3JV4A

Crystal structure of the dimerization domains p50 and relb
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
TSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 15
structure length 101
sequence length 101
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv4A00
3JWNC 3BPOC 4PJFB 3JWOH 1Z9SA 5IIEA 1NCTA 1UM4H 5CMAA 2BMKB 2EYSB 2VWEC 2A1WL 2XWJB 1TVBB 3CXDH 4XMLH 1ZLSH 2EYTA 2NY0C 5CSGA 3HUJF 3EO9L 4R8WH 3X12A 3TZVB 5E8DL 7CGTA 3KPRA 5F9OL 2D4FA 4XP9L 3CUPB 1T1XA 1KIPA 1KPVB 5DZNA 1H5BB 2I07A 2BSED 3QUKA 2VZ1A 1NBYB 2VXUL 2LU7A 3RX7A 1JZ3A 4YHNB 1NKOA 3EDJA 5D70H 1QFWL 5HGGS 2YD9A 1AFVL 3EYUH 1YEKH 1M7DB 1B0RB 3ARBB 3OJDA 3Q6FB 1OGTA 2BSTA 3BISA 2A83B 1A6PA 1MCCA 4OKVA 4L8SA 1S7UB 3KXFB 5GS1C 3RPIA 2HFTA 1I85C 2H2SD 2QSQA 1ZA3A 4S1QL 1DN2A 3FQRA 5DJ8B 1O7VA 3BKJL 1GGCL 1I7RB 1MJUH 3WLBA 3O6KL 3QG7L 3HLAB 1EFQA 1NBVL 4OM1H 5FHBH 4U1NB 3M8OH 4Y2DD 1IM9A 1IGTB 1WZKA 4Z7WA 2DD8L 4BSJA 5C07D 2AERT 3JWDH 3FQTB 3P4OA 4LK4A 5C0CB 4RWHA 5IHZB 1IGCL 1YNTB 3NIDF 1CT8A 4XMKL 2A77L 4IOFD 1NBVH 4OM1L 2G9HA 4CU8A 1W72A 1A2YB 1AGDB 4N0FB 3NH7H 2GT9A 2KZWA 4OLVH 4RQQA 1UKQA 4Y5YB 1BD2B 3D3VA 3ULVC 3OKMA 5I8OL 4KZDL 5C8JA 1I1AC 2RAMA 1IGYB 5E2VH 5H2BA 4F3FA 4FZEL 1JFQL 4OGZA 5LXGH 3FMGH 4V1DD 1AIFA 5C09A 1YYML 4XI5C 3RX5A 3PE9A 3O8XA 4QXTB 5EIIA 1J1XH 1OY3B 3QI9A 4OIAA 5AZEH 5KSBE 1IT9H 1EBPA 1CQKA 4QHLB 3G5XA 4WTZA 1QFUL 3MLRH 4LLWB 2GY5A 3P2TA 3FRPA 4YE4L 1JYNA 2HVKA 2NY7L 1K5NB 1BFOB 5GJTH 2I27N 2XZCH 3L3GB 2XWBB 3O6MH 4XHQA 1DSFL 5HTSA 2OXGA 1FV1A 2CKBL 3OPZL 3AM8C 3IF1A 4M61A 4ZFOL 3BZEA 1FZKA 3MRFA 2FZ3A 5DC0A 4YPJA 5FKAB 1E0OB 3MROB 4LU5H 1CFTB 4LSUH 2Z8WC 4JO3L 1KOAA 5DD0H 3GHBL 1MHPH 1BMGA 1Q8MA 4IHOB 3L3IA 5CJQL 3O3AB 1NCDL 4GQ9H 5JR1L 3ARVA 1FO0H 1IQDA 3DROB 3PQYD 3QAZC 3ROOA 3T65A 1IAOB 4EXKA 2C1PA 5FEBA 4XBEL 4FQXB 2HVKB 3BKML 2DMCA 4ISVA 4U1HB 4G6FB 1DFBH 1ZWIA 1N4XH 4J6RL 1WITA 3VXMB 3L9RA 2BJML 4M8VA 5F8QC 4G3YH 1YEIH 2OJZL 2AW2A 4KHXL 3O9WA 4X6DF 5I1AB 3KYKL 2G5BB 4W68A 4OLYH 1T1WB 5ITFB 2NY0D 4NQDE 4O51A 3ARGB 3O3AA 3TWCH 2I5YH 1RUML 2FLBT 3GSNH 5HHMD 1UWGL 3ULUL 5DK2A 1M7XA 2P5ED 3ARSA 2NX5B 2Q76A 2QHLA 3CX2A 3MV7A 1X5LA 2B1HL 2UYLA 1NGXA 4XZUA 5IWLC 5DUPH 4QRUA 4ONHB 5C0AE 1X5AA 4MAYD 3BZEB 5E8OA 3S36L 3TBYA 2M2DA 2EYRB 1U8LB 2D0GA 2GAZA 4GKOA 4Y7MA 3J7HA 3V4PL 4MA3A 2ICES 3SDXE 1TDQA 3QXTA 1F6LL 1SVZA 3O6FD 3IDMB 3LKNB 1FFNA 4MAUH 4O2CA 4CMMA 4DGIH 2B8OT 1V5JA 1U58B 3DJ9A 5HGBB 4OLZH 2R0KL 4XAKE 5EC1B 1JGLH 2QQKH 3HCVB 2VDPH 3P0VH 1LGVA 1CICD 2D3VA 1QBBA 1CF8L 1C5BL 3NA4A 4TVSa 2N1KA 4MD4A 3LKRB 5IMLB 3F12A 3GIVA 3RKPA 4X8XA 4P46D 3FO0L 1ZT1A 5GHWH 3UTTA 1UQSB 1ZKAA 3AC0A 4KRNA 1NDGB 5E2WL 1MLBA 4IMLA 3P4NB 4U1MA 4NNYB 4PS4L 1MCFA 2WWMC 5DQJB 3UTZB 4POZD 2HH0H 3F58L 3NGBC 2G2RA 4JFXB 4HIXH 3FONA 3HRZB 4PRHB 1XGRB 1F3DJ 5LQBH 2NY2B 1ZGLB 2E7LA 3S37X 3I9GH 5EPMA 3C6SB 4YDVA 4M3KB 1P53A 3QWRA 2OX5A 1E27B 5CIPA 1FVCB 5I74B 2F74B 3V6OA 4A6YH 2NCMA 2R0WL 5C6TL 3RHWK 4DK3A 5IB4B 1N5YL 4RGMC 3UJJH 5E6ZA 5DVMA 4RIRA 5EZLA 4K7FB 4XVSL 5HD8C 3TT3H 1D5XB 2O5XL 1ZTXL 1CLOL 1FHGA 4O00A 3SKMA 1SEQH 4O02L 4DKFH 1I1YA 3T77B 3UTTD 4R7DA 3HZYB 4YR6B 4XRCB 4PJFE 2XQYK 4I0PA 5GSVB 4XT1C 1R5IB 1RV6X 3BP7A 4TSBL 2ADJA 2JTDA 2X4OB 5IBLD 5TFSL 3VFRB 4GW5B 4NBXB 2FGWH 3M1BA 3NIFE 5DRXA 4S1DC 2ZPKH 5T3ZH 3BEWB 2J1KA 4YJZL 1FGVH 2YPLA 3LAFA 2W0PA 3MX0A 1T7XA 4K3DL 4RDQG 4ZXBB 2R69L 3V8CA 1JZ8A 3LH2L 4KK9D 4TULL 1MFDL 2EXWD 2QJDA 4HH8A 1IGTA 5BMFH 5C0IA 1EAPA 1P1ZA 1YEGL 3K74B 5B22A 5DJ6B 1KG0B 2QEJA 3WLWD 2DLIA 3RJQB 3VFVA 3QUXD 4ZFFB 3SQOH 3ZE1E 4I0PB 5IG7A 4ODBD 2MCPH 4P4KC 5INDB 5J13C 3F6IA 1N6UA 2X4NA 4D9QD 3AVEA 3ECBB 3MRJB 2W0LA 3ARYA 4LDEB 3S96A 4K3JL 7FABL 4Y5VA 1YNKH 4RDQF 1PKQB 1MELA 4H1LB 4WV1B 2HLFD 1V3KA 3GRWL 1HHIB 1QVOB 3EDFA 2Y07L 3VU2A 5CCKH 3MJ9H 1X5GA 4PJBB 3DX7A 3L5HA 2E9JA 5FA3B 3ZLQC 5E5MB 3FT2A 1AO7D 1FH5L 1OTTC 2BDNL 4MLIA 1BD2A 3TESA 4YHPB 2X4SA 3FT3B 1NL0H 2DN7A 4RRPG 5DJDB 2IH1B 3WHE1 3RAJH 4UU9B 3BP7B 5DEFB 2IH3B 4KI5F 2W91A 2P8PB 1SYSB 5FYJU 1FG2B 1FYTD 5TE4L 1T04A 1DL7H 3BQUC 2R0ZH 4LEXH 3T08A 3RKDD 4QRRB 5HHOD 1GH7A 1NFKA 3CU7A 4CJ0A 1I1CA 2MJWA 4JFOB 3ZYOA 3EJYD 4AM0B 1Q1JH 4M6MH 4PJEB 3ET9F 1Y6MR 4C57C 2IJ0C 3MLSH 5BQ7A 1HK6A 3K2UH 5GPRA 4P48A 3OJVC 5DHVA 4CL7A 4GRLB 1RURH 1GZQA 5FCUL 3ZKND 2R2BA 1CFVH 5A2KH 1EA9C 2FJHA 2W0FB 3MSPA 5TDNA 3UP1A 3KWWB 3WXVH 2OSLA 5CZXD 1RAMA 2G60L 3V0AC 1QFOA 3B43A 3GMOB 2BFVH 5EZJB 4QHKJ 2W9EH 1MI5D 4J7RA 2NXYD 4Y4FB 3O8XD 1CLOH 3ZHLA 5IEKB 4FMFA 1MOEA 1W2KT 1Z3GL 1I7UB 2JB5H 3HTLX 3M17B 4M7ZC 2X1OA 3S4SB 1V3LA 1AQDA 2CRIA 3Q1SL 3QP3A 1I7TB 3GHEL 3B5TA 4OZHA 3WHXA 2HFFB 3QNYA 3PV6B 3UTSE 4HD9A 3GSOA 1T1WA 4PLNC 5ITFA 5F96L 4X99A 1PVHA 2GK2A 2YRLA 3QDGB 1GYAA 2EIZB 4D0DA 1L7IH 4LLMB 2CJUL 3MGTB 5GRJH 2CRZA 2VITA 4JFFD 4GAFB 2BOBA 4MNGB 3QXUA 1U8KA 2XG5A 5LAXB 3KYKH 1ZHKA 2YHGA 4LEOB 4NO2B 3SE3A 4G8GB 1QLRB 5IB5A 4N8CH 3LRHA 2X4RB 4K23L 4APQC 5BJTA 4P23A 4IMKA 4RMWA 2Y9RT 5DFVC 5IV2B 2ARJB 4C56D 5D1XC 2XKNB 4RFOH 3WYRA 2ZG3A 4PJIF 1RJYA 2IPKA 5I9QB 