3JV4A

Crystal structure of the dimerization domains p50 and relb
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription factor RelB
publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 101
sequence length 101
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv4A00
3E6HA 3Q3GA 4NRYB 3ZKXB 3T2QA 5M94B 3SDCC 1T0NB 2W60B 1J1OL 3SKJH 3TJHC 5E6IB 5BV7L 3EO1A 3OWEA 4PJGB 4PTTA 2VDQH 3KLAA 2ZNWA 2DQIH 1WISA 1TZHA 1OAZH 1UXWA 4R90L 4ZUWB 2FGWH 4YHIA 1DE4B 4LVNC 3C60A 2FX7L 5I75B 5GGVL 5LGHH 3I75B 4ZSOE 3K1KC 2XN9B 3OAYK 4OQ1A 3EYSH 3QCTH 3LMJL 4FQHA 1F8TH 4XP1L 3V52L 4ALAH 5L2JA 4HUUB 2AJ3B 4PJ5D 3S35H 3VG9C 3PGCB 2A6JB 3A0OA 3LQAL 3JV6A 4R4FL 2NY6B 1GGBL 2GJ6B 1CDHA 2YMXL 4MA7H 4PJAA 2FX8L 1MCOL 3NGBB 3RI5F 5KSUA 3SJVB 3UJTL 3RWGA 3MNZB 3GI8L 5F7EL 2JCCF 3BWUC 1K8IA 3HG1E 5BRZE 2CO6B 5F7UA 4Y4FD 4GMTL 1EHLH 4OFYA 3ULVE 4L4TD 3HAEH 4M48L 4CW1B 5D5ME 1S9VB 2UZYB 1Z0NA 2RCSL 1A7RH 1DFBH 3S88H 3PP4H 3RWDB 2EDHA 3BP5A 1CVRA 2XRAL 4EDWL 2R0ZH 1XCQA 1S9YB 4LCIL 4NWTH 5L0QB 2ATKA 2YA1A 3ESUF 5HXMA 4XP5H 2BSRB 3MBEB 1LE5B 1BHGA 5MP6H 5F6HI 4I3SL 4M3KB 3RPKA 4X6EB 2JIXD 3C5ZA 1KJMA 3LEVL 1QA9A 3RPIA 1DBMH 3CMOL 2DYPD 1TCRB 2VRAA 1TTGA 2DQCL 3MLRH 2WQ8A 1KT2B 5TQ0L 3QWRA 4C56D 4F37F 3HI5L 4FTVE 2C4FU 3A6CL 4OLUH 4FXGA 4LPWA 1FG2A 4DW2L 1JTOA 1T66D 1FL3A 4QRRD 4WU7B 1WFNA 4G6FB 2FDBP 4H5SB 3FRUB 3MCKA 4QNPE 3ROLB 5DXWA 4WEMB 4IMKA 1I7TB 1G0DA 1IGFL 3OBAA 5ILTL 3QCUH 3IDJA 1X5JA 2Y06L 4J3WA 4APQB 1JGLL 2YD4A 5B38G 5FO9A 4LSRH 4CL7A 3QFJA 2OLDA 4PJ7A 4YWGH 1QSZA 1MQ8A 3RJQB 4I3RL 1I7ZA 4R4BA 5C0BA 5TF0A 4OZHB 3KXFA 3O41B 4G80A 4ONOA 1FRGH 3N85H 3O9WC 4OV5B 2Z9TA 4U6HA 1T0MB 2R1WB 2OTUB 4JHBA 4HIEB 3VG0L 1MRCL 3WD5L 2YBRA 4U1NB 3IETA 5AZEL 2DQUL 1QLRA 1H3TA 1I1RA 1BBDH 1YNKH 2NY0C 3STLB 4NO0A 3ZKSD 3D25A 1A14L 4KRPC 1CFBA 5IR1B 1OT1A 2LU7A 3PF2A 4NZJA 5FO8B 3TESA 3IFPB 1BAFL 5K93A 4G8GA 3S4SA 1FZJA 5EZIH 5I1DA 5AUMB 1JWSB 1KTKE 1R3JA 2OYPA 3QPQC 4HKXB 4JM4L 4O58H 3WXWL 4X98B 2Y6SD 1ROWA 5CP3H 1N6QL 3BEVA 1L0QA 5BCAA 1XGUB 1NC4B 4QTIL 4PJDF 2DWEA 2MQ0A 4H26A 1RVFH 3SDXE 4MDJA 3T0ED 3NPSC 4PRPA 5C0AA 2JCCB 1YPZA 2XWBB 1OOAA 4YHPA 4M3JA 2JB6B 4AH2A 1AIFA 1NMBH 1MHHB 5GGTL 4F9LC 3MLVH 5DJZB 2KH2B 3O3BA 4P5TD 5J6HA 2FHFA 5CD5C 5DJ0B 4DN3L 1PY9A 1VEMA 2HH0H 4L1DA 3VXMA 4JKMA 3CVIL 4I5BB 3QHFL 4PRHE 5FYLE 2FJHB 2WWKT 4L29B 3TJEH 2XZCH 5KVGL 3WFCL 3WJJA 5E00B 3RDTA 5BV7B 3DX8A 5HD8D 1V7NL 1KELL 3ESVF 3PWVA 4H1LH 3WCYA 3VFPB 3SOBH 4XWGH 3QUXC 1FDLL 1SYVB 2N7BA 4GXUM 1PQZB 4V1DA 3ULVL 4HUVA 4LLWA 2WK2A 4MDIA 2X9WA 3R0NA 2B20A 5EG6C 2GTZB 4GMSL 3U6RB 5DC4B 4DKDC 3QEQD 1VCAA 5LAXB 2E9WA 4ZUUA 3ZHDA 4AT6A 2LE9A 3NIGE 1BWWA 3GFUA 5L6YL 2UY6A 4YXLL 1AI1H 4K94H 1KENH 1A1NB 2WBKA 1A6TA 3GRWH 2EYSB 4HG4K 3QDMB 1CICB 1RJYB 4MZ3A 1M05A 1DEDA 1UWEL 3AY4A 3GNML 1J9CT 1LEKB 4GAFB 5JORB 2FO4A 1QFUH 2BC4A 5KSVA 5E08H 1NUGA 5C0NC 5AD0B 5F7FA 3BPCB 3G5ZB 1JV5A 1MI5D 4WWID 1SM3L 5J9PB 1MRFH 4OB5H 3DHJA 4WDIB 5IQ9A 4PGCB 1P7KA 5DUMH 5F9WC 3VRJB 4WW1B 4G7VH 1RUPH 4MA1B 3ZSSA 3IJSA 4RAHA 4GAJL 2NLJB 3BHBA 1MJ7H 3TVMC 2VLJA 2J4WH 1XGPB 4ZUVA 1SBSL 4CBPA 2F8XC 5FEBA 1UH2A 3A6BH 5F1IA 3RJDA 4U3CA 1U0QA 2SEBB 2DQJH 4YBQD 1DTUA 2ADFH 1NKOA 2IFFH 1JZ4A 2AEWA 1KBGL 2OQJA 4TVPH 3ULVF 2OP4H 1EO7A 1ZT4B 1LQSR 5H94B 3BISA 3D85D 1J5OH 2W9DL 1IGYB 3DVFA 4Y4KB 5D5MF 1K8DA 4OI9A 4CUCA 5DDHA 2B7DT 4XPBH 2J5LB 3IFNL 3U9UB 1YEGL 1YYML 2R2CA 1ORSA 2ITDB 2AQ3A 5HSFA 1NC2B 2AEIT 1G9NL 3L3HB 3IXTB 4PJDB 4U1GC 5D7LA 4KI5D 2DL9A 1JPFB 1J1OH 3U4EA 3BDXA 1Y6KR 1Q9WB 3RY6A 5KS9E 5BV7H 5HBBA 2BVPA 3SKNA 5JIPA 4CNIB 3KYMA 3B2UC 1VPOL 2I9LB 5AAMA 1AE6H 5HHMD 4R90H 4YBLB 4HJGA 1KGCD 3D18A 1NDGB 2OL3A 4P5KA 1BQLL 1E28A 2FX7H 3BGMA 5D1XC 1JPSL 5C07E 4QNPF 3TFKD 4CDHA 1DBKH 2XQYK 3LHPL 3MRRB 2R8SL 3LMJH 3HZVA 3V52H 4X99B 3WNOA 1HDMB 5C09B 4HWBL 1NAMA 1N3NA 5EUOE 3CDGB 1VKXB 1N2RA 3LQAH 2R4RH 1H5BA 1QZ1A 4XP6L 2I24N 1BECA 5L2KD 1GGBH 4PRAB 3E3QE 2YMXH 1BD2A 1MCOH 5IB5B 4LMQI 3LQZB 3UJTH 3GI8H 5F7EH 4S11A 5IBUG 2YD8A 4GMTH 5C9JA 5DJYB 3GB7A 3LRSA 4M48H 1X5GA 3TPKA 5FYLL 4BSJA 2RCSH 1U36A 5ESQA 4RAUA 1AGCB 4RNRB 2NW2A 4R4NC 2XRAH 3S5LB 4EDWH 4ZODA 4LCIH 4JGJA 4BA8A 2BMKA 4HPOL 1N4XL 5CZVL 3G6JE 3JV0A 5M7QA 1LO0L 2PW2B 5FHBL 3LH2L 4P5MB 3GSNA 4I3SH 1BJMA 4Z7UE 1PKOA 4IIQA 4YIQB 1CLZH 5D6DC 2D7QA 3LPGA 4ZSOB 1RK0B 3ARPA 2ZUYA 2UZIH 3LEVH 4WI2A 4GJTB 3HC0A 1NCAL 4LSQL 3CMOH 5D7IA 3SCMA 4QHUA 2VXTL 1IC7L 1Z6JT 3VXTB 2DQCH 5TQ0H 1QD0A 1FN4A 3HI5H 5GGRA 1JZ8A 1T1YB 2WW8A 3BP4A 5BJTB 1NCDL 4NDMB 2MMXA 1TLKA 3VXOA 3KGRA 5F7DB 3SDXF 5J6GA 5I8OL 1IGFH 5ALCL 2G60L 1CXFA 3HG1B 5BRZB 1UCTA 1HHHA 2YZ1A 2Y06H 5FA3A 5IQ7H 1P4LA 4X8JA 1JGLH 2XY2A 1WF5A 3FO0H 1S78D 5D5MB 1EX0A 2GEEA 1MCLA 3LKRB 4I3RH 2FH6A 2DBJA 2ED8A 3WJLC 1UEMA 1VEPA 3DYPA 5JPMB 2EE2A 1MCDA 3EDJA 3DYMA 2Y7QB 3VG0H 2VISA 4S2SB 1XIWB 3BDBA 4GLRH 1MRCH 4EI5C 4JZNA 1B9ZA 4PJ9A 3UTTE 3WD5H 5AZEH 4W4NA 2DQUH 4HWEL 1IAOB 1DVFC 5CBAA 4FTVB 5IG7A 4K94C 4DOHE 1H8NA 1TITA 1UZ8A 2PO6A 1CLYL 3NMEA 3NIGF 1A14H 3QDGA 4QYOA 4HGMA 3VGHA 1X4XA 