUVA 3IDMA 4E5XA 5BOPA 4LLMA 3QUZA 5CJOL 1CL7I 3I9GL 3F6LA 3LHPH 1SJHB 5DZNA 4K7PL 4UTBL 3X13A 2ATKB 1DP0A 1T7VA 2LTQC 2VDPL 4NKMA 5IESL 4PJ9B 3BIKB 4J3SA 4DKFH 3KXFB 2ESVD 3PL6D 2OQJB 2VH5L 3O6LH 1VFOA 3BPOC 3L7FB 3PDOA 4NFDA 4OUUA 5L6YL 5DJ8B 3W9EA 1HSAB 1TVHB 4IOIA 1Y6MR 1ZWIB 5DJDA 3OJDA 1S8DA 1YY8B 1EBAA 1LE9A 2YHGA 3DXAE 4X5LA 3SKJL 3Q1SH 5KW9L 3EZ8A 2AQ2A 2B4CC 4PJ5D 3QHFH 1Y18A 4BQBA 2Q76A 2VLRA 3S35X 2XICA 4A6YH 4LARH 1HI6A 4JPVL 1N6QH 3B9VA 2PTUA 4H20H 1GGBH 1ZHBA 3ZDXF 5I1DB 5IB2B 3LZFH 1YEEL 4PG9B 1YEIH 5D6CB 3T2OA 25C8H 3EOBB 2CDFA 5FKAB 2GTWB 1P9MC 5FGRA 4BJLA 5DVMA 4XB7A 4URTB 4XNZC 2EDDA 1WWAX 3LN5B 4NYLA 3QHZH 1LHZA 2XYCA 1A6ZA 4HS8H 3ARQA 4EBQL 2Z92B 4U0RC 5F8RC 5LGHH 1OAQH 4XZUA 4ZAKB 4BK5A 5EOTB 3OGCA 3QO0B 3CFJB 4OAWA 3BE1H 2YD4A 2Q3ZA 3OAZH 4ODSL 3ZYZA 4EUPB 5LGJA 5FA4B 4AIXA 3VWJD 4MA8L 4XWGL 1JPGB 4AZ8A 1MUJA 1J5OH 3VJ6B 1NGWB 3BP4A 4U1KA 3DX9B 2IADB 5FA3A 2DD8L 1BQUA 5EU3B 3BPLB 1IC4H 3H7BA 2YUWA 5D93C 5JORA 1NGXB 4O5LL 3DUUA 4OZFA 3OQ3B 1RZ8A 5IVXF 4G8IA 4I0CC 1LDPH 4R8WH 5EUOE 3QB7C 2X5PA 5E6ZA 1D6VL 4CJ1A 4GW4A 3LH2L 2VDMH 1EEZB 3MJ8A 4RZCB 4Z7VF 3DGGA 4XPFH 3C5ZD 3FQXA 3VCLB 3N9GH 3VFSB 5IB3A 3ULUD 2P7TA 1HKFA 3RX8A 4KV5E 2NY1C 4FFYH 3DPBA 4PG2C 2C3GA 4WUKL 1KPRA 1Q9OB 2CKBB 3SDXE 4ZODA 1JPSL 2DRUA 4YHPB 4BKLA 3U0WH 3S37L 2PCPA 3ZE1F 2EZ0C 1F58H 2AQ1A 1T03L 4DAGH 1AGBA 4P2CG 1PQZB 4JY5H 4PTTA 2VZOA 3QEQD 4FTVE 2AKRA 4N68A 2EDRA 1QLFA 5DRWB 1WGOA 2CGRL 2EC9T 2X40A 3CVHL 1A7PH 3VXQA 3T4YB 1EA9C 2R23A 4GAYA 3RTQC 4NQDD 2WP3O 2OI9C 3MLXH 1BD2D 3RL2A 1PG7H 4HPYL 5JQ6L 4HZLB 1BHGA 4Q9RH 3CFDB 4KRPB 3B9AA 3DBXA 2BP3A 3QI9A 4C59B 4WI2A 1C08A 5IB1B 1PLGL 4O58H 4OD2A 1A3LH 2MOVA 4LGRB 5BV7H 1WBZA 1MHHA 3RUGB 3LRGA 4ZD3H 2PW1B 1RIUL 1OAYH 2IAMA 1NC4D 3G9VA 5DK0B 3P9LB 4C56A 5EO1A 4OLXH 4JM4L 1UVQB 1HNFA 1VKXA 3PV7A 3L3OA 1AFVL 4Y19E 1YMMB 5B39B 4WHCA 4NRZA 1IARB 2FX8H 3HHRB 4QRTB 2OJZH 4KVNL 2KPNA 3TBSB 3X12B 5SWSE 3TZVC 5AWNH 4JFPB 5EBWB 1C5DB 3MLZL 4LVHC 3PHOA 1RVFH 4HEME 3SO3C 3D25A 2H6PA 5F8QC 1DBBH 4CDHA 3DETC 2J3SA 5HGHB 1FFQA 3OZ9L 4G9FB 1WZ1H 4Z7WF 5ID1B 2EYRA 3BUTA 5I16A 1Q8MA 4U1GB 3O4LE 1YJDL 1C1EL 1UGNA 5K9KA 3M1BA 1KV3A 5E2TL 3WE6A 4N0YL 3SO5A 3IGAA 1F11A 5K9QG 2XZQH 4XPTL 1EJOH 4M62L 3CU1A 4PRPE 5SX5H 3I84A 3VGAB 1PZ5B 2ICWI 1KBGH 5TQ2H 3P0YH 4J7RA 2AS5M 3V4PH 5FYLE 4Y4KA 1D5BB 4LSPL 4JB9L 3WUWG 4P4RB 4LEOA 3SDDA 3VXRD 3WXVL 1EAPA 2QHRL 3UTTD 5BXFB 4JN2B 3SBWA 5IK3B 2XQYG 5IWLA 4P57A 4R4NC 4UT6L 1AHWB 5E8NA 2X9WA 5HHMB 4UBDC 7FABH 4ZO9A 1HK6A 4U05A 4HCRA 2VXSH 2R15A 4A6YB 5E0QA 5FYKD 2PYFB 3KR3L 1RZKH 1IGCH 5I1HH 4Q9QL 2BSED 5GRVL 1RZIA 4JZNA 5FYJU 3DVGA 4MQ7B 4WO4C 1CZ8H 5D8JH 3ECBB 4QXUH 5ALCH 4OZHA 4YDKH 4PGDB 5T5FL 1YC8A 2BCKA 3A6CL 3NFPA 3SCMB 3KNBA 4XI5C 4RMRA 3KYNA 5J06A 2H1PH 5J13B 4Z7UB 1A4KA 2WLYA 5JXED 2IALA 2P49B 3QIWD 3ZE2E 5DD1L 2OX5A 1RK1A 2VABB 4MMZC 3LPWA 4XCFL 4LCWB 3RNQB 1DANU 2R4SL 3BP6B 1WTLA 4FZ8L 4LCCB 5T3XH 2ARJA 3TGXA 4R0LC 1QSFE 1F4XH 4EDWH 3L7EA 3QFJB 1RUAL 1OD9A 4L5FH 4GRLA 4ZPVB 3NA9H 2XA8H 3VXNA 4N8VB 2GY7B 3KLHC 4YO0A 3L3KB 2BNQE 5EZOH 2BSRB 1KEMH 1QLEL 3E6HB 1F2XK 1FL3A 1RIVL 1JWMB 3VFWB 5DRNA 4R96B 2AQ3A 1XR8A 5D7JD 5DHYA 3V5HB 1NGZA 1EXUA 4JQIH 3WXWH 4PJ9C 3PWJA 2GT9A 3R8BB 1MVUB 1T20A 3HN3A 1OAUL 1CD9B 1GGIL 4KAQH 5EOCL 3RGVD 2XN9D 1OTSD 1AY1L 2WWKT 2WIIB 3QJFB 4OF0A 4LP5A 5GS0H 5DMIH 4HF5H 1WCBB 3TO4A 3KXFE 1K4DA 3PHQB 5L2KD 5BMFH 5KSVA 5CEZD 2MKLC 1I8KA 2ZJSH 4X98B 3RWGA 2R8SL 3MNWA 4NGHL 4XBGA 4JM2F 4U1NA 3SE8H 1K8IB 2DWDB 2HYMA 1JRHI 1ZGLA 3ZMRA 1JZ4A 1E4XH 5IQ9B 3EDEA 1AIFA 4X6BB 4GXUM 4NRXB 4OQTL 3VD3A 4AH2A 4P4KD 4GKNA 3V5DB 1AXSB 1MFCH 1TVDA 3B83A 5DJYA 4IEFB 1KNOB 2F53D 3O2VH 5I1KH 5KVDH 3FT4A 4O4YL 5ETUB 4BH8A 5T1MA 1G9NH 3RWJB 4XVUC 1EHLL 1RZ7L 2E6JA 1EVTC 2AEQL 1E6JH 4HT1H 5HHXH 4ZAKC 5TE4H 4TVPL 4NN6B 5DMGD 2GITA 2ZSWB 3RVWC 3GZKA 3P77B 1U41A 3BD5A 2ZKHH 2JK5B 5D71H 4X6FA 4U1JA 3D9AH 3FB7A 4AENA 3LEVL 4XAKE 3IB4A 1BX2A 1IE5A 2HKHL 5ANMB 3P73A 4XXDB 1CDYA 3VH8A 4X7CC 5SX4I 1Q0YL 4NO0B 4WHTA 5C0BB 1CXKA 1YEGL 1BJ1H 4EI5B 1VCAA 3FT3B 3BPLC 3VFPA 4ODBD 2NXYB 4XCNA 3JV4A 4W4OA 1ZKAA 4Y4HD 3IKCB 