1I82A

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with cellobiose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i82A00
1I8UA 1I82A 1ULVA 1UG9A 1I8AA 2IVFC 4JPQA
chains in the Genus database with same CATH superfamily
2E9WA 2O4EA 1N64L 1UKQA 4B5EA 4HHAB 3BH9B 3QORB 1FNEA 5AYUH 4D0CA 1HEHC 1G7IB 5IHUH 1NGQL 1T7YA 5I0YA 3AS2A 3EW3B 4IRSC 4FDWA 4NOBA 5FO7B 2JKSA 3SDDD 1JYXA 3JVGA 3QEGL 3MV8B 4C4UA 4X5XA 5H2BA 5E0QA 4PBXA 3ZQWA 2G9KA 4I3RL 1WCQA 4LSPH 2NY5L 4HIIA 1ZT7B 4PV9B 4CJ0A 5A6IA 3NPSC 1HE8A 3IXAB 2WIIA 5EN3A 3B2MA 5KBKA 2CCLA 3AU1A 4Z0BH 1GY2A 3EFOB 2CIKB 3PL6D 1GKOA 2VLJA 2DL9A 3VAEA 1CD1A 3L6FB 1FGNH 3QVAA 1MIEL 1E2WA 1ZHLB 3ZDYE 4RWHA 4XI5C 4OJCA 1ZT4B 4KTEH 4L8SC 3GXIA 2PTTB 3TJEH 1UFUA 4ZO8A 5SX5H 3C6LC 3O8XD 1ONQA 3KAAA 4YNYA 4ZO9A 5DRXA 3T2OA 4XCFH 1YMMA 4Y8AA 2J5WA 3HZKB 5F7EH 4GXFA 3D12B 2Z91A 1FH2A 1OCCB 15C8L 3S3CB 1E4JA 2CAKA 1RIHH 1S2EA 3S97C 3UEQA 1ZIAA 3RZCB 5IVNA 4DKFL 4OFPA 1QQDB 1I85A 3GSXA 2NYYD 3CU7A 1XGTB 1HJBC 1A66A 2BCKB 1CE6A 5I8KL 1HHGB 2IPTH 1H9VA 3JWDC 3D18A 4NP4L 3WIIL 5BPPA 4KX8A 1U8LB 3TA3C 4DFHA 4UT6A 4GG6A 1A1MB 1E67A 3Q01A 3NG5A 4V1DE 2Y1YA 1YYLH 5F21B 3A6CL 2E7CA 2CDEA 3QEHB 1X9QA 1NFIB 1T80A 2F7IA 2ZSWA 1ZTXL 2XWRA 4JZNA 5D2NA 1RY7B 1SJHB 1PY0A 1VFBA 4I0KA 2O6PA 3DTXB 5DMGD 1FL3B 4W81A 3SKMA 1H8NA 3K1KC 1GTNA 4HSCX 4OIIH 4U0RB 1TVHA 2CHWA 3JWOH 4KU1A 2BSRB 4KDTA 3GXFA 1ZWIA 4JHWH 4XHQA 32C2B 1HZHL 2DQUL 3S37H 3SD5A 1L9TA 4O51B 1HEJC 1FZOA 1UHVA 3H6AA 4GG6E 2K6YA 3QA3A 1AGCA 1V55B 1SHXA 1XCTB 3HZMB 4NRZA 1Y6KR 1ADQA 3DBXB 4MAUH 5LBVA 5HYSG 2P8PB 3RWJB 3TF7C 2NR6A 2PXYA 1E28B 3IDXL 5HHOA 5FUOH 3BP7B 2ZPKH 3TYFA 1I3GH 2B1OA 5D2NE 2X89A 5C08A 3X17A 3F6JA 1LWHA 1U8JB 4OLZL 1EXUA 2BMKA 5E6ID 3FL7A 4KUCD 4YSAA 2LQRA 5HPMA 4PJAA 1YECH 5CKGA 4JQIH 3RUGB 2D7OA 4R7VA 1RERA 2FEJA 2VDRL 2AJZB 2FJSA 3K0WA 5EZLA 2I60L 3HB3C 5KUMA 1T22A 4YIQA 2WMPB 1ZDSA 5GRVL 2IWKA 2XFXA 4AEHL 2DH3A 4M7KL 3QUZD 2OX5B 4Q74A 1ND0A 3NAAH 2WTPA 5HHOE 3T0WA 4M1CD 5GGRY 5C08E 4NZTL 1MWAB 4AQ1B 1OAKH 4Z7NE 4FXKC 4HWEL 2OK0H 3ZZQA 2B9AA 5I18H 1YEFL 1JF5A 3X11B 2MPAL 2QQLH 4ACPA 4UV7L 2DQDL 3RTQB 2QPDB 1CFMA 5TQ0H 1V3KA 4FS0A 2CLVB 1A4BA 2DYRB 3JVFC 4NQDE 3PHQB 2O1AA 1ET5A 4WW2B 4MAYB 2DLFL 4HWNA 2XTSA 5HHQB 4HSAC 5E6ZA 1SXBA 1TJIL 3MSPA 4UNVA 3OTTA 2R29A 3KH4A 3QXUA 1INEL 2BDNL 2OMZA 1NICA 3RNQB 4GBXA 5GIRB 2BHFA 2VQUA 1NDTA 3IMUA 4Y19B 4FABL 1UWGL 2PYEA 1JNLL 1I1AC 2VR4A 4LDOB 5ICUA 3VJ6A 2VDOL 3ARDA 1EZSA 3GEWB 3DRQA 1B4TA 3O9WB 5GRJL 5D9SB 5B3NA 2F1EA 5D1XD 1LLAA 1J5OH 1V3MA 2FL5B 5C2BH 3U6RA 3QUHA 1OAUL 3U0PB 3U9UA 2RAMA 3RNKB 4LVNB 2HFFA 2BY0A 3DX2A 1GSMA 2MTPA 2K9FB 1SJEA 3LHPH 4JO4H 4MRBA 4JG1L 4NB7A 3IJSA 3O11B 3FQ1A 3HNVL 4PVMA 1ANUA 3EFDL 1HEZA 1OAQL 2JQMA 1DQTA 4P2YA 2ZOTA 4J3BA 2R27A 3TU6A 4YDKL 4MDIA 4LKCA 1E5UI 3S8WA 4G8EB 3TZVC 3ZRSA 4Z3FA 3D0VB 2W59A 2XKUA 3WFBH 1J11A 4BZ2A 2AJXH 2OSLA 4L9LC 2RA1A 4M5YH 3RBSA 4MNGB 4NQEA 2PYEE 3KLSA 3OAWA 2HJKB 5I73C 1U9KA 3CUPB 3FFCB 4F15B 5JW4M 2AQ2A 4EZMA 3C2SA 3QNXA 1ODUA 5ALBL 3V4UL 4LEOA 2JCWA 4G7RB 1LVEA 4FN0A 1WFIA 2ATPB 1GVIA 2V7NB 5DUML 5I1AA 3EJCA 5JOFA 1ZTMA 4JY5L 3VU1A 4HCIA 3ELAT 1YY9C 1WICA 4FHKA 2PR4L 3DV6B 1L6XA 5FC9A 4AG4L 4CU6A 3WLWD 3OKDB 5GPRA 1F2QA 1MNUL 4YSSA 4AL8C 4LL4A 5E94A 2F19H 3CVIH 3D52A 1E42A 2NY6C 5ID1B 4NQEE 1A6ZA 1YLBB 2DQMA 3UZVA 3VXQA 4MD4B 2Z8SA 3BAXA 3LH9A 4HXBL 4J4PD 3WFDH 2FYYA 1JXFA 1F3JB 1KYFA 3X12B 2OL3L 1X9UA 1KIQB 3BWZA 1D5XB 1XGYL 4QY8A 4RMQA 5I66B 1HESA 2WSDA 4G6FD 5JPNA 5BMFL 1IE5A 4AJWA 5AW2B 3JWNH 2FX7L 4NQTA 5E8NA 3KBEA 1EK3A 5EBMA 4H0LC 2X2JA 2ZCHL 2ZX5A 4Y8DC 1KXTB 1UUSA 4XCNA 4DO6A 4Z7OE 4QRPD 1PGRB 2WYHA 4XT1C 3TBBA 5BO1H 2WWMC 3NFSL 3LZOA 4FX5A 1V7MH 1WEJH 2GKIA 2QMKA 1SEBB 3D3VE 3V0WL 3VQ2C 3NT0A 4OLWH 3ME0A 4N4YB 2Y5EA 4FFYH 3VXSD 1A3RH 1U8MB 3BP4B 2W95A 1FHNA 3HI1A 2QLYA 4JFVA 3VFUA 4E42B 2VWEC 3BD3A 5E2VL 3UZQB 2G60H 3IS0X 3MNZB 3EF7A 4DUXA 1JGUH 3PGDA 3QDME 3STBA 2N0MA 4P48A 5JUEH 1OM3H 5E2TH 3FUMA 8PAZA 5DJXB 3UBGA 5MEOB 5D6DA 1R5VB 1TCMA 1KIRA 4BH8A 2NLJB 4KITB 1OAXL 1R6VA 1T3FA 4FLRA 4J12A 1QA9A 3ZPDA 4EKXA 4Y1SA 4IKKA 4P59L 5I1IL 1WF5A 2UY6A 3EH2A 4XP9H 3OR7A 1KELH 1XSOA 4NT6B 5LCVL 1L9QA 1XIWA 1N8ZA 4YL4A 3KYMB 3C5ZA 4M02A 5F7AA 1CL7H 1NOLA 4WHTB 5FGRA 1OVZA 1C12B 1ROWA 3BW9B 1MW3A 1R17A 4XO3A 5ADOH 2G5BB 3MRPB 2ZD0A 2UY7A 3D9AH 4WUUD 4MCMA 5SWQB 1GZPA 1J0ZA 2YRLA 3NCJH 5I0ZA 1FORH 5HYFA 3R0NA 3MYJB 3MLYL 1MHPH 4NO0B 5AVUB 3ZE1E 3T6QC 4GRWH 2P5EB 5AW8B 1MAMH 4BE5A 1OARH 4JHUA 2R0ZL 4BZ1L 4NI3A 5BVJB 1T5XB 1LO0L 3MRJA 3BI9X 4UNUA 5FYJL 4PRAA 2UVEA 1ZVHA 1S9WB 1ZANL 4O2CB 3GTVA 5ETUA 4DTGL 4XBGB 1G5GA 2ZUYA 4UTBA 1A7PL 4F7KA 5FO8A 4JFHE 3BYTA 4ZYKA 4PRHD 3CXHJ 1NOFA 5DTFA 1AGDA 2VDLH 4OU3A 3QIBC 3FUFA 4TVPH 5I17A 2DLEA 4IM8A 2OMYA 4TYUA 1CZ8L 1K5WA 1HDMA 1BV8A 3PPEA 4OB5H 3AB0C 4AZ8A 3H2PA 2HAZA 1C16A 1NFDA 1D7DA 1QSED 5F3HA 3ZQXA 5CEXB 5LXVA 4QTHA 4BFFA 1MRDL 2OR8A 4GKLA 3ZMEA 3B83A 2ENSA 3EBAA 4U1NA 5CR8A 3RJDA 5C0RH 3S0PA 1QBMH 5DT1L 2K8QA 1CGSH 4JGJA 