4Y5XC 1BAFH 3GI9L 5IWLC 3BEWB 5GZOD 4TUJB 1FCCA 1CGUA 3IT8D 4J8RA 3WXWH 3BIKA 3MNVB 2VDNL 4MA3A 1N6QH 5I76A 1KNOA 4QTIH 3KDMA 4K55A 4EIGB 1RZIB 2J8UE 3DUUA 3QRGL 5JOPD 3CIQA 3NN8B 4OIIL 5FKPB 4QOKA 4FRWA 5D7IF 1GVIA 5GGTH 1RQ5A 2H32A 2XNAB 4XPAH 5E8NA 3B9KD 2OR7A 4QEGA 4OI7A 4PD4J 4WHCA 4JKPL 3ARFC 2QHRL 1ZWIB 5CLTA 3CVIH 4OCLC 5H37H 3QHFH 4IS6A 1KYOK 2F8VA 3GJEA 5GSRB 1JPTL 5KVGH 2Y25A 4PJ5E 3WFCH 3BI9X 4OKVB 5I1LA 1HHJA 4NHCL 1V7NH 4DEPB 1E4KA 4ZOBA 1KELH 4JG1L 3FQXA 3BWAA 5A2LH 5J8OA 4NCC2 1FDLH 3SE4A 3ULVH 1HCFX 4ONFL 4LF3B 3MUGB 3D0LA 3QUYD 2OTWB 3VRIB 3VWJB 4L4TE 4XCFL 2P7TB 3C8DA 3RX5A 2XV6B 2C3VB 1ZLVK 4XNZB 5L6YH 5JDJA 4ZUSB 4YXLH 5DMKB 3SDXB 2X4RB 2YEZB 3CH1A 5KS9F 4HGWB 2C7UB 3HRZA 4FQCL 3RZCC 1CFTA 4LCWD 4PJ8B 4J23A 4P23C 2VLKD 4L8SA 1OCWL 2R9HC 4K7PL 3GNMH 2NX5A 1UXSA 4NKMB 2CDGA 3V4VL 3F65A 5EZLA 5HYQA 2YS4A 3JWDL 3V6ZB 1SM3H 4PRHB 4FABL 1F6AB 2HFGL 4LOUD 3D5OF 4C56E 3KLHD 2H9GA 5F7YC 1YEDA 1EERB 1S9WB 1U8NA 1BZQK 4Q6YA 1S7XA 5IROA 5EUOF 4ZO7A 5FCSH 1KJ2L 2HLAB 5FDYA 4QRRE 3WDIA 5JW5A 1J86A 4GAJH 4PJEE 4XCYB 4NN7C 1SBSH 4LPVA 3IDUA 1QSFA 1FFRA 3C60C 1TIUA 4FFWC 4UTAL 4UBDC 2WWMC 4PJFA 3UTZA 3N1FC 5H2BA 1KBGH 2ICWB 4U1JA 3N1QC 2LQRA 4X6CE 3MRBA 3O6FA 1M6OB 4MVBC 5DJ2B 1WBZB 5H35B 5D93C 5E8PA 2AQ1A 4EUPA 4OZIA 1X6NA 3IFNH 2VLRD 4LIQE 4XPFL 1YEGH 1WSST 2GCYB 1X5XA 5CGYC 1EAJA 5F72S 2R2EA 5IK3A 1A6ZA 5ISZA 3SE8L 3G6JF 2DJ4A 1FORH 4ODTL 5BOZG 5IW6A 4OZGE 1TNNA 2G5BB 2FJFA 5IBLC 3DMMB 4Z7UF 5SV3A 1PX3A 5MERB 3NCMA 5HYIA 2ZUXA 3WUZA 3MYJA 4FG6C 3ZE1E 2A6IA 2QKIA 1VPOH 3D0VB 1SEQL 3MLTB 4OD1L 4KROB 3ZE2E 5TPWL 4N5EC 2BVQA 4WW2C 2J8HA 4AY0A 1BQLH 5SWZA 2C1OA 3QUZD 2E3VA 1N6VA 1U91A 4G6AC 3TN0A 3P0YL 1K3IA 3RBGA 1Y6MR 5IT2L 5F9JA 3LHPH 4R7DA 2R8SH 1D6EA 2J2ZA 2XPGB 3GHBL 4HWBH 5JDSB 4QY8A 3C5ZC 4H0IA 4XMLL 4KZEL 2VN7A 5IESL 4YDJA 4MQ7B 1DN0A 3BKYL 2FWOA 1IGCL 3T0EE 3MPCA 3I9GL 3FFCA 4LFHD 1EIBA 3CFEB 2F54D 1BVZA 1MELA 5GS0C 2ZOLB 3V8OA 2UVEA 1UQSA 1RI8A 3LD8B 5ACLA 2HJFB 1KIQB 4PJXE 5DMGC 1YN6A 4IMKC 1FVEA 2OMBA 3TEUA 2EDWA 4LNRB 5FYLH 3DHMA 2EDTA 2GT9A 3U1SL 5KS9B 3RL2A 3ZZ1A 3L5HA 5C0DB 1NAMH 5I1GL 1JFQL 2GY7B 4HPOH 1VFBB 5CZVH 1DCLA 3M1BA 1JWUA 2D7PA 2GITB 1YY9C 3HMWL 1LGVA 1LO0H 1NQBA 3LH2H 5FHBH 1RV6X 2D9CA 4HX1A 2X4NA 4AIZA 1FO0A 3KWWA 1TETL 5D2NA 5C07B 5CWSA 4R6UA 4LEXL 4ZFGL 1KB9J 1NCAH 4LSQH 5DQ9A 5EO0A 4ZS7L 2VXTH 4M8VA 1IC7H 3ILQC 3MGAA 4LLUB 1G7HA 3BVNA 5EUOB 3QEQE 1HWGB 3PWUB 4HD9A 4QHMA 2EYRB 1UCBL 2BXYA 1D9KA 1NCDH 2VUOA 4PJCA 3CDCA 4KVNL 1F4XL 5E2JA 1BLNB 2J8UF 1OARL 3DX7A 1HQRB 1JGUL 3S37L 4UQ3B 4JPIA 1WICA 4PP1D 5I8OH 4PLJC 5LJYH 5ALCH 2G60H 4IDJL 3PWJB 4X4YB 3K1DA 4YX2L 3RY5A 3MSPA 1BZ7A 1HKFA 1ZLSL 2CLVB 1ZVSB 1FG9C 4NGHL 1LMKA 5IMKA 5IVXE 3S34L 1MI5E 1Y6NR 3F7VB 4ZQKA 1YJDL 1NCUA 4N1CA 4ZFFB 1YN7A 5GPRA 3ULUC 4JZJA 3G6JB 4PG9A 2IADA 4RGMC 4U6XA 4Y2DD 1J1PL 2BOCA 4I2XA 3OJDA 5E94A 5FF6B 4OCNC 3CLEL 2VC2L 3L5XL 4Z7UB 4HV8B 2WMPA 3WLWC 3BH9B 2LABA 1RIVL 1R3KB 3EJYD 5JIHA 1WLHA 2HJLB 3IU4L 1NBQA 3FQNB 3GJFK 4HWEH 1FP5A 1MCBA 1EMTL 3V79C 2D0GA 4N0FB 1KTDB 4LIQL 4CRPA 4D0CA 3GMOB 5EBLA 4YQXL 4BFGA 3WJJC 5DVNA 1CLYH 3RDTC 3SE9L 2MJWA 4F80A 2JELH 4NRYA 3VXQB 1KJ2B 2OXGA 1KJ3L 2W60A 4WGWB 1A9EB 5B8CA 1WK0A 4WO4A 3GI9H 1QUNA 1C1EL 5C71A 3MRGB 4UDTA 4F7MA 2VDNH 1JK8A 4KI5E 3RX8A 3WUWG 1IQDA 1B0RA 5T1KD 4NM4L 5HPOA 4M1GL 4JRXD 4OAWA 1AHWA 3GBNL 3OZ9L 3MZGB 3O0RL 3QRGH 5F88B 4DVRL 4NQED 5EZOL 4MWFA 4OIIH 5KAQF 5HHME 1NMAL 1FGNL 4A6YA 1DANT 4D94A 5ESVB 1KGCE 3KLDA 5C08D 2MSPA 4JKKA 1NGZA 5GS3A 5GS1A 3F5WA 4JQIL 4PJEF 2JKXA 5I1IL 1KIRA 1OF2B 3C8HA 4JKPH 4Y16D 4NFCA 3VW3L 1EEYB 2QHRH 3L3GA 1FFPA 3AY4C 3UTTB 6CGTA 3QQ3B 2CK0L 1JPTH 4NKOA 4IOFC 4NHCH 1YMMA 3MRDA 4JG1H 4X6CF 4DOHB 4NZRH 5L2KE 4JFDA 1OT2A 3FQRA 3MV9D 5I9QC 3BT2H 4JY4A 1U3HA 3MCLL 5FYKE 2XTJD 1UKTA 4N1EA 3V0AC 2L7UA 2NY3D 4X6FA 1IC5L 3B9VA 1JWMA 4LLAA 4PGZA 4OZGF 3CAFA 5CSGA 1XF1A 1BZ9B 2J8UB 5FYKU 1UGNA 5IB4A 4UQ2B 4F7EB 4HJJL 2HT2D 5DK2B 5CEXB 3VXPB 1OSPL 3ZE1F 3P4MB 4FQCH 1ZE3C 3BYTA 5ID1B 1AGBA 1C12B 1NBYB 4PV8A 5C2UB 1OCWH 4ZPVB 3PDOA 4FXKB 3EJJX 4Q2ZB 3V4VH 3FAWA 1IGMH 3P0VL 5ICXA 2FEEL 3JWDH 5CP7B 2BNQD 3IKKA 2HFGH 4PJ5B 4WWKA 3RY6C 4UB0L 3X11A 3RVVD 3UTSA 5MEPB 4I1NB 5CIPA 5JQHC 3DRQA 4I0PA 1KJ2H 2EE9A 1IE5A 3PDDA 5J4MA 1HK6A 1AD0A 1P5UA 3RWHA 4Y4FB 1T7XA 3B3IB 7FABL 5I1KL 4L4TB 4BZ2L 3V6FB 4YDIL 4PJXF 4XRCB 4HKZB 4HIHB 1PZ5B 3SY0A 3D69B 4Z18A 1A7QL 3BP6A 5KN5A 1S3KL 1H5BC 4XPFH 3KLSA 1H3PL 3T04D 3SE8H 4ELME 5F9OL 3C5SA 4ODTH 4RZCA 5DZLA 1T04B 2Q6WA 5IW1A 2YPKA 5HJ3A 3V7MA 1FZMB 1OAKL 1H0DB 4N9GB 2PW1B 2ARWA 2DS4A 2JIXB 1F13A 4X4XA 3PWNB 1D6VL 43CAB 4U2YA 4J3VA 3ZHKA 2DYPB 4UUJB 2BSSA 5HVHC 2OZ4L 4O9HL 5HHOA 4B53A 4C56B 3RKDD 1SEQH 1JGDA 4OD1H 5JA8B 3OQ3B 3JTSB 1BFOA 3E6FA 4QRRB 4XNMA 2Z31D 4PJEB 2Z8WC 1J0HA 5L8JB 2O61A 2Q7NA 3TCLA 3VFOB 3E2HC 3P0YH 1QO3A 4QLRA 1G6RA 1XGUA 3WFEL 5IT2H 4PTUA 2I9TB 3LS5L 4IIQC 4I13B 3GHBH 2ADGA 4JFEA 4KY1L 5GQBA 4N0CD 4XMLH 2NZ9D 5BXFB 3OKEA 4KZEH 1U8JA 4TSAL 3SCMC 1ZA3A 4X6CB 3EJZC 5IESH 1U9KA 