1I82A

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with cellobiose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
b'MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i82A00
2IVFC 1I8AA 1I82A 1I8UA 1UG9A 4JPQA 1ULVA
chains in the Genus database with same CATH superfamily
2TSBA 3QK0A 4IRSC 1KYAA 3SKNB 2CM5A 1QLEB 3O3AA 3F84A 4G6FD 1VGEL 4I3SL 4Y4FD 5I8CB 4ZOCA 1U3NA 2CHWA 3ZRFC 4YVNA 1LILA 1GPOH 4IIQC 1TR7A 2CO4A 4UQ3B 5BRPA 3GHEH 1MJ7H 2R2HB 3OM3B 3DYMA 3H9ZA 4FNUA 4JRXD 2XETA 5HHNB 5B21A 3NEOA 3VI4A 4RGNB 4XNMA 1TO5A 1UWXK 1W8NA 3HFMH 5EOCJ 3HZMB 2YAQA 2JWYA 1NOLA 1NIEA 5C0GA 2XV2A 3NZ8A 4JFWA 1UB6A 3Q8AA 4N0RA 3FULA 3QP3A 4IU2A 2P4AB 4Y8DC 2I5YL 4HS3B 2R9HC 3RVTD 3T8VA 2QQKL 1NLBL 5HHPA 4JFPA 4ZNEE 4S1DD 1HSAA 4DTGH 4F37K 5KYYB 3I6SA 3BH9A 2QHRL 3L4ZA 2V37A 2Y7LA 3P4LA 1HWHB 1AO7E 3LQAH 3G6AB 3BXNB 3V0HA 1JCKA 1KYOK 4WI4A 3VH8A 1HH6B 4PJCF 2IDUA 4XX5A 3UTZA 4P2AA 1SXBA 1T6WA 2V9UA 4X6CB 2R69A 4XPHH 3FQ4A 3BO8B 5I1DA 3C6LB 2H2SC 2NRDA 3BAXA 1CD1A 3J2PA 2CGYA 1OP9A 4OZIB 3IDIB 2X70A 1MCOL 5FHAL 3CK0H 3B9KD 2P8MA 2P28B 3QQDA 4PG2A 5LAXB 3B9KB 1YC7A 1U21A 3TVMB 4ZFFB 5A2KH 1ZS8A 4MBOA 3B2MA 4Y1TA 4YE0A 5FCUH 1HL8A 1UURA 4PG2C 1RIHH 5EZJB 3TV3H 4JFQB 4Z7OF 3OZKA 3VSUA 4CBZA 5KBPA 3TFKD 3MNDA 2WCGA 5DUBB 4HJIA 4HKJA 4NJ9H 2EIDA 4PJHA 5C7XL 2IFFL 2A9BA 4OF5A 4PIRF 3AXHA 4HLZG 4HVBA 3FB5A 3GF8A 4GBXC 4HAGA 1XGUA 3INUH 3BMVA 1JNJA 1GH7A 4I18B 4CVXA 1LE9B 3IKCB 2XV0A 3RJOA 4R4NC 4TSBL 2EP6A 4Y9CA 5GGVH 2EE9A 1QUNB 4NAQA 1QVOB 2X2YA 1GMEA 2XNAA 3UBXI 1YMMB 4DETA 4KRMB 1RZKC 5KVDH 1YQ2A 3H6JA 2CD0A 4U33A 4P2QA 3U7YL 1NCTA 2OSXA 5FYLE 1ZIAA 1BDYA 3K8MA 4CVZB 2H1PL 3QISA 2BK8A 1CN4A 5FAAA 5TQ0L 4B7IA 3DX1A 4WUKH 1CUOA 5J11B 5I6OA 5L2KA 2BS9A 2MOGA 2WLIB 1CFMA 1UXSA 5C2UB 1OCWH 3QHTC 2E9WA 4GQRA 5BVPL 2ZF8A 5BQDA 1V3JA 5E0FA 4I48B 3CC5A 4M6AA 4ZFGH 3LKNA 1H3WM 3HR6A 4B9IA 2NCEA 2ZOKA 3DC0A 4IDJL 4NQDE 2VMCA 1YNTA 2IDFA 2AHIA 4DO5A 4G83A 4RAUA 5AVXB 4N6RB 2BP0A 3MFFA 5FYLH 2AFNA 1F00I 2ZE0A 4XMKH 5E2UL 1WWAX 2APWA 5EG6C 3FO2A 2B3IA 3HE6C 3SDAD 3MRFB 3R06A 5E4AA 1RCYA 4G71B 4U7KA 4BQ9A 3QO1B 2OMWA 5HDBF 1AGFA 3V0DA 3L4WA 3SO3B 3CN3A 1BV8A 4MMXB 3DMMB 3TOPA 3FFCE 1S46A 2WZPA 4HKBA 1ZY9A 1JF5A 2HKFL 4XBPA 2Q8AL 5ICZB 1IBYA 3KPSD 1NAMH 3QUZD 3CX5J 5F1IA 2G75A 3LRSA 5TF1H 4JB9H 3N91A 2CR0A 3OG6B 3G6JE 4QAWA 3QXUA 4JQVA 5DEFB 3WMSA 5I8OH 2GUOA 3ZQXA 2WVTA 4BZ2A 3ARXA 3BHBB 1BGXL 1EEQA 4PEEA 4PRHB 3LOWA 1SDAB 2IEPA 12E8L 1OT2A 5ABZA 1RK0B 1J1OH 3QFJE 2BOBB 1A2YA 2HFEA 3GIZL 4NWUH 2R56H 2VLJA 2E6QA 4BBWA 4XVOA 4F8QA 5BMFL 5HXMA 3EFDL 2I9LB 2NY5L 4JQXA 4LL4A 4GUCA 1NFDB 4PRPE 4UQ3A 4YIQB 1L9MA 2YQGA 3Q06A 1T7XA 2WQXA 3QB7C 4AQAB 1DN0A 5H37H 1FNGA 4BUHA 5AW6B 4P4KD 1SUJA 2BSRA 3PYCA 4FC3E 4GIPD 2J55A 2NXYC 1RPUA 3DRTA 2G4GA 3QWRA 4Y9EA 1DO6A 5LAXA 4PJIE 3L2NA 3TT1L 3GLZA 5DCCA 4WHYG 2DD8H 2MHAA 2XVLA 1T2QL 4KI5F 5DHVA 5JUEL 2ZXAA 3COOA 3LZOA 5E8NB 5F6IC 4YFLF 5E5MA 1S8DA 4LCIL 4QRUB 4O2FA 1NICA 2CZNA 4LAQL 4K5NA 3F7YB 1VESA 1E4XL 2H5UA 1PLAA 4WWKA 1E4JA 1JVLA 3LKOB 1LNUA 1WT5C 2BSDA 3B8YA 4YDKH 3SE8H 4OAWB 3NRQA 2JH2A 4QKTA 3RWEA 2VUYA 4JG1L 2UWEA 1YG9A 1I9EA 4L8DB 3I85A 3BO8A 4MA3B 2OJEA 5HYJE 2OSLB 1HCVA 1XIWA 5CLXA 1KXQA 3NAAL 3WTTA 5GS0C 4Z76A 1V3KA 4LLMB 3Q5TA 4KY1L 5LGYA 4Y5VC 1XX9C 4NB7A 1YEIH 1S7TB 4CBPA 2WO3B 3IS0X 4N90D 3GK8H 5DVOA 3DGGB 2G9KA 4MDJA 4RESB 5IK3B 3DARA 4YXHH 3RP1A 2CRZA 1KIQB 3UZQB 2O5XL 3O3EA 3SDDB 4M61B 5A2AA 1CF8L 2WXNA 2XTLA 2J8UB 4HQQH 3DKHA 4N0FA 5D72L 2JKNA 2VR8A 4UNVA 3PRZA 4HZLB 3NJXA 4NYLB 5DQDH 2ZUQB 1TXKA 2E7MA 2GSIB 4H0HB 3VXQB 3WIFB 1M6UA 2J6EH 2OXHA 1GVIA 2YAOA 4YQXH 3JTBA 3ZUCA 3GMMB 3Q2VA 1UT1A 2YD7A 3P3YA 5FM4A 1MELA 1ZANH 5HGBB 4QJ5B 3GRGA 3JVGC 4YSAA 1IARB 3MLTB 4HJJH 5H35B 4AEHL 3B2UD 4JFYB 4N0YH 4FQLH 3TLRA 3FU9A 5BS0E 3KLSA 4PN6A 4NUGL 4YZFF 4CVZA 3MQIA 2X4SB 4TQIA 5FUCE 1DL7H 2VH5L 4DH2A 3ECVA 1NCDL 1E6OL 4KTDL 4RX4A 2AI0L 1MHPL 2LU5A 4JKPL 3SDXE 4DP0X 1KLUB 3FT3A 2EVHA 3S37L 3PE9A 4KMLB 4YSPA 5BZDA 1PD1A 2H41A 3JWNH 2V17L 2VWEC 4M5YL 4Q6IA 2NSXA 3W11C 1ZHLA 5HYSA 4GRLC 4U1NA 3VXRE 4M8UA 5IHZA 5LBSL 3ZMRA 3PDOA 3WELA 1NCHA 5D96C 2ORBL 1OPGL 1KTDB 4FQJH 3PXLA 4PY8I 5JOPD 1T03L 3FRUB 4OIFA 1ZHKB 1FZKA 2NY6C 2W88A 5TD4A 3AQXA 3GI9L 3LHPL 4I13B 4UTAA 3GSUA 2P1YA 2XN9D 5HD8C 4NRZB 2GK0B 4ONGH 3ISRA 3QFJB 4WJG3 4GRMB 1AGFB 4W9DC 1NAKH 1UCTA 3RWHA 4ZTOH 3NTCL 5AW1B 2IGFL 4N8UA 3CU7A 5ICYA 4DCQB 2VL5A 3GS7A 5CO1A 3BLBA 3ELQA 3R18A 3N04A 5TK4A 2K1MA 1E4KA 1SOXA 3ZE0B 1AGCA 3VFNB 1XH0A 1E9QB 3IJSA 1DQJA 4LSSL 4BCZA 4G8AC 4ZMXA 4PV1C 5DEFA 2O72A 1AZNA 4P4KB 4W6WB 1YYMH 1LM8V 5HVWA 3BVDB 3K4AA 4NEHB 3PJSA 2X10A 3KGTA 3LS5H 1XSOA 5AKTA 3EBAA 4X9BA 4QHNA 3B1TA 2B59B 4HSAC 1SYSB 2V2WB 2XQBL 5DFAA 1Z3GH 4PLJD 4JM2A 5FUZH 4NBZB 2DAVA 4AQAA 1CXEA 1AQDA 1TTFA 4OB5L 4JN2A 2Y7MA 3DRQA 2AJUL 1AKJB 1L3NA 1FAKT 1QPKA 1SEQL 4PJHF 3ZX1A 2A7BA 5AD0A 2QFRA 3LD8B 3KPSB 1G7QB 2A3TA 2F7QA 5F7FA 4LRNL 1KN4H 3UZVA 3HZYB 1SLUA 2M83A 3Q6GL 4X7EC 3OAUH 2QJDA 1Z2KA 1XZ0A 5B4MC 