2BSRB 1WAAA 2NR6C 3VG9B 5T1LB 1FIEA 1J10A 4I2XB 1YN7A 5BVPL 35C8L 3I3BA 4MJIB 5J9PA 2P43B 5HHNA 3DV4B 3K2MC 5J89A 3FHQA 3QJHB 1UWEH 4JG1L 2AV7B 1NMCB 3MO1B 3RVVD 5LGJB 2ZUQB 4UIKH 4FFZL 4DN4H 5DHYA 4JEGB 4MMZC 4RAUA 5TH2B 5I8EA 2X7LB 3C2AH 5D8JL 3CSGA 2AABL 2WAHA 1SJXA 1N3NA 4PGJA 4RMTA 2AXFB 1I1AA 1KN2H 2VISA 4JO3H 4R4FL 3V5DA 3BXNA 2FX9L 3BMWA 1D6VL 2Y5TB 3QG6B 4M1GH 3EZJB 4Y4KD 1A8JH 2BERA 4XNYL 3BH8B 1T80A 1KCRH 3BT2L 5JHDA 4HFUL 2PYEA 4FS0A 5JR1H 5JW4Q 1Z9LA 1W72H 3WL9A 1CICA 2WK2A 1QPPA 4XCEB 1MUJA 2XV6B 4WENB 3RBGA 4RMUA 4MAUL 4PJ7E 3ZKSD 1UXWA 5L2KA 4WUUB 1ADQA 3FB8B 5A1AA 4OF6A 4RAHA 2XKSA 2ICWJ 1QUNA 2EO1A 3QIWB 3VFOB 4BK4A 4GAYB 4KTEL 3TPUA 3PWJB 4LKXB 4P2OD 4Y1AB 4D9RD 4HXBL 4LCCC 3T2QA 2VR4A 4ZNEA 3WLWC 4W70A 4WI4A 1K4CB 3QUXC 4PP1C 3DYOA 5CJ8A 2DQGL 4QRPE 4GQPH 2VABA 4P5TD 4NOFA 5IG7B 2V2WA 1NLDL 4K7FA 4HBCH 5GS2H 1UACL 3VFVB 5GJSH 2D9QB 3BKCH 4MNHB 5GGSY 3AAZB 2IC2A 3FOLB 4NQDB 4P2RB 3DUUA 1TVBA 1T1ZA 2JCCF 3GHEH 3DUSB 2UZYB 2AEWA 4AY0A 5D7LD 1UZ8B 3QXWA 5I2IB 4ENEC 1TJHL 2A6KB 1OPGL 4Z7OF 1QFWM 3OKDA 4C4KO 4TRPL 1QTYT 4D9LH 1DUZB 2DLTA 4HUNB 2ILLA 4BZ2L 4GXVL 4F33B 3ZHKA 3PL6D 1ZT4A 4ODXB 1HKLL 1PEZA 3QIWD 2WSKA 5DK2B 3QEGL 3GSXB 4OTXL 3W0WE 3B3IA 4JPKL 1ZK9A 3FQWB 4L8BB 2FX8H 3QHFH 1BOYA 4HT1H 1I3GH 2ICWA 4YDIL 1A1OB 4CDGC 4W6YB 4ZDHA 4TUKL 1KTDA 4APQA 3C60B 1I8LA 5GQBA 3UTPD 1RSFA 2Q87A 2PO6C 4UBDD 3FMGL 1NMCC 4CN1A 2CKBB 3DSNA 1A4JA 5GGRB 4Y5XB 5DUML 2BY2A 2VC2L 5DF0A 4V1DA 3OR6B 5C09D 4IRSB 2L0DA 1R5WB 4OB5H 2CDGB 3RY6C 3VG9C 4U2ZA 1G9NL 4A6YL 5JPMB 1WIOA 1B4JH 2AK1H 2FSEB 2ITDB 2VQTA 1GL4B 1Q9KA 4ZO9A 5K59E 4R8WL 1NGPH 3ARTA 2X1PA 1CXIA 3TZVD 4YPGB 1UM5H 2ZZUT 4KVCH 1J1PH 4DVRL 4XRCA 2XY1A 4NO0A 1PG7L 2HTLD 2O61B 4GMTH 4HJGA 2XOTA 2HG5B 4KPHH 1UJTA 4IEFB 3MRNA 4WI3A 4WGVB 4PG9A 1D5ZA 5ETUB 5EU5A 3V6OC 3PF2A 2D7NA 4U6YA 1FORH 4U6XA 3BE1H 4XBGA 5DA0B 2KPNA 3T2PA 3OKLB 5E70A 3HNTH 1HE7A 2IBBA 3C5SA 2Y23A 1UKTA 4YAQB 4WJ5B 1MFDH 3DXAD 3LB6D 4GKSB 4B0MM 1N5AA 3REWB 1TETH 4R4BB 1VFMA 2W9LA 4NCC1 1FL3A 5I18L 1NLBH 1DLHA 2A9ML 2D7OA 1DQLH 4KI1A 3ZSTA 1KG0A 2IPTL 4GH7B 1DEEB 4G8IB 5JNYA 4LCIH 3WN5C 5BO1H 1TVDA 2R4RH 3S4SA 2NX5A 5JHLH 2YD1A 2EC9U 4XP9H 3MRKB 4ZAKC 1X5JA 5JPNA 4E9LA 1KCUH 1I8IB 4Y4FD 1RJZB 3U4EB 4TNVF 5EOTB 1JGUH 2ARJQ 4U6HA 5FM5O 5J57B 4ONFH 3MRBA 1XGPA 3LN4B 5HHMB 4G8GA 1S7SA 3RIFK 5I75B 4P5KA 1AGBB 2BOBB 4MNGA 3IETA 3ZL4H 4KKCC 1MHHB 2RB8A 43CAA 4WNQB 2UWEE 5E9DB 1JCKA 4YHML 2C1OB 5H94B 2FO4B 2P5WB 5D7IA 2X42A 3CLEL 2FWOB 3RIAF 1XGQB 3OX8A 3B4NA 3D0LA 3RNKB 4F2MB 1YZZA 3O6FB 1IC4L 4KHTH 3SOBH 1CDBA 3QB7C 1XGYL 4YEFA 2XXMB 3FQNB 1F11B 4IRJA 4YHIB 2IQ9H 2FECI 2BP3A 5JMRA 4LPWA 1M05A 1JMZA 3TT1L 1F5WA 5A2JH 3LMJH 5BRZE 3QQ9D 4OD2A 1CFQA 3TF7C 1AGBA 2EDJA 4G9FB 4MDJA 5I9QC 4KKAD 2C3WA 1YPZE 4O4YL 4AEEA 5HI5C 3MBXH 3SOBL 4AIZB 2NTSP 3PWNA 5DI8A 3TN0D 3B2UC 4PLJC 4L9LC 4E41D 4EI5D 1LNUA 4MS8D 2NY6C 2KBGA 1KB5H 1TZGL 2E9WA 4NM4H 3V4VH 3TH3T 5MEQB 4WV1C 2BCKA 2X4UA 2NTFA 3TT1H 4CAGA 5I1JH 3ARDB 4PRHE 1G6RB 3KPMB 1KCSH 4G43A 5BW7C 4GKNB 3RTQB 4HK3N 4JFDA 4JY4A 1G9ML 1SMOA 4P4KB 5K9OB 1JNJA 4MNHA 3VFMB 1NCDH 3MRPB 4XWGL 3CJJA 1PJ9A 1ZA6A 1GOGA 4HS3B 4P57A 3RWDA 5B39G 3T09A 3THML 4JM2D 3SDDB 5CJXA 1GAFL 1U41A 1GZPB 4UNUA 4FQXD 1SYSA 4UV4H 4P0DA 1MCWW 3ALWA 5F71A 1S7WB 3IB4A 2NLJA 2ATKB 3UJTL 4QXUL 5IOPB 5D2LE 3BN9D 2MMXA 3D9AH 2G60H 4HMDA 3IKCA 3C5ZB 4HS6B 4I18A 2H3NA 2E9BA 4KROC 3QUZD 1AY1H 5E6YA 3BPLC 4XNZB 1AGFA 3BKYL 3DGGB 1UH3A 3MLZL 3V2AR 4MMXC 2CKBH 2JB6A 1WIPA 3VD7A 1J0ZA 3WS3B 3TWCL 4L9DA 4E42B 4PRID 2VLJB 4YQXH 3RNQA 2IPTH 3M1BB 4Z95H 4I5BA 4MDIA 2EXYC 4TTDD 2O5YH 3CDFA 2QADC 5DFWH 5T3XD 3INUH 3UCRA 3MGOB 3MV9B 1J1XL 5HD8D 3QUYA 1S78D 1Z5LA 4HKZB 1DQML 4BQ8A 2LQRA 1RMFH 4X98B 1FNAA 3RWHB 1CI5A 1LP9F 3VFMA 3QIUA 3MRPA 1UC6A 1XZ0A 1JPSH 3CXDL 4XMLL 3O8XB 3VRJB 1MWAH 2DL2A 4D0CA 1OARL 4AEHH 5FYKD 4PV9A 2BHUA 2Q3ZA 3QNZA 4ZUVA 3FT4A 3GSUB 1N0LA 2DDQH 1JZ7A 4F57L 3CFJB 3IDXL 3ULVF 3LDBB 4BM7A 3TCXA 2R0ZL 1NKRA 4JQXA 4PTUA 5IMKA 4UTBH 3IU3A 3X11B 3QUKB 3GBNH 5J56B 4HW6A 3MV8E 1U95A 5CEZH 4PLKC 3WIHA 3CUPA 4YHOL 4M6AA 1J18A 4S1RH 2CIIB 3SKJH 3ROLB 3IDUA 1OTUD 5KSBA 1LO3L 3HMXH 4ZD3H 1JHTB 4ODUA 4CKVX 4AQ1B 5ID1B 1MAJA 2E6QA 3N1PC 4PB9H 3QEQA 1CVSC 4GAGL 2NNAB 2Y6SD 4L4VB 2R56H 1AO7B 1T6WA 3AMKA 1LVEA 5ACMA 4WFEE 4DQOL 3ULVL 3U2SA 5C0NC 4KGLA 1AH1A 4I0PC 1OP3H 2HRLA 4JLRB 4D3CL 2VLME 4FFVC 3TBVB 5MP6H 4HLZH 2VDPL 3T4AB 5FYJH 2H9GA 5DO2D 3ROLA 4GAGH 4HKJA 4HCRH 1X5XA 2R23B 4I77H 4MJ5A 1IAIL 4O2EA 5F6HI 3CXHJ 1FSKC 5GRYA 1RZ8A 5DMYA 4PJ9D 1I8LC 1S7QB 3IDJA 1DJSA 1OP5H 3KPOB 3TO4A 4Z7WE 3V9FA 1MREL 2KUTA 3RDTB 3U0WL 4KJQD 3WUWG 4PV9B 5ID0B 4J3UA 3IT8D 3UZQA 4NQEB 3MLPA 3MRDB 5GGTA 2GCYB 3P73A 3X11A 1U8QA 3BVNA 3L5JA 4N8PA 1CR9H 4EKXA 3VW3L 2P44B 4E41E 4S1RL 1A5FH 2ADFL 3I6KB 1IMHC 3MV9D 3GBLA 1RUQH 3UPRA 12E8L 3PWPA 4OCWL 4UIMB 5CZKA 2D7TH 4O9HL 25C8H 2EIDA 2XQBL 2P8MB 4HFWA 3P9WB 4MA8H 4TSAH 3V6ZB 1WC7B 1BIIB 4OCLC 1DEDA 3U9UA 4NZUL 3QUMB 5CSZB 2JELH 3EYUL 1R3LA 4KI5E 1KJ3H 4LKCA 5IB3A 