4LQFL 1QFWI 3C6LC 3BKYH 1R0AL 5HHPB 1IGCH 3OX8A 5E6YA 2IMNA 3V9FA 3I9GH 3GIZL 2IF7A 3KPRA 5JOPE 2ERJB 4KKBD 4JN2B 3RGHA 4JQVA 4Z9KB 5TF1L 1FE8H 2APXA 4OZGB 1O5DT 1OLZA 1IARB 3RWIB 3HPJA 4J4PA 3U1SH 4XB8A 3AXLB 3EZ8A 5I1GH 1JFQH 4FQQA 4D9RD 5GRWA 4PR5B 1YDPB 3HMWH 3J7HA 5FYKL 5CS7A 1RZKL 3CDYA 1ITBB 3FB6B 1ZOXA 1TETH 2CDEA 2JTDA 5DD6A 5F7LB 1PKQE 4LEXH 3JTTA 5DHVA 3SEPA 4ZFGH 3NFPA 4G9FA 3P73A 1SVZA 3L3KB 2V5SA 3EHBC 2ZUUA 5ESAB 2XXCB 5EU4B 4PJ9C 5EIQA 1UCBH 4TPRL 4DCQB 5I1EH 2FR4B 1Y18A 3H3KA 4KI5F 4KVNH 1F4XH 1XZ0B 3QQ4A 1MHCA 3M17B 3T0EB 5FA4A 1P84J 1OARH 1JGUH 4OIAA 4G9DA 2EKSB 3S37H 4I3GA 4YH6A 4LCWE 3MOBH 2PO6C 2VLKE 4YFLF 4YX2H 1INQA 4PJXB 3VGEA 3GMLB 1FO0H 4XX1G 4FQXA 4P5TB 4P2RD 5DRNB 1YYLL 3KPSA 4M5YH 1KPRA 4NGHH 5JO5A 4WU5A 8FABA 4FXLA 3S34H 3U0PB 3BUYB 3VFTA 4I18A 3BKCL 1HZHL 2GJZB 2XFXB 3P4OA 3P4NB 5K9KB 4RFEB 3QO0B 2X05A 4JPWL 1J1PH 1BQHA 3FFDA 1T6WA 3GGWA 2VC2H 3L5XH 3TGXA 2R1YA 4PLKC 2D7TL 1N8ZA 5JXEA 1RIVH 5J12B 4X7SL 4XNQB 4IRJA 3QUMA 1WBYA 2BSTA 2D7MA 3IU4H 4WVRA 2WZPD 3TH2T 3RU8L 5FOBB 1T5WB 3WN5B 3QEQB 1EMTH 3IAQA 5J11C 3S35X 5J1SC 4LIQH 3MFFA 5EPMB 4IRSC 5F89A 1R5WA 3ZTJH 2EC8A 4LGPB 4MSWA 1FC1A 3SE9H 1E4KC 2VLRE 2C4XA 1BIIA 1IMHC 3DBXB 3NAAL 2ITCA 1KJ3H 2QSQA 2C1PB 5D2LA 1C1EH 1JF6A 5HYJD 3QJFB 4O51B 1A8JH 2ZWLT 4HIJB 4HKJA 1EEZA 4NM4H 4YGVA 3T4YA 4WENB 4KH2A 4M1GH 3QUML 5IVXB 2NY4C 1OTTC 3QULA 1MI5B 3GBNH 3OZ9H 4KMQA 4PRID 4TVSa 3AMLA 4RRPA 5EZOH 2BVTA 3WHXB 3ARYA 4KKNA 4Q9RL 1NMAH 3GSXA 1FGNH 4HS3B 5EZJB 3FOMB 5HGAB 4EN3A 5EU6D 3KYAA 5DJ6A 3R8BB 3UTOA 4JQIH 4F8QA 1VFAB 1OPGL 5EUKA 5I1IH 4L8SC 3OF6D 4QT5A 1WJ3A 3VW3H 2M26A 3CC5B 5I1AB 3ARGD 4Y89A 3OAYH 2A0LC 3D3VD 2CK0H 4L4VA 1CQYA 4MD0B 5FUCC 1JRHI 3LKNB 3LZFL 3D85B 1G7JB 4F58L 4NPYB 2AV7A 4CADA 3RVUD 1FL6B 1VGKB 3W9EA 5IROC 2F54E 3FOLA 3U7AA 1CFVL 3MCLH 2Z4QB 4JFQA 4U05A 1IC5H 3CFCH 1F58L 1DQQB 4XC1L 3LKSA 4YUEL 4DFIA 1RK1B 2A74B 3LY6A 4ELMF 5T5NG 3GSWB 3Q6FA 4U1KB 2H6PB 3OTTA 4HLJA 4K8RD 1ZHNB 3K3QA 3MRJA 3BD4A 5I8CA 3LPFA 4HJJH 5A3IC 1IEAB 2F8OA 3TWCL 2E8ZA 2ESVA 1UA6L 1OSPH 3O3AB 4P2OD 5EIIB 5HHMB 1XF4B 3ZKMD 1N6UA 4PRDA 3V4UH 3VE0B 4U2ZA 5DO2D 3IF1A 5DJXA 2CR6A 5LGJA 2P8MA 1G0YR 3HB3D 3PWLB 4FZ8L 5HYSA 3P0VH 3IFOA 4MCZB 4XCEA 2GSGB 5FGRA 3WBDA 2C3XA 3AM8A 3W9DB 1HXMA 3NA4A 5LBSH 4UB0H 1DUZA 2I07A 3TA3A 1AQDB 3KPQB 1MCWM 1MJUL 5DMIL 5FUZL 3M07A 3TYFA 5L2KB 4N8VG 1OTUC 3TBSA 3P30L 1KXVC 1YEIL 5BVJB 4MJ6A 1HH9B 3L9RB 4GT7A 1KEMH 7FABH 5I1KH 4AMKL 4BZ2H 4ODWA 3TN0C 4YDIH 4G42A 1LEIA 3ILPB 3OKNA 4AEFA 2W65B 4M7JL 4UIMB 1A7QH 4HUXA 1QTYT 1T22A 3DURB 4NQVB 1WUNT 1S3KH 3SKOA 2FECL 1XR9B 2C9AA 3H0TB 1SBBA 3T08A 5DRZB 5F9OH 2D0HA 2X4UB 3L95B 1AXSB 3F7YB 4K7FB 4PLNC 1OAKH 1LO4L 4Q6IB 4KWUA 1D6VH 1RZJC 3OB8A 3UYPA 2IPUK 1K2DA 1H8SA 4G8EA 2QADC 5SX4I 4O9HH 1ZGLB 5GGUB 3MV8D 2Q8BH 3G5VA 5EOTB 1MEXL 3U46B 3FQUA 4WI6A 3QI9D 5F1NB 3PL6A 3G9AB 3VH8G 2X70B 1MVUB 4UNTA 4OI8A 3DUSB 3P9MB 4GRMB 2ZUVA 3ARDA 4RDQF 3UDWA 3WFEH 3IDMB 4GS7B 4HCRA 4PJBA 5ANMA 1L7IH 3OPZL 4MB4A 3NACL 4OLVL 5D2NC 4KY1H 2H3NB 3AU1A 5DVMA 4LRIA 4Z5RB 2Q76B 3QZWG 4TSAH 4LHUA 1DN2A 4JFFA 1A1MB 5C9KA 3D2UD 1HOCB 2WP3O 4LQFH 4JRXE 2Z8VC 2EC9U 4AM0A 4JFOB 5ETUA 1QR1B 4NQEE 5JOFB 1D9KC 1GGUA 2DLIA 5EU7E 5TF1H 1HWHB 4ELMB 1QPPA 3RTQA 5C08E 3SKUD 3FO1A 3EW3B 3HNTL 4UI2A 1RHHA 1OM3L 5DFWH 2BCKB 4AZ8A 4KK9C 2X1QA 2ZG2A 3V0VA 2X7LB 4HK0B 3GMPA 3VCLA 2XTLA 4F15C 4MJ5B 1KB5L 3GM8A 3NFSL 2IBGA 1NBZA 4BFIA 1S7SB 4OF0A 4PGJA 4MJ4A 4XVJL 1OGTB 1ZTXL 2UZXB 4XGZB 1J0ZA 5FYKH 1RZKH 1FCGA 4JZJC 4LBEB 3QIUD 3MV9E 1OB1B 1JZ6A 3HZKB 2XTJE 1YY8B 3QO1B 1BJ8A 5DQJB 1JTPA 1LK3L 4XBGA 3OGCB 3BPNB 1T2XA 5E4EB 4P4KD 1NDMB 5T33L 1I4FA 1NCTA 2AJZA 4TPRH 4ZFZB 2R1XA 4YO0B 1VADB 2Q8AL 1F4AA 3BJ91 5D7JD 2FYYA 4E9LA 2R0LL 5DMYA 4R26L 2YK1L 4OTXL 2NW3A 5JR1L 2BOBB 2ZZUT 2AXFA 3AFLA 3B9KB 1MJ8L 2ARJB 4PRHA 3T1FB 5B8CC 4WO4C 1YYLH 5DHVH 3IU3A 4U1IA 1I7RA 2RBLA 3HTLX 4LSPL 4YHML 4W68A 1MF2L 1RJCA 2OK0L 2BNQE 5DD5L 3BKCH 1DDHB 5EU3B 5ITFA 1AR1C 4MB5A 2QL1A 5CBEA 3MRLA 2YRPA 1AHWC 5B39G 5HI4C 1HN1A 4JFPB 3KAAA 3RNQA 2ZCKH 1PLGL 1C5BL 1MH5A 3KNBB 1PKQB 4X7SH 2A73A 5E70A 5GS1C 1I1AA 3RVXC 3QUYB 3DXAA 2AK4A 2CIIB 5E1AA 3RU8H 3IRZA 4GXVL 2XKNA 2CRYA 4XI5C 5DEFA 3BQUD 2P5ED 4QTHB 3KYOB 1IAKB 3KPTA 5DJDA 3MZTA 3OAUL 2EICA 2B2XH 4XVUC 3NAAH 1T3FB 1JGEA 3FO2B 4P4RA 4LCWB 4MHHG 5GSVB 2VLKB 1U3HC 2M8XA 5MENA 5F3HA 1J7VR 4Z0XB 1F02I 3LKQA 4K3EL 4NT6A 5L8KB 1CE6A 4TUOB 3X17A 3QUMH 2APWA 1EFXD 3HAEG 1XR8A 3B6SA 4ISVA 4BSVB 1GC1L 1U8HA 4X7TB 3MNWA 3O8XD 5AG8A 5A2KH 5J57B 2P8PA 4QHNA 3DI3B 3S96B 1XCTA 2A2QT 3IJHB 2VTFA 3DWTA 4NP4H 2A6KA 1OPGH 1W72L 3H6JA 4QHLB 5IHZA 3CFBA 1K6QH 3GSQB 1INEL 2NXZC 1FZOA 5DHXB 3T8XB 5E9DA 4AQ1B 3HE7A 3HS0B 4GOSA 4O02L 3LZFH 1NGWA 1R5VB 3L3OA 1RUML 4PPTA 5DUBA 4F58H 2DLFH 4OCRL 4WWKC 4NM8L 4GW5A 3OG6B 1RURL 4JRYA 3EYOA 1BX2B 3RWFA 2O5XL 2VLRB 1CFVH 3QG6A 4LLDA 4I0PC 4JLRA 2DM7A 1T1WA 3O45B 4GRLD 4U49A 1IGJA 1K4CA 1F58H 2HVKA 4NC0B 4XC1H 4GBXA 4YUEH 5D7SL 1R5IA 3LKOB 2Z93B 3GUTA 2XICA 3W11C 2R39A 1U58A 