5FGSA 2BNUB 3VXUD 4XH2A 3MQIA 3IDJA 3SPVA 1BQLH 2AEPL 4PJAB 2P43B 3MV11 5C07B 4LCIL 4MVBD 5DDHB 2GFBB 2VKXA 3U1SL 1G7MB 5D1ZD 1F6AA 1CL7L 3TPUA 3QZWB 4MDIA 1RMFH 2W60B 4Z7NF 5L7XL 2EH8H 2Z8VC 2YZ8A 4PB9L 4HJGB 3UJIH 5CP7B 3VFUA 5IMOB 4NZTL 4L4VD 4RX4D 2NXZD 3LQAH 3DRTA 3NIGF 4HIEA 1DEDA 1WWCA 4LKCB 5I1GL 3PWLA 1PKQA 2MCPL 4HGMA 3ETBF 4PRNA 4PRBA 1C7SA 1CLYH 2H3NB 3ZO0A 1AGCB 5GGSB 4YHLL 1FORL 2I07B 1A4JA 2P8LB 4JDZB 3FFCB 5TJWK 4U3CA 5GGVL 4RA0C 2YSSB 5DUPL 1ZEAH 4J3WA 3SGKC 4MD4B 5E4EB 4Q97A 3OR7A 2IG2H 4MQXC 2BSSB 3MLUH 1HEZA 4BQ9A 3BZ4B 4M7JH 3V95A 4BSWA 4KRPC 1SQ2N 4YXKL 5HI3D 4QNPE 3MA9H 3S6CA 5DD3H 5CJXA 1K85A 5A40E 5L88L 1C16B 2HJKB 3FQRB 1MLCB 3TBVB 1MCFA 4FQCH 5TQ0L 4IRJB 4HBCH 5DJCB 1K6QL 1ZV5A 3L1OL 4H26B 3RUGE 1S7SB 4DGYL 2NZ9C 4OZHF 3L95B 5IEHB 1TLKA 3IXTB 4I4WB 1YMME 2GK0B 3DO7B 3UTOA 2R1YA 2PO6B 5LQBH 3OKKB 2ITCB 4LVEA 5JO5B 4LAJH 3VXSD 3ARFB 4NQEA 1HHJB 5KSUA 4QHMA 1OLLA 1U8MB 2CLRA 3IYLW 1UH4A 5AEAA 2PYEE 1MREH 3RIAF 4PJ7B 2GQHA 5E8EA 1YEHL 3DMMB 3PWPD 3RVTC 5AD0B 4JFOA 1GH7A 4G3YL 4N1EA 3IAQA 4ZDHB 4K3DL 3VGAC 2KDGA 1N7MH 1SM3H 3Q5OA 1YQVL 3VWKB 4R4BA 5BCAA 5E2UL 4H25B 3MV8B 4KWUA 2YPKB 3KLSA 5EU7C 3VDCA 1EZVX 2FH6A 3KYMB 5CMAB 1A6WH 4U31A 1I7TB 1F5WA 2VSCA 3Q48A 4YC2B 4RFEB 3VXOB 1S7VB 5EU7E 1N0XL 2CK0L 5DMYA 1AHWC 1H3WM 2OCFD 1QEWA 2CIKB 1RZGA 5HYSA 4I48B 5KVEL 4CRPA 1EHAA 1YPZA 1TTGA 2EXWD 1MRDH 2YN5A 1FG9C 4LRIC 5DZLA 3MR9A 1CFSB 3B9KD 5HHME 3MNZA 1T7XA 1VADA 2NY4B 3PABA 2FJHB 5H37H 3Q6GH 5DLMH 1ADQL 4KI1A 1CBVL 3GJFK 2EO1A 5EU4B 3WFDH 5EU5A 3G5YB 3SCMC 4TNVF 5I1EH 4AEFA 3MV9D 5JPNA 4UINH 5J13C 3DIFB 3RVUD 2DS4A 3ARGD 2Q8BL 4EIGB 4QWWC 4TYUA 4HKBA 3FOMA 3VXTB 2HAZA 4YDJB 2DTML 1NDMA 4Y16D 3W39B 1X5IA 6FABH 1B4RA 1F3JA 5FDYA 1TVBB 1T22B 2P44B 3ZTNH 4ZOCA 1RULL 1A5FH 1RURL 4LCCC 1FFPB 1RJYA 2R2HA 4OLVH 2P5WB 5E5UB 4I5BB 4KROD 3BMVA 4LCWE 4FABH 3MXVL 3EW3B 2X4PA 3DX7B 4U6TA 4NKOA 3QUKB 3G6JF 3ALPA 1K2DA 5DA0B 2JJTC 4O51B 3CSYA 5EPMB 4LQ1A 4OLZH 1YA5A 5IBUB 2IPTH 2BNRB 2Q6WB 5TE6L 1J0YA 5SX4H 5ADPH 2AXHA 4DUWA 4JFEA 4QRUA 3MV7E 3RDTD 1NC2A 4S2SB 5IEKB 3C2AH 2CJUH 2FX7L 4UOW1 1P1ZA 4UMGA 3Q5YA 3WFHA 3WNLA 1ETZA 5IFHL 1A0QL 3LN9A 1CDBA 3QCVH 1NMBH 3I6LD 4HWBA 1G9MH 1LO4H 2Z91B 5HJ3A 2DL9A 5BVJA 4XCYB 4BH7A 3BQUA 3SDCB 5FOJA 1JYNA 3TCLB 4JFFA 1ZA3A 2V2WA 4NO2B 5GSVA 1HCVA 3M17B 3DV4B 5FYKU 5M95B 2QADB 4H88H 3VFGL 3MJ6A 2VN4A 2W0LA 1XZ0B 5F7NC 2V7NA 1XAUA 3HNVH 5EIQA 4PUBH 3MX0A 5GS1A 4OLUL 1VEOA 4KK5D 1DVFA 2F58H 1QOKA 2NX5A 3VRIB 4U49A 4G8FA 1U92A 4D9RD 4RAVB 3QR2A 1KTLA 1JNLH 3ZL4H 4CBPA 1GPOH 2A6DB 1H3GA 1CCZA 4OFKA 5IFAL 1TENA 4U7SA 1B6DA 5I8OL 4NZUH 4HDIB 3WFZA 1JZ3A 2DM2A 3QNZB 1H8NA 1IAKB 1FNGA 3I6GA 4YE4H 5C3LD 4Y1AA 3AY4C 4PJBE 4BFBD 3FB5B 2EXYC 4NNYB 2ZCHL 4M43L 5LCVL 5BVPH 4HGKC 4S0SD 5J4MA 2HA1A 2X4QA 3CVIL 1KCRL 3T4AB 1ZMYA 2ESVA 1L6ZA 1YZZA 1BFOA 2AJSL 2VXTH 3ARZA 4NN6C 4GAJL 3IU4L 3PL6A 4FQXD 3FN3A 1S9XB 1A7QH 2QSQA 1FPTH 4YX2L 4W6WB 5E08H 3HMXA 5EN2A 1JTOA 4M6NL 1BLNA 3OAUL 1TZGH 1LEKB 2EDXA 3G08B 3MJ9A 3MLYH 4R6UA 1YYLL 3PXJA 3OPZL 2WBJD 1NBYB 2VR9A 4ODVL 3MBXL 4KKLC 5ENWB 3JWOH 4K3JL 4NJ9H 4PJ5A 1Q94A 3MXWH 4EI5C 1PYWA 1S78C 2BC4B 2CMRH 4KJWC 4LDLB 4OD1L 5ANME 3LS4H 2NXYC 4KK9C 4R4FL 5TDNB 1JFQH 4FN0A 3V7AG 3QIBD 3UPRA 5C0BE 1J8KA 4UT9L 3B5GA 2HT4C 3O11A 2NY2D 4J12A 2CIIA 2ORBH 4GKSA 1MI5A 2JCCE 5I15L 5ESAB 2BVQA 4V1DB 1WLHA 3HRPA 5I19H 2FRGP 2BDNL 2KBGA 1JPFA 4UDTA 4S1QH 2UWEF 2EH7L 1S9VA 2FO4B 3GMQB 1Z6JT 5D7SH 4PJAE 4X6CA 4FHBD 1WBYA 5C07E 3DRQA 3MACL 5I66B 5HGAA 3U46A 4O02L 1QHOA 4MJ2A 2FJFA 3PGDB 1LEGB 1NCBL 1TTFA 2P1YA 2UY7A 4NO3B 2D9QB 5CKGA 8CGTA 5T1KB 4QTIH 5D1QD 5I73B 4R9HA 1FIGL 1NUFA 3IU3A 5E4EC 2A1WL 5E99L 4AL8H 2FBJL 1JRHL 4LQFH 1AJ7L 4M6OL 3FFCE 3TBYB 3RKDC 1HILA 4WEBL 4DEPB 2FL5A 3MBEC 2ZG2A 1I8IB 1RZKC 4JDTL 2BY3A 4LSTL 1ZA6A 5IVZA 4EIZC 1I7RB 3RGHA 1J8HD 5HPOA 2BRRH 2W0KA 3K7UA 3MOBL 4YPGA 5CZVH 5C09B 1E27A 4C54A 3C5ZA 5KAQG 4HS6B 3WFBL 4IRJC 4JKPL 5TDOA 3LMJH 1PG7X 1HHHA 2I60H 3P4LA 3WUZA 4PLNC 1XGYL 2XIDA 2ZCKH 1UXSA 4IHOA 4ZFZB 5IQ7H 3BX7C 3VDBA 2OP4L 4W4NA 5ID0B 4ODUA 5F7UA 2V17L 3B8SA 5F7YC 4U6VL 3NIFF 4LPCA 3QEQA 