2FECL

Structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Separate ion pathways in a Cl-/H+ exchanger
pubmed rcsb
source organism Escherichia coli
molecule tags Proton transport,membrane protein
total genus 41
structure length 211
sequence length 211
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fecL01
3VRLE 3EDDA 3ZDXF 5F97E 5EOQH 3TBWA 3U36B 4CVZA 1LGVA 3BD4A 4J4PA 3SDAB 4ZUUB 3MRLA 5D7IE 2EXYD 5F44A 5C07B 2X1QA 4MWFB 2VRAA 4NZTH 3H0TB 4RNRB 2Y1VA 5SWZB 2VL5A 3OAZH 4KMQA 4P49A 4K7FB 1NUNB 4O02H 1MCJA 5C71A 3T65A 4JFHD 2EYTB 1QOKA 1TTFA 2H1PL 3NZ8A 5DR5L 5CJOL 4DGYH 1F4HA 4OQTL 1DE4A 4JZJB 1U8IB 4HKJB 4UDUB 4H26B 3K8KA 2VDMH 4DUVA 1YN6B 1DN2A 2ZWLT 3O6FA 3WHXB 2ORBH 5C70A 3K0WA 2P49B 2BVUA 4ZS7H 4G6AC 3P9LB 4ONFH 4IRJA 1UWXH 2P5EE 2X40A 1FNGB 2P42B 2QHLA 2C1PB 3EFDL 1A4KB 1RIVL 4NRZA 1N6VA 1CL7H 4N68A 4KAQH 5EZIL 4XVSH 4XPTL 4D9RE 1TIUA 4MS8C 4ZFFA 2AK1H 5LGHL 1R3HA 2DLEA 3VFNB 4QRPA 3GRWH 4K3JL 1Q9LA 5EO1B 2SEBA 2C4FT 2UY7A 5H94B 1OAXL 5C0AD 3TN0D 5K9KA 1PG7W 3QDMA 2WQRA 3D3VD 1C08B 5E2VL 4P2RE 4GW5B 3SCMA 1ERNA 5IQ7L 1DBML 1SBBA 3DV6A 4I18B 3VXMA 2J6EH 4F58L 1A5FH 1O7VA 2NY0D 5HYJE 1FFOB 4J3WA 3N85H 2PTTB 2XTJE 4G7VH 43C9B 4F3FB 3MQIA 3OKLB 4OI9A 1ZLWH 5DYOA 3FKUS 3ZE1E 4ZYKA 2CKBB 1TJIL 4G9DA 4C57C 4YQXH 3QA3A 1Z9SA 4Z0BH 1A21A 1A8JH 4LLMA 2Q7YA 4ZO7A 2PXYA 5F1NA 4JFDD 4ODWB 4MXWL 1MI5D 4HCRH 1UEMA 5DMGC 4XCEA 1NAKH 4X4YA 1JK8B 3FO9A 4JFPA 2D2OA 5DHVH 3H3PL 3WV0A 4APQB 2YXFA 2CIKA 4JFXB 2DL9A 2FEEI 4UT6H 1OLZA 4KXZI 1PW3A 1IC4L 1YJDC 1IGJA 3FB6A 4U6YB 1ZGLP 1AH1A 1AD0B 1NC2A 1V7ML 4OLYL 3VE0A 2J88H 3MOAH 2X4PA 5MEQB 3F5WA 4HC1A 4F7PA 5HDQH 4NN7B 3I3DA 3EYSL 2AEQL 1M6OB 2D7PA 3QNZA 2LTQC 2GSGB 5IESH 5DZOA 4IOFC 1Q72L 1U8LA 2W92A 1EMTL 1F4AA 1RZKH 3PWNA 4HQQH 5B3NA 3N1PC 4JPKL 5KW9L 5CAYB 3T0WA 1HZHH 1PKQA 1N4XH 2Y5TB 3RL1B 3H9SE 5L0QC 4YXHH 4QY8B 4WU7A 1JHLH 3KPRA 4U1IA 2W9DL 1KYOJ 4KUZH 4CW1B 1FG2B 3RDTD 3VFOB 4XP4H 1G7PB 5C08D 1OAZH 1CFNB 4QRPE 2OMBA 5GXBB 4OZGF 2A6JA 4UNVA 1TTGA 2EDJA 3NFNB 3RU8L 3FQUA 1HI6B 3ULSA 3LKRB 5BV7L 3RVXC 1NFDF 4HWUA 3LOWA 1ZANL 3VXME 4NP4H 3V52L 3VWJB 3MBED 2I60L 3GI8L 3REVB 3KLHC 4JFEB 4WW1A 1JGUL 4PREB 5I8OH 4DKDC 2P5WA 4NRYB 3MODL 3VFTA 1F4XL 4YBQC 1KPVA 4LEOA 2AK4D 5D7LA 5I15H 3MCKB 2PO6C 3BPCA 3PWJA 2D4FA 1W2KT 1OD7A 1VACB 4PJCA 3T77A 4RFNC 2D7TH 1SJHB 1PYWB 4MHHI 3WJLC 3EGSA 1DUYB 5HHOD 3WEXB 1T1XA 1ZT7B 5HI3C 4PJGA 1TJGL 1W72L 3H42H 4PTTA 3VGFA 2ZJSH 4YNYB 5T1KB 2YSSA 3BOVA 5C9JA 1BWMA 1GIGH 3NA9H 1BAFH 2F58H 4Y1AA 4DVRH 1UM4H 4M4PA 4WUUD 3ET9F 3WDHA 1GGCL 4Q9BA 3V6ZA 4D0CB 3OQ3B 3HNTH 4OZIA 1M71B 4URTB 1T83C 3GEWB 1H0DA 4QCIA 1MQKL 3E6HB 5GRWA 1RMFL 5L6YL 2G75A 1Q8MA 5LVEA 1VEPA 4RRPG 4JHZA 4PRPD 4YBHA 5J11B 5C0FB 4ZUSA 1VGEL 4Q6IB 3HG1B 1A1NB 2NLJA 4HHAA 4RGNE 1JIBA 1PKQE 3ISWA 4OLUL 2C4FU 1LO3L 5JW3H 1BVLA 3CH8A 2ZCKL 1UJ3B 3GMLB 1BMGA 1B0WA 2ICEB 5HGAA 3O9WB 5F7LB 1DANT 1K9TA 3B9EA 1N3NB 3OF6D 5D7JC 4V1DA 3B4NA 3S4SB 4XCNB 5GISL 3JWOL 1KJMB 1P7KB 3IRZA 1BX2B 4DUXA 2YPLA 1TJHH 4M5ZH 3MX0A 1OTTC 3Q3GA 4JRWA 4Y4HD 5DK0A 5E4EB 5CGMA 3FO2A 2GJ6A 1RI8A 1MY7A 3R8BB 2FGZA 3DX6A 3UBXB 2GY7B 5JXAL 2R1XB 5FECB 3UP1A 1SYVB 4YZFE 3PQYB 2NXYC 5E94A 3V0WL 4RDQG 5TE7H 3BJLA 3OR7B 2FL5B 3M1BA 1ULVA 1X4YA 4JLRB 4MJ6B 2HG5B 4NQED 2OL3H 3EIFA 4U33A 3RHWF 3EYQD 4JZOA 1X5KA 3QCVH 5HHQB 1U95B 4OZFG 4PJ9B 4NM8H 1T1YA 1KCSH 4F15C 4E41A 4LSVH 3TBTB 4KK8D 2P24B 1CYGA 2F9BT 1QYGL 4FFYL 9CGTA 5MHSD 4NCC1 4FQIL 2QR0A 4AM0A 2P8PA 3KWWA 2VITA 2ADIB 2HWZL 4PJGE 4YHIB 3SDDC 3MRNB 1MCLA 3IFPA 5KZCB 1A9BB 5EOCL 2PO6A 4HS8L 2IC2A 4FQLL 5AD0A 2DQCH 4LFHG 3LKSB 3LRSB 4HMDA 4OGYH 5IB4B 1MRCH 1MHHB 2NXZC 4PB0H 4JDVB 2CLZA 4OZIE 5EU3B 1G7IB 4PR5B 1F3JB 3S34L 1AXTL 2BDNH 4KROD 4PBWD 2ICCA 5IV2A 3Q6GH 5IFHL 2Y6SC 1K4CA 4K94C 3L95B 2YOCA 1RJZB 4LDLB 5EDXA 4XP9L 1T83A 4UV4H 3RWFB 2EC8A 1D9KB 1HCFX 3PWLA 4KI1A 4XX1E 4D9QD 4GXVH 5KN5B 2BHUA 1I9IH 5HHPA 4RGOL 3LPGA 3C2AH 3T4AB 2LVCA 2VKWA 2JIXA 3P0GB 1S3KL 3VH8B 5DJ0B 2K7PA 2QQLH 2IGFH 3BAEH 3KPLB 3OPZH 3CFCL 1KCUH 2HT2C 4JO1H 4W4NA 4RA3A 1JN6B 3P4LA 2YUXA 4NNXB 4NBZB 2GJ6E 4Z5RA 3CZJA 1EEYA 4CVWA 4M7JL 1HOCA 4PRDB 3LKQB 5D7JA 2OZ4A 3CVHA 2QKIA 2FIKA 2VZOA 1EVUA 5MP6L 5EC1B 2I9TB 1J12A 2YD1A 3OKEB 2XI9A 4XRCB 5IMLA 1GAFH 1U8QB 3ZKQD 1I9RL 2ZPKH 1I4FB 5IMMA 4ZS6D 4UMGA 4XNZC 5TDPA 1HHGA 4E41E 1AGBB 5EA0H 1FNAA 1E4XH 1GGYA 2JB5H 4NN6C 4JKWA 1QSEB 3B9KD 3MRFB 3L3OB 4LLQB 4MQXD 2HRPL 1T22B 4R90H 3WKMH 2WBJB 1QKZL 2APBA 5DUBA 2XN9E 5JIKA 4OIIL 4U6HA 3CMGA 4P48A 1WBXB 5D5MF 2XFXB 1RSFA 3ZDXE 3MCLH 2VLRA 4QOKD 2RJMA 3QRGH 1XGQA 1X5HA 2FRGP 1S78C 3SDCB 3S3JA 1FZKB 2H26A 5D6CB 2EH8H 4KI5F 5FKAA 3R0MA 4QYOB 4DGVL 3T0DA 4MZ3A 1FL3B 1AGCB 1QVOB 3DXAA 4WV1C 4ZUWA 1OGAE 1GZQA 3GMMB 4OFVA 4XNYH 5ICZB 3VRIB 1OSZA 1VEMA 2NY6D 3QXDA 5I1DA 1KPUB 2ESVA 5DD3H 2VLLB 5H37H 3TZVD 1MCPL 2BVQA 1FBIL 1UADC 2Q3AA 1TZIB 4ODHH 5E6IA 1INDH 2BVPA 4PGEA 1SHMA 4I13B 2HH0L 4BFGA 2APWA 2WWKO 2V2TB 1G9MC 1VFAA 4F33A 3GBNH 3BFOA 4ODXB 4AY0A 5BVPL 4G8GB 5F3BB 1DR9A 5MENB 