4QHKJ

Uca (unbound) from ch103 lineage
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
209
Chain Sequence
YELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSFSTFVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords UCA heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 209
sequence length 209
chains with identical sequence L, N, P
ec nomenclature
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkJ02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkJ01
3I50H 5DJCA 3HR5B 2YKLH 4LKCA 1A9EA 4PGDB 4FQ2H 2EDWA 4AZ8A 2DMCA 3L3JB 1E4JA 3MOBH 5I1AA 3NBNA 1F4WH 2H2PD 3OV6A 4JPVH 5JORA 4P2OB 5HHOB 1SYVA 4OZ4A 3QFJA 1XR8A 3PP4H 4S1DD 3ZDXE 1PG7L 1IM9B 5BOZG 5C09D 5MEPA 3U9UA 2UWEB 3VD5A 4RAVA 3K4AA 4XNXH 1Z3GH 3MRGA 4NJ9L 1KJ2B 5E7BA 5I2IA 2H32A 1FYHB 3T3PF 3ZTJG 4BSVA 3MV9A 5EIIB 3AU1B 2BNQD 5HHOE 5HYEA 4PV9B 1K8IA 1CCZA 5CSZA 2IAMA 3PHSA 1UACH 4LU5H 3CH1A 4I9WD 4JDTH 3RWJB 5F9JA 3EDKA 3EJYC 4NN5B 4M1CC 4Y5VB 1R3KA 2VLJD 1O0VA 2E6QA 3Q3GB 2E6PA 3VDCA 1EMTH 4XXDA 5I19H 1Z2KA 3OF6A 3N85H 2DQCL 1JGEA 5E70A 2GUOB 5BV7C 2DB8A 1FVCA 1VERA 2ICWA 3STLA 5JLZA 4J3XA 1TCMA 3TBVA 1KENL 2F19L 3LKPA 1PY9A 4PJ9B 1U8PA 2X4NB 2DM3A 2P24A 3H0TA 3CDYA 1X5GA 5ALBH 2H2SD 1JNLH 1N0XH 4P57A 4RIRA 4EQ3A 5TH2A 1KLUB 5EU4A 1ZHLA 2CMRH 1HHKA 4M48H 5D7LD 5AYQA 5DMYA 5GSRB 1JWSB 3BW9B 5IQ9A 1ES0A 1CFSA 1NFIA 1QLRB 2HTKC 4M8QB 3W11C 1L0QA 1DBAH 1CDHA 4EDXA 5ESVB 3F8UB 3TGXA 1U93B 2Y6SD 1RUPL 4JJ5A 1IEBB 1IL1B 5J13B 2F54D 5DGRA 3FZUC 5ID1A 5TDOA 1U95A 2H1PL 3BPLB 3OG4B 5E08H 3S9DB 1FNGB 2AV1A 2YK1H 5C8JB 3P4NA 4BZ1H 5CGMA 2Z0BA 3QIWB 4Z7UA 1TZGH 1OVZA 1RJZB 4RQQA 3PG2A 4V1DD 3PGDB 2ADJA 4WI7A 1KGCE 5GRVK 2GY7B 4A6YB 5C0AA 1FZKA 1FDLL 1AHWC 5JR1L 5DHXB 3O4OB 1ITCA 2V2WB 2VDRH 4KTEH 4NQVB 4XZUA 5EWIL 2A9ML 4DK3A 5HGDB 3DX7B 4BFGA 1KB5A 1G0YR 4HPOH 4L8CA 3EOYG 1T66C 2CXGA 1JPGB 2DQIL 3AS1A 1GOFA 2V7HA 4FFVC 4P59L 1ORSB 1WVZA 1ZLSL 5ETUA 2IAMC 2IPKB 3O0RH 3PIQB 1WTLA 2FATH 3TN0D 1FJ1A 2YD1A 1KLGA 5DLMH 4Z78B 3ME0A 4X6BB 1BECA 4B53A 4F2MB 1VACB 4IHOA 2VXTL 1J1PH 2E27H 3ARBA 3QHZH 4D0BA 4ONGH 3EHBD 1HDMB 1UCBH 4NRXA 3UTQB 1U8MA 1U91B 1XGQB 1EFQA 3JWDL 3U4AA 4ZUUA 2XNAA 3JWOC 4OZHB 4NHUB 1ZLVH 1EGJH 1JUFB 1YY8B 1C5CL 1KPUA 4CJ1A 1MCOH 4OI8A 3DXAA 1HIMH 1V7NH 5FHAL 1T0MA 1CFBA 1NGYA 3FQWA 1T1ZB 4OZHE 1S78D 3PV7A 4XTRC 1DFBL 4XCCL 3LN4A 5FGSA 5IMOB 3K2UL 5GJTH 4OAWA 3ILPB 4XP9L 5C07D 2GSIA 5E03A 2FB4L 4GS7C 1B4RA 1Z9MA 2GTZB 4JFOB 3P0YH 1CXLA 5IVNA 4DGIL 3LEXB 4M93C 1TETL 3CFJB 4OUOA 4AIZB 3B2UC 2MTPA 3PJSB 1LO3H 5GGRB 5IW1B 4FOMA 1VKXB 2DQJH 4ETQA 4LVNB 4Y89A 3OGCB 3PXHA 1BZ9B 2V9RA 4GRMA 5EBMB 4NQUA 1Q94A 2VL5B 5J3HC 4PJ5D 5HHXH 1R5IB 3ARDD 3JXAA 4L3ED 1NCDL 3TYGH 4G42B 1MRFH 1BIIB 2H45A 3QUML 3GSUA 5J6HA 1UM6H 3CVHH 1G7HB 2F74A 3V52L 6CGTA 4Y0GA 4K7PL 3L7FB 1CDYA 3IF1A 1DQTA 1FAIH 3F7VA 3IRZA 3ZKXC 3H9SD 1GGCH 3SKNB 4HCRH 3QSKB 1EEZB 2YMXH 1XGRA 3TFKC 4YX2H 3FAXA 1DZBA 5D1XD 3V0AC 3ARBC 1P4LB 1CICD 1F3JB 3H6JA 5KG9B 4NO0B 3AAZB 1KACB 1LK3L 4XBPB 1GGBH 2NX5B 1QLEH 1FN4B 1NBZA 3UAJD 1FIGL 2V17H 3D18A 2P5EA 3MRDA 1CYGA 5DEFB 2DJSA 3RDTD 4WW2F 4JG0H 3EFDH 3QDMA 5EC1A 2NX5E 1J0HA 2Z91A 1MLCA 2EDHA 4CVUA 2B0SH 3W9EA 4LPVA 3TESA 2BJMH 1UXSB 2ZSWA 5DJ2B 3TVMB 4N0YL 1XGPA 4NN7C 3DX8A 4WY7H 2EKSA 4GKOA 4X99B 3BKYH 1YECL 3O6KH 2NTFB 4MS8D 2W0PA 5JW4R 5H37H 1T80A 4N0CD 4DGVL 4F7MA 4PJEE 4JQIH 1F11B 1IGMH 1HH6A 4YDLB 4JFZL 4LL9A 3VH8G 1TZIA 1J05B 1N5AB 3R0MA 5GGVY 1ZTXH 3GKZA 4P5KA 1NC2A 3MJ9H 4RFNC 5DJ0A 2JIXD 1NLBH 4TSAL 1SJVA 4NQDB 3R1GL 5D96B 3G6JA 4HT1H 1AKJD 2ATPB 2ZZUT 5I66A 1FNEA 4X0KA 1G0XA 3E3QE 2OMNA 4U0RB 5HTSA 2WWKO 1YJDL 4NQDE 5DWUH 2C3HA 3IYLW 3S35X 1D5ZB 3UTTB 1BFVH 3VWKA 5JHLH 2ITDA 4B7LA 2YZ1A 2DBLH 1MHPH 1WCQA 1LEGA 3NIDF 2R4SH 5IK3B 3O8XD 3EYFA 3GSNB 4HSQA 1QA9B 4Y1AB 1B0GB 4OSUL 3S3PA 2HMID 4FZ8H 3UTTE 5DJDA 1P7QA 1CLOL 3ARFD 2BK8A 2FJGA 3UCRA 4WUUA 1RJLA 4HG4K 1FGNH 2X89A 3U46A 1H3UA 5I1GL 4OV5A 5IUSA 2WIIA 2UZYB 2C26A 4Y1AE 2RCSL 4C55A 3O6FD 4AEIH 2I9TB 2QR0A 3U0PA 5TPWH 4LIQH 4E41D 5J11C 5FOJA 3QO1A 4PRHD 3NPZB 4U1JB 5F7WC 4RFEA 4XRCA 1CT8A 4X5WA 4ZUSA 3B2VH 1ZSDA 1VHPA 4LCWA 3FRPG 3V0WL 4PRBB 4JAMA 1F13A 1N0LA 2C5DC 5JOEA 2DQTL 2OK0L 2D7PA 2J4WL 5FGBC 1HILB 4BA8A 4XPFH 2Q6WA 1R6VA 4IOFC 1T03L 1FO0H 4BZ2H 3KPPA 1QRNE 4LSVL 4JG1H 1RK0B 2JK5B 3UEZA 1G9ML 5D8JH 3ZKMC 2VC2L 3FB6A 5HYFA 5B3NA 5DFTA 3H3KA 4YQXH 4IS6A 4X6EA 4BQ8A 2F53B 4YAQA 2BFVH 1J8KA 3OZ9H 2ARJQ 2CSPA 5J56B 1NDMA 5DMJB 3O2DA 5MP6H 5DF0A 1GGYA 4NIKB 2F53E 1AFVL 4J1UA 2BVYA 4MDIB 2ZPKL 3ECBB 3NA9L 5I1IH 5GHWL 3TYFB 3K74B 3ZL4L 1RIUH 2YRLA 1EV2E 5H35B 1Q0XL 3CVHB 4QCIA 5HYJE 3VWKC 3QI9B 3KPLB 4HUMB 2KDGA 4LPUA 4PRIB 4YBLC 1G6RA 2Y5TB 4POZC 1BQUA 4X6DA 3IDMA 4WTWA 2WWMD 1LO0H 3OHXA 2Q7YA 1S8DB 3VXPA 2C3VB 4HUWB 2FZ3A 3LS4H 2FJHA 5BO1L 4HKBB 5T1LA 4PRIE 2YN3A 4Z5RA 1NEZA 4U1IA 4XMKL 4M6AA 4J6RH 3KPRD 2NTSP 3LN5B 3QIUB 5BXFA 2WBJD 4KJQD 2JJUA 3SCMA 4PGCA 3SKMA 4LPYA 3QFDB 3ARED 3WSQH 1MRDL 3BVNB 4R7DB 1RJYB 2G75A 2HJFA 4NO3A 4PTUB 3QULB 1RURH 3MRBB 4IJ3C 1KIPA 1K4DB 