4IMLA 3ARFC 4FQ1L 2NY5C 5FV1L 2NY3D 3QEUA 3FHAA 3RVVD 3VFNB 5DWUL 4HS3B 1FZOB 1HQRA 3INUL 2XQBH 5HYJD 3Q5TA 4DKEL 1GC1L 3FMGL 4KMTH 4NQDA 5T3XE 4BQ6A 3DMMC 5FO9A 1BD2A 1HH9B 2VZ3A 5CJ8A 1AE6L 1IQDB 5GZNC 2E7MA 3LV3A 3WIFA 3O3BA 2VL4A 4PJ7E 2C4FU 4F7TB 3MRMB 3GFUA 3NABH 4PR5B 2QTEA 4WUUB 1BGXH 3VWKC 4HFUH 5ESQA 4I18B 1GIGH 3SGJC 3SKMA 1NC4A 3KPNB 4WFFD 1AGEA 3U9PL 1WC7B 1BQHA 2DOCA 4TRPL 1Z5LB 1WF5A 3RAJH 3G04B 5GS0C 5E00A 4YC2C 4JHWH 4FQPA 2EYTB 3OKOA 4NN5B 4FMFA 2HG5A 4CW1A 4KJPD 1F90H 1XF4B 5FOBB 4P3CL 5C0FB 3TJEL 1UZ8B 2G60L 4WY7H 4D3CL 2YD3A 3RY5A 3FHQA 4Q6IA 2P24A 2EKSA 1K5NA 3QG6A 5EULV 4HUWB 4MNQB 3TBWB 3MRJA 2NY4C 5JIIA 2V9TA 1Q72L 3BPNB 4HUUB 3QWOA 1DQLL 4JPKH 3IFOB 1JHTB 2V6HA 3LRSB 4WDIA 2LV4A 2C9AA 1FLTX 2DWEB 4XP6L 1CYGA 1QYGL 1S5HA 2ZOKA 3GBML 1G9NC 2N4IA 3IJYB 4P3DA 3MRPA 5I30H 3L3JA 1FFOA 1R3HA 4OD3H 5I75B 2I24N 4PBXA 3SGDI 1HYSC 1G84A 4TULH 1C12B 4XWOC 2Q86B 2DL2A 2DQTL 5DYOA 1OGAD 3U0TB 5H35B 5EO0B 2XTJD 3ZKXB 3UBXB 4M3KB 3FB8B 1DQJB 1HXMB 4LASL 4HK3J 2VN7A 3K4AA 4HUXA 3WS3A 5BZWA 5DK2A 4U1SA 5IM7B 4OZIA 1QSEB 1EAJA 2AJVL 2BVYA 2XWJB 3K46A 2P5WE 3OTTA 3P9MA 5GGTL 5JA8B 5ABDE 1EDQA 3O9WB 2WQRA 4Y5YA 3MGTB 1FNSL 4JQVA 5E8PB 5BRZE 5F7KC 1GRWA 2HJFB 4IRZL 3GJFH 2XWBA 3QUYB 4NOBA 5AYUH 3PP4H 3NACL 2BNRE 5HYEA 4PJXA 4Q2ZB 3D85B 3V6FA 4CMMB 4RDQF 3GSRB 4OZ4A 3VD9A 1NCAH 5D7KD 2DLGA 3SDCC 2P45B 2A9MH 1AC0A 1BFVL 2DLFH 2X4NB 3OKYA 2QADC 5JXEA 1T2QL 2ATPA 5DJ0A 4NKDB 3QO1B 3WL9B 1MCWW 3MLSH 3QIWA 4QGYA 1BECA 1BAFH 1BJMA 4AMKH 1NDGA 5FM4A 5DQ9A 1WT5C 4XP1H 4KK8D 2C3HA 4QRSA 4WHYG 3D48R 1CICD 1DSFL 3JTTB 3RIAK 2FR4A 1OLZA 2Z0BA 3U0PA 2Z31D 3C08H 4GW5A 1U8OA 2VIRB 3MRNB 4C83B 1D9KD 1SVZA 5HHVH 1RZJH 1WZLA 4NCC2 4PJFF 1G7IA 4I9WE 5B38G 1V7ML 3MO1B 2XV6B 3EOTL 4QHKJ 1KELL 3M8OL 1QBML 2PXYB 5D7JA 1FZJB 1GL4B 2BHZA 3LVEA 3KWWA 5EBLB 4R3SA 1UM5H 3AREC 4W6YB 3KYOB 4PJGB 3KDMA 3V4VH 1OSZA 4U6XB 4PGBB 4JRXB 1HIMH 5E9DD 1OGTB 1JYVA 3F7YA 3RGVA 2XN9A 3FQUB 5ILTH 2C1PA 2DQHH 4F57H 5I8CA 4GO6B 4MB5A 3HAEG 4U1IB 2UVFA 1CDIA 5L2KA 1WIOA 4L3CA 1KLUA 3TVMB 1RJZB 3TT1L 2X1QA 3GJEA 4YFLI 2DQUL 1UWGH 1WQVT 1VFMA 3QQ9D 1KC5L 4GKZA 4XAWL 1T5XA 5D6DA 3MRLA 1EGJH 5GS2H 4RMSA 5HHOA 1LD9A 1O5DT 4MLSA 1MCEA 1Q0XL 2V2XA 2Z4QA 5CKAA 2NTFB 1V3KA 1ZLUK 3RZCD 4MGXA 2V7HB 4TNVK 1F2QA 4P4KA 3WFEL 1YN7B 4Z0XA 3RWHA 3PP3K 1JI2A 2GAZB 1TCMA 3KPOB 3ARWA 1FBIH 4K8RH 1AXTL 1OAKL 4Z6AT 1XGTA 2F53A 1ZT4A 1KENH 3CC5B 5FAAA 1FIEA 2FH8A 3K81A 4HXBH 1YEKH 3GGWB 1FRGH 4NRYB 4HH8A 3ZT6A 2BK8A 3MLWH 4LCUA 4V1DE 4X7FC 1ORSB 3U2SB 2VQUA 1HH6B 3JVGC 2GCYA 2DKUA 2D03L 3TP4A 4M5ZL 4XPHH 5I73C 4HWEL 4LF3A 1CE6A 4WI3A 5FM8A 4PJHA 3BSZL 1J05B 1H5BB 3GHEH 4QTHA 5HDQL 2H2SD 4UIKL 4JGMA 3V0VB 5JTWA 3NH7L 5KOMC 2ICES 1JGLL 1UCBL 2ERJB 1QFOA 3G6DH 4Y4HA 3EYSL 4NHCH 4D0DB 3C6LB 1DBKL 1NAKH 1YNKH 2XKSA 3BN9C 4DEPC 1SYVB 3VXUA 3QDME 1ZHLA 2EIZB 3FOLB 3TV3L 3G5XA 2Z9TA 4IS6B 5DMKA 4LIQL 5ACZB 3SDYL 2DQEL 1OSPH 2W9DL 3KPQB 4ZMAT 2EIEA 4FQJL 1UXWB 5D1ZA 3J7HA 3OXSB 1OARL 3ARDD 5C09E 5KS9F 2Y5EA 2LU3A 4PBWD 4L4VA 4JFQA 4RX4A 4K3HA 3LY6A 3U7WH 5L2JA 4U7MA 4XT1C 3JTSA 4ODXA 5KSAB 4YHKL 5T1LB 1B0GA 3IF1A 3SQOH 4IRSB 1UM6H 4N0FA 5A3ID 3D18B 3G5ZA 3LEYL 4UI2A 3SGDH 4BM7A 3VI3F 1KJVB 2AJUL 4F33A 5HGDB 3DYMA 3STBA 1NBZB 3REWB 4V2BA 3HUJA 5IBLD 2X4TA 4CVZA 2P47B 1XGQA 4Z7VB 1GOFA 3GNMH 1D5IL 2R0WL 5B8CA 3IKKA 4OZFH 1IC7H 1FYTB 2E8ZA 3GJFB 5AAWA 2BSTA 4I18C 4WI5A 5MI0B 1KULA 4BZ2L 3J8F7 3MCKA 1KJMA 3PDGA 4QCIB 1G7JB 4CNIA 3RWIA 3BOVA 3IAPA 1DBMH 2HN7A 4M7ZB 4U6YA 3FAXA 1AO7D 2ENSA 5CUSH 4AG4L 5JIPA 1AKJD 4X5XB 4O2FA 4NN5C 3VXPB 1D5XA 1UB6B 1SJEA 4I0PB 1A1OA 1CVRA 1T1WA 3OKNB 4TVSa 5F70A 3VFTA 4G9DA 4QOKD 4I3RH 2QQKL 5AZ2H 3CDGB 3UYOD 1P6FA 3TC9A 1SBSL 3VXSA 4HC1L 2C1OA 1UJ3A 1IL1A 1JGVL 2JTDA 2PF6A 2X7LB 5GGRB 5EZLB 4GBXB 3BPNC 3RPIA 4CVXA 2VMFA 5A1AA 3CPLB 1S3KH 1R3KB 1NCUA 3O3EA 4MNQE 5J6HA 2WWMC 2VLKD 3PWPA 3C09B 3ILQD 4LSSH 4XTRD 5CGYC 4EN3D 2LU7A 4E41B 3O2DL 5E8OB 2RFXA 2FCBA 3BWAA 5I17B 5KN5B 1OT2A 3QH3A 4YHMH 4JN1L 3KPLA 5CHNA 1I7ZB 1MEXH 4HJ0D 3FO2B 4H0GA 5I75C 12E8H 4NP4L 1TZIB 2HT2D 3MFFB 2C3WA 3FRPG 1MJ8L 3KYKL 5LXGL 5IF0A 3MPCA 