1HH6B 4JJ5B 3VFVA 3R06B 3N9GL 4P2QB 4QHNA 2UWEF 3REWB 2IPKA 4YWGL 4IDJL 1T5WB 5TE6L 4WI4A 3F6IA 2EICA 1OAQL 1G0DA 3BUYA 1N64L 1JTTA 2NY2C 2X4TA 4M8QB 1H3GA 2O5YH 3BDYL 4MZ2A 1CDBA 2ZNWA 1KJ3L 4BYHA 5GHWH 4R2GD 5DJXA 4WWKB 1KB5L 3ILPB 1MREH 2VUYA 2C3HA 1X4ZA 3A6BL 3VFSB 4OZGA 1I8KB 5TPWH 3NCMA 5ACLA 1VSCA 4H8WL 4ODVL 3QEHA 1MFCH 4P2OD 3SDYH 4Q0XH 3MUGB 3GMRB 4PJHB 4IIQB 5KSAD 1NFDA 5DSCA 1EEZA 4F2MB 2OR8A 4S1DD 2NQCA 3UTTD 3OXRA 1I3GL 2HKFL 1MJ7H 1HQRB 2WW8A 1WBYB 3WKNA 4Q9RL 5FO9B 1NGPL 2EDEA 1G7HB 2NYYC 4RISH 1HKLL 3HI1A 3L3GB 2D7QA 4KQ4L 2HN7A 1HHKA 2EIZA 2Z35B 3KPOB 2E7MA 1DEDA 1NCWH 3S37L 5C2UB 2GT9A 3D18B 5J4MA 1BHGA 1HEZA 1H15A 2DYPD 2XA8H 4WU5B 5SX4H 3UJTH 3QUMB 4GQ9L 4MB3A 1KTDB 4XBGA 3VFGH 4X6BB 1XF5A 4F7TB 1MH5B 5EU5A 2X4NA 3UTZA 3DXAE 4XWGH 3FHQA 4O4YH 4XNQB 1WWBX 3KYAA 3K8LA 5F72S 3KYNA 1OW0C 1A6TB 1RULH 1T1ZA 3SEPA 2BY0A 3C60C 4OZ4A 4YUEH 3BISA 5BS0E 4QGYA 2FH8A 4P3DB 5IW6A 1QLEH 3MJ8A 4UUJA 3RZWA 4HJGA 2F8XC 1YEFH 2BOCA 3MRCB 1JPSL 4XPGH 3S35X 3O3AA 4PD4K 1NMCC 2ZSWB 4U1NB 1SQ2N 4PRIE 5ECJE 4WDIB 4HUUA 1DQMH 3DVGB 3QEGL 3INUL 3HS0A 1YY9C 2F8VA 1DBJH 1T66D 1QFWI 4MNHB 1DP0A 3D2UA 3QHFL 5L2KA 3NACL 3AY4C 3FL7A 4OGAC 4X7TB 4HKXA 5BJTB 2FSEB 2IMMA 3VW3H 4L9LB 3DRQA 4D0DA 1G6RA 4EDXB 5FM8A 1T89C 4TOYL 4IMKC 4FQ2H 2GK0B 4LHUD 1AP2A 3VXRB 1G84A 2Z9TA 4OZGE 2NNAA 1AGFA 5TDNA 4HEME 5FO7B 4FXGB 2BX5A 3V0AC 3CDYA 1CGWA 2DM4A 2ILLA 4MJ4A 5AYUH 5C0BA 3WXVL 4EI6A 3QEQD 3C5ZC 1JNJA 5I18H 2X4UB 4OT1L 4G8IA 5FYLH 1A1MB 2Z93B 3DBXB 2EDDA 2XT1B 5F7KC 3IU4H 4HKBB 1TVHB 1YYML 2A6KA 5FYLD 3TJHC 1RUAL 4KTEL 4JM2D 1F3RB 4MX7A 4NZRL 4K9EH 4YE4L 1CGUA 1X7QA 3BKML 3MREA 3QPQC 5HHNB 2Y4SA 3OXSA 3S96A 4OD3L 2F19H 5DD5L 1HILA 4XWOC 4M00A 1EZVX 5EZOL 4C55A 3SOBL 1BFOB 1C5DA 3DETC 1QFWM 4R4FL 3TCLB 1NEZA 2FB4H 3O6LL 3WD5H 4BUHA 2ARJB 3AAZA 4X9GA 5DRWA 4JN2A 4KI5C 4AL8H 2YD7A 4NC0B 2VABA 1BJ1J 3PP3H 4R7NB 1J0KA 3FFDA 2PETA 4I3SH 4YDLC 2IAMC 4NKMA 5FOBA 4HIIA 1CE6B 4HLZH 4NWTL 1OGTA 1FNSL 5IM7B 4AMKH 1OF2A 4L3EA 3OGCB 1Z6JT 1S7VB 2RCSL 4G7YH 3KHOA 1ZT4B 3NCFB 3WIIH 4YPGB 5IT2L 5MEPB 1EXUA 3BWAB 5I1GH 3KXFD 5F7WC 5T1DL 1RD6A 2BVEA 1E4WL 1OW0A 1CGTA 1HIMH 3C60A 2F54D 1T0MA 2ARJQ 1JWUA 1IGIL 4X98A 3NIGF 4CU7A 2R4RL 5EUKB 2BC4A 3UPAA 4ZFZA 4QHMA 1Q9OB 2B2XL 3QXVA 2FWOA 2H32A 3B2VH 4L4TD 4OAWA 3QUXC 1NCUA 3VXNA 2V2XA 1A7PL 1YEJH 4KK6C 4U1GC 1KELH 2PYEA 3CNKA 5T3ZH 4PRBA 3U46A 3BRFA 3MA9H 5ITBH 5E08H 2VISA 5T3ZD 3AY4A 4D3CL 4C4KT 1U6AL 3VFWA 3LS4H 2AEWA 4HBQA 1GH7A 4MA3A 1BBDL 1I1AB 1I8IA 4HSQA 3UYRL 1F3DH 5F88B 4N0YL 4O51A 2X89D 2DQHH 1JHTA 1T89A 5IBLC 4OI7A 4UAOB 3UC0H 3CZFB 5GGSB 3N50A 1AI1H 4IMKA 4LCIL 4RIRB 4TSBH 5CINH 4OCSL 3RWJA 4BZ2H 4MJ5B 5FHAL 2F8OA 3MRKB 5D1XB 4K71B 1WC7A 2BSSB 3ESUF 1H3UA 5F89A 4L4VD 2DIAA 4UOW1 3WCYA 4EI5C 4AG4L 5J06A 1IC7L 2XICA 3TBYA 1NBYB 3DX8A 3IAQA 4U3HA 3U9UB 1IC1A 1EEUA 4I0KA 1NMAL 5DUPL 2ZUVA 2PCPA 4JO2L 4M7LL 1MRDL 3D39D 1YN7B 2XRAH 3SKOB 2NY4B 4X6DB 1T5XB 5D5MA 4PV8B 4J3TA 2OTPA 1J7VR 1NUGA 5AWNL 2AJUL 4R3SB 5DC4B 3QNYB 3ARSA 2X4OA 1CD1A 3GMOB 5IQ9B 1NC4A 1OB1A 1CICC 4Y4KA 5IROC 2HTLD 2Y06H 2PN5A 4FTVE 3KPSA 2ED7A 4YFLF 2IAMA 1SMAA 2FX9L 32C2B 4OSUL 2IAND 5D2LF 2F15A 1X44A 4NOBA 1G7LA 5LCVL 2IQAA 5FYJE 3WIHH 4GBXD 2AJ3A 1NCDH 1V3MA 2AJSL 3KYKL 3PHQB 5F7UA 4NRXA 2E9JA 4L3CB 4I5BB 3V5HB 5I76A 4ORGA 2VLKD 4JO4L 3U7WH 3GNMH 5IHZA 1WFTA 1JWSB 2PYEE 1JF6A 1F4WL 1ED3A 3ES6B 4Q9QL 2V7NA 8CGTA 1CVRA 3CJJA 3BEVB 2UWEA 1DBAH 1IMHC 4QHLA 5CBAA 4N1CA 5TFSL 5HYQB 3LD8C 1VENA 1S7UA 2L7UA 4M7KL 1A6VH 1INEL 4QWWC 4GAJL 4I48B 3QUXA 4HPYL 4C83B 1W0WA 2GTZA 3RFZC 2MFNA 2BSED 1FP5A 4LBEB 4AEFA 2QTEA 4MMZC 1RHHA 3LKPA 1U3ZA 1I3RA 4WGVB 2FJGB 2WWMC 3CCHB 4LCCB 2J6EA 3STBA 3MRPA 4MA7H 5DEGB 3BYTA 4PP1C 5KSUA 2OCFD 1MIEH 3GM8A 3LQZA 3I6LE 2MPAL 2P47B 3WO4B 4EQ3A 1AKJA 1FC2D 1KLUA 4UQ2A 4YAQB 4ZTPL 4E0RB 8FABB 3PP4L 1T20A 4LPYA 3RWGB 2FZ3A 4EZMA 3L5WB 2D31A 5KVDH 3RVWD 3WLBA 4FQJL 1PSKL 5TDOA 3ZYJA 4EI5A 3BPNB 2WIIB 5DHVA 2AQ3A 3FB7B 2AQ2A 5F1SA 4K8RH 4G9FA 1WFOA 1FNEA 2H6PB 5EIIB 3PWPA 5EC2A 1NKRA 3GSVA 4G43A 4K8RD 5CMAB 2YKLH 2CO7B 4O2FB 1IQDA 4KI5E 3NGBB 3S88L 4FMFA 2Q8AH 4TNVK 4DZ8B 4LNRA 1A0QH 3KPSE 4CGTA 1PKOA 3LB6C 5H2BA 5C0JB 1KCKA 1YEDB 3SJVB 1C5CL 3UTQB 3MXVH 4QF1A 2VH5H 3P30L 4JFYA 1QNZL 3DTXA 4MJID 4JFZL 4UOW0 3WUWA 4X5XB 5I1LB 1BOYA 1EA9C 1OVZA 2R56L 4CDGC 4JRYB 1CFSB 2ZCHH 1N5AA 1CICA 1G7MB 5IROA 5B22A 4EOWH 2Q76A 3WSQL 4U0RB 1SBSH 2X4RB 4R4BA 5DS8A 1XR9B 3JV4B 5E7FA 3TEUA 3GSWB 1VERA 1A3RH 5HGDB 2H41A 2VLJA 2DQDH 3QRFM 5BV7B 3MNWA 3ZE2E 2NMSA 1J1OH 4U1KA 2FD6L 4X6FB 2QADD 4QXTB 1L6ZA 2W38A 2YS4A 4OD2A 1WIPA 5JOEA 4FRWA 4K3DH 1KIPB 4ZO8A 5BQ7A 4PB9L 4Y2DC 1VCAA 1UKSA 3E2HC 5DQ9A 1WT5C 5SV3A 3IFNL 4IJ3B 4MQSB 4JDTH 4PGBA 5JW5A 1JWMA 1NGZA 2CLRB 1SMOA 4JHAL 3RY6C 3QDJD 1U8MA 2VZUA 3QIBB 4B50A 3V4VL 1QBLL 4TTGA 4Q9CA 1DEEB 4MSWB 1ZTXH 3TA3D 4XP6H 1AO7B 2ENSA 1W72B 4KUCD 4YHNA 1UB6A 4R9HA 4Z7UF 5F96H 3SO5A 3BVNB 2P4AB 1XF3B 3O2DH 3SY0B 4DGIH 1TZGH 1WCBA 1DUZB 1LWRA 4L8BA 4MQTB 2W65B 4GW4B 2MQ0A 1J8HE 