2NY2C 1CL7L 4XPAH 5J1TC 4OF8A 2EE6A 1FL6B 2EEAA 2BNQE 3C60D 3AM8A 4Q9QH 5F7WC 2OL3B 1BQSA 1NMAH 5JHDE 3VWJD 1CLYL 1EDQA 3I2CH 3MV8D 4S1SH 5A2FA 5TF1H 3WHXB 4JPIB 1CDGA 3GHBH 3TM6A 5HDOA 5ABDE 4M6OL 3SPVB 2CLRA 4UTAH 2AP2A 4HC1H 1K6QL 2DYPD 1AQKH 3CC5B 1G9EA 3KPOA 5T3ZL 3VXTA 3QFJD 5FECB 3TYGH 5KSAC 1A4JB 4YFDB 5INCA 3GSWB 1BPVA 1AD9B 2D03L 1I3GL 4MJ2A 3LN5A 2NMSA 1SJHB 3RGVD 2HYMA 4U1GB 3UYRH 1GZPA 4JFQB 4YDKL 4U1HA 4JKMA 3GUTB 1QFPA 1MAKA 4MD0B 1I1AB 4HS3A 2DQTL 5FV1L 2AEQH 1L9NA 2EE2A 3L6FB 5ICYA 1VFUA 5SWSA 2V17H 1KLGB 5A2IH 3R0NA 4FQLH 4Y5YC 1U8NA 3TO4D 4KTDL 1QSEE 2HP4A 1QSFB 3BXNB 3U30B 3U46B 1F6AB 4MQ7A 2SEBB 3U79A 4XCCH 4OBSA 2R1WB 4NBZB 3SJVA 2FD6H 5F7DB 2GFBA 5J4MA 1F3JB 1RULL 3ALPA 1LK3L 4YBQC 1CU4L 1FYTE 4I2XA 3EZ8A 2IPUG 5LGJA 4WW2B 3UC0L 1NSNH 1A6VL 1QRKA 5L8LB 4NZRH 3OKKB 4KC3B 3V4VL 2BY1A 3VGGA 3NA9L 4QXGH 3H3BC 3TYFB 5B21A 5F89A 4NSKA 1DFBL 4DAGH 3FRUA 2E5EA 3W9EB 1NUDA 1TZIA 1MCWM 3X12B 4GW4B 3AU1A 5EU6E 2A6DA 2HH0L 2ZJSL 5BS0B 1WIUA 1TJIL 2OLDA 4P3WA 4W81A 1J0HA 4LBEB 3S4SG 2FHCA 2V2WB 3OF6D 4M7LL 3E3QC 4PJ8B 1D3CA 5EOCH 3GJEB 3PGDA 4U1LB 4M7KH 5CP7A 1CLZH 1MI5E 1G7JA 4QXWA 3PWLA 4N9GB 4Y16D 5FYLH 4RMQA 2BNQD 5CJXC 3T0VA 2UUDK 3FB7A 2HTLC 2AQ2A 1CE1L 4NC2B 3RNQB 2J88L 2V17L 2P7TA 1BVLB 3BP4A 3QFDA 5DD5H 2EDFA 1ZVSA 1MI5A 2GYSA 3THMH 1A9EA 4XPHH 2XA3A 1FLTX 5I0ZA 1MFCL 1FIGL 2ZCKL 1CG9A 1CD1B 4X5XB 1VDGA 3R06B 1KTKE 5ITBH 2NY1B 1NFIA 1CE1H 2ZOKA 1S7VA 3WFCL 1CGSH 2B4CC 2P42B 5BOPA 2ADJB 3QNZB 1TQBB 5JOFA 3U30C 5T3XH 2VZVA 4Z7VA 5F8RC 4YHYB 3EOBA 5DUPL 4PJ9B 2WIIA 5I1CL 4YHLH 4GW4A 3G5YA 4MSWB 4FFZH 4OZ4B 4HG4K 3BPNB 4GO6B 5C6PB 3L3JA 3I3DA 2OBGA 3P77B 2ZKHL 4JFEB 2ED7A 2APTA 1AR2A 4LSRL 5ENWA 2EDDA 5ELIA 1J1PL 3L3HB 4XP1L 4G43B 3RVWD 1F3RB 1QBMH 5AG9A 5F1IA 4DWHA 5EUKA 3QUMH 4KKCD 1YEFL 4Z9KB 1JHTA 3SKNA 4GMSL 4IRSA 3BIKA 5FK9A 2HWZH 5I1HH 4FNLL 1EFXB 1DP0A 2DKMA 2HN7A 2WQRA 4JO2L 1BD2D 4ZFGH 3PWLB 4N9GA 1A7BA 2YD8A 3MNVA 3O3EA 1VFAA 5SWQA 5FOBA 2KZ1B 3CFDA 4Q9RH 4LPUA 4C83A 3GM0A 4HPOH 1KTDB 2X4RA 5LVEA 4K3EL 1OARH 3VFPB 2Y6SC 4HWBL 1L4IA 5EU7E 3JV6B 4JQIL 2GKIA 2MTPA 2QHRH 1CYGA 2Z9TA 4Y5VC 3QDGA 4R2GD 3U7YL 4H88L 4Q6IC 3ARBC 3PWUB 3QO1B 3K4DA 1S8DA 4XNMB 3INUL 2FGWL 2YR3A 4U0RC 5K93A 1R5VA 3CH1B 3V5HA 4EBQH 3RTQD 5DJ0B 2ZG1A 4LLQB 3GSVB 1A6ZB 4DZ8A 3CMOL 1BFVL 1IGJA 1AC6A 3U7YH 2H26B 4PJGB 5E5MA 3GFUA 3TZVC 2YD2A 4RWYL 2EDEA 3D2UA 2NY0B 3FT3A 3QEUA 5FYJE 5TDNB 4RISH 2JK5B 4FHBD 1ZMYA 4OLVL 1J5OH 1OTTD 1MIEH 1T5WB 3QPXL 5K9KB 4ZTOL 1MF2H 4WJ5A 2DKSA 1GHFL 2XRAH 2AJVH 4GMTL 1B4RA 3U0PA 3OKLA 1KNOB 4PRIE 4U7KA 4NZUH 1MRFL 3GIVB 4B53A 3PHSA 5GS0L 4OCRH 3LQAC 2OXHA 5E9DA 5GXBB 2ESVE 4B5EA 2EXYD 1E6OL 1QO3A 3SPVA 1GSMA 4NNPH 3UDWA 1UWGH 3ZDYF 3EOAA 3VXNB 5CKAA 3UAJC 4OSUH 3FQUA 2ORBL 3HZMB 5L6YL 1UH4A 5KZCB 4GBXD 4NJ9H 3ZYJA 3S35X 1OGAE 1WBXA 3SY0A 5F7YC 3TIEB 5K9QI 3FB5A 3L3OB 1VADA 1YN6A 4HKJB 1JTPA 1A7OH 1IARB 3EAKA 4P23B 2MQ0A 3WFEH 3MRFB 2W59A 3STZB 3ZKXC 3O0RH 3LDBC 2GJZA 4NNYA 3BZ4B 1P69B 4G9FD 5A40E 2HKHH 1V3MA 4Z7UE 5T33H 4JO4L 1N6QH 4FXKB 1V7ML 4PJAA 5BZWA 3HS0A 4JKLA 1TTGA 2B1AL 3WN5A 3C8HA 4ZSOB 1U8PB 1AHWA 3B9KC 4E5XA 1XR8A 1DQQA 2HJFA 3ZMRA 1XMWA 3TVMA 1YJDH 3C6LA 3MJ6A 1WBZA 5CINL 4BQ9A 5E2TL 1RZKH 1J1OH 5A3ID 4P3DA 1A6AA 3GSXA 4EI5C 3PNWA 3WNMA 1TZIB 1MFEH 4I8DA 2BCKB 2X4UB 5F89B 2ENSA 1MJ8L 5BVPH 2F53B 3HE7D 1FNFA 2AV1A 2J8UF 3U7AA 3Q5OA 4APQD 3ARUA 3PP4L 2DWDA 5JLZB 3VXRD 4LSTH 1I8KA 2UYLB 4XZUB 1A4KA 4K55A 3AS0A 1BM3L 4P5TB 1BWMA 2YN5A 5D9SA 4HIEA 4FQQA 2ZUYA 5E0QA 5GRXG 3RZCC 4FXKA 4KY1L 4F7PB 2J3SA 1KACB 4X80L 3VXUA 2JF1A 3MLVH 2IADA 1QRND 3PGCB 4UQ3B 1A1OA 4C58B 3SDXB 4CUCA 3L9RB 1NCUA 2B5IC 3G5VB 3LZFL 5IFAH 5AG8A 4J4PA 2J4WL 1F90L 4LRIC 4M43H 5ILTH 3OF6A 3A67L 2X10A 3ARDC 5HYSA 1MQKH 3GI8L 3HG1A 2HN7B 4WWKA 1CTNA 4Z0XB 5F6IB 4JQVA 4L9LB 4X9FA 1QR4A 3S37H 4PY8I 2F58H 3BZDA 3GSNB 2GT9B 2Q76B 3I02A 2PN5A 2G9HB 3TJHD 2J4WH 1WTGT 3AUVA 3NFPB 3TFKD 5CGYC 5FM8A 1OAZL 1VB9A 3ILPB 1UA6L 1A64A 2FX9H 3QIUB 4LQFL 1FNGA 3BYYA 2F54B 4Q6YA 2ERJB 3QT2A 5H35A 4Z7WB 4QXTA 5E7BA 2PCPB 1RHHA 2J5LB 3HCVA 3IDGB 2NY3C 4NFBA 5ERWA 4PY8J 3GSNA 4JPKH 2B0SH 4JRXE 4L4VD 1TQCB 1CD9B 2P48B 2NXYC 3FQWA 1F13A 4Y5YA 5L88L 3WIHL 1MH5B 1LWRA 4OZFH 3UPCA 1G7HA 3VXPB 4KRMB 1PZUB 1QSEA 5DQDL 1FZJB 1OSPH 4JGJA 4V2CB 2EECA 3HPJA 2WP3T 2VLJE 2Q86A 5GS2D 1YA5A 4JCMA 2VE6A 3KPQA 1A7QL 4IBLT 4M1CC 4PJIE 1R5IA 5B8CA 3MMEA 5BQ7B 4U1LA 4XPAL 5FF6A 4BFIB 4FFVD 4FQLL 3VWKC 5IWLA 1QFHA 4YXHL 1JUFB 4WRLA 5FHBL 2J6EH 4TQEL 4HZLA 1PQZA 1QLRA 2M26A 3LKPA 5ISZB 1XAUA 1CFSA 5KVGH 4G6MH 1U8KB 5CBAB 3PV7A 3T4AA 4MGXA 1RZJH 1UKSA 5EOQH 3OWEA 4OV5A 3BYTA 1OAUL 3VGAB 4NZTH 3OAYH 3VA2C 1YDPA 1S9VA 2BHZA 2J2ZA 1IGJB 5KTEH 4HUXB 5FYJL 5D5MB 1RUPH 4C56A 1IQDB 3DROA 4LU5L 3QNYB 5FF6B 5F7NC 3QWQB 4LCUB 3Q5YA 5M7QA 3KYMB 3LIZH 1EX0A 3RDTA 5I73B 2QR0B 2VXTH 3ARXA 1IC1A 1OD9A 3T0EC 3T77A 1S9XB 4MZ2A 1MCQA 1MRDL 3MRCB 4JJ5A 4W4OA 3V5KB 1C8PA 6FABH 1E6JH 1A6TB 4BELD 1BGXL 1K8DB 4MNGE 4A6YA 4PGDB 1OB1A 4ODWA 3GJFA 3PWPD 1S5IL 2ZCHL 4K8RD 