3ZKXC 4NN7B 1ZVHA 4OZGA 2CXKA 3C60B 4MX7A 4MNGB 4Z7WB 4XC1H 2CO6B 4WWKD 4J8RB 3JWOC 1AR1C 5DEFB 1KF9B 3PWNB 1FYHB 1AD0B 3O9WC 5D96B 1AP2B 4QRQB 4XC3L 3D69B 5HHQA 5GSRA 1QSEE 3AS3A 1I3GH 3B9KA 5AZEL 2DQCH 3QUYC 3T2NH 1HOCB 6CGTA 3I3EA 5IMKA 4NQXB 4S1RH 1YDPA 2HTKD 4NWTL 3DI3B 1KT2A 4NNXA 3IDMB 4E5XB 4HUVB 3SOBH 4X7TA 3L3IA 3ZT7A 5F6IB 1B3JA 4K07A 1R3LB 4MS8D 3MV9A 4LLMB 5GRUH 5DRXB 1WAAA 2YMXL 2IPUK 3X13B 3ARGA 4MLIA 4KRMB 3ARXA 1NMAL 2R0KH 2W07A 4XPGL 1PY4A 3WUWA 4MA7L 2NZIA 2VDRL 4FFVC 1NCCL 4KV5F 3PDOB 3BDYL 1UH3A 2NLJB 3AAZB 2YPLA 1K8DA 3HZKB 3W9EB 4UV4H 4ERSH 4PRHD 4DCQB 1FLRL 2BHYA 3CXDL 4EUPG 1LE9B 1D7FA 4X9FA 3GM8A 4HWUA 3IETA 3NCJH 4XP5H 2F5AH 4IOFC 2Q76B 1UH2A 3I3BA 4KI5C 3SEPA 4HCRH 3TA3C 2VLRB 4PJHF 3WSQL 4YQXH 5EWIH 3EAKA 4TSBH 1TJHL 4YGVA 4OTXH 3RDTA 1HI6B 1P5UA 2PXYC 1JV5A 5FDWA 4GFTB 1IGJA 4KI5E 4X6EB 2APWA 3TT3H 1MIMH 5F7MC 5CCKL 1N4XH 4OSUH 3BRGC 5ADOH 1CXFA 1A7RH 5CSZA 2X9YA 4FQHA 2VZ1A 1JWSA 4PJGE 4NYLB 2VXVL 1A6ZB 1R5VA 4JRXE 2FECI 3TVMC 5D5MA 1S5IL 3MRCA 3D0LA 1AC6A 4PB0L 1ZHKB 1XCTA 3OGCB 5JOFA 2OYPA 1BOGA 2ZPKH 4CN1A 2A74A 1ZHNA 1MCDA 5LGJB 1HKLL 3H9SB 5D2NB 1DQDL 3ROLB 1T4KB 2GSGA 5IHBA 4WEMB 4PLKC 3N1FC 4NT6B 4GJTB 1MUJB 1N2RA 4HUKB 1OPGL 5K33A 3CU7A 1A64A 3MROA 1UKSA 3ZYJA 4YDVA 5CD5D 5H2BB 5JORB 3RWEB 4GRMA 4MSWB 3T0AA 3L5WB 4S1DC 1VGEH 1OM3H 2CDEA 4APQD 2NY0D 2OL3A 3B3IB 4GW4B 4YBLB 1JZ6A 1WBXA 3FQXB 1RUKH 5IB3B 3VU2A 2P7TB 5FM5O 3QEHA 4PY8J 4FQXA 1OAXL 1KPRB 1OW0A 4JM2B 1F4WH 5FECA 4QXTA 4XHJC 3IT8D 1MFEL 2B1AH 3MOAH 5MEPA 5F9JB 3MZTA 5HDLA 2BERA 2NNAB 1H5BC 2WBJA 1KFAH 3FCTA 2YD2A 1HSBA 3Q6FA 2ZCLL 4KK6D 3HR5A 4TSAL 1AGBB 4FQIH 2AXJA 1ZLUH 4F3FB 4UT7L 2ERJC 3STLA 3C9NA 3C6LC 5GJSL 3QIBA 5DHVA 4P99A 3PP3H 3VXQB 3F5WA 1MCSA 3L3HA 2YOCA 2DQFA 2R23B 3DX6B 4GAYB 4J6RH 3ZYOA 3ULVH 3V6BR 1ACZA 1MJ7H 2AV7A 3SQBA 5C0AB 4JDVA 3BAEL 3GIVB 3RY6A 3HE7C 2VTFA 3QI9B 1JGDA 4AJ0A 1A9EA 4ZXBA 1NPUA 3V6OA 5LWYH 2Y9RT 1MHHB 4ZFOA 1R6VA 3QQ3A 1CGUA 5CJBA 5SWSD 2E9BA 4G8EA 4C56B 3LS5H 5MHSE 3KS0H 2IQAA 4J3TA 5KSAC 4YGAB 4FOMA 1JPTH 4NRZB 4IRSC 4LSQH 3TZVD 4TSCL 4ZSOA 5D1QA 2HLAA 4X5WA 3U79A 1DL7H 3ZE2F 4NBXB 1NGYA 3A6BL 1C5BH 3D25B 1GCFA 1U8LB 4XCCL 2H6PB 1T0NA 2EEDA 4CN4A 4OZGF 1DJSA 2EC8A 5B22A 3TYGH 2C4XA 1L0QA 3UYRH 2EYRB 1NEUA 1LE5A 5E6IB 2BVPA 4Z7VE 4N0UA 4PRPD 5MI0C 1J8HA 3BDXA 1ITCA 1QP1A 3VXMD 5EOQL 4RFOL 3UMTA 3WE6B 4P5KB 4JQXC 1KXVC 3IGAB 1F11B 4GT7A 1FYTE 4LNRA 4QEGA 4W81A 4M7ZC 1VEPA 1VPOH 1BWWA 2HTLD 4OJFL 5T3ZH 3VMNA 5DD6B 4PRAA 4MJ5B 2NY5L 3OHXA 4I0PC 3JXAA 1G9EA 4H5SA 2QSCH 4N9OB 3GRWA 1KIQB 1BBDH 2F74B 2YEZB 1N3NB 4XBEH 5JXAL 3UAJC 3T0BA 2BY0A 1WEJH 2Y36L 5C08D 3SKNB 4LEOB 2Q7NA 3QULB 3SDDB 1EAPB 4KVCL 1G7HA 1CIDA 4P57B 3SGEH 4GBXC 1CLOH 5HYJA 2R29H 2VDNH 1RZJC 3BYYA 3MRDB 3C09C 1RUPH 1JNHA 1GAFL 3GBLA 5JW4M 4NKIH 3QG7H 3NCYS 1UACH 3ZSSA 5JW4Q 2GIYA 4PREB 4JZNB 3DVGB 2DI8A 1W72B 5MENB 4HF5L 4ONOA 2Z8RA 15C8H 3OR6A 4OZHB 4GXVH 2V9QA 1G0DA 5CLTA 3NFPB 4XI5D 4ELMA 4YEEA 3QP3A 4NN7C 3C60C 3D3VB 4NCDA 5ICZB 2IALB 2DJUA 2VDKH 2DM4A 2K7QA 4NZJA 2VITA 2F54D 4F9PA 4X4ZA 3QXWA 5CBAA 2KUTA 2D4DA 1N59B 3BKJL 4JZJA 1F8TL 5D96C 4MNGE 5J9PA 2ICEA 2PKDA 5C0RL 4Z7WE 2ARJB 1FDLH 2VOTA 2Y5TA 1PY9A 2CLVA 4KKCD 1P4BL 3JV5A 5I1LB 3MA7B 3L7EB 1KB5L 2BOCB 4KQ4H 1UCTA 3QPXL 3VXNB 3ZE0E 3HCVB 4YO0B 3BO8B 3T3PF 1UEYA 4K8RC 1EERB 5F6IC 3GSQB 4DJMA 3RWCA 4M8VA 4NQCD 1FGNH 1XR8B 2E27H 5DHYB 4HXAL 3KJ4B 1GXEA 2XZAL 1KJ2H 4PJ9D 2QQNL 2XZCH 3PWJB 4PJCA 3KXFD 5IMLA 3CFCL 1T20B 2VQ1A 5E4IA 4EVNA 1YUHB 4IDLA 2WINA 4XP9L 3RNKA 2RBLA 1OGAA 1J1PL 4NBZB 5DURD 5KSVB 5LBSH 2RAMA 1XR9B 1H15B 5FO7A 4LOUC 1I8KB 5EU6B 1D5MA 5C2BH 3MCLH 3GMPA 5C6TH 3SE9L 3CLFL 5JW4R 1DLHA 4GQ9H 5A2JH 5IHUH 4DGVL 2X10A 3P30L 3MLVH 4OIIL 1T89C 2R0LH 3HRZA 1NFDA 5CINL 4AH2B 2FD6H 2E9IA 4GUPA 3U30B 1ONQA 1XCQB 2VLRE 3IDYB 5SV4A 2VAAB 1OP9A 3GMLB 5KVGL 2DDQL 3HI5L 2FEEL 4L4JA 3JV6A 4NHUA 3FT4B 4OQTA 1RU9H 3VDAA 4PJEF 4QNPF 5T1MB 3LKSA 3QNYA 4XX1E 2JIXB 4ZAKD 1L7TL 2C4FT 2BZDA 1RJLB 5DQJB 1ND0A 5JW5A 3G6JB 2OLDA 3CZFA 4JLRA 3RPKA 2ENYA 2B39A 4X6FB 5ITFA 1IRAY 4YEFA 5D2NC 1CICA 2A83A 1BX2B 4L3AA 2XXMB 3MODH 2Z31A 