5HYSB 1EO8H 3PUCA 1RZ8B 4G9FE 4OIBA 2EE6A 3DGGB 3RRQA 4HXBH 3ZKND 4GRLC 1UWGL 4OCXL 4RWYH 1HQ4A 2X1WL 1JF5A 2GCYA 1RVFL 3TFKD 1EDQA 2Q8BL 4KRPC 4BQCA 1FGNH 4NN5C 3SE8L 4NHCH 1HH9B 1VPOH 3MLXH 1DFBL 3P11L 1OWRM 4U1JA 3GHBL 1UACL 1HYSD 4IRZH 4HJJL 4KJPC 3MLZH 3L3KB 5IJKA 5GZNC 3BH9A 5CUSL 1OHQA 3FONB 3VRJA 1KIQA 4I1NB 4P5TA 4S1QL 3GSXB 4QRRB 2ITDB 5ADOL 4NQCA 1DVFD 1QHPA 3FQNB 3DHMA 2V2WB 4OFDA 2HVJB 1YMHA 2XWJB 5EB9A 2GTWB 5JW4Q 1F45A 2JJUA 4MXQD 2QBWA 4R4NC 5D1ZB 5E2TH 1Y6MR 1JGVH 2ZZUT 3OJDB 3P4OB 4KTDL 3G5VA 1HDMB 1NDGB 1LEKA 1AY1L 2EIDA 1UWEH 3O3EB 5HY9A 3MO1B 1I8LC 4JREC 1LDPH 3QWRA 4LSSH 3M17B 4ENED 3TT1L 1ND0B 2W0LA 3FT4B 3JBG7 1DQDL 2P5EB 5EBMA 1DBKL 4OM1H 1UQSA 1QFUL 2FCBA 1M7DA 2X70A 4NPYA 2DDQH 3QDHA 1XH3A 4LF3A 1BD2A 1HSAB 5A2JH 2FECI 1WWWX 2DM3A 5DD0H 2OL3A 1MIML 5CSZB 3UJIL 5JDSA 4Y2DA 4LVNB 2OR9L 3EO1A 3T1WA 1BPVA 5HPMA 4FFZH 5JIPA 3H9HA 5IW1A 2GJZA 3VXSA 4AEIH 1X5IA 3ARGD 3S5LB 1H8SA 3LKOB 4RZCB 4DQOL 4YHML 2A6IA 2PR4H 3IXAB 4LCYB 1T1WA 1IEBA 4DEPB 4K23L 4N5ED 1TPXB 5MEOB 4KZEH 3KPMA 4PJ8B 5J3HD 4JKPL 2BNQB 5E8NB 1HSBB 2X41A 4U6XA 3WIFA 2OJEB 2CPCA 5DUML 1JNNL 3FAWA 1WZ1L 4P2RB 1CZ8H 1G9EA 2MQ3A 4ALAL 1I85C 1P4IH 3ULVL 4MA1B 2P7TB 4PLOB 1MHCA 1VFOA 5HYJB 2XTJB 3IFOB 4M62H 1IE5A 5DRZA 3BQUB 2EYSA 4XH2A 3PDGA 5D93B 4WEBL 3HR6A 4HUXA 3OKMA 3PGCA 4LIQE 3EO9H 1K8IA 2DQIH 2R23B 4GRLA 4ZOBA 1YPZA 3LS5H 1KOAA 1ZE3C 3BE1L 5D7SL 1CDIA 1R3JA 1LQSR 1LEGA 3QCTH 4OCLC 4NQCE 3TVMB 2DQUH 3ARFB 3IS1X 2DTML 2CD0A 4HK3N 4OCYH 4OGXH 1CE1L 2E8YA 5FCUH 3ARXA 5DJ2B 3E6FB 4YK4C 2C4XA 3VGBA 3ZTJH 2ATPA 3OX8B 5CEZD 4NDMA 4ZTOL 4TVPH 3NIGE 4EN3C 3O4OB 2JJTC 4CVXB 2HMID 1B0RB 3BT2H 1J86A 4TVPD 2ZSVB 5BRZA 3KYOB 1QQDB 4ZSOA 4WI2A 2X09A 3UEZA 3DOSA 5DMJB 1AIFB 1Y0LA 5I19L 4LCWA 2OI9B 5ESVA 3JSSA 4LKXA 4Q58C 1JGLH 3L7EA 3MJ9H 4MDJA 3TYGL 4LPVA 1FHGA 2ADGA 2AV7B 3ZDZF 1M05B 2CDFA 3MLTA 4KKBC 1J05A 1AD9A 5EO0A 1BD2E 3WFHA 5HVHB 2WZPD 4N0UA 5BZWA 1LILA 3H9SB 1C12B 1JJUA 5C7XL 1I8LA 3WFEH 4L5FL 3EYOA 5D2NC 4FQHB 1F4YL 4LU5L 5FB8A 3O4LE 1OPGL 4Y5XC 3IF1A 3QR2A 3HPLA 3PGFL 2BVOB 4JRXD 2BCKA 4K7PH 2YEZB 4KDVA 2JK5A 1E6JL 5GGTH 1FNLA 2ZUQB 4PUBH 1OAKH 3IDIB 4FQPA 1SY6L 5CCKH 2QQKL 5DVNA 5GSVB 4FP8L 3F7YA 1V3JA 3CMOH 3U7YH 2JE8A 5E03A 5EORL 3DMMC 3PHOA 4NGHH 4NBXB 4O58L 4Y5VB 3VGAB 4GT7A 3Q1SL 2FO1A 2ZKHH 3HA0A 4ACPA 4U7MA 3FQTA 1Q1JH 1EX0A 3CVIH 5HHVH 3TWCL 4F7MA 1CLYL 2GK2A 1K5NB 1T04B 3GI9L 4WTXA 1EFXB 5C1MB 3F12A 1JZ6A 4ZXBB 3VXUA 4H5SB 4MNQE 1JVKA 3CFBB 3TV3H 2BXZA 3CLFH 1I85A 1GYAA 5GS1B 15C8L 3D0VB 1P2CB 3TIDA 3VFRB 4WJ5A 3I9GH 3NABH 4XVTL 2IBBA 1KUMA 1I8MA 2QQNL 3MRMA 4Y19A 3BESR 3RX5A 3DARA 4LSRH 4BSJA 3D25A 3KNBB 3FT3B 4H88L 5JNYB 2FEDC 2HT4C 5D2LE 1T7WA 4DTGL 1CXEA 5GS0D 1NAMA 4RAVA 3B3IA 4NIKB 3LEYL 1JP5A 2BSTB 1LP9B 1F6FB 4W68A 3MV8B 3DI3B 2BHZA 1M4KA 4ZSOE 3WNMA 1KB5B 3HNVH 4JO3L 3I6GB 5FA4B 3FCTB 1YY8B 1KJ2L 2HYMA 5IK3B 3QI9D 4LLDA 2HRLA 4P23B 3TT3L 4W4OA 4EN3A 2R1YA 4F8QA 3PJSB 2JJTA 2NY1C 3DX7B 3MLRH 3H7LA 1OSPL 4M1DH 4EVNA 1MJUL 4YDVB 4RGNB 4U1MB 1YEIL 1JF1B 2DM7A 1TCRB 1UFUA 1H3XA 3C09C 4CRPA 4RMQA 2WQ8A 1HHIB 3VFUA 2VXTH 4KV5F 35C8H 5IWLC 4HGMA 3FQRA 1PLGL 3KPPB 1YC7A 3AXLA 1S5IH 2O5XH 1IL1B 2F5AH 3FMGH 5H35A 3CLEL 5CJ8A 1ZHBA 1RZGA 2YK1L 1QSFA 3HFMH 3LIZL 3K4AA 1HNFA 2D7MA 2ED9A 5HVGB 2C1OB 5SWSE 3S36L 2WUBL 4HS3B 5EU6A 1A6UH 2ATKB 5B38A 1D6VH 3LRHA 2VXSL 1KGCD 4CN6A 4LDEB 2OQJA 4G8FA 4XCYB 1VESA 1KCRH 4Y5XA 5C0ND 2H3NA 3FFCE 3MV7A 3VMOA 3K1KC 2APVA 3GKWL 3EZ8A 3SDAC 4KGJA 3W0WA 3EYFB 5GIRB 3TO4B 4YH6A 4AENB 5ENWA 4WI8A 4IDLA 3BP6B 1I7ZA 3ZTNH 1U93B 2H8PB 3VJ6B 4IMLA 3DMMA 3SKNB 5I16B 1MAKA 3ZT5A 3BUTA 1MEXL 3HC4H 2OTUB 5B4MC 1F90H 1I1CA 2HFEB 2OR7A 4EBQH 4G5ZL 6FABH 3QXAB 4EXPX 1NUDA 2RIKA 4JZJC 5GGRA 4NJ9H 3EYVA 5KBNC 3P0YH 4JFQA 1ZS8A 3OKOA 2IQ9H 4RX4D 3FOLA 1J1PL 3ROOB 3H7BA 2ERJC 1NEZG 3F6LA 5I1IL 1EBAA 3HKFA 1P7QA 5JIHA 2VKXA 5CD3B 2WWKT 4OTXH 5IEKA 3PL6B 4MLSA 4K2UL 1BQHA 2L4OA 5E95B 3G5YB 3O6KL 5CKAA 4QXGH 2EZ0C 3RAJL 2YPVL 1XIWB 1B0GB 4P0DA 2DBJA 3VXOB 1NFIA 1LO0L 3ETBF 2R2EA 3MYJB 5DJ8A 4LHUA 3PNWA 1CTNA 4YFDB 1KXVC 1NUFA 4OV5B 1XF4B 2R0ZL 2IFGA 5E99H 2JCCB 4X8JA 3R8QA 2D4DA 3K4DA 1NL0L 5E8OA 5GSRB 1A7QH 2HTKD 2VDNL 1NBZB 1FSKB 3GB7A 1JRHL 4KKLD 2VDLH 2VIRB 4I18C 4PLNC 3P73A 1RJLA 4JVUA 5GGVY 3D9AH 1KTKE 3UO1H 3RPIA 3K2UH 5J89A 1ZEAL 4KHXH 3HE7D 1FVDB 2DQEH 3O2WH 5FUOH 5D2NE 1ZHLB 5ICYA 3G5XB 4XP5H 5I8KH 2ZUYA 4B5EA 4D0BB 2WINA 5I1HL 3MJ7B 5IVZB 1UJTA 3O0RH 2Q6WB 2VE6B 2AJZB 4Z7UE 2P8MA 3ARDB 4WI3A 3U0WL 2ITCA 3W0WE 4M9OA 4PV9B 3KLAA 1AC0A 3GHEH 3BIKA 5CSGA 3VXPA 1ZGLM 1N8ZA 1BGXL 4APQC 3V8CA 4P9HH 1CGSL 4IRSD 5B21A 1MWAH 4QHKI 4LLAA 3U36A 4OJFL 3HNSH 3SDAA 4ZUUA 4AK1A 5F9OL 2YZ1A 1EZVY 3P9MB 5C07A 1ZHNB 4LFHD 4OQTH 4P59H 3RGVD 3H0TA 3LQAL 4JANB 4RNRA 5SWZA 4XBEL 1EK3A 4NN7C 5I1EH 2XN9B 1ONQB 2DD8H 4K7FA 1JHKL 4CMHB 1I7UB 4HIHB 4KKCC 5DGQA 5FKPB 3QH3B 5ADPL 2MHAB 2EYTA 4LSUH 4OF8A 1LVEA 1Z9MA 1G7JB 3ZHLA 1G9NC 2F74B 5FK9B 1KLGB 4R7DB 3O8XB 1U8IA 4HKJA 4JZJA 4H26A 4UDUA 5ILTH 3T3PF 1RUQL 4XNMB 