3HMXL 2ILLA 4HW6A 3UPRA 4U7SA 1A3RL 3PWPA 3TWCH 4ZNCD 1UA6H 5C0CA 1DQJA 4HBCL 4D9RE 1ADQA 1QVOB 3LKPA 4JZOA 4F33B 3MXVL 4GKZB 3SKMB 5HGHA 3S3SA 4N0YL 3IB4A 1C16A 1IAIL 2IPKA 3QUZB 1Q9LA 3CVHL 1CGVA 1A6AB 4WTXA 4KMTL 4ZPTA 4PG2A 1RZ8B 3WIFA 5TE6L 4ELKB 3HN3A 2JK5B 1ZS8A 5DMIH 1MJUH 5FUZH 1G7IA 3IDGA 2KKQA 1KB5B 4RWYL 2ZSWB 4MX7B 4I8DA 4NO2A 4Z7QE 4KV5E 1M4KA 1FFOB 4IRZL 1HSAA 4JHAL 2F54B 1ADQL 1U2HA 2ZUTA 1FNEB 4KUZL 3D39D 1L6XA 2C4FT 3BW9A 5JIIA 5GIRA 3HI6L 2G5RA 1XGRB 4P2RE 4LCCA 3MC0A 4HAFA 3KPLB 3MRCB 3GSVB 3ZT7A 1AFVL 5KSBA 1JN6A 4M7JH 5LWYL 3MGOB 4NNYA 2PTTB 2Y23A 3O9WD 2MCPL 4P3CL 4HS6A 3BGFB 2X89A 1CG9B 3N50A 1OWRM 5I17B 1AP2B 5DZOA 1SMAA 4JQVC 2YC1B 2AKRA 2HG5B 1K5NA 2NY0D 4X6DA 4Z77B 3MCG1 3RAJL 5C6PB 1URLA 1MEXH 1TQCC 2BVOB 4KKLC 3UBXB 4JY6B 4U1SB 3OKKA 4KJQC 4F7CB 3PXJA 3VXSA 1JF5A 1MLBB 2W0LA 3KPNA 5F7NC 2GI7A 4H1LG 4KK6C 3OPZH 1HHKA 4LKXB 4OLVH 3HCVB 5CHNB 5HYJE 1FAIH 3QB7C 4D3CL 2X40A 1YEEL 2RIKA 2HT4C 4C4KO 1EEQA 4P2YA 4PRIE 1KXTB 3L3DA 3BZEA 5IV2A 5D1QA 1F3RB 5JPNA 4R7NB 1TJIL 4Y2DB 1W0VB 3PIQA 3ZKQD 4H8WC 5CD5D 1KULA 2IWGA 5TDOB 5EU6E 4ONHA 3HNTH 2EXWC 1OM3H 2ICWJ 5LCVL 4PBVC 4IOSD 5C0FA 1CT8B 5INCA 2PYFA 4BJLA 3RUGA 4FQXC 3D3VE 1Z9OA 4HWNA 4U7MA 1KCVL 3QUXD 4XVJH 3RFZC 1WC7B 1ZTXH 4I18C 3QNXA 2YD3A 4F2MA 4EI6B 2D31B 5DK0B 1EEUA 2DI7A 5K9QG 3H9HB 3MBXL 1GJIA 3WFHA 3MA9L 4I48A 1B2WL 1LK3H 3QRFM 5C8JB 5D1ZA 1W72B 5JXEC 2ZSVA 3CXHK 4IRJC 5T33H 5T1KB 4JFYB 2Q8AH 5FK9B 5ID1A 3IGAA 2A9ML 4JRXB 4GG6E 1ZLVH 3FJTA 5MEOA 1G7PA 4NQEB 3MRPB 1SVCP 5IEHB 2R0LH 1GGCL 3QIWA 4HKBB 2YK1H 1T0PB 4OTXH 4POUB 4R26H 5JR1H 4FMKA 5C08B 5DUPL 5C0ND 3MGTA 1C5CH 1KPUA 1MJ8H 2IH3B 5I74B 1X5LA 5I8EB 3DIFB 4L3CB 1FL5B 3WO4B 4KHXL 3VDBA 4Y16B 1AGEA 3MUZ1 2DQFA 4LSPH 3RGVA 4PJIE 1MF2H 2OK0H 5DD5H 1V05A 4ORGB 3ZMRA 2V2WB 3TBVB 3TVMD 4JREB 4PY7B 3BKJL 3S36H 2F5AL 3WLBB 1PLGH 3MV9B 1C5BH 4B7IA 3O6LL 4UOW0 3WNNA 2H2SC 2XTJB 4MAYA 4E0RA 2NY3B 1WT5A 1KG0A 3GSRB 1BFSA 2J88L 3C9NA 3CVHB 3U4AA 2GW5A 4GXVH 4S1DC 3T0BA 5J3HC 3RNKB 4E41A 3QH3B 1R3LA 3SGKA 3HNSL 3QSKB 1IC1A 4ZFOB 3EGSA 2J7LA 3QJHA 1S7RB 1A4JA 5DSCA 1LO3L 3OAUH 1YNTB 3CFKA 5HY9B 4K3DH 3ZYJA 5EBWB 1I8MB 1ULVA 5LQBL 4KHTH 3VRLE 3DROB 2PUQT 1GOFA 4K3EH 4AEHL 3B4NA 3B2UD 4Y5YB 1ITCA 4NQXA 3NABL 4HIIB 3MRMA 1K4DB 1ZSDA 5DRWB 4OFPA 1EFQA 2BNQB 4LLMB 3MV8E 3O3DB 1GC1H 4BZ1L 3LDBB 5D1XD 4PGBB 3BGAA 3TBYB 3MRHA 1J8HD 4KK5C 1IKNA 1AKJA 1A02N 2PYED 5BXFA 4Z7QF 1W72H 4ZOEA 4KV5F 4F7PA 2XXMB 3VI4E 4GKNA 2B4CL 1NFDA 4XNYH 4D8PB 1INEH 3L3IA 3WFZA 4C83B 1RZGB 3I02B 1JJUA 2OMNA 2YXMA 4O02H 4KKAC 3AM8C 4W4OA 1T1ZA 3CUPA 1RUMH 5CD3B 4J1UA 4OCRH 1A6WL 2QJDA 4NM8H 1JNHB 1RURH 3GJFB 4Z0BL 4WI8A 3TA3C 2D9QB 2O5XH 3MO1A 3GHEL 2X4TB 1BFTA 4HIXH 1O7SA 2AI0L 5BO1L 1FLRL 4R3SB 3IKCB 3O2DL 3OSKA 5I66A 3N06B 3UC0L 5BQ7A 5D7SH 4R4ND 2GJ6D 1FZKB 3HMXH 1UWXK 4QXTB 4WFED 1DLHA 1RUKL 3DVGA 4XMPL 4GFTB 3GMQB 5KANI 5C2BH 1ODAA 4HPYL 2X4SA 3ZSTA 2DWDA 1W0WA 5IMMA 2H1PL 1S7QB 3MXVH 1U8IA 3BZFB 3V6OE 2H8PB 4OLZL 4N0YH 2G75A 3H9SD 5I0DA 2Z31B 3B2VL 1K9TA 3DRTA 5IFAL 3OB0K 3IDXL 3FB7A 3CVHH 2VLLB 5DYOA 5GZNC 4KMTH 2ZOKB 4BK4A 5L9DL 4OCYL 4HDIB 2W0FA 3DO7B 3MRKA 4KK8C 4K8RL 5FO7A 2HKHL 1OWWA 2QLVB 5TE6H 4L9LA 3QR2A 4G8IB 3BOVA 3BSZL 1G9ML 5I2IB 2OR9H 2LAGB 1NSNL 4BH7A 4RWYH 4HH9A 5JMOC 1ONQB 1CR9L 4IRZH 1RU9L 2HJKB 4JHAH 2CIKA 1ADQH 1IQWL 3PL6C 1A7OL 4KUZH 5ECJE 2AV1A 4PGEB 1E27B 1U3ZA 3FQTA 4XZUA 3ARDC 3UDWC 3HI6H 3QWQB 5HDQL 2QEJA 1YNLL 2NQCA 3WHE0 5L88L 4TNWF 4H0GA 1EXUB 1AFVH 5LWYH 3S5LG 5DA0B 4EEEA 2BNRD 2MCPH 4P3CH 5I6XC 3TT3L 1VESA 3IDYB 3V5HB 2KQMA 3MJ8B 1SYSA 1IM9A 1X5HA 1KCSL 2HP4A 1R24A 3R06A 2ORBL 3RTQC 1B90A 1DVFD 1FSKB 1FVDA 3G6AA 5IP4A 1RJZA 2W0PA 4AIOA 1CBVL 5EU5B 1XGYL 3GJFH 4MXQC 3S4SG 3VFSA 3HRPA 1YC7A 2P5EE 5H37G 3QA3A 1FJ1B 4X7DC 2ZCLL 4L9DA 4JFXB 3NCJL 4GG6F 4H20L 1S7UA 1H3UA 3CD4A 5EC1A 1MHEB 1LILA 4Z7WA 1NCBL 5TFSL 1NUDA 4E5XB 1HSBB 4D3CH 2BY3A 5AYUL 3HZYB 1YEEH 4P2RB 5CJOL 1CDGA 3AAZA 4QF1B 3QQNA 4QRUB 4EZMA 1HNFA 3CX5K 5CEZL 5DURD 4PJIF 3FT2A 3S8WA 1ZGLP 4OIBA 2E7CA 1E6OL 4U6YB 1TJIH 2WUCL 2FEDC 3C2SA 1IM3B 3ARFD 1EHXA 2IJ0C 4ODVL 5IF0A 5DJ8A 5T1LD 5LCVH 1KOAA 4MD0A 1KCKA 2P8LA 5TDNB 4NPYA 2E6QA 3C87A 1HYSC 4KXZH 3MACL 2XIDA 1F4YL 2PXYA 1KLGA 1KCVH 5DRXA 4ZXBD 3DOSA 1J87A 3ET9F 1I8KA 1NBVL 1TDQA 2BRRL 2DM3A 4QRSB 3PGDA 1AY1L 5F6IC 3VFGL 5KSAA 1HHIB 3MBXH 1DBAH 3ZDXE 5SWQA 2VITB 5GJTL 5HYJB 3P4LA 2Z8RA 3L7FA 2YKLL 1I1AC 3VRLF 1EH9A 5T1MB 3S6CA 3RZCD 2A9MH 3DTXB 3GK8L 4P23D 4PRIB 1P4IL 5ICYA 5EC2A 2ATPB 3RVWC 2R9HD 3GIVB 1GGCH 3C5JA 4WHDA 2PCPB 2R23B 1PBYA 4GUPB 2J6EA 4XAWL 4KJYA 5EU6B 1Z5LA 3SGEI 1EHNA 2A83B 4G43B 4KHXH 2UV3A 1Q38A 4IJ3B 2DKUA 2F53A 3ARGB 3KPQA 4ZUTB 3WIHA 3GKWL 3QIBA 3VI4F 3D3VB 2C3WA 4L8BA 2WBJA 4NN5B 4UINL 4X4ZA 4YEEA 2R4SL 4CMHB 3WEXA 1CXHA 3BKJH 2F5AH 5HHQA 4FS0A 3C60D 3VXRA 2EIZB 4FFWD 1VFOA 3O6LH 1E6JL 1FNGB 4MJIA 3NFNB 3D39E 1IGTB 5F70A 1M71A 2EE3A 3MXWL 4QRQB 4POYA 2J88H 2VOTA 1CD1A 4MVBD 5L7XL 1AO7A 4X5XA 2M2DA 5E03A 5B38A 3HNSH 3ZLQC 3B8YA 3HFML 1H8OA 4GKOA 