2LFGA 5E94A 2RGSA 4WHTB 5JR1L 1D9KA 3GMOA 2E7HA 4AEHL 2O5XL 3H9SE 5D2NE 2EE3A 1T1YB 4XCNB 3MLTA 3JV4B 1NGQL 3HLAA 3PHSA 4MYWB 3ZKMC 4XH2B 3IDJB 2O5ZL 3SPVB 3SY0A 3DSNA 4YBLC 4LU5H 1NEZG 4HWBH 5C0DB 3U4BH 2J88L 1TJGL 5E9DA 5F9DC 1H3PH 3KLDA 2DBJA 3V7MA 4XVSL 1LO0H 4HKZA 1UWEH 1GGTA 3V9FA 4JM2C 3VFUB 4ODWA 3BUYB 5TDPA 2BJML 4YXHH 4JFHD 1JGUL 4WTXA 3RVXC 4ISVA 4FG6C 3PWLB 1PKQB 2XXCB 3QXDA 4X80H 4M48L 3RA7H 2H26A 5DVKA 1A4JB 1DEEA 1S9YB 4HPOL 1MJJB 2YS4A 3WIIH 3C8KB 4KZDH 3MRHA 3I2CH 4Z8FL 1K4CA 2CLZB 2XFXA 2XKUA 5EORL 4MQXD 1KACB 2FB4L 4LKXB 5GRZA 3RX5A 4XBPB 4BSWB 3IVKA 3QI9C 1INEH 1IGIH 5C0CB 5IFJB 1IEHA 5D72L 3REVA 1ZS8A 2G75B 4U6HB 4BFEA 1OTTC 4M6AA 2NY6D 3TPKA 2ZNWA 5EZIH 3HI1A 4XNYL 5C0AE 4BQCA 2IFFH 4N0RA 4H8WL 2FGWL 2YKLH 3HMWH 1K3IA 4B7IA 2QJDA 1U95A 3HMXH 2NZ9D 5E8DL 3MJ9H 4C56E 1C8PA 1X5FA 5HD8D 3ORJA 1DLFL 2PNDA 4ELMF 4RWYL 1S7TA 1CDCA 3MTRA 1G7LA 1A14H 3GKWH 1FO0L 4OCMC 2R1YB 4Y2OA 4X6DA 2CRZA 2NY7L 3WYRA 4G9FD 3NBNA 5CILL 5J3HC 4FNLL 4U1HB 5DUMH 2CLRB 2VLJB 2UWEB 2UY6A 5HY9B 4F7MB 5E6IC 5DEGA 4QHLB 1IC5L 3RVTD 5FKPB 3DWTA 4TPRH 3U4AA 4OM1H 1HXYB 4JFOB 3L9RA 3BHBA 5ITBH 3TN0B 2B2XL 4HJJL 1QR1B 3B2UD 3CH1A 5DQDL 1MFBH 1D5ZA 4FFWC 4RIRA 3GBNL 1OWWA 1A6VL 4OBRA 1KJ2B 3ARDA 4R4BB 4D94A 1B90A 3NIGE 4G6AC 3O6FB 4Y2DA 1TIUA 5FYJL 3NZHL 1BM3L 5TPWH 1A1MB 4UTAH 1KTDB 1NLBL 1Z0MA 5H8DA 3IDGA 1HZHL 3HB3D 3HZMB 3K8LA 4MD5A 4Z9KB 4ZTPH 5C8JA 3SDDC 2CD0A 5JPMB 2I9TA 5F21B 3SBWC 2XKNA 3HZYA 4POZC 1ZGLP 3NPZB 1L9MA 4NPYB 1QEWB 1RZGB 1MWAH 2YUXA 1YEDA 3FQWA 5GIRB 1YPZB 4N1CA 4JO4H 1CG9B 4DQOH 3VA2C 5EZJA 3ZKNC 1QRND 4D8PA 5IBUG 2NMSA 4K2UL 1FV1B 2FYYB 5KSBA 4L29A 3DVNA 3EUUA 5DTFA 5MERA 1S7RB 3WKML 1MCIA 5L8JB 3SCMD 5EU5B 1LGVA 3ULUH 1MCPH 3VRLE 5LGKA 3HFMH 3FRUA 4PJBF 1DQMH 3NFSH 3DECA 5I18H 1FL5B 3UO1L 1ADQA 1AO7A 2AGJH 3KPSB 4XGZA 4OZHE 4QWWD 1AKJA 2AABL 4G80A 4KU1A 3L6FA 1HHGA 3FOMB 4J3XA 5E2WL 3WV0A 1NDMB 2UZIL 2HKFH 5IW1B 1EHNA 3VFOA 4QOKA 4J3UA 5GGQH 1A9BA 5LAXB 4HWZB 3ROOA 1B4JH 2R2HB 2VNCA 2L7JA 1EO5A 2ICCA 5DXWA 4CADA 2HFGL 3QFJD 2QHLA 2X4PB 1FVCA 3JWDH 1INDL 1IGML 2ZUVA 3CSYB 3MUZ1 3VH8G 1IEBA 2XPGA 4ODHH 1IBGH 3QDGB 2VLKA 2ZSVA 1KCSH 4XRCA 1TQBB 5IJVA 5K9JH 1R0AH 3QDJD 3EJYD 3HC3H 3KJ4C 2VLLA 4DZ8A 4P9HC 3HC0A 3UTPD 4UV7H 4TTDD 2JCCF 1DUZA 1Q38A 1I9EA 4Y5XA 5HJ3B 3FN0L 3KPMB 5BVJB 4LSUL 1I7UA 3TNNB 4BH7B 3BQUB 1X5AA 3O45A 2DB8A 4JFFB 4NQVA 1U8QA 4PJAF 4UQ2A 1MJUH 1IGFH 1R5WB 4F7CA 2GTZA 3M45A 3LS4L 1GHFH 4HAGA 4OLWH 1DBAH 3OKMB 5LVEA 1DDHA 3C5SA 3F7VB 4WWKA 2XRAH 3MRGA 3GUTA 3H8NA 3HI6H 3O6KH 3X3GL 3QUXD 5J12B 1S7WA 4R2GB 2F9BT 2E7LA 3EDJA 5EU6E 3TH2T 4JREB 4Z95H 4DN3L 4YHZL 1UFUA 3ES6A 4MCYA 3CDFA 1CD1A 3DARA 1QNZH 2PTVA 5HDOA 1NUDA 3S36H 5K9OB 1C7TA 4JPIA 1OTUC 5MEQA 4JO1H 3I6GB 5J8OA 1FNGB 2O5YH 3D0VB 5JOPE 1MCKA 2HRPH 1QO3B 2SEBA 3ULVE 4XVTL 1N0LA 2X4QB 4OV6F 4NUJB 2ZWLT 1BFOB 1T66D 2IBGA 4JO3H 4KUZH 3PL6B 2ADFL 2DQJL 4MXWH 2P8PA 3P11L 5ACLA 4JZOB 2LU4A 1AH1A 2XQYK 4L8SB 2NW2B 4PRHA 3G6JE 4KY1L 2EECA 5EB9A 2Q1EA 1E28A 1CFTA 5BO1H 5JNYA 2H9GA 1CXHA 4GAGH 4MDJB 2NXYD 4KK9D 4ALAL 1J11A 3LKNB 1KUMA 3UPRB 4YDIL 3JBG7 4PD4J 1OB1B 1A02N 2HT4D 2IQ9H 4K3EL 4G5ZL 5HI4D 1IAOA 2ADJB 2DQDH 3O41B 3S34L 1T04A 4WCYL 3BKCL 5C07D 1Z3GL 4GKSB 2PETA 2H8PA 2BVQB 3BYTA 3F65A 1EFXA 3HS0B 4UDTB 1A7NH 4PJ7F 4X6CB 3I50L 3F58L 4JG0L 1WBYB 2BMKA 4B50A 2FWOB 3OXRA 4P5MA 2IAMD 2Y6SC 1FH5L 5ECJE 4YNYB 1LK3L 4LRNL 3QHTC 3B6SB 3V52L 4XNXH 1X7QB 2XT1B 3C87A 5T3ZE 1PW3A 4ZO6A 5C3TA 3BD4A 1NCDL 4LLDB 2JJUA 2YK1L 4PJFB 3IDIA 3H9YA 2A38A 4NZDA 3VWJB 1CU4L 3RIFF 1OD7A 1V3JA 1PKQE 5B38A 5CD3A 4NM4H 4WVRA 3IU3B 5EUOA 5CWSA 1MWAB 3PDDA 1IC1A 5KZCB 2X4RA 2LAAA 1EHXA 4LLWA 4A2LA 3LEXA 3DX8A 3BPCB 4J1UA 2FL5B 2OTUA 5IVZB 1YNLH 4KTEL 3NAAH 3BKYL 4HG4J 4J4PC 5KVFL 3GHBH 1YEFL 3IJHB 3SDXA 1MF2L 4APQA 4AIOA 1M71B 3FB6A 4DW2H 1B0WA 1QFWH 1V3LA 2GW5A 4ZS7L 1E27B 3C5ZB 5C0CE 1EVUA 5TDOB 3WHXA 2R0ZL 1HHHB 1QHPA 5KSBF 3UYPA 2DQGH 4M6MH 4UIMA 4I77L 1CFVH 2EYSB 3WJJC 4IHOB 4WI4A 4IJ3B 1YEJL 5CEZH 2FATH 4ODUB 1NJ9A 4HIIB 1QBAA 5F1IB 1CGWA 3MYZA 1P4IH 2W0FA 2PO6D 4J2XA 4PRDB 5K9QI 1M7DA 4G42B 4UB0H 4X4YB 1LO5A 