1TZIA 3MMEA 4H88L 3U6RA 5D4JA 3FAXA 4PJAF 1SDDB 4QXVA 3WTUA 3QH3A 3HMXA 1JZJA 5EC2B 1JVKA 2DH3A 1I9RL 2P49B 4MNQB 1LP9B 3KR3H 5DD3L 1KIRA 4HS6A 3U0WL 1CCZA 3MCLH 5D7SH 4BELD 3CG8A 4GMSL 1EEZB 2E6PA 4G6JH 2ADIA 4FA8A 3PFQA 5T1JA 2BFVL 2IO5A 2QSVA 5ERWB 2WWMD 5A16B 4GKNB 1RIVH 4PJAB 3FQRB 1D5BB 1ORSB 4R0LB 3RZCC 3S35X 1IM3B 4Y2LA 3VD7A 1AHMA 2XWTA 1WITA 5ID1B 1KBGL 5IHLB 3PWUB 3Q9PA 2Q8BL 3O6FB 4R7DB 2WNGA 4MQTB 5CZXC 4LOVA 1TDQA 5I8OL 3CSYB 4JPWH 3N43F 1B3IA 4L1HA 3ARBD 2R51A 2A9AA 3KH4A 2BP3A 4A7GA 2A0LC 1ILSA 5LXGL 3C5ZB 5IWLA 1RZIA 4B5EA 1KEMH 1WD8A 4FLOA 1DQML 1RZ7H 4Z7OE 4RSVA 3SDXB 4GKZA 3V6ZA 3VJ6A 3WIFA 5EUKB 3DK2A 3FZUD 3B9VA 1NPUA 3AS3A 4L37A 3H3PL 4LSUH 2Q6WA 3IU3B 1BD2A 2HTLC 4OZHE 5MEND 3NFPA 4OH2A 9CGTA 4J5VA 1I75A 3UIYA 2XG4B 4BFFA 3QDGA 1GTNA 3U2JA 3QCVH 3BWSA 1HINL 1A66A 1DVQA 3AY2A 1ZTMA 4HKZB 3VGDA 3C2AH 4HGMA 3RVXD 2G9HA 2VAAB 3ULVE 3QQNA 3KPOB 4W9LC 2B39A 3REWA 2NPLX 3JZ7A 3PWLB 2V8MA 5I75B 4ES9A 2G3MA 4LIQE 1WAAF 4NO3B 4ZS6C 2BVPB 5KSUB 1YYML 2IOIA 1J9RA 3WKML 4UQCA 1BFSA 4X9IA 1U8NA 3IS1X 5ELIA 1TTCA 2CLRB 3LX9A 4A04A 2F8XC 3WCYA 3CZUB 4NQTA 3JTSA 4L9LC 1GRWA 3QRFM 4PRIA 5I16B 1GYWA 2BHZA 3AJ7A 5KSAC 1ND0B 2D7NA 1XSJA 1A6TB 1ILUA 1L9TA 2P8PA 1DANU 3CFTA 4PJ9B 3UYRL 1U8HA 2ZXEB 5TDPA 3V0GA 4XXWC 5GRYA 2Y6TE 3B4NA 3H7BA 4HCRL 4N0CD 3NPZB 2AGJL 1UD8A 2P5PA 1Z66A 1HHKB 3ZUNC 3DA0A 4X8GA 1FL3B 3NQIA 4B9GA 5F96L 3S36H 1RVFH 4AXWA 3OF6D 2DBLH 3QUMH 2H0JA 2W92A 1SN0A 3PNWA 5IEKB 2WWKO 5K9KA 2G2RB 3IGAB 2VDOL 1PNCA 3QJXA 1FRGH 3J7HA 5EOCL 2UZIL 4OV6F 4WFGE 3IRCA 3KHOA 1RK0A 3NIGE 3QQ9C 4C56E 2DD8L 4JRXB 1ZXQA 3H55A 4FI6A 4G3YH 1H3PL 1T22B 2D3NA 4FAAB 1ET7A 3FU5A 4I0PB 2X88A 3KXFE 1G5GA 3VWKB 5INCB 3MRNA 2IADA 4GP4B 4P5KA 3F01A 4G8EB 2VQUA 1ZT1A 3ARDB 2JJTC 2VM9A 1MAML 2B3RA 4BE5A 4KOBA 3B2XA 4GW4A 4IM8A 1LQBC 1YDPB 5I71B 1A14H 1N0LB 3V4PA 2ZX5A 1KGXA 2XTSA 4G7SB 1VPOL 4X6EA 3A6BH 3WFHA 4MGXA 3BVXA 3C08L 3EFOB 4CSPA 5EWIL 1IC7H 2F5AL 2FT6A 3S98A 2VLJE 5C0FA 4M5ZH 4NKMA 3KLAB 2K3HA 3QUMA 3TEWA 5AW5B 1KC5H 4LSPH 3KJ6H 3A5VA 4N0UE 2YZ1A 4JZNB 2WLNA 2VDKH 3QXAB 4LPCA 3T4YB 1TT6A 1I9JH 3MMEB 4G8GE 4JFFA 5T1KD 4P23D 3N85H 2XN2A 4UZUA 4QDGA 4DGYL 4LPVA 4WGWB 3F58L 3WBDA 5DGRA 4AK2A 2C4XA 4ZT1A 4ODTH 5ANME 5IVXF 3DTUB 1ETZA 5D7HA 1FO0L 1XL4A 3BKCL 4WK4B 3NFPB 4ONGL 4YK4B 5C3LD 3H8NA 3ZZ1A 4IRJA 5TE6L 3LNDA 4WI0B 5E7FA 2CRMA 3MLSH 4QNPE 4WCYL 3QZPA 4ODXA 4ABQA 2CLVA 3BIBX 2WUCL 2CUMA 5C09D 3OVUB 4FL4C 2WANA 1XH2A 2HN7A 3KPNA 4D9RE 2H32H 2WKGA 3NPSC 3QZWA 3WHE0 2XG5B 3NFSL 4QYOB 2BNUA 3I75B 5FK9A 3IDXH 5T1KB 4KC3B 4P5TB 1WWBX 1S3RA 4M7JH 1J8HA 3EO1A 1BZ7B 4G8FB 2R7EB 3N3EA 3O9WC 1E4HA 4LGPB 5MERB 3UO1H 3S37H 1KMGA 3VXUD 4AIEA 5HGBA 2C9UA 3O2DA 5E6UB 1JPTL 1OVZA 3ASNB 4GMTL 5E70A 4FG0A 4Z7WE 4WV1A 1IGIH 5B39A 1EVTC 4J3OG 2X4OA 2I9TB 4DKFH 2DQIL 3RZCA 2CK0L 3BUDA 1SMOA 5F88B 4JFZL 4UT6L 3SGJC 3POHA 3TGXA 4H4NA 1HXKA 4HBCH 1A6TA 1QBML 2UY6B 4A7UA 2X2HA 4NHCH 1WCBB 2ZXCA 4G7QB 1HOCA 2J88H 3NJGA 1GAFH 5C0CE 2YD4A 3MV7B 3UYPB 3LKSB 1JMZA 5ALBL 3C9NB 3VWKD 4Z7VA 2WKLA 4NN7B 4Q58C 5LNDA 2LR4A 5HPOA 1AC0A 2IGFH 3PIQA 4H8WL 5KZCD 3KM2A 2IDTA 1J5DA 1BEXA 1I3GL 3LDBB 3H3KA 4TNVK 1FFRA 2F0CA 2XZQH 3CDGA 4HXBL 4LFHG 5CD3A 5B1BB 2GFBA 1GZHA 2D3JA 3LEVL 4F15B 5FLVA 5CKGA 5EIQA 2IPTL 3ULVC 3OXRB 1NGZB 1JRHL 2GG1A 4AGOA 2NUPB 4N2AA 4DGYH 1BXUA 2O6PA 2FAUA 4J3BA 4OJEH 3AT0A 1V7ML 2GK0A 1PCSA 3VXUA 2ARJQ 5EUOB 1UENA 3VG9B 1E9PA 1WWWX 3IETB 3ARDA 4Z78A 3JT2A 4H20H 3STZB 4L3CB 2G5RA 5F7NC 3FT1A 4K7FB 2EINB 4WW2B 1OTSD 1U30A 1ZDSA 1ADQH 2VERN 4Y19A 3AWFA 4MMZA 5DZ9A 4KJPC 5GQBA 4GSRA 1E2ZA 2DQGH 2QPSA 2YPLD 2HPOA 3ZGHA 4FLSA 5B38A 2CHXA 1PVHA 5IKCA 2OI9B 5DMKB 4HGWB 1C16A 1JNLL 1OP5K 3EYUH 4LLYB 2JLPA 3RIAK 2X4QA 4DP2X 4PJ7E 1HFUA 2WBJD 1JPST 2ITDA 2BVEA 1LO3H 3D7PA 1XAKA 3BP4A 4DERA 4IRZA 3VM5A 3BX7C 5D1ZI 3MRRB 3GKZA 3L1EA 2J1ZA 2O5ZH 2VR9A 3L5JA 1KCKA 3TNMB 2VZ3A 1PG7W 3C6LA 4DO4A 1F58L 1XGYL 4PGCA 1MQKL 1XMEB 3WGVB 1RERA 5CS7A 5F7DB 4UT9H 3VXME 1PFOA 1ZLSH 4QRTB 3VX0A 4F9PC 3TJHC 4JPIA 4H0LC 2B9AA 4OCRH 3W3BA 1TNNA 3HMXH 3OQ3B 4Y8AA 3T1FA 2YLHA 4OCSL 3LQZB 2VZOA 3FO0H 4K7PL 3FOMB 5DWUL 1C5DB 4NQCB 5DUBA 4PJBE 4FNPA 3L48A 1IAKB 3D18B 4NERA 5KJRH 4RGMB 4XCNA 3HRZC 4TVSa 3EIFA 3QH3B 3FF8A 4HSCX 2V3DA 1MJ8L 5I9QC 3B2UC 1MDTA 1X6LA 4EI5A 4KV5F 4FXGB 4YHIA 2JJTA 1JNHA 2E76C 4S2SA 2IDQA 5HYJA 4CVUA 2ADIB 2Z7UA 4WO4C 2KUTA 1YHPA 3LEVH 3BUTA 1J1XH 5ERWA 2GYSA 2Y4SA 4GXVL 5JHDB 3UTTB 5C8JB 1D5XB 1W8OA 4HEME 3O6MH 3OKKA 5HTSA 1E90A 1MCOH 4MYPA 3HG2A 5F88A 5DS2A 5FHAH 2JJSC 1LD9B 3GB7A 2OMNA 4YH6A 3RNKA 1BBDH 4I0CC 2OTWA 4C57C 3MODL 4P2OB 2MMXA 4FQXB 5L8KB 2UXVA 1PU0A 2AQNA 2EYSB 4KI5E 1GMIA 2EQDA 2WQAA 1RULL 1U0QA 5A2IH 4DP8X 1Q72H 3HPLB 4PJIA 1U8IB 3APCA 2R27A 4ZUSA 1D9KB 4NJAL 4ZAKB 3QYMA 1K8IB 3H85A 1TJHH 3OTTA 5CINH 1WT5A 2HMID 3TNNB 2P80A 2EYTA 3GBMH 4NWTL 4P5TA 4BKTC 2L7UA 4JM0A 3ULSB 5FIEA 2WMPB 1X4XA 2BSED 3JV6A 4JFEB 4KQ3H 2EKJA 4Q74A 1ZEAH 2ZKYA 2YPVL 4ERSH 4U05A 4DKTA 1HH9A 3MV8A 4WV1B 5B39B 1JYVA 1E5YA 