2FIRT 3RWEA 3WS6A 4GG6B 2CRZA 6FABH 4P2OB 2Y5TA 3L5IA 4OF3A 5IBLD 3WFDL 2QQNL 4OFYD 3QAZC 1UB5A 5I73C 4WNQA 1CWVA 1P2CB 5LQBH 2ZJSH 4XXDB 2P49B 3BKML 1UH4A 3ES6B 3MRIA 5CSZB 3VFMA 4DAGL 4AEHH 5A2JH 3ZYOA 5EN2B 4GBXC 3NABH 2MNUA 4PJIB 3BZ4A 3CSYB 2QQKL 1QOKA 4N5ED 5E0QA 1AGFB 4L8CA 5JIKA 2MCG1 5I1HH 2FZ3B 4JO3L 4WJ5A 3VFNA 1X4ZA 1F11A 4G6AD 3VA6A 2QQLL 3EYUL 4CVXB 3C5ZD 3BXNB 3OXRA 2OJEB 4NO3A 1SMOA 2B4CH 1HOCA 4U1MB 4QRTB 3BD3A 1CCZA 4YPGA 3TBWA 4WV1A 4TQEL 4PG2C 3QWRD 4NQCA 2LTQB 4L3EA 4I9WD 4UNVA 3LN5A 5GS0D 2CLZA 2A77H 1JRHH 2IAMB 4OZ4A 1A6WH 5IFJB 1QPXA 3QP3A 1S7WB 4Z0BH 3C09C 3U30B 2GK0B 4ETQA 1X9QA 3GHEH 5DMGD 3K74B 4X9HA 2AI0H 3S37X 1FLRH 4OSUL 3O2DH 4E42B 1ORQB 1MFBH 5C0EA 3LS4L 3SGDH 3KYNB 3Q48A 4GAYA 3OKLA 1C5DB 3BJLA 5ITBL 3TNMA 4O2FB 3QFJD 4QCIB 3SDDA 3MMEB 4OF7A 1RUKH 4LCYB 4XMPH 1YY9D 3TPUB 2HLFC 4NQDA 4J7RA 1GHFL 4ZNEA 1OHQA 3MV8B 5C0BD 1HHGA 2V9RA 3EO9L 2P24A 3BRFA 5J89A 1CDIA 4OLZH 4ZO8A 3LVEA 2DJUA 4NIKB 2HVJA 3B2VH 5C0IA 3L7EB 5IFAH 3QXDA 3ILQD 1QRNA 5L9DH 1JYVA 1B0GB 4OCYH 2V2XA 5CJ8A 1K85A 2HKHH 4ZMAT 4JDZA 4WY7H 3BSZH 1G9MH 3MROB 3WL9B 3VFWA 3E8UL 1LD9A 3D2UB 3HA0A 3NCEB 5CEYB 4GW4A 3BPOB 4NO0D 2VXVL 5FECB 4ZAKA 1T7VA 3MUJA 1CR9H 1XF2B 1RU9H 1N5AB 1WQVT 3DUHA 5GJSL 2DKSA 4PRBB 3ZYIA 1A7OH 2EDFA 4G8GD 1JNJA 1MWAA 5T5NF 3ROOB 3N1PC 2V6HA 5HDQH 4ODUA 1YNLH 1N59B 5L88H 3FHQA 1L4IA 3ULUD 3TF7C 3L3JA 5IM7A 4URTB 4PRPD 2HYMA 5C0AD 1FNAA 5EBMA 5I16A 2GSIA 4JN1L 3TT3H 3MRFB 1NEUA 2EEDA 4D0DB 5D1QC 2YD7A 5CMAA 3QUYA 5TE7L 2OJZL 3QIUB 4NYLB 1KCSH 5GRUL 4NOBA 1NJ9B 2B5IB 5KG9A 3MV7A 2ORBH 1N7ML 3VXMD 3WE6A 2Z35B 5IMOA 1HILB 4LDLB 4JG0H 4RIRA 3ZDXF 4N9OB 1CBVH 3AROA 2YUZA 1ZA6B 1XGYH 4P4KB 5BZDB 1PEWA 3RDTD 3R4DA 3DO3A 2YPLA 4PRNA 4AG4L 4AIXA 5D7JB 5IB2A 2LU4A 2VDOL 2ZCLH 2DQEL 4MCYA 3EOBB 5FDWB 4P9ML 2EDOA 5ACZB 3NCJH 2VUYA 3O11B 3IDIB 4V1DD 3O6KH 2AJVH 2AJXL 2HTLC 1RUAH 4JEGB 1NCBH 1EZVY 5TFSH 1JUFB 3NZ8B 4ZDHA 2MHAB 3JV4A 2VDLL 5DEZA 5AYUH 1MAJA 5CJOH 5D1ZC 2GUOB 4LNVA 3V0WL 1FFNB 5CEZH 2AJUL 3IS1X 4DWHA 1VSCA 1JZ7A 2PTUA 3CZFB 4V2CB 2GIYA 4KTYA 1E6OH 4PJHE 5ACMA 5JTWA 4ODVH 1QLFA 1J8HE 5IGXH 2PYEE 3EFFA 3BUTA 4GG8B 3W81A 3FKUS 2BXZA 3Q1SH 4IOFD 4P3DA 5DK3A 4CN4A 4NQTA 2DQGL 4DGIL 1XGTA 1F4YH 1CL7I 4XBPB 3CH8A 1YEFL 1UH3A 1XF3A 3RGVC 3QXAB 1GL4B 1NBVH 2EYTB 3BQUB 2P5EB 1KCLA 2BRRH 1T7WA 5DHYB 1CGXA 2RB8A 4M6NL 1UACL 4RGOH 3VU2A 5D72L 4N0UA 1QQDB 1AY1H 2VLJD 1GZPB 4P99A 3VFGH 3PHOA 4MNHA 3BP7B 5MEQB 3SDCB 1U95B 4PYHA 2YUWA 5GJTH 1VB9A 1CGWA 4MAYC 2YSSA 1F3JB 2GJ6E 4M43L 1S5HB 1WT5C 2YKLH 3EYVA 4WFEE 4M7LL 5SWSD 1EFXB 1P4IH 1E4XI 3SGKC 2BY0A 4EVNA 1P6AB 3VMNA 3O8XB 3X14A 3FTGA 4XAWH 4L3AA 3H9SE 5C0GA 2K7QA 4NKDB 5D7LD 5F96L 3FN3A 5INDB 2LU3A 3VG9B 5JQ6L 3GKWH 4UINH 1I8IA 2ZUWA 1O7VA 2R4SH 1D5XA 4LU5L 4Z7VE 4L8DB 5LGHL 2HFEA 2VABB 2WSKA 2NYYC 1KB9K 1T20B 1F8TL 1E6JH 1XGRA 4ZTPL 1VHPA 3DGGA 4GRLB 4RAVA 4EUPG 1AGDB 2CD0A 1IKNC 3S35L 3UTQA 3MXWH 3DV6A 3MGOA 4HFWB 3G08B 5L7XH 3QQ9C 1NEZB 1KLUA 3DETC 1GSMA 3QEHB 1BD2D 1CFNB 2FLRT 3CXDL 4JAMB 4JJ5B 2BNRE 1XH3A 4W4OC 1OQXA 1S7TB 1BOGA 5HI3C 3WFDH 2QQNH 3RVTC 4AENB 3SO5A 2L7JA 4OCSL 1AR2A 2LV4A 3BKMH 4DAGH 2DBLL 2UWEA 4JM2A 4U6VL 3EDFA 4ODBD 1TVBB 3I2CH 2QQKH 4M7KH 4CMMA 4F3FA 1YEJL 1MLBA 4NJAL 4JO3H 4Y5VA 5D6CB 2QQLH 2WUBL 3EYUH 4MQTB 1P7QA 1DBML 3O2WL 1NFKA 5MI0B 3ZDZE 1S9XA 1OY3B 3EO0A 5ELIA 2VN4A 1IEBB 3IXAA 1MAKA 3D39B 3PNWB 3SCMD 5I1CH 3EJZD 4RCAA 3ARBA 3C6SA 2XWTB 1WFUA 4ZO9A 3WMSA 4L9LC 3LSOB 3PV6A 3RKPA 2VQ1A 4OQTA 1EGJA 3O9WB 4CVZA 4OSUH 5JLZB 1CFSA 2CGRL 2CXGA 3LS4H 3HZMB 5ITBH 4KVCL 3ETBF 1YUHA 2W07A 1J0IA 5GISL 2NY0B 5D8JL 1TZIB 3L6FA 1GHFH 2AW2A 4H25A 2D31A 2RHEA 3QXTA 5HD8C 2ID5A 2VLMD 4RMTA 4LCUA 3EO9H 5E5MB 4LSUL 3GMNB 3FT3B 4M8QA 1CIDA 4OQTL 2AGJH 4CJ0A 2P47B 3CCHA 2EDJA 3EHBD 3QDJA 1I3VA 2GAZB 2QV2A 2MQ3A 1T2QL 4PJ9D 2EDBA 3FB8B 4LARH 3CSPA 3QNZA 4DKAA 3O4LA 3N1GC 1WCBB 1XFPA 2IQAB 1WAAA 3HLAB 4P2CG 2OI9C 5LXGL 3NPSB 1H9VA 3E8UH 2Q7YB 4KJPC 2VDML 5JNYB 4TULL 3BPLC 4BSWB 1D5MB 1EK3A 1SJHB 2VXVH 2XWJB 3HC3L 2PO6D 1U93B 3QDGD 2VXUL 5EZIL 2UWEF 5GJSH 5SV4A 2BX5A 4D0BB 1P9MA 2QSVA 3C2AL 3ZTJG 1PJ9A 4PJHF 1U41A 1Z3GL 1GXEA 3AREA 2QR0A 1MCQA 4OUOA 3ABZA 2AXHA 1S5IL 4GKSB 1JHTA 4HBQA 1BQUA 3MLZH 3QUXB 4PLKD 4JN1H 5HDBF 4QOKD 1OGAA 1KTLB 2HH0L 3T65A 1M7IA 1U92B 5TE7H 5FAAA 2OJZH 4ERSL 1M7DB 4NUGH 4ZS6C 3T09A 1MCPL 4QHKJ 1N7MH 3S7GA 1J0KA 1DQTA 3C8KA 2VIRB 4YC2C 1MWAH 5GRYA 2CMRL 1NMCC 1XF5A 5DTFA 5C0JA 1NL0L 1VACA 1I1FA 2E7BA 4CKVX 2ADJB 1U8KA 2YWYA 3OKOA 4BQBA 3TO2A 2R2BA 3DX9B 3RWCB 4PV9A 3P9LA 2NNAB 1ES0A 2PXYC 2VDOH 3K2MC 1LO5A 2DQEH 4CDGC 4PJAE 2ICCA 4P9MH 4EBQL 3H7BB 4NBXB 1LP9A 2Q86B 4NHUA 2BNUB 2AJXH 5DI8A 1YMHA 2FIKA 1FHGA 2V7HB 2VYRE 5E2TL 5KSAC 2NY4D 4MQXC 1MFNA 5IJVA 2VDLH 2MQCA 3BFOA 3VGFA 4K94L 5CINH 1KENL 5J56B 4DVBB 1T4KB 3V0WH 1UJ3B 3FQWA 2AJUH 4KTDL 3I6KA 5ICZB 4YDVA 5DWUH 2ADIA 5A16B 3ECBA 3TVMB 3CFJB 5HGBA 3REVA 5DEGB 1QFUL 4Z7VF 1QACA 2OR8A 5BZWA 1NFIA 2NX5D 4UILL 2A0LD 5HVGB 3TFKC 2BY1A 4PY8I 1ZHKB 1S8DA 4HHAA 1HINH 4IHOB 