5FK9B 2Y36L 3FT2A 1MCFA 3GSVA 5E94A 2YD3A 2JCCF 4TNVK 5D4QA 1JHLH 4LSRH 4N0UB 2AEQH 2IPTH 2PW1B 2OL3B 2JJSA 1BJ1J 4BFIB 1OM3H 3ULSB 2YWZA 4MSWB 3K2MC 1FLTX 4FHBD 1XF4A 4U1KB 3S37H 3SJVD 3QUZA 4L8BB 5C9JB 4N90D 3ROLA 3CFDA 4N0UE 1F90H 4E42B 3BPOB 4FTVB 2GJ6E 3D0VA 5ADOL 3MLPA 3E0GA 4ODVL 2GSGB 1B0WA 3MRCA 4NQED 2WBWB 2NY2C 4H8WL 3ZDXF 4XPTL 5EZLA 3TJEH 3TO4A 4C54A 1EHNA 1T21A 1EHAA 2ORBL 3V6BR 5IW6B 4FTVE 1UENA 3H9HB 4W6YB 1MREH 4NQSB 2FYYB 2FGWL 5CD5D 1QEWB 1IM3B 2BY2A 2XZCL 3BWAB 1JHKL 4TSBL 3WXWH 4N8CH 5T3XD 3GMOA 3IAGC 5ESAB 2UWEF 3MV7A 1QQDB 5I1KH 1ZVYA 4R6UA 1KXQE 3GBMH 2YPKB 3CK0H 1OF2A 3NH7H 2CIKA 1IEAA 2CK2A 3RVVD 1UADC 1T20B 1A8JH 4MX7A 3OKNB 4KZDL 2W59A 3MBEB 4ELMA 1XZ0A 5BOPA 5T1DH 3HMXL 4G6KL 1DE4A 2XWJB 4HEME 1WAAE 3EYUL 1CFVL 3SCMC 1MJ8L 1DDHA 2MNUA 4EI6A 2YXMA 4C4KT 5K93A 2DWDA 3BDXA 3E8UL 4DK6A 1KCVH 4HS6A 1AXSB 4PRPE 2DYPB 4PR5B 2WIMA 1XIWA 5GS2H 4M5YH 3QDAA 2NY4C 3KWWB 1SJEA 1MH5B 2K1MA 3LEVL 4JQVA 4PV8B 1FL3A 1HINH 5DUML 2VAAA 3VXQA 2B2XH 4U3HA 2XICA 5JQ6L 4LIQE 1FV1A 2BSSB 1ZWIB 5FXCH 4L3CB 2HKHH 3HNSH 2JJSC 1MHCB 3VXRB 1UXWB 1T5XB 3NPSB 1MCNA 4HIIB 1A7PH 2VE6A 1I7UB 3GI9H 2VXUH 4LHUG 4HC1H 4ELKB 3QUZC 1MHEB 3EO9H 1JNHB 5TQ0H 3MLYL 5GS0C 2XY2A 4WUKL 5DD6A 4NKDA 2PCPA 2VJXA 3OR6B 4RGMB 3VXRE 2AXGB 1PX3A 2I25N 1RUQL 2BY0A 4JDVB 4MWFA 5IB2A 5E2TH 4B7IA 4LK4A 3HAEA 1Q9OA 1FRGL 4Z77A 3KPNB 1FSKC 1KPRB 3W0WD 2RAMA 4FQQB 4J4PD 1E6JH 4QRQA 5D1QD 4P9HC 5FOBA 3WIHH 4PJAF 5ACMA 3MACH 3OXRB 4XMPH 1QFOA 3HZYA 5GGQL 3NFSH 4XNMA 1UM5L 5C6TL 1P4IH 1JF5A 5DFWH 3ARRA 4RWHA 3P4OA 2Q1EA 4JFQA 1NGZB 1PEZA 3MLRL 3HNVH 5CINH 1KN2L 3BEWA 4Y16B 3ESVF 4D0DB 4XCFH 2UUDH 3NTCL 3X3FH 5LWYH 5IHZB 3PE9A 2F5BL 4LAJH 3AY4A 3GIZH 2OR9L 4NC1E 1Z6JT 4NYLB 2QQNH 2AERT 3KPOB 4UT6L 4GG6B 1S9VB 2W91A 2X4QB 3B6SA 4ODTH 2DL2A 3ULUE 4C83B 4KK5C 1LQSR 5ACLA 4TNWF 4OZHF 1E4KA 3TBWB 3VG9B 4YXHH 1M05B 3OKOB 3TLRA 5IKCB 4X7SH 4GG6E 1S9XB 4FMKA 1A7RL 3DX6A 3DI2B 3QAZB 4DUVA 4OM1L 4HS8H 4OCLC 4B0MM 3IJYA 3P73A 4BZYA 4WFHD 5C1MB 3FQNA 2C3GA 5IQ7H 3MA9L 5HHPA 4KRPB 3DLQR 1FYTD 1VCAA 2A38A 5DTFA 3T1FA 1TZHB 4CU7A 1RZIA 4GRLA 1LILA 3TEUA 5L88H 3BGAA 3S3JA 3U0WH 1DANT 4MB3A 3BZDA 3FHQA 5IESH 4QF1B 5IEHB 2EDJA 1IQWH 5IR1A 1T7XA 3EYVA 5EO9B 3MCLL 4ZUTB 1S7WB 2Z8RA 3QCUL 5C0GA 5CBEB 5C0ND 4M62H 4MZ3A 2B1HL 2YPVH 3BP7A 5FAAA 3MXWL 2AXJA 5CCKL 1U92A 2JJWA 4UDUB 1U8QA 4O51A 1I8KA 3D0LA 3VXUA 1F6FB 2R0KL 1BVZA 1O5DT 3CMGA 4YK4C 5MHSE 4OT1L 4PG9B 4P2OD 1VPOH 4HK3N 5HHOD 3SGKC 4NFDA 3HE6B 1IM9D 2JB5H 5ICXA 3ZKQD 2V7NA 4D8PA 5DS8B 3BGMA 3LD8B 1LE9B 2PYFB 1WZLA 5D5ME 3L95A 1JZ5A 5CJQL 4KTDL 3AY4C 2KBGA 2VZ1A 4K2UL 1UEMA 2J2ZA 5CIPA 3DYMA 1JBJA 2Q7NA 1H15A 2YPLB 3CAFA 4S1QH 5IB3A 4M5ZL 3HRZA 2VWEE 1EHLH 1KPVB 1A6PA 2A74A 3VXOA 4DFIA 1CVRA 4PGEB 1TQBB 5FHBL 4PJ9D 4KJYA 2YPLE 2YEZB 3W2DH 2AK4B 5E5UB 1X5KA 3T8XB 1KSRA 4GAJH 5IBLD 4XX1G 4WU7B 2AJZA 1W2KT 5DFVC 1BZQK 1UQSA 4MQ7B 4LBEA 1NGXB 3VJ6B 2UZXB 4JREC 3CDFA 4GRLC 4JR9H 1X3DA 4K8RL 2Q76B 3QXDB 3MRJB 1UT9A 3SDXA 1OAZH 4KMTL 4G5ZH 2I26N 4GW5A 4FQLH 1UH2A 3IDXH 4PJFA 2HA1A 4ZQKB 2IALA 3A0OA 3B83A 5FV2A 4YFEA 1ORQB 4OKDA 4HWZB 4H1LA 5CEYA 1ZT1B 4AG4H 3MLXL 5HYQA 3IFPA 4HBCL 1BAFH 1U8HA 4NOFA 1V8HA 4Y8AA 1GL4B 3QIWD 3K7UA 2NQCA 2A9NL 1W72H 3BQUA 4JM2B 1FZMA 4DKDC 3NIGE 5LVEA 4HKJB 1R5VA 4FQ1L 3T77A 5JHDB 3CFIC 1ZLUK 5D1ZB 3A6BL 2DTMH 3NCMA 2R2BB 1L6XA 1J12A 4KKAC 4UILH 3MYJA 3GIVA 4I8DA 3S97C 3T1WA 4K71B 5JHDE 3SDAA 2IGFL 2H32H 3OL2A 1YN6A 3RWIA 3TV3H 3P0VL 3LRSB 4MLSA 3G5YB 1CR9H 3FN0L 3HI5L 2R29H 3TNNB 3OKLA 3WE6B 5JXED 1EFXA 1Y18A 1XFPA 3UJTL 4JFPA 1MRCH 3A6OA 2IBGA 2FBJL 3QJHA 3EOBB 1F97A 2ZG3A 4MD4A 4P4KD 2V5TA 1M6OB 5C0CA 5E5MB 5IVZB 1CLZL 3PGCA 4HXBL 1R3HB 4EBQH 2YSSB 1AE6L 3IXAB 5E2WH 3RIFF 3MRIB 2Y07H 12E8H 4HFWA 5LGKA 1LO2L 1EIBA 1JVKA 2DLIA 4HEPG 1QFWH 3VD4A 1NGQL 3IETA 1NAML 3M8OL 4OGYH 4LDOB 4MAYB 3G9AB 4F7CB 3F62A 3RWDA 2GK0A 4DW2L 2OCFD 3AS0A 3D85A 4LLUA 5BQ7A 5IFHL 5K33A 2XKUA 5GS1A 4F80A 3CXDH 2X1WL 5FYKE 3B9EA 2QQLH 5CFHA 2UY7A 2B1AH 4OUUA 5ITBL 4RWYH 4DTGH 4R97B 4A2MA 3JWDC 3BQUC 4JM4L 4PJCB 5JA9A 2I07A 4ERSL 3BD3A 3CDGB 4QTHB 2NZIA 5GGTL 5C92A 5T1KA 3NABH 5IVXB 2CJUH 4LSQL 3HRPA 1HOCB 2OI9C 3VW3H 5I15H 1GGUA 3VFOB 4XVJL 3GSRB 5E8OA 4F58H 5C7XH 5EA0L 4YDKH 3KPMB 4PJCE 4UBDD 4ISVB 1QACA 2G5BB 3CMOH 3P9MA 3SDAC 5BW7A 3P30L 3BT2L 3VFGL 4GLRI 1AQKL 1NDGB 2XKSA 5F88B 4UNVA 1PBYA 2VDKL 2VLRA 3D2UB 4Z0BL 5J12C 1BD2B 2Q8BH 4Q2ZA 3KAAA 4KK9C 5I1JH 2XWTB 5FDWB 3FTGB 2ENYA 4XMLL 1FBIH 4NO0D 3P77A 4MJIB 4HJGB 1BD2E 2NX5D 4XCEA 4AL8L 1GC1L 4HGWA 4U1HB 1DSFH 5IB1B 1YY9C 5DZNA 5B38B 4WO4A 1MFBH 1RUKH 1GIGL 3QEHA 5D7KE 4XAWL 3IFOA 4MJIE 5BV7B 4G7YL 3ETBF 1JPSH 1XCQB 1LDSA 5EU6D 4L8SA 3WLBB 5C09A 5F9AC 2P47B 2PXYA 1OSZB 3I3BA 1SBBA 2JELH 2ZOKB 4NBZB 1PZ5B 3D69B 2WBKA 2BNQA 2XZQH 1LEKA 1MFEL 4M7KH 4NDMA 4HBQA 3TVMD 4UNUA 1QOKA 1PJ9A 1LK2A 5DURB 1WBXB 1F4XH 5DYOA 5GS1C 3VFPB 2X42A 4X80L 5FUOL 4CVXB 5I8CA 2VLJA 3EFFA 5D93C 4HXAL 1CGVA 2EEAA 4KKBC 1Q0YL 4BYHA 1K2DA 5DJCB 1NCNA 3ZTNL 4NQDD 3RWHA 4MMXC 2OQJA 2NY5L 3OPZH 