2XNAB 2HJKA 3FO2B 1A3QA 3AMLA 3NIGB 4QHUB 1MFUA 1A14L 2DLGA 1E7VA 1TO4A 4PJGB 4F7TA 4JK0D 3GI8H 3UMNA 5F2FA 1P53A 4K9JA 1HHJA 1MCNA 1WC7B 4GI6A 1JE6A 4PB0L 4DAGL 3DXAA 4XPGL 4W9FC 1UH2A 1NBZB 1BHGA 3WEMA 2AQQA 4I48A 3BKYL 5BW7C 2NY5C 3HFML 4FJYA 3TZVB 5MEPB 5IKCB 1YNTB 4XB3A 1S9YB 3DX9A 3HHMA 3N1MC 2DI9A 4TTDC 4DESA 1INDH 3JVGA 2JJVA 1UEMA 4JMXA 1UT9A 4ZMVA 2YPLE 4DOHE 1A6WH 1DCLA 5E6SB 2GFBB 1INEL 3QIWA 4EXPX 4OLWL 1RY7B 1TLMA 2XX1A 3CSGA 3E1F1 3PAVA 1CBJA 1X7SA 5E2UH 4V1DA 3S4SB 5IB5B 2K6YA 3SB3A 4F9LA 2ZCHL 5LQBH 3Q8FA 1XF3A 4TULH 3BH4A 4HH8A 3EYSH 6FABL 3L5XH 4X6BA 3V0AC 2YXMA 4K94L 4PREB 1NOAA 3ECQA 4PJ8A 3PL6C 2BJMH 2Q87A 3BLKA 3MUZ1 4RFOL 3BZDA 5I17A 4APQB 4YR6B 4TUOA 1NCAH 4BKLA 4F7CA 3WN6A 1QHQA 2CH8A 4XO3A 4QHLA 3V52L 4ADIA 4EF3A 1KT2B 1UOLA 3D33A 3O3DB 1R0AH 2W9LA 1MREH 4XOEA 3HVDA 4XI5D 3VI4F 4LEOB 4DO6A 5HI4D 1QRKA 1WEJL 3UO1L 3DXAD 5DUPH 3U7AA 4YN3A 3QEQD 1VFAB 5FYJU 5AB0A 1DJWA 1DLHA 1XBRA 5FUOL 4YSTA 1X5YA 4L8DA 1OWWA 4DP4X 4K3DH 1SY6L 5EF2A 4OVVA 2B1OA 4HUVB 3RTLA 2EXYD 2QPEB 4LF3B 1CXFA 5CZXD 4X6EB 1D6EB 2DWDA 4MRBA 4X5PA 5IJVA 2EIMB 2JTYA 4GT7A 5CJQL 5B1JA 3SDXF 1U8CB 1H8OA 1FH2A 4Q9CA 2MQGA 5I18H 2AXGB 3OJ2C 3O3BA 1LD9A 3I2CL 3N5AA 1QSED 4ODUA 2J44A 4WNQB 1TETL 2PMZA 5CN3A 3OKLA 5GS1B 1RZKL 1S9KC 2I27N 1RV6X 1ZA6A 4YHMH 5FW7A 2YKKA 4OQTA 1S5IH 3SYOA 3UZQA 5JHBA 2Y69B 3MV7E 5EU6A 2NTFA 2NY0C 1CD9B 1NEZA 3GNML 1ZK5A 4UAOC 1K8IA 1TNMA 4PRPD 4TL4A 4RNRA 3WE1A 3OMNB 1TEGA 3I6KA 4EOWH 1KCVH 4JN1H 4LB8A 2PO6B 1CBVL 5CXPA 3UC0L 1UM6L 4JREB 4MNQE 3TA3B 4QXGH 2OSLA 5JHLH 3H54A 3HI5H 1XIWB 2J5LC 4PJXE 4HF5H 4JAMB 3IAPA 1MFBL 4U1LB 3BWAB 1KN2L 1LK2B 4XXCA 4Z7VF 5HGGS 1E4XI 2X3AA 2VTFA 1IE4A 1CK0L 3D4GA 1CFSB 2RFXA 3L4CA 3NJHA 4QF1B 4HX1B 4PRBA 4TL5A 1PX4A 2WK2A 5AVQB 4PJGF 2FD6H 4GRWF 1Y18B 1FNEB 2PUQT 3T0WA 3VWJD 2H2PD 1P4IH 3QIBD 4OIIL 4EI5C 2NDGA 2Z0BA 3BC9A 4UV4H 2C9QA 3RY4A 3JSSA 1D5ZA 2L7JA 5J1SC 3ZQWA 3MUY1 5EORH 2AITA 2IPKA 3DGDA 3HNSH 4AVHA 3BWUF 5HHMB 1WIPA 5DRXA 5IUCA 2GJJA 3QIWB 2YXWA 2WB7A 2PR4L 2UY6A 2Y23A 3FRUA 1J0IA 4P3WA 3CUPA 2F5BL 3B9KC 4AX3A 1IKOP 3ZKSD 2DB8A 3MBXL 3QPXH 2RACA 3ARYA 5EBWB 2VDQH 4IBQA 4PREA 5J1AA 3NCCB 5C09B 5D7LA 2Q20A 1HHJB 4DK5A 3FTZA 1EA9C 2V0AA 2P46B 3MA9H 3CZEA 2H6UA 3L7EB 1A25A 2HKFH 3X11B 3TU6A 1Q0XL 1R34A 2X3CA 4LSQH 4BKLB 4DN3L 2D0GA 4UILH 5DK3A 1A3RL 4S11A 4ZK8A 1PG7X 4Z5RB 1WA2X 4U1NB 2H45A 2VL4A 2P7TA 4JY5L 2J1KA 3RLSA 1BQSA 4Q0XH 4RMUA 3QFDB 1QSFE 4HKXB 4L4VA 1MAKA 3ZRCC 4Z3FA 1GOHA 4IOIA 2CO7B 3SPJA 4Z7VE 3D9AH 3ARDC 2ED7A 2EXYC 1AI1H 3CLFH 3UBHA 3Q8BA 5IB5A 2ICWA 1N4XH 3GSUB 4WFFD 2VJXA 4H7VA 4OZGF 1VACB 2QVKA 3ZGIA 3Q01A 1ZHNB 3ET9F 4QIRA 4L9LA 4LLWA 3NBNA 2DQJL 1QFUL 3FB7B 1ACZA 3GMQA 2QLVB 4ENEC 1USZA 3DJRA 4O51A 4TUOB 5FYKL 4N9OB 3TVMC 2H1LM 3VFNA 2K6ZA 1TQVA 1U2YA 5AG8A 1MI5E 1VZIA 1Q90A 4BKSC 5C0EB 3FQNB 2WTRA 2FTAA 1XZ0B 2CCVA 3CH8A 4O2CA 1YN7B 2V2TA 1EGJH 3KLHC 3RVUC 3BRDA 4BQ6A 5CU9A 4GYBA 5EOCH 3D0VB 3SDYL 4N85A 1OSPH 1YEKL 4PP1D 4D0BB 5HHQA 1RJLA 3CCHB 3SDAC 1BECA 2GI7A 4F33B 1RJYA 5H2BB 5C0AE 4YXKL 3FTSA 5DYOB 1FZMB 2A1WL 3KWWA 5BZWB 4JPIB 4CW1A 3V6FA 5IT2L 3SE9H 5GJTH 3HUJE 5T3XH 2FX7H 1VKXB 1WTGT 1SXNA 3WIAA 1BXAA 5ID1A 3K81A 4NQCA 3ETBJ 2BRQA 4LHJB 2EC9T 5DYFA 3ZRSA 3KPSA 2I25N 4APQD 3BCDA 4JY4B 2HFGL 3OPZL 5INDA 3WNJA 1JPSL 2YSTA 4P2OD 3VO0A 3SBWC 1O7DE 5LBSA 5KN5B 4M1DH 2H2PC 2I24N 5C08A 4FQXC 2QQNL 3DX8B 3NQKA 2O61A 2HT4C 2Z7YA 3O6KH 4YHYC 1SN2A 2VW6A 4G8GB 4KKCC 1OZTG 4M9OA 5HYJB 1N59A 3TIEA 5JHAA 4MNQA 4BJLA 5IJBC 4H8VA 1WBXA 4TVUA 3RDJA 3WMQA 5KYXB 2IFGA 3HB3C 4ZBJA 1XGQB 1YNKL 5C8JA 1D5ZB 1AZRA 3MSPA 2B15A 5CEYA 2X4UB 5F7KC 2MOQA 2QL1A 3SGEI 1HIMH 3C12A 1XF5B 3T0DA 5MI0B 3NCXA 2N7BA 4XMZA 2EXTA 5F3HA 2NT1A 2CJ3A 3BDBA 4NC2B 3C8HA 3EDJA 1K8DA 3ZDYE 2BHYA 3H0TB 1HI6A 4K15A 1RKRA 2VMDA 2P5WD 1UXWA 4OFIA 5J6HB 4FFYH 3OXSA 3QJVB 4Q2ZA 3PREA 4Y7OC 3REWB 1I1AD 1PJ9A 2BIHA 4U0QB 5C0BD 3DMMC 3V4VB 3MV01 5AAPA 2OXGA 5FO8A 1UZGA 5D7LB 2EIEA 3VXTB 1XCTA 3V0WL 4W9CC 4B7LA 1NAMA 1AR1C 2DWYA 4MDIB 1UH4A 4AQZA 3A67L 4U1HB 3OJVC 1ZGLB 3DJTA 2KC0A 1HH9B 3Q8EA 5FUOH 5I30H 4M9PA 4LP5A 4ZMPA 1IMHC 5JIIA 1IGMH 2IBBA 3FT4A 3RWCB 3APNA 3V8OA 4F7TB 3C5ZD 3MRIA 1S5HB 1XH3B 3HE7B 5CU5A 1VZHA 4Y16B 3F65A 3FSVA 4U1SA 2WUBH 4X6DB 5E51A 1PZ2A 5FYKH 3FKUS 4ZAKD 1L6ZA 5AWNL 2VXVL 1BWMA 2WBJC 1YY9C 1J05A 1KZYA 1HKLL 4HIQA 4LLWB 5DFVD 3VFMB 2GCYB 1REIA 2Y25A 3TN0B 2Q7YB 3WDHA 3W37A 1A7OL 1JIBA 5F89B 4Z7NF 1MNUL 4TLKA 1TTGA 3SKNA 1CU4H 2XBTA 2XYCA 3UTQB 1CFQB 3A6BL 4G80A 3WHE1 3QA3B 1T4WA 1X9LA 3IMWA 5C3TA 3GPEA 2PYEE 4A67A 3QZLA 5GSRB 3EGXA 3F05A 2DLFL 3TESA 4O2CB 5E6ID 1LO3L 2AXJA 4D8PB 4L4VB 4DZ8B 1VFBA 1A6ZB 4X6DF 4OW6A 3L4YA 1A9BA 2A73A 2PPCA 4RQQA 5FYKE 4X98B 3TWCH 2VCOA 4RMRA 2AEQH 4KZ0A 1ZT1B 4ANUA 1BIHA 1TENA 3HE7D 1SBSH 2VW7A 3AQDA 3U48A 1EO7A 1IL1A 3DVFA 4IIZA 3RNQB 3LIZA 3I6GA 5GSVB 1KOAA 4J8QA 4BFRA 2R9HD 3RVTC 4APQA 1M7IA 4J3OC 3DXAE 2IJ0C 2K45A 4IU2B 1R5WA 3DPBA 2X41A 3HR5A 3L08A 2ZIDA 4HJJL 5KVEE 3O8XD 2VR6A 3CHPA 4ZOEA 4G42A 