4OFDA 1MCOH 1AR2A 2A73A 3MRFB 4HLZG 4FQLL 4GQPH 3GB7B 1DBJH 4KUCF 3W5NA 3TFKD 4ZPTA 4JFZH 5CZXD 4ZFGH 1BJ8A 3DMMD 1F00I 3MZGB 4NQEE 5CJQL 5GGSY 4YXLL 3CFBA 5FO9B 1BD2B 2O93L 5E70A 2VLJE 2UWEE 3TN0C 3SJVB 3T8XB 3GSUA 4W70A 4LMQE 3WIFB 3O3BB 3O6MH 1J10A 1MAMH 3MV8D 5ESQB 1QRKA 3O6FC 4Z5RA 4L3EB 1T1ZA 5DJAB 5SWSA 1NC4B 4DTGH 1AGEB 1MHPH 3ZHKA 1BQHB 5HSFA 3S4SA 1OF2B 3LIZL 2M26A 4Q6YA 4D9LL 5GJTH 4KDTC 1MIEH 3TZVA 3KPPA 5CEXB 5AUMA 2HFFA 3UBXG 4RMWA 2ZG3A 4ODTL 4U1LA 1KEGL 1XGRA 3IDNA 4P59L 1X5KA 2P24B 2EDEA 5IW6A 1F6LL 3MUGA 2F8OA 1K5NB 3QG6B 4MJIB 3HG1D 3PJSA 5ERWA 4BQ8A 1I9JL 5DT1H 5HYIA 4M1GL 3LSOA 4RMTA 1YPZE 1R24B 1EEYB 3QWOB 4PRPA 4PLJD 5DJXA 2OZ4H 4O2CA 5IR1A 5KS9B 4FXGB 3PGFL 4DVBB 1KCVH 1W0YT 2B1HL 2VDOL 4PJ8B 4YWGH 1S5HB 3G6AA 5F7EH 3AXLA 3ARVA 1BJ1J 1QBLH 3VG0H 4P3DB 3BH8A 3L3JB 1SY6H 4G7VL 1QFUL 4H1LB 1FFOB 3X3FH 4DVRH 4PGCB 4KGLA 3KPSE 2WUCH 5DYOB 1JNNL 1JWUA 3NIFE 1Y6NR 4Y89A 5C08A 2VDQH 2RCSH 3VXRB 4AY0A 3UTTB 1LQSR 3QUMB 4FFZL 5JW3L 3ARSA 4HUXB 4XVJH 5FYKL 5BZWB 5DK2B 1MCWM 4JRYD 1IMHC 3GSVB 3P9MB 3UTZA 3C5JA 4OLEA 4MWFA 4O2EA 1N6VA 1TQBC 4MZ2A 1XF2B 1IAIL 2ZOLB 1MRCL 1VSCA 2V2TA 1CF8L 4JCMA 1U3HD 5GGTA 2FGZA 4OCNC 3OJMB 3QDGE 4I3SL 1BFTA 1QQDB 3AU1A 3EGSA 1EO8H 5DA4A 2JB5H 3NTCL 1PAMA 4OZ4B 1XEDA 2G5RA 2X6MA 1CR9H 4NNPL 1U93B 5DUBB 3BQUC 1LEIB 3K2MC 3QSKB 3FAWA 4KMQA 2D7QA 1MFDH 3C6SA 4WIQA 2QADD 5GRVK 5DJ0B 5E95B 1A6AA 1YECH 3GIZL 1IAIM 4JFFE 3CCHA 4ONGL 2DIJA 4JO2H 4TOYL 1CXEA 5J12C 4R2GC 5DQ9B 3TF7C 4QRSB 1IAMA 4NC2B 3R1GL 1GZPA 43CAA 4EQ2A 4JREC 3I3DA 3U0PB 4UOW0 1JHLH 3BESR 2WBWB 4WJ5B 1MH5B 4Q0XL 2OXGA 5HI5D 3MGOA 4FQQA 3Q0HA 4JHAL 1MLBA 3HC4L 3O2WL 2NR6C 2Q8AL 4M7KH 2AI0L 4OCRL 1W0WA 4NQCA 3BIAX 1IKFH 2NCMA 4OT1H 1INQB 4R3SB 5A2IH 4PJ9A 4M02A 1ZSDB 3KXFA 2WWKO 2R69H 1DFBH 1OAZL 2E6PA 3PL6C 1CFNA 5JDSA 4PY7B 5I8CB 1CDUA 4G6JL 1HSAA 1TVHA 4NM8H 4L8SC 4WU7A 5MP6L 5L2KB 1FE8H 1KLUB 4OF8A 2FX9H 2WUBL 1DTUA 2DMKA 3GJEB 4AIZB 4DK6A 2XACC 1Z9LA 1XIWD 5FCUH 5D2LF 2AP2A 2AXGB 2Y07H 1DN0A 5F7FA 5TE7H 1HHIA 3H3PL 4RISL 2Z4QB 2MJWA 3O3UN 4PJ5E 5I1DA 4P4KB 4NQTA 4U3HA 1MQKH 3NCFB 1JK8B 3FFDB 1VB9A 2JELL 4PG9A 5D6CA 1OP3K 4K94L 1ORQB 3ZZ1A 2GYSA 1KJ3L 2F53B 1TETH 1ZT4B 2DF3A 3LN5A 1VEMA 3O0RL 2HP4A 2L0DA 1AGDB 1I8LA 5T33L 4ZAKA 2GCYB 4QGTA 5CJOH 3I9GH 4X6CE 5EOTA 4K7PH 1KN4L 4GMTL 4UTBH 4HIJA 2IAND 3CFEA 4BK4A 3P9WB 2VDPH 3BI9X 5IESH 4EUPA 5FA4A 1OWRM 1M4KA 4FTVB 4N9GB 5L8KB 2MQ0A 3LKRA 3VWJC 5IHZA 4PJHB 1L6XA 2VH5H 5DHXB 1JPGA 3S96A 2AJZB 5I6XB 4QKXB 3WN5A 1GOGA 2MPAL 3VJ6A 1M7XA 4KKAC 3MRRA 4PYHA 5L6YH 3UJJL 4PJFE 4ZO8A 1BEYL 2PR4L 2F5BL 1IZJA 1T0PB 1ZXQA 2GKIA 1NGXA 3SKJH 4DFHA 5A16A 1H3VA 5KW9H 2W59A 3VXUB 1ZHLB 5GHWL 1AXIB 4LEXL 1EEZA 5DMKB 2G2RA 1WZMA 3D1MC 2D4FA 3VCLA 3VFSA 4JPVH 4OCXL 1ZLSL 3C5ZC 3ULUC 3F62A 5HVGB 1Q9OA 1YEEH 2VR4A 3GSNL 4Y19B 4OCWL 4NQSB 4IJ3C 3ULUE 1IKNA 2B7DT 4JFQB 4M03A 2GJ6D 2JJWA 5L2JB 1FAIL 5DF0A 1H9VA 1L7IL 3JTSB 1PQZA 4EBQH 4EOWL 1NAMB 1B0GB 4B5EA 1ES0B 4N0FB 5FYJD 1A47A 4KC3B 4QRRB 3G5ZB 1PSKL 1E6OL 1KIPA 2A77L 4HULB 3T4YA 3SO3B 2HWZL 4F33B 3JWDC 1A2YA 2DLEA 3QEQE 4ZYKB 4ODSH 1UM4L 3BGFB 2EE2A 3HUJB 4P2RD 1WIUA 4MA8H 4CVZB 1Z9MA 4XWGH 1XGQB 2WANA 4HZLA 3H42L 3VG9B 1W2KT 4LLVA 2IH1A 4NQDE 2DD8H 1BOYA 4WUUD 1BD2E 1MCHA 3GO1L 4PFEA 3DUHA 1I8MB 4O5LH 1WWWX 3MCKB 2DTSA 1Y0LB 1XGUB 1EIBA 4MNHB 4U3XA 1KPVA 2HN7B 4U6YB 4XP4L 1D6VH 1ZANL 1LP9F 3LH2H 4QRTA 4L3EE 3TBSA 2C7UB 3EHBD 3K1DA 4O2FB 1MCRA 1B2WL 1C5DA 1AQKL 4WUKH 5D7IF 4JFYB 3VFTB 4G9DB 1KCKA 1JPSH 1S7QB 1AI1L 4JPWL 3S37H 4CVUA 5HGHA 1Q9KB 4ENEC 5IROC 3VXSB 4G9FA 5EO9B 4MNQD 5DHVH 5ID1A 2DLHA 4GMSL 5DD0L 1T03H 4FQ2L 2FEDD 4BUGA 4CVXB 3BZEB 3I6KA 3KJ6L 1G0XA 2CGRH 1NBVL 4HC1A 2WWMD 1VENA 3CVHH 3O3EB 5J6HB 3PWPB 4QXGL 5CGYD 4JFED 4PJ8C 3BGMA 4MQTB 1X5LA 1UKQA 3H9HA 4P9ML 2HLFD 5KS9E 1PZ5A 3KPLB 5CHNB 4HPYH 5JQ6H 5TFSL 3RRQA 3SDAB 1RIHL 2OJEB 3O2DA 1PLGH 3QXAA 1D5BA 4HD9A 4P4RA 4OFIA 1RIUH 3DNKA 4OZGB 3WO4B 4DN4L 4MX7B 5IK3A 4JM4H 3SE4A 1AFVH 1AHWA 1QSED 1QSFB 3IRZA 1AR1D 3ARBD 1EFQA 4G6FD 4KVNH 2I25N 3VXRE 4MHHG 1FC2D 3UTTE 4MB4A 1W72L 3MLZH 4E42B 2BNQB 4HKJA 5GSRB 1KB9K 4OZIE 1CN4A 