4GT7A 4B50A 1A9EB 4JY5L 1DL7H 4HUUA 1YEJL 3LN9A 3LQMA 2YA2A 1YYLL 2V9QA 5KN5A 4U1SA 1KCUH 3RVTD 3GMQB 1S3KH 2ARWA 3NCJL 4KJWC 5KTEL 4PTTB 1AHWB 5JORB 1RUML 1SYVB 3DV6B 5D7LA 3QFJB 5BW7C 3GMPA 3LKRA 1KJ2L 5MEPB 3U9UB 4GOSA 1QUNA 4MCZB 1WAAF 4HIJB 4LEXL 3UTTD 5JW4Q 1LEIA 4NKOA 5K59F 1J0JA 2H32B 5BZWA 3DSFH 3MV9B 1RU9L 1IAOA 1A6UL 1RI8A 3QCTH 5HDOA 1U2HA 1A6AA 4XCYB 3QFJE 5E00A 2VXQL 1QFUH 2F54A 4TTDD 1K8IB 5CSZB 3OWEA 2IAMB 3NA4A 1A9BB 3CH1B 2EICA 2DMBA 5F9JB 3MV9E 1R3KB 2YD4A 4NJAH 2DLFL 4IMLA 4ACPA 4XVSH 4WO4C 3LY6A 3RY6A 3UJIH 4P5MB 2ICWB 5DRZB 3STLB 3DROA 1YJDC 4NZDA 4DN3H 3LKPB 3UROR 1I9RL 1W0YT 2P24B 2BCKA 2PXYC 4MXWH 4P57B 4RIRB 5I18H 5EU4B 1FFRA 1IFHL 1ZHLB 2K9UA 4FG6D 2KH2B 3S36H 4ZPVA 4BSWA 1HHKB 1TVBB 1AY1L 1ES0B 3Q1SH 3AUVA 1CF8H 2A73A 5TE4H 1DR9A 3G5XB 2AP2A 4LCCA 3PHOA 4RGOL 3ZHKA 2NY1C 1NCBH 2F53D 4GS7B 5ID1B 3SE9L 1Q9LB 2ZSVA 3EOTL 1XF3A 2AV1B 1F2XK 3P4NB 5FO8B 2OXHA 4M93B 3OAUH 1WCBB 4Z7UB 2AJSH 1S9YB 1MCSA 1MHHB 3EZ8A 3EDFA 3FCTB 5HJ3A 4QHKI 2VZOA 5FYJD 1E4XI 3VMNA 1JYVA 3EYOA 3UO1H 1X5JA 1FZKB 4QXGH 4ZO8A 4Z95H 1VFMA 2D0FA 5D72H 3L7EA 4PGJA 4Z7UE 2EC8A 4XZUB 4JFXA 3V5KA 2FHBA 4OI7A 3QI9D 3QQ4B 1GHFH 1KB5B 2DI7A 2IC2A 4PRID 5GGSA 4L8CB 1G9MC 1MCPL 2DIBA 3ZYIA 4HK3J 3U7YH 4KK6D 1FE8L 3MJ7A 5ETUB 3ULUF 2V9TA 3ZKXB 5AZEL 1CLYH 1FJ1B 3GBNH 1KLGB 2COQA 4KVNH 3WUWG 4ZFZA 3QIUD 4LLQA 4QT5A 4GG6F 1KOAA 1OGTA 5E95B 3BDYH 1EHXA 3ARBB 4UIMA 5T3ZE 1KN4H 4U3XA 3RY6C 1QYGH 1W0WA 5T5FL 4PJ5A 5CLWA 4LF3B 4KAQL 1IC7H 4NRXB 3GHBH 3ARDA 3CSPA 4L3EA 4QWWC 1IGIL 5AWNL 4FQXA 4K3DL 3IVKB 2HWZH 3WXVL 4HWEL 4TQEL 2MQ0A 1DBJH 4OLEA 1JIBA 4BFEA 4CN1A 3DXAB 4QGTA 1EEYA 1I1RA 1QVOB 4R4BA 1J11A 1INEL 1MIMH 1NGYB 3FQWB 5LGJA 1DLHA 3QO0B 3LN4B 3I75B 3H9SA 2ARJB 3T2QA 4MD0A 5KJRH 4HMCA 4OAWB 4JN1H 4LCCC 2FR4A 4KZEH 3N1MC 3C5JA 3DXAE 2GSIB 4KHTH 1Z9OA 1HQ4A 3MGTB 3PF2A 3MRHA 4PUBL 5DUBA 1HYSC 3MYZA 3HMXA 4I3RH 3EKCA 1CICA 2I24N 3U0TA 4BH8A 3EHBC 4FTVD 3HCVB 3MMEA 4HKZB 1XCTB 4M6MH 2QQKL 1FL5A 2QLVB 5B21A 4ETQB 4YJZL 3O2DH 3T3ME 4UT7H 2PETA 4RFNB 2V2XA 2D2OA 4OCYH 5I0DA 5INDA 5HI3C 4OGAC 1Q94B 2X1QA 2WSKA 2FEEL 4O00A 4FFZL 1S78C 1R5WA 4MDJB 5ALCH 5EZJA 2CIIA 5FGCE 4PB9L 3GSUB 4EXKA 1TXKA 5J6HB 2F74B 1S7RB 5E2JA 1QBML 2DF3A 1WWBX 3KYNB 3OKEB 3WIIL 4DGYL 3AC0A 2BC4A 1CN4A 3F7VB 3IF1B 3GB7A 4M3JA 2JF1A 1YZZA 3MBED 1H9VA 25C8L 4I13B 4LCIL 4WFFE 3MRMA 3HC4H 4QRPB 1JHTA 3WDHA 2DIJA 2ICWI 3DVIA 3T2OA 2JIXA 4H8WC 5D7SL 5E4IA 5DHYB 2OZ4H 5E99L 3E6FB 4HFUL 1AKJA 2FWOA 4XP6L 4TVSa 3ARDC 2DYPD 3Q5YA 2AEWA 3MBXL 4FQXC 1BVLB 1IGTB 4L3AA 4FFWD 3LDBC 3MRDB 4LRNL 2EH7L 1EO8L 2GKIA 2VH5L 4MNGB 5JW3H 5J11B 2Z31A 3QDMB 5EC1B 3CC5B 4FP8H 4MJ2A 4GRWH 4OFPA 2R0LL 1ZEAH 2Z91B 1MLCB 4GH7B 2P5EE 15C8L 3VXRD 3I3EA 3W9EB 2NY0D 4MNGE 1BEYL 4OCRH 2IADA 2ZSWB 3WFBL 2Y5EA 3QDME 4RNRA 3DX8B 4ONFH 3RL1A 2VR9A 4LSTL 5HHNB 4CMMA 2AJXH 1IAII 3S96A 3PL6A 5GISH 1HH6B 5ERWB 1TZIB 1WWWX 4OZGB 2BDNL 3H3PL 1NC2B 5BJTA 5FM8A 4JM2F 3X3GL 2W92A 2R2HA 4PRHA 4CVWA 3G6JB 2A6KB 5B38G 4OF6A 2CD0A 3LKOA 4JZNA 1ZHNB 4YHYC 4OZGE 2R1YA 1CL7H 3MPCA 5CILL 4ORZC 4KKNA 4MVBC 1CE6A 3HS0A 5F7FA 4XNQA 4M7LH 5EB9A 1QBLH 2UY6A 3G6JE 4L4TA 4G8EA 4MS8C 3C08H 3VWKB 2D7NA 4YGVA 3S37X 4OF0A 4N0CC 3TBSA 2ITDB 2YR3A 1ZVSA 4KGJA 4YWGL 2HJLB 4YBLB 3MRPA 3EYFB 4J3OC 3ULUD 5DJDB 1BQSA 1P7QB 4I77L 1P6FA 3OB8A 2MPAL 4FRWA 2Q8AL 4GBXA 3BIKB 4WUUB 4K7PY 2ZJSH 3U46B 1YYMH 5HI4D 4G6JH 1DBBH 4OV5B 1I9JL 2WIIB 4R96A 4G3YH 5TJWK 5E8EA 5LCVL 1CXFA 2QR0B 4OCWH 3U0PB 4WTZG 3LRGA 1ZOXA 1P2CA 3IAQA 1H3VA 4F7EA 3OKYA 4LLDA 4JO4L 2Z31C 3L5XL 3QO1B 4WUUE 4HZLA 4U0QB 5DR5H 4RAUA 3REWA 4RFEB 4U6VH 4X5WB 4ZUSB 4YFLI 5IG7A 1ZSDB 2FEDD 2NW2A 2VXSL 4IJ3B 1SVZA 2F5AH 4XP5H 4Z18A 5E4EC 1JFQH 2BERA 1A6WH 1MAKA 5BRZD 1C12A 4N0FA 2EDRA 1OAKL 3IU3A 3C5ZC 4Z0XA 1ONQA 5SX4H 2Q6WB 4KRPD 4JFHE 1N5YL 3KPPB 1QKZL 2G60L 2PUQT 4UOW1 1N4XL 5DSCA 3MJ8A 3FB6B 3BXNA 1MAJA 3PL6C 1JK8B 1T2JA 4HDIA 4IS6B 3X17A 4P2CG 4TUJB 5IJVA 3PWLB 4JHWH 1PFCA 1MFCH 3MO1B 3DIFA 3QDJA 1PYWA 3AREA 3LMJH 5MHSD 1NDMB 3CFEA 4PJCF 4DWHA 3FO2B 3T0BA 1M1SA 5FYJL 1NMBH 5JUEH 5IVXF 5KVEL 4KQ3L 4IRJD 2NY2B 5TQ2L 4LGPB 1PSKH 2UVFA 4OD2A 1U0QA 2HFFA 3BSZL 4WW2A 4M1GH 2IBBA 3F5WA 3P9WB 1GGIL 5DD5H 2VISB 1OSPH 2P44B 3HE6D 2FLRT 1QBBA 3VI4E 2P5WA 1DVFC 1G6RB 3HUJB 1Q1JH 3OX8A 5JW4M 2LVCA 3IDMB 4QRTA 3MOAH 3I6GA 4YHNB 3OHXB 1PEWA 3VXPB 2DQGH 2P49B 3MGOB 5E8DL 2FZ3B 3ARXA 2FJHB 4GBXC 2CPCA 4XVTL 3HUJE 5GSVA 3KYKL 3SN6N 4NQEA 4ZDHA 5BXFB 3SCMB 2R39A 4PGCB 3SKMB 3TF7C 2HJKA 3UJJL 1AD0A 3LKQB 2G75B 4JZJC 2VRAA 3D3VB 4OLVL 4ONHA 1A0QL 1CD1A 1KIPB 4U6YA 3KDMA 4JCLA 2B4CH 3ULVH 1YNTB 2R8SH 1T3FA 2EDXA 2NY4B 1X5FA 2AK4D 3FT2B 5C2BH 4ONOA 1HCVA 2A1WH 4ZS6C 4PY7A 5E94B 3LZFL 3ISWA 5C71A 1HZHH 4R26H 4U1LA 2AS5M 3JSSA 4AH2B 1X5HA 3NMEA 2N56A 3CJJA 5C0FA 5KVMC 4WEMB 4RMRA 5EUOB 1XF4B 3QG6A 1II4E 4R3SA 4KJQC 3RBSA 4GQ9H 3ROLB 4YDVA 1P1ZB 4M7ZC 4PGBB 5BVPL 3CFDB 4PJ7B 3D0VB 5EUOE 5K9JL 3MRCB 2K3TA 5C0EA 4HIHA 5EZLB 3CIQA 3F58H 4JPWL 5EO0A 5JZ7D 3BZFA 1FSKB 5BMFH 1ED3B 1T21B 1UG9A 3NZHL 4PJ7E 3G08A 