4OLXH 5E08H 3CHQA 3BFOA 4HDIA 4KK6C 4WO4D 2E75C 4YO0B 3UBFA 2VR7A 4GSUA 3QXAA 2MKWA 3FQNA 4Z23A 3STBA 1X5ZA 3UAAA 5HBBA 4XN1A 1UWGL 5IGXL 2KLSA 2GEEA 4JKWA 3Q6FA 4EBQL 3UO8B 5I1DB 1DUZB 5FCSH 5C0NC 3IFOA 1KIUA 2ATPB 4J4PA 2IPUK 1Q9OB 3U0WH 3MNVA 1QASA 4L4TE 1J1PH 1J8SA 1QKZL 1R3LB 1X5FA 5A43C 4URKA 2G2PA 3O2VL 4LVNC 4ZFOA 5DC4B 1C08A 4XC1H 3QIUB 4GKSB 1Q0YL 2RTTA 4DQAA 2QADC 2EDMA 2F58L 1NC4B 2Z65C 4GMTH 4M62L 5EC1A 2J8UF 2OMZB 3EFOA 2R69H 3TONA 4W4OC 1FL6B 5ITFA 3EW3B 1G7IA 2VLMD 4LL9A 4NKMB 1HSAB 5KYYA 4MA1B 4XP4L 1JP5A 5INDB 1LO5A 4G7VH 3NJJA 1FO0B 3PHSA 4L1LA 2EDLA 3X1FA 1EZSA 2BZ7A 5LO7A 1EZUA 3I3BA 3KLDA 2FB4H 2FGZA 1EWHA 2QR0A 3LQAC 2X6MA 3O8XA 3WAKA 3HN5A 4MTMA 3VSTA 2D31A 1PEZA 1J88A 3HUJB 4FCHA 4KY2A 2ROXA 1ZGLA 1S7XA 4HIJA 2VDPB 4LE8A 1BF2A 4B6ZA 4IRSB 5F21B 3VD5A 1XVSA 2BIIA 3VGAB 1U3JA 4PJBF 2WN3A 4NUGH 1G7MA 2XPGB 4YDVA 3S35H 3LNGA 3V7MA 4TUJB 4ZO9A 1UXWB 3A4AA 3HFFA 4PV9B 5TFSH 2YGPA 3CLEH 2WHVA 1G9NC 2VDQB 3RVVD 4LEEA 2X1XR 2Y7QB 5MHSE 5AVSB 3ZE1F 3UZEC 3CVIH 1OHQA 1OP3H 4B9JA 5DTFA 1EXHA 3HOGA 4FCAA 2KDGA 1FLRH 1V8HA 1CURA 5KVDL 1MH5A 4OZFB 4LCYA 5JHLA 2IPKB 2QKIB 2VMJA 2FSDA 4J27A 3IWUA 4TVPE 5A7BA 2Y5QA 2ALWA 2LAAA 3BE1H 4GRLB 4RMWA 5A1AA 3WUWB 1VA9A 2CA4A 3ES6A 4IBLT 1TEFA 5TE4L 1WFOA 2G2NA 2JJSA 4P2RD 2WWMC 2YD0A 3QNYA 1F4HA 3B7RL 1XIWD 2Z8WC 4MQXC 1PY4A 3DMMA 3CZNA 4GP5B 3BKMH 4DKAA 3OR6B 2J88L 1JV2B 2B1HL 1QSFD 5EU4B 3F04A 4JNXA 3NIDF 5HYSG 4L05A 1I9IL 1N5YL 1KBWA 1T3FB 2QELA 1DLFL 4RMSA 3KS0J 4UUJB 3ASWA 1MAJA 2K3TA 4OZGA 3WLWD 4G42B 1PZUB 2R29A 4G80B 3BT2H 3MDJA 1T5WB 3S7GA 4FHJA 4R5TA 4KZEL 5D2LE 2ITFA 4XPFH 3R06B 4LLDB 4KJWD 2PP7A 2IIJA 1NC4D 1EHLL 4U1JB 2IH8A 3QIUD 4C83B 2BSRB 3JV0A 4JDEA 5TH2B 3ZMNA 3QIWD 3JWDH 5EA0H 2WWOA 1M3IA 2R0LL 5T1DH 4DQOL 1EAJA 5IOKA 4PJXB 4HIIB 4W9ZA 1XQ4A 2FJFB 4FQLL 5BCAA 2H0PA 2XZAH 4MS6A 3E3QE 2F8IA 4IJ3B 4FFVC 1E2WA 4L4TD 2DTSA 5TE6H 2NNAB 4LLAA 1ZJAA 1F8TH 3KJ4C 5CP3H 4AI7A 3MNWA 4JDVB 3HS9A 2VAJA 1ED3B 2X4QB 2A83B 2HVKA 3FCTA 1E3FA 3QNZA 5T3XE 3VFSB 4YO0A 1NCJA 3CVIL 1LNUB 1SXAA 4LKXB 4OY9A 1DVXA 4XVSH 2H32B 3LB6D 3FHQA 4XNYH 2AXFB 4J12A 1XL6A 4Y4FC 5GHWL 1DBJH 3O6LL 2FE0A 4OM0H 1JXDA 1KIUB 2ATPA 1E9OA 4A2GA 3KVPA 4PRHD 3RE0A 4OTXL 3T4AB 1CGXA 1L0QA 2GITB 1KNOA 3I02B 4UQBA 4R3SB 1ITCA 2EE3A 5EBLB 2EIBA 4AEIH 2AJ3A 1TZHB 3F7VB 4KQ4L 4R4BB 5EU3B 1SJHA 2HPTA 1I1FA 4E0RB 3APMA 2EIZA 3DRTB 4NJAH 4PP2A 2WAQA 4ZOAA 2WB1A 1SHMA 2E5EA 3DTXB 4LXFA 3TBTB 3QCUL 2DQEH 1CYGA 4GQ9L 4HBCL 1JI1A 5EF3A 2KPNA 3R0MA 2BC4B 4XHQA 1MRCL 1D9KA 4HD9A 2YMTA 2FYYB 1N4XL 4XCNB 3UPRA 2QVFB 1RUPH 2YBRA 4NI6A 3W57A 2SODB 1XH1A 3GSXB 1QWNA 2EKSA 8FABA 4P9HL 4DPAX 3GM0A 2WMPA 3JV6B 5E03A 4N25A 4JHVA 1DQQB 3FUHA 1H6FA 1MCJA 2J73A 2OJEB 4OZFA 5HGAA 3WJLA 1R75A 1VERA 5IG7A 4QJ3B 4PWFA 1NGWB 2PN5A 5AUMB 5JHDA 4G59C 5BRZD 1EFXB 2FH8A 4JKKA 3B83A 1O7VA 1ZVSA 3CXHK 3KPPA 3OXSB 4FGMA 4Q2ZB 3HA0A 4ZNEA 4NQCE 3N0AA 5HVFB 2OZ4A 3RPKA 4KNSA 2PXYD 1ZLDA 5MENE 3HLKA 4K7PX 3D39E 3RURA 2J8UA 4N0FB 3DXAB 2I32A 1BFVL 4PJDB 1XAUA 3RGVA 3RZCD 1HX0A 2CJUL 4N1EA 4NN6B 2IH3B 2OL3L 1LL1A 3TM6A 4BFJA 5HPMB 3R19A 3S8FB 2NY0D 4NI3A 3D52A 3RU8H 3ZOAA 1AG6A 4UOZA 1T0OA 4ZDHB 2VDOB 3AWEA 4ODSL 2YEZA 1QMUA 5D7LD 4Y16C 4GKLA 1NJ9B 2XU9A 1T0MB 4LBEB 2PTTB 3CFJB 3OLDA 2D3LA 1OQXA 1UJ3A 3WUWA 3D2UD 3SZKC 2APXA 4LSTL 3NCMA 4OLZL 2XWBA 4HOXA 3FFCB 1A8JH 2FIKA 4HSQA 1E6OH 2VL5B 3F58H 3PGDB 3RWJB 2HG5B 3T09A 4ZMTA 3PQYE 5JUEH 3IGFA 1AGCB 3PF2A 1E9QA 3IJSB 3N44F 2DV6A 1JGEB 1P2CA 5GRVL 5L0QB 1S9XA 1KYUA 5SWSE 3TZVD 1ZVHA 3BMWA 5DVLA 2FNBA 4LEOA 4WVRA 2Q8BH 3Q9QA 3WEAA 4Q9QH 1KXHA 1R5VB 1TSHA 4NQSB 4XZUB 5KVEH 4KROD 1OM9A 2V8LA 4U3HA 3VGEA 3EZJB 4HH9B 4MWFB 4WO0A 1YPZA 4ESKA 4KRPB 4FABL 4M43L 3TJEH 5CR1A 1N0XL 3D39B 2ZCHH 3TYFA 1SFHA 1MLBB 3CZSA 1SUHA 2VR5A 1AZZC 1MQKH 4HZAA 2OL3A 4WI8A 1CF1A 2KERA 4GFTB 4HPOL 2AJ3B 4JFEE 1CDYA 4MJHA 2LQRA 3HAEH 4J23A 1M56B 4QMEA 1YYLL 3UTTE 4OF3A 4AK1A 1MJ7L 2ESVE 1YSOA 3IDNA 5GIRB 3DTXA 5EDSA 4LARL 1E8WA 1D5MA 4JO8A 3UIZA 1CDIA 1ASPA 3E2HB 2QPUA 1ZOXA 4N0CC 5CGYD 4HG4J 1EBAA 3IXAB 4GMSH 4E36A 4NPYB 1N5AB 3MJ9H 4L3EA 4P2CG 3L2LA 2CQVA 2GJRA 3BFWA 3IRPX 2K7PA 3OV6A 5IIEA 2OPCA 3V55A 1A6VL 5I8KH 4YHLL 1UT2A 3ASOB 2J5LB 3TA3A 4YPGA 3SN6N 3WJMB 3TFKC 2EXSA 5C07E 3LN9A 4GXUM 2EH7L 5DHXB 4JAMA 5D1XB 5FB8B 1CU4L 5I66B 1A1OB 3SEPA 3BQUB 3V0IA 4W4OA 3EF4A 4WHTA 1TZ8A 1SEQH 3HZMA 3E8UH 3PU7A 2ARJB 4UAOB 3R1GL 2YGOA 4XOBA 1K3IA 1IM9D 5ACLA 2O5YH 1I8KA 3LPPA 5C2BL 3IJ8A 1ZDQA 2CBOA 1P7KA 5IFJA 2F61A 4XMLH 1C1EL 1V7NL 2EO7A 4NQCD 3VCLB 2XN9B 3EDDA 5DZJA 2VDPL 3BT0A 1BXXA 3QUXB 4L37B 4G5ZL 2H1PH 2PO6A 1G9ML 2Q6WB 5GGSB 2V5RA 2N56A 5DJ6B 5CAYB 2IGLA 4BINA 1XEUA 4B50A 3HZ3A 4OM1L 3FQWA 3GI9H 1FG9C 3LHPH 4YHKH 4L8CB 2B4CC 1QPPA 4CU8A 4WU7A 5AB2A 2HFFA 3CZKA 5I6KA 2FO8A 4YPJA 3L81A 1M6OA 2GABA 2DS4A 5EA0L 5B3JF 2G0LA 1JYXA 1MFMA 3DYPA 5I24A 1Y0LA 4V11A 1ZE3H 5HHXL 5HHMD 2X2JA 7PCYA 4JANA 4PMEA 2HWZH 3MUGB 5KSUA 5E6IC 3TJPA 1RZIB 5AAWA 4H44C 4ORZC 2WPGA 4LCYB 4HKJB 4K9EL 4X4ME 2JI2A 