1YN6A 1CDJA 3FN0L 3WHXA 5IVOA 2GI7A 3QFJB 5L2JA 1DSFH 1OGAB 3P9LA 4XPTH 5HYFA 1KB9J 5F7EL 1FNGA 4OCMC 3WLWC 4E5XB 5L7XL 4CNIB 4KU1A 1A4KA 3K1DA 4NKDB 1OQOA 2VR4A 3WNLA 3THML 1D3CA 4TNVF 3EOTH 4YHLH 2AJXH 2DKUA 4OCRH 3NIFE 2QSQA 1D5XB 2EDQA 3QQ4B 2BNRE 1HHJA 1J0ZA 1QFPA 1J11A 1CF8L 3VFNA 5IQ7H 3VWJC 5D70H 2Q7NA 5CS7A 2AV1A 1QRND 5EO1A 3BKJL 1E4KC 1A7NH 3JWDH 3KVQA 1T4KB 3PXJA 3C6LB 5H94A 2FO4B 3HZKB 1SEQL 4X83A 4PJ5E 4TSAL 3MV9B 1XZ0B 3R4DA 1YMMB 1C08A 1A3QA 4LP4A 1FVCB 2E7LC 4GW5A 4X7DC 3P40A 1EAPB 4Z8FL 1BJ8A 5DZLA 5JW4N 4FNLH 2H9GB 1IZKA 5DWUL 3M8OH 1FFOA 2PTTA 2XYCA 43C9A 4F3FA 3OKLA 1CT8B 3IXTB 5JHDD 1IRAY 2CKBA 2I25N 5E1HB 5JOFB 1N0LA 2DL2A 3UJJL 3VI3E 4NQUA 1IC4H 3S3SA 4OFKA 3EDFA 4UT9L 1EIBA 1MRFH 1KENL 1JK8A 1NANH 3SQOL 4OLVL 1QLRB 1RPQA 1T2XA 4NQDB 1TITA 4APQA 2CRYA 3NPSB 4JFXA 1I75A 2QV2A 2FH6A 5LQBL 5EU4B 2QHRH 5ACZB 1J0HA 5K9JL 1IILE 3EYSH 1U8NB 1JRHI 5J11C 2GJJA 3HMWH 4EKXA 3U4BL 3H3BC 4Q6IC 4U6YA 3QPXL 1AD0A 4QXUL 5IR1A 3MRHB 5F7DB 1V5JA 4XC3H 5FHBL 5DEFB 5MEQA 3E1F1 1UJ3C 3MOBL 1OAUL 1M6OA 2GSGA 3O9WC 5GRVL 4LAQL 1DJSA 4YXLL 1FE8H 2IPTL 3IDJA 4S1RH 2B1HL 5BS0B 3E0GA 5GZOC 2Y5TA 3RL1A 4CDHA 4NNPL 5E4IA 4YHYB 4QY8A 3GBML 3QHZH 3DIFB 5E4EC 3AREC 2AXGB 1KJVB 4MD4B 2Y7QB 3WUWG 5E8PB 4CW1A 1FG2A 3QULB 3LSOA 3VFOA 2NX5B 3X3GL 3QWOB 4LRNL 1G7PA 5IUSA 1CFNA 5DFVC 1KPRB 3ZDZE 5FYKL 5I66B 3NFNA 5GGQH 1EGJH 1NBVH 1HI6A 4HMCA 3LKRA 5DTFB 1F4XH 4PJ9C 3QUZB 4PJHF 3LZFL 1KC5H 4FFVD 2OP4L 4HWBH 1I9JH 4KMTH 3MJGX 5SV4A 5TJWK 3T0BA 3QG7L 4WI9A 1I1YB 2AJVH 5EZJB 3VWJA 4Z95L 3DUSB 5GGUA 3REVA 4JFEA 1E4KA 4PREA 4NRYA 4OUOA 3ARRA 1PY4A 2I9LB 1VFBB 3MCKA 4FZEH 2CJUL 5CZXC 4ODTH 12E8L 2E7LA 1VACA 1UB5B 4GMTH 1SJHA 1PYWA 1DUYA 4MJ2A 3WEXA 1ZT7A 1MF2L 1MY5A 5CZKA 3BZEB 4YNYA 4Y8AA 5T1KA 1MQKH 4XCCL 3ILQD 4LASL 4GRWB 1QA9B 1P84K 3F7QA 3BKCH 3STZA 4Z18A 2ZOLB 1INQB 2DKSA 1E4JA 5A43C 4XPBL 4HUKB 4EDWL 2IH1B 4D0CA 4MA8H 4GAGL 4N8PA 1M71A 4W6WB 4ETYA 4YDKH 2YUWA 4ETQA 2NZIA 5JQHC 1D9KC 5EIVA 4PP2B 3E6HA 4HT1H 5DMKB 2OMNA 1L9NA 3U4EB 4GW1B 4GMSL 5KJRL 5JUEH 2I5YL 3N1MC 5IFAL 3NPZB 2V7HB 3DV4B 2RR3A 4Q6IA 2VZ1A 1A1NA 3U6RB 3DVNB 3MLYL 3JWOH 2C7UB 3H2WA 5GPRA 5I8EB 3OAUL 2DJUA 3ZO0A 5T1LB 3RZCB 2HKHL 2A9MH 1UJ3A 2NY5L 1IGMH 2ICEA 4WWID 3VGEA 2HFFB 3O9WA 4M5YL 4MCYB 4JY4B 1TZHB 1N3NA 3UYOD 4Z6AT 2DQGL 4KZDL 1E27B 5CWSB 4HFUH 1DBBH 5AZ2L 3S4SA 4XCNA 3MGAA 1KJMA 3ZE0F 3CFJB 1P7KA 1R3LA 1BX2A 5I0DA 3C2SA 4N8VB 2F5BL 3VFPB 3MLWH 2DQFB 4HIXL 5K59F 4K7PX 1BF8A 4KV5E 3ZSSA 3RX7A 5EH1A 2Z4QB 3UBXA 2R1XA 5FECA 4ELKB 2F53D 2LU7A 3MLSH 25C8L 3OR7A 2FL5A 3PF2A 4JFEE 4MJ6A 2GITB 4JLRA 4ZD3H 1TCMA 2HG5A 2P46B 4HPOH 5IGXH 4S0SD 1Q9KB 1RIHH 4XNXH 3O41B 5HHQA 1U95A 2WBJC 3UZQA 4UU9B 4PJ9A 1GZPB 4GKSB 3LH2H 5EOCH 3CXHJ 4FQLH 3TBTA 2XG5A 3FZUC 2LVEA 2P24A 3AMLA 3MUJA 3SDCC 3TM6A 4XPHH 2Z31D 1EJOL 2ADIA 3A6OA 3MRNA 4QXWA 5E56A 2HLFC 3ZKMD 1A9BA 2YR3A 3GGWB 1AXTH 1LE5B 4PRHE 4JY6B 2YN3A 1X5GA 3LKSA 4FXLA 3LRSA 5E1AB 4UQ3B 4XVUD 1B6DA 1NGQL 5IB4A 3BPLB 1MHHA 1WVZA 4WFFE 4R97B 3HC3L 1IGFL 4JDVA 1OCWH 2OZ4L 5EU3A 1G7IA 2WNGA 1FIEA 4PR5A 1F3JA 4XP9H 4WHYH 5DVLA 1JFQH 2PUQT 4O9HH 3HG1E 4HG4K 3SGEI 1S7SB 3L95A 1RJZA 2WLYA 4HKZB 4LQFL 5DMYA 3LV3B 1EERB 3C08H 5C0GB 1KXQE 3GMQB 1D9KA 5AEAA 5JZ7C 3RDTC 2E6PA 2YD5A 4XZUB 4NJAH 5KN5A 4PGCB 2BRRH 4FTVB 5I1KH 2YA0A 3T4AA 1VDGA 3VH8A 5DJ0A 5FA3A 1LK3L 3KPLA 4WWKC 3IRPX 4O5LH 5L8KB 1R24B 2P48B 4M6MH 3P77B 2EYRB 4LSTL 5DJ6B 1JN6A 2W60B 4HW6A 2H2PC 2Y5EA 4NNXA 3UAJC 3QDGE 2CUHA 2NR6C 3O6FD 3DX9B 4P5MB 2ZUSA 4IIQC 1A02N 1SM3L 4PRDA 3LKQA 4LMQE 3OV6A 3PQYE 3R1GL 4X7SL 4BFIA 4IRJD 3TJEL 4ODBD 5EC1A 2I9TA 4FQCL 3OKEA 2YZ8A 3HMXH 5HDBF 4XRCA 1U8QA 2IMNA 1I4FA 1JCKA 3QP3A 4NOFA 4RMWA 4UV7L 3MRRB 2YRPA 1AGBA 3SE9L 5AZEH 4W81A 2BJML 5E00B 1P1ZB 4OF7A 1QSEA 3MRFA 1YNLL 3L3OA 4LLQA 1OAYL 4TYUA 4QRPD 3G6DL 2WP3T 3I2CL 1T22A 3U2SB 1KBGL 5CIPB 2WBJA 5D72L 2RBLA 5HGBB 1LK2B 4X6DF 3D1MC 1WTGT 1WBXA 4XNUL 2XFXA 4K3EH 4HEPG 4POYA 3SCMD 3T4YA 2W0PA 5TF0A 3LN4B 1MFBL 3SDCA 3VXMD 3P4MB 1FZKA 5D6CA 1RU9H 1GC1L 4FZ8L 4QYOA 4M48H 1U3JA 2WBKA 3IU3B 4ONOA 2WM0A 1FL3A 1RZJC 1AGCA 1QVOA 3ULUL 1IFHH 3M45A 4OFIA 3GMMA 5C0DB 5ICZA 3RJQB 3VRIA 1FL6B 4UB0H 1KPUA 2PXYD 2VLLA 4MVBD 1TZIA 3WNOA 4KVNH 5E5MB 1I3UA 2V2TA 2Q3ZA 4L9LC 5F3BA 4G8GA 5MENA 1UA6H 1HH6A 4JJ5A 3R06A 4JFOB 4P2QA 3BDYH 3REWA 4HUWB 4F7CB 5H37G 1QO3B 1J1XH 3MLPA 3QIWB 4KQ3H 1T5WA 2J8HA 4HC1H 1NC2D 2DLFL 4P9ML 5HHXL 3LHPL 4M8QA 3TP4A 2YMXL 3RIFK 2XZAH 5CJQL 2LABA 2R2CA 4J6RL 4O00A 4X7FC 5KVEL 1A3LL 4WWKA 5C0AE 5F6IB 1I3GH 3ILPA 1HXMB 5JORB 3BP5B 3VFSA 4JB9H 3D3VE 2ZUTA 3C6SB 3KPTA 1HKLH 5FDWB 1UVQB 1XEDA 2DIBA 4KK8C 4AEEA 3MUGA 3GMRA 3WXWH 4PJHA 1C5BL 3KPRD 4IIQA 4JG0H 3S37H 3CDGA 4F2MA 4G6AD 4L8CB 3IVKB 1XT5A 1HQRA 1QSEE 2V9TA 4YHKL 2RAMA 5ITFB 5SWQB 5T33H 5ALBL 5FO9A 2A1WH 3NFSL 4QRSB 1G7HA 1IARB 2XKSA 4P3CL 3L3GA 5TE4L 2Z35A 4M1GH 3KPOA 3D5OF 1G9ML 3A6CH 5IHUL 3BEWB 3D18A 1I9EA 4UIKH 4BQBA 3DRTB 4MS8D 1ORQB 3LPWA 5JA9A 1J5OH 1G6RL 1SJEB 3EAKA 4WU5A 2Y36H 4I2XA 3U48A 