4H1LG 1TENA 3H9SE 1CK0L 2VLKA 4IRSC 1TVHA 4LCIL 4K3HA 5JXAL 4MXWH 3LQZB 4LVOB 4DN3L 4D9LL 3HE6A 3V6ZA 2XPGA 5IB3B 3RKDC 5AUMB 4JN1L 3RTQA 5CSZA 5D6DA 4B41A 3EFFA 1CFSB 1X5IA 1NMBH 1FC1A 3LN4A 1S7VB 1PQZB 3JSSA 1OGTB 3BUYA 5HHOE 1EHNA 5BV7L 2I60L 1KB9J 1N59B 5JOPD 3G08B 1JTOA 3I50L 1QKZL 5CZVL 3LKQA 4AEHL 3MRLA 1H15B 1BEYH 5C0CE 2NW2B 3K3QA 4XPTL 5F7LB 2A0LD 4JFXA 3U0TB 2ATPB 3IXTA 4V1DE 3GBNL 5TDPA 3GMNB 2O93L 5DWUL 1LO2L 3NCYP 5C0CA 4WFED 4OUUA 4Z8FL 4S2SA 3BH9A 1RD6A 1UB5A 3GNML 3K46A 2MKLC 2WANA 4YDLC 5L2KB 4Q2ZA 5C0AB 5IMMB 3GM8A 5M95B 1FYTA 2F8VA 3TP4A 2XQYG 3C2SA 1ZT7A 1OSPL 4M3JA 3TVMB 1F2QA 3WUWB 3R1GH 3Q0HA 1QLEL 1M1SA 4YNYB 1REIA 3LQZA 4GLRH 4ZFOA 3WJJA 5GIRB 1NUFA 4ZQKB 4UV7H 5GGUA 3D9AL 2Q8BL 3PHOB 1K2DB 4D3CH 5ESVA 5DXWA 3KJ6L 5HHVL 4A2MA 3KPSE 2EIZA 3ARDD 1KIUA 3QIBA 3JVGA 1BBDL 3NCCB 4JFDB 2FX8L 3GK8H 3V4PH 1HOCB 3L7EA 3KYOA 1KUMA 4QKXB 1N0XH 1HH6B 3W82A 4JRYD 3SGEI 1T0PB 1W0YT 4JB9H 3QDJB 4OZFB 3RA7L 3TJEH 3NOIA 3HAEA 1C7SA 3P40A 1AKJB 3FQXA 1JPTL 4X4XA 4KQ3H 4Z7UA 3MA7B 3QXAA 3OKOA 4XP1H 4JFZH 1GGTA 2XWBA 3ZO0A 1K3IA 3BDBA 3SKMB 2ZCLL 3SDAB 4OF7A 4XP4H 2DBLH 3CFKB 3F8UB 5DMIL 3SDXA 4L8DB 3OR7A 5IF0A 4L5FL 3HMWL 3PL6B 3QDME 2NY2D 2VL5B 4Q2ZB 1OWWA 5C0AA 1RZIA 4GRLD 1I1RA 4IHOA 3ZT6A 1KCLA 4HGWA 1T5WA 3P9MA 1ZLUK 3BDXA 1HILB 2AVGA 3NFPA 5HVWA 5F6IC 2ZKHH 1DBKH 3ZKNC 4UDTB 3QFDB 4HG4J 5EUOB 2J8HA 3FN3A 2Z93B 3L3HA 1MVUB 5JOPE 5GS0C 2ARJA 4XHJD 1WK0A 4E42A 2R0LL 1CGYA 2B5IB 5DD3H 3UZVB 3FFCE 4L29A 1FFPA 3MA9L 4HHAA 1I1FA 4JRYB 4U33A 5K9QG 1UA6H 1D5IH 1UJ3C 5C0DB 5ITBL 2VOTA 2FECL 1Y6NR 5T33L 2IWGA 4FG6C 4PJGE 4ISVB 5IGXH 2ADGB 5JHLL 3GB7B 4URTB 4DW2H 4FQIL 4X5WA 1Z5LB 4HK3J 4X4YB 1E4XL 1CBVL 1UB6B 4LNRA 3ZYZA 1BVKB 2VXSH 5DJZB 3I84A 5FM4A 4PJCA 4P9HC 3C6LC 1T7VA 1U42A 3U4EA 4XB8A 2P8PA 1NLBL 3TBSA 1AGDA 3O4LA 5IJKC 2GTZB 1HI6B 3QDGE 3MLRL 1KIRA 1U95B 2VLKD 1AE6H 3T2OA 2FR4A 1FZMB 4QRUB 1LK3H 1A6ZA 1IBGH 1H3VA 3N1QC 4ELKA 1MRCH 5LCVH 2X09A 1A0QH 3VJ6B 3VXOB 3DX6B 1FN4A 1NH6A 3GUTA 4NZRL 1BVKA 4WUKH 3WJJC 2QV2A 5TQ0L 3SHSA 2DYPA 3VXME 4I3GA 5SWSB 2RCSH 5JORA 3MUHL 1Z0MA 1G7PA 5L6YH 3T0EE 2GEEA 4JDZB 5EBMB 4AQOA 1T7ZA 1X5HA 2B4CH 5INCB 2YPVH 3A6BH 3PQYB 3ZKXB 2VABB 3U0PB 2IALB 4DJMA 1FH5H 2JCCB 1OTSC 4JFZL 1JV5A 5IHBA 2OTWB 2VUOA 4Z78B 2VDNL 4RCAA 3GMPA 4IOIB 5GSRB 4L3EB 3VJ6A 3VXOA 4J1UA 3FO9A 3CZJA 5A16A 4NN6B 5FKPA 5DFTA 2A73B 4HC1L 4R7NB 2BSRA 1B0GB 3GGWB 3L3IB 5IJKA 4QRRE 1LO0L 2RHEA 4ACPA 1F6AA 4MQ7B 4PBXA 2Q7YB 1BGXH 2YK1H 1U3YA 3KPTA 5DK0A 2XACC 3GJFK 2XKUA 4Z7VE 3HZMA 4WI9A 5CINH 4XVUC 3PWVB 2WUCH 1FL6A 4GG6A 5E2VL 4PV8B 1Q9KB 5CMAB 5KS9E 4LGRB 4PPTA 5EZIL 5DEGB 5C0BE 3F6LA 4U1KA 1MHEB 2Y06H 3CFCL 4TSCH 1P4IL 4KUCD 3GI9L 1CWVA 3WUWA 3KLDA 3VG0L 3MJ8A 1G7PB 4HPOL 3NCJH 4NM8L 3STZA 2XNAA 3PDOB 3RIAK 1R24A 4PGEA 3CC5A 5J13B 2R2HB 4MVBD 1KJ3L 2E7HA 1C08A 4OJFH 1ZTXH 2AXJA 4M62H 5IB1B 4F7MB 2C7UA 1WZ1L 3SE4A 5SWZB 3LKOA 4KROD 5CZVH 5TDPB 4OZIF 1KEML 2E7CA 2DJSA 1CG9B 4X5XA 1FCGA 3EYOA 1HH6A 2DI8A 5E8EA 5JDJA 1SQ2N 2CPCA 3T04D 7FABH 3F7VA 3MOBH 4XX1E 4QOKA 4S1QH 4PUBH 4ZPTA 2EYTB 2JJVA 4WUUD 2IMNA 4LLAA 4G8IA 3PWJA 4LKXA 5JNYB 2N7BA 3LVEA 4MA7L 3IS1X 5C2UB 2R1WA 3SJVB 5C9JB 4ZSOA 5D1QD 4L3EE 5EO1A 5HJ3B 1DVFB 5KN5B 3H8NA 4U1NA 2FLRT 3F7YA 1EZVX 1ZANL 1AP2A 3WFZA 3RHWF 5EDXA 3LKRA 4NN7B 1JYVA 1A4KB 1T22A 5EPMB 1JF5A 3QQ4B 5EZIH 3IETB 3EOTH 3LQMA 2R1YB 1QRNA 5BV7B 5ADPL 5I74C 4DUWA 4TVPH 4HZLB 1JGVL 1A14H 2CKNA 2EICA 2APXA 5T5NF 4LCWE 5JQ6H 1A02N 1IGFH 1FO0L 3X14B 3EBAA 1T0NA 1S5HB 3SO3C 1MVUA 4OTXH 1BBJA 1IM9D 1P84J 2VLLA 4TQEH 1KJVA 4MAYB 2VQ1A 4XPBL 1T20B 4NRXB 4Q9RL 1KFAH 1TPXC 5D5MA 3VD3A 1T22B 3D25A 4HPYH 3LN9A 5TFSH 4KDWA 1DSFH 1XR9B 4MX7A 4NHCL 3JWOC 1S9WB 5DC4B 3TH2T 4F37K 5C0DA 4JDVA 5E2UH 5C0ND 2X44D 1K5NA 4D2NA 3STLB 1QSVA 2HFEA 1S7XB 1PZ5B 1PKQE 2ADGA 2EDOA 5EIVA 5FYKU 1D5BB 2YUWA 1A7QH 2CLZB 2NY1C 4MB3A 5KANG 4YFEA 2OZ4H 3BGMB 4IOFC 2VLKB 1T66C 4KRPB 5ALCH 2EKSA 1BZ7B 3BD4A 3BH9B 3OAUH 2LVEA 4HGMA 1UM6L 4TOYL 4Q0XL 3SE4C 2FL5B 3D25B 3GI9H 4FQXA 2DOCA 5SWSE 1A9BB 2DQFB 5FO8A 1BFVH 1CS6A 4H25A 2E8ZA 3MRMB 4LOUC 2EDTA 1PX3A 4Y19B 5DR5H 1MI5B 1G7IB 1PY4A 5CGTA 3I02B 1RZFL 4NYLB 4CVZB 4JFDD 4G80A 1EMTL 3DLQR 3ZTJH 4Z5RB 1J0YA 3P0VL 2YWZA 4AYFA 1XIWC 5BJTB 3MRIA 5KVDH 2Z92A 1MFBH 1LD9B 4LFHD 4XVUD 3T0BA 3MNWA 5K33A 3QHTC 3MZTA 3VDCA 3ARGC 1NCWL 3TN0A 2MCG1 4N8VB 3SGDI 1AKJD 2H1PH 3EW3B 3KPSB 3OPZH 2MKWA 1NFDF 3H7LA 3ZKQD 1MFBL 5F44A 5T3XE 4M7KL 1JUFA 4OFYD 4UT9H 1M4KA 1P7QB 1CE6A 3OKEA 1D9KA 1VADB 1YN6B 1OF2B 4UIMA 2VR9A 3H3PL 1MNUH 2AV7A 2DS4A 4KJWD 4OAWA 2H8PB 1B0GA 2GSIA 4PJ5A 3VFSA 5I17A 2BXYA 2ZJSH 1LEKB 3QAZB 3EO1A 2HWZL 2BNRE 2VWEE 3GSQB 2OP4H 3MPCA 1ZGLP 1BLNA 1TJIH 5ACLA 5AYQA 4AIOA 3QNXA 4HV8B 5DMJB 1B9ZA 4R2GB 3SE9H 3ZT7A 3IXAB 3IU3B 1IGCH 1K6QH 1RZ7H 3QBTB 2OL3A 3FFDA 1BECA 4R4BA 5E56A 4MD4B 1QKZH 1OF2A 1BJMA 4BKLB 4XP4L 4P3DB 3T8XA 2AQ1A 32C2B 3KPNB 3Q6GL 15C8H 1CXLA 1MIMH 4PJDF 2BVPB 2AJZB 1KLGA 2HVJA 4AM0A 4L5FH 3NH7L 4JM2F 4HC1A 4TSAL 3HE6B 3FQXB 2D9CA 4JZJA 2FATH 1A7NL 