1I7UB 3BGFB 4BFIA 3SKUD 2GPZA 1NCDH 1KCBA 3DECA 1B9KA 3JV4A 2CK2A 5E8PA 1H15A 5BV7B 4ZX6A 4GAYB 5DRXB 1RZJL 4OTXH 2C9PA 1V3LA 1B0RB 4OCNC 3WFDH 5LUMA 2UV3A 3L4VA 3QEUA 4LBEA 4C8XA 3QDAA 3BVWA 5TDPB 1NCGA 3PG2A 3VRIA 5LN4A 3A6CL 2JCCB 1ZLUH 5KVMC 3T3PF 5DJ0B 1NCWL 3QYNA 2A74C 3E80A 4NXKA 3O4LE 1OGTA 2VDRB 1QRNE 1ZSDB 1JK8A 3UFIA 5K9JL 3MCKB 2ZCZA 3QDHA 3WSQH 2Z31D 2V5TA 3FNKA 1ZTXL 5JOFA 4Z7NB 4WFEE 3SYAA 2GJZB 4UTBH 4YHOL 5CZVL 1S7RA 5F9JA 3SKMA 3FO1A 1T5WA 2EDJA 3HNTH 1KCSH 1L7TL 1YN6B 5C6WH 4GRLD 2A1WH 2V33A 2FT8A 3BVNA 1QFWL 1HWWA 3SE4C 2A9ML 4LLDA 1WZ1L 4P5KB 1R46A 2VISA 4CMHC 3MV8D 5I1JH 5IIEB 1CYXA 2YC1A 2ZJSL 4LSSH 4MA8H 3VXRA 4ICXA 4YPGB 2HSIA 3G3LA 1YEEL 3V4PB 2AZAA 1ZHNA 4OM0L 2Y6SD 2EADA 2CBTA 1AS6A 1F2XK 3MYJB 4IK6A 1I8UA 4Y9FA 3UJTH 5C0FB 3G5XB 3O41B 2R2EA 2WVSA 3X3GH 5ICZA 1DVUA 1VAHA 1XTMA 1URLA 2C3XA 1Q9KA 4S1RL 1UWXH 4F9LC 5C0EA 4QRPB 1ETJA 2MSPA 3LYRA 4OLVL 1F0LA 4H0GA 4AQ8A 5K1JA 2H32A 2J8UE 2ALAA 2GQHA 4MZ3A 1GCYA 2RR3A 3OGOE 4AQ8C 3U9UB 5INCA 5TTRA 2VC2H 4Z7WF 1W0YT 5IFAL 2I60H 4RBPH 1UWYA 2RD0A 3CCHA 3P0YL 2DW5A 3E9UA 4LOUC 2RAMA 5L88H 1NEUA 2F19L 1KNOB 2NR6D 3FUEA 4FLQA 5IW1A 4G9FD 2X7LA 5E56A 4PYHA 3OKYA 4NQDB 5EN3A 3GIVB 1ZKAA 2EEFA 3WEXA 5L8JB 15C8H 1AXIB 1O6VA 1CF8H 4ZUWB 5C0JA 3DUSA 1CTMA 2VLLA 3L3HA 2CLVB 3VGBA 1UKSA 3FMGL 4PY8J 3M17B 3S97C 3WDIA 4YBQC 2PNDA 4QEGA 4RFEA 5LVEA 2HLAA 1QRNA 4AKPA 1E4WH 1TTAA 1CL7L 4O4YL 1ACXA 4G8IA 2WYHA 5F7YC 3KYMA 2MNJB 2P24B 1TZGH 5DEGB 2PWFA 1KUMA 1XWVA 4P3DA 3WL9B 1ZV2A 5A7EA 5IJDC 1LE9A 2YRZA 4TLTA 1CYWA 1DE4B 5SV4A 1C12A 5IG7B 4WWKB 1BG9A 4PLNC 3E2HC 4A7QA 1UWEH 3ULUH 1GGUA 1PX3A 3NIDB 1M9SA 2QSCL 1CLYH 2ZOUA 2XBZA 5E2JA 2KLRA 1HQ4A 2IAMC 3KPPB 4WI6A 3T2OA 3LXAA 4FI8A 2JF1A 5TE4H 3T0ED 1HQRB 2JKWA 4OD2B 3GSNA 2XZZA 5HI5C 5DQ9B 5LGKA 4HULB 2NSMA 1WFMA 5BV7L 5CP7A 2I26N 5F7AA 4C56B 1B88A 1MNUH 3D50A 2L0DA 5IB4A 1ET5A 3UG3A 3ZTDC 1DJXA 3Q0HA 1NEZG 2QHLA 4LSUL 2EXWC 3UP1A 5HPMA 5TPWH 3BI9X 5GISL 5BXFA 4KAQH 4DGUA 1WA0X 3Q48A 4L5FH 4LVHB 5IB1B 43CAB 1KTLB 1MCKA 3II3A 1DBJL 3NH7H 4B27A 4PRPA 1FIEA 7PAZA 3MXVL 4Q89A 3QA3A 4HP5A 3TBCA 2XIIA 5I1JL 4A2HA 5BUAA 1WQVT 2FCBA 3CDYA 3O6FD 1GYAA 3C6EA 4FNLL 1E27B 4YDIH 4R5XA 4UTBA 1I4FA 1IGML 1B0RA 4XWOC 1E9PB 3IETA 4LASH 2CDFB 3CIQA 2VLKD 4KZDH 1RK1A 3MBED 1OOAA 4JFHD 5FA3A 2VZVA 6FABH 2FQFA 4WHDA 2JV6A 1ITBB 3Q2CA 4KROB 4C47A 4JFDA 4BQBA 2HG5A 2R2CA 4KRLB 2NZ9C 5EZLB 4PBXA 4QLRA 3ZTNH 4X5WB 1XCWA 3BSZA 3K7UA 4MHHI 3OPUA 3GS0A 4LLYA 4CILA 4XP9H 2K78A 2CPUA 3L4TA 1YEFL 4LSRH 5T1LD 4DGIL 4RZCA 2Y36L 1BVOA 3L3DA 3K74B 5JYLA 1CTOA 1EANA 1NIAA 1QUPA 1PG7H 2VNCA 3NK4A 2N4IA 3EGXB 2AQ1A 1JGLH 4D0CA 2D4DA 1S7UB 2Q86A 1TIUA 4XC1L 1GW6A 3JWNC 3S88L 1MUJB 3ULVH 1AHKA 2K70A 2A6JB 2YC1B 1WE5A 4YWGH 3STZA 2GY7B 2F74B 5SWZA 2EEDA 5ADPL 3CXHJ 1KLGB 2DI7A 4NQDD 3PWNA 3ZTJH 1NANI 3I6GB 3ZIMA 5CD5C 2YR3A 1FFPB 2VN3A 4MMZB 2AKRA 2IBZX 2ZXGA 1K5NA 3L9EA 4QHMB 4IKKA 4KKZA 2WXPA 2FGWH 3EOTH 3RWHB 3ZDYB 5E2TH 3VGAC 5IB2A 1MFDL 4HGWA 3ECWA 2OQJA 3O2WH 3O81A 5CM1A 5T3ZD 1TPXC 3NACL 3ZYIA 2P47B 3OAYK 4LHUD 2QVMA 1MG2C 3VD1A 5DURD 5IVZB 4HALA 1X9RA 4MHHG 2YAPA 4F2MB 3E8VA 1GY1A 2XPZA 3KYMB 4OFQA 3GXFA 1BJ1J 1NCBL 5GS3A 4BWTA 1T21B 4X0KA 5E1AA 3X1GA 5A6LA 5ICUA 5HHOB 2NSQA 4FXKC 4P3DB 3EJQA 1COBA 2YS4A 3MTXA 1BW8A 4HWZB 4R83A 4UDUB 3MOQA 1CB4A 3Q43A 1NKGA 5BW7A 3X13B 4F92B 2ZTBA 3PABA 4MJIA 1QNIA 4KJQC 3UGXA 1T7WA 2BSCA 3HAEA 4AQOA 2LOEA 1LDPH 4NQEA 4XC3H 4YBHA 5CJXC 4EN2A 3QIUA 4LEBA 3P54A 2ARJA 5AZ2L 1AG0A 5EBMB 1KXQE 5GZOC 4CAGA 5C0JB 3QIUC 1PY9A 2AK4D 4ACTA 1W0WA 2EDDA 3CFIC 4MNQD 4TUJA 4WNJA 3UAEA 1WBYB 1Z9SA 3S3CB 3DTDA 4QTIL 2MOVA 2A6DA 4FABH 5KS9E 1FNAA 4EUPH 2NY1B 3CK0L 1E67A 2CLZB 3LRHA 4ODWB 2P42B 4M93B 5DXWA 1I7TB 3ULSA 1T1YB 3BVTA 4PJBA 1P4IL 1XT5A 2I7OA 5J57B 5KWYC 3E7JA 4XO9A 1BMGA 1HHIA 4TUKH 4YFEA 3GUTB 4M8QA 3ZE0E 32C2B 3P30L 4B0MB 3OC8A 4M48L 4NJ9L 4N0UB 2JI1A 3TBVB 2FX9H 3QPKA 3FOLB 1DQDL 5C0DB 4FFYA 3IU4L 4N2IA 1OE2A 3GB7B 4HXAH 3W39A 4BGDA 4J1UA 1NGQL 4GKNA 1LMKA 5IROC 3W9EA 4N4YB 4NQUA 2WIIA 3L95B 1WTLA 3HMWL 3MUGA 3SOBH 3NSDA 3TZVC 3B7YA 4LP8A 5LQBL 4WTXA 1UADC 4MA7H 4P2QD 5AAWC 5BO1H 2GC4C 2GKIA 3BGMB 4LZKA 3TZVA 1NOFA 4FQHA 3K2IA 4WAFA 5HYSB 1F4YH 3D2TA 4UYPA 4LVEA 3MLZH 3BKJL 3V6OA 5T3XL 4AL8H 4S1SL 4XR8C 2FX8H 5AYTA 4JY5H 4Q6KA 1I3UA 2JE8A 4U6VL 5A3IC 4KKAD 2C3GA 2PF6A 3HIZA 4HPYL 1SDYA 2HFGH 4L9DA 4X8CA 4L1DA 1X3DA 4YNYB 4QOKD 3W56A 1KTJA 2XWEA 1TU2B 3EF7A 1ZSDA 1KCWA 3IJEA 1LE5B 4Y1AD 2E7CA 3ZQ9A 4YJZL 2GY5A 2VSKB 1SOQA 3KPLB 2ZUSA 1RI8A 3T08A 3DI2B 5I17B 1JV2A 4KOCA 3FO0L 3FSOA 4QTHA 1M1SA 2Q7NA 1S7RB 2OR9H 3PWLA 3IKKA 4GRWE 2AV1B 4MCNA 3QWOB 1HL4A 5I26A 1WDAA 1RFDH 3FQ1A 1MJUL 2CGRH 3MNWB 5KVGL 4NP4L 2ATKA 4D0DA 5SV3A 3F3HA 4G1MB 4YAQA 3PHOA 3SE4A 2MCMA 4KUZH 4XVTH 4ZO6A 4Z18A 1MCPH 4OGXL 1VGEH 4WFHD 3TA3D 4EZJA 4BSVA 3ZDZF 3LAFA 2D2CC 5GRUL 4QRRB 4D0CB 5GJTL 1JPEA 3BAWA 3S2AA 5IQ9B 3FBQA 5GRJL 4PRID 2Y5EA 5DHYB 5HYQA 2QGDA 1J9SA 5ANMB 2OULB 5C08D 4JDEB 5TH2A 2D73A 2WIMA 2FHCA 4JDZB 