3R06A 4UU9A 1QRNA 5KTEL 1A6TA 5HPMB 3NGBB 3HKFA 4MQ7A 2BVUA 4UAOB 2RJMA 3OZ9H 3DYOA 4JFXB 3ESUF 5DO2C 3SCMA 5I71B 5IHLB 1MHEA 2FIKA 4X7TB 3L3IB 3VFMB 1YJDH 5HGBB 1C1EH 3UJTL 4MJ4A 4QHKI 5E2TH 4Z7UA 2K9UA 3EFDL 3ARGB 1BVLA 5IV2A 5JXEC 4K9EL 4N0YH 1T83A 1HINL 3GSOB 4ZOAA 2D0HA 3WUWB 3WNOA 3UZQA 4XPTH 1KIRB 4Y16B 1N8ZA 4FFVD 4M62H 3RNQA 4KQ3L 1IGTA 3BP6A 4LCCA 4X8JA 1LO3L 3D39D 1K8DB 1CDJA 3AMLA 4AT6A 3S5LB 5J1SC 4KROB 1VFAB 4LSPH 3QFJA 3WFCL 4JB9H 1VESA 3EO1B 4ZPVA 1AGFA 5CGTA 1UQSB 5CBEB 3WXVH 2YD6A 4OGXL 2QHRH 4KI5D 4P9HL 1B88A 3FTGB 2OSLA 4UT6H 1IFHL 1JWMA 3VFWA 5F6HJ 3FO1B 2DI9A 4YGVB 3RDTB 2PXYD 3H3KA 2XWTA 5F1SA 3QDJA 5F96L 5FDWB 3V5HA 2OBGA 4D9QD 1IGJB 1MI5D 1JL8A 1X44A 2JE8A 1CTNA 3KR3H 1R3IL 2F19L 1TITA 3S36X 4WFEE 4JAMB 3BW9A 1NLDL 4ZQKB 1OTSC 4Q9QH 2QSTA 2WIIA 3QJFA 4UILL 5E1AB 4KDWA 5T5FH 3A6CH 4RGOL 5D5MB 2Q7YA 1BP3B 2XN9E 3GI8L 4QT5A 1NFIB 4GSDL 3PGCB 5E24E 2DQIL 5JZ7C 4N8PA 5JOFB 3UZEA 5L2KE 3QUXA 1BOGB 4L8DB 1ZHNB 1Q9LA 3E2HB 5CEZE 3LAFA 5DD1H 5HBBA 5IQ9A 3QCTL 3QCUL 2GSGB 5DZOA 4XCFH 1LO2L 4X6BA 3T0DA 4PLKD 1TXKA 2R4SH 1P7KB 4FZ8H 4YFEA 4P4KC 1N2RB 5TF1L 2Y4SA 2X41A 1AXSA 2EDOA 2OL3L 1KCUL 1KNOA 2EIDA 4YDVB 4JY4B 1U8IA 1RUAH 4Z0BL 1ROWA 2W38A 1PDKA 4RMVA 3RWJA 3EO0B 1NGPL 3VFRB 4N0CD 4J3OC 2OTWA 5ICXB 1QLEH 1RI8A 1RIVH 5KJRL 1N5YL 2F53E 1Q1JL 1JTPA 3GK8H 3EFFA 1MNUL 1V5JA 3P77A 3QEHB 3NN8B 4FQXB 1I1FA 2JK5A 5FIEA 1M05B 4LNVA 1OAUH 1GGIH 4XXDA 5EOCH 4ORGA 5I6XC 1AY1H 2WBJB 3FCTB 4NO0A 5D70L 3ULSA 3ZDZE 3HR5B 3CGTA 3GMRB 2X09A 4LSVL 4O00A 4PJHE 4Z78A 1IM9D 3VD4A 4ONFL 3IKCA 3C9NB 4Y4HC 4Y4FB 2R8SH 4HX1A 1OP3H 5I9QB 4NGHH 4PJEB 3LRHA 3L3HB 5I74B 3OB8A 2DQFB 5I8EB 2NY2B 5GISL 1U8JB 3R8QA 2X9XA 1PG7W 3T2PA 5C07A 4ZFOL 1FGVL 4BYHA 4OIAA 1ZT1A 3LN4B 3OJ2C 2AV7B 3CVHB 3QFDA 5DDHA 3W82A 1HWGB 1UC6A 2IEPA 3HNSL 3VXUE 4OQTH 4JDVB 4N90D 2IMMA 1U8HA 1JGDB 4XNQA 1A9EB 2X4UA 4OF5A 4HJGA 3QQ3B 4O4YH 2E3VA 3OV6A 4G8EB 4R7NB 4GRWF 1P2CA 1C5CL 4NZRL 4IRSD 4KHXL 1RZ7H 4Q74A 1EHLH 3S97C 2AEQH 4P0DA 4L4VE 2F15A 3VD5A 4P46D 2I07A 2P8LA 4TVPH 2W92A 5D1QB 2HLAB 4JDZA 4X5WB 3QT2A 4MXQC 3RL1B 3HE6D 5BS0B 2PYEB 3BGFC 3LEVH 2HVJA 4QRRE 2HKHH 2BSSA 3QQ4B 3THML 3QNXA 2HMID 3BZ4A 1Q0YH 1NEZA 3VG9C 3DSFL 4L1HA 1YEGH 5DVOA 1BVZA 5HI3C 4XNUL 3HUJE 3W81A 2BVPB 1KXQE 4N0UB 3ZE0F 3PF2A 1S7UB 2HJKA 3P4OB 1NCWL 3IDXL 2OK0L 5J11B 3GRWL 3PIQB 4PV9B 4OLYL 3DO3A 1FL6B 5FUZL 3M07A 1F4YL 3W11D 5F3BA 2AEPH 4ZS6D 1S7SA 3DJ9A 4MXVE 1CLZL 5T1DL 1SHMA 2R2EB 3L95A 5IEHA 4LCIH 3U1SH 2Y06L 3IXTA 4H5SB 4I4WA 3DO7A 1CL7H 5I1AA 3VGFA 5L7XH 4QF1A 4F9LA 5INCB 4PB9H 2PO6A 1LWRA 4HV8A 2ITCA 5JO5A 4NZTH 3P4NB 1JYXA 4L4TB 4YIQA 2NY3B 5FHAL 4K7FB 4AQOA 5I1GH 3GI9L 4GBXD 4Q7DA 2MCPH 2AV1B 4HK0B 5HYJB 3VXSE 3DMMA 4YHLH 4MAYD 1FORH 5TGBA 4FA8A 5E5MA 1G7PB 2OR9L 4E41D 4XXCC 4ZDHA 1JF1A 5GGVH 3T65B 5DUPH 4M1DL 2VWEC 3GSXA 4UUJB 2VXUL 3W9DA 1M7IB 3PWPE 3SDAC 2IBZY 4F2MA 1MELA 3MV8A 5KBNC 1HHKA 1JF5A 4S1SL 4YXKH 3TLRA 3DUSA 3BKML 2B5IB 5D4QA 2E8YA 2VWEE 4ELMB 2BHUA 4YHOL 4DWHA 2YD7A 4HUMB 3WO4C 3BZDA 4YHIA 4RFEA 5L88H 1KN2L 2NW3B 3U83A 3VXOA 3F7PC 1RPQA 2YD5A 1XF5B 2H32A 2HFEA 5TQ0H 2ZUQB 4U2ZA 2VITB 1K6QH 3L1OH 4DGYH 1CFBA 2CIKA 3HZVA 4OZGE 4AEIL 4KJYB 5CBAB 3D6GA 3PQYB 4Y0GA 5J9PB 4D0CA 2EXWC 2ICEB 4Z7OE 4M7LT 5JA9A 1DE4B 1CFSA 2N56A 3HG1A 1BQSA 2Y5TB 3B9KC 1IEAB 2WBKA 1E4KA 3NGBC 3MV7B 4BZ1L 1FFRA 1IT9L 2FJHA 1ED3A 4UAOC 2J6EL 3T3MF 1TNMA 2QQLL 2E7BA 4E0RB 3G5YA 1OP5K 5I71C 3DVFA 5GGRY 1KB5A 1J1OL 3RWCB 2A2QT 1MPAL 3RVUC 1YEHH 3ARGC 3V0AC 5F71A 1F45A 2DI7A 4G3YH 3SKUD 3W39A 2P48B 3MV9E 2A6KA 4Y16C 5C6WH 1WAAE 2Z8SA 2ZUYA 4K3DH 1TVBA 3VE0A 2B0SL 2WINB 1YQVH 4RMUA 2EDYA 4MA3B 1OGAB 5E2UH 1J86A 4I5BA 3T0XA 1RD6A 5EFIA 4KROC 4LOUD 3DX7A 3NMEA 3QUKA 3X14B 3EDKA 4JRYA 5HHOD 4TNWF 4FP8L 2NYYD 4XPAL 1N0XH 1R5IA 2CK0H 4RQQA 2D7MA 4LU5L 1WFNA 3P3YA 4OV5A 4MB3A 3NIDE 4OGAD 3RDTC 5IEKA 4PJBB 3EYQD 5KVEH 3E6FB 1U3HA 2PW2B 4OIBA 3OAYK 1FQ9C 4GUPB 3N1GC 3LKOB 2BVTA 2Z91A 4HQQL 3TYFB 3MLRL 5J1TC 3FQTB 3ILPA 5BQ7A 3JV6B 3O3AA 4NHUB 3SDCA 4XPBL 1Z2KA 4YXHL 1WITA 1ADQH 1CBVH 3DV4A 5SWQA 3QNYB 3IXAA 1U8NA 5BV7B 3I6LE 3LPFA 5EC1A 1XZ0A 4JVUA 