4S2SA 5DQJA 2QBWA 1C5BH 5I8KL 1SMOA 3HZKA 4X7EC 2CR6A 5JHDD 1VADA 4O2CA 1WFTA 5D1ZD 3GMOB 5EUKA 4ZYKA 1X6NA 3MV7B 4KFZC 4UTAH 4H0GA 4K8RC 3QG7H 1FZJB 4KK8D 3U2SA 1ZXQA 3IDNA 2I9LB 2CIKB 4XWGL 5IW3A 5CAYB 1IEAB 1RZJH 4HUVA 5TE6H 5FCSH 7FABL 2AXFA 4I0KA 3VMOA 3QZWG 3MV7E 4MX7B 5DJ6B 2HLAA 4GFTB 4ELMB 3GJFB 2VSCA 3GHEH 3GSWA 1ZANH 2FO1A 2NCMA 3W0WA 3E1F1 3N1QC 4J4PA 2DWDB 4GKZA 5CIPH 5FFLA 5DQ9A 2ENSA 3V4PL 3FMGH 4LPTA 4HS6B 4ELME 3UYRH 1ITBB 4O4YH 4Q6YA 4HKXA 3WS6A 5GGTA 3S88L 2CRZA 2KPNA 3GGWA 3BH8B 2VTFA 1IMHC 4YXKL 3THMH 4X5XA 2OYPA 3MR9A 2HVKB 2VAAB 3VXQB 4EQ2A 1IE5A 2W9DL 1V05A 3MGAA 1FV1B 3RVVC 3SBWC 1SM3L 2CLVA 2A9MH 3IRPX 3MLSL 5F6IC 4C59B 2D03L 1I1FA 4XAKE 3TBTA 2FD6L 1IKFL 5FYKD 4MAYD 1Y0LA 1MCDA 1G7JA 5EOTA 1YEGH 4OF7A 3BPNC 1QO3A 5DD6B 4PPTA 1F2QA 1G1CA 2PCPB 4W6WB 5EZOL 1EA9C 1M4KA 3VH8A 5IV2A 4YPGA 5F7UA 4MWFB 5IB2B 1G7LB 4M6NL 4MQXD 3HAEB 1Q9OB 5I6XC 5GGSY 5IMKA 5DUPL 4Z77B 4Z7UF 5KVGH 3PWNA 4X4ZA 3U4EA 2XN9D 2EXYD 2PW2B 3IKKA 4PJBB 4AMKL 2O5XL 2Y9RT 4FABH 1X5ZA 4GG8B 2VDNL 4L8DA 3ZSSA 1ZKAA 4I3SH 5J9PA 3FOLB 1U58A 3GKWH 3HZYB 1MFDH 3DRQA 2DLEA 3CX2A 1C5CH 4YK4B 3JVGA 1NCAH 3U9PL 4RCAA 5FHAH 3P4OB 1HCFX 2ZCHH 2BMKA 3RHWK 3HG1B 1DFBH 2IH1A 3QPQC 4ESKA 4F37K 1MJJB 4BH7A 3IFNH 3D2UD 1WSST 3ZKNC 1BD2D 2X4PA 3G6DL 4ZFFA 1UWEL 2YUWA 1V3KA 3WV0A 1XEDA 2ADFL 4YZFF 3QDGA 1R3LB 2OLDA 3GRWL 3HG1E 3HR5A 1ZLUH 2X4SB 3C8KA 3LSOA 1UFUA 3MCG1 4MJID 5EPMB 2HKFL 3EJYD 1B2WH 2X4UA 4M1CD 4EOWH 3G6AB 1LE5A 3B6SB 1TETH 1I8LA 3L3JA 1MCIA 3TIEA 1T0PB 4M9PA 2BXYA 3DETC 1J7VR 2V5YA 1PG7W 3STZB 5L2JB 5I1EL 5H94B 3FRPA 3UTPE 5HHOA 4V2BA 1IZKA 3OMZA 1IM9A 2X4TA 2UWEA 3TWCL 5F1NB 3DX6B 4OCMC 1KJ2A 3P73B 4OFKA 3FQNB 2UYLB 5HHPB 4YFLF 1FLRL 4K7PH 2O5YH 2KL6A 5DURD 4PV9A 5DTFB 3T1FB 4JREB 2AJYL 5HYSG 4GRLB 2HTKD 4Y2DA 3EDDA 3DV4A 3RWJA 3W11D 3T3MF 4NWUH 4DN4H 1SBSL 4TVPL 1TIUA 4Y5VA 1RZ7H 2QADC 4X83A 1KBGL 5IR1B 3QUKA 2WK2A 3FZUD 1GC1C 1G7MB 5FCUL 2FO4B 5C0JA 3RJDA 3RKDC 3JV5A 4Z7VB 4EVNB 4MYWB 3SKOA 4IMKA 1OAUL 1A7QH 4M03A 1CXKA 5DK3A 4PJ9A 4JHZA 1AXTL 1U92B 2VL4A 4G43B 3D0LB 3VXUB 4NWTL 4IDJL 4RSVA 2EIZB 3H8NA 2W07A 1KLUA 3O3AA 1X9QA 3JVGC 4MJ5B 4Z7VE 1OTTD 2IEPA 1RAMA 4KJPC 3QFJD 2QSVA 3HPLA 5GSRA 4NRZA 3BW9A 4CU6A 2DBJA 5JPMA 3P40A 3GEWB 3MFGB 3SDYH 3K46A 1QLRA 2BSRA 1JPFA 2CKBH 3EO0A 4M8QA 4OCXH 3VXUE 3UTZA 4WJ5A 5ESVA 4WIQA 5A40E 3BGMB 4FFYL 2O5ZL 1T66D 4N0YH 5E1HB 1UKTA 3L95B 1IEBA 1IL1A 4FFVD 3ZT5A 4JPKL 2IAMD 4XI5D 1OP5K 1DLFL 2AEPL 1B9ZA 1A7OL 1FNGA 3WNMA 5C0NC 5CEZH 2J6EL 3L1OL 5CIPB 3LCYA 4JFZH 1I8LC 2NY5C 5JDJA 1H15B 4OM0H 1A14H 4WFGD 1FFOB 3L5WA 4GKNA 1MFAH 3NCBB 1D9KD 4ZS7H 1WBYA 3OF6D 4A6YA 5IB3B 4TSAH 4PJAA 4EXPX 4NZRH 1DEEB 3HRZB 3R1GH 4XC1L 5CP3A 5AUMB 3RZCB 3VXOB 1LMKA 2V2WA 3NCYS 4NQVA 1ZGLP 3G5VA 4KJYB 4P3CL 1MAMH 3JV0A 2E9WA 4UV7L 3V0VB 3N50A 2XXCB 2CK0L 3L9RB 4NKIH 3CFKB 2AJZB 4R8WH 4YHKL 1E4WL 1SQ2N 1UQSB 4RFOH 1MCKA 1ORSA 1IC5L 3RU8L 4OB5L 3PIQA 3MXVL 4XTRD 4Y2DC 1D6VH 3QQ9C 1L7TH 5F1OB 4Z78A 4GW5B 4X6BA 4F2MA 1AGEA 1VACA 4PJFB 1I3RA 3D9AH 5LQBH 5F9OL 4ZODA 1JRHL 4OZGF 1RHHA 2RJMA 3MRLB 4H1LB 5HYQB 3IFPB 1YEKH 2DDQL 4P4KA 4IMKC 5D70H 3SDXE 1E27A 1HDMA 4XGZB 3WS3A 4JLRB 2I60H 3G6JF 3IT8D 3KXFA 3B2UD 4PJFE 1Q9KA 4K3JH 3O6ML 4NHUA 3V5HA 3BQUB 1FZMB 2FX7L 1JUFA 4C58B 5DO2C 4D9LL 1MEXH 3LVEA 1R5VB 2R15A 1Z0MA 5J3HD 3T77B 1ZLWH 4NUJB 4RAHA 1KTDA 1RVFH 3U4BH 3L3KB 2OI9B 3KLHC 2XA3A 2XQBL 3S6CA 2DL9A 3BAEH 3QEGL 1GOHA 3W82A 3MYJB 3ILPA 1UWXK 3M17B 3CLEH 1KTRL 1J1XL 4D0CA 1T03H 2OP4L 4CBPA 4K55A 3SDAB 1YN6B 3K1DA 3RWIB 3BPLC 5T3ZD 3TIDB 4BM7A 1V7MH 2A83A 2BOCB 5J12B 3LEXA 3Q0HA 3RX8A 1QZ1A 2AGJL 3CFJA 3PJSA 1BLNA 2YA1A 3OKLB 3TFKD 2CLRA 5I73C 1VKXA 5IT2L 1MJ7H 5KSVB 2D7OA 3ARBD 8FABA 2FLBT 1BZ9A 1MQ8A 2WV3A 4F9LA 1MY5A 2ICWJ 2VL5A 5CSGA 1R5IA 5T33L 4NUGH 4S0SD 4MXVE 4G42A 4JRXA 4RA3A 1BIIA 5HDQH 3EYSL 4ODSH 2G9HA 1G7HA 3DXAD 2VDOL 2W0KA 3QUMB 5FEBA 3DUUA 4FMFA 4HFWB 3HN3A 3VGBA 4ODBD 3L7FA 4KKLD 1EH9A 4LHUA 1OGAA 4LVOB 1AIFA 2MWCA 2W0FA 4UZGA 4MXQC 1JF6A 4WEBH 2HLFC 5JQHC 3RWDB 2GK0B 2APTA 1KFAL 5CKAA 2YD7A 4LLUB 5BQ7B 4IOSD 1OAXL 5I0ZA 5KG9A 5BO1H 4QHMA 1H3GA 4P4KC 2NX5A 1XMWA 1EEUA 3ZYZA 1I1YB 3LH2H 3O3DA 4CMHC 2V5RA 1VFOA 3VI4F 3VFNA 1GAFH 5T1KB 2HTLC 3BO8A 3KS0J 5EU6A 1ZT4A 2LVEA 2K7PA 2B7DT 3S36X 4XPBL 3LQAL 1NKOA 1OT1A 1UXSA 1MIEH 1TJHH 4OTXH 3FQTA 3TVMA 3HUJF 3P9MB 2H3NA 3BKMH 1KCRH 5DJXB 4OFVA 3SPVB 2VLRB 3CNKA 5D71H 1RHFA 3SE8H 4CJ0A 1VSCA 3FB5B 4QRPD 2VR5A 2B20A 1PX4A 3S98A 1ACYH 1J05A 1N5AA 1JTTA 3BI9X 4LVNC 3HAEG 3FRUB 1JE6A 5CUSL 3VMPA 1PLGH 4NQDA 2W60B 2VLRE 4XNYL 3ESUF 1GJIA 2ATPA 2DQDL 3DURA 4XCEB 4U6TA 5SX5K 1A3QA 1NGPL 2E7MA 4HGWB 2UZIH 4H8WH 4UTBL 4XPTH 4JO1L 4F8TA 3PWJA 4WO4B 4ODHL 2DKSA 1IZJA 3IFOB 3QDMD 2FH6A 5FV1L 1R0AL 3UTTA 1D7FA 1Z9LA 4LSPH 2PXYB 4C56A 1A02N 2EDDA 5K9OB 4L5FH 2BNQB 1LEKB 5ITFA 4NDMB 1KELL 5IK3A 1AI1L 3GSNA 5EUOF 1UH3A 4IOFD 3H2WA 5C09E 3PUCA 3G04A 1WWCA 2EE2A 2EEDA 3T4YA 3KLAA 2IG2H 4KZDH 4PJ7F 3ZKMD 3ZT6A 5I8CB 5C0RH 3K4ZA 1J0ZA 3RIFK 2BNQE 3HMXH 3L3IA 5TFSL 3P9LA 4YHLH 4TNVF 