4LCCB 1MY5A 3TBYA 4W6YB 2JTDA 4NM4H 5DFVC 1R3KB 3P02A 4WNQA 5D9SA 3TBBA 4DWHA 3GIZH 4FDWA 4JG0L 4NCC2 3C60A 2X2IA 4G6AD 4MFHA 5DK2A 4EZKA 3MU3A 2OW7A 3K1KC 4A63A 4AV4A 3CPLA 3ATFA 5KG9A 4L5FL 4X4ZA 2MCG1 3SQBB 3MUJA 2XQBH 4GSXA 4RRPG 1FO0H 2CO6A 4HLZH 1MVUB 1SJVA 1DLHB 3OL2A 5D2LA 2Z3FA 1MXDA 2W07A 4LSQL 3HC3H 1LGVA 2OZ4L 5F72S 4IJ3C 2N3JA 5DD5H 5F7MC 4L3ED 4DP6X 3OJDA 1J8RA 1MG3C 2UZXB 1H3UA 4J3WA 5EU7E 4V2BA 2FQGA 3QJHA 4NBXB 3VI4B 1XCQA 2BZDA 3G5YA 4PV8A 5FOBA 3FOLA 2WSDA 1CLYL 2QSCH 2ZOWA 1AQKL 5J3HC 3VXUE 3UJJH 1MY7A 2C7UB 2C9SA 4CU6A 3FK3A 5D2NE 3SCMB 5CGTA 2J43A 1PGRB 3QZBA 1BPLB 5CSGA 2R8SH 2Q3AA 1OCZB 2PR4H 3CC1A 3QCUH 2FJSA 1CR9L 3LRGA 5AVWB 2G60L 3FB8B 3IN0A 1NEZB 3D4YA 5EORL 2BVOB 2J2ZA 4EI5B 2BOLA 3EOAA 2XN0A 3FH5A 5JA9A 4LK4A 4E41D 1JK9B 3HG1A 1JJUA 2VXUL 4ODWA 2ZSVB 4L1SA 1QR4A 3CXDL 3QI9B 1BBDL 4JFZH 4UT6H 4YSQA 4XN4A 5C0CD 5ID0B 4Y4HD 2D7PA 3ABLB 4XPBL 5KSBF 2ZUWA 5DVPA 5HGAB 1IGYB 4AQ1C 3BOVA 1UOKA 2C1OA 5EEZA 3KCPB 3GMPA 4MRCA 1NPNA 3ARGC 4A55A 5J6GB 3HI5L 5LGJA 1KG0B 3V5DA 1QG3A 2AEWA 4TLSA 1ZGLP 2ZKXA 1LO0L 2Z93A 5C0AA 3H53A 3W39B 3FQYA 3KW8A 1TKWB 1GKOA 2XKNB 1GR7A 4LEXH 1DQKA 1SJEB 4FKKA 3GDBA 1KV7A 1L0PA 4P3CL 5AVTB 3WV0A 5I0YA 2HA1A 1G6RL 4R26H 3X11A 4AMKL 3DX4A 3IVKB 5FR3A 4RDQF 4OQ1A 3TH2T 3MGTB 4E9QA 3I50L 2FT7A 4DEPB 3X12B 5T1KA 1E3ZA 5EO9B 1AMXA 3D5OF 3RKDC 4OIAA 5IBLC 1U8PB 5ACZB 4HKXA 1DSYA 3MRKA 4N9GB 4WW1A 1QLRA 2E7BA 1GKEA 1XSIA 5EEUA 2NY1C 4UMGA 1A1NB 3LJ3A 3BT2L 1SY6H 2Z92A 1SLXA 2FWLB 3BKYH 3DSFL 5T5FH 3UG4A 3WFZA 4LGSB 4UQIM 2CRIA 1N64L 2ZJSH 4MA8L 1MRDH 3UTPD 5EIIG 5D7JD 1TVHB 1GIGH 3BAIA 5ANMA 1U9KA 4Q14A 3ZR5A 3TXAA 1GY2A 3WO3B 4LRNH 4X5XB 1FBIH 3D05A 4Z7OB 3FDWA 5KTEH 2BVUA 1WSST 3Q44A 5FA4A 1BQHB 3AWGA 3C9NA 5IHBA 2E9IA 1TQTA 4WK2B 2QDVA 2KBGA 5IMLA 3DO7A 2FGWL 3EOTL 5ICXA 4B0MM 3OHXB 1XB6A 4WHYH 4OGZA 2XV3A 4JRXA 2R1XA 4UTBL 5CZRA 2B2XH 4NPYA 4FADA 1Z6JT 3U6XS 2BJML 1BX2B 3BP5A 1CIDA 5AVRB 4N3TA 4F37F 3MRNB 2CO7A 1F4XH 4XH2A 3UJIL 2CHZA 3DUUB 2CUAA 1E42A 3V52H 4MJ5A 2ICWB 2GTQA 3JVFC 4EKJA 4P4RB 3ZN6A 4JLRB 3NCYP 3NDZE 3QAZB 1YDPA 3VG9C 1FZOB 2FBJL 1Z5HA 2R8SL 3ZDYF 5CFHA 3AXLB 3W82A 3T9WA 2VITB 5G5DB 4HV8A 4TS6A 5I1CL 3CSTA 4N3UA 2DYPD 1PDKB 4OZHA 2ZXWB 4FQXD 1CZ8H 5T33L 2F2HA 2IANA 4R2GD 5PCYA 3IXAA 1RAMA 1YN7A 4CN4A 1P5UB 2V2TB 5EMYA 2J2ZB 4Z7IA 3SQRA 4O2EA 2QVIA 2HP4A 4GG8B 3IDJB 5DZLA 5LN8A 4Z8FL 2XXCB 4JVWA 1MVUA 1P84J 4JR9L 5AYUL 4IHOB 2WBJA 1EO8L 2ITEA 1LP9E 2AJVL 3HAEB 3TNMA 1JXFA 4ZTPL 1NFDA 3GTVA 3MCYA 4WSGA 3ARQA 5J6GA 1I1YA 3SE8L 5BRZB 5KVDE 4B96A 4YSUA 2J57A 2DIEA 4RVBA 5AB9A 1T83C 3BQUA 5D7IA 4PHXA 2F7RA 2ZG2A 3CN0A 5HYJD 4JPQA 1IE5A 1WBZA 2VXSH 1E8ZA 2BCKA 3H2PA 2CU9A 5D7SL 5FOJA 1AGEB 2EE6A 1SEBA 4FFVD 5D7IE 4WJ5B 2EDXA 5E9NA 5HVGB 4I85A 2VDLH 5F6IB 2OR9L 5KN5A 1SJEA 4QR7A 4G1EA 1E8XA 1C5DA 2D7OA 3QHFL 4QRUA 4AIOA 3I9AA 2W65B 2XYBA 4MBRA 4MDIA 4JE4B 3TIEB 4KUZL 4XVTL 4IGBB 1L0YA 3KL5A 4C4BA 4OAWA 3HC0B 4KKBC 4N5ED 3QUXC 4FQ2H 2C1PA 4P5MA 3LEXB 4R5VA 5KBKA 1UASA 4WW1B 5L6YH 4HWBA 4QRPD 3VD0A 1PW3A 3GXPA 2WXFA 3PWJB 2ICWI 2ZUVA 4IS6A 2NZ9D 4TNWK 3K72B 5KZCB 2OX5A 1MJJB 1T4KA 2GT9B 1FL5A 3H0TA 2X4PB 5CLWA 5FPIA 1I8MA 3T6QC 3BSHA 2X0WA 5E23A 5JXED 1S9VA 1S7TA 4IHBA 4CMMA 5EIIB 5CSBA 1LEIB 3BGMA 4CADA 4LRIA 1OKEA 2VQ1B 3LH2L 1BAFL 1RLWA 4Y5XC 4QRQB 5JOFB 4ZUTA 2XA8L 3U2IA 4DK6A 2WKOA 3GMOA 4NO5A 2UX6A 3FUMA 4YBQD 4LCWE 1BQHA 4BSJA 1RHHB 2I85A 2VSCA 3C5JA 4FFWC 4JHZA 3EJYC 4L5FE 3P0VH 2FBRA 5DZOA 4FQ1H 4HUUA 2KDYA 3GXNA 3H56A 4LSRL 4OLYH 4WWKD 5FGBC 2NY2B 3QIBC 4G6JL 4TSBH 3THML 3VE0B 4FKEA 5GZNA 2UXGA 4G5AA 4EIZC 3VXUB 3UPCA 3HPJA 1PYWA 1T0NA 1H19A 3FBKA 2BSTB 2OYPA 3UTOA 4OKVA 4J3SA 1RUPL 3DGCR 3P3SA 4JUSA 4M03A 4ZTPH 3DDGA 1G5AA 5CIPB 1NCOA 3AW5A 1W8EA 2E8ZA 3O8XC 1P4UA 4IRZH 5F8QC 1F18A 4FA6A 3RRQA 5HHVH 4YMPA 3HR5B 3MFGB 1I7ZA 1QLFB 5C86A 3ARBA 4AH2A 2ENSA 2R2EB 1NMAH 3Q1EA 2G60H 3K6SB 4NKDB 4Y1AB 2JB6A 3EJZC 4K07A 1C7SA 5DRNA 3S96B 4DP9X 4DVRL 1ZLVK 1NM9A 2BNQD 4TUKL 1A7RH 2VE6A 2X4TB 5FGCE 5IW6B 2F54A 1XGZA 3P4OB 4IQHA 3ETSA 1VFBB 2FO1A 4J39A 2Y36H 2NY5H 2ZKHL 4XVSL 2AJZB 3OLEA 1CVRA 2FEEI 5FYJH 4N6QA 2HT3C 3GMRA 4NKIL 3SGKC 2OP4H 5IF0A 4PTUB 4KO9A 2NLJB 1IL1B 1CGTA 3RNQA 2CA3A 4JDZA 3TBYB 5KSVA 2WZ5A 3TTSA 1C08B 5A2LH 1EDHA 2NY6D 2B16A 2BY3A 4PQXA 5KOMC 1KJMB 2FX8L 3SPGA 4N8VG 2XKSA 2VLLB 3L3HB 5HD8D 3DX6A 4HV8B 2ZUTA 4JFDD 4YHKL 5D71H 5EN2A 3SGDH 3HG4A 4QCIA 5DUJA 5BOZG 1DVTA 2NUTA 3Q3GA 1R3HA 3GSVA 2F53D 2VO5A 5JIPA 1KB3A 4JG9A 2Y22A 2VJ8A 2VZUA 3O8XB 2MPAL 1JWSA 5TFSL 3E3QC 3QXTA 3BD4A 3L1FA 3IJYA 2UZXA 2Y7NA 3M7OA 4QI3A 1ZGLM 3BRGC 4N68A 2VZ1A 1XF2B 1EEUA 1SYSA 3PCYA 3AB0B 4ZFOB 2XOTA 4JFFD 4UWQB 1IX2A 5SWZD 4HUKB 1RIVL 4EZLA 1NC4A 3EO9L 5DQ9A 3RVVC 1M2VB 3WUZA 4IGBD 4P5SA 2DOCA 5DEJA 1NUNB 5EZOH 4YXLL 2KZ1B 3KEDA 1MFCH 5KSBA 2WWNA 2BSSA 1YQVL 3ZY7A 4AJYV 1YNLH 3FC8A 4U0RB 1IAOA 3HLAB 1TF4A 4ZUTB 1NGYB 4FXKA 4HAKA 2F68X 2FUTA 2QZ5A 2ILLA 2ZWLT 5C6PB 1FVCB 1J10A 3CX5K 3GJEB 3IFLH 2D31B 1F4WL 1PNDA 4FULA 4RGNC 4NUQA 