5BQ7A 3S4SA 1TQBB 4QO1B 5CBAA 4DW2L 5AZ2L 2UX6A 4OIAA 1NLBL 4ABWA 4MXWH 2WZPA 3ZE2B 3MREA 3GK8H 5CD5C 6FABL 1A6TB 2WNGA 3PP3H 1AR2A 4P2QB 1T6WA 1JWSB 1KB5H 1JL8A 2DYPB 1MCBA 2V2WA 3ARYA 4RX4D 3MOQA 1FDLL 1NFDE 2EEDA 3F6IA 5GGUB 5KBDA 2FWOB 1BG9A 3QUMH 3EJUA 4A7SA 4KK9C 2F54D 2COQA 4PJ8B 4WFED 2Q86A 1ZHBB 1T2QL 3AVEA 3L5JA 3ZDXE 4MMXB 5IB5B 1JPEA 1HQRA 3DSNB 3C5SA 3L4WA 5FB8B 1PZDA 3WOVA 4ONFL 1FIEA 1A0QL 5I82A 5C0NC 5T1JA 3NIDB 3OJDA 4MXQC 4O2EA 2YD8A 1J1PL 4R7NB 4G43A 2FH8A 4KGLA 3K6OA 2X4NA 1SHSA 5BUAA 5TPWH 1WFMA 5A2JH 2V9TA 1GGIH 2WYIA 4P4KC 1HIMH 3P4NA 4TUOA 1FV1B 2GB2A 1T83C 4HKJA 4UUJB 5IV2A 1AGEB 3HMWL 4M4RB 4F7PB 3SDAD 3OR6A 3FQXA 4JPKH 1IGCH 3RVVC 3ZU8A 5F7BA 3KCPB 4OBSA 1MFEL 1RPQA 4NQXA 4XXWC 2EH8H 1P5UA 4FTVB 1HXMB 2PPFA 3NZ8A 3CFTA 5F1SA 3JWDL 5JQ6H 2X4TA 5DEFA 3O8XA 4L4JA 1OW0A 2WBJC 2QR0B 5CUSH 1A4JB 1RKRA 4FLOA 3GEFA 4F58L 2E6QA 5CGTA 1QKZL 3DIFB 4X99B 5DLMH 3SHSA 1L7IH 2H0FA 1CPUA 3HN5A 3L5IA 4OI9A 5B3SB 5JIDA 1Q9LB 2X28A 2MCMA 2DN7A 4DGIL 1XCQB 4K7FB 4WNQB 4FTDA 2VN7A 5DHVB 4Z7QE 2Q8AL 3IJHA 4JPWL 1KBGL 4MQSB 1QI5A 1A7OH 1EJOL 1FBIH 3TCXA 4ECNA 3O45B 2FJHA 2JCCA 1MWAL 5TF1H 2Z31D 4DOHB 3O3EA 2CQVA 5IT2H 4PS3A 4G3YH 5EOCL 2JE8A 3MRCA 4HGWB 4OF8A 3AT9A 4I0PB 3B3BA 2NY4D 5HGBA 3GIVB 5GS1C 3D0LB 4LHUD 1N64H 3DVNB 1HSAB 3ZK0A 3V7AG 4X9IA 3RZWA 5BOZG 3QCUL 1L0PA 3VYNA 2GJZB 5T1LD 1SY6L 1NGQH 3VH8A 1CDIA 2WNKA 3JV6A 3FNKA 4JCMA 4OGAD 5J9PB 5DDHA 2R8SL 2X09A 3I6KB 3PFUA 3RDJA 4AZUA 1IVLA 3QEGH 5F9AC 4DKEH 4I3RH 1FYTA 2NY5H 4NQVA 2D7TL 4N68A 4BK8A 1RD6A 4Y4HB 2JCCE 1JAEA 2AQSA 2IV8A 3CLEL 2AEWA 4MNHA 3T6ZA 1KZYA 2X44D 2V6HA 2DMKA 2KT6A 1WZKA 3ZXAC 1MIEH 2NYKA 3FO1B 4NNYA 4A6YA 4WWPA 2Y6TE 3S5LA 5IJCC 2J6EL 5AW1B 1DVQA 1D9KD 4M03A 4ZO7A 3QBTB 1MF2L 4A1RA 5DZPA 3T0VA 5E6IA 1MAJA 1SF3A 4LLUB 3KPOB 1SXZA 1MCEA 4NQCA 3Q44A 5C09D 4GQRA 3WIFA 5DWUL 1KCWA 4ODVL 1FYTE 1L9OA 1N0XL 1C8PA 1C7SA 2XV6B 4DKFH 4FQXB 3CFMA 3WLBA 4ETYA 4E5XB 4QEGA 1F42A 5E8EB 1L0QA 2DQIL 3BISA 1PFOA 5I8KH 4NP4H 3RI5F 3WIIH 4I5BB 2BNUB 1TZAA 1LEIA 1FZMA 3B2UC 3NCYS 4F3FB 1EWHA 1LHZA 3S2AA 1WPCA 3QI9A 4NWUL 3QUZA 2LW3A 5D55A 4EVNA 1CDBA 4KY1L 3QQ9D 2FATL 3A6CH 2NY3B 5E56A 4CSPA 2IOIA 3I50L 5KVDE 1ZTXH 3QHFL 4BFOA 2D4DA 3DYPA 3LQAC 5F2FA 3MLTA 4P2OB 3NGBC 1MFAL 3DUHA 1FC2D 2WP3O 3ARBD 2ZWYA 3C2AL 3DDFA 3MA7A 3HCVA 3QG7L 3AM8A 5GRWA 3WTYA 4X83A 3H0TB 4Y7OC 5IVXB 2VDQB 3UTSB 5I19H 3OXSA 1D7BA 1HZHH 2VW6A 4DEPB 1G7QA 5DEJA 1VLXA 1MEXL 1QWHA 2MTAA 3AREB 4IGBC 3AMKA 3L7EB 3QUYD 1DQDL 5I8CB 4WI8A 1YYCA 3EYFA 4NC2B 2A3TA 2VXSL 4U1IA 1U95B 5HVGB 3GBNL 4WEMB 1TQUA 3P0VL 4ISVA 1ET7A 1UQSB 4M00A 1MY7A 4PJ9B 1XH0A 4J3OC 3IDXH 4JRWA 3F84A 4KC3B 1T04A 4PB9L 1E3XA 3GSUB 3VFOA 1ZMYA 5KSBB 1W80A 3BWAA 4NPYB 3KPMB 1EEZA 3RY5A 2V2XB 1KSRA 4NENA 3QWRA 3MTRA 4MMZC 4TUJB 1OOWA 4DVBA 1QATA 3P4OA 4BH7B 4Z3JA 3JTTA 4AGNA 3U2SB 1AKPA 1MHEA 4U1MB 2FGZA 2Y3AA 2F6AA 3DGCR 1UOKA 1XF3B 2ILLA 2MNWA 2J56A 1U8OB 2I60H 1RJZA 1ZGLP 3O4OB 2BFGA 3V6BR 5FYLD 1PKOA 3SKNA 3CFUA 4LSRL 3B9KD 4HC1L 1P9MC 4AEHH 4I88A 4M7KH 4BJLA 1MVUB 1ILSA 3HJ0A 1F18A 2EDKA 3ZN6A 4BBWA 4WHDA 4F1SA 5K9KA 1JF6A 4JNXA 4AQ8C 4NZTH 5DUBB 3HRZC 3QH3B 3QIWC 5AD0A 1ZPUA 3D1MC 1TEYA 3MLVL 4HIHA 3I9IA 1YEFH 2X7LB 1U3HC 2YPVA 3H55A 2MPAH 1G6RL 3TVMB 4AM0Q 5IROC 5ANHA 5KS9A 1P7QA 4M7LL 4UV7H 1EERB 2NNRA 4Z7WB 4G6AC 1CFTB 1I9IL 1TQTA 2DEXX 3PDOA 5J1AB 1F6AA 3MRLB 3KXFD 4XBPA 3AY2A 4L37A 5JW4N 2DLFH 3LCYA 4LCYA 1E43A 4MJIB 4MQXC 4Q6KA 3K1DA 4ZMTA 1DCEA 3KBPA 4X6CF 1KCLA 3O4LD 1TJIH 3CWGA 3GMPA 2FLMA 2L7JA 5CXPA 2BDNH 3RURA 3B8SA 2PETA 2JKJA 2E46A 4EI5D 2QKIA 2X0VA 5LNGA 4FAAB 1R5WA 4Y4FB 5PCYA 4ANUA 3V2AR 4FABH 1UWGH 2QQQA 1Z9OA 4J4PA 5SX5K 4LT7A 1JNLH 3HPLA 3QQ4B 1LE5A 1ZAGA 4KZCA 2VDOH 4L05A 2UWEF 3IU3A 3MGOA 1IEAA 2BVQA 5GRJH 2CO6A 3WYRA 5EIIA 2YC1A 3FU0A 5LXGH 3CXFA 5GSRA 4HWZB 4TM9A 4O58L 3KJ4C 1S9VB 2OMNA 3OC5A 4ZUVA 2HSIA 4B9GA 1OAUH 3QPQC 3Q2WA 4PR5B 2NY1D 2YMTA 3H2WA 2EZ0C 1G1YA 1IBBA 5GGTH 5EZOL 4JG1H 1G6VK 5F7NC 4F9LC 3HNVH 1MPAL 3EFDH 4LAQH 1OAQH 4JM0A 4MJ5B 2N7AA 4C8XA 4YDKH 1YN7B 3VB9A 4WW1B 4APQC 1BX2B 4S0TD 3ARGD 4RSVA 2CDGB 5HGDA 1AO7B 1O0VA 4MGXA 4MCYB 1N2RA 4YHML 1R19A 1XMEB 2OTWB 1BFOB 3N9GL 5AKSA 1XXFC 5HHMB 1CICA 4L3FA 4AMWA 4MXVF 2HTKC 4EF3A 5HI4C 3IFOA 5ALBH 1E9PA 4Y9BA 4XNQA 4PJXB 3O3DB 3VXTB 3AXLA 2PCPB 2A83B 2GITB 3ZY7A 4QRPE 2Q2EB 3JV5A 2HTLC 5CCHE 4JY5H 3GLAA 4B5ZA 4V11A 5C1MB 3WNKA 2PR4H 4L29B 4AG4H 5EU6D 2I69A 3UAJD 1MNUH 1A9EB 1SOKA 2IBZY 4WUUA 3RVTD 2ZXAA 3L7FA 4YMPA 2VZUA 1NC4D 5IESL 3JYCA 1E7UA 4OGQC 2AV7A 3FUDA 3HS0C 4BZYA 4G7YL 1F45A 3NIFE 3JXAA 1J9CT 3QJRB 2OL3H 1XGYH 4LVOB 2A7BA 3MLWL 1ZA6B 5BMFH 2FJGA 3TIEB 2MIZA 2W60B 4FQPA 7FABL 1PNCA 2FX7H 4N8UA 3UADA 2MFNA 4OCWL 3D2UA 2X0UA 5DJDB 3CN2A 3RDTC 1UB6B 4NBYB 4WFFE 2ZCHH 3L54A 4O2FB 1FZKA 3MFFA 2A4EA 4ZUUB 3NFSH 4MKMA 2CR6A 5B4MD 2OMVA 3V0WH 3C8KA 1QPPA 1HE7A 5D1QA 3LZPA 1N68A 4WUUE 3TJHC 1KIUA 2UZIL 1QSEA 3G7TA 4PCSA 3GSWA 2C4XA 2OI9B 3UTTB 1MNNA 1CMOA 2J8UA 5DZJA 1CYWA 1K8IA 2I25N 1JNHA 