4M6NL 4NO0B 2EC9U 5B38G 4RGMB 3QUMA 3HI5L 1KTDA 1ORSB 4X6BA 3CU1A 2G5BB 2P5WD 1MH5A 4F7TA 2VXUL 5EUOB 7FABL 1LDSA 5B39B 5D7LD 1MCOH 2R0LL 4FQQB 5CP7B 2CIIB 5K9QI 1A6TA 2EO1A 2VL4A 5J12B 5ISZB 4F7EB 3QEGH 2UZIL 4EJ1C 4P3DA 1KJ2B 1UM6H 4G6KL 4XXCC 3RNKB 5CZVH 4UDTB 3MRCA 1JZ2A 4J1UB 4U7KA 2ZSWA 4PLJC 4G8GE 4U1NA 5MENE 1RUML 3HRZB 4KPHL 4WDIA 4Y1AD 1CXHA 4OLWH 4P2QE 3DVGA 5DI8B 4P4RB 1YEEL 5FYKD 2MCPH 4MNHA 3A67H 1U0QA 3TPKA 5DMGD 1BQSA 1RJYB 4JPWL 1F5WA 4X7TA 1A14L 1U8JB 1N7MH 5TQ2L 2C3WA 2FSEA 5BJTA 5C08E 1YJDH 2YD4A 4L9LA 2KQNA 4EDXA 4UAOC 5GJTL 1DTUA 1H8OA 4PJ7B 2GK0A 3BMWA 3VD4A 1BQHG 2V17L 3OG4B 3VXRA 5IBTH 3QCUL 3S6CA 3DJ9A 2OJZL 4MGXA 5D1XC 5FO7A 4FXGA 3HHRB 4LHUG 3DSNA 4PJHE 1R3IH 1AHWB 1FIGH 4FG6C 4IOFD 1MHPH 2X4UA 1A1MA 2Z93A 4HKBA 5A3IC 4V1DD 1TVHA 1Q0YL 3B8SA 4YDJB 1NFKA 3SKMB 3ZL4L 2LU3A 3SGJC 5F8QC 5IB2B 1XF2B 1BM3L 2YPLD 5HHNA 5DJYB 1ZLSL 3FO0L 4YEFA 2R0KL 2GJ6D 2NY4C 2J8UB 3RUGE 1V05A 1A6WL 5HPOA 4JQVC 2EXWC 5T3XL 1P7HL 4PLKC 1W8OA 5DLML 4G6MH 1F02I 2R9HC 3SN6N 2PW2B 3CPLB 5M94B 2ARJA 3V5KB 4X4XB 1D5IH 5C09B 1CFQB 4M1CC 4DFIA 3MXWL 4R7NA 2EECA 1FLRL 5IT2H 3DUUA 5J6GB 4UTAH 3RVXD 1NSNL 3OKDB 5CP3H 5BMFH 1M7IB 2HVKB 4N90D 1CE6A 1U2HA 1TQCB 4E41D 3K4ZA 4YHPB 5HI4C 5E8DL 4WY7L 1JYVA 5IM7A 1FPTH 2E27L 2XWBB 1IGIH 4I3RH 1F6LL 3CSBA 3OGCA 1S7VA 1GGBL 1ZT4A 4Y88A 2NZ9D 4PRPE 4YPGA 1FGVL 4R8WL 5DA0B 5MEPA 4YBQD 5E6YA 1DLFL 3BWAA 4OD1L 3K3QA 2PO6D 1AXIB 3MRLB 2R39A 4NUGL 5EUKA 1XGRB 3VCLB 4XXCA 3RKDC 4AYFA 1FORH 1Q9OA 1EHLH 2B4CH 1KNOB 5FM4A 2FHFA 5HI3D 5J7CC 2D03H 3L1OH 1LD9B 5EOQL 4IOSD 2Q1EA 3WO3B 4P4KB 1U58B 1YEHH 4LGPB 1DE4B 4KKAC 2GQHA 3VXRE 2W91A 3ZE0E 3HI6H 1SEBB 1VEOA 1KACB 5I17B 3EDJA 4O02L 1I1AA 1CDCA 5F88A 5K59E 1SYSB 2ZG3A 4DGYL 4HGKC 3WO4C 3CZFA 5GGSA 4UINH 2VDML 4RIRA 5TH2B 4YEEA 2JIXD 3B5TA 4X9IA 2X42A 5IB1B 2VUOA 4M03A 3CU7A 4MJ5A 5FEBA 1JPST 1OLLA 2ORBL 5ELIA 5D1XA 4ZS7L 3RVTC 4N9GB 3DYPA 5DUPH 3BKYH 3S35L 2BSSA 2HJLB 4ONFL 4KK9C 2NY7H 4ZFFB 3CVHH 3BPNC 5HYIA 5MHSE 2D0GA 3DHJA 4IRSA 3O4LB 2LU4A 5E24E 5A1AA 2A6DB 4M61B 1NBYA 4ZAKB 1UKTA 5D7JD 5IMOB 2A77H 4I77H 1S7XB 3U9UA 1CD0A 3IJSB 3IDYB 2IH3B 4KAQL 2Q87A 5HJ3A 4MYWB 3NGBC 3SGJA 3QDMB 1MNUH 2IF7A 1QPPA 4JEGB 1YN7A 3ZE1F 3SKOA 1OTTD 4OQTA 4FXKB 4KDWA 3GRWL 4X6DA 4JQVA 1T5XA 4PV8A 1U92B 1CLOH 4XVJH 2NXYD 4R3SA 4ERSH 3QNYA 3LN9A 2J5LB 3GMOA 5IQ9A 3KYKH 4HUNB 3HB3C 4DN4H 3W5MA 4XPAL 4U0RC 1PD6A 2K1MA 3G9AB 2JLLA 4OLEA 1A5FL 32C2A 2CRZA 2AABH 1OP3K 3ARUA 3N85L 4G7VL 3MZGB 5BV7C 3FO9B 2VLRD 5CJ5A 4MNQB 1IM3B 3X3FH 4MNGE 5C0RH 3PHQA 5D1QB 4YQXL 4L3CA 4KRPB 4Z0BL 3EHBC 2CGRH 4NN5B 4I5BA 3V5HA 4AEHH 1JYXA 2QEJA 5IJVB 4HX1B 4M7KH 3P4NB 1JMZA 4GAJH 3DXAD 3EOBB 1JWSA 3QIUB 4ESKA 4QNPF 4HCRL 2HFGH 1NAKL 3ES6A 4IJ3C 3ZZ1A 3BEVA 3FN9A 2ESVD 1VFUA 3RWDB 1QRNA 3IDXL 2XPGB 4UT6L 4Y89A 5K33A 5HYQA 3QIBC 4OV6F 5E6ID 2YBRB 3DSFH 3V8OA 1T21A 4I48A 3RI5K 3AU1B 4C83A 3PWNB 2AI0H 4K94H 4RMUA 5MERB 1KEMH 5C86A 4LBEA 2J88L 4I0PB 2AW2A 2Y6SD 5IHBA 2V9RA 4P46B 2FHBA 5IB3B 5HHMB 5IESL 2FJGA 4LCCA 3CCHA 5HDBE 4ZODA 5I74B 5DEGA 3OG6B 1RZKL 3HAEB 4HQQL 2V5TA 1HZHL 3FN3A 1N4XL 3D85B 1FFNB 4YAQA 4E0RA 1PZ5B 4YXHL 8FABA 3GUTB 1JHLL 2LAAA 3UYPA 3W39B 3RWGA 1DN0B 3MNZA 1ZA6B 4MAYB 4YJZL 5SWSB 4KUZL 3L5WA 1BQUA 2HT2D 3ULUD 1KCVH 4XP4L 3QXUA 4QOKE 3S88H 5I1JH 4KJQC 2WIIA 3FB7A 1FH5H 4X6DE 4XP1H 3RY5A 1C5CH 5A2FA 1JUFB 1C1EH 1LO5B 2H6PA 5EIIA 3FFCB 2Q20A 4NBYB 43CAB 4DAGH 2NY3B 5CMAA 2R69H 4O2FA 3WMSA 1W8NA 5C9KA 4G3YH 3ARBB 3JXAA 3OBAA 4PRAB 4YX2H 4DZ8A 3QUYB 1A2YB 2O93L 4WI7A 3JWOC 4NP4L 4BFBD 2FBOJ 5C0JA 3AB0B 1YEDA 3SJVA 5JPNB 2R8SH 4JN1L 3UTQA 1AFVH 4LOUC 5I8OL 1D7FA 3MRGB 1T1XB 3VA6A 5B8CB 4X5XA 5I15L 5I1LA 2AKRB 5E9DB 1CK0H 1LP9F 3MFFB 4JRYA 1CFSA 4JM4H 3QFDB 3KPNB 1BFTA 2OS7A 5FUZH 1G7MA 4QO1A 1U8OB 2D7TL 4OCNC 2X4RA 3V7AE 1A4JA 1PJ9A 2VZSA 1XR9A 1E0OB 3JV4A 1N2RB 3GSWA 5HGDA 1WISA 4WHDA 4QRUB 1CL7I 3H42L 2ZJSL 5E2UH 4P5KB 4RMRA 3V0VB 1S78D 4M7LT 4X6FA 5DT1H 1GIGL 3NA9L 1BAFL 2DMKA 2F58L 4JHAH 4QXTA 4YFEA 2AEPH 3V4VH 1UM4L 4DVRL 1KIPA 5I30H 3IETB 5JMOC 2KDGA 4ZUSB 5JMRA 2NLJB 3HNTL 4LVNC 3MOQA 1U36A 2FGWH 1X6LA 3O2VH 2CLRA 4IBLT 4NQXB 1MAML 3D2UD 5L2KD 3QIBA 4X80H 1MCKA 3S98A 3UTTE 1DEEA 4DEPC 3QYCA 2EKSA 1BZ7B 3C8KB 4MSWA 1OP3H 3S4SG 4PJ8C 4LLVB 1AO7A 4V1DB 1W72A 2CUIA 4YXKH 1IKNC 3HLAB 4N0CC 4YZFF 5JW3L 2A38A 3BVNA 4CKVX 1XF3A 3SY0A 2BY2A 4UT7L 1BP3B 1DUZA 3BGAA 1WV7T 2W65A 2AVGA 4GW4A 4KK5D 5GS2D 3UBXG 2XTJC 2ZCLH 5HYSA 2NY2D 3BQUC 2DB8A 3MNVB 5D93C 3BX7C 1RZ8A 4DVBB 3SO3B 1Q38A 2V5SA 1JPGB 5C0BD 3IJYB 1WFUA 2FBJH 3GHBH 3DGGA 1UACH 3V6BR 4HGWB 3OB0K 1FYTB 2J12B 1TJHL 3R0NA 4M5ZL 4JZOB 4XPFH 1CTOA 2HTLC 5F7FA 1S9XB 2R0WL 3GK8H 4EIGB 4JR9H 5ABDE 4OBSA 4D8PB 4ZO6A 3BJ91 1HH9A 3T2OA 5ADOH 5F9WB 3SJVE 1ETZB 3N1GC 4JPVH 5TE7L 3W9EB 2OL3L 1XR8B 1YZZA 3L3KA 3KWWB 3QCVL 4DKAA 4UTBH 3O4OC 3SKUD 2E3VA 3FONA 4XI5C 5IBUB 1U3HB 4NM8L 1KCSL 4ONHB 2NYYD 3GSXA 4QRRA 2ITDA 5L88H 4KHTH 3O6MH 4Z7VE 3X11B 2B5IC 5LJYH 3FQNA 4XT1C 3U79A 1JI2A 3WHE0 2V2WA 2HVJA 2OI9C 2VNCA 2XWJA 