3FQRB 2YEZA 5KSAB 4F9PA 1R3JB 3PIQB 4MNQD 3IDMA 3BZFB 2ZP0T 4PJEF 3HS0B 1X9QA 4U1JA 2V5TA 5CCKL 1K4CA 3OXSA 1RK0A 4YDJA 4OF3A 3PWVA 1XGPB 3HRZA 3WXWL 3DETD 3SDXF 1YYLH 1B6UA 5D72H 3N1FC 1TPXB 1KIQB 1KJMB 1RIUH 4LDLB 1S9YA 3DSFL 4YE4H 3U1SL 5BV7H 1AQDB 5H37G 5CBEA 2RJMA 1NEZG 5DA4A 3L5XL 4XAWL 1U8NB 2EE9A 1F4WL 4NWTH 1S7QA 3L6FA 5ICYB 4M7LT 2P8LB 3T3MF 4WHYG 3C8KA 2WUBL 4JKWA 1YNKL 3MUGB 4XVTH 1MLCA 1A1MB 3D18B 4NKMA 4R7DB 2FB4H 1OAKL 1VCAA 3L3KB 4PBVC 1AIFB 1CZ8H 1KJ2A 1JWMB 3O11B 5T1KB 2YA1A 1I9RL 4LMQE 3ISWA 2ICEB 2ID5A 3WFEL 1JRHH 4DTGH 5DUBA 1ZVSB 2AEPH 3LKQB 2B39A 4OSUL 3MYJB 5HHNB 3DV4A 5DMIH 1XIWB 1OSZB 5HYJE 5E99H 4NCC2 1FZKB 2VDLL 4JDTH 5C3LD 5F1OB 3FRPG 5F9WC 1YECL 1RK0B 2BVUA 1K9TA 5D7KE 4E0RA 5GSVA 5DD6B 3O4LE 2HT3D 5SX4I 1UXWB 4YH6A 4OGYL 4V1DB 1G7QB 5F1KC 4PJ8A 4O58H 4J1UB 2CKBA 1WGOA 2GK0B 5DJ8A 3IDGA 5CIPH 3SGJC 5DS8B 2VDLH 1Q0XL 3STLA 4X5LA 3ULUF 1GIGH 2ZSVB 1AFVH 5CD3B 5IJVB 3HE6D 3D18A 4NKMB 3OKOB 3FFCB 4HIJA 3NMEA 2LFGA 2VDML 2HJLB 4F7EB 4X98A 3RWHA 2AQ3A 3MR9A 1SY6L 1NFIB 3V4UH 3KS0H 4R26H 4FQHB 2NY4C 4G42B 5LGKA 2DQEH 2DYPB 1FJ1B 2V9QA 1IQWH 1WFOA 5FGSA 3P30H 4FTVB 3MLZH 3T4YB 3VFGL 5DJDA 1C5BH 4BH7B 3X3GL 3FOMB 1R5WA 3NCEB 5D5MF 3CFDB 2DM2A 2YPKB 3I2CL 3BAEH 3DECA 4P2CG 4PJCE 2V9RA 4TNWF 3V4UL 3G5ZA 4UDTA 1ITBB 1DQJB 2I9LB 5D7IE 5HHXL 5BZDA 2SEBA 5IFHH 5E24E 5GRWA 4ZO7A 3TCLA 2D7PA 4NN5C 3QWRD 1KJ2H 2DLFL 2G2RB 4WEBL 3FO1B 4WI8A 5HI3D 3BGMA 5FKPB 4NN6C 5FGBA 1DEEA 1P9MC 1J05B 4G9FE 3LHPH 4MXVE 4R0LB 4HGKC 1ZHLB 4QHLA 4RBPK 1T1ZB 2MNUA 3RY5A 3TN0B 5CILL 2NY5L 5HYQA 1VERA 1HHJA 3ZE0E 3SJVD 2OS7A 4X6EB 4XPGH 1JGLL 3QCUH 4KFZC 4NQCA 1T66D 5KSUA 4X7SH 4K7PL 5DEGA 1S9XA 4X9IA 2CIKB 2R0WH 5C6TH 1JK8A 8FABA 4J3VA 2XY2A 2RBLA 1RK1A 3IDYB 2RR3A 3P9LA 4XNZC 4J8RB 1YMMA 5ALBH 3Q3GB 1Q9OA 1QSED 1OT2A 3U4AA 1XFPA 1T5XB 4QHNB 3DYMA 3U36B 2PW2B 4PTTB 4R4ND 5DJCA 1XGYH 1UENA 3HHRB 4LIQH 4Y4HD 4YFLI 1S5IH 3KLSA 1DQMH 3EFFB 5JPMA 1FDLH 2ARWA 3ULUD 4QOKE 4PJXA 4OZIA 3PWUA 3QO1A 5KSUB 4PJCF 3IJSA 3QWOB 2YUXA 1TITA 5FV2A 3WCYA 4JPWH 4KJPD 3W9DB 4EN3C 1B90A 2ZSWA 2HFFA 3KPSD 5KSAA 4BZ1L 4PY7A 3TIDA 4WFHD 5I1AA 5H94A 1RHFA 3IRPX 3PP4H 4QHMB 5HVFB 2H32A 1QPXA 4RBPH 1QRNE 4P23D 5IVOA 2VZTA 2AXGA 4S2SB 5J11B 5KAQF 1CFNA 3SE3C 4KRLB 1Z3GH 4EIGB 1FYHB 1XCTA 3MGAA 4QTIL 4G8GE 4KMTL 3E6HB 4X0KA 1X44A 3MREA 4M4PA 3ABZA 4BZ1H 1IFHH 4ONHA 4LF3B 3QH3B 4F8TA 1IKNC 5J8OA 1EJOL 1H8OA 5DVNA 1D9KC 4L3EA 3L5IA 4H0GA 2P5WE 2QSCL 1HN1A 5T1KD 1S7WA 1LO4H 4L1DA 1D5MB 3I6GB 4Y2DC 4JY5L 3BH8A 4LRNH 1BVLA 4WTXA 1NANI 3BZFA 4U1IB 3VFGH 2DAVA 3PQYA 5AAMA 4W6XB 3ES6A 5FUZL 2GI7A 4TTGA 4FRWA 1AHWB 3TEUA 4E5XB 5EBMA 5I71C 1LK2A 1K2DA 4PJIA 5IIEB 1JWMA 3O11A 2BJMH 4JY4B 3P0YL 1WEJL 4HIIA 2C3VB 4CNIB 3E2HC 4I1NB 2YZ1A 5JOFB 3DMMB 2AK4B 3QWOA 5DHXB 4L4TB 4I5BB 4MDIB 4MD0A 1NEZB 5TE4H 1JN6A 3GMMB 3KHOA 3UYOD 4G5ZH 3ZDXF 4U6TA 3QRGH 4BQ6A 4HKBB 1H3TA 3TA3C 2D0FA 4PRHA 4JZJC 3RVVC 4HEPG 1CR9L 5CHNB 5FGRA 3KWWA 4OGXL 3GRWH 3MRCA 1OSZA 1F2XK 1WZLA 5F7FA 4OCWH 3WIIH 2YUZA 3RY4A 2QR0A 4Z7OE 4P59L 5EZJA 1IZKA 3A6CH 3RUGF 3GSRB 1JPTH 1VGKA 1J0IA 4HQQH 1R5VB 1VPOH 2FIRT 2AEIT 2IQ9L 4XTRD 1C5DA 2NY1D 3JWDL 1MCDA 3LRSA 5SWZD 1UQSA 4KDVA 3V6FA 1H9VA 2EDWA 3C6LB 1EIBA 3RZWA 2NXZD 2BHYA 3D3VE 4LCWB 3DUSA 3LEVH 3MZGB 4HLZG 2EIBA 2BX5A 4KKBD 3H42L 3QEUB 5CD3A 3TO2A 3SDCB 4OM0H 3HLAA 3VWJC 2OK0L 2XPGB 5IR1B 4WFHE 3BWAB 5DWUH 3TBTA 4QLRA 2F54D 2DKUA 3RPKA 2BMKA 2GQHA 4JFFE 4HJJH 1L7TH 3QPQC 4Y1AE 3V52H 3SBWC 1YEKL 3QXVA 5IMMA 3KLAA 3QIUD 1UJ3B 4BH7A 4K7PY 1EHAA 2HRPH 4MZ3A 3VFRA 1G1CA 4WHTA 3ARWA 5KSAD 4HKBA 3MV9E 1U93B 1HHHB 3VXUE 3X13A 2VDQL 3ZE0F 3SKJL 4RQQB 2OYPA 3IF1B 4TSBH 4ZG1A 3IRZA 1AXTH 4OKDA 3UO1H 4U1JB 1CL7H 4JZNA 4R3SB 2WLYA 4JM4H 5HHPB 2FGZA 4P2QD 2PO6B 4JQIH 4G42A 1DBAL 5D2NB 3IDJB 1N2RA 3MV7E 3ZTNL 2BDNH 1P5VA 4LBEA 2YPLD 3U0WH 3UZEA 4Y19D 3QUZA 3STBA 3G5YB 4MSWA 1NL0L 4K8RH 2HLAB 3U82B 3UO1L 2I60H 4YNYA 4JM4L 4HULB 1A3QA 5EO9B 3OBAA 4R90H 3ZTNH 3ILPA 1P1ZB 3BVNB 2FR4B 1CD1A 1W8NA 2AI0H 4NM8H 4JZNB 5EUKB 1QHPA 4ZUTA 1WT5A 1JGVH 1EFXA 1EXUB 1P2CB 2FO1A 1XCQB 3VMPA 1IC7H 2YMXL 1A9BA 3RWIA 1D9KD 4RISL 3NZHL 1HHHA 1KJ2L 1PKQA 3VDAA 2DL9A 4MB4A 2L4OA 3QRFM 2R2EB 1ZVHA 2AJYH 4ZS7H 2ITCA 3C5SB 3VGBA 2OQJA 4NQTA 3FZUD 4JAMB 1YQVH 4H88H 3KLHD 4LHUB 3IAGC 3GMLB 4X6DA 2PXYD 3OZ9H 3VFPA 4I4WB 1U3HB 1KPRA 3PP3H 3OB8A 2HA1A 3TNMB 4FQCL 4MA7H 3VRJA 4CMMB 4IMKC 3N1MC 4ZD3L 2WBJD 4IRJD 1LDSA 3Q2CA 3QUXB 4X6BA 4OQTH 3C8KB 3HG1D 3GSWA 2GSGA 1MWAL 3CIQA 3U2SB 3GDBA 5I15H 5CD5C 2O5ZH 4RFEA 3GMQB 3O41A 5HHQA 1I8MA 2PXYC 1HNFA 5JW4N 3B83A 4YK4B 4OI7A 2C5DC 4PG2C 1YEJH 4ZFGL 1KB9K 1WZ1H 2K7QA 1A0QL 4R96B 2A6KA 2WIMA 4LSQL 3U9PL 1LEKA 4R4NC 3QH3A 1GGUA 2BOCA 3BMVA 5T1MA 1HSAA 3ARGD 5MERA 1PBYA 4OGYH 4CJ1A 2ENYA 5JQHC 3ZYIA 1INEL 4XPFH 3O6FA 2XTJC 4LSTL 4QCIA 4YHKH 4PB0H 3HZVA 1MJJA 4OLEA 1R24B 1XGQA 3U7WH 5IB2A 1VA9A 4X6FB 2VDOL 3H9HB 5D7JC 3SQBA 3BGFB 3I75A 3VXQB 2DWEB 2HT4D 4AL8H 3RGVB 1HQ4A 3WFHB 4RA3A 1TMCB 1SJHA 1YMME 1UYWH 2AJZA 1CBVH 4HWUA 4HKXB 1MRCL 5EU6B 