4NFDA 1MCKA 5E2VH 1HILB 2WVVA 1GYWA 4CW1A 3ZL4L 2GSIB 2JVUA 3UPRA 1X5AA 4ZFZB 4K07A 5IUCA 4XMKL 2YSTA 4DN3H 3JTBA 2NY0B 4R9HA 3HKZA 1OAXH 1X5LA 1X9LA 2ZAIA 3NTCH 5DHDA 4YQXL 4UNTA 4L5FE 2WB7A 4Z1PA 5T3ZD 4P59H 4NIKB 1I7RB 5I1IH 3CFDB 1BD2A 4WWKD 1USQA 5LCVH 5ITBL 1FFNA 3MRRA 4RX4A 5D1QE 4HUCA 2NX5B 3MNMA 3VRJB 2YSSB 2A73A 4U4BA 2YEZB 1QSEE 2IAMC 2WJ5A 2GEQA 3KR3L 1XVSA 3ZKND 3M8OL 4EIBA 2J8UE 4PJGB 4JUSA 4LEXL 4IBUA 4DQAA 4IRZL 4GIPD 4JKNA 5IEKB 4XPFL 1WRFA 3W39B 5L4FA 3MLYH 5FCSH 4MD5A 3UAAA 3VSVA 3FT3B 5DRNA 2H6PA 4WNJA 4PEEA 2VN6A 4ESKA 1B88A 1HS6A 4G1EB 4AYSA 4BZ1H 1R75A 1ZIBA 3IU4L 1LO0H 4I9XA 1ZPLA 4K3DL 5GISL 1H3XA 5HDWA 4JMXA 3BZEA 2BOBB 2FT8A 3O2DL 1ZANH 4AGMA 1ORQB 4OAWA 2EIMB 4OR1A 5EC1A 5JOEA 4DTGH 4X50A 4DHLA 4UAHA 5JHLL 1A7PH 2G2PA 1H5BC 1U4EA 1BD2E 2D3JA 1IEBB 1UACL 2QFPA 1KJ2B 4N0UA 4TLKA 3DX3A 3K81A 1CZ8H 3KPSB 3QDGB 2NXZC 1MW0A 2F54E 2WKGA 1PX8A 4DCQA 1FVEA 2WUBL 4WFEE 3SDAA 1TQVA 1AR1B 2WHVA 1WT5C 3FRUB 3HC4L 2GTZA 4GG8A 1L0XA 3EO1B 4CAGA 2A77L 3NCMA 3FZUD 4X4YA 3IVKB 2Q2LA 2D3LA 1K4DB 1MRDH 2EDOA 3L3JB 1FO0B 3U25A 2YRBA 4KROC 1Y18B 3BZ5A 2EO9A 3EOBA 4Y4KB 1PLBA 2AS5M 4RMRA 5DT1H 3V5KB 5ACZB 2GCYB 4DW2H 3RUGF 3BGMB 1NLBH 3S6CA 2O30A 1KIPA 2DQGL 1S7RB 4MJ2A 2VLKB 4UB0H 3E2HC 1OWWA 1UUNA 3CZFB 4CC4C 4X6FA 6FABH 5SWSB 4HJTA 1LEGA 1DL7L 2YKLL 3VMNA 1YQVL 1CF8L 5EOTB 2D8KA 1JCVA 4LE8A 4GKZB 4PRDA 2IXQB 1IC0A 4V33A 4ADJA 3QRBA 1FDLH 3HW7A 3IGFA 5I5RA 3IAGC 5DJ8A 3PWVA 4KVCL 4OI7A 2ICEA 2Z8WC 4DP1X 1T2QH 1OM9A 1A6VL 1BZ8A 3CCHB 3TBVB 3CPUA 1R34A 3AAZA 4UI2A 5L8KB 4OT1L 5IIEA 2MSPA 2FEDC 2X2UA 3TN0B 2FE0A 5K69A 4I18A 4HLJA 4ONFH 1BA9A 4OFIA 2RFXA 1A0QH 3P0GB 1P84K 2ZE0A 43CAB 2X6VA 4N2LA 5LBSL 4GSRA 3CDYA 1J87A 1J1PH 2JFCA 3JVGC 5KYWA 4JFQB 4P2CG 1ES0B 1KV3A 1RUKL 2PO6B 4QHKJ 5I74C 1VFAB 4MLIA 5TDPB 4BFEA 3U7AA 1I7ZA 3TH4T 4I1NB 1JZ7A 2FHFA 3MXVL 2BW5A 3HMWH 3LZNA 4F7EA 5L8LB 1KTLB 1Q9KA 4ENZA 2VJ8A 1T1ZA 3OHXB 5EBLB 5IFAL 2MPVA 4NLHA 2VUYA 5K1JA 4PD4J 2EKSA 1A4KB 1LYQA 2E4TA 4IOFC 3L9BA 4XP1L 2GUYA 2ZICA 3PRZA 2UZYB 3P30H 1J8HA 4FA6A 3JWDH 4XX1G 1D9KA 1QZ1A 3ARFB 4R4ND 3HFFA 2QLVB 3ROOA 2XG5B 4X6EB 2G3MA 4XB3A 5DC4B 1QKZH 2A6DA 4HQQL 4POYA 5H4YA 3PGCA 1HTYA 3PYCA 4K3JL 3TNNA 3WJMA 3GB7A 1KBKA 2ICCA 1HH9A 4DP2X 4WUKH 3UPAA 1JZGA 4NM4H 4NN6C 4DGIH 1XTMA 4EIUA 5E1QA 1I85C 1SJMA 4N8CL 4Q4EA 3LS4H 4TL4A 5TE7L 3VD3A 3VSTA 2Q8AH 4AVHA 5GS0C 4J3OG 4JPWH 5F70A 1KBGH 1ECZA 1D6VL 4CU8A 1KYOK 3FOLA 1MAKA 1BMWA 1EJOH 2ATKA 3ERXA 3HI6H 3VRIA 4AM0A 3FAXA 4R4BA 2BIPA 1INQB 4MLSA 2X40A 4PI0A 3UBHA 5DSCB 3FXIC 4K15A 1R3LB 1AE6L 5EOCH 4FFVD 5J6GB 3VM5A 1J8HE 5FLVA 4ZUSA 3EFFA 4GUQA 4PJCB 1R24B 3OKEB 4XMVA 1ZLVH 1A9VA 3QJFA 1EXGA 2YPLB 5JW5A 1YNLL 4OZIA 2YZ8A 3NJGA 1AZVA 1XCWA 1RZFL 3QCUH 5D2NC 4JO1L 5DCCA 3TGXA 5IHZA 1SY6H 2W80C 3GRWL 1V7NL 2CRMA 1XZ0A 2IDSA 3MV9D 4I4WA 4ELDA 2PPEA 1H3GA 2R8SH 3SDCA 4M8QA 2FQEA 4KJQC 4NDMA 3H2QA 1JGLL 4L1LA 3M1BB 3ARBA 4M3HA 2A9NH 2EIDA 4KDTC 1XBRA 3NABL 5GZND 3SN6N 1W0VA 3HHSA 3OZKA 4GI8A 4PJDF 3GBEA 3T77B 5HYSB 1TTUA 5DD5L 1WISA 1SVZA 4X5WA 1EEYA 2EIZA 3ZZSA 1IM3A 2XLLA 3KPPA 1FIGH 1D5BA 5CEZD 6TAAA 2XVGA 3GHEH 1NDMA 3QGVA 3IE9A 2QSCH 3I9PA 1S7SA 2O6FA 2CKBA 3L45A 2ICES 5IB2B 2J6EH 2PXYC 4KH9A 2E9BA 1QRNB 4OZIE 1O9ZA 2DWXA 3LN4B 3QQNA 2AQPA 5BV7B 5D6CA 4W6WB 1MF2H 4F2EA 5D5MF 1EANA 4X98B 2EUVA 2AQ1A 2Z0UA 4PJHF 5LGHL 2R1XA 3RVUC 2XN2A 2R2HA 3IT8D 1XGPA 3T3ME 3X1BA 4W9DC 5ENWB 3NEEA 3K74B 4XN8A 4FEMA 5DWUH 2Z1KA 1TTGA 2FHCA 3K72B 3VMOA 3IKKA 3PP3K 1N0XH 1R47A 1HINL 3DMMA 2XTLA 1UWXH 2Y07L 5IOPA 4M48H 4QRUB 1JI2A 1ZHKB 2BOCB 3O3BB 2DQIH 4AKQA 1WLHA 4XXDB 3BDBA 2WSPA 3SBWA 1HXYB 1GC1L 2E7HA 5ITFA 1EBPA 1H15A 4IRJD 3SCMA 2VDNB 4ZMWA 4NWUH 1LO5B 2F7PA 2AKRB 2N1TE 4O00A 2DEYX 3C6EA 4KY1H 1KG0B 2FATH 2WNXA 4ZX4A 3I50H 5FUZL 1CURA 2UZPA 1MJJB 3OKOA 3DOHA 2AI0L 4Y2DB 3QHFH 5ICYB 4TSAL 2D03L 4QHLB 1FNLA 1MFAH 4QRTA 2J5LB 4G42B 2PF6A 1QTSA 1T1YA 3C2AH 3CGTA 2HZHA 2EE2A 3QG7H 5L9DL 2JKRM 5SWZB 5A7EA 2BK8A 4QIRA 2UUDH 1SOSA 4J3TA 4KKCC 2R15A 3U46A 3WIHA 5FYLE 3DX8B 4FHBD 2HT3D 1XQ4A 1E50A 2XICA 3O4LA 3BUIA 1MEXH 3G3LA 4GBXC 1DQDH 1X3DA 4EI5A 1NCNA 3T3PF 2VXSH 5KYYA 3TM6A 4EN3B 3DETD 3GBNH 4CADA 3P0VH 4S10A 5F9WB 3L95B 4HKXB 4IU3A 3LOWA 4ELMA 1DANT 3ARDC 3IRPX 2OMWA 4K7PL 1XD0A 4X7EC 4OQTA 5G4OA 3V10A 3K6SA 1MQ8A 2B4CL 2DQ6A 2R69L 3N41B 1OF2A 4PY7B 4Y9CA 4LCCB 1X6LA 1X5GA 2FECL 3TTSA 3QIUD 4Q52A 4IHOB 5DJ0B 1B2YA 3HLAA 1OB1A 3AXIA 3TCLB 1OGTB 4X5LA 3TTYA 1OOAA 2BIHA 4KK8C 2IGTA 1TQCC 3RGVB 1W72A 4JY6B 3T04D 3O4LE 4AC4A 1DSWA 1RUPL 2GAZB 5KYNA 3QYCA 3PWPD 1PG7W 2LV4A 1R3KA 4TNVK 3ARGA 1JZ2A 5DK2A 1UJ3B 4LSRH 2K6WA 4HC1H 3QCTL 4WJ5B 3TV3H 3F7YB 1ZA3A 1USZA 1QFUL 1G7JB 1KCUL 2VJ0A 4OZFB 2WLHA 4RAVA 4XMTA 2VTFA 3MNVB 4OD1L 2JB5L 3D07A 4KNUA 3E6FA 2K78A 3BQUD 4H1LG 4JDVB 3WDJA 5CJ5A 1MCJA 2Z64C 3MLVH 1OSEA 2AXJA 2XWCA 5JO5B 2DQFB 5CGYD 1G6RH 1YEDA 1UEMA 2XKSA 4M7LH 2OM5A 4HAKA 5EEVA 5TK2A 3BAWA 5DQ9B 1I9IH 1DN2A 2HJLB 2ITDA 1E4KA 3QS3A 2R23A 1CDHA 4FQCL 5F7DA 1GYAA 4K71B 