2GTWA 4XBPB 1QUNA 2H2SD 1IQWL 3CIQA 5D1ZA 1NPUA 1PEWA 4ZPTB 1HHHB 3OJDA 2JCCF 3P4OA 5CFHA 4C56B 1HDMA 1NDGA 4L3ED 2DQCL 3QG6B 5HVHC 3O3EA 3GJFB 5DRNB 3MO1A 4LPUA 4OGYL 3NMEA 1PG7H 1MRCL 1RK1B 4PB0L 3OL2A 1K4CB 2FJFB 3GSQB 4KRMB 2QSCL 4BKLB 1J87A 4CUCA 3BXNB 3M17A 4BK4A 3GSNB 3C60D 1DCLA 1ND0A 3FT4A 2P5EA 3PWLB 5FYJD 2ZUQC 2BDNL 4PJBE 1HSAA 3Q6GL 4DQOH 1GJIA 4PJEE 1CBVH 4MAUH 3VH8G 2JIXB 3NCBB 5GS3A 1AO7E 5T3XD 2W59A 3V4UH 1T7VA 2PYED 1IM9B 4UV4L 4K7PY 5DUMH 1YY9D 1WZ1H 3VGAC 2BNRB 2DQJH 4NNYB 1U8HA 2VWEE 5DRXB 1I9IL 2KUTA 1K6QH 3LKOA 4RZCA 1WK0A 1Z0NA 2VDRH 4OGAD 3IXAA 2FATH 3C2AL 1CFVH 1NH6A 4LCYA 2EDNA 5MEOA 5D9SB 2QQLL 4PJ8A 2IGFL 3BAEL 1X4XA 2BNQA 4PJ5B 5E8NA 4WEBH 1HSBA 1KCUL 3EDKA 3N0PB 5HDLA 5DQJB 1F8TH 1IKNA 4JO1L 5FGRA 4ZXBC 4P2RA 4LAJH 5CIPH 1WJ3A 4EUPB 5GS1C 2P7TA 1YYLH 5D7SH 5HYJA 4HF5H 3IFOA 4A2MA 3UTSB 4H1LB 3BQUA 1Z0MA 2XXMB 1MFAH 1BVKB 1EO5A 3C5ZD 3NCJL 2R23A 1GAFL 2ZPKL 3TYFB 3DVIA 5DUBB 5E6ZA 3KXFE 3GSUB 4J3OC 4QRRE 2MJWA 5F1KC 3TJHD 1E4XL 3TVMA 1IAOB 1BEYH 3WS3B 2JB5L 2OTWB 4LEXH 1ZVYA 3ARFA 3QPQD 1R5VA 4OM0H 3QZWB 4XWOD 5DJ2A 3E6FA 1NCBH 1PX3A 3DWTA 4H8WC 4R90L 3OX8A 4P23C 3WKML 4WNQB 4LARH 4N1EA 1AE6H 4CVXA 1B0RA 1E6OH 2W9EH 2EDRA 4RGNC 4M7ZC 4G80B 3CGTA 1GVIA 2ZSVA 3KYOA 4KI5D 1QQDA 1NC4D 3MCLL 4Y4KD 5JQ6H 4WO4B 1AIFA 3QRGL 3KPSD 3OB0H 4FQXB 4NQTA 4LU5H 2ERJB 2IAMD 3ZTJG 2EH8L 3IYLW 1OPGH 5E6IB 1HXYB 4JE4B 2AV7A 4HH8A 1M05A 2XOTA 5BVJB 4JZNB 1Q94A 5DO2D 4G6FD 3KYMB 1RZFH 3IDGB 1SY6H 3H9SA 4XNYL 1C12A 5EO9B 4NQVB 4R6UA 4S2SB 2G5RA 3VFVB 3HMXA 4FQHA 2ADFH 5DD3L 2JJWA 1L0YA 4MQ7B 4JQIH 3TH4T 1INDL 4X99B 4XMKL 5LBSH 2BVOA 5T5FL 3C87A 3B43A 2YEZA 2YUZA 4O58H 3GBNL 1CVSC 3IDIA 4C58B 3TO4C 1HINH 1MLCB 4DW2H 2LQRA 5HGGS 4NM4L 3QUXD 2BNQE 1PZUB 2DLHA 4DOHB 4KK6D 2IEPA 4Y5VA 1UKQA 2G9HB 4HAFA 1K3ZA 2O5YL 5LG1A 4JKLA 2FHCA 2IWGA 4N0FB 2CMRH 1CGVA 3PE9A 4Y16B 3HC0B 3CX5K 1K5NA 1T04A 4LPXA 4WFHD 1CWVA 5GHWL 3RTQB 1EFXA 1A6ZB 5DURB 5C0CB 4X7EC 1MREL 5IBLD 2K3TA 5E2WH 2DI8A 2WLZA 4ZXBA 5TPWL 4H5SA 3CFBA 4G6JL 4IHOB 1AKJD 1TNMA 1MFCL 4DTGH 4EQ2A 5GS1A 1EUUA 1P2CA 3VFRA 3HI1B 4Q0XL 5FUCC 3PL6C 5DJDB 1K2DB 2IANE 2JB6B 1MJ7L 1XIWC 4Z7QE 4EI5D 1HEZB 3KNBA 3FT3A 5JNYA 1KJ2H 4GXUN 4G9FD 4RISL 4ZUTB 5GRYA 3OR6B 4PS4H 4YFLI 4DN3H 3PWPD 1XF5B 5EOTB 1ZLVK 2VLKE 1NCWL 2BSTA 1LP9A 3MV8A 4X5LA 1C16B 1L9MA 3RA7L 1KB5A 4XHJC 3KYNB 3I6GA 3WDJA 3FCTA 2XA8L 1YY8A 1RUKH 4DKFH 4QNPE 4U3CA 1A7RH 3AS0A 4RMSA 5IK3A 1FSKC 3GO1L 3UJTL 3G6AB 4L8SB 3CFEB 3VFGL 4P23A 4JFFB 1W0YT 2DWEB 3PJSA 3RWCB 3DX7A 4XWGL 4OB5H 1IBGH 4MCZB 4YDVA 4JQXC 3U9PH 4LP5A 4U1MA 3HE6B 1JF1A 4TUOB 4O4YL 1TCRA 4Z77B 5ID1B 1RULL 4G8EB 4YUEL 1CICD 1HHIA 2ED8A 1VGKB 5K93A 1K3IA 2CRIA 1QLEL 3E8UH 3VD3A 3KPPA 1IL1A 1XCQB 2J4WH 5L2KB 4WENB 1YEFL 2NCMA 1NCCH 3ARDC 4XPGL 2VLJD 2XACC 2PYFB 4AIZB 5D8JH 1U41A 2C1OA 4HS3A 1AQKH 5J3HC 2ATKA 3DRQB 4P99A 4D0DB 4F37F 1E4XI 1AR1C 4GLRI 4Q6YA 3V6FB 1GPOH 1DBJL 4NKOB 4Z0XA 4XCYA 1U3YA 1AXSB 4G42B 4YHOH 3QO0B 2NNAB 2BY1A 5FXCH 3SE3C 4OLXL 3K2MC 3EYFA 2VDPH 3VW3L 3TO4A 3DVFA 4AENA 1AJ7L 4BSWA 2WMPA 3BP6A 4NSKB 4E42B 4QWWD 4GRWF 1U93A 5E8EB 2H8PA 3VJ6A 3VD9A 5C8JB 3MRQB 3SKNA 4CMHC 5I16A 3MCG1 2Y07H 2VXQH 5I1IH 2OTUA 2HFEA 5KOVC 3QXAA 5AYUL 3O8XC 3OXSB 2AP2A 2WWMD 3I02B 3P9WB 2A74B 3EFFB 5I18L 3WFDH 5FYLL 4B53A 3IU4L 4YR6B 3LAFA 2B4CC 1C5DB 4L8DB 3ROOA 4PRHB 4PJXE 1NMBH 3MRJB 2MOVA 3EZJB 5DD1H 2EEAA 1CI5A 3T0EB 5I8CB 2Z0BA 4K9EL 5CD3A 2VABB 2FYYA 2B1AH 2F19L 1LP9E 3PL6A 5IG7A 3MV8E 4JCLA 1DDHB 3G5YA 3U1SH 4NKMB 4LIQH 1XIWA 4HIIB 1B0GA 4QTHB 2W9LA 1VB9A 3WD5L 2FB4L 3MYJA 3RWEB 3VG9C 1LHZA 1BLNB 2DLIA 4JGJA 4Q2ZB 4OV5A 5LAXB 1XF4A 3BZ4B 4I3SL 2JCCA 4P5TD 5IKCB 1Y18B 3FQXB 3C6LC 4NQCD 1A1OB 5GSRA 3LB6D 4AMKL 5KG9B 1NBZA 3T09A 1OWWA 1DQTA 4G7YL 2CDEB 2VIRA 4NT6B 1CDHA 4UBDC 3WIIL 3TIEB 2H32B 5M95B 3WL9B 5I1GL 4FN0A 3SPVB 2V2XB 1FVDA 1HIML 1ZHLA 2CH8A 3VWKB 2XA3A 3G5XA 4MD5A 3QDGB 1BGXH 4PRBB 4D0BA 2DMBA 3AREB 1IGTB 3QWRD 3OJ2C 1ZSDB 3MJ7A 2IBZX 5IVZA 1ZLVH 2VISB 2Q6WA 2VE6A 2AJZA 3ARDA 3B2VL 4X5WB 1B2WL 4PV9A 5F9OH 4MA3B 1I8IB 2O5ZH 3EJZD 1YEJL 3LEVH 4O51B 4TQEH 1KELL 4A6YB 5T3ZL 5FM5M 4Y4FB 1BD2D 3RI5F 3SDXB 5AG8A 1N59B 3LDBB 3NPSC 1FZMB 1RURH 1PFCA 4LL9A 3CH1A 4Y2DD 5SX4I 2CKNA 3LS4L 5EG6C 4UI2A 5J8OA 3SE3A 5CP3A 3P9MA 3PGDB 2VSCA 3MUZ1 3VXSD 2DQHL 1LEIB 4JANA 1GHFH 3UC0L 1AI1L 3F7RA 3S9DB 4TSBL 4HDIB 5CINL 1TNNA 4Z78B 2XN9A 1ONQA 4Z7NF 1I7UA 4HIHA 5FKPA 4U3XA 3QH3A 2MHAA 1MCWM 1G7JA 5FUCE 2F74A 5FK9A 3WJLA 1KLGA 4R7DA 3O8XA 3FOMB 2FJHB 3I50L 5KTEH 4HFWB 1RUPH 4QHUB 4YHYC 3QFJA 1LE9B 4WFED 4XAKE 4F57H 2WBWB 1UYWH 1UH3A 1OGAA 2G2RB 5HVWA 5DMIH 1BF2A 5EFIB 4GRLD 2DJ4A 4MHHG 4E5XA 3IAPA 4CNIA 2JCCE 4M4RA 4NKDA 4JGMA 1MFDH 4TTDC 1Y6KR 3D87B 5E5UB 4YGAB 3QUZC 3MZTA 4PGDB 1CGYA 4GKZB 3WN5B 1D5XA 4JKMA 3QNXB 3QQ4A 4HZLB 4KJPD 4U6VH 4X9FA 1JZ3A 5GZND 4NRXB 3W9DB 2Y06L 2ZP0T 3G6JB 1WCQA 3MLUH 1T4KA 3V7AG 3C6LA 3VFMB 2FO4A 3HZKA 5BRZD 3KHQA 3ULVF 3WIHL 3MV9A 1XZ0A 1S7TB 4CN4A 3OKKB 1NCDL 2XG4A 1FVCA 1OTUD 1S7QB 4LCWD 1EAPA 1S9YB 