5LCVL 4I48B 3TCLB 1FIGH 5CEZE 1QQDB 3PWPB 3ARED 5IROA 5E1HB 4ZAKD 2W38A 1HSAB 5CFHA 4Q6IA 2DLHA 4DZ8B 1MJ8H 5FKAA 3QDMA 4M8QA 5MEND 4LCCA 2IFGA 4NKIL 4TNWK 4ONGH 4KV5E 4LLVB 4P2OB 4Y1AD 2BRRL 3ALXA 4IDJH 3D1MC 1G6RL 3QJHA 3ZE2F 1G6VK 1KCKA 1HIML 1MPAL 5J9PB 4WU5A 2WBJB 1OL0A 3ARFD 1AXSA 2FBJH 4OFDA 3HG1B 4GW5A 4NWUH 4MQXC 3S34H 1X3DA 1WV7T 4G9FA 4MDJB 3LHPL 4OLWH 3CZFA 3VI4F 5D4QA 3IVKB 4JFHE 1BBDH 5GIRA 35C8H 2Y5TA 3KPNA 1CGUA 2HFGL 1LEIB 1DQLL 4X6CE 1WQVT 5EG6C 2B1HH 1YEFH 1ACZA 1P7KB 2Z31A 5IVXA 1U58A 4ZOBA 1SM3H 5IM7B 4YHKL 2ZUVA 5LG1A 5C6WH 3O9WC 4WFGD 1WT5C 4QOKD 4RMVA 1BF8A 1S9YB 4PJXF 2K7PA 1N8ZB 1UXSA 4LMQI 5IHUL 5D2NE 4NKQB 1AI1H 3V6FB 3TPUB 4POYA 4H20H 5I1CH 3RZCA 4WO4B 5B39A 3CDGA 5TDOB 5JTWA 1LDPH 3TV3H 1IEAA 2FSEA 3QCVL 5CJOH 5HHOB 1GVIA 3DARA 4HK0A 3DHJA 3X14A 4BSVB 3C5ZA 2GFBB 4LSVH 1I7RA 4M62L 4F7MA 2E27L 4U49A 3FQTA 3P4OB 4NFDA 3G9AB 4EI5B 5JHDB 3CSYB 3RL1B 2EKSB 1EEUA 2BK8A 2IAMC 2VLJD 5EWIH 3SDCA 4GAJL 2VIRB 2NXZC 4BH8B 4PGZA 1XZ0B 2VKWA 3FB6A 3K8KA 1OLZA 1IM3A 5EC2B 3D2UD 1DQQB 3F12B 3MV11 3S8WA 4MQSB 1B3JA 4K9EH 4P9ML 3MV01 1C16B 4C55A 4UAOC 3MXVH 1BOGB 5HYJA 3H9SD 5DSCA 3AREB 4EN3A 1S9WA 4QGYA 4IIQB 2Q3AA 2XYCA 2Q6WA 1IGFL 3SKOB 3REVB 4OLXH 5D7IB 5TF0A 3IGAA 3QIUC 5I19H 2E9IA 1IT9L 4ODUB 2GUOA 1WWWX 4OCNC 3SDAA 5KTEL 5KSBB 4TUKH 5EUOA 1EUUA 1T7WA 2VAAB 4JG0L 2DWDB 4MHHI 5IHZA 3CLFL 4LHUD 5MI0C 4ODVH 3B5HA 2I9TB 3F7PC 2EDXA 5FK9B 4JRXB 1R0AL 3TT3L 4HLJA 1WAAF 5GGVY 4JHZA 3G5XB 1G7MA 5EORL 1U8OB 1E6OH 3B9KD 2IGFL 2YC1A 4DZBB 2JELL 3U4BH 5HJ3A 1BAFL 1U9KA 4MCZA 4FG6D 3DNKA 3TNMA 3L5XH 3HNSH 5C8JB 3BKJH 4LHQB 5A3IC 3KPRE 5EBGA 3WIFB 1M71B 5JMOC 2QTEA 4KI5D 4U05A 1U6AL 15C8L 1MIML 4P4RB 1UGNA 4JN1H 3K1KC 4FZ8L 4BH8A 2AJXL 1MVFA 4DKDC 1T0MA 1I7TA 5GGTH 4LAJH 1NMBL 4ZXBC 2MQ3A 1IEBB 4HH9A 5HY9B 5LWYL 4ZUWB 4FFYH 3IFOA 1LE9B 4XP5L 2APWA 4Y4KA 4PRPB 4FQ1H 4ZO8A 3DHMA 4AENB 3O4LD 1IAOA 2CMRH 2QLVB 4J4PC 3BUTA 4LRIA 25C8L 3EO0B 1HCFX 5E2WH 3T0XA 4WY7L 3HI5L 4JFEE 2R23A 4U1SA 2AGJH 4S1DD 5F3HB 1ND0A 1URLA 1J87A 3EYFA 5IV2A 5D93C 4QY8A 3FJTA 2H2PC 4P2YA 5EU6D 5I66A 2DTSA 5E8DH 2YSSA 1JYWA 1C7TA 4FN0A 1XF5B 3FO2B 4ELMA 3H7BA 5GGQH 2CDGA 1A6WL 2IALA 3ZKMD 4L3CB 4NP4H 4KV5F 4L8SB 1HQ4B 4X4ME 4YBLB 2VLRA 1XR9A 1NMAL 3TA3D 4TNVK 3QJFB 5D1QB 1IAIH 3P3YA 4B7LA 1BVZA 4PR5A 4OM0L 3QA3B 2WP3O 3VD9A 4N1CA 3B8SA 4PP1D 2X1XR 2YD3A 2QQKL 2YPVL 3A6BL 5F3HA 5C7XL 2VZUA 2CLRB 4ORGA 4LASH 5J12B 2BNQA 5F9OH 5HGBA 3B2VH 3DX6A 5FB8B 4QHNA 3N0PB 2Q86B 4DEPB 3ARQA 4FZ8H 3S3SA 3IKCB 4R4FH 4YFLF 4FP8L 1XCTB 5J12C 3UJTH 1RUQL 5DGQA 3GMOA 4Y89A 2F54E 1K8DA 1R3HB 4MJ6A 5C08D 5IHUH 1YY8B 3FCTB 5I6XC 4W4OC 5J1SC 5FFLA 4JR9L 3EDEA 4I3SL 4ODTH 1X6LA 3QA3A 3IDXH 3VGFA 5GSRA 2BVOB 5FUCC 3MODL 4OAWB 4GSDL 1YPZB 1JV5B 1L6XA 4GKSA 4M43L 1KLUB 3QPQD 1IRAY 4YHOH 3IDNB 5JW4R 1I3UA 4PJEA 4TPRL 4WFFD 1D6EA 4HUXA 1LO4L 5JUEH 5D1ZD 1WFUA 2VLRD 1PSKL 2FO4A 2P5WA 1LMKA 3G6JB 2O5YL 3KPSA 3NIGE 5IVXB 1JWSA 2FJGA 4NFCA 4JZOA 4NRYB 5D1ZB 2V9TA 4LSRH 5D93B 4FQIH 4KVNL 2R2EA 1J8HA 4LPXA 3FAXA 1NAKL 3UBXB 1BM3H 1A7RH 4XNXL 1J1OL 1NJ9B 1DANT 3DWTA 4U6HB 4ZNCD 3T2NL 2JIXA 3DGCR 4FABL 5HHOA 1G7LA 1JPGA 2MPAL 1F8TL 1EAJA 1MLBB 4IMLB 5B39B 4QTIH 3CDGB 5TDOA 3MRLB 1HYSC 1JGUL 2VYRE 3DV6B 5JDSB 2ZUTA 4QWWC 5I1IL 4XNXH 5T1LA 4UOW0 1QYGH 5F7KC 5KVGL 3WFDL 2WZPD 5F7DA 4YDJB 1ZA6B 1R3IL 2NW3A 4U0RB 2C26A 4Y2OA 1UZ6E 2HMID 3GJEA 4P4KA 2DLFH 5K9OA 5EH1A 3LS4H 1CF8H 2HKFH 2VN7A 1ZLVH 1KLUA 2WW8A 5DR5L 1G6RH 1N3NB 3NIFF 2Q8AL 3C6SA 2MFNA 4YDVB 2P8MA 1L0XA 3MV8A 3QI9C 4JAMA 5BRZA 4UTAL 1T4KA 5E9DE 4J3OC 4QT5B 5DJ2B 3KXFE 3E6FB 4E41A 5BO1L 5CEXB 1TZHA 1RMFL 4X7SL 1M7DA 4MJIA 4N0UB 4F7TA 3MCG1 5B3JF 4WHTB 1A7RL 5L2JB 4O58L 4WW2C 3HZYA 4GT7A 4YR6A 4IIQC 4MWFA 4FQ1L 2JIXB 4K71B 1ONQA 1IILE 3JV0A 2AEQL 4QRTA 5GGRA 2HT2D 4Y5XA 4KJPC 2IAMD 3CPLA 4HWNA 4TOYH 5B8CC 4XXCC 4EN3D 3ESUF 3X3FH 1SJVA 1JNHA 4OZGB 4DZBA 1KB5B 4C56E 4PJAB 2DQUH 1DE4B 3CLEH 1AGEA 3RWGB 2NPLX 1A5FL 2ADFH 4XPGL 3OKNA 3BPNC 4JFYB 1JRHI 1OD7A 4YWGH 3S3JA 1HKFA 4PYHA 4YBHA 1N2RB 5KOMC 1VKXA 2IAMA 2VLJA 2HG5A 4JPVL 2CUIA 4WDIA 2A0LC 2VXQL 5I8CB 4G8GD 2PR4H 4XCYB 4XMPL 4LPCA 3MNVB 4XGZA 5B8CB 2BSTB 4PFEA 5JXAH 4OJFL 1B4JL 4Y0GA 4PJHF 3QDJA 3SBWA 4K71C 2FH6A 4IJ3C 2R8SH 2EDRA 3RVTD 1MWAB 5DQJA 2IFFL 2XFXB 1CFVL 5L0QB 4Z7UF 4PD4K 3EJZD 3D85B 1JK8B 8FABB 9CGTA 2QHRL 4JPIA 1NPUA 4RX4D 3UTQA 4NKDB 2X4SB 5I1LB 3JUYA 1NC2B 5D70L 3RQ3A 3RAJL 5H37H 3ZT5A 4LIQE 3I50H 1HXYB 1YNLH 4G3YL 3DUUB 2ZSVA 1MCSA 1FZOB 4FQQB 3BSZH 1SYVA 5DS8A 1VACB 1VFBA 2ZNXA 1KXTB 3QJFA 2Y5EA 3UROR 1AGEB 1ZANH 5E95B 2YOCA 2FBOJ 4GMSH 4OZGA 4XBEH 4F33A 3ULSA 1QBAA 3H9YA 3VFTB 3VFWA 1H3UA 2VZOA 3EYVA 2CGRL 5DHVH 3MTRA 3WNOA 1BLNB 5C0FB 1MFEL 3RI5F 4P2OC 3BSZL 3GBML 3RIFF 1IC5H 1QD0A 4YHMH 4ENED 5GGSA 1BAFH 4JANA 1B2WH 4KPHL 4Z0XA 4NT6B 1RI8A 2CR6A 4ZUSB 3T4YA 4Q97A 4X6DE 1F11A 4IRJB 4YHIA 3RDTC 1CFNB 3NABH 4ONFL 1S8DB 4X4YA 1DN0B 3O3BA 3TFKC 5KBNC 4KQ4L 5FO7A 3RGVC 2A6JA 1KPRB 5EN2A 4O2EB 4S11A 1KCVL 2DMBA 4FQPA 4MNQA 3GEWB 3BPOB 1EEZA 1NCNA 