4W4OA 2NY1B 2APBA 1CFVH 1MJ8H 2V5MA 1NUFA 1K2DB 1NC2D 4M43H 4I9WE 4YEFA 5HDBE 3RWHB 8CGTA 1MPAH 4U1JA 2OQJB 5DMKA 3WMSA 4HUUB 5I1LB 5CJOL 2PO6B 1OP3K 2AQ3A 5CJ8A 4X5LA 3TT1H 4ZFGL 4XNUH 5KN5B 4U1SB 2GCYA 2BY1A 1HILA 4BELD 2CQVA 5DD1L 3TVMC 1BP3B 3LKRB 2DQEL 1Y6KR 1RK0A 4NKOB 4PRNA 1MCJA 2F58L 5BZWB 1K4CA 1IAOB 4POZD 1N59A 4ELMF 1A6AB 5E00B 4WUKH 3HMWH 4LQ1A 4WU5B 3WIFB 3RX5A 1P7QD 1CZ8H 1A47A 2X2YA 4PJDB 2D31A 4TPRH 4ZXBD 3PWVA 3PDGA 4P9ML 2WP3O 4YHZL 2F54E 4MDIA 3H7BA 2MCPH 1A6TA 3RVTC 3QQ3A 3SDDA 2UV3A 4ZTPL 4PJDE 1TJIL 4UAOC 3DROB 4JFHD 5H35A 4YE4L 1I3GH 3QBTB 3NIFE 2BCKB 1GPOL 5JXAL 3MLVH 2F9BT 1UM5H 5C6TH 2BNUA 5LGHH 4ZPVB 5DA0B 5F6HJ 4GXVH 1CFNB 3DNKA 1BM3H 4XC3H 3IS1X 2ED7A 3CSGA 4HUWA 2EDTA 1NLDH 2A73B 4MJ6A 4HKBA 3QCVH 3QP3A 3W81A 3PHOB 4MA3A 2W65A 4W4OC 5GQBA 4PJGB 2F5BH 1I9EA 2J8UB 2ZSVB 3PP3H 2IWGA 5C6PB 1KEGH 2H8PB 4F15C 4R7DA 4AT6A 1H3XA 1IAIL 1KUMA 1YNLL 4PJBF 3H42L 4DKFH 1K4DA 1NMAH 2NY2D 2X10A 4KMQA 1S7UB 5HJ3B 3MNWB 3EYOB 3EYQC 5TDNB 3BP5B 1A6VL 3TPUB 1WZMA 3REVA 5C6WH 3L7EB 1XF5B 1MWAH 1U3YA 4K3HA 4QXWA 3HFMH 2R0WH 4JFXB 4K3EL 5FYLL 5CZVL 1F58L 3S35H 2XRAH 4G6ML 4BFIA 5GGSB 5EZIH 4U1KA 3MA9H 1RMFH 1JJUA 3VFSA 3ZTJH 3IU4H 5C9JA 1HH9B 3MJ7B 2R4RL 1BJ1H 2ZCLH 1IAKA 4E42A 4KXZI 4NNYA 1P7HL 3CLFH 4UDTA 4FTVA 1NEUA 2EH8L 4YIQA 4TTGA 2I27N 4H1LG 4OQTA 3HA0A 4ZFZB 4JFDA 4LLQB 1OGTB 3SCMD 1OLLA 2EDLA 3K1KC 4NC2B 3SDDC 5I1HH 4YBQC 3F6LA 3H9ZA 3NCEB 3H9HA 4NQSA 4OBRA 3VWJD 2FYYA 2B1HH 3D3VD 4L3EB 4FQXB 3H9YA 2BHUA 1LDPL 3MXWH 4HG4J 3WD5L 5ESAA 3LDBB 1C7TA 2NY4D 4XPAL 3RTQA 4OKVA 5JNYB 4OCSL 5CHNB 4NGHL 2H26A 3BKCL 2F8XC 1T04B 2YPKA 1EEYB 1IC4L 2CO7B 4L3EE 3S8WA 5LGJB 5IB5A 35C8L 1R3IH 3WCYA 4MD0B 1YEHH 2E6JA 1UH4A 3MBEA 3OKNA 4V2CB 2FR4B 1JMXA 5L8JB 5FA4A 2JKXA 3A67H 1OL0A 2XWJA 2HT3D 3MRHB 5DUBB 5GS0D 5JW4N 3FOMB 2QTEA 4RMTA 5GS3A 2EE6A 3T3PE 3U0TB 3O3UN 3MMEB 2GT9A 1AXSA 1A3RH 4TN9A 4Z7VF 4PR5A 4FQCH 5F1KC 3ALXA 3BUYA 4OFIA 1F8TL 3VXTA 1RPQA 2J88L 1MH5A 5D7JB 1BOYA 4MLIA 2V2XB 5INDB 5ACZA 2YD6A 3BE1H 1T2QH 2BSSA 4Q9QH 1ZWIA 4JFYA 4L3CA 4YHYB 1R5WB 5EZJB 2CIIB 1UXWA 3SHSA 2RB8A 1I7UA 1EZVY 4KHXH 5F9WC 3MUJA 2RFXA 5DD0H 3S5LB 5K9QI 3V4UL 3BPOC 4G8FA 3GB7B 3OR6A 3ZYJA 1EBAA 3I50L 4JDVA 2YKLL 3MRMB 1CWVA 4EUPB 5ICYA 3TP4A 5IVOA 2P43B 4UT9L 4QHNB 2ITCA 2GEEA 1IC1A 1KPRA 3N06B 1F4WL 4JPVL 1AKJB 2FWOB 4JDZA 3PP4L 4DVRH 5BZDB 3LKNB 3OXRA 3QEQD 4O02H 1P84K 1N7MH 5SWZA 5JW5B 4U6HB 4KK5D 2V2TA 4XNXL 1Z3GL 2C7UB 1PVHA 2EDEA 3RTQC 3RWFA 4ENEC 2PTUA 5GZND 3H7LA 3L5HA 2Z31B 3RPIA 3RVXC 5DD3L 5T3XH 5DVNA 3LPWA 1NGZA 1C16A 2VYRE 1QBAA 5E4EB 1UACL 4LU5L 4JB9H 5HI5D 4NT6A 4JDTL 3MBEC 4D0DA 1B4JH 3KLDA 2ZNXA 3C5ZB 1QPPA 2IADB 5HHQB 2GAZB 4X7TB 1DEDA 1EMTL 2AK1H 5IHZA 1MVFA 5I19L 1M71B 4PJFF 4CMMB 43CAA 3QEUA 3N85L 3P0VH 2XTJC 3S96B 1P5VA 4JHAL 3GRWA 3PL6B 5SV4A 2WZPD 1MOEA 1QFWI 2XT1B 3TC9A 5ALBL 1JNLL 4JQXA 2QEJA 1N0XL 4YLQT 4LQFH 3W39B 2R2HB 2CMRL 2DM7A 3OKOA 3OKMA 1SJXA 3AFLA 1S9XA 1FG2A 4JZNB 5BS0A 2R1YB 3CXHK 4PLKC 3HI6H 4PP2B 2GW5A 3IKCA 2GK2A 5BRZA 3SOBL 3NPSC 3PQYB 4ZNEE 2NY0C 1DBAL 4ZO9A 3HS0B 1PG7X 4XNQB 4P48A 4F3FB 3D48R 4L4TB 1JYNA 4G9FB 3BMVA 1TZHA 4YGVB 3HG1D 5E08L 1DVFB 2YK1L 1INDH 4QF1A 4BZ1L 4NSKB 3ARUA 3MRPB 1TZGL 1RV6X 4L4TE 5EO9A 4ZSOB 5L0QC 4G9FE 4HJ0C 3MLZH 3HC3H 4GBXB 5CBEA 1T7WA 1T22A 5L7XH 3UTPD 2YC1B 4NM4H 5JMRA 4JO2H 2VDRL 4KTEL 4IRJA 4R96B 4IRZH 4U7KA 2ADIA 2ICCA 5E8EB 4ZSOE 4NKQB 4HPOL 4ERSH 1P2CB 3NZ8B 4RMWA 5IP4A 2G5RA 4HZLB 4JZJB 4KUZH 5MEOB 4RAUB 3REWB 1AR2A 1WEJH 4NCC2 5FKAA 4JE4B 3O0RL 4XVJH 2FATL 5EA0H 1OP9A 1C12B 4GW1A 5DLML 1SVCP 4Z0XB 5F7HA 1RIVH 1TNNA 1LE9A 3P30H 1J1PL 3DBXB 2E27L 4OD3H 1XF2A 4GRLD 3QHZL 3QNZA 1IAMA 3MJ8B 2ADGB 3IS0X 5ILTH 5I8OH 3ES6A 2VQ1B 1UB5A 4OQ1A 4HDIB 2EXWC 4U1GC 4LLMB 2J6EA 5K9QG 4M7ZB 3QDJB 1PYWB 4JQXC 3WHE0 5HGHB 2M2DA 1WZKA 4U31A 4ZFOL 1MCOL 1HKFA 2BOBA 2CH8A 1HIML 1V7NL 4PGEA 2FEDC 3GMNA 1VESA 2CUIA 3BH9A 2YEZA 3VXUD 6FABH 2AK4A 3QDJE 1ADQL 4WU7A 3F5WB 4IDLA 1H8OA 1UJTA 4U33A 5IJKA 2WWKT 4DFHA 4MQ7A 4MHHI 2YUXA 5DRXB 3P0YL 3WKMH 3O9WA 4BKLA 4TUKH 2BVPA 3UXFA 3MRJA 2P5WB 5JOPE 4KKAD 5CEXB 3OX8B 1AQDB 1V3LA 4F7PB 4Q97A 4W70A 4QRTB 1HWHB 1LO3L 4OIBA 1PQZA 2DQJL 1OTUC 1ORQA 3WUWA 4HWZA 3IJSA 1HEZB 1IGFH 2P5WE 3VRJA 2J5LC 1N3NA 4HAGA 2HT2C 2JTDA 4IRJC 3R06A 2KZ1B 3VFVB 4F9PA 1MRFL 2ZUWA 2HJKB 4HKJA 1AD0B 1CE1H 2HH0H 1UM6L 1YN7A 4UB0H 5JHDA 3RZCD 5HGAA 1NL0L 4U6YB 3KDMB 4KRLB 1WZ1H 1T3FB 1F4HA 2R2BA 1CBVH 3AMKA 1GGCL 1EAPA 2OMBA 2AVGA 3NFPA 1KYOK 1INQB 4HCRL 3GSOA 5GIRA 1RUMH 2YMXL 4YX2L 4Z9KB 2N4IA 1NSNL 1KJ2H 2AI0H 2LE9A 3C2SA 5F6IB 4WI2A 3LRSA 1RU9H 3FFDA 1GGBL 3QWQB 4P23C 3BPNB 2V17L 3HNTH 4YDVB 5E2UH 3WE6A 2YA0A 5C3TA 3N9GH 4O58H 1BFOB 3NIDE 3GDBA 4JG0L 3EFDL 1LWRA 3RWEB 3TA3A 1M6OA 4OGXH 4PJXB 1CD0A 5E5MA 5I6XB 5IVZA 5FUZH 4HIHB 1R3HA 3BQUD 1A5FH 3NACH 4S2SB 5DQJB 4LRIA 3IXAA 1CI5A 2BJML 3HZKB 1CIDA 3MRIA 5IJKC 1WBZB 5AG8A 4JZOA 3T0AA 1VADB 4BK4A 4HLZG 5EUKB 3O9WC 2YD8A 3OAZK 4K7PX 4JQIL 3U2SB 2CGRH 1F5WA 1IGML 1NAMB 3IDNB 1N26A 4XXCA 4WEUD 1IILE 3FB8B 2R1XB 