2QL1A 2EE3A 4I89A 5FM5M 1NKGA 1KYUA 3DX1A 2AJUL 3DVGB 4HAFA 4NNXB 4TVPD 1NC4A 3AT0A 3LEYL 1K4CA 5EEXA 3F7PC 4UBDD 4F37K 5CLWA 1M2VA 2DBLH 4YFDB 4ZS6D 3MGAA 1XMWA 1HCYA 5D7HA 2D3VA 3BHBA 3NIDF 5FYKL 5FWQA 5JPNC 1T1XA 5DJ2A 3BX7C 3VXMD 4BSJA 5FDWA 1M05B 4WU5B 2H2SC 2MKWA 3EGXB 4LOUD 2H6UA 4K5LA 2DM3A 4M7ZC 2B59A 1OCOB 2Z4QB 2IDFA 1YNTB 4XMXA 2FWUA 2VE6B 2W0KA 2Y4SA 5DMJB 2DF3A 5EU6E 3PXJA 2VXQL 5EZOH 4BK4A 1UG9A 4XHJD 1GZHA 1MPAH 1TQSA 1V3JA 4XMZA 3ML8A 2I5YH 3T1WA 1SN0A 1WA2X 3IDJB 3N55A 5TDNA 5HDBB 3CDGA 4A66A 2C3VA 1BIHA 1G4MA 3LKQA 4YHMH 4QF1A 2CJUL 3WKYA 4UAOB 1UXWA 1IM9B 4CMHB 5D6DC 4EI0A 3RKDC 4B50A 2AAAA 4ZTEA 1D2OA 2YA1A 4R5TA 3L1FA 1FFTB 3GRBA 4LLYA 4EUPB 3MNWB 2ZCKL 4EBQH 4G6KL 4AMXA 1T66C 3VFNA 1XIWC 4WWKA 1RJYA 3C5ZC 4B7IA 4E41B 1PCXA 1G94A 1K3IA 3BPNB 3UBFA 3Q43A 1OQOA 1ET8A 3K3QA 2BP0A 1EBAA 4OLXL 2FDBP 4AIEA 1K85A 3P3RA 2I9TB 5H37G 3WNMA 3QZPA 2DJ4A 5IESH 1XT5A 3AU0A 2PWEA 3QDHA 2EE9A 2ENPA 4OFQA 5CGBA 2AQTA 4MSWB 3D69A 4G7YH 4M6NL 1G9HA 1BOGB 1IC5L 1EAQA 3LZLA 3MLWH 3QO1B 3NFNA 3N0AA 3V0AC 4GW1B 4IRSB 7FABH 5IB3A 4IEFA 4LOFA 4OCWH 4ZOEA 1DEEB 5T3ZE 3CSBA 3WE6A 4LPCA 3C12A 5EF0A 1YEEL 4M9PA 5LGJB 5BS0D 4UQCA 3ZGHA 4HH9B 4WWNA 3NPSB 1W8OA 1BYPA 1NAML 2E4FA 5DGRA 4KJYB 1N5AB 2CRZA 2EDYA 5JXEA 5A3IC 4FE9A 2ETWA 2UZIH 1P69B 2NY7L 5H94A 4YPGB 1PD1A 1LP9A 4QHMA 4AGOA 7CGTA 1E9QA 4U3SA 3C6LB 1KFGA 1SJXA 3ZL4H 1LEKB 2VISB 3QZNA 1WBZB 3HBQA 2GSGA 2WLYA 5LDUA 1E0OB 3BT2H 3JTSA 1Z9SB 4XMKH 5HDLA 3RPIA 2YJLA 3DURA 2BZCA 2YD9A 3JSSA 4GUPB 5CD3B 3ZLQC 2CNYA 5D7JD 3E8VA 4YQXH 4JZOB 3RL2A 2DQTH 5JHDD 3NCYP 5A16A 1IV8A 4UQEA 3AROA 2X3BA 1MUJB 4G9DA 1FRGL 5ITBH 2DAVA 4O9HL 5DQDL 3SPHA 3D6GA 5IMOA 3ESUF 5E9NA 3VYOA 4PRPD 3OM3B 3KR3H 3TJPA 1S78C 4HT1H 4JFDD 3V55A 2HFGL 4LEXH 4KTDL 4IRZH 4OJDH 4XPFH 3TA3B 1LP9E 3A23A 4JG0H 3HPJB 4M6OL 3UC2A 3NJJA 5J0BA 3PJLA 4ADIA 4XPHL 3HBZA 3BVWA 1RP9A 5GISH 1JXKA 4K3DH 5DRZB 4B96A 3EJYD 1KJMB 4AH2A 3UJIL 1JHLL 3MDJA 3O2DH 2QHRL 2YQ3A 1FG2A 2X42A 2H32B 3IMVA 3LV3A 5HVWA 4HK3J 1BXAA 4B3EA 1TSRA 2HUEA 1I9EA 2CO3A 3QZWB 1VESA 3HZYB 3ZHFA 1AIFA 4CN4A 3DV4A 5IVXF 1GS6X 2YMOA 1U2HA 3D33A 4C4KO 1UACH 4KI5C 1MI5D 5DU7A 3SQRA 4BINA 4C47A 1NTDA 1S9KC 4A68A 3QUXB 1HXKA 3EJJX 2D7NA 2K3TA 3OMIB 1TCRA 2FX9L 1QSZA 3RA7L 1N59B 3B7RL 4DEUA 3HC4H 3UP1A 3RIAF 2GT9B 4IBLT 2A77H 5DO2C 1P5UC 4UDTB 4J1UB 1X5JA 4WTXA 4OD2A 4ORGA 2F8VA 3B9DA 3O8XC 1LK2A 1OW0C 4I2XB 3LPPA 2SODB 2DEWX 4GAJL 1JPGB 1AHMA 3W57A 3Q6FB 4DUVA 5KYXA 1JD7A 5CEYA 2DQGH 4FYQA 2J12B 1F11B 2CBPA 3VYPA 4FKKA 1UA6L 2WK2A 1DL7H 5C0GA 4U7MA 2YKLH 3BKML 2R1WA 3ZTCC 1YQVH 1CF8H 1OAJA 5HHXH 4A04A 5E5RB 1JGVL 4HH8A 3HB3B 1NAKL 3H8NA 4N2DA 1FWXA 4I8DA 3L3HB 3CN0A 3BWUF 3LRSA 1R9FA 3O3AA 2WYTA 1AG6A 1RVFL 3O81A 4KVCH 2L0DA 1PVHA 1A6VH 1WAAF 4GQQA 4ODSL 2Z92A 4OT1H 4ZX5A 1BZOA 4BQ8A 3UGXA 1VFUA 2CPCA 5GJSL 2G3NA 3BPCB 5G55A 1O5DT 1AACA 3TEYA 3KGSA 1EHXA 3ABLB 3VG0L 5EU4A 3O6FD 4G80A 3S96A 4FXKB 4F2MA 5I8OL 4JR9L 1TR7A 1IVTA 4Z7WF 4CGTA 3MV9A 4F8OA 3CIAA 2OYPA 1WC7B 2ITCA 4ZJ9A 4BSVB 4I48B 4IBSA 3B5HA 2RQ8A 4PQXA 3DO7A 4J3XA 2QSQA 3OPZL 4K73A 3SDXF 3TC9A 3FTZA 5E6RB 5AB0A 1RUKH 3BGFC 2F68X 3LNFA 4I13B 4M7LT 4NKQB 1F6FB 1HHHA 2H47C 3HZ3A 4FMFA 1U92B 4PRBA 2NSXA 1AZCA 3MXVH 2BY3A 1KPVA 3GS7A 5IFAH 4W6XB 1FJ1A 2WV3A 2CO2A 4EE2A 2E86A 2FSEA 2J21A 4XP1H 5MENB 4G8FA 4JFPB 4XE0A 3HE6D 4XO9A 3WUWB 1F6LL 2K7QA 3EYQD 4KFMA 2J57A 2FT7A 1I1AB 3T2PA 1BYNA 1NSNL 4JAMA 4PMFA 3U4KA 1A6UL 3BAIA 2HRGA 4F2ME 5MHSD 5AW9B 4QXTB 3FQ4A 5I2IA 5E6IC 3MV9E 1BCIA 2GTQA 2W9DL 4PWJA 2VLRB 3Q2LA 4F80A 4MD0A 4KKQA 3OZLA 4X6BB 1KGCE 4K3JH 5AB1A 4PLJD 4QT5A 4NO3B 3LZQA 5DQJB 2FSDA 4CNIB 1FVCB 2P28B 4YHKL 4IBYA 4LCWD 3MGTA 5TE7H 4N8CH 1WS7A 4L4TB 4BFNA 1VGEH 2IFFL 3LQAH 4PFEA 2VLMD 4J8RA 3V4PB 3MX0A 3LXAA 1M7XA 2QQNH 2WLIB 3SKUD 3BSGA 3TZVB 3MRFA 1IL1A 3UYPB 3QI9C 2ZNXA 4L9LB 1KBVA 1AE6H 3ILQC 3QUZC 2F1BA 4L1BA 4PW4A 1YSOA 5T5FH 4M1CC 4UCFA 3SKOA 1AQKL 1QLEL 4PJXF 4P3DA 4X0NA 1OAYH 4YGVB 3PG2A 1YNLH 4PP2A 4Z3EA 1YN6B 2YKKA 3BIBX 1RZFH 5KN5A 3V0JA 4JO1H 1HI6B 1HHJA 3GRWH 3QULA 1V7NH 4BV1A 2QPSA 4Z95L 1JGLH 5IQLA 4NKMB 3FS9A 3AM8C 1WWCA 3L4XA 2F58L 2GK0A 3NABH 1G1CA 4J3OH 4NJAL 4U6VH 2X53A 1SQ2N 1U93A 4H4NA 2AEOA 1HU8A 1QX1A 3PF2A 5EULV 3SGJA 4W6YB 1IAOA 2C7UB 4Z7VB 3RVXD 1HOCB 1ZJAA 3CFBB 2NY6B 4BKTC 4JDEB 1M57B 4ATTA 1T7ZA 5F6IC 4YFEA 1WO2A 3QNYB 3NDZE 2NW3A 4FFYA 2WLKA 4YDNA 4TTDD 4OGXL 2HYMA 4R96A 2GI7A 4WI0B 4KXBA 5B1JA 3QIUA 2XZCH 4W9FC 3MCKB 2AMUA 5B8CB 1MCRA 3MRIB 1AD9A 1G9NL 3H3PL 2X3CA 4UDUB 1HINH 2FD6L 5KOMC 2Y07H 3OKMB 4XRCB 5BXFB 3BCFA 4L48A 3V4VA 3X1FA 1IIKA 1SMOA 3KGRA 4PCTA 3N2JA 1GC1H 4BE6A 2ZSVA 3IMRA 5JYMA 1FHGA 2GVYA 3KLHD 5E9DB 3U4EB 3FQNA 4WO4D 3QO0B 1S8DA 2GY5A 3KPLB 3MTXA 3CMOL 1PD0A 2O61B 3EIFA 3KBFA 2NW2B 1RJCA 3SSGA 2K3HA 4LK4A 4E9QA 4X6DF 4PJ5D 2AI0H 3CVHA 1N8OE 5L2KB 3T0AA 4TSAH 3I6GA 2D03H 2YD7A 2EYSB 1NCAH 5JNYB 3LPFA 4PJ7F 3ABZA 2G2NA 2ZYIA 5AYQA 5L9DH 4PJGF 4KRPD 1QHPA 1U8HB 4PV8B 3DTUB 4C4KT 2GJJA 3PWPE 3I75B 2PR9A 