4G9DB 4NO0B 4P9MH 1HXYA 3ULUC 1V7NL 2YS4A 2P5EA 1FG9C 3MGTA 4QNPF 2R69H 4NO5B 4XX1G 4HCRL 4U1GC 3T0AA 1SEQL 2EDHA 3FFCD 4NWTL 5IUSA 2BY0A 3OTTA 1C5DB 1U8LA 4H26B 4MD5B 2AJSH 4WWKD 4U0QB 5HBBA 3VGEA 3SY0B 3TIEA 2DQUL 4PREA 1OOAA 5EOCL 3G6DH 5IW6A 1TJHH 1Q9OB 4K7PX 4XMKH 4YWGL 1KPVA 3PWNB 5IVZA 3RWEB 5C0GB 1L0YA 4UILH 3A6CL 1NFDE 1RJYB 1CTOA 4ZXBA 1I9JL 4P3CH 2R9HC 2PYEB 3RL2A 4NPYA 5ANMA 4P46B 4GRWF 4O5LL 3U1SH 3OAYK 1U8JB 1JTTA 1FAIH 5FIEA 4DEPC 4U6XB 4XBGB 5BXFB 4M02A 2A9NL 1XGUB 3L95B 1NGPL 2Y25A 2DRUA 3NZ8A 4OCXL 1D5ZB 1TCMA 3UBXA 5F1SA 4ONOA 5IR1A 5KVDL 4UT7H 2FJFA 1AGCB 2YZ8A 3O8XC 5HDQL 2KDGA 4JFED 1DDHB 2PXYA 3VE0A 3QUYC 4MNQB 3MO1A 1U6AH 4MX7B 2VDOH 2R39A 2IANB 5DQ9B 1MHCA 5D1QC 3HA0A 3DX8B 3HAEB 1N7MH 2OR7A 3LD8C 4YUEL 5F1NB 4JRXD 3VXTB 5JDSA 4L3AA 3RY6A 4DGYH 1HH9B 3IFLH 5IROC 1AE6L 1K8IB 3H6JA 1QLFB 4L8CB 3CCHA 2DJUA 1MCIA 2H6PB 3P11L 4YHPA 2UZIH 4X0KB 2VERN 1CD8A 2X4QA 3MLTA 4LAQH 1PLGH 2GY7B 3BPLB 3IJYB 4OLXL 2VXSL 5I1GL 1YQ2A 3LRGA 1E4WL 4PJFF 3V0WL 1R3IH 3UTPE 2EH8L 4F58H 5EZLB 4JKPL 1BX2B 1JGDB 5IBUG 4I3RH 3F7YB 2NY4D 3QEHA 1RIHL 4M1GL 5HXMA 1JNHB 4HIIB 2GJ6A 2ICWI 1I1AD 1DQDL 4OUUB 2ZCKH 4GAJH 4KJQC 3K2UL 3SDDC 3QULB 2VZ3A 1NFDB 3WNNA 1A22B 3ARZA 1NCCH 4C4KT 4Z6AT 1XCQA 1PYWA 4WWKB 4Q9QL 3RVTC 3QHZH 4GBXA 1PFCA 1BQUA 3BOVA 3MXWL 3BWUC 2I9LA 4GKZA 2X1QA 4EUPG 2NY6B 2HJKB 5IK3B 2Q20A 1NANH 4ELME 2K9UA 2FYYB 4M1DH 4CVXA 1BREA 1RY7B 5MI0B 4ORGB 2PTTA 1ITCA 3VWJB 4Z76B 4CVWA 3OL2A 3UTSD 2LU4A 4M5YH 2F54A 2Z4QA 2AAVA 2VMFA 3LS5H 3MJ9L 2NQCA 4JY6B 2CJUH 4X6EA 4LVNB 3ECBA 4NZJA 5CP7B 4M1DL 3BKMH 2CK2A 3AREC 1OM3H 4ZOAA 4O5LH 5JA8B 1DTUA 1MIEL 3QPXH 3SDCD 5GGVL 2BVOA 4OQTL 1YEHL 4OFKA 1XH3A 3QSKB 2FHFA 2XRAL 2O5ZL 1S3KL 2HTKD 2DM7A 1JWUB 4DKAA 4PJAE 5I75C 2UWEF 4WEUD 2LTQB 2JB6B 1PG7W 1NEUA 3MFGB 5M94B 3GK8L 2MPAH 1UWXK 4WI6A 4PTUB 4WV1A 1F97A 4BUHA 2AJYL 2P1YA 4ZS7L 4ZAKB 4Q58C 3DMMC 2OTWA 3WNLA 2XG4A 2R4RL 1FNEB 1O0VA 3O81A 1NUGA 3P77A 4JFEA 1M71A 3CGTA 4QRPD 5I8KH 2OTUB 4CVUA 2Y36L 1FL3B 1X6NA 1QFUH 3O9WB 3O45A 4EDXA 2OMNA 4MXQC 2ZUUA 3PJSB 5JZ7D 1ZLSL 3L3DA 3MOBL 3K80A 3PL6A 2IH3A 1Q0XH 3BN9C 1RUKH 2PYFA 1MJ7L 2DQJH 4XNQB 1CFBA 1ES0B 4U4BA 1BEYL 3AS2A 4J4PD 1I3RB 4PTTA 1NGZA 5FHAH 4LF3A 3HNTL 4K7PH 4MXVF 4ZTOH 4BZ2H 4EI6B 3ARFA 1VFAB 3E6HA 4IRSD 1YUHA 1ETZB 1GRWA 4L3ED 3RUGE 1IGYA 4XCFL 3VXUD 3TBYB 2VDQH 4FQJL 4UBDC 4Y1AA 4I0KA 5DTFA 4OQ1A 1Z9OA 2CQVA 3UEZA 2LAAA 4IM8A 1UM5L 5BS0D 1KXQE 2H2PD 3NFSL 5CJBA 1QSFA 5CEZL 5B38B 5CLTA 3RVXD 2R2HA 3CVHB 4C56B 1CGVA 3A0OA 4QHKI 1ZE3C 3W5MA 2AJ3B 1HHKB 3PABB 5L9DH 3HR5B 4LDOB 5C07E 1JHKH 1IAMA 3BP6B 4AG4H 43CAB 1L9MA 1JRHL 3D69A 4OZHB 1OHQA 1E27A 1HXMB 2AEPL 5CIPB 1JZ6A 1AXTL 1P7KA 3GIZH 4NQXB 3FRUB 4IOSD 1TVHB 3C6LD 3UTZA 4QCIB 1U8JA 2DQEL 4PYGA 5F9DC 2HT2C 3KHQA 4Y4HA 1IL1B 4ZFZA 3TNNB 3I85A 3IDYC 1O5DT 2E6PA 1RZKC 1N8ZA 1UXSB 3MLUH 4PJGF 4UMGA 4KRPD 5CKGA 2XTJE 4NRZB 4M9OA 5SV3A 1MHCB 3L5WB 5T5NG 4NNXB 3VFTA 1DDHA 2PXYB 5EOQL 3VE0B 1N64H 4O51B 1NBYA 3TN0C 4M8QB 5HYJB 2WMPA 1KIPB 5EC1A 5BVJB 5AYUL 5DRNB 3PHOA 5DO2C 3DBXB 4UB0L 1KJ2B 3UBXI 4TYUA 4G8EB 3T1FA 3V95A 3KPMA 4EDWH 2NY5C 5KSVB 3L3OA 1PSKH 3KG5A 1TNMA 2A83A 2IANE 2FIKB 4J12A 4G6AD 2PTUA 3K0WA 2A6JB 2F5AH 2J6EL 4OZFA 3LMJL 5DJYB 1FFNB 3LKNA 1FYTB 1UEYA 4RGNE 2EIEA 3LRSB 5HGAA 3MLXL 1T03L 3OGCB 1QVOA 3BP4B 4FXLA 4KY1H 4ETQB 4LCCB 3VDBA 2HRPL 1ZHNB 3GRWA 3QIBC 4HS8H 4TUOB 2NY4B 2GUOB 2I07B 5L88H 4JFFA 3HPJB 3V6OE 5JW5A 3E6FA 3QIWC 1FFOB 2PUQT 5IMLA 1G0YR 4NWUL 5ESVB 3QULA 1RZGA 1ADQH 3QQ9C 4X4MA 4PRPE 2OI9C 4PRBB 1MEXH 1ZT1B 5INDA 4P4RA 5IMKB 3PWPE 2BC4A 1CDCA 2F74A 4PG9B 4ZUVB 2Z31B 3GZKA 4JY6A 1EV2E 2QADD 5C0AD 3VA6A 5FUZH 4F9LA 4WI2A 5SX5K 2W0KA 4F7CB 3WO3B 2YC1B 1JPFA 2HTKC 5CBAA 5FUOH 1FBIL 2V2TA 2APFA 5BVJA 2KH2B 2W65B 3MRQB 3CVIL 2FNBA 3EHBD 4HFUH 3MA9H 3D3VB 1ZT4B 1NCWH 3O2WH 4WI5A 4G7VL 3K7UA 2ZUXA 1RURL 3QDGD 2R29L 4PRBA 3CFIC 5FCUH 2X4OA 3MLVL 4UU9A 1I7ZA 5E8EB 4KVNH 5KJRH 3MRGA 5MEOB 2DQFA 4KH2A 5FO8B 3WUZA 4DGIL 1N7ML 1UZ8A 2JLLA 4M7LH 2LAGB 2J8UB 2C4FU 1HINH 4RIRB 3UBXG 1JE6A 2F9BT 1FFQA 2B4CL 5BS0A 3NZHH 3QUZC 3D39A 4RGOH 4NJAH 1GIGL 2A6DB 4O2FA 4YO0A 3MUZ1 4X5WB 2W9DH 4APQB 3QEQE 3NA9H 2XZQL 4QXGL 1YEJL 4JHBA 2BC4B 4X80H 1RUMH 4HBCL 4QHUB 4LSQH 4N8VA 3ROOB 1KB5L 2EH7L 5GRJL 3G6JF 4NO3B 5J6GB 5C0EA 2Z8SA 2OJEA 2YPKA 5C0IB 1U8QB 5CUSL 5E08L 3N1GC 1FNEA 1T7YA 1S7TA 5DJ0A 3JV5A 1ZLWK 1J86A 4WUUE 1A3RH 1BF2A 2FEDD 4UV7L 1AGFB 4KU1A 4Y4FC 3ULSB 4QRPA 4NKOB 1KTLB 1YMMB 4JR9H 1P7HL 1IAKA 3HFMH 3BN3B 3WSQL 4XPBH 4JZJB 2HMIC 4ZNEE 1JF1B 3MACH 3HE6C 4HH9B 4N90D 4OZ4A 3QUXA 4S1SL 5C0BD 1JZ4A 4UINL 1F4YL 2CUHA 2F53D 4WCYH 3TH4T 3RPIB 2EDKA 1EEYA 1G9MH 1BJ1J 4JZOB 4NRYA 1TCRA 5D1ZA 2VXTL 5LXGL 2UY7A 2YA2A 2DWEA 5HPOA 1EEQA 4QF1A 1OP5K 1S7XA 3QI9D 4KQ4H 4QGTA 4PJXE 1NGQL 5FO7B 5J06A 5KVMC 3MRHB 3W0WD 4O2FB 5AWNH 1TNNA 3EOTL 3IDNA 3I6LD 2WBKA 3W9DA 5E6IA 1EH9A 5GJTL 5C08A 4LCWA 3UDWC 4K94C 1AHWC 3R1GL 4CW1B 1BX2A 1RFDL 5FYKE 5CLWA 4I0PD 5E5RB 3VRIA 1FG2A 4HF5H 4QYOA 5DK0B 2ORBH 2V7HA 4HUUB 4PRNB 