4ZQTA 1Q1PA 4I0PD 4LPTA 2XWRA 1UGKA 1Z0NA 4FXLA 4OCYL 2J1YA 5D70L 2BY1A 4XAKE 5D7EA 2A6KB 3QWNA 3PWJA 4L0YA 2X0UA 1HQRA 4OD2A 5DURB 4WTZA 4OBRA 2ERJC 2OM5A 5DJYA 1UACL 3L1OL 3MAWA 2V7HB 3V95A 2X4PA 3WEBA 2XKNA 1WCQA 2X2UA 4JVUA 5CIPA 5M7QA 3QORA 2VDKL 2A4EA 5GZOD 2QSTA 1XF4A 3IMBA 3QORC 1ZT7A 2QADB 4X5WA 3IFNL 4FERA 4PJ7A 3JWOH 2ZP0T 5DTFB 1WA1X 5D6CB 1FIGH 1YO4A 1RHHA 3C5JB 1F86A 4FTVD 1HZHL 4FG6C 2QKIA 3CLFL 2KKQA 1TQCC 2VMEA 2ZQKA 2DJSA 4KI5D 1PSKL 4S1RH 5E1GA 4PW4A 1K85A 1OL0A 4XMWA 4FHBD 4LNVA 2ZXQA 4K0OA 4PJEB 3C6SB 2RB8A 1XF3B 3WS3A 2AQ3A 1UYWH 2VXTH 3CHXA 1Q9WB 4NZUH 3TVMD 4DUXA 3CFMA 4U1JA 1P5VA 1RK1B 4EJ1C 1QYGH 2QQLL 3E6HA 4DEPC 4N8PA 1KJ3L 4UQ9A 4JG5A 1HEJC 5DF0A 3UCRA 4WLCA 2X38A 3P73B 3AT9A 5EZLA 4OZFH 5D8JH 4QOKA 5M95B 3T77A 1JFQH 2Y06L 4JFHE 2OQJB 2I7SA 3TEXA 3B7TA 1OF2A 5B8CA 1J87A 5FGSA 3RVWD 3RYMA 1XGPA 1QBLH 3WIIL 4U0RC 3RKPA 1EHKB 2IALB 2VLKE 2WLLA 2GAZA 2JKSA 1GC1H 3BW9A 3WXWH 1OPOA 5F7EL 1HN1A 5T3ZL 3QFDA 1UZ8B 5J3HD 1BD2D 1MUJA 2J72A 3RUGB 2DMBA 4A7TA 3IAGC 1M3JA 5IP4A 4FTVA 3T4AA 2UYLA 2FK9A 4U6HB 2EDEA 3SO3C 2VITA 5G5DA 4KROC 4PY7B 3F62A 1XO8A 1H5BC 3NTCH 4K7PY 1IEBA 4PW3A 2K4AA 2AKRB 1FN4A 5HVHB 2B7DT 3O0LA 1PY0A 1Z5LB 4H8UA 2KS0A 3JWDC 4JO5A 4WNSA 3ZDZB 5C2BH 1NC2A 1ACCA 4LQFL 4C58B 4Z77B 2BOCB 3QAQA 4MASA 4KK5D 35C8H 3AUVA 1FL3A 4I88A 3Q6GH 4C56D 1BF8A 5F7BA 1UXLA 2FJHA 4XPTH 2B0SL 1H6TA 1U8JA 1SVBA 2NTFB 4JDVA 4WZ9A 5I73C 2BMKA 3MCG1 4OI8A 2P8LB 1X5IA 3Q3GB 2YRPA 4X4XA 2FLBT 4GIOA 3RUGF 4ENZA 5E2VH 4DP1X 3HLAA 1CS6A 2ZICA 4PJHE 3EG9A 2PW1A 4HEPA 3O4OB 2ZYIA 3QRGL 4RGMC 3ZT6A 1JNNH 4M4RA 3T8MA 4OI7A 4R4FH 2NNCA 4DGVH 1E9OB 4NLAA 1DJYA 3BJLA 4NLHA 1CD8A 2DQUH 3HC4H 4U1LA 5JNYB 1TZHA 1YECH 4XP5H 5EU3A 4F5CE 1AR1B 2LV4A 5C0DA 1TQBB 1CI5A 1FBIL 1E5BA 3MLXL 5IQ7L 2F08A 2YO3A 3R8BB 4CSZA 4KMQA 4PD4J 3GKWH 4OFVA 4W68A 2BIOA 3FU6A 4KKNA 2MQ0A 3MO1B 2K6WA 2EZ0C 1AQKH 1DJGA 1VKXA 4IKLA 1U36A 4K8RD 1AKJD 3GJFH 5K59E 4EVNB 1KZQA 4ZX3A 2HYMA 4LDCA 4IBUA 4F57L 3AZUA 2AAVA 1VGKA 1W72B 1AE6H 3SYPA 4ADJA 5I76A 5IQMA 2VIRB 4ODHL 5SX5H 5CEXA 1TJMA 4X6CA 5F1SA 2ENQA 4OF8A 2HZHA 1GZQA 3ML9A 3OX8B 4ZPVB 4F8PA 3P0VL 3DBXA 1DFXA 2Y3AA 3GMNB 2LFEA 1XGQA 3HHRB 4QO1B 1ETZB 3BYTA 1DVFA 1IGTB 3OHXC 3W1ZA 1I85A 2Z91B 3VTAA 1KC5L 1R6VA 2R0ZL 3GK8L 4FTVE 2BWDA 4CRPA 3BAEH 5AOKA 5JIHA 4XNDA 5C0RH 1B4TA 1OB1B 2COVD 5F1NB 5IY5B 3E1ZA 5EZJA 3BUYB 1BYOA 3AQYA 4FLHA 4L4JA 4X4MA 3TO4D 4KXBA 1HAWA 2HFTA 4PJDA 2J4WH 3RGVB 4FD0A 4EZMA 5ADOL 1OCOB 1WFUA 5CR8A 2ICWJ 2OV0A 1E5AA 2I07A 2NY2C 2X53A 3CZFA 3QIBB 1J8HE 1KFGA 4GY4A 3ZDXF 2HRPH 4X9HA 1IFHL 3FQTB 2DM4A 4KI1A 3RL2B 4GSDL 4ZUVA 4AYID 1NMAL 4KXDA 4MAUH 4FI7A 4FQCL 4P9MH 1KTCA 3LD8C 1RQ5A 2R0KL 3N40P 2DQJH 1RPKA 2X0VA 3QRGH 1AHWB 5FKAA 3OF6A 3QEHB 2I9TA 4Y88A 2FBOJ 2WTPA 1UZ8A 3L9YA 3KL0A 1HHGB 3BVVA 3RWCA 3UDWA 3WNNA 1TTUA 3WGUB 5EUOF 1AANA 1HE8A 3S3PA 5EFIA 4G5ZH 2AI0H 2G3NA 4XCFL 4HMCA 1KIPA 3TL5A 1KJ2H 4OLXL 2X1QA 3NIFF 5E8EA 2UVFA 2ZXBA 3A22A 3FU3A 3GTTA 3T2NL 3B1UA 1DEEB 4S1DC 5I8CA 4JO2H 5T1MB 4Y5VA 1A65A 5H8DA 5DJAA 1AO7A 2E59A 1NBVL 5KTEL 4XNUH 2ATKB 3BSZL 3J27A 2R2HA 3NACH 4TUUA 3P9MA 1QZ1A 1KGYE 1XGPB 3MXWL 3ZZLA 3B3IB 2YFOA 3KPTA 3HC4L 1RJLB 1CFNB 4G82A 1N9PA 3EJTA 3QI9C 3NZ8B 5A2JH 1R9FA 4S1QH 1PPIA 1URIA 1ID2A 4RMTA 4XWOD 2UXFA 3MRFA 3FH8A 5E6IA 5DHYA 2IANE 3MBEC 4GINA 5HYQB 1TQBC 1YEJH 5C7ZA 1YPZF 3VXSB 4AIZA 1IBZA 2JKRM 1S78C 4J3OH 1EZVY 4NZDA 4QRFA 2KLTA 3EGSA 3VFVA 1YMME 2C7UA 3GXUB 4DKEH 1I3RB 4GJTB 2M2DA 1FC1A 1EIBA 2XLLA 2NUTB 4DEUA 3ISWA 3VA6A 1T2QH 1UTDA 3B5HA 3T6VA 2UY7A 5J1TC 1A4KB 1MI5A 4KVNH 5FXCH 3QHZL 4E9LA 4MKTA 4O02L 2A2QT 5I8KL 1NL0H 2OMUB 4KQ4H 2PPEA 1JF1A 1XB8A 3OKMA 2WQVA 5EZIL 2HRPL 4QRAA 4EUPB 4OV5B 4NENA 4Y9BA 4FHKA 2YUVA 1RP9A 1PSKH 3WY2A 1A1MB 5FUZL 4E9SA 3WJMA 4WUUB 4BFKA 3RB5A 2DQEL 3OX8A 1DDHB 2DQFB 5MHSD 1JFHA 4PLJC 2VXQL 2EDFA 2XFGB 1AXSA 1BLIA 1PQZA 1U8OA 1M05A 3I9IA 4N8CL 4ODVH 4X4KA 4TMPA 3QXWA 4PVMA 1YLBB 3QUZA 5GS2H 3ULAB 2ICEA 5DU7A 3JBG7 3IN2A 4Z95L 2FJUB 5SWSB 1PLGH 4L4VE 1XGUB 3FHAA 1CIUA 1KCVL 3ZXAC 4YHPB 4ZMWA 5EC1B 4Q9BA 5AOMA 3UCQA 7CGTA 2WNXA 4BH7B 2Y0SA 4JO4H 3KWVA 4BFEA 3PQYB 5T5FL 3EFDH 3BQUD 1ID5I 3GLEA 3I6LD 1SF5A 1WZMA 3L3IB 4V2CB 1AR2A 1GSKA 3WTSA 1ZLWH 4BFIB 2Z7ZA 5FYJL 3RWGB 5MEOA 4YHNA 4WSKA 5ACZA 2QR0B 1LK3H 3MRHA 1JNHB 1H15B 3V4VL 4JREC 5IQLA 2WD0A 4UV7L 2A6KA 4Y5YC 3WKPA 4HIPA 3MRIB 3T04D 2AJSL 3WFEH 1JCVA 4MAZA 5DC0A 4HJ1A 3QDGE 2NYKA 4XMXA 3B3BA 2WSPA 3T3ME 3U36A 2CJSA 1OGTB 4L8SA 1KLFA 4MD4B 3UJIH 2Z1KA 3C8DA 4XNXL 4V1DD 1IBFA 3TN0A 1VB9A 2FJGB 4ZXBC 1K9TA 4C4KT 3TBSA 4I2XE 4QLWA 2HWZL 3QC6X 4F8NA 5KYWA 1YEEH 4P59L 4NQQA 2E47A 4MZRA 1U3HD 1KF9B 1QRND 1FZJB 1VJSA 4OZ4B 5EHFA 1N7MH 4WFED 5D7KD 2GJ6A 3BEWB 1TZOA 5IR1A 3VD3A 7FABH 1QLRB 2QHRH 3N55A 3ZT5A 2HMIC 4KKLD 1IIKA 3QPQD 4MXVF 5AW0B 2DQHH 2YPKA 3QJFB 1KPUB 4OLYL 4XH2B 4XO5A 3KYOB 4IKNA 4IMLA 3ARZA 4YUEH 3VACA 1QBBA 2G75B 2HLEB 5GSVA 3SE3C 4AEFA 4QY8A 2GJPA 4JY6A 5JLZB 1TTBA 4N22A 4JPWL 4U2YA 3MA7A 4HWUA 4LSDA 2YD1A 4OF7A 