1I82A

Family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with cellobiose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
189
structure length
189
Chain Sequence
MVATAKYGTPVIDGEIDEIWNTTEEIETKAVAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFNIQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title Crystal structures of the family 9 carbohydrate-binding module from Thermotoga maritima xylanase 10A in native and ligand-bound forms.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 54
structure length 189
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06452 CBM9_1 Carbohydrate family 9 binding domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1190 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1i82A00
2IVFC 1UG9A 1I8UA 1ULVA 4JPQA 1I82A 1I8AA
chains in the Genus database with same CATH superfamily
3E9TA 3L7FA 4PJ5E 3S7GA 2VIRB 1NUGA 2IWGA 4PJ8D 4HKBA 5IMOA 1I8UA 5J11C 1DVFC 2APWA 2X0VA 1U8CA 2CLZB 3R0NA 4JFEE 4AZUA 1D9KD 2OAAA 4R7LA 5DFVC 4PJXB 3KEDA 1IE5A 5JW4Q 1D7CA 2BP8A 3IJYA 4TLUA 3EG9B 1FNGB 3CFQA 3QPXL 1AGCB 4MD0A 2D7TL 2GTWA 5B38G 3NRFA 5JW4R 3GKWL 2YRZA 3I50L 3ULUD 3DRTA 4IRSB 4PW3A 5GS2D 4EI0A 1PNCA 3CFMA 1F4YL 4W9EC 5DK3A 3OBAA 3QZWA 5LXGH 1HXKA 3ARFA 2WLNA 4TUJA 4UZUA 4GEIA 4X6CE 1FSKB 5EFIB 1FC1A 1F90L 2V9UA 2VLKB 2Y07H 1U3ZA 4R2GB 5JW3L 4AIZA 1IM9B 4MCZA 3FB8A 1KXQE 2LABA 5AOJA 4MA1C 2AQ2A 3B1UA 5AW7B 5JIDA 2VC2H 4R0LC 3ECBA 2AVFA 3JWOC 5AVQB 2YAMA 5ESQA 2GJZB 3JVGA 4DK3A 1OHQA 1CFQA 2EXSA 5FF6B 4F15B 1H6UA 1HKLL 3TPUA 3RWEB 5AKSA 2QVMA 4OM0L 2XKSA 2JE8A 1FIGH 1NCAH 3P11L 3PDGA 1BMGA 4NO2A 5HHNA 4HG4J 4S1SL 1CTOA 4PJGA 1IGFL 1LQBC 1KJ3H 3QFJA 4RIRA 5BRQA 4TPRL 4BRJA 2Y3NA 4DAGL 3HLAA 4A6YA 1Q9WB 2XA8L 2QV2A 1T0OA 5CFAA 4PH8A 1UH3A 3D33A 5GRXG 2I60H 5L9DL 3RA7L 4L1BA 4P59L 2MQ0A 2MOQA 2FBOJ 1FUNA 4ODWA 4Z7AA 1A6WL 5IROC 1RUAL 2EIKB 5CJQH 2FSEB 1CE1L 3FN3A 1KELH 1WD8A 5AW2B 3X3FH 4U6YA 2GPZA 1OAJA 1CLYH 2A9NL 1N5AB 1RK1A 2QQNL 4P3WA 4ZMZA 3DNKA 3OTTA 4H13C 2V2XB 5C7ZA 5IQMA 4FYTA 4Q9QH 3FXIC 2EDQA 