1B88A 5HI3C 2VRAA 4LOUD 1W72B 2PR4L 1CE6B 4MS8C 5TGBB 1T21B 2PKDA 1B2WL 4W6WB 4LLQA 1P9MA 5A16B 1YMHB 1TLKA 3EJYC 4YGVA 5E8NA 5C07A 43C9B 3P4NA 5DD1L 2IQAA 3UJJL 4NQSB 1JWUA 1NDGA 3MBEC 1MCEA 3N85L 1C08B 5D1XB 5L9DL 3RNKA 3NCYS 3C09B 2DQHH 3P0GB 4H5SA 5FHAL 4F2MA 4PRAA 3QG6A 4EJ1C 1KT2B 5KZCD 4RAVA 2XNAB 3PDOA 1GZQB 3MUGA 3EFDH 5CZXC 3QRGL 5CP3H 2C3XA 5FECA 1CDYA 5GGTL 5T5FH 1JPSL 3V52L 1OP9A 2OQJB 3QZWA 4AT6B 4QRQA 4P5MB 1WCBB 3BKCL 3O2DA 3H2WA 1I7UA 3DOSA 2DQDL 1V05A 4GG6B 1WSST 3WV0A 3CSPA 3DX9A 2W9DL 2DIJA 4DTGL 2JJUA 1J5OL 3EDDA 4P99A 1G7QA 4GXUM 3EJJX 3MLYH 5AWNL 3KAAA 2GJ6D 1RZ8B 4KZEH 5CS7A 5CEYA 4P46A 2C9AA 4BFGA 4LHUG 4K9EC 1ZHBA 5E94B 3EIFA 5J0BA 4KKLD 1DQDH 1IAII 1HCVA 2NY3D 4HUUA 4PRNA 1XF2A 3BEVA 3IS0X 1LO3H 3HMXL 5ACZA 1MFAH 3OSKA 2GITA 3VXSA 3DPBA 1NGZB 3C9NB 5IB5B 3RWGA 3DMMA 4JM2A 5I8KL 2A74B 4CNIA 1FJ1A 2IF7A 1RIUL 5DSCB 2YWYA 3WFBH 4LAQL 5D9SB 1WAAE 1QR1A 4GW1B 2AXFA 4Q7DA 2IANA 3KNBA 4HWBH 2X70A 5K59F 3MC0A 5HI4C 2Z0BA 1KPUB 4PJDB 5E00A 1A47A 2HT4C 2XIDA 3AY4A 1C12A 3MOAL 3C60A 4UT6H 4FA8A 5GZOD 3OQ3B 2MOVA 4EI5A 4ZFFA 4YHNA 1O7SA 4R0LA 3OG4B 1FQ9C 2VLLB 2RCSL 3LZFH 5C3TA 2BNRA 5DJ6A 1EMTH 4Q9BA 4KXZH 1F02I 1AI1L 5E2JA 5AZ2L 3HNVL 4PS4H 2YUVA 5C71A 2I9TA 3UC0H 3FB5B 5E1AA 4XGZB 1QRNB 3O4LB 3QQ3A 4GBXB 5EOCJ 1HHIA 2DQGH 3AB0B 4KTYA 2C3GA 3HMXA 5DRXB 5AAWA 4NQXA 1GXEA 3FB7B 1UT9A 2VSCA 1CLCA 2HFEB 5JUEL 2FEEI 3OKYA 3MBEA 3UPAA 2DQCH 4PJEE 5ENWB 1DVFC 3NFNB 3HZKB 4OLWL 2NW3B 2FB4L 4PV8A 3WIFA 1P4BH 3HPLB 1CCZA 3MACL 5FO9B 1JNLL 4JDZA 3F5WB 1EHLH 1B0RA 4PJ9A 1VGEH 2KQMA 3UMTA 4NNXA 2FDBP 3MA7A 3QXAB 1I9IL 3I6LE 4S10A 1OVZA 4FABH 3LSOB 3OKMB 2R29H 3RVXC 2FRGP 3WIIL 1FRGL 2NX5D 1MQ8A 4HDIB 1F42A 3DO3A 3FT2B 4MA3B 2ED9A 5DD6A 4YC2C 2A38A 1XGRA 1P6FA 3PDGA 2OMBA 5F9WB 4WW2A 5JO5B 1OWRM 1RUAL 2HT3C 3BIKB 2VXQH 4H8WC 3RWCB 4XAKD 5KW9H 3QR2A 3OG6B 4NO3A 3ZDYE 3BPCB 1KN2L 2MHAB 4HBQA 3VXUB 3EJZC 3KR3H 3DURA 1OT1A 3BDYH 3MNZA 3OB0K 1WISA 1IGML 3CNKA 4J3WA 4NBYB 1A7OL 1UYWL 4XNMA 3L3GA 2R0LH 5DD3L 4M5YL 3MBEB 5SV4A 3D87B 1U8HA 1A6VH 2XTJD 3WD5L 1UM6H 4HIJB 1AXIB 2CH8A 5E7FA 4PGCA 3O2VH 4RGNB 3AB0C 1MHHA 2APVA 1ND0B 2ZUSA 2F5AL 5C70A 4F3FB 5ID0A 1LO2H 4GSDH 1FFPB 4HHAB 4OT1H 1XGUA 3L95A 1N64L 1RULH 1FO0A 1HDMA 2D0HA 4P2RD 3B2VL 1PEWA 1N0XL 4R96A 3QDMD 5MENA 1NGYA 3CH1A 3CU1A 3F65A 3QCUL 3DVGA 2BVQA 4DKEL 3ARFB 2CIKA 4FP8H 3G08A 1QFWI 3NGBB 2WQ8A 1Z2KA 3GMMA 4YQXL 2D03H 5IESH 4RX4A 1NC4A 4HAFA 4HWBA 4D94A 2C1OA 4X6BB 4QO1A 3UYRL 1OAQH 3RP1A 5HYQB 4EUPB 1IVLA 3OX8B 2FX7L 3DETC 4D0BB 3KYNA 3LPGA 2VQUA 4LSDA 3MNZB 5EORH 3U9UB 2XN9D 3WJLA 4K3JH 4IRZL 2EYSA 3NZ8B 4HCRA 4DQOH 1EGJH 5TPWH 4PJXB 4ELKB 2X41A 4P49A 5TH2A 4KI5C 3OV6A 1J12A 1GPOH 1UB5B 4U6VH 5D7IF 1HHGB 2X2YA 1YUHB 3KPRD 5CEYB 5A43C 1WTLA 2VNCA 3AMLA 1G0XA 2DQIL 2BOCB 3BJLA 4KJYB 3TGXA 1AR1D 4XVTL 2A1WH 4R2GC 3U0TA 1HQRB 2PETA 2EC9T 3ARBD 2ATKA 1K8IA 2CSPA 1A14L 3WMSA 2XA8H 3NACH 2X9WA 4NT6A 3OAUL 4H25B 2Z8RA 4OD3L 1EZVY 1TZGH 2VO5A 5DEZA 1LHZA 4XBPA 5EU3A 4R90L 5I0DA 2AGJL 1C1EL 1MUJB 3GNMH 4UT7L 3SGEH 4P57B 2VDMH 3RWDB 1KCVH 2DLEA 2GHWB 3GKZA 1LEIA 1FLRL 4U1KB 3L7FB 3EOBB 1SEBB 3IVKA 3HI6L 4PP2B 1NDMB 2D7QA 3V5DB 1G7MB 1MCRA 5DRNA 4GG6F 5I66B 4P3CL 1U92B 4MA8L 4OD1H 5DURB 1FAKT 3IU4H 4PJHA 3QCVH 3LQAH 4Z76A 1IC5L 3HI1B 3SN6N 1BJ8A 1OB1B 4MXWL 4ZYKA 3L7EB 2Z35A 1JYXA 4GJTB 3RU8H 2DQJL 1MJ7H 1VENA 3CK0H 5CWSA 3ARBA 3OJDB 4OD2B 5IW6B 1RZKL 3RX8A 1TJGH 3UX9B 3DMMD 2EZ0D 5FDWB 4P4KD 4ZUWA 3ULVD 4FQ2H 1YEDB 1RZIB 4HT1L 1KENH 4U7SA 1E4XH 2PYED 4XI5D 4PJDA 5E00B 2GJJA 5D5ME 1F3JA 4UINH 3VRLF 3KNBB 3WFDH 4KK8D 4HIHA 4MLSA 2HKHL 3FFCA 4OZIE 1V7NH 5MENE 4LEXL 3L1OL 2J88H 2APBA 5EIIB 1P84K 4KUCF 4OCYL 2VIRA 3NBNA 3QQ4A 4DKEH 1YYLL 1T2QH 2R56L 5J1AA 1QEWA 1ORSA 2BVYA 4M48H 5IESL 3QQNA 5I8OH 1Y0LA 5IQ9B 4Z7QE 3IXTB 2Q7NA 4ZS6D 4MWFB 1U8IB 4FXGA 2A6IB 4AIZA 4XAWH 5DYOB 4BUGA 3T3PE 1A9EB 3FKUS 2YRPA 4JKPH 4WEMB 4C59B 2V2XB 2P5WD 1MCLA 4JO2H 4KJWC 1MWAA 1ZSDA 1VEMA 2FZ3B 1A7NH 1JL8A 3WS6A 4UOJA 1PG7H 1OTSD 5HHME 1WBYB 5HYSB 4MAYC 4XXCA 3VMOA 2J6EA 1WCBA 5I8CA 1UJ3A 2EDYA 4NQVB 3SO3B 3ZTJG 1MY7A 1VEOA 1VKXB 3ZDZE 3ILQC 4YEEA 3RUGB 3S96B 3TZVA 1LEGB 4DK6A 5BV7C 1U8HB 5C08E 5LAXA 5IQ7L 4NC1C 3P0YH 2OR8A 3FTGB 3FO0H 3TC9A 3TLRA 1H3GA 3EHBC 4YDLB 4DW2L 3T8XB 5KS9A 1YNLL 3NN8B 2YXMA 2YKLL 3QISA 3RA7H 2P49B 4DVBA 3VI3F 4LARH 3ZE1F 4ZO6A 2XZQH 3HRPA 5IVNA 4MJIE 2WLZA 3RWJB 1U91A 3UTQB 4HJJL 1FNLA 2QSCH 4EOWH 5SX5H 4ODVL 5DJCB 4PRHD 3FL7A 2B20A 4WEBH 3IFPA 4WHCA 3CVHH 1NGXB 1PY9A 3P73B 4N8VG 1Q38A 1WUNT 1PLGL 2OL3L 1OCWL 1KIRB 3MCLL 5EO9A 1RJLB 5LGHL 1NJ9A 1P4BL 1MCOH 1KBGH 5GGVH 1VPOL 5J3HD 5ICZB 1FVEA 1MH5A 3QDJD 1A3RL 1EVUA 5SWZE 4HKXA 5EU6A 2A73A 4AH2B 1M6OA 1IM9B 4IS6B 2R2BB 2BNRB 2UV3A 5AD0A 4UQ2B 5DRWB 3OR7B 2DLGA 2GTWB 3P30L 3U7WL 2UUDH 3MCLH 3W39B 1F58L 4L1HA 2OI9B 3B9VA 2Q1EA 2ZCLH 4PGDA 5CGYD 3IJSB 1OQOA 4BQBA 3O3BB 4LSVL 3V5KA 4LVHC 4DGVH 3T0EB 5IEHB 2BVQB 4OCXH 3F7QA 5F9JA 4JRWA 2AI0L 3BO8B 5DMGC 3R8QA 2FEDC 5EBWB 3ZDXE 4BQCA 4OFVA 5JPNB 4LPVA 3VFNB 4YBQD