2EDLA 3DX6A 2DQGH 1QNZL 4JDVA 4DGIH 3DV4A 1RUPL 3QXVA 1YEFH 2FL5A 5CZXD 1OSZB 2CKBL 3MRNB 1T5XA 3QIBC 4I9WE 1X7QB 3I3DA 2WBJC 4M6NH 1UACH 4R3SA 3A6BL 4HXAL 5D72H 1LK2B 2VE6A 1KIPB 3FONB 2HFFB 1D5ZA 3D1MC 2IFFL 1FZKA 4RA3A 1AD9A 5JHLL 1UT9A 3VFVA 4U1GB 4JPKH 3O6ML 4D2NA 4JVWA 2HN7B 5A3ID 4M43H 5J1AA 3QFJE 1DJSA 5E95B 3CZJA 3O6FD 4M7LH 4PJ7E 4BUGA 2JB5H 4NCC1 4S1SL 3TNNA 5C0BE 1NANI 4PJHB 5D1XB 4R0LA 1NGYA 2YHGA 3WS6C 5ISZD 4NFDA 1A4KA 5E8OB 1J8HB 1PG7W 1ZT7A 3PABA 4Q6IC 4NRXB 2PYEB 1NH6A 5F96H 2XA3A 3ZDZF 4MS8C 3O3EA 4P2QA 1AE6L 2VSCA 5E7FA 3U2SA 5JQ6H 1T03L 1HH6B 2RJMA 5DVLA 3BRGC 4NCDA 1FH5L 4LU5H 5IIEB 2AABL 2CDFB 2V2TB 2G9HA 3BDYL 4GW1B 1T83A 3QFDB 3RL1B 1DBKL 5SWZD 3TIDA 3VA2C 1FNLA 4X6BA 1XGQB 3TN0D 4RGND 2H26B 4KQ4L 4G6KL 4ZTPH 4KJWC 1SJEA 1E4WH 2P4AB 2Z92B 3OR6A 4G8GE 3VMOA 5F1KC 2ZUSA 4RBPK 2R4RL 3F8UB 1BGXL 1S78C 5FV2A 1P84K 3GMMB 4HK3J 3ULUE 3U7YH 1JTTA 1UVQB 4WV1C 4Z78A 2YRLA 4PRPE 1CTOA 5C0AE 3FFCD 2VXSL 3CXDH 4HZAA 4X5LA 3V6BR 1YPZE 1RZFH 3TLRA 4NFBA 5D96C 3NVQA 3G04A 3HUJF 5TE4H 3H9SB 5LVEA 2X4PB 4OCSH 1FV1A 2DBLH 2QADD 3VXME 4U6VH 4WW2A 5DF0A 4Q74A 5KVMC 5T3XH 1FJ1A 1BM3L 2I60H 3V4PL 5TGBB 3SDDC 2BDNL 2X6MA 3KR3L 1TQBC 1J0JA 1HXYA 1YEJH 5IB3B 3KPMB 4NJAH 4X7FC 4Z7VB 1CLZL 1D5BA 1QYGL 1MCFA 2WUBH 1TVHA 1YECL 2UZIL 4M6ML 4MNQA 4WHTB 3LV3A 3O2WH 3IDNB 4V1DE 5IOPA 1MAML 2BP3A 5DS8B 1HQ4B 1A0QH 25C8L 3UEZA 4QRUA 4JO4L 4B0MM 4NUJB 2JJWA 5HDOA 2AXGB 4M00A 4UU9A 1BVKB 1D9KD 4ODXA 5EO9A 1YC8A 4P57B 3WUWA 4UTBL 4H1LB 2BERA 2NMSA 4XPTL 4IMLB 2BNRB 2VJXA 2WIIA 3GSOB 2OSLB 5IQ7L 2P44B 3U0TA 3T4AB 1CFQB 3FO0L 4ZAKC 2F74B 4U1HA 3NCYS 2CGRH 3FO9B 4EI5B 4S1QL 4LEOA 1VFMA 4YR6A 2BHZA 3QDAA 2EC9T 2EEAA 4KVCH 4UT7L 3KPPA 4MHHI 1QSVA 1DVFB 4OLYH 1T1XB 5GISH 4MB3A 5D8JH 4YAQB 3V95A 1G84A 4KI1A 5GS0L 3G5XA 3RX7A 1U8MB 1HHIA 1H15B 2XACC 4LSUH 3S36X 3HKFA 4OQTH 4Y5XB 1RJLA 2VLJE 4LKCA 4PJAF 5GGSB 5DJAB 1T2QH 2P5WA 3PJSB 3QUYC 1YQ2A 1MLCB 1ZXQA 3CMGA 2OM5A 2WP3T 1Q9OA 1Y0LB 2IBZY 2NTFB 3BESR 4I77H 2EDQA 5LXGH 3MJ6A 5F44A 5F8RC 2VNCA 2VDMH 4TULH 5IB1A 2IBBA 3AMKA 3UROR 3X13B 1NAKL 1I7UB 2IGFL 4OFVA 4NO5A 5HYEA 2IMMA 4LDEB 5SWSE 3HC3H 4F7TB 5DURB 5E99L 3WDJA 2CKBB 4M6AA 2NY5H 2VXUH 2A83A 4WW2F 3C2AH 3PXHA 4WO4D 1G7MB 2F15A 1LEGA 3ARFB 1Z3GH 3EYQC 1H3XA 5T1LB 1FQ9C 1AXIB 5D7LE 3MREA 3V5DA 4BUHA 1AR1D 1ZK9A 1S5IH 5HI4D 5TQ2L 4LOUC 4LVEA 4BH8A 4LGSB 4NNXA 2I26N 3HUJB 5ERWA 4ZXBB 3U9PL 3QNYB 4XPAL 4OM0L 5K9OB 4PB0L 3REWB 1K3ZA 4WEBL 4ERSH 1MIEL 2UYLA 1MCPH 4I4WB 3I6GA 4HC1A 1Q0YL 3CPLB 1ETZB 5IKCB 4ODHL 4LL9A 4XI5D 2CMRH 2GFBA 3ULUL 1NL0H 4G8FA 3QEUB 2FO1A 3E1F1 1YMMD 4XXCA 2KZWA 5DGRA 5D9SA 5JHDA 4YHKL 3GSUB 4MD4B 2B8OT 2XQYG 2A6DA 3RZCB 1JE6A 4M93C 4PJ7F 4JFDD 1BD2E 3WKML 4P23B 4EBQH 1A3QA 3OKYA 4TSBL 5J13C 1U3HD 5ID0A 4XAKD 1GOHA 3MJ9A 4YXHL 3OHXB 3ARSA 3VFRA 1DSFL 5E2TH 3E6HB 1EVUA 3Q3GB 4G6JH 2NXYC 1G7QA 2ZP0T 2NTSP 3QXUA 3RHWF 3DPBA 3BX7C 1L7TL 3EO1B 4M62L 2DQTH 2XKUA 4KTDH 4PTTB 1BFVL 3CU7A 3KLAB 1TZHB 4YZFE 4NN7B 1UXWB 1MOEA 4YHIB 5T3ZL 4LPYA 1ZT1A 3C60B 4P49A 2YD2A 4UILH 3IVKA 2NXZD 1A47A 1O0VA 4M7ZB 5CGTA 1J11A 5HGDA 2P48B 4O2CA 5D7IE 4FQHB 1TJHL 1JHLL 5L2JB 1QNZH 4M61A 5DJCA 4R97C 2WNGA 1Z9LA 4WWKD 5D93B 3VD9A 2CKBH 3UTSD 4XT1C 3JV6B 1WZLA 5DT1L 5CJBA 4P46A 4HXAH 3ULUF 4PJAB 5KSUB 4RDQG 1BF8A 3RWGB 4JY5L 1UFUA 1K8IB 4EDXA 1YPZF 5JHLH 2WAHA 5CILH 3O6MH 1U8PA 3DVNA 4NSKA 3VFUA 1T21A 1UKQA 4LPXA 5ENWA 1ZVHA 4LSDA 3QI9A 1UWXH 3BP5B 4B50A 1XCQB 1UEYA 2EZ0D 4S1SH 1FORL 3NCCB 1U8LA 4OF8A 5BS0A 2VLME 2ATKB 3K8MA 4P9HC 3UTPD 4Q9QL 1TNMA 4IBLT 2VSDA 2O5YL 1CD8A 3ZKND 4XH2A 4U33A 4WFHD 4OZFA 4UAOC 4O00A 3C5ZB 3PQYA 1KJMB 4NQSA 5KZCD 4Z8FL 1QA9B 3RPIB 4L4JA 4BKLA 1T03H 4N8PA 1D5IL 4JM2C 3W0WA 5FKAA 4FOMA 5HHOD 1QP1A 1FH5H 4FXGB 3SO3C 1FG2B 2A38A 2AABH 2VZTA 1C08A 1FL3B 3M8OH 2R56L 3BDYH 4RX4A 3QDGE 3MCKB 15C8L 3W39A 4Y5VC 3PG2A 3OKDA 4KQ4H 4G6KH 3VXUA 4Y19A 3IDJB 4JFED 3BN3B 4W70A 3EDDA 1BGXH 2W9LA 5FO9B 3QFJB 4PJ7B 3GBML 3ARBC 5FYKD 1QBBA 5FFLA 1U8QA 2VXSH 3KPRD 1I7ZB 1R3HA 1V8HA 2OL3L 4R4BB 5C0BB 3AVEA 4X5WA 4QOKE 4G80B 1BVLA 3ZT6A 3R0MA 2FJGA 4U6HB 2R29L 1T89A 5AZ2L 1IL1A 1NAML 3AB0C 4YEFA 2P46B 5C86A 4J4PD 2O5ZL 2YBRB 3CSGA 3IETB 4LLVA 1X5IA 1BM3H 4KKLD 2VKXA 3V4PH 2NY2C 1QLRB 2BDNH 3KR3H 4KJQD 1MCSA 1MCNA 2YD6A 4U1LA 1QYGH 1WZ1L 3STZA 2HFTA 4FQJL 4NO0B 1YECH 2NY5C 3D25B 4KK6D 4F57L 3NA9H 2LFGA 1QSEA 4M6MH 2V7NA 5D7KD 4LFHG 1MAMH 2MHAA 3UZQA 1FVCA 3C6LA 1Z2KA 4JR9H 4QRPA 5HPMA 4HUWA 25C8H 4IOIA 4G8GB 4G9FD 3S4SB 2HT4D 4XCNA 1FZJB 4JO4H 5I1DB 1ZHLA 1R3JB 3MUHL 3BEVB 2DWEB 3T77A 4RGMB 1N5YL 1IFHH 4FQPA 4UTBH 4H26B 4MDJB 3TYGL 32C2A 1E4JA 4PRPB 4XPTH 5C0AB 3GSNL 2W9EL 4WHYH 5EU7C 1YPZB 2EXWD 1DL7L 4YHPB 3LN4A 3VGDA 4AH2B 1AIFB 4NZUH 4HQQL 5I74C 4U3HA 1JPGA 5GGVY 3JVGA 5GGQH 4S1QH 2NX5E 3O3BB 1P9MC 3MRQA 4FQXD 5J6HB 4FQIL 3S9DB 3KPSD 4UT7H 2DOCA 3VXMB 5FUCE 1V3KA 3AREC 5FB8A 5GS0H 2YRZA 3TZVA 1VERA 3RDTB 4OJFH 3DX8B 4PLOB 3PWVB 4K3JL 3UBXG 1JIBA 3UZEA 2J8OA 3HE6D 3L5JA 1NGXA 4HUVB 4V1DB 5JXED 2WINA 3UMTA 4LLWB 3ELAT 3N9GH 