2N1KA 1ND0B 3AS1A 5HVHB 5JW5B 9CGTA 3L5XL 2Q8BH 2YD1A 3WIHL 4LBEB 4KK5C 3VRIA 1PVHA 3TJHD 1Q9WB 3E2HC 5D5ME 3H9SD 4UQ3A 5ITFB 3U7YL 2DTMH 1CICB 4RAVA 5AG9A 2YC1B 3SKOA 4KXZI 2Z31B 3DROA 1RULH 2J8OA 1RURH 5I1CL 4M8QA 4LHQB 1INEL 3GMOB 4NWUL 3T3PE 1RY7B 4JR9L 4D9RE 1NL0L 3QNZA 1OHQA 4YJZL 3MXVH 2JCCB 5EC2A 3HLAB 5ESVA 1A3RL 1O7SA 1WSST 2QEJA 3ZKMD 3HMWL 4P3WA 7CGTA 1ZLWK 5INDA 5TE6H 4L9LB 3CK0L 3T4AA 1FG2A 2FX7H 4YFLF 2DLIA 2VL5B 4FQXC 5IFHH 4HKZB 3DLQR 4JM2D 1OW0C 1UA6L 4OI7A 5D1XD 1A14L 2M2DA 3CZJA 3G08A 3QIUD 1LEKA 4RRPG 4ODWB 4TN9A 4P48A 5TDPB 2WBJC 2HH0L 3RVXD 3MV01 1CE1L 4FG6D 5F88A 1XIWA 2BC4A 4GH7B 4MA1B 3QXDB 4KZEL 3VFGH 4K7PX 5TDNA 4PJDA 2WV3A 1G6VK 2H26B 4Y4FC 1P84K 3D2UD 3QIBC 5C2UB 5I9QC 3DOSA 4OLUH 3DURA 3RZCB 5A43C 5I74C 2P46B 1K4CB 2NY2C 1Y6KR 2CUIA 4ZUWA 1CXLA 2XFXB 5ESAA 4V1DA 5JUEL 2APXA 4M9PA 4F58L 3WHE1 2XY1A 1L9NA 2GK2A 1TJIL 4PJEE 2C3XA 3RY6C 1F97A 3EYUL 2FO4A 5IFAH 3GMQA 3MBEB 4UTAL 3L3GA 1JBJA 5I8OH 4RSVA 1OTTD 3V6OC 1JP5A 4LAQL 1NH6A 2EDLA 5I66A 3HI1B 4G8GD 4I2XB 3JVGA 1CQKA 2ZCHH 4M43H 5C1MB 3VRLF 3PGDA 1M6OA 1UADC 5LCVH 4G6KL 1YY9D 3V6OE 2IANA 4HGWA 3P0GB 3CVIH 1MWAL 1KCRH 2YBRA 2AJSH 2VUYA 3GSWB 5D1QC 4JG1L 4GAJH 3IU4H 2EEBA 5C0ND 1KIUA 4YX2H 4X4MA 3FZUC 1S7TB 3WDHA 1G7LB 5ISZD 4M6NH 3OAUH 2YR3A 2HT3D 2ZUSA 4ZSOE 1YYLH 1E4WL 4KPHL 3OPZH 4ODVH 3TBYA 2IPKA 2V5MA 3MBXH 1IQWL 3DTXB 4K3JH 5BS0E 5FK9A 4WNQB 5DC4B 1I8IA 4P2QD 1G1CA 1FO0A 3I02B 4OD1H 1KPUA 4R4FH 5DEGB 5DS8B 4KHTL 1T21B 3N85L 5J11C 5HDBF 3BHBB 1YC7A 4UT9H 1ZVSA 4OCSL 3WKNA 2B8OT 1NFKA 2X4SB 1YJDC 1J88A 2ITDA 4N0UE 3CH1B 5I15H 4FFWD 1NSNL 3ARDB 2BDNH 5IB4A 4XMPL 4WHYH 2MNUA 2EH7H 4EDXA 2GJ6A 2GY5A 1ZE3C 1X4YA 4R90L 4UDUB 3MRBB 3MACH 5C8JB 1EUTA 4IMKA 1JMZA 4YHNB 2NY3C 2WK2A 4POUB 4O02H 3CXHK 2XKNB 5L9DL 4IIQA 2J4WL 1NCBH 2X2YA 3JZ7A 2DBLL 1XGPB 3K8KA 3MREB 4L4TE 3RJDA 5FGCE 1A7OL 1N26A 1HH9A 1YEDB 4P2RA 4GS7B 4UV7L 4YPJA 3ZKND 1G6RL 3S37X 1U2CA 3WEXB 4D8PB 1FIGH 1RUML 2V5SA 4F7TA 5HYJE 5JHLH 2A1WH 5E99H 4PR5A 5KSBB 2FBJH 4WUUA 5MEND 1JRHH 1AJ7H 4M6OH 4I18A 3HAEH 3KPNA 3AM8A 1MSPA 2B5IC 4WEBH 4JDTH 4OF6A 2AJYL 4LSTH 1MVFA 3S88L 3EYOA 4Q9CA 3ARRA 1Z5LA 2EKJA 3G04A 3OF6D 3S35L 1AO7B 3D3VD 1AKJB 4M4RA 3MOBH 5SWZD 3ULVF 2EYTA 3B5TA 3DGCR 1HHGB 4WFFE 1YYML 4KJPC 3WFBH 4JKPH 5FOBA 1RAMA 2ZUQC 4ELME 4UNTA 1UZ8A 1XGYH 4W6XB 2A9NL 4XHQA 2YPLD 3ROOB 2D7PA 2JF1A 2OP4H 5DEZA 3CFKB 1CTOA 2V17H 4MNQA 4CADB 4U6VH 1FVCB 3L3DA 5BRZB 3PQYE 4FQ1H 3IFOA 1ACYL 1IEBB 1H0DA 5ALBL 2I5YL 2W0PA 2DWEA 1VACA 5DWUH 4KXZH 4HMDA 4XRCB 4EN3B 5IJVB 3INUH 4OB5L 4D0BB 4DKEH 1GC1H 1F4AA 5IJKA 3FMGH 4KUZL 4DZ8B 3A0OA 5F7DA 3HC0B 1AE6H 5B3NA 2AEWA 1U58B 2FJGB 1C12A 1GGCL 2Q86A 2VZVA 3QUML 4Y5XB 4HUNB 5HGGS 1FHGA 3K2UH 5AYQA 1MQ8A 2AJXH 3V0WL 5H35A 3UBXA 4MJ6A 4NQVB 4GLRI 4PJCE 4WV1A 4F7CB 1QA9B 5IT2H 2GTZB 3U9PH 2B20A 5EU6D 1T1XA 1FJ1B 4TRPH 1DDHB 1QSEA 4WWKB 5DD5L 3MRGB 1OGAE 3Q2CA 1MCBA 4KTDH 2XWJA 3ARBA 4GXUN 1S7WB 2ICWB 2YPVL 3U4EA 5D7LD 3OKEA 4P3CH 3MGTA 4QRPD 3TJEH 2R1WB 5E8PA 2G60H 3KS0J 4D3CH 1VFBB 2R4RL 3ES6B 4MCYB 4TQEL 1OP5H 1UB5B 4XMKL 2CUHA 4N5UA 5IMMA 4WU5A 3GSRA 4JPIB 4MCZB 3OSKA 1YN6B 3HNTL 1Q72H 4QO1A 2CK2A 1ZLVK 1DQLH 3TWCL 4LPVA 3F12A 3AREB 2SEBB 5BV7C 5H94A 1FZKA 3QO1A 2JIXD 1TCRA 4XP6H 5D7KE 35C8L 4PBVC 3UC0L 1QYGH 2IBBA 5FHBH 2MCG1 5JHDB 3QRGL 5HVHC 3GBMH 5JIKA 5FUOL 1CXIA 2B4CL 4JANB 2P8MB 2EDHA 3QWRD 4CU7A 1DQTA 4KK8C 4BFIA 4N8CL 1CICC 3D39A 1WFOA 2KQMA 4BUHA 2DQTH 2Z31C 1KTKE 4PRHB 2VIRA 3MRNA 4C83A 1E28B 2BXZA 5DJ6B 5JNYB 4OCYL 2H9GB 2BOBB 4LK4A 4LASH 4PYGA 1CK0L 3JSSA 4TVPE 3V5KB 4ELKA 3OAYH 1KGCE 2VQTA 2AJVH 2PXYA 5EBMA 1FZJA 2OM5A 5GGTH 1CVSC 2BFVL 3H0TA 4CU8A 4ZNEA 1IAOB 3V4UL 4NOFA 5DRZA 3KYOA 2VDLL 4L9LC 4PJGA 4YK4B 4U6XA 4PGBA 1FNSH 1OGTA 1WVZA 1ZVYA 2D7TL 2YXFA 4IRZH 1DCLA 5FCSH 1QPPA 5EA0L 3FQUA 4X99A 3NACH 3QQNA 2WSKA 4ZXBD 1BREA 4DUXA 2DMBA 4LPWA 1XF3A 3O81A 2BMKB 2Y6SD 1X5JA 1RJZA 5E9DE 1RUQL 1I3VA 4GKOA 1QFWM 1BFVH 4LVNB 1H3XA 1PEWA 3QQ9C 1B6UA 5I8KL 1DBJL 2PN5A 4MA1C 1T2QH 2GUOA 2FHBA 4TUKL 3CX5K 5ICYA 5IG7B 4HFWB 5IVNA 2CR3A 3RZCC 4LCYB 4EVNB 1YN7A 3QDMB 4HKXA 3DYPA 1DSFH 2GAZA 1CT8A