3T77B 4P5RA 3ATAA 1IJ9A 5E1QA 3U30B 3O41A 2VN5A 4EBQH 4L1BA 2DIBA 2HKAA 1CDHA 4KH9A 5D70H 2O5YL 5T5NF 3W9DB 4UT6A 2VLJB 3P2DA 4AM0Q 1KYFA 4O58H 4WEEA 4AV0A 4F58L 5KVFE 2XV6B 5EU6E 3VU2A 4LCWA 1PZ5A 5F9OL 4ODHH 4PBVC 1R3JA 5L9DH 2WBKA 4Z3TA 1G7PB 2GSGA 2RALA 3U9UA 5DJCB 3KYNB 3VFTB 1USQA 1GYUA 3NCBB 1UZ6E 4R2GB 3MLPA 4FTVB 2FQDA 4WWKC 1A1MA 3QPXL 3JWOC 2DKSA 1UQSB 1H8LA 3G5WA 4KX8A 4Q97A 3IBEA 3TEUA 3BFQG 4KK9C 5CJ8A 4M7JL 4MJ4A 3LZQA 5C0BB 3ZHDA 4JFVA 2ZX6A 3DIFB 3T0VA 4MCZB 1F1DA 2L3BA 4PIBA 4FQ2L 3QJSB 4FEIA 2BCKB 2BRRL 4OT1H 5C0GB 2QLYA 2HJLB 2C3VB 5GGUA 1M42A 2FJFA 4QHLB 4EE2A 2UWEB 1FVEA 4JO1L 1FO0A 5CD5D 3UG5A 4RGND 2WO4A 3QE5A 4OFKA 1E5CA 2DQTH 3G6DH 2UY7B 3O3UN 3EG9B 2EACA 3KWUA 1OXYA 4NXSA 1MXGA 1P5UA 2IWGA 5F97E 1LK3L 3RDTC 1NDTA 3V4VH 2ICES 1IB5A 4L4VD 3HUJF 4X6CE 4LLMA 2YEQA 2LVEA 2F54D 4JUTA 4XI5C 4IDJH 3RJDA 3BXNA 4IGBA 4RWYH 2ZP9A 1YEGH 3KPQB 3PV6B 4LKXA 2PCFA 4Z8FH 1BIIA 5HI4C 2F53A 1YEFH 3HHSB 4M3HA 3MRHB 3NSXA 2BPBA 3P77B 3C60C 2R69L 3MI6A 1WYJA 1HQ4B 4LLVB 4LCCC 4HUMB 2APFA 4NZJA 3ZJAA 2DBLL 3QUML 4ZYKA 1X5MA 1PQZB 1U8OB 1G7MB 2GITA 1D6VL 3A6OA 4XAWH 5AYQA 4IMKC 4YXHL 2XA8H 4X80H 4UB0H 1WBZB 3FMGH 5EUOE 1U2HA 1QRNB 1IBDA 1Y7VA 3B37A 5B38G 1RJZB 3MRJA 1MCRA 5K1NA 2ADGB 2Z35A 5E4IA 1AJ7L 1R3IH 4Q9RH 3GEWB 5I6LA 1KY6A 2AQRA 3QS2A 4DPCX 3ARUA 4XNQA 1A7NL 5E99L 2E7LA 3ZHNA 2CUHA 5EC2A 1U8QB 1BVNP 3H9YA 3K6FA 4CC0A 4OLZH 3OB0H 4X0NA 4AZUA 5JO5B 4FJZA 4UIKH 1IGTA 2VLRE 3KPRA 1BAWA 4OCXH 4OIIH 1EX0A 2H8PB 2ICEC 1KPUA 2EH8L 1OGSA 4WCYH 2PPAA 1AOZA 1P4LA 1IBBA 5FO2A 2CXKA 4NBYB 1O0VA 5HJDA 3KYAA 3U0TB 4L48A 4JFDB 4MXWL 3UJTL 3MNZA 4N20A 1NGQH 2XC8A 3JWNE 1MWAH 1T1XA 3QULB 4EKXA 4N2KA 2ZCKH 5DFWH 2AK4A 4AQ1A 2FJGA 2RCSH 4ZZFA 1YY8A 2W5PA 3HZKB 4GS7C 5FYLD 4XBEH 4OZGB 4NQXA 1AQMA 1GS7A 2CR6A 5JHDE 3AITA 1ADWA 1E40A 4HLJA 1UWGH 3IMRA 3BDYH 5IGXH 3ZE0F 3HS0C 4U1KA 5E2TL 1OARL 2DI8A 1FC2D 3MLYL 1T0PB 1JYNA 3P9LB 4CDGC 5I1IH 4YSOA 4U1MB 4KKPA 2YD3A 4N6RA 4EI5D 2J6EL 4YQXL 3CH1B 2AJZA 2BNQB 2K0RA 2YPKB 1WO2A 3V5KA 3QDGB 4OIBA 1QW9A 3K71B 4UZSA 4PGEA 5IJKA 3KYOA 2MJWA 1CFBA 3IFLL 5CGYC 4Y7MA 3QQXA 2XWXA 4Z7WB 2JELL 1UWFA 1B0WA 3FCUB 1EO5A 3KXFD 4ZNCD 1ANUA 1TJGL 1MVFA 1XR9A 5C0BA 4K71B 1ZV9A 2BXYA 1IBHA 3B7SA 1BEYL 4Y5VB 1J5CA 4N8VB 4LCUB 5C09A 4OZIF 2XKUA 4QYAA 3RWFB 2P44B 3ZDXB 4NCDA 3LV3B 5DC9B 3MX0A 1IGJA 3K46A 3SPCA 4K3GA 1NKOA 3DETC 1N18A 4P2RE 5I23A 1ZWIA 1P2CB 4DVRH 1RPQA 3H2QA 5FGCB 5E00B 4L0ZA 1WS7A 4FOMA 5HHOA 3VB8A 3MLVL 3PGFH 3TP4A 3ZKXB 2VDLB 4KJQD 1T04B 3DJSA 5LBSH 1K4DB 3VXMA 2BNRA 3DOIA 1CE6A 3WIHA 4OCMC 2HFEB 3IJYB 4MJIB 3MLUH 5ESAB 1LXMA 3UZVB 4PCSA 1A6UH 2I9LA 3PWNB 5DMIL 3FRPB 3O2WL 4OCLC 5FLUA 3GMLB 3DJ9A 1TYEB 3D39A 4PJXF 1CR9H 1P7BA 2Q1EA 1A3RH 1OGAB 3M88A 3LKRB 1RSYA 2GEQA 2X89D 4ZW6A 5I1EH 1KENL 3SYQA 2ITCB 5B1AB 1KWKA 3ZE2E 4ZMOA 2ZWYA 5I9QB 2NY7H 2V4LA 5BQ7A 2FYYA 3IE4A 4NS0A 4L3AA 2B20A 3L7FB 4G7YL 5C9KA 4N0YL 4XP6L 5IMKA 1JF1B 1D5MB 1N64H 3OKMB 1EEZA 3TA4D 5I1LB 5LG6A 5G4OA 2KQMA 1T21A 2VJ0A 4X0KB 5GRWA 2ZOLB 5D7IF 1IU1A 2EIKB 5C9JA 1N5AA 5ETUB 1G6RB 4HGKC 4JEGB 4BYHA 4LPUA 4CKQA 1M71B 2VKWA 3GUTA 1SBSL 3E38A 32C2A 4D0BA 3BD5A 3D3VA 4FQQB 5FM8A 4N86A 5LDSA 3RVUD 2NZIA 5CCHE 4HLEA 1CVSC 3BKJH 2HRLA 5AVYB 1FZMA 3NABH 1FVDB 2W91A 4LCVA 3QNFA 2ZYHA 1LP9F 5EDXA 3WXVL 3RGBA 4GP8B 2V7HA 3FCBA 3Q1SL 3REVB 4IBWA 4RZKA 4FF9A 3EO9H 4PI0A 3MYZA 1FIGL 5AVUB 4NQEE 4S1SH 4U3CA 3L5IA 1BWWA 5EU7C 1JUFB 1BSIA 4JFXA 5HP5A 1F11B 3RPBA 1XF4B 1EJFA 3ZK0A 1Q38A 2ZWKA 2HVJA 4X8JA 1IBGH 5SX4I 3HNVH 2ENJA 1E28B 2X1PA 3E6FB 5JPNB 4UTAL 3EYSL 3GJEA 3QUYA 2O61B 4JBSA 1U8LA 3ZSTA 2HVBA 2OMXB 3T1WA 1BM3H 5BS0B 1U8QA 1NDGA 3GSRB 3PP3K 4TXVB 4NC0B 4QXGL 5AL8A 2X70B 1UA6H 4KKCD 1J12A 5DJ6A 2WKOF 3THMH 2HKHL 4NP4H 5TPWL 5FO7A 1SOKA 1S7VA 4DW2L 1J48A 5K59F 5H94B 4JFYA 1KB5B 4EO5A 5EZIH 3FT2A 1GZPB 1MRDL 3C6LC 5HHOE 2H4EA 2YQ3A 1Q72L 3QJRB 5AALA 3IMTA 3CXFA 3TN0C 2HLFC 4YX2L 5LJYH 3P73A 2AJVH 5AOJA 4Y2NA 4P2RA 4FQHB 5JQ6L 1LEKA 4N8VA 1CGUA 4AEHH 4H8PA 4U7MA 5GRVK 4Y1AE 4YLCA 1K2DA 3G5ZB 3IGLA 3DUHA 3QWOA 4KGJA 3V6BR 5I19L 1DQIA 2XI9A 1P4BH 4QD2E 5B8CB 4I18A 3GKWL 5HJ3A 1ZWIB 2PO6D 1ZHLB 4GBXD 5D1XE 4PSRA 1I7UA 3NUKA 1WZLA 1AR1D 3PDOB 4GIAA 3MRPB 3HRZA 5CBEA 6PCYA 4WRLA 4ONOA 3RFZB 2IWEA 5L4JA 1DBAH 1BXVA 1G6VK 4JO4L 3C6SA 5F7HA 4E5XG 3D39D 1ONQA 4AEIL 1JMXA 2AEQL 4MJ2A 5HDBB 5I1CH 5T5NG 1F1GA 5DT1H 5H37G 4FX5A 4TF4A 2CKBL 3A4DA 2HG0A 4FYRA 2XIDA 1DVYA 4RLDA 1YEHH 3PXJA 4YSCA 4N2GA 2W38A 6PAZA 2H6PB 5IFHL 3TF4A 3ARFD 5EULV 5JPMB 3VWKA 4HC1H 4KHTL 5IQOA 4W81A 1KWGA 4R96A 4P23C 1VADB 2XPYA 5G4NA 4AE1A 1MF2L 4UI2A 4TQPA 1JGUH 3MRBB 4JHAL 1YA5A 3HJEA 5JIMA 1TZAA 2PW1B 3VYNA 2P43B 5F9JB 1JV5B 2PW2A 1HXYA 1F97A 4ORGA 1TFPA 5C9JB 3OXRA 5JPNC 3HB3B 1FFOB 1EXUB 4NIYE 3UBXB 2XWZA 1IKNC 3AG4B 3P3RA 1HKLH 3VFWB 1UA6L 1XSKA 4MMXA 4MAUL 3B2VL 4X6FB 5SX4H 3QJZA 4PPTA 1P84K 3G6AA 5BVPH 1R3KA 3ZHLA 4U7SA 2F1EA 2DYPB 1BBJA 5E9DD 3LKRA 4Z77A 3H3PH 2VDMH 3BYYA 1MFEH 5JXAH 4I87A 1R5WB 3DPBB 2MNWA 1OCCB 2O6DA 4NNXB