2H45A 4HLJA 4GG8B 4R4ND 5C2BL 5C0AB 3TN0B 3U7WL 3GNML 2H9GA 4WCYH 3HAEH 1KENH 3RVUC 3GZKA 1W0WB 4PJDB 3D3VB 1CT8A 2GTZB 3IXTA 4U1SB 2NTFA 3AUVA 2X44D 1DBAL 5JOFA 5K9JH 4CADB 1J18A 2NY0B 4CU8A 4GLRH 3U4AA 5LWYH 1F3DJ 4HZAA 3NAAH 1A6VL 5F7YC 1H3PH 1QFWL 3KR3H 3U4BH 4R26H 5DK2B 5L8JB 3L6FB 1QLRA 4TUKH 2X9WA 3GJFK 4M43L 4NQDA 5I71B 2XQBH 3NN8A 1N5YH 5CHNB 1JYNA 4JFDB 4RBPK 5ACZA 2BZDA 4PD4J 1MI5B 1U8NA 4YXLH 5C0EB 4MA7L 1FO0B 1UM5H 2IPTH 2CDGB 5H8DA 1UXWB 3NIDF 4OKVB 5F3HB 3N1FC 3MRHA 5F7DA 3B8YA 5DEFA 3SDDA 4AIXA 4LPWA 5CGYC 3RZCC 1UG9A 5CEZE 1MCQA 1FNEB 2ZOKB 4GO6B 1JNHB 3QFJE 4WHCA 5DFTA 5FFLA 2A0LC 3BSZH 1WWAX 3X13B 4YHZL 1XGPB 5GRJH 1ZXQA 2XY1A 5KVDL 4Q7DA 3VXUD 1NGWA 2BXYA 5BS0A 4LNRB 5I75C 1L6XA 1IAIM 4K8RL 4D9LH 2D0HA 4DKEH 1CLCA 1WBZB 4KY1H 3T08A 1P4LB 4QF1B 3DIFA 4ZNCD 1VA9A 1BIIB 2AXGA 1KJVA 4JFYB 4Y19D 4MD4A 2Y7QA 3NZHH 3OZ9H 1P69B 5E8PA 2YKLL 3FTGA 3IGAB 1JYWA 1NAMH 3QULA 4PRIA 2NX5A 3LCYA 3QWOA 1IT9H 2VDOH 2Q8AL 1DL7L 3ZE2F 1KPRA 1N5AB 1A0QL 1OARH 4ZPVB 2VC2H 1N6QH 4TPRH 4OZHE 5I66A 3MXVL 1I3VA 4OQ1A 2VH5L 3RDTB 5DTFA 4HWEH 4JRXE 3MV9E 3QUZA 1YMME 5C08B 2KH2B 3IDNB 3T8XB 4H0HB 12E8H 4H0GA 4PGZA 2ZCHL 1I1YA 5EZJA 1L4IA 4EN3D 4EOWL 2D9QB 5CSBA 4LPTA 3ESVF 1SBSL 1LO2H 1A3RL 1VFBA 2DQDL 5D71H 3TGXA 1J1OL 4H25B 3MBEB 1UB5A 1OQXA 4LSQH 4XTRC 5CD5C 3BPLC 1A7BA 2GAZB 4BH7B 4R97C 1QSFD 4TSCH 4K3DL 2QSVA 2AK4B 1WF5A 4KDTC 1DQLH 4KKBD 3CSPA 4NQDE 1R0AH 2W07A 5EU6D 5EUOF 4XHQA 5D7KD 4JDTL 3K7UA 1QA9A 4JAMB 5KJRH 4GAYB 3OSKA 2ZOLA 5HYEA 1INQA 3RUGB 5HHOB 3MV7D 5JOPE 2IH1A 3LVEA 4NZUH 5HYSG 1YUHB 3W0WD 3MLYH 1ZTXL 4KRNA 4XP6L 2O26U 3MBXH 4PP2A 5DMKA 1XCTB 3U4EA 4GW1A 2KQMA 4WUUB 5F96L 3PV6B 3O2DL 4L1HA 4DGIL 1TZGL 1KXTB 3CSYB 5JDJA 2V7HA 3DV4A 2BSRB 3DMMD 1F58H 1GOGA 5BW7C 4GOSA 1BJMA 3U6RA 2DQGH 4JCMA 3DVNA 1EO8L 1KT2B 1IKFH 2FX7H 3ZYZA 5I8EA 1C8PA 5T1LA 1A64A 4HXBL 3RZCA 2EH7H 4PRPB 4WV1A 4WFGD 1NEUA 2HFFA 4MCYA 4JY4A 1TZHA 4IEFB 2W0FB 2NX5E 4PJ7F 1IJ9A 1KN4H 4KVCH 1E27A 4P5TB 2XWTB 5CWSA 1YQ2A 1JNLH 3S7GA 2MTPA 1FGNL 1A6AB 1FDLH 4HUMB 1NCNA 4BQ9A 4NHCL 1P7QD 3GJFH 2YN5A 4PJFF 3CFJA 1VPOL 3MLXL 1KEGH 4N8VA 4RBPH 4IRZL 1EAJA 3VFPA 3GMPB 3MLZL 2DQFA 1ZWIB 3TF7C 3GSNH 3ULVC 2Z4QA 5FGBC 4ZQKB 4JVWA 4ELKA 2FEDD 2HT4D 3OAYK 1JPFB 4Z7OF 5HY9B 5TF1H 2GITA 4Y4HB 1Q9KA 3SGKC 1TQBB 3O41A 5KSBE 4TULL 4UU9A 1YDPB 5E2TL 1GZPA 4GKSA 2J8UF 1JGVL 4KJYB 4HBCH 4RQQB 4NQEB 3CSGA 4OCWH 1UQSB 4PJIB 1UWEL 1U8KB 1NGQH 1T0PB 2NY1D 1LDPL 4LSSL 1T2QH 2VMFA 1Z5LB 3TH3T 1FFQA 4KJWC 4LKCB 4X4ME 1A9EA 4GRWE 1HCVA 3GGWA 1LE5A 1X6NA 4IOIB 1EH9A 4JY6A 4JJHA 1IAIH 4OM1L 4EUPH 2DDQL 5E1AA 4UQ3A 1MFEH 2Z8RA 3RQ3A 5DD0L 3MV11 4KDTA 4H1LH 2MCG1 1RFDH 3VXTB 1R5IB 4FFZL 4U6XB 4XCFH 2DBLH 5J1SC 3I84A 3OHXB 4AEIL 3L5XH 4JG1H 1J0IA 2WAHA 2X2YA 2PR4L 4XGZB 1S7SA 1Q0XH 2I24N 3SDAD 3QIWC 4HKZA 4KZEL 3LV3A 1YQVH 5C07D 4KROB 5C0GA 3GMQA 4WHYG 4MLIA 4LSTH 3PGCB 4XZUA 1MCNA 4PGCA 3VG0H 4J3SA 3KJ6H 5SWZD 4BZ1H 4FTVA 1P4IL 3AS2A 1P9MC 3MC0A 1EUTA 2BY3A 5BW7A 3G08B 1SM3H 1U9KA 1MCEA 4M62L 1NDMB 5F6IC 5B4MD 1R24A 1X9QA 4DJMA 3P77A 4FQCH 4MNGB 5DJ6A 2W60A 1S9KC 3EO9L 4UIMB 5JHLL 1CU4H 3HUJE 3DX9A 4P5MA 1Q9WB 3QCTL 3V7MA 5HXMA 2BJMH 1Z9LA 2XV6B 3MR9B 3UBXI 2DQUL 5CEZL 1YNLH 4OCYL 4OGXL 1ODAA 5FCUL 3GJEB 4NHUB 1T6VN 5KS9B 3GIZH 1CXFA 2VDKH 4HWZA 1FFPB 2EZ0D 2AS5M 4TVPL 4LKXB 3MRRA 2OXHA 1URLA 4MDJB 3F58H 5DK3A 5FGBA 3BT2L 3QAZB 3MLTB 5ALCH 2EE2A 5E00A 1P1ZA 1AD9B 3RL2B 3CXDH 1MCCA 4N0UB 4RGMC 2DLTA 4BUGA 3ILQC 2DJSA 3U2SA 3SGKA 1LNUB 2XKNB 4PBVC 5CIPA 1P4BH 1TVDA 4BH8B 5FB8B 2I07B 2ADJB 3MLVH 1JGLL 2EDHA 3MJ9L 3CFIC 1A7OH 5HGBA 1LK2A 4NWUH 4J8RB 3B9KB 3C5ZA 1J88A 3O3DB 5J12C 3QWQB 3LN4A 1N0XH 2UZYB 2AXFB 4LLUA 3WFEL 5C6TL 3P4MA 4ZFGH 3W81A 1OT1A 3CK0H 4R0LB 2CKBH 3PXHA 4KRLB 2G60H 2UYLB 3RGHA 3IU3A 3ALXA 4FHBD 4K7PL 4QOKB 5GGTL 4Z7NE 5FGCB 5C0DA 2PNDA 4PUBL 1OAKL 3QISA 1FL6A 4MMXC 4N8CH 5CCKL 3QO1B 4GG6E 5CILH 1BECA 1X3DA 5ACMA 1O0VA 2Z91B 3CMOL 3SKJH 3U7YL 3GSOB 2XQYK 4YDIH 2YWYA 3T2NH 4PPTA 5E5MA 5FM5O 4NGHL 5LGJB 2NY6B 2HP4A 4APQD 3W2DH 3RWHB 5EIQA 3TZVB 2IFFH 2ZKHL 2M1KA 4JFOA 1B90A 2DOCA 4HUWA 1Q1JL 1GSMA 4F7CA 5C6WH 3CVIL 1QO3A 5HHVL 1S5HB 3QIWA 4POZC 1I1FB 2AJYH 1FYHB 1UCBH 1VADB 4Y19B 5HD8C 1KFAH 2VR9A 4J2XA 3TV3L 3EJYC 4S0TD 2Y72A 5AYQA 3CLFL 1AHWC 1SY6A 1P9MA 5CEYB 1C5BH 1G9NH 3I9GL 4OBRA 3G04B 3NABL 4GJTB 4KKCD 2EO9A 5HGHB 4U1LB 4N5UA 2K9UA 1ZVHA 3U30B 5DA4A 1HXMA 5JORA 3BP5A 4LSRL 5GS0L 3C6SA 2DQTH 3MYZA 4M93B 3W11C 3EO0A 3L7FB 5FDWA 4P3CH 1BWWA 1UVQA 4TUJB 3ULVE 1T6WA 4R2GB 5KVMC 1RIUH 3HRPA 2AXHA 4J7RA 5IHUH 4EVNB 4L8CA 3IVKA 1BQLH 5FYKU 5KVGL 5ITFA 4H20H 3L9RB 3HNVL 4P2OB 2FNBA 4QRSA 1ES0A 4C4KO 3WLWD 4X0KB 2FX8H 2VQTA 1QP1A 5KSAB 2DN7A 4BZYA 1D6EB 2VAAA 4MXVE 4XVUC 3UTTB 3KS0H 3OAZK 1JGDB 3MLRL 4M1DL 3BEWA 1QSFB 2O61B 3DRTA 1ORQA 1TQCC 1NGYB 2HT3D 5L9DL 1SJEA 1WAAF 4NO0A 3VWJD 2VXTL 3FAXA 1RK0A 4XMPH 35C8L 4JFED 4HMEA 4Y5YB 2G5BA 1S5IL 2O5XL 4CVUA 3FMGL 5EUOA 1J0JA 5KAQG 3MV7B 4PJCF 1J8HA 5B39A 2DYPB 2UUDK 4FQQA 4Y8DC 1KTLB 4J4PC 5CP7A 