1KF9B 1E28B 2R69L 2VQUA 3MJ9L 1DQLH 1NLBL 5AG9A 1DQQB 2HLAB 4HT1L 3GSWB 4PJDF 4RGOH 5CZXC 3V6ZA 4KK9D 3GMMB 4Q6IC 4F9PC 3W0WB 2XN9A 3VFUA 3NIFF 4GKZB 4CN6A 5HPMA 5DQ9B 3OKDA 1A22B 3P0GB 5IVXA 5DWUL 1X4XA 3LHPH 1HOCA 3GGWB 3RFZC 2Y7QA 4A6YH 1BFVL 2KQMA 3GSRA 1NUDA 4X5XB 4UIKH 5JHLL 3W0WE 5CP3H 4RISL 1YY9D 4KK8C 4QO1A 5MERA 1OAYH 2R4SL 5JOFA 2G2RA 1AC0A 2DM2A 4Q9RL 4F8QA 5I1CH 3CCHA 4FZ8L 1ZVHA 5F88A 5KAQG 3MUY1 3S5LG 3GFUA 3TBTB 4N5EC 1Y0LB 1FGNL 3LIZL 1MQKH 1G7JB 5EOTB 4MHHG 1QO3B 3WNPA 5FDWA 2QV2A 4EUPG 4PJGF 5TPWL 3VH8B 2J8UF 5IV2B 3RNQA 5HHMB 4HJGA 3TA3C 2QADB 3B2VL 5IMKB 2YWYA 4KKBD 4AJ0A 3PWNB 4U1HA 1WITA 3U4EB 1OWWA 5B38A 4QHLA 4LRIC 1EVTC 4K9EH 5E0QA 2ZG2A 1BOGA 1QSVA 1K6QH 4XPFL 5T1KD 5HHME 2FSEA 4L8DB 2OTWA 4LSSH 1FO0L 2GY5A 4K3DH 4NO5A 1U58B 4BZ2L 5I17A 4JG1L 3MLWH 4KRNA 3O41A 3WXVH 5D8JL 1XH3B 2VKWA 4BQ9A 2APWA 2ZOKA 4QXUH 1HXMA 4X4ME 4XXCC 4KJWD 1WFUA 4YQXL 3OBAA 2GQHA 3T2PA 2X1XR 2BFVL 2BMKB 2J3SA 4M1DL 3U36A 3OZ9L 3U1SH 3VFPA 4BH7B 4NCDA 3DOSA 2VLRD 3Q6GL 1N8ZA 4FQJH 4HW6A 2DMKA 2X4PB 1UM4L 4YUEH 1OOAA 3T0EA 3QDGB 2DKUA 5I1IL 5CLTA 3C8KB 3LSOB 1HWGB 2VAJA 1I3VA 4N9OB 2QQKH 4LLVB 2X4UB 1RIUL 3VA2C 2ILLA 1D5IH 4GMTL 1LE5B 4WTZA 2C1PB 4LLWB 1UWXH 5I16A 4J3VA 3TIEB 2NW3A 3F7YB 3QDGE 4ZUVB 3B5GA 1X5IA 3GMQA 4WO4D 1S7VA 2RR3A 3LEYH 3PGFH 5TE7H 4PTTA 1AHWA 4LASH 4UI2A 4Q74A 3DV6A 3LQAC 4CADA 4ZOBA 3PXJA 2X4TB 1LO0L 4FFZH 4MCZA 4HIJA 5DEGA 3SGEI 2PXYD 3LS4L 4XWOC 4DAGH 5ECJE 4U1NA 3TJHC 1XGTA 4RX4D 4J6RL 4X9GA 1WIOA 2GITA 4XCYA 5LAXA 2HN7A 5MI0C 2A77H 2UWEE 3DX9A 3TCLB 1A9BA 3VU2A 3BD5A 4Y2DB 3DV4B 4LGSB 2C1OA 4U4BA 5L6YH 2PR4H 4JKLA 3QRFM 1D5MA 3QUKB 2NMSA 2NY1D 5C08B 1D9KA 1S7TB 4L4VA 1NCCH 5D7SH 1JI1A 2NY6C 5C0JB 1X5AA 3UPCA 1FGVH 2AW2A 3SKOB 4P5MA 5DRZA 5EU5A 5TF1H 1HK6A 2QSQA 2X44D 3I85A 3B8SA 1B0RA 1J1OL 3K8KA 1JHLL 4LSRL 3KR3L 3NAAL 2AEQL 2PO6D 5GJSH 3VA6A 5C08E 3CU1A 1OM3L 3F7QA 3O3AB 2K7QA 4TSCH 3ZE0E 1S7SB 1JCKA 4AEFA 3HPLB 1TVBA 4NRZB 1YEFL 5JPMB 1M7XA 1F90L 2BSRB 1JPFB 3EO0B 5EU3B 3UTZB 4WJ5B 5IBUB 5FB8A 4UINH 1IGYA 3G5XA 5FKPB 4EN3A 3QXTA 3PHQB 2QL1A 3PV6B 3T0EC 3TJEL 1Q9LA 3TO2B 2XY1A 3D5OF 3MV01 1FP5A 2EDYA 2YUZA 4WWKC 1TVDA 2EDBA 1PZUB 1MREL 1YEEH 5FO8A 5KANI 1KTLB 2YD5A 1WCBA 1NKRA 1S9YA 3IDGA 1MHHA 5F7KC 3P11H 1X6LA 3L5WB 4N8CL 1T0NB 3FCTA 4GKNB 5I73B 2P8MB 1WBYB 3SKJH 5I1KL 3RVWC 2MFNA 4PJAB 4YR6A 1LO4L 3IFLH 1OTTC 3GBML 1WT5A 3CK0L 3NH7L 5CJXA 4P5TD 3G5VB 4QWWD 1HHHB 3QQ4A 4OFYD 3IXTA 5B8CA 2NY3C 3FO1B 4LARH 3O11A 4PJAE 5T1DL 3BN9C 2DKMA 4M6OH 1SY6H 4XI5C 1P6AB 5SX5H 4UV4H 1JGVL 3GSNH 5GRWA 5DVKA 3SEPA 1AGEB 4Y19A 5AAMA 1I3RB 1HYSD 4M5YL 1D9KC 3RUGB 4I77H 4F33A 1RHHB 1QLFA 5F72S 4HQQH 2B2XL 1CGUA 4P4KB 3WS3B 1E27B 4LF3A 1Y6NR 3CPLA 5KVFL 4RMSA 3KXFB 2BSED 3NN8B 3RPKA 3IVKA 3X13A 1MCHA 1Q9KB 5E8PB 4Z8FH 1I3UA 2HKHL 3HNSL 3KHQA 3V5HB 4AEHL 2DI9A 4ZD3L 4CMHB 1A7PL 1V3JA 3GI9L 2VXUL 3L5XH 4U1MA 5HI3D 4HC1L 4OGAD 3EO9L 1QVOA 4OJFH 1KTDB 3KXFE 2VXSH 1KNOA 3QNXB 1EJ6A 2R2EA 3QO0A 3I75A 5FO7A 2ARJA 3QRGH 2EC9U 2X9YA 4EN3C 4YBHA 5E2TL 1W0VA 1GH7A 3MGTA 2E9JA 4D0CB 3QZWA 9CGTA 4HWBH 1G7QA 2DWEA 4IIQA 1E6JL 1P53A 2A83B 1DQMH 3GNMH 3HCVA 4HKZA 1XCTA 3WIHL 1KCKA 4HD9A 3MACL 1BLNB 1XGYL 2CLRB 4XMPL 3NFSL 4WTXA 4HMDA 2GJZA 4KV5F 8FABB 1KJ3H 1P4IL 4TULH 3PWPD 1WT5C 3ABZA 4HWNA 5CJXC 2QSCH 5FYJH 5IFJA 4KQ3H 4FQXD 1A6ZA 3HNVL 4JRXB 4MDJA 3U7WH 5B8CC 2G9HB 4XCFL 3QYCA 3RRQA 1MF2L 1UA6L 1S7RA 3X3FL 5LWYL 3DUUB 4YXLH 3KYNA 5ID0B 3OKEA 1JV5B 4XBEH 4LHUB 1OGAB 4HH8A 4JRXE 1S9WA 5I75C 3GIZL 1AIFB 3GM8A 5KW9H 2W0FB 4ZTOH 1V3MA 1VGEL 2Y4SA 1WICA 2DAVA 4O9HH 2QQNL 2E3VA 4QRPA 4R4NC 1U6AH 4PD4K 1YEDA 1I9IL 4OCNC 1OGAE 4QHMB 5DHYA 4YXHL 1ROWA 3E6FA 4X7SL 1BVLA 1IGTA 5I76A 3O3DB 5D7JD 4HS8L 1DBKH 1OPGH 4MNGA 3WEXA 3VFNB 4KVCH 3Q6FA 5KANG 3CC5A 3BO8B 5EU6B 1A0QH 1ZT4B 2EECA 4KKLC 5HGGS 5KSUA 4YDJB 3KPQA 2Z93B 5L88L 3U0WL 4MVBD 3S34H 2VLKA 5FGBA 2EDKA 1MNUL 3KNBB 5IESL 2HVJA 3QHTC 3FQTB 1IQWL 1UVQA 3NGBC 4GJTB 2OL3H 4M02A 1EO5A 4PP1C 5EU6E 2QJDA 1JTOA 2JJTA 2H3NB 5HHNA 4IIQC 4DKEL 1C08A 1QSFB 4EDWH 4JJHA 4M62L 5ERWA 2XZAL 2YPVL 4OZGA 1FFQA 1FH5H 3GK8H 1A3LH 2OX5A 4S1SH 4OQTH 3R8BB 1PDKA 1QSFE 2A6KA 5ISZA 1VPOL 4X6CB 3DURB 1ZHNA 3BP6B 1ACZA 3RX7A 4F57H 3K80A 3PWJB 5F7EH 3C6LA 2Z31D 4UAOB 3QXWA 5D2NC 5DI8A 1REIA 3NCCB 4CNIB 4C56B 2GIYA 4DVBB 3MV8A 2HJLA 2J12B 2HFGL 1W8OA 3C5ZD 1DJSA 1TTUA 5ITFB 3UC0H 4XWGH 5HYSA 3V4VH 5HPOA 3QNYA 1MCCA 1NMCC 3G04B 4S1QL 3T4YB 4C56E 4D9RE 3KLAB 4ZXBA 4K94H 3BIKA 1EHLL 3PL6D 3L3IB 1CU4L 3P9LB 1SJHB 4PJXF 2M1KA 3W2DL 4GAJL 4F15B 3DYPA 4X4YA 3F7PC 5DMKB 2AJVL 5E8NB 1FPTL 4JR9L 3GSXA 1MSPA 3O45B 3PQYD 2GCYB 1OAZL 4G5ZL 4FQLL 3IDXL 3O4LA 4NN6C 3MRKA 4L4TD 4AM0A 2Y1VA 2JJTC 3AMLA 4G9FD 4PRNB 3MLSH 1H3PH 2YBRB 4AG4L 2FD6H 5GRYA 1DVFD 1JK8A 1K4CB 2R9HC 1BAFL 1N59B 5EU7C 4TUJA 5DRWB 3PWLA 1P4BH 1J10A 1A1OA 1U8LA 2WNGA 4H20L 5FA3A 5CMAA 1W72L 3HTLX 3MO1A 5DQDH 4YFDB 4CN4A 2D31B 2E7HA 2BVQB 2PKDA 4GBXD 2FEEI 3MFFB 1FNSH 3EIFA 4WRLA 3PWVB 3FO2A 2VZUA 4ZFOA 1I1AD 4U05A 2X9WA 3H7BB 2DTML 1A6TB 3QQ3B 4PJHF 