1FN4A 3EJRA 2F53D 4PCKA 4BDVA 4Y2OB 5E1IA 1VCBC 2QKIC 1QD0A 2WLZA 3X1EA 1OGAD 1KY6A 5C9JB 2OQJB 3KW7A 4YC2C 5EEUA 2AXFA 4H8WL 4K7PH 2WZ0A 4TSCH 5ESQA 4ZFQA 5C9KA 5AEAA 1CG9B 2B4CH 2R69H 1QO3B 3VXMA 5I6NA 3NJXA 5E24E 1ILUA 2CKNA 2YQGA 3G5VB 4HUVA 2HN7B 2P3YA 5D1ZD 5KSVA 1ERNA 5FIEA 2FO4B 3R1GL 1XGRA 3QIBB 3HG4A 3C08L 3L1EA 1UADC 2HRHA 4XMLL 4JG9A 3LNGA 5AB2A 2YD1A 4GAGL 4LGSB 2G3ZA 3AB0B 3CFEB 4TVPE 2EDHA 2X1OA 1RUPH 3V0IA 1KB5A 2E9IA 1T03H 3LKOA 4JRXD 5IW3A 4V2BA 3I3EA 3QCTH 1ZLEA 2P4AB 3QUMA 4XP5L 5HVHC 2AGJL 1QFUH 4ANKA 1ZLVK 1C08B 1CICC 1KCUH 4G71B 1X5KA 1S4IA 5F0JB 1VKXA 3QORD 5E08L 4OD1H 1B2WL 2ICWJ 2JB5H 2WBWB 3VCLB 5J6SA 3VXME 4KJWD 1TT6A 3L9RB 1UXMA 5EO1B 5F1KC 5FF6A 1MCWM 3MV8D 3KPQB 4IU2A 5FYJD 1FFOB 1NM4A 3IAPA 5T1KB 2FRGP 4FNTA 4N2OA 1KLUA 3H9ZA 1TZGL 4FQCH 2BVUA 4L8BB 4UM8A 5K39B 3S4SG 5F7KC 4AT6A 4UTBL 2VZTA 3L4TA 1YPZF 2AJUH 5J5EA 3ARXA 4UQIM 1CFVL 2VMFA 5CIPB 4N26A 1F41A 4NHCL 1CXLA 1JWUA 3LEYH 2VZ1A 3MJWA 5GGSB 5DJCB 5DJAA 1NCIA 2NZ1A 1A7BA 5JORA 2XWJA 1S7QA 2NUPB 4JFUA 4Z5RA 3IS1X 4H1LH 2OXGA 3O2WL 5FYKH 4POUB 4GAAA 5HGAB 4F33A 3ZHNA 1YC7A 3IF1A 4UOZA 4IMKA 3Q9QA 2IVFC 4KQ0A 2EYRB 3ZDZB 3ZYIA 4NAQA 1DDHB 3FU9A 3RG1C 1JWMA 1ORSB 4TQEL 5F97E 3IFNL 4ZW3A 1IAII 4P4KB 5BS0A 1UWXK 4DK5A 1WHPA 2LE9A 2VXQH 1TYEB 4W4OA 4P0DA 5D1QC 3VFRA 3V9CA 1G1OA 1SYSA 3FRPA 4JX0A 2EACA 3CLFH 3BJLA 4DP7X 2I7SA 3PCYA 1KPUA 3PY9A 5FK9A 1EVUA 3BMWA 1MHHB 1NGWA 2CJUH 4PAZA 5HYJA 5BCAA 1RK0A 1ITCA 1BFVL 3CZJA 5F3FA 4QRRA 2V5MA 1P0SE 3IDMA 3L4VA 4UQ2B 4EQ2A 4FI7A 1S6NA 1BQ5A 1JVOA 4BUQA 1RI8A 4JHBA 1VFOA 2QPFA 2H26A 4G6KH 2XC8A 3H3BC 5BS0E 1RPUA 4NWTH 4CUCA 4JE4B 3X13A 3GWJA 5IK3A 2UUDK 2J3SA 4R3SB 5AQ0A 1KV7A 2FR4B 3BZ4A 2WXQA 3AQXA 4OLXH 4PRPA 4JFDA 3ULUC 1DQQB 4PJCF 3D4ZA 4U1HA 1XBDA 2XXFA 4QRSB 1D5IL 1Q4NX 5K9QI 3PXLA 5LWYL 2EVIA 2A9DA 4JJOA 3FQTA 4JVPA 3ZIYA 4PG9A 5HYJE 5DZLA 3FSAA 4M6NH 2H5UA 5GS1B 4R97C 1IC5H 2R2BB 4QRRE 3S3SA 2F61A 5D7LB 3RWFB 3B34A 3DVFA 2NDFA 3GXPA 3U2JA 3Q5YA 2K0RA 4JZJC 5CSZA 3NVQA 3DK2A 4MMYA 4R4FL 2E7LC 1OK0A 5F88A 2V37A 2Q76B 4AIZB 1DFBL 1MI5A 1WCBB 1YEEH 1ADWA 5IP4A 4ICXA 2DKSA 1O6SA 3AQDA 4PRPE 3QXAB 4Z76B 5F71A 1NAMH 5H37H 3SDAC 4JFDE 3UBXI 3NCEB 3WJLC 2VMEA 1PDKA 3MHZA 5JZ7D 4X8GA 2VOTA 5KSAA 2CM5A 2IALB 5E4AA 4JN1L 2OJEA 4UV4H 2BRQA 2UZXB 1PSKL 4EOWL 4UU9B 5AVTB 1OEZW 4RQQB 4X5RA 3LRGA 1M71B 5AW4B 2I9LB 3QQDB 4WV1B 2PP7A 1BJMA 2GIMA 3RTQD 1IKFL 1MI5E 2UV3A 3S5LG 2X3AA 1ZEAH 3MRHB 4LGPB 2VZSA 3FYEB 4MAYD 4YK4C 2ZUTA 1FRGH 4D7BA 3CG8A 4O9HH 5DQDH 3IKCB 1GOHA 1DSFL 4YO0B 3BIKB 4IKLA 1WV7T 2MWCA 2WGXA 3MRGB 3HR5A 3DROB 2HVJB 2Q5BA 4PGJA 4KTDH 1NEZB 5TGBB 4A2FA 3KBHE 4I1PA 1AGFA 3DPBB 4DJMA 1BEXA 4Y19D 3CZUB 4JANB 4FNRA 2NY4C 2QQKL 5IMKB 1MHCA 4FEIA 5EZIL 3A6BL 3NA4A 4I18C 4P2RB 5T5NG 3T0EC 3O9WD 4FJ6A 3C8HA 4RWYL 1VZIA 2YAMA 3UJIH 2AJVL 3ZVVA 4PGBA 2QHRH 4OGAC 3VA2C 1ED3A 4KMLB 5FA4A 1I8AA 3Q8CA 1ZTXE 4CSTA 3U36B 2R2EB 4TTGA 1QOKA 1HHKA 2B77A 1AHKA 1YAIA 3BRFA 3DXAA 3F2LA 1JGEB 2YGNA 4WU7A 1JZIA 3LYRA 5E4EC 2NZ9D 1VEMA 3UPCA 2X9YA 3UH8A 3RWHA 2GIXA 4H25A 5IUSA 5J3HD 4Y9FA 2HWZL 5GS0H 2DLGA 4TNWF 1QYGH 2Y22A 5BRZB 4E9SA 3FFCD 5E00B 3MO1B 3OKKA 2EECA 1QR4A 3GMQB 3MRNA 4XNMB 5DFAA 1H0DA 3QUKA 2A6KA 4GAJH 1U36A 2DM2A 1D5MB 2X0WA 2XG4A 3FCTA 2J2ZA 3QFJB 1E9OB 5EUOE 1N6QH 4EZLA 3LQZB 2CCVA 3CFNA 3BVUA 2XV2A 2VZOA 1KN4L 1IC7H 4PIRF 1IBGL 2YEQA 2YXFA 5C86A 1KB9K 1UA6H 3KGUA 1J05A 4FZ8H 3IFLL 1A25A 1AC6A 2Z93A 3Q06A 2XWBA 2N01B 4WRLA 4Y2NA 3GMRB 1JGVH 1NAKH 4HIEB 4RDQG 1U42A 1S3RA 1MREL 2JJSA 3SJVB 3TFKD 3G5YA 5C0CB 3MJ9A 5IHBA 1GMEA 1I82A 1RVFH 2BSSA 3FTYA 3QJHA 3LKRB 3FH7A 3QQ9C 4ODSH 5C6TH 4XVSL 1M6OB 2DIJA 1YZZA 5MHSE 4ABQA 1CIUA 5T1MA 2FH6A 3VG0H 4YXLL 1A7RL 4HUXB 3RFZA 3SDCC 1U3HB 4GSDL 3GUTB 4PP1C 3AC0A 1D7CA 2YQ2A 3ARBC 4ZAKA 4LCWE 2EVFA 4B27A 1FNGB 2E5EA 3MBWA 2WCPA 3CFJA 3S34L 2VMDA 2YD5A 4L8DA 3PABB 3S35L 4R7DA 2K7PA 1QEWA 3TL5A 2DIAA 4XX5A 5I8EB 4QYAA 2J71A 2LTQC 5ID0A 1AAJA 4X7TA 1ZGLB 2WSKA 3CHSA 2A4CA 2XACC 3GPEA 1H8LA 2BSEA 2P47B 1CUOA 5GGQH 2EEFA 2C3GA 5E1AB 5BZDA 5L0QC 1A6UH 1JJUA 1GGUA 4U0QB 3RHWF 1JV5B 3IM1A 3DLQR 2HFEB 3PAYA 4NSKA 3S88L 4FQ1L 3GBLA 2W9DH 5IMLB 3KJ4B 2IPKB 2VERN 4P5MA 3GF8A 2HG0A 1EXHA 4JMNA 1NCBL 3PV7A 4ZFGL 3DMMC 4YHKH 1I8IB 1A02N 5AOKA 5EIIG 2XHNA 4AYEC 1MLCA 4JRYB 2QADC 2ZKXA 4F8NA 2IFFH 3OXRA 1L9PA 5ICZA 3SBWC 1FVDA 1KJVB 5IJVB 1T4KA 4APQB 5FGCE 4HWBL 4NO0D 5JA9A 1Q8MA 3SCMC 2ZOLA 1MCQA 4X6CA 4CVZA 4PYHA 4HZLA 2P5ED 5CFHA 1AOZA 2YUVA 2XT1B 4LBEA 4MBOA 1UVQB 2GG1A 3D0AA 2RH0A 1AQKH 1QLEH 1URIA 3MRMA 4BFJA 5JDJA 5HI3D 5I0WA 1XEUA 4AI7A 1FNHA 4PLNC 2DWSA 3B2VL 3MRQA 2UWEA 3L3DB 3GSRA 1WG3A 3KLAB 3A4EA 4XPGL 1A21A 1I3RB 1LD9B 2OL3A 3ARWA 3J8F7 5LBGA 3QG6A 1TPXC 43C9B 1KT2B 3TURA 4XNYL 2F58H 4NJAH 1WZAA 5JMOC 3G04A 5CHNB 1JTPA 3CHOA 3X3GL 3G6JB 3IK2A 3QHZL 1GSKA 3WHXA 3RL1A 4WI4A 4ODTL 3I02B 3O6ML 4X6CE 4EI5C 3F7RA 1CB4A 1G7LA 1M7IB 1O7DE 4RFNC 5I16A 2LOEA 3TIDB 3HS0B 4L4VB 1BQHB 4KK6C 1BVLA 5C8JA 2FECI 1RV6X 5I28A 3PHOB 2CO1A 1RUAL 