5JW4Q 4IRJD 4MDIB 4C4KT 3JWOC 1GZQA 4PJFE 3T0XA 2G2RA 1F3DH 3Q5YA 2X4OA 4EJ1C 2CO7B 3MJ7A 3T0WA 5HYFA 4ZUUB 1NAKH 2X4QA 4AL8L 4AT6B 2IGFH 2JELL 4UIKL 4KRMB 3VJ6A 1Q0XL 3FL7A 3UPCA 5E99H 4OZIE 1A6TB 3LRHA 1I3RA 1X5KA 1MQKL 5ISZE 4FFYL 4YZFF 1M05B 3ZE0E 2LAAA 2NR6D 2XZZA 4X9IA 1ZHBA 4X0KA 3UX9B 2FO4B 2BC4B 3W2DH 3TBTA 5KSVB 3FCTA 4DZBA 4M9PA 5I15L 1JV5B 2VAAA 5TQ2H 4WI4A 3LDBC 5IQ9B 3U9PH 2B0SL 5I9QB 1IILE 1P7KB 4OM0H 5D70L 5DGQA 3IJSB 4PB0H 4YE4H 4GRLA 4WEBH 3BHBB 4EN3D 2XZAL 2VLJB 5F93C 5SWZE 1MIEH 1T80A 3TO4A 4ZUVB 3SE3A 2VKWA 3T1WA 3OKMA 1MCIA 3ARZA 4RGNE 4IRSA 5F1IB 1Q0YH 3ARXA 4S1DD 4LVOC 4N8VA 5J3HD 4ODHH 2OCFD 2PNDA 3H9ZA 3ULUH 2VL5A 4L4VD 1FYTA 4HJ0C 3I3BA 4NZRL 2OQJB 2DKMA 1MCWW 1U8OA 1KPVA 3BT2L 4YHKH 2X42A 1K8DB 5SWSB 3SPVA 4Y4HA 3WKMH 1QG3A 3FFCE 4TSBH 1QEWA 4GLRI 3HI1A 4DZ8A 2B1AL 1ORSB 3EOAA 5E5UB 4YXHH 5I19H 2R0WL 4MD5A 5JXAL 1DSFH 3FB5B 3QUKA 2FLBT 5D7LB 1LNUA 3U4EB 4AJ0A 1HI6A 1NLBL 2DRUA 2JJUA 2DD8L 1L7TH 2BVPB 4M62H 3SKNB 1I1YA 4HWZA 2ESVD 1TPXC 4DUWA 5EFIA 3RKDC 3T2PA 1BFVH 1IZJA 4KK5D 1WBXA 5DFVC 3QWOA 2BVYA 3B9AA 4HJGB 1INDL 5T3ZH 3D18B 1IGML 2OL3B 1YEKL 4P5KB 1E28B 4RQQA 3BGMB 2RFXA 4R0LC 4G5ZH 5D2NE 1EBAA 3VH8A 2NY1C 4YJZL 4KKAD 1TJHH 3HZVB 3MR9A 1JHLH 1NAMB 1N3NB 3X12A 5BOPA 1ZLUH 1FAKT 3SDYL 4LLYB 3L5WA 1N2RB 2GJJA 3TA3D 4NN6C 1A2YA 1CL7H 1H5BB 4PJCE 5DT1H 3QZWA 3TIEA 3U36A 1DUYA 1CF8L 1EAPA 1BD2B 1MVFA 3WS3A 1MCCA 1IZKA 5I1JL 4XPGL 4JY5H 2ICEA 1T83C 4YNYA 1SY6A 2CQVA 5C9JB 43C9A 1WITA 3IJYA 3GB7B 5LGKA 3LRSB 1EA9C 5JW4N 5TDPA 2P45B 4CGTA 5ESQB 4RAUB 4EXKA 3RBSA 4PGDA 2NW2B 3LB6C 2EH8L 2BMKB 3D87B 1ERNA 3ZT5A 1I85A 4Q9QH 3WDHA 5HHNA 1MFDL 1HEZA 4I2XE 2CH8A 2VWEC 2CLRA 5GZND 3DSNA 2O5YH 3E2HB 3GSNB 1OTSC 1TTFA 4IIQB 2HWZH 4KK8D 3AGVA 2HRLA 4RMUA 3F12A 3VD5A 4Z8FH 2K7PA 3HC0B 3SCMB 5D7IB 1I3GL 4BSWA 4QHUB 1KEGL 1D5IH 3FRPA 3GMRA 3HPLA 5GGRB 4ZYKA 3F58L 1MNUH 1BBJA 3BP4B 2R56H 3PL6D 4JHZA 2D7NA 3V5KA 15C8H 3VXOB 5IW3A 5I18H 3ARDD 1QKZL 3UCRA 4CU6A 1FPTL 1HHHB 4J12A 5FA3B 2N4IA 4O2EA 4K71B 4PP2A 1P4LB 4X8JB 3BYYA 4NRZA 5M95B 4LHUD 4JFFD 1A64A 4MNGA 1SEBA 1FNSL 1G7LA 3GBMH 1TTUA 1A21A 4OUUB 1IT9L 3K8KA 3ULSB 2CR3A 2FSEA 4FFVC 4YGAB 1FE8L 2OL3H 5GS2H 4WTWA 2HA1A 2DM4A 5HHVL 1A9BA 3CFDA 4R96A 1S7VB 1Q94A 4ESKA 3RTQD 3NCBB 3G5YB 3RWJA 5B39A 2R29H 5AZ2H 2VISB 4RFNC 4WFFD 2O5ZH 4MXQD 4JZNB 4PJ9B 1LWRA 3GO1L 4LPCA 3VWKA 3U82B 1LE9A 1Z9SA 4PJFF 3FMGH 4XMKL 5FYJU 5CBAB 3MFGB 1YMME 1JNLL 5AEAA 5IG7B 1QLEL 1WZ1H 1PYWA 2IANA 4FQJH 4WI3A 4JFDE 1UZ8B 2DMKA 1RZ7H 2PO6B 3MLUL 4F57H 3QDGB 5IMLA 1RZJL 1VGEL 4XWOD 5B22A 4OZIF 4XAKE 3OR7A 3QPXH 3A67L 4HZLA 5FCUL 1ND0A 5DQDL 4UDUA 5I1EL 1Q9KA 4J8RB 3BIKB 2AP2A 3ZE0F 4MA3B 3BAEL 5I76B 1KNOB 4J3UA 3KDMB 2IH1A 3DUUB 1JF1A 1N5YH 1NCCL 1OAUL 3TYGH 3MOBL 2Q3AA 3GSNH 2W9EH 3HAEA 1DL7H 5E2UL 1FO0L 4N68A 4QOKB 2FBJL 3FT4A 4HQQH 2BRQA 4JDTH 1QBML 2H32B 4M5YL 5E8NB 3NPZB 3P77A 3PUCA 1Q1JH 3IAGC 1HYSD 4FQIH 4LVHC 5E8EA 4YHNA 4FMFA 1FNFA 5J11B 3SDAA 1VA9A 4IS6B 3GJEB 5I1LB 5IVZA 1HHJB 3UTSE 2YOCA 3FQXB 3BWAB 4K3JH 1UB6A 4U0RB 4QWWD 2Z91A 4PREA 1P1ZA 4Y1AA 3ALPA 3BO8A 5DD1L 2HKFL 4EKXA 2R2HA 1I1AD 3WNKA 3D0LB 3DXAD 1S9KC 2AK4D 2CRMA 1AXTL 3F7QA 2NY4B 4S1RH 1IC4L 3RVWD 4AL8H 4UIKH 4NZDA 4OT1L 1Q0XH 1T0NA 3CH1B 2E9BA 4XXCC 2ICWI 5E6IA 2VZOA 3HRZB 1VDGA 3UTPE 1CFTB 4PJGA 1MQKH 3JXAA 4X80L 3EDEA 3KJ4C 4L8SB 4FFYH 1FBIL 2R69L 5MEND 4FFZL 2NX5B 1UXSB 4ZUWA 1HH6A 4WFHE 4KQ3L 2CDGB 4K9EC 1DE4A 5DZNA 4X4MA 5EZLB 5HYQB 5CAYB 5I15H 3I75A 3MJGX 2XN9A 5C92A 5HHOE 2H9GB 4N8CL 4BK5A 1YEDB 2VZ3A 2B0SH 4HUUA 1U8NB 4YFEA 1S7XB 2AJ3A 5D70H 5JW5B 4LMQE 4N0RA 2XZAH 3PGCA 2A6JA 4PJCF 4Y2OA 2GJ6A 4LPTA 3SJVA 1WIOA 4NWUL 3MNZA 4PJFB 4JFEE 3UTZB 5H2BB 5E9DD 3HE7D 3CNKA 4Y8AA 4U1JB 3MRBB 5E8DH 4ZD3L 2W59A 3O6FB 5EORL 2EXYC 4CW1A 4A6YL 1S9VA 4JRYD 5E8PB 4EUPB 4OZIB 3CFCL 3KPRE 3RWDA 2H32H 2Y5EA 5IK3B 5CP3A 2B1AH 2R2EB 4P46C 5FYJL 1S9YA 1A6ZB 5ISZB 2R0WH 1V3JA 5JXAH 4GBXD 5IW6B 4YHYC 2BSRA 2A1WL 2FJFB 3MBEA 1LE5A 4IM8A 2J3SA 2Q20A 5TGBA 2PTVA 1NLBH 4X6EA 3MYJB 4H88L 3PWPD 2DD8H 2FHBA 2A6IB 2QKIB 5C0CD 3V4UL 1IAMA 4LP4A 4YPJA 4KPHL 1TCRA 1I9RH 3QI9C 4Q9BA 1KT2A 2BVQB 1INDH 2D3VA 1N0LA 3OGOE 1EVTC 1YEKH 5SWZB 5I71C 5D7KE 2C1OB 2IPTL 4CAGA 1U91B 4WU7A 3TN0B 5AWNL 1CGTA 4RGNB 5LBSL 3N1MC 4H5SA 4WCYL 3FRUA 5F9JB 4G9FE 4R7DB 3ROLA 1D6EB 1I7TA 4QY8B 1J05B 2AAVA 3K4AA 4UZGA 3SDYH 4XB7A 1IGIL 4YDJB 5DFTA 4APQA 1DN0B 3HR6A 1F4WL 1CF8H 2FWOB 5E2WL 5KVDL 5FUOL 3FFCB 5I0ZA 1KEML 5I1JH 2VDRL 4XPGH 1EHAA 1UQSB 4EOWL 1C7SA 4OZHA 4OKDA 1YN6B 4J2XA 1FVEB 3O41A 4DFHA 1RY7B 2QADB 4OV5A 3KPSE 3GRWA 2GT9B 4G3YL 3RL2B 1T0MA 2R1WA 2OTUA 4HIEA 2EH8H 3VI3E 2ZPKL 4U1NA 3M1BB 3RIAK 1JWUB 2X89D 4LHQB 1MFDH 1OAXL 4MXWL 4M02A 3QIUC 3O4OC 2X4NB 4HX1B 4AIZB 3STLA 1FO0B 3KWWB 5KVEH 2CUMA 5D2NB 4M6OL 5CWSB 2Q8BL 1I3GH 5DQ9B 4OM1L 1T89C 3K4DA 4K3HA 5EO0B 1J12A 5IR1A 1G7HB 1KEGH 4P4KC 5FO8A 4C57C 3IFPA 3BVNB 4EUPH 4QHMB 5AUMA 1JWSA 1D9KB 3F58H 4HKXA 4XTRD 4PJCB 4X98A 2WLZA 4M7LT 1NC4A 2CRIA 3VXSD 3H8NA 1L7IL 3DX7B 1MIML 4JPIB 1QKZH 