5D7IB 3SDDB 1Z9SA 3C6LC 4UILL 3C8HA 2AV7A 1ADQA 1HXYB 1TQCC 2VISA 1ZT7B 5KS9B 3Q48A 3CVIH 4G9DA 5FYJE 3TV3L 2VERN 3MROB 4JFFA 3HUJA 1CR9L 1S5IH 2BNUB 4ZS6D 1PKQA 5IBUG 1C1EH 3O2WH 4YHNA 1MFNA 2AJ3B 4P49A 5J0BA 4XX1E 3MGOA 1FCCA 1LGVA 4MJ6B 2AAVA 4ZXBC 1MRCL 4BQ6A 3ULUH 4MA3B 2HT4C 2W65B 5CP7A 1G7IB 5DDHB 1WJ3A 4EBQL 4NP4H 3QDJD 4AT6B 3EDEA 3LKQA 5E2WL 4PB0H 3VWJA 5F1SA 3B9AA 2Y07L 3D3VA 12E8L 4QY8B 1KIUA 2H41A 1F02I 3VE0A 5FF6A 1YNTA 1QFWL 5JOPD 1FVDB 1OW0C 1TTGA 1MJUH 3M1BA 4NZTL 3REVB 2CR3A 1B6UA 4P2RA 4AH2A 3VI3E 4QKXB 2P5WD 4I2XA 1F45A 2QQLL 4K8RD 5DK0A 5EUOA 3VXSB 5F9WB 3VFSB 2B1AL 3TM6A 4DTGL 1G84A 1P1ZA 4PGBA 1AGDB 1IAKB 4NNYB 4PJ7A 3BUTA 4UDTB 4YIQB 1SBSH 3NABL 5IGXH 1GCFA 2CJUL 1EBPA 4L29A 5F89B 4PRDA 4JFDB 3BHBA 4PJ8C 3VW3L 5I15L 5E24E 3RHWF 4F58L 1QSEA 2OJZH 1JN6A 1J8HB 5C7XL 1UWGL 4F37F 1ED3A 4YDKL 2P42B 4HH9B 1WUNT 2P1YA 3WFCH 3GJFK 2ICEA 3T4AA 4JFDE 2LU3A 5F21B 5DT1H 4WCYH 4L1DA 1J8HE 1NANI 4NWTH 1T83A 2WW8A 3RTQB 4OKVB 3ZE2E 1FZJA 2H26B 2Q8BL 4WW1B 2I9LA 3EZJB 1OB1A 3WHXB 5I1JL 5C0BB 1IBGH 5IB5B 1U8KA 4DOHB 5B4MC 1FBIL 5DJ6A 4HGMA 1YMMB 1IGJB 3GJFA 4YO0A 5FA4B 2DQHL 5E7FA 2R1WA 5HBBA 3G5ZA 5C0BE 1DSFL 5K59E 4QGYA 1FVEB 4DOHE 5HVHC 2R2CA 1DLFH 1YQ2A 2AEPH 4GLRH 3V6OC 1MFBL 2BSTA 2XTJB 3VWJC 2FH8A 1NBYB 1YMME 2GT9B 2J6EH 2JB6A 3OTTA 5D2LA 2HG5B 1JPSL 2P7TA 5EORH 3ZE0F 1VENA 3BUYB 3QEQA 3BH8A 4HV8A 5ELIA 4O5LH 3VXTB 2E7LA 2XQYG 2JELL 2Y25A 2HVKA 5ACZB 2XZQL 4KY1H 1P7KA 2XTJE 4M7KL 4P3WA 1HHGA 4JFYB 4P3CH 4P2QA 1AGFA 1F4XL 4YHOH 2R0ZH 5MENA 1H3WM 4R4FH 2NY0B 3SO3C 4DQOH 1Z5LA 5M7QA 5EFIB 1FQ9C 3DHMA 2HT3C 2RFXB 4OLUH 2VLLB 4G7VH 4U7SA 4G8FB 3QPQD 2B5IC 5EOCL 2AABH 5F7YC 3RNKA 3ZKND 3OPZL 1G7LA 1TVHA 1DL7L 5ICYB 5F96H 1CDIA 5F9OH 1RZGB 2ITCB 4N8VB 5L0QB 3LV3A 1KCUL 1N6QL 1BMGA 2PW2A 1S3KL 4J8RA 1WFOA 4PJBA 4I4WB 3BP4A 4JDZB 4GG8A 4JFEB 2PNDA 2IFFH 5F97E 3FOLA 5SWZB 4JKPH 2V2TB 1FO0A 1T83C 4OLXH 3RWFB 3DETD 5IOPB 3QWRA 2GJJA 3DSFL 3QCTL 4D94A 3RPIB 3OXSA 4JFEE 3SGKA 1QFUL 5EC2A 2D7TH 5SWZE 1C16B 3HG1A 1MJJA 1J9CT 4NT6B 5GGVH 4YHPB 1BGXH 2ZOLA 3WFDH 2FIKA 4NJAL 4QRUA 4XVSL 1R3LA 1KIRB 43CAB 3QEUB 3RUGF 2X4SA 5EPMA 5HHMD 4Q58C 3G6AA 2QADD 3C60A 4U1GB 5IEKA 2FDBP 1ETZA 2E7LC 5DC9B 3KVQA 1NH6A 4MXWL 5I18L 3STZA 5L2JA 5GZNC 3CH8A 5H94A 3RKDD 3OKMB 5T33H 1YA5A 1YDPA 4OV6F 1GXEA 1FG2B 5BS0B 5F1NA 5CGYC 2Y06L 1CF8L 1F3DJ 3IKCB 5BRZB 5HI5C 5TE4L 1WTGT 4RGNB 1UCTA 1A7NH 1EPFA 2JLLA 3MRQA 1JYXA 2VITA 2UYLA 5EOQH 4FXKA 2OJEB 5E2VH 1VDGA 1NCBL 3KYMA 3OQ3B 4KJPD 5BS0E 1KEML 5FYKH 4H88H 1S7QB 3T2NH 2ZNWA 3WFEH 5L8LB 5BRZE 1NBQA 5I1DB 1I7RA 2VDPH 2X1PA 4H25A 4OIIL 3OAUL 1KFAH 2IPUG 1HYRC 2AJSL 4GAYB 3QDGD 5EBLA 2VDLL 1G7MA 2FO4A 2NR6C 3VFRA 4HK0B 5IFAH 2LTQC 4QXGL 4Z95L 4Z7VA 3LQZB 1T22B 4B41A 4EVNA 5DZOA 1KG0A 2J5LB 4XPHH 3HB3D 3ILQC 2IANB 3MRFB 2DLTA 4IRJB 3QJFA 4G43A 4TVPE 2ZP0T 2QHRL 2ADIB 4Y5XC 4DEPC 2P8LA 2XA8H 2BVUA 3ARVA 4S0TD 5DRNA 2A6IA 2EIZA 5DMGC 3WNOA 4MJ5A 3U7YL 3AS2A 2IANE 3STBA 1U8OA 4MAUH 4KQ4L 5FKAB 5IHBA 3I2CH 2JE8A 3W9DA 3MRNB 4P4RA 1CLYL 1IAIM 4GW1B 3GBNL 3HZVB 1E4XH 3N1GC 3OJDB 4KVNL 4Q0XH 1BF2A 4B5EA 2BVEA 2CRIA 3QH3A 3BDYL 1OT2A 1UJ3C 1XF2B 1KN4L 2MHAB 1QYGL 2YD2A 2W0LA 3QNZB 4Y2DD 5KSBB 3ES6B 3QQ9D 1UB5B 4GSDL 2DOCA 1IC7L 3C60C 2FJFA 2AKRB 3MV11 4P23B 3BN3B 1FFOA 5C08D 4HIEA 1BQHB 1EZVX 1DBJL 1DEEA 2BOBB 5DHVB 1TJGH 2DQDH 5AUMA 2XKNB 3RZCA 1JGUL 3GMNB 1QNZH 1A2YB 1MIML 4L4JA 5HHVH 3BH9B 4WI9A 3V0VA 3KJ6H 5BV7H 3AS3A 3L9RA 5KJRL 5DO2D 4KZEL 4JN1L 3CFKA 3GI8H 4RA0C 4Y5YC 4KHTL 3LPFA 3BESR 2XWBA 4JKWA 4I3RL 4KKCC 4OZIA 2EDOA 4LCYA 4UQ3A 3VD9A 3O9WB 3KLHD 4BKLB 2AK4E 2BVPB 2F8OA 5FM5M 3D6GA 4IRSD 3QT2A 2C3WA 2GHWB 1NCTA 4FZEH 3VRLE 1YEIH 1PQZB 2ZG1A 1CG9A 3O2DL 3WUWB 4UT7L 3IJSB 2VUOA 3MRLA 4OCYL 3WL9A 3VRJB 4NZUH 3L5JA 4XGZA 3FN3A 4JLRA 3BKJH 1N3NB 4Y88A 3OAYK 3R06B 4X6CF 2N1KA 1AXIB 4K3GA 1D6EA 4HUNB 4PFEA 4Q6IB 5ALCL 3MC0A 1WIPA 1NAKL 3Q5OA 3MLTB 1XGUA 1DN0A 1YN7B 1FNLA 1CTNA 4P2YA 4NUJA 5HGAB 2N7AA 4HC1A 3L3KA 5CJOH 4MD5B 2RBLA 3DUSA 3F65A 4I0PA 4PJIB 4XHJC 3RJQB 1EAPB 1J0YA 4AENA 3NFPB 3GSOB 5GIRB 3M17A 3HC4L 2W9EH 4K07A 4NC0B 3T08A 4ETYA 3INUH 2NYYC 2ERJC 3TIDA 4PJIE 2OZ4L 2BOCA 4MXQD 3FFDB 3QDHA 2HLFD 3EO1B 3O81A 3WIHA 2DICA 3BIBX 3OG6B 4J3SA 3GJEB 4GQPH 5KSVA 5JW3L 2OTUA 4MNQA 2WUBH 3RZCC 3TA3B 2GFBA 2VDQH 2DRUA 3KXFD 2IH3A 1RULH 5TDPA 3WNKA 1SEQH 1ZAGA 1NUGA 4OCRL 5HVGB 1TJIH 1NBVH 2XIDA 2DD8L 3JWOH 3QUMA 4MCYB 1LD9A 3TPKA 2HTLD 4JZOB 4ONFL 3O6LH 3ARQA 3I9GL 2XPGA 2N7BA 3SDCB 2AJXL 1I7TA 4XT1C 5F7NC 2OTPA 2APFA 4X6FA 4JRYB 5GISL 1J5OH 3C6SB 1ND0A 2E5EA 4MA7H 3K4DA 4N9GA 4JN2A 3O3EB 5KSAB 2MKWA 4JRYE 3V6ZB 2FHFA 1H3TA 3ARGB 2MCG1 4G8IB 2CO6B 1X4YA 4LMQI 3UTSD 4OLZL 1CL7L 1I1YA 3ZYOA 4LGRB 1H8NA 2XN9B 3VFUB 5L2KD 1RZKL 5HPMB 5D7IF 3OJMB 5C9KA 3OKDB 1IAIH 1QBLL 4R0LC 3H42H 2Y7QB 2FECI 3C08L 4I0PC 4JRXD 1HN1A 5KS9F 3F7RA 5EDXA 2XN9E 3MODH 1EUTA 3UPAA 4NHCH 5MERB 2EZ0C 3KS0H 5JOFB 5IVXE 3ZLQC 2G2RB 2VN4A 1KB5H 4CU8A 3CCHB 4DUWA 3W5NA 4LHUD 1OGAD 5DJXA 3SPVA 1YUHB 2OS7A 2AEIT 2ZJSL 1YYML 4OLYH 3UDWA 