5B39G 4OGXH 4JFSA 4PJ5E 5CJBA 2JTDA 3SQBB 5I71B 2UWEE 1IQWL 2NT1A 3BN9D 4ENED 4YH6A 4P5TB 5DFVC 4KV5F 3GSQB 3RDTB 2IH3B 2DWDB 1FG9C 2P48B 1UM5L 4FADA 4P2QD 5L4MA 4PWEA 1G9NH 1M7UA 2BIQA 2DYPD 2VT0A 3H3PH 3OG6B 4G72B 4G8GB 2F74A 3VXNA 3KW8A 3DX6B 4PTTA 3N1MC 3GDCA 5A2BA 3U82B 4XZUA 4PJ8D 3PWNA 5LCVA 5FKPB 4LKXA 2GK2A 1CU4L 1I1YA 3PS6A 3KNBA 4JRXA 4OZHF 3ET9F 2COVD 3CQPA 3GMOA 1U8KA 3QDJB 3N42F 2KYIA 4KXZH 1EAJA 4PS4L 3CMOH 3QORA 2EDTA 1SJVA 4HS3A 3OKNB 1O75A 3ZKMD 3MRDA 2P8LB 4MXVE 3V52L 4BKLA 2DKUA 2WZ5A 3FN0L 3MV7B 3N1GC 1ZV2A 4PRIA 4BZ1A 5AAPA 2NQ3A 1CQKA 1IILE 2QVIA 2VM4A 2FUTA 4M4PA 1JXDA 4G8IA 4G11A 4OM0L 1E4KC 2JV6A 4HUUA 4L8CA 4PU2A 3IXAA 1OZTG 1PZBA 3CU1A 5KSUB 5AFAA 4LRNL 3ZUNC 5F9JB 3UG5A 1BVNT 1IAIM 4JRXE 4RFEB 3GS0A 2X4QA 2ADFL 2FUQA 1ZVSB 2BY2A 4FTVD 5DVPA 1H19A 2ZKYA 4CC0A 2J55A 3UGEA 1ZT4A 5AW3B 3SKJL 2CRIA 2FO8A 4J3WA 2YN5A 4UQBA 3DGGA 1CD0A 1MCPL 4GW5A 2WQWA 5AAWC 2CM6A 1EFXA 1IGYA 3LAFA 4PRIE 3VXUB 3C5JA 3NCXA 2BVOB 3ZE0B 1N3NB 1CBVL 3EGDB 4WKZA 5FYJE 4CKVX 3QE5A 5FOJA 4QGTA 2R7EB 3D30A 1T20B 1YUKB 2R1YB 3R1GH 3S3JA 1S5HB 3U0WL 2CJTA 3DPDA 1AHWB 1OXYA 1XGTA 2A4ZA 3C08H 3HUJB 1GZHC 3L17A 4GP5B 2NQDA 4XMLH 5AW5B 1QUNA 4GAGH 2NXZB 4YHOL 1BEYL 3FW6A 4DVRL 5IR1B 4GO8A 2Z35A 4XOEA 4NM8L 3TFKC 1A1MA 4ACTA 2X6AA 3P73B 1FAIL 1QWNA 4BQ6A 2C9RA 4Z7UB 4I0PD 1BQUA 4HULB 5JTWA 4XP5H 5I5IA 1QBBA 2AGJH 2VLLA 5KBPA 5EIQA 4KROB 4P23B 4C55A 1NFIA 3TOPA 1G7MB 1B2WH 1D3CA 1QEXA 1JZDC 2P5WB 4HKZB 4C59B 3P9MB 5IWLC 5DFTA 2CDFA 3DTXA 1COBA 1FCCA 3B9EA 3GMLB 3E2HB 2BSRA 4RGOL 4WWKC 4GRMB 4UINL 4GUCA 1I8MB 1TZGH 4Y4HD 3HVDA 1U91B 3EH1A 4ERSH 4UTBH 1OE3A 4AYFB 5FA3B 3M46A 1CFVH 2HT2C 2BO0A 2BJML 3MN8A 4NHCH 3HZMA 1U4FA 2BZ7A 1CO1A 2FNWA 1P6AB 4X8JB 2YD6A 4PTUB 1T7XA 2P8PA 3KEHA 3RWJA 3FQRA 2L7EA 2ZOKB 3D39A 1J1XH 3O2WH 3QRFM 2XWZA 1FNEB 2D7PA 4D0CB 1U8JA 1ZD6A 2ZXBA 4KKLC 3OMAB 1F3DH 5CJQL 2D73A 2N3JA 1WAPA 4KQ4L 1UM4H 2DI9A 2N7BA 2X6MA 4AUUA 4ZPVB 1M6UA 2V17L 3WNLA 4X5XB 5DA0B 5H2BB 4KZ0A 4TQEH 3IFNH 4FQXD 1QSFA 4LHUG 2WIIB 1IB5A 4LLMB 3AU1B 4RVBA 4JO3L 5JXEC 1OT4A 5I0VA 3P77A 1FPTL 1CLOL 2VLJB 5EBWB 4ZUTB 4H26A 1IX2A 2HJFA 1CD1B 1VPOL 4HG4J 4G6JL 4IS6B 4NRXB 4AIXA 1WFNA 3WO4C 3EYOA 1UWEL 4AQAA 2NY3D 3C87A 4N2KA 1LM8V 1OB0A 1SFHA 1MWAA 3ZMNA 1ONQB 3D85B 3NZSA 1YMMB 1QWUA 1BFVH 1NFKA 3BAEH 4RMVA 4NNPL 4P2OD 2Z91B 2NXYC 3K8LA 3RUGE 3LS5H 3H4FA 3GIZL 2DKMA 5KWYC 3X3FL 1QSFE 4NN6B 4M3JA 2J72A 3UTSD 4DP8X 4EMZA 3SGEH 1CE6B 3JWOC 3D18B 3D7PA 3ARED 2Y23A 1VRSA 1WFTA 4QXVA 3JZ7A 3RNQA 3MXWL 1IFGA 1E8XA 4M8UA 2V9QA 3DARA 4GG6B 4APXB 1D5IH 1PZ2A 1YUHA 3RY4A 5LWYH 1KWKA 5I1LB 5B7FA 1SXCA 3FN3A 3DX9B 2GBVA 3VI3A 2HMID 2BSDA 2HH0L 5D9SA 3ZKXC 4C58B 2ZSWB 2Q20A 2FL5A 3NUKA 4JZNB 4PJEB 5D2NB 1VFBB 4LDLB 1H8OA 2J6EA 4FGMA 3SKMB 3U0PA 4EO5A 3RNKA 1GZQB 4R4FH 4HCGA 2ZOUA 4YHLL 2J4WH 3B7YA 1NGYB 1DFBH 1MY5A 4IDLA 4PPTA 5E8DL 4Z7VF 4KKRA 4MCNA 1W8NA 1LMKA 3CZEA 3Q1SL 3MUUA 2CUMA 3ASWA 4CDHA 1QR1A 3Q8FA 4G8EA 2DWTA 4GW4A 2D31A 4XN4A 1F4HA 4MNGA 4N5ED 4JN1H 4NRZB 4BQ9A 1FC1A 2AXWA 4HUNB 1PIFA 4LO9A 3QXWA 3Q13A 1PSKH 4EOWH 2PXYB 1YEWA 4A37A 4R4NC 2EDRA 3TYFB 3IAQA 2B9BA 1EXUB 1KMGA 1MSPA 3VXRD 3TVMD 3OAUL 5J1TC 1PX3A 4ZK8A 4PJAB 1AD0A 3QAZB 1IKFH 1PAZA 4N2FA 1Y6NR 4M43L 4AVKA 5B3JF 4QAWA 4HCRL 2W0PA 1D5ZB 1C5DA 3DV6A 4H20L 5DWPA 3N6YA 1WGVA 4MJID 3Q2NA 5EZLB 4PJDA 1DSFH 2IH9A 4BRVA 4YIQB 1EV2E 3ZYOA 3C9NA 3NDYE 4H88L 4LFHD 4HIXL 1MW1A 4MNGE 2XFXB 3T4AA 1X7QB 3QQ3A 4Y4FD 4FFVC 5DXWA 4EI6B 3FB5A 4ZXBB 1ND0B 2QQKH 1F3JA 3X12A 5EZIH 4UM9B 3MC0A 4Z3IA 1D5XA 4PHZA 1I9JL 4JB9L 3R8BB 1DQKA 1KTDA 4PJIB 4RWYH 5FV1L 1ZLDA 3V5DA 4O02B 3V8OA 2VDMB 2AJVH 1R3JA 1G87A 3PNWA 3LXCA 2A6IA 5I6MA 3F7QA 4LCUA 3TWCL 5D5MA 4PJHA 2F7QA 1BREA 2G3XA 2J6WA 4C57C 1A47A 1P1ZB 2CK2A 2X4RA 1XB8A 4QYOB 1SEBA 1S7VA 4IOIA 3F7LA 5BQDA 4PJDE 4LVEA 2VDKB 3BUPA 5KVDH 1YVLA 1IQDB 4ZOAA 5ADPL 5I0DA 5EDSA 4P46A 1XB6A 2OMZB 4YE4H 1AO7D 1GOFA 1MDTA 1NDGA 4GBXB 5EG6C 4E42A 2BP8A 3P40A 1VZHA 3P1VA 3BO8B 2HWZH 4YSQA 2AEPL 2H3KA 1ETZA 5FM4A 1K72A 1RU9L 2CHDA 5FW6A 2X38A 3IWVA 5HHMD 3VJ6B 4OF6A 3BAJA 3ARDB 4HETA 1MIMH 5F96L 5CM1A 3DRQB 4HC1A 5BW7A 3BP6A 3MLPA 3ESOA 2NLJA 1BF2A 4LU5L 2ZONA 4OF5A 2JKLA 1IGJA 1CFNA 5D5ME 5F89A 1PLGL 4PJHE 3KYNA 1CLYL 3U9UB 4X4KA 2DD8L 2PPAA 4WHCA 5F9OL 1KN4H 5KVEL 3BVNA 1IBGH 4U1JA 2GYSA 1SJEB 4PREA 4PV1C 5KVMC 5F0PB 2JJUA 4P3CL 3KYMA 1G6RA 1LNUA 3IFLH 3IJSB 3L5HA 1E5ZA 1HEZB 1SLVA 1TQCB 1UCTA 3SE9L 1BGXL 4MDIB 1N9PA 1RH8A 4LKCB 3KJ6L 1MREH 3HI5L 2WYZA 4K94L 4NO0A 5FR3A 2OSLB 4HJJL 4NQEB 4JPIA 1J9SA 1PJWA 2P5EA 3WIAA 3Q9PA 4NN5B 2CWRA 2EXWC 1DUYA 5BVJA 3P3UA 4XVSH 1OSZB 4ZMYA 5J1SC 3GMMB 1S9WA 3QNXB 4DGUA 4V2CB 4YXLH 1ROCA 4MJJA 4ZDHA 1OT1A 4XBGA 3R8QA 2EDNA 2OMBA 2EXSA 1IBYA 4W70A 3JWNC 3EJQA 4R0LA 4NPJA 1RZJL 4LNVA 2YLKA 1OLLA 3S34H 2V33A 1THAA 2VKXA 1A8JH 3SGJC 3S35H 2HT3C 5E94B 2BSTA 3UTTD 3GI8L 5CEXA 1I7UB 3SQOL 3OLDA 2P5EE 5F1OB 1A6ZB 3C75A 3UZVB 5SX4H 3FQ2A 2BNQA 3T3PE 2FYYB 2WXFA 1B90A 2XZAL 4F8QA 4F93B 5LVEA 2WAQA 3FUEA 