2CIIA 4KPHH 5ISZA 1BVZA 1T0NB 1A6UL 4F7EA 1QLFB 4R96B 1YNKH 1KJ2A 1D6VL 4QTIH 3RNKA 3NIDE 3VI4F 1KCRL 4UDTA 5IHLB 3B6SB 4BSVB 2FECL 4J1UA 1TFHA 2MQCA 5T1KD 4U6TA 3HRZA 1F2XK 4P4KC 1JGEB 1I7RB 4AJ0A 5DI8A 1KLFA 4P4RA 1IGYB 3ZTNL 4HIEA 4WFFD 3JV0A 1RJYA 2R29H 1U8JA 2X4SB 4Z7VB 4DWHA 3HC4L 2R4SH 1MPAL 4WHTB 1SVZA 2IPUK 1F90L 4F9PC 4EBQL 1CR9H 2GKIA 6FABL 2JELH 4PJ7A 4NJ9L 3P0YL 3HG1D 2IG2H 2IQ9L 4CJ1A 3ARWA 1S7RB 2B0SH 5DF0A 1X5JA 2R2EB 3UROR 5AAWA 4LHUB 2PKDA 1BM3H 4ODUB 1AHWA 4V2CB 3O9WD 4OTXL 1EV2E 1D5MB 3LQAC 4ZAKC 5ICXB 1NLDH 1R5WB 3NH7H 2KZWA 3BP7B 3O81A 1V7NL 4WUKH 4YDJA 3IDYC 2YD6A 2R1WB 4XX1G 4DK3A 3SKMA 5GZOD 4PJBB 3QEQB 5IB2A 1XF2A 3PWUB 2EDXA 5DJYA 2YXMA 4PJEB 1FLRH 5E99L 5INCB 3P73B 4FMKA 4HK3J 1XMWA 4JM2B 4U4BA 4A6YH 5DFVD 3BMVA 2PW2A 1DQQB 1A7QL 1PY9A 1X5FA 4X4XA 3V5KA 2J5LC 5C09A 1CFQA 2VDQL 5EUOE 2VDLL 3AM8C 1SJVA 5J6GA 4PJ9D 3MRIB 3OKDA 5HDOA 1M7IA 2HVKA 3D9AL 4V2BA 3UO1L 5ISZE 4YHPA 4KHXL 2DQEL 3O2WL 2A9NH 5FUOL 2XWBA 4PYHA 4XP5L 3MJ6A 5J6HB 3O45B 5D1QC 1MUJB 3WFBH 1DQJB 1P6AB 1MJJB 3O0RL 5AUMB 1T7YA 2EEBA 3MACL 4GUPB 5KZCD 3QIUC 3WFCH 5CZXD 1FVEB 5IB5B 4M6OH 3PWVB 3GHEL 3OMZA 2WUCH 2CUMA 1XGRA 3VCLA 3JTSB 1T80A 1G7QA 3C5SB 1JPTH 1KNOA 3KXFB 4P9HL 3PABB 1FQ9C 1MWAL 1LD9A 4RAUA 2F54B 3HNSL 3BHBB 4S1SH 3Q5YA 4XAWH 2VXVH 4P4KA 1U58A 4PJ7E 5EWIH 3L3IB 4DCQB 4P59L 1JV5B 4I0PC 1CLZH 4P46C 3PV7A 4L4TB 4PJFE 5I1EL 1SEBA 4PBXA 4J3VA 5I17A 1XGUB 5ETUB 5IIEB 1CG9B 2DD8L 5I2IB 5L2JB 5I74C 2UUDH 1CQKA 1D9KD 2XNAB 3H6JA 4LSUL 3MGTB 2F53E 3S35H 1SYSA 4F9PA 3DNKA 3NIFF 3TPUB 3TNMB 5ILTL 1ITBB 5ERWB 5TH2A 5I1CL 4YPJA 5IB1A 3PIQB 3U83A 4Z7OE 4JHWL 4S11A 2X9XA 1FRGH 4MAYC 1DSFL 1U91B 4RFEB 4N9GA 5BXFB 4UZGA 3V5DB 2HJLA 1ADQH 4U1HB 3BN9D 3V9FA 2GUOB 2J8UE 5DHYB 1HHJB 5BOZG 4OF3A 3O4LA 1WT5A 2A6DA 4M61A 1OT2A 5J13B 2AV1B 2QSTA 4ZAKA 5GGVH 5IMOA 3J8F7 1ACYL 3EOTL 1S7XA 2AJXL 1FNHA 3GIVB 4YHLL 3IJSA 2IBZY 2IH3A 2NY3C 3RY6A 4OCRL 2IJ0C 4PIRF 4L4VB 1NLBH 5C09E 4P57B 3ARBC 4U31A 4WEUD 4YIQB 4QRQB 4XMLL 3AS3A 3TO2B 3QUYC 4OF5A 4PFEA 2GSIB 3AB0C 4FXKA 4XPAH 4NQSA 5D70L 4O2CB 5F71A 4Y0GA 3VI3F 1OL0A 1A7NL 1U92A 3JWDL 2YUVA 3JV6A 5B8CC 3EBAA 1MQ8A 1RZ7H 3D39B 1QSED 5CGTA 4XC1H 3ZHKA 3U0PB 1NCAH 3L5JA 2GFBB 3AM8A 1UENA 4CMMA 4B7IA 2WBJD 3C9NA 1Z9OA 3QT2A 4ZFOL 1CIUA 2EDOA 4ODSH 1FO0H 4FNLL 3B5GA 3M8OL 4ISVB 4L29B 1RQ5A 3JTTB 3FZUD 3VMNA 4MNQA 1IM3A 4GSDH 3FRPA 1C7TA 3SDCD 2AGJH 5F7MC 5HI5C 5D1QA 3IDXH 5IJVA 2IANB 4HX1A 3P4NA 3GFUA 2HLFD 2LE9A 2V9QA 2AAVA 1U8PB 3EOBA 3QIUA 2X9YA 1MRFL 1L7TH 4GBXB 1T3FA 4UILL 1B4JH 4EXKA 5D2LA 5IR1B 1IAMA 4GKOA 3RWDA 2VLKB 2XPGA 2QHRL 5F9JB 1IEHA 1YEKH 2YBRA 4NO3B 3SGDH 4NZDA 3AU1A 3HMWL 2B5IB 5INDB 4KWUA 3IDJB 4KMLB 4G8GD 5MERA 5MEND 3B2UC 1ITCA 4XC3L 4I0PA 4P2QD 3ELAT 4P46A 1CDGA 2XZZA 3CC5B 2J2ZA 5IB3A 4KGLA 3EUUA 3HZVB 1FE8L 1H9VA 2XIDA 5JZ7D 3HAEA 3LSOB 4ZUVA 4S1RL 3D0LB 3SO3C 2W0KA 1JTPA 1U42A 3D85A 3ULUF 1FFNA 4KC3B 1PAMA 4GQPH 1PZ5A 3GUTA 4WWKD 3IKCB 3QHZL 3W39A 1DN0A 5BO1H 1ZA6A 4MAYA 2XZQH 5SWSA 3QDME 2CRMA 2R2BB 4X6EB 5JR1H 1CXIA 2H2PD 3BPOB 3UAJD 4ZDHA 3DURB 5F9WC 2NR6D 3RWIB 4UNUA 1Y6NR 3CUPB 4PG9B 3DROB 1JUFA 4JN1H 1LO5A 5GGUB 2DWDB 2A73B 3FFCA 1UZ8B 2NY5C 2NZ9C 1WAAA 5GGQL 1OM3H 4TN9A 43CAA 1EGJL 1NBVL 4GAFB 5GRUH 5JA8B 3G5ZB 1U3HC 3ARBA 1KC5L 3QSKB 4PRAA 1QBML 4HWBL 1I9JL 4KMTL 1H5BB 1A2YA 3QUYA 1BFVH 4K55A 3RY4A 2AJVL 5JPNA 3B83A 3P0VH 3NBNA 3QUMH 3MRGA 3F8UB 4GH7B 5B8CA 1IGCL 4LVHB 2AKRA 2UY6A 4NUJB 5E9DA 1UT9A 4FZEL 3MFFA 4ODTL 2YC1B 4DZBB 3FB5B 4QRTA 3QFDA 3KPNA 3KJ4B 1EHNA 3STZB 3B5HA 1U8OA 5EN2B 1XF1A 3D69B 4GMTL 4MJIB 4GRMB 1N2RA 4PJXB 4QRUA 4HH9B 4ETQB 4P5KA 2JTDA 3V0VA 3TCXA 5DGRA 1RZJH 1MAMH 1QFHA 2ID5A 3BKCL 1KG0B 2JKXA 5J9PB 5HSFA 3T2QA 3IETA 5IF0A 3QQ9C 4MA8L 1ZLUK 4YDKL 2QADB 2EDWA 4ONGH 5E5RB 4HT1L 2HJFB 4NQXA 5HHME 1GXEA 4U7SA 2FR4B 4UT7H 3KPRE 5JUEL 5JXEC 4YO0B 4M7ZB 5ANMB 2IADB 3FJTA 4I8DA 5DJAB 3FO1B 1DLHB 3RVVC 1QTYT 1BZ7A 3C8KA 2C3VB 4LLVA 5BZDB 3BGMB 5D6DC 2E7HA 4OUUB 3QDJB 3HLAA 5KVFL 1R3LB 1D5ZA 4N8VG 2PTUA 4FFWC 3MA7B 2A9ML 3VXRD 3TBSA 1XGYH 1IGML 1QSZA 1IC5H 1T03H 3TA3B 2R0WH 3WE6B 3QQ3B 2NW3B 4HFUL 3MNVA 4Y2OA 1DBBL 1R3KB 5D2NA 4DVBA 1OTSD 4HJ0C 2XKUA 1JPGA 3IDMB 5JLZB 3IJYA 5GJSH 3EYUH 1NANI 1OP9A 4HGWA 5T1MB 1FYTA 1WAAE 2P5WE 1ZT1A 2V6HA 4Z7UA 5FYJU 3MLWL 3X12B 5D7LE 1S9XA 1KYOK 1BREA 3MMEB 1S9VB 1F11B 4D8PA 2BFVH 4FQ1L 2KBGA 3GBLA 4LGRB 2AQ1A 4LSPH 4PJCE 3MLSL 4OLZH 1ETZA 5I1AB 4ZD3L 3W9EA 5IGXL 4HPOL 1YNTB 3UPRB 1XR8A 1Z3GH 2XZCH 2YRLA 1RIHL 3LMJH 5EPMA 4XNXL 4PYGA 5E9DE 1IQWH 3T2PA 1IEAB 3VI4E 1U3HA 3LH2L 4ONHA 2E7CA 4Y1AE 3SHSA 5JPMB 3X11A 1HE7A 4NKIH 5FYKE 4WO4C 5IMKB 4TVSa 4B0MM 4FQXC 1HN1A 4XPHL 1BBJB 4KFZC 3NTCL 1QR1B 4I9WD 1MHEB 2QSCH 4XBPA 5LXGH 4HXAH 5E6IC 3DLQR 4ZPTA 1HHHA 3UMTA 5KSVB 2VERN 1FAIH 1DVFB 4C56A 1WGOA 3QG6A 1F2QA 3GJFA 5DRNA 1T2JA 2DLGA 1RK1A 2OK0H 2CK0H 2FJFA 3GSQA 1OCWL 5J1TC 3V4PH 5I0ZA 5EZLB 4BKLA 3BXNA 4KXZH 3X14B 2YPKB 3KDMB 1EO7A 4ELMB 3GSNA 4Y7MA 1KN2H 5FAAA 1JFQL 5C6PB 3ARZA 4O9HL 1WFNA 4YGVB 4V1DE 3VXQB