4PLNC 3FB5A 4G6JL 1DBBL 5T3ZH 4G3YL 4XNZC 5MI0B 2R4RH 4GMSL 3FRUA 4OCWL 4NM8H 4XCNB 3KPSB 2W60A 4N8VG 4HJJL 2C4FU 5DR5L 3RNQB 1F42A 3RGVC 4U6VL 3SGDI 2F5AL 4XP5L 3C2AH 2R56H 1P5UA 4UMGA 5B3JE 1JFQL 1CS6A 1CXHA 1PGRB 3VI3F 4KPHH 4QHLB 2NY6B 4MA1C 5IHLB 3VDAA 1FAKT 1BOGB 1A4KA 4ZNCD 2FSEB 3L6FB 5I9QC 2OTWB 1A4JA 4NO5B 1LDPH 1CDGA 5I17B 4LVOC 5ESQA 4HULB 3DMMC 1AGBA 3O41B 2OR7A 4UOJA 1HXMB 5K9OA 2D9CA 4RX4A 5ICZB 2EEBA 1JRHI 4JHWL 2V5SA 5L9DH 3FT3B 3U36B 1FHGA 3LMJL 4KRMB 2W1NA 1U8NB 1QSFD 1N8ZB 2HP4A 5A2IH 3DVGB 5LKNA 1L7IH 2L7JA 1NMBL 4OZFG 5JUEL 4XPGH 3T0EB 1PSKL 3CFCH 1NCUA 3V5DA 4WWKB 3RGHA 4M1GL 4OD1H 3P2TA 3ZE2F 5DD5L 4JVWA 1OSPL 5GRUL 5T5NG 3L3DA 5I1LA 2D0HA 5I16B 4BSJA 2PO6A 2NW3B 3T0EE 3QWOA 4QYOA 1S7VB 4XBGA 1CGSH 1Q1JL 1UZ8A 4PBVC 4WHTA 4CADB 3MOAL 3MJGX 4NNPH 1ZV5A 3B5TA 3WBDA 2DQGL 5DEGB 4G6AD 2ZKHH 1AJ7L 4C56D 2AJUH 4D9RD 2Z4QB 3RI5K 2NY3B 3QQNA 4U1NB 4CDGC 2DLHA 3WNNA 1XGTB 3MTRA 3UDWC 4GXUN 4DKAA 2GITB 4TRPH 5LAXB 2HN7B 3VGFA 4WU5A 3DX9B 3V4UH 3WIFA 3UX9B 4NRYA 1L4IA 4PJDA 1W72A 2C1OB 4HPYH 1OY3B 1GVIA 1GGTA 1D5MB 3S7GA 3UP1A 1FORH 2BXZA 2B4CL 4UT9H 3ULVL 2R8SL 1D9KB 4XH2A 2WINA 1HKLL 4L4VB 3CFBB 2WUCH 3HZMA 1BWMA 3B9DA 5C2BL 2A1WL 2IJ0C 4Q7DA 4YNYB 5EU5B 1HZHL 1G9NL 1B0RB 3B5HA 4P5TA 4R26L 4WFGE 4OFYA 4L4VE 3GBLA 3EYQD 4M61B 4WI3A 5DD3H 2IBZX 3MUHL 4GQ9L 1CFNA 3WDJA 1F4YH 5T1MA 1EK3A 4HF5L 5FB8B 1IGYB 1U8IA 4EN3B 5J1AB 2P4AB 2YHGA 2VR4A 1JGLL 3V7AE 4PJGA 3F58L 2J8UA 5FO9A 5BMFL 2H8PA 2WANA 4J12A 2Q3ZA 1C5BL 4JHAH 3A6CL 1BQHG 3IDGB 2PO6C 1S7UA 1RZ8A 3MNWA 3SDDD 4UTAL 5LJYH 4YR6B 4YBQD 1B90A 5TDNA 1IT9H 3QG7L 4KMLB 3BP5A 5F3HA 2NLJA 1JGDA 3RIAF 3TPUA 1U9KA 5DMIH 1XF5A 1RZJL 4LFHG 3O2VL 4CVZB 5TE6L 3SOBH 1KCSH 5H2BA 3WLWC 3IXTB 3FT4A 5B8CB 5J06A 2APXA 1JPTH 3O11B 3U48A 1ZE3C 3GHEL 1ZANL 1FZOB 1YQVH 1HH9A 4WI4A 4TYUA 3DTXA 3EBAA 5I75B 3B9KA 2D7MA 2VXVL 3FMGL 3UYRL 4CW1B 4O4YL 5FYLE 2VQTA 4RMVA 1G6VK 1WF5A 1DUYB 4Y19B 5IM7B 3ZZ1A 1OARH 2ATKA 4LPXA 3THML 3UTOA 1L9MA 4F33B 1BWWA 3B3IA 1CQKA 1QLFB 4FQHA 3QB7C 3PWPA 4KI1A 3CPLB 3PABB 5T5NF 4P5TC 2FHCA 4YZFE 4Y19E 1BZ7A 3X13B 3MUGA 1DQJB 4I48B 2FRGP 2H6PA 1RZFH 4GUPA 4R90H 4ALAH 4E5XA 2GTWA 1NFDA 5JNYA 5CHNA 4U1MB 1T04A 1YEGL 1KNOB 4HIXL 2R2EB 2C4FT 1Q72H 4FQPA 5FO7B 1RUAL 1LO5A 2EIEA 3HLAA 1YNKL 1ERNA 2CDGA 4GAGH 3MSPA 1W0VB 4QEGA 1KC5H 3VXSD 1I8IA 4N1CA 4CUCA 3QZWB 1CK0H 3NGBB 4OLWH 5KVGL 3FOMA 1G7QB 2DWEB 2XZZA 3BZ4A 2P46B 4IIQB 2XACC 5DGQA 4FABL 1D5BA 4I3SL 1CFTA 4JFDD 2KQNA 3GKWL 1MFDL 2NXZC 1J8HD 2GJZB 4HWUA 5D7JA 2LFGA 3O3BB 2LU4A 3CDCA 4X7DC 3AGVA 1NCAL 2BRRL 3TNMB 4MB5A 4A2LA 5IFJB 4LNRA 2ZCHL 1A6ZB 1ADQH 3IFNL 5SV3A 3RTQD 3FQRB 4ENED 3GZKA 5ADPH 43C9A 3I02B 3RVXD 4U49A 4LNVA 3AM8A 3S5LA 5C0BD 5CKGA 3HC0A 5D2NB 1G6RH 1S9WB 3B9KC 4UUJB 1T1WB 1YMMD 1VFBA 1A1MB 1B2WL 4FQIL 5CZKA 2GYSA 3TT3H 5KSBF 4EOWL 4EUPA 2O26U 1YEDB 2M26A 3V6FA 4DZBB 5KVDH 3IAPA 4QHNA 1T5WB 1M7IA 2X70A 3X11A 5D2NE 4PS4H 5J6GB 1NMCB 1UYWH 3T0WA 2XTJD 3EDJA 1JNNH 5AEAA 2LU7A 4TUOA 5BZDA 4QRPE 4J3WA 3TZVD 4EI5A 3LKNA 4QRRB 1QR1B 3WUZA 4HX1B 5I76B 4G80B 5JW5A 4U6HA 2C3XA 2C7UA 2ZUVA 4XVUC 1ZA6A 3WEXB 3JZ7A 3Q6FB 4IOIB 3RP1A 2CKNA 3FO0H 3QPXH 2O5YL 1IEHA 1NL0H 4QRRE 2A6JB 2Z8SA 3VRLF 3PWUB 5KSUB 4PLKD 2AQ2A 4L9LA 3KPQB 4DN4L 4NWUL 4D3CH 2VLKB 2CDFB 3C5ZA 2HVJB 1RZ7L 4NCC1 5HHQA 1KB9K 2GAZA 4X7TA 1UVQB 5HYIA 3RY4A 4NN6B 1NSNH 5JPNB 2BVOA 4R9HA 1M71A 1C08B 1RIHH 3EJZD 2E9IA 1T89A 2FX8H 2VLKE 5GS0H 1A7QL 4Y4KA 2FX9H 5B22A 5EIQA 3VG0H 4LSUH 5C86A 2IQAA 4ZNEA 5D7JC 4HJ0D 3G9VA 2BX5A 5AYUH 3W39A 3T65A 3TH2T 3SQOH 5ISZB 4JFED 5EU7E 3QHFL 5SWZD 3SDYL 2CKBL 4PP2A 4OCXL 3PQYA 4P9HH 3C6LB 3OKKB 4N8PA 5IB4A 3P4MB 4X98A 4PJEB 4Z76A 4PJIF 3OR7A 2EIBA 2LQRA 5LXGH 5ISZE 2DQUH 3EJJX 1TQCB 4F3FA 3AM8C 1OAQL 4G9FA 5DI8B 5GXBB 3CSYB 3EAKA 2DM4A 4R2GC 4K7FA 3MV8B 1DVFA 5CEZL 4NSKA 1I8MB 5D6CB 5HYSB 3NFNA 3OGOE 3SY0A 3FFCA 4IEFB 3ZDZE 1M7DB 4OM0L 1A14L 4G8GA 4ZSOA 3QNYB 1MFAL 1D5XB 4ZS7L 2R69H 3GJFH 4POYA 1EJOH 4ZXBB 4NZRL 3MV8E 4Z7NE 3AXLA 2NXYC 2YC1A 5MEQB 2EXWD 4M7JL 4EI5C 1I1AA 4OFDA 1MAML 3VFWA 5I8EB 2XFXB 3N1FC 3NZ8A 4NKIL 4ZUWB 3WFHA 4JZJA 1JP5A 4FN0A 3V2AR 4R8WL 1QG3A 5MEOA 5E9DA 2WM0A 5DA4A 1NCWH 4R7NA 4APQA 4TOYH 4RFOL 2PYEA 4X4YB 5E6IA 5BS0D 4XP4H 2VO5A 3GSXB 4L9LC 4RISH 1D6VL 4MQSB 4RGND 1L7TL 3O4LB 3L3HA 3MRKB 4AM0B 4Q9RH 3D9AL 1K8DB 1LHZA 5LQBL 5GRZA 1H5BA 2R23A 3DBXA 1WWAX 2VZVA 4S1RH 4HS3A 2MQCA 2X41A 1T89C 3BGFB 2ADGA 1PY4A 4JY6A 1YEKL 5D70L 3LIZH 2VQ1A 2X4RA 4Y4KC 32C2A 4LLMA 2I60L 2XYCA 3O4LE 4TVPD 1CGWA 1U8LB 1A1OB 1X5YA 4K3JL 5FA3B 3VXMA 5CMAB 1OTUD 1BVKB 5HGHA 2D4DA 1MEXL 3QUXA 3HAEH 3HPJA 2EKJA 3LS5H 2X4OA 1HNFA 4ODUA 2IAND 4ZFOB 2HT2D 5JDSA 3T04D 1RVFL 1OTSC 1UB6A 3U4BL 1QRNB 4PJ8B 3E2HC 5CGTA 3BAEL 1CDBA 3RWGA 4LAQH 2AV7B 3DECA 2DJ4A 3CLEL 2E8ZA 5LBSL 2BY3A 1YC7A 1S7XA 5DRXA 2D9QB 3SGJA 3V7AG 4G9DB 1V7ML 1DQDH 3MNVB 5IHUH 4JFFB 5FYJU 3NCYP 4POUB 4FNLH 5GRJH 1P84J 1J0IA 3X12A 5CEXA 1AQDA 1PKQB 3VGEA 4F7PA 4O2FA 4M1DH 1MJ7L 5B3JF 3F12B 1HEZA 4JO3H 3Q6GH 1RD6A 4MA8H 4JFFE 2EYRA 4ZO7A 1RFDH