4QO1A 1FCGA 3ZDZF 5JPNB 3S88H 1YRKA 5E23A 2NY0D 5FLUA 5AVXB 4PLOB 4FQ1H 3B3IA 1CIDA 3QIUC 5B1JC 1QTYT 2YGPA 4M7ZB 2KH2B 1UKSA 4KGJA 1A6TA 3GBDA 4RLDA 4ZFGH 1OSPL 2NX5D 2B16A 2YUWA 2YRPA 3GO1L 3VGBA 3LD8C 2E0PA 3OZ9L 2FWOA 4FRWA 2OTPA 3ME0B 5CZVL 4PJ8A 4FNQA 3MROA 1VGKB 4HIPA 4A67A 4HWBH 4A7GF 3J07A 4MMXA 4BGDA 5IB5A 2BNQE 1LWJA 3VFUB 1GAFL 4Y5YB 1ACZA 3DX7A 3ZE1B 2CIIA 5FB8A 5DYOA 4FQLL 1W9XA 2FEEL 5GJTL 1DE4B 3PGDB 4Q56A 3GSNL 2X4SA 4ZFFA 4MKTA 2DY2A 3ARSA 3CFCL 4E68A 1T3FB 4R7NA 4UQ9A 1ZXQA 3B2VH 3A24A 4HIJA 1QA9B 2W8CA 4XPGH 2J73A 4P05A 3WXVL 1P5VA 2YBRA 4P2QE 1M1SA 2UY6B 2W0FA 25C8L 1FV1A 3OR7B 4UUJA 1XIWB 1N8ZB 4XNYH 4HP5A 4M3KB 2HVBA 3EOAA 2IQ9L 3C5ZB 3KPSD 5CP3A 1KTKE 3QDGD 1DBJL 1AGEA 4M4RA 3DSFL 4F7PA 3U79A 2YARA 4YHNA 3X3GH 1AR1D 3ML9A 3QHZH 5I6KA 2UY7B 4QXGL 4Q89A 3DECA 4ODTH 3O6MH 1NOAA 1GZPB 3VD7A 1MCOL 4LHQB 4ZX6A 2WZ6A 2GFBA 3W0WA 3REWA 5DVOA 5ISZA 2GI0A 1B6UA 3F00A 4XH2A 1VB9A 4Y4KD 2J1ZA 3MRJB 4JCLA 4ZX3A 3NIDE 4PRAB 1RUAH 5LDSA 4JFYB 1BLIA 1Z9PA 4HIQA 4ODHH 5IBUB 5IW1B 4X8CA 5T33L 3DIFA 3S36L 3D50A 1IQWH 2ZG2A 2VLKD 2C34A 3B9VA 4URTB 1J0HA 1Q9LA 3ZR5A 5SWSD 5FO8B 1HH6B 4MX7A 2EYTB 4ZYKB 1A14L 4HOWA 1IBFA 1UM5H 5DTFB 1AGDB 2ZX7A 4B60A 3ECBA 5DHVA 1OCRB 2DTML 2OMYB 2YMXH 3GMNA 4NCC1 1HDMB 4AZ8B 1TVBA 1C16B 1NFDB 2DPKA 4BFBD 5T3ZL 3GI9L 4FTVE 3FUNA 1EHNA 5F3HB 1AQDB 3W0WE 4QHPA 1CU4H 4QTHB 3RWGA 5ISZE 3ZDXB 4I0PA 3L9YA 5CO1A 3TN0D 5I1DB 5KVFE 3DVNA 5JHBA 4IRZA 1I7TB 3SO5A 4QAMB 2RHEA 4AK1A 4JKPH 3S4SB 3QJSB 5BQ7B 3QC5X 2Z7UA 5DD0L 3V52H 3WU1A 3T0XA 3I6KA 3WL9A 4DT2A 5HI5D 4O4YL 3MREB 1S7TA 4MDJB 2PO6D 2O6CA 1N26A 3EDFA 3O2DA 4H2AA 4OM0H 2XIBA 2V2WB 1CXKA 2YAEA 4Y4HA 3RB5A 1Q94A 2NZIA 5JHLA 5IB1A 2XQBL 4B53A 1OV8A 3EUDA 4DOHE 4I9WD 2CU9A 1B4RA 3TPUA 2FB4L 3JT2A 2AK4A 4L1TA 4LRNH 2Q86B 1F90L 2ADFH 3BVXA 4TNWK 3MODL 2E74C 3SKJH 1HQRB 4UT7L 1NIAA 3STZA 1KYDA 5GZOD 4ICWA 3NK3A 3ARFD 1MCPH 1P84J 4UQDA 4N1EA 3UBXA 3SYOA 4LSQL 3IETB 4IMKC 4LLUA 3OJDB 1HWHB 4O2EB 4G43B 1CBVH 2X4NB 4AW4A 4QNPF 3UZEA 3GKWH 5AUMA 4P9HL 2WC7A 5FCUL 4C56B 3PQYA 3P4NB 4TUOB 3RGBA 4HKJB 5MEPB 4HX1A 2D7MA 3U0WH 2EEAA 4W4OC 1O6VA 1NUDA 1T0MB 2DM7A 4CKQA 1WYJA 3HHRB 2CRYA 3FQXB 4YHOH 1BEYH 1VHPA 5FO2A 4DVRH 3RVWC 1KEML 2OYLA 2KI6A 3CH1A 4NM8H 4NQXB 5HPOA 1E27B 1FAIH 3NZ8B 4NZJA 4HSQA 4K7PY 2Z0BA 2ZX6A 3KVPA 1UKTA 2WCSA 3H9SB 3N91A 3RAJL 4QRFA 2ALAA 2YPLD 2X4TB 5DEFB 5IMMA 2IDUA 3NRQA 4PGCA 3BPOC 3LEVL 5EN2A 2W07A 5SV4A 8CGTA 3EJSA 2NSMA 3DUUA 4HOZA 4Q14A 2F8OA 2QZQA 3VDAA 1XF2B 4RGOH 3G5XA 3AXHA 1Z9LA 1JD9A 1TSHA 4JLRB 5LBSA 3H0TA 4GB9A 4UINH 3IJHB 5IVXA 4RISL 1E8ZA 4QHUA 1KYOJ 2MNUA 1A9BB 5TE6L 4H0GA 4R83A 5HJDA 3MZGB 2FJHB 2JCCB 2NY5C 3L7EA 1ZLSL 3ZT7A 2APVA 1Q90A 3O3EB 4JFFB 4GT0A 1K8DB 1IGTB 2BJMH 3BWSA 4X5QA 5DHYA 3BN3B 1VA9A 3MRCB 2WLLA 2NTFB 1UQSA 2VDML 4ZSOA 5JOPD 1JFQL 2GW5A 1YJDL 3QJUB 4FL4C 2QELA 5HGBB 1QRND 4PWKA 1J0JA 5DD6A 5IBLC 3GSUA 2ORBL 3DK0A 3WD5L 5CJQH 1ID2A 1C1EH 3VH8B 2OYMA 4HK0A 4TUKL 5DDHB 4E9VA 4HF5L 4TUJA 4KQ4H 4G9FA 4JBSA 3PJSA 2V17H 3GZPA 4FA7B 4YHPB 5DURB 5IVXE 1FYTB 4NQVB 3BGFB 1JUFA 4KO7A 5C3IA 3OLEA 1T6BX 1NANI 1SN5A 3BXNB 1J1OH 4MNHB 4X7FC 1BLNA 1FPTH 1CLOH 4HHWA 5KSAC 1K2DA 2IDCA 1VPOH 4AC2A 3FCGA 5I1GL 3D87B 4L0YA 1BSIA 1EO8H 4NNYB 1E3ZA 4HPOL 4A6YB 4DO4A 2LR4A 3FO2A 1UWEH 3VFMB 5DC2A 4NKDA 4NZUL 5IW6B 2EXYD 1F97A 3TO2B 1WAAA 4XN1A 1AMXA 2EO1A 4QI3A 3N5AA 2TSAA 4Y2DD 1XF1A 3QWQB 4PW3A 5IB4A 3SGDH 3VXRA 4NNPH 1DJSA 4G7QB 4MZIA 4XN9A 3DDGA 1SN2A 3QRGL 2G75A 4JFEB 4NQCB 6CGTA 3WIFB 3GIZH 2I85A 1CFTA 3X3FH 2ICWB 3S48A 3LPWA 1DZBA 3MRLA 5SWZD 3GRWA 1G5AA 3TO4A 3WLBB 2A99A 1F2XK 3LKPA 3SDXA 4R5XA 4N2EA 3NESA 3UO1L 4BSWA 1P7KA 1WP6A 1LEIB 1FZMB 3CNKA 3MXWH 3IYLW 1SM3L 4Y4FA 2BHZA 2A9ML 3QI9B 4EN3D 3T8XB 4GS7C 2NNXA 1HSBB 1RSFA 3QUZB 1KDIA 4G7SB 2B3IA 1KTRL 3L4ZA 1WAAE 3MUGA 1T21A 3CVDA 5CEZL 2XIDA 2QBWA 2ZG3A 4XX1E 2QTVA 2HH0H 1LO2L 4GAYA 3GT6A 1NMCC 1PG7L 3VXRE 3N40P 4HWZA 4JFOA 4N0YL 3NJMA 5TD4A 4Q9RL 2B0SL 4WTQA 3MLTB 1HWGB 1ODAA 2X2HA 5D7IF 2NDGA 2F1AA 4Z7WE 2HCZX 1XHHA 2EDJA 2XN9A 2WJ7A 3G6JF 3HCVB 4YHLH 3VI4B 12E8L 1FNSL 2EUXA 3ASNB 2WXOA 5E8DH 3SDXE 3FUHA 3RGVD 2WB1A 1MLBA 3OXSB 1TTCA 1E5YA 5CZXC 4E9YA 5DK3A 4WW1A 4KMTH 5CN2A 1BX2A 4XNBA 2ADJB 1ZSHA 4W9ZA 3EYFB 2Y9RT 4U1IB 4F5CA 3PGFL 2I27N 4EXPX 4ZODA 2OTWA 4JKMA 3EYQC 3ILPA 4OGYH 5F6IB 1WS8A 3QXDA 4WI3A 3V6ZA 5D4HA 1T0NB 1X7SA 4X80L 5DUPL 1T04B 1TJHL 2WKLA 3VFOB 2DIEA 1T1WB 4LIQL 5D4IA 5AL0A 3HLKA 3O3DA 3VXTA 3PLYA 1EEZB 3OAUH 4PLJC 3UERA 2PCPA 3VG9C 1UWYA 4Z8FL 1VSCA 4DVBB 5B38B 3P4OB 1JZFA 5AVQB 1MHEB 1NCJA 1EZVY 4H20H 4L29A 3COOA 4LLDA 2ENJA 1RJZB 4A2GA 3GJEA 2JJSC 3MBEA 4TQIA 3UG3A 2ZXWB 3BZDA 1MELA 1DEDA 4H88H 5EFIB 3MACL 4HIXH 3SKNB 4EAEA 4F5CE 5GHWL 1MWOA 3VD1A 3APFA 4N3UA 1ZK5A 2R9HC 5HHME 2JXMA 4JM4L 3JT0A 3WMPA 5K9KB 1I9JH 5MERA 1GGCL 1ZA6A 5AD0B 3SO3C 5HXMA 4TKWA 1KULA 2W60A 3NCFB 4HIHB 4R7XA 4TMPA 4YVNA 5D2LA 5DJDA 4H44C 3RFZC 5KS9B 1TFPA 3BSZL 1UB6A 3D06A 1P7QB 2VXVL 4ZAKC 1HNFA 5FOBA 3F5WA 4ZZFA 