1FPTH 2JCCA 4K7PY 4PS4L 5D2LE 2A9NL 2XWBA 1YZZA 4LQ1A 5MHSD 1JHKH 2JB6A 3UAJC 1BZ7B 1MHHA 5KTEL 4F15B 1FNSH 5DJZA 5IEKB 5IMKB 2IC2A 3EBAA 1IT9H 5DJ0A 4BFBD 2KPNA 4ZQKB 5D1QD 1YN7B 3GBLA 4JZJB 1DBBL 4PG9B 2IADB 4I5BA 5HHVH 4M1DL 4U6XB 2FJHA 4L29A 2BOCB 4I2XB 3OJDB 4FZEL 5E94B 2AXJA 1G6RL 5E00A 4GRWE 3MLXL 5KVFL 2ENYA 3JUZA 1VEOA 4L1HA 3VFPA 1WWWX 3F7RA 3JVGC 1SYVA 2I25N 1PQZA 4K3GA 3GO1H 5CCKL 4Q97A 4L4VE 3MV01 2CK2A 1BWMA 2Y36L 4KKCC 4XMKH 2AJSL 2GTZA 1JNLH 5EA0L 1QLEH 3U6RA 4D0CB 4OV6F 5EBLB 3TZVC 2ED9A 1BIHA 2HTLD 3MLUH 5LAXA 4WUUD 1RZJH 1VGEH 5FGSA 3A67H 1QR4A 1A1NA 5B8CB 5FCUH 4WO4B 4BFEA 4B41A 1UM5H 5DQDH 5D1ZD 2EYSA 4UDTB 4F7MB 3QDMA 1CICA 1P5VA 1RJYA 3BAEH 1AH1A 1JK8B 1IQDB 1B0RB 3BN9C 3U4BL 1LEKA 5JORA 4OAWB 1NCCH 5H8DA 1AHWB 1OAUH 2ESVE 5AD0A 1JZ3A 3O8XC 4MWFB 3BPCA 3G5ZA 2D2OA 2H2PC 3QIWD 4LSVL 5E2UH 2D0FA 4A6YB 2FBJH 4LAQL 5J9PA 1LDPL 4Q9CA 4NKQB 1QBMH 4WDIA 4PGCA 2VR5A 1NGZB 5GS1B 3VRJA 3F5WB 4WW1A 5HI5C 2YD9A 1KIRB 1Q72H 2NLJA 1XGPA 1REIA 3L3GB 3RGVD 1FFPB 2K9UA 3FHAA 2BJMH 3CXHJ 2W92A 1NGPH 4CJ1A 2ZCKL 4NKOB 2SEBA 4H8WL 5ADOL 1YMMB 3MRDB 1HKLL 1WWBX 2DDQL 1QFHA 3INUL 1ZT4A 4JFDB 5H94A 3FQRB 1IGYA 4Y4KA 4JY4B 1U3HB 3LN9A 5DD1H 3T0VA 4GRLC 2HKFH 4MAYD 4W6XB 3VGAC 1OL0A 4X6FB 3JBG7 3U9UA 3TO4C 3SE3C 1X5ZA 3Q2CA 2DLHA 5IBTL 4MGXA 1JWMB 1AXTH 2ITDA 2E6JA 4OGAC 4DGVL 5JMRA 1IC4H 1NC2A 4Y7MA 4E41D 1M7XA 3L3HA 3IXTA 5DD3L 5IB4B 2B2XL 2KQNA 4PJDA 4OT1H 1JPFA 5A40E 1Q9WA 4YK4C 2W38A 1AGBB 4XHJD 4CNIA 4PV8B 4X80H 4Y4HC 2I9LA 4HH8A 1FBIH 2R69H 4TTDC 4FFZH 3PDOB 4KQ3H 1UADC 3G6DL 5CFHA 4N90D 2ZKHL 2NXZB 4YDLC 1NDGA 2JJSA 2GQHA 5ICXB 1MCKA 1KFAL 3ISWA 2NYYD 4ENEC 3MRRA 4WWKB 1B6UA 4N8CH 4R2GC 4X99A 3X11B 1HDMA 5C09A 3UTSB 5CIPB 4NP4L 3DRQB 4V2BA 4I0PB 3CDGA 3AS3A 2IPUG 5MI0C 1VKXA 1K6QL 1AKJD 1AD0B 4PRAA 3QQ9D 2AVGA 4PJBE 5ANME 5IB5A 3RWHB 3LQZA 4W6YB 5B3NA 4NWUH 4LAJH 3DETD 2DLFL 4NC1C 4RBPH 1JMZA 4JFFE 5DJYA 4ZD3H 4OGZA 3SY0B 5EORH 7CGTA 5HI3D 4A6YH 3BP6B 5KN5B 2YR3A 3RVTD 2LVEA 2V9QA 2VMFA 1AGCA 4RNRA 3S5LA 5FYJH 3VI3F 4X7CC 4XNUL 5T1DL 3C5SB 3UXFA 4RZCB 2DAVA 2FBOJ 2YPVH 5IW1B 2Q6WB 4JRWA 2YPKB 5HJ3B 1KIUA 2A1WH 2PW2A 4P5MA 5IFHL 1J1XL 4WFFE 4X4XB 4ONGL 4J3XA 4YIQA 1ZAGA 5KZCB 2FATL 4H88H 5I30L 1MREL 2BSSB 4ZSOA 1RK0A 5GGTA 5CJQH 5HHOB 4PUBL 4KPHH 4M1CC 3UO1L 1JGDB 4JVUA 3VXTA 4CN1A 1BFOB 3E6FB 4XNMB 4RA0C 4TUKL 1I85C 1T1YA 3A6OA 3MV11 2IPTH 5BJTA 4NDMA 2E9IA 4OFKA 2O61B 3TCLB 2V9TA 5AWNH 1QO3B 1G6RB 4WCYH 4PTUB 4GXUN 5F7DA 5GRVK 5SX5K 2ADGB 4JFEB 3LIZL 5D2LF 3HG1A 5BRZA 3OKEB 1U8JB 1ZA3B 3OAZK 4LRNL 1NEZG 1IGIH 1F4WH 1B0WA 5E2WH 5KVDH 3OX8B 5D5MA 5C70A 5FUOH 3TP4A 3KPRB 5DD0L 2VDRH 3LKRA 4KRLB 2YUXA 4EOWH 1EO5A 1G6VK 5F7WC 4HEME 2IAMD 4GRWF 5JPMA 2GYSA 3HPJB 5B4MC 4G3YH 1TQCB 2Y7QA 5CIPH 5C1MB 1F2QA 2FNBA 4S2SA 1TFHA 1XIWA 2ZPKH 1AJ7L 4FQQB 4HMCA 1IAOA 1OAXH 4MXWH 4FTVA 1GYAA 1IM9D 3CGTA 1FLTX 4PBXA 5CKAA 2CDEB 4M6OH 5DD6B 3JTTB 3R1GL 5DHVB 4R8WL 3NFPB 4G9FB 1UG9A 3P73B 3DXAE 4KJPD 4OM1H 5DLML 1C8PA 2AK4E 5CEZD 3QISA 3BEWA 4GH7B 4TUJA 2XT1B 3VWKC 1Y18B 3MNVA 2CUIA 1F97A 3QQ4B 1T7ZA 1MHCB 1GGIL 5FA4B 1LHZA 1RZIA 1MIMH 4ZTOL 2MPAL 4G9DB 1FAIL 4EXPX 2FEEI 2D4FA 3DSFH 4PS4H 3NN8A 2A9NH 4ZO6A 1INQB 5FKPA 5MENE 5KTEH 4TTGA 4FQXB 2XNAA 3KPSB 1UJ3C 1KPRB 5JO5B 4WU5B 8FABB 3VFTB 4I18B 4TNVK 3P4OB 1ZWIA 1DBBH 3P3YA 4ZS6D 4M1DH 5GSRA 1BQHB 3FFDB 4FZEH 5LKNA 3GGWB 5KVFH 1G6RH 3MLXH 1HIML 2EECA 4OKVA 3VGBA 4HCRL 2R1YB 1A3LL 3HE6B 2VERN 4K2UL 2YWZA 1N8ZB 4IRJB 3QUMB 1WBYB 2BSTB 5CCKH 5SWSA 2EDXA 5E9DE 2XY1A 2PXYD 1GOGA 2Y36H 4LF3A 3MUGA 2AJSH 2OTWA 3SDAC 3VRIA 1JNNL 3VWJA 3CX5J 5EA0H 3MFFB 1A6VL 2P7TA 5F89B 1R5WB 4JRYE 3FB5A 2C3VA 4MSWB 4HWBA 5KSAD 4QXUL 1MHPL 4ZUSA 1BIIB 2QBWA 5DMKA 3SDXA 2ITCB 2X4RA 2YEZA 4L5FL 3DLQR 4MQXD 4HGWA 2C7UA 3MOAL 4C59B 4P48A 5D2LB 4LDOB 4PJ8A 2ZUQC 3DECA 4UNUA 2IQ9L 3QG7L 2DJSA 4HUMB 4HKJB 1EEZB 5J7CC 4YGVB 3T4YB 4NKMA 5CJ5A 5F7KC 3PWPE 3U4BH 3QULB 5C0CE 5F3BB 2XKSA 5GGVH 3V6ZA 1C5CL 4LSVH 3ZKXC 3GSXB 3NIFE 1F6AA 4LAQH 1LDPH 3K0WA 3UZVB 5E6IC 4GRWB 1S9WA 3KJ6L 4XP1H 5DC0A 3ZYZA 4EN3B 5DJ6B 4LLQB 2HLAA 5EUKB 4YFLI 1F3DJ 4QT5B 4LLYA 4XCYA 2JE8A 3ARVA 2F53D 4R4FH 3RIFK 3QIBD 5T5FL 4PJBF 4L4VB 3S36L 2WBJD 2FX8H 5I75C 4WTZG 5ADOH 4H8WH 3P0GB 3ARRA 4Z6AT 3IFLL 1CVSC 1HKLH 2AV7B 2DDQH 1G9EA 2ICWA 4CADB 3INUH 4X9BA 3W9EB 3VXRD 2ZNXA 1NGQL 3FOLB 1M6OA 5DJ2A 5H35A 1WBZA 3ARTA 4MJID 1EPFA 3EUUA 3OV6A 1A7PL 4JFQB 2Q3ZA 1G1CA 2GCYA 3LKSB 2NY6C 5IBTH 1AO7D 4DGVH 3NGBC 3Q6FB 3UJJL 3EYFB 4LASL 3MRJB 1T6VN 2G5BA 4K3DL 5DD3H 5KSBE 5I8CB 3DMMA 3WXVL 3CX2A 2ESVB 5MERA 3SDCD 3TJHD 4KHTL 5D71L 4QKXB 3KVQA 4PRDB 3D0VA 4DK6A 4MS8D 1PW3A 2PN5A 3IF1B 3MLTA 3LOWA 5DJXB 3VDAA 3G6DH 5LGJB 2ZKHH 5L0QC 2P8MB 3A6CH 5HYSB 3IFOB 4XCEB 4DW2H 4IDLA 4X6DE 2X2YA 1KFAH 3MBEC 1HXMB 4OCXL 1DUZB 1MFEL 2XPGA 2X44D 5JDSA 2I07B 4HF5L 3TA3B 1MUJB 5ILTH 3TYFB 1LO2L 4KJWD 3VXSE 5IJKA 3PV7A 4MQ7A 4XNYL 3TBSB 3GM0A 4MJ6B 3CFEA 4LP5A 4OUUA 5MHSE 2ZOLA 4ODWB 3ULSA 4NQCD 2BVUA 4G42B 1LEIB 1B6DA 2HJFA 1KIQA 4L3ED 3OKNB 1XT5A 1S7VA 2I27N