3K71A 4XMWA 5DR5L 1XX9C 2CMRL 3QW9A 4ZUUA 4XBPB 4MQ7A 2DICA 4LCYB 5FV2A 2C9QA 1NCTA 3SE4A 4FD0A 5DMIL 2GJ6B 3ARRA 5ADPH 2PMZA 1VACA 3WO3B 3CZSA 2CO7A 2QKIB 3FULA 3VX0A 1R5WB 2Y7SA 3R7RA 2Y0SA 2AEPH 4OFKA 4YC2B 2G0KA 1RU9H 3HPLB 1IM9D 3V4VL 5J57B 3ZE0F 5F96H 5FYLH 3MGOB 1JF1B 3IU3B 1IEAB 1N0LA 2BVQB 2CO6B 4GO9A 1J18A 5EPMA 5F93C 5GSRB 3K4ZA 4LPXA 2JKWA 2DJUA 5EU5B 4ZUVB 1PLGH 4QHNA 3HUJF 3OLGA 1JS4A 1J9QA 3KWWA 4X6DA 2DD8H 5FAAA 5F9OH 1T0OA 5KVEH 1N67A 2LU3A 5KJ7E 4E41D 4P3CH 1L4IA 3CVHL 3VRJA 3QWNA 2YSSA 4FCHA 4B9JA 4MZ2A 4PJ7A 3U1SL 4EJ1C 3UTTE 1BGXH 3VXPB 2PLTA 4Z7UF 5IEKA 1DO6A 3KJ6H 4RMWA 1IT9L 1KLFA 1QFPA 4G83A 1P6FA 4K94H 3L2NA 4U33A 3QEQA 4P2AA 1J10A 2BIOA 3KLHC 4HJJH 4NFCA 1N2RB 4IHBA 3FT3A 4GLRI 4W9LC 4ZUWA 2P46B 3HG1A 3W82A 3FFDB 1CICB 2AXGA 8FABA 3LKSA 2BOBA 1P6WA 3TF4A 1W0YT 2DI8A 5C7XL 3IFOB 1ORQA 5DI8B 4IRSD 5KBLA 4XNQB 4X6DE 5DMKA 5JLZB 1GGTA 5D71L 2Q7YA 2VQTA 2EAEA 4BELD 4BYHA 4OQTH 3RX9A 4IBZA 1OGPA 1RZJH 2OXHB 2IPUG 4B9ZA 5KW9L 4PJ7E 4X4MA 3KPSA 1JRHL 5HYQB 3M17A 2XY1A 2LLGA 3MFGB 5GRYA 5KOVC 4PJGE 3NJKA 3ZSSA 4BWWA 5A2LH 4RZCA 3FRUA 4JS7A 3EO1A 1DVUA 4LLVA 4KXAA 4GOSA 2ZUVA 4GQPH 4OVUA 2VXQA 3NZHL 4XI5D 4RZKA 4E9RA 1KBWA 5IEHA 4IOSD 1Y18A 4ZW6A 1BVKA 3C6LD 3D34A 4PGDA 1CC3A 4QCIA 3O6KL 4NEHB 2XZAH 2R2CA 3V5KA 3RIFK 1DHKA 3VRLF 3KGTA 4AV4A 2FJGB 3BGMA 3PNRB 2IMMA 1JPSL 1W0WA 1OTSC 1S7RA 3D2UB 3Q8AA 3CZFA 3EO0A 4GRLD 3WMSA 4D0DB 5IFJB 1FZKB 3MFFB 4ABVA 3MUZ1 1YEGL 2FIKB 2UXFA 4JFZH 4UYPA 4X4ME 3KPSE 4N90D 4LVHC 1L7TL 3HAEG 1GYVA 1OSPH 3FTVA 3HVNA 4GKZA 5E6YA 2ALWA 2OMVB 1FAKT 3GO1H 5LAXA 5D1QB 3OZ9H 4IYKA 3MNDA 4ZD3L 4JKKA 3IPBA 4KMQA 1KIUB 1QSEB 2V8LA 5CZVH 3GSWB 1R33A 2J8UB 4F7MA 4S2SA 4UILL 3CCHA 3OJ2C 1K8IB 1OO2A 1JNHB 1YPZA 4MNQD 3E1ZA 1GAFH 3U83A 2YAHA 4MS8C 2VC2L 3CMGA 2ZXQA 5IQ7L 4FQLH 3QORC 4CW1B 2DM4A 5GJTH 1DVTA 4JO8A 3TPKA 3KWVA 3GSNH 4KJWC 1VADA 5CJXA 3DOSB 4WI2A 3CFCH 4GY4A 3FRPG 3WENA 4Y1TA 5SWSE 4RNRA 4YHIA 1UM6L 3WXVH 2V9UA 2WQUA 3E7JA 25C8H 4L2LA 3LN5A 1BD2B 4W9GC 2HXAA 3FPXA 3QUXD 5E99L 3ZUCA 2IQ9H 3T0DA 1DBJH 2DLTA 3CIQA 3DSFH 1FL5A 2ZKHL 3WXWL 2VDPB 3OHXA 2J1YA 5C92A 4QXGH 4AQOA 2K70A 3KD4A 3O6LL 1YPZE 3E8UH 1MCOH 4PLKC 2AQQA 4AQEA 5CAYB 4MD5B 1NAMA 3QFGA 5H37A 2YGVA 3CN4A 2UZYA 4J3VA 1ESOA 4PJEF 1NUNB 2CBOA 5K1VA 1NPNA 1B3IA 3GINA 3ZO9A 4OAWB 5T33H 3S36H 1XR9B 4AJVA 1UZ8A 2DV6A 4JZJB 2EDEA 2ITEA 3AG1B 2Q8BL 3AS1A 4HAGA 4J3UA 1AKJB 1A14H 4WENB 5EU7E 4N0UB 1F86A 2DTMH 4KX7A 1JDAA 5HHNB 2DRUA 2CXGA 4I9WE 4FJZA 4DCQB 1FVEB 3E1F1 2EH7L 1BBDL 4BHUI 2GTZB 4GG8B 1INQA 5T3ZH 4FG6D 3GI9H 5DSCA 2OSXA 3QCVL 5CLZA 4X2UA 3EDKA 5DA4A 4AK2A 3V6OE 3MLRL 1T2JA 4X7CC 4PJCA 1R24A 1CXEA 3NSXA 3UC0L 1TF4A 3EOBB 5EDXA 2XN1A 3KEDA 3EJPA 4MB5A 4PJAF 3HC0B 4IIZA 4L3AA 4RAHA 3VQMA 2XBTA 2YRZA 3VFTA 5DD0H 5AB9A 1ACXA 1KIPB 4OV5A 5DHMC 1F4AA 1J9RA 4O4YH 4X6FB 1BZ9A 4XC3L 4M93C 3RKPA 3GGWA 1LEGB 3O0LA 4CILA 2B2XH 3I3BA 2BWDA 3I74A 4YK4B 1YEKL 1KGIA 2AV1A 3MLSH 3PIQA 5HYEA 4V1DA 2WBKA 4XMPL 4BD4A 4FQHA 3PDDA 5CF3A 2FB4H 3PWVB 4HYTB 1NEPA 5B1CA 1F90H 1QFHA 4K9JA 3PWJA 4RAUA 2GC4C 4R7LA 1J8KA 4PJCE 5MEND 4MFHA 3MODH 4PBDA 4PJIF 3GTTA 4UT7H 2NY4B 4H13C 1I1AD 4J5VA 4Z18A 2N7SA 1XB3A 1UD5A 1SHWA 2VR8A 3T0EB 4X98A 2C9SA 2ZWSA 4LSQH 4QLRA 1HNGA 3TFBA 4DZ8A 3AMLA 2GIYA 1CT8A 4OCLC 4ADGA 4P9HH 1LWRA 3K72A 1T5KA 5FCUH 5J4MA 3UMTA 4QTIH 1JOIA 1RPKA 4QRUA 2R0KH 4L4TD 4WK2B 1ZHKA 3RWCB 3KG5A 2H3NA 1XAKA 4XXDA 4F7EB 5JZ7C 4N2HA 2ROYA 1T1ZB 2EC9U 1A6AA 1JNNL 5E4EB 3TZVD 3EBIA 4YDJB 5JOPE 2EKSB 5DD1L 3QT2A 3DGDA 1QRNE 4L2YA 1KG0A 5D8JL 3SGDI 1J8HB 4WFHD 3RAJH 2OCJA 1R0AL 1NGPL 2WPGA 3AFLA 1W2KT 1TMQA 2E75C 3FT4B 2Y5QA 3ROOB 3BP5A 2XOTA 3Q2VA 3WY4A 2A6DB 2Y2WA 1MCNA 3P2DA 2WIMA 4WNSA 2OZ4L 4E9XA 3WJMB 3GB7B 4G42A 1HH9B 3QZMA 4M8VA 4BRJA 1ZY9A 1RQ5A 4PVNA 5SWZA 1OP3H 2ZQKA 1EDYA 1YY9D 2CBQA 3S7GA 4W9KC 4RISH 2H41A 3U7WL 2WVSA 1JHKL 1N19A 2H8PA 2HRPL 3FOLB 4F1ZA 4AW7A 5TE6H 1WE5A 1IBHA 4B9CA 3VRIB 1NWOA 1ZLSH 4AM0B 2NY6D 1TITA 3DRTA 1AJ7L 1RZ8A 4AWJC 3FT2A 4DEWA 3U2IA 4EN3A 4U1LB 3RB7A 1L5GA 1FYHB 1JGDA 3FOMA 3L95A 2BVYA 4ZUSB 1IC4L 1JFQH 1YJDH 5IG7A 1QPXA 3NRFA 4OZ4A 3QJFB 1OANA 3S36X 4S11A 3VQLA 5C07A 1GR7A 4HALA 4OKVA 4PY7A 2ORBH 4NQDA 2PP8A 1LDPL 5IHZB 4I4WB 3WD5H 5C3TA 1XZ0B 2W9EL 3KPRA 4TUKH 3SDCB 4M8QB 4N2NA 4NDMB 3TCLA 3ARBB 5SWZE 1W0VB 3HHSB 2WWMD 1A65A 4X5WB 1EEYB 2CA4A 1IM3B 2JIXB 3BLKA 1D5BB 2NZ9C 5ESAA 5L7XL 1WVZA 1A64A 2LTQB 1UJ3A 3MBXH 3POHA 6PAZA 3NEXA 1NIDA 1NDMB 2JWYA 5J3HC 1BIIA 1VCAA 1JPTL 3BFQG 3F7YA 3K5RA 4ODWA 5E9DD 4XWGL 3TH2T 3ZOAA 4HPOH 2AQRA 2CKBB 3F7KA 3LZFL 3KWTA 2ZUQC 5C07E 2YD3A 2P43B 4JDVA 2OS7A 5D6CB 5FPIA 2XA8H 3MJ9L 2F5AL 5C0IA 2BC4B 3KPRE 5JO5A 5L2KD 2WOYA 3I2CH 2NCEA 2R2HB 5CWSB 1XGPB 3POCA 2MQGA 1CFQB 3NP4A 2NSQA 2HJLA 4YSEA 4RGMC 4M7JL 4A39A 4ZS7L 3DMMB 5IOPB 1FFPA 4GP4B 1ZS8A 3MAWA 3EJTA 1Y0LA 1Y1DA 4Y0GA 2QADB 5DHXB 4KJPC 4NNXA 3UO1H 1U8NA 4XP4H 1SQMA 2E8ZA 3T4AC 5ITFB 2Y5TA 1ZKAA 5AWNL 5HDQL 3SCMB 2V9RA 2A9MH 4BCYA 4K3EH 1Z0MA 1TJGH 2XKNA 2XRAL 1CN4A