4N8PA 3Q9QA 2HJLB 5F0JB 1LD9A 2X05A 1WPCA 1QYGL 1HQRB 3WN5B 3BGMB 3P0GB 1JPGB 3QJVB 3RTLA 2X9YA 3GTVA 2Q86A 2Q7YB 3PJNA 4PU2A 1SY6L 4U1KA 2AJYL 4WK0B 3GXPA 5B1BB 1FHGA 3RL2A 2EXTA 4JKLA 4MAUH 3FONB 2D2OA 3G6DH 4NERA 3WLWC 5SX5H 4U05A 4U3HA 2B1HH 4ZFZA 3V5DA 1PS3A 3F85A 1F2XK 1NKGA 3S8GB 1JPEA 1S7VB 4H0HB 3DX8B 1TIUA 4XNXH 2R1WB 3L7EB 4QRBA 4AIXA 1Z3GL 1X5MA 2HXAA 4X99B 2E9IA 4J8QA 4HOXA 4LBEA 2GITA 3JV6A 3W81A 4HJUA 1AG0A 4N8VA 4CL7A 1NJ9B 1N4XL 2DRUA 2AEOA 2QEJA 1ZLSL 4P23A 3H42L 5KUKA 3MRKB 1RPUA 4EDWL 1B0RA 1ZANH 2Y25A 4F20A 3VUAA 4HWBH 4PLKD 2JMRA 2V33A 1AGBB 3PAVA 2Y1AA 3WCYA 2EEFA 1JHTA 1QWNA 2X09A 4KBPA 3LCYA 1ZVYA 4U1HA 2Z64C 3BP4B 3PY9A 2IC2A 4NNYA 3IKCA 5KVGE 4LCVA 1DQLL 1YC7A 5TGBB 3MV9B 4LSTH 2VDRL 2IBGA 2KQNA 3U1SH 4EZJA 4ABWA 1KB5A 3QG6B 5F7YC 4N24A 3BKCL 1RK0B 1IFRA 1DSYA 3TBSA 5GJSH 2Y6SC 2A6DA 1BJMA 3H7BA 3APNA 2KYIA 4FG2A 3LAFA 1N0LB 5HHPB 2X6MA 1YQ2A 4XC3L 5JDJA 5F97E 4KXZI 1YEDA 4TUOA 4RGOL 4DEWA 5C0AA 1DHKA 1SOQA 3UAJA 4LLQB 1I3UA 1V05A 1OL0A 5HDBF 4ELMF 4FN0A 2UVEA 4R4NC 4U1NA 2HG5B 4KMTL 4RA0C 1JN6A 4UAOB 5IR1A 5FWQA 2UX7A 3HMXH 3NIDE 4LHJB 3VXRD 3TS8A 1PTZA 2JK5A 4KV5F 4QO1B 3MNVB 2Z34A 4NKDA 3TT3L 1NC2B 3ARUA 5DJ0A 5ABZA 1YO4A 1SDAB 2FZ3B 3GHEH 5FYLH 4WI0A 3S37L 4OKDA 2CRYA 2R2EB 3C6LB 3L1OL 1XCQB 2WYTA 3FHQA 4YHMH 4ETQB 5DJ6B 1OLZA 2ENSA 3SDXF 5CEXB 1GY2A 4Y1AD 1C1EH 3QUKA 4KAQH 4KO6A 5H37A 4HP5A 3M46A 5C70A 4RZCB 2FWSA 1UCTA 2QTVA 4YO0B 1WS8A 4NCDA 4UQ9A 4YHPB 2X0UA 1HT6A 1FF5A 1T1YB 3MRHB 5B1KA 4CAGA 3E9UA 1TQUA 3VG0H 2CUMA 4W4NA 3V5HA 5J57B 5D1ZD 5CGYD 5D4QA 5BZWB 2PYFB 3BW9B 3PWVB 4ALAH 1LEIB 4HSCX 1CD0A 3OSVA 5E5RB 1CGVA 3DUSB 4S1DD 3TF4A 4MZIA 3P30L 2WK2A 1JV2B 2ZOTA 3EOYG 2H6OA 4XNYL 4YE0A 1UCBL 3ZDYB 4AMKH 3WENA 2ZSWB 4WAFA 5A2AA 4XRCA 5GRJH 5FYLD 1L0PA 3VI4A 2NY1C 1MLBB 5JW4M 1I1RA 4D0BA 1I4FA 1ZT7A 5FUZL 1OIOA 5IVZA 3CHXA 3D0LB 4WUUD 5K9OA 5EOTB 2F5BH 2GEEA 3P02A 2C1OA 4PSRA 1U42A 1QACA 3NZHL 3Q0HA 4Y7OC 4B53A 4EXPX 5JQHC 4JVWA 3CQPA 1FH5H 3PJSB 2VMCA 4Z7VE 4NUPA 2A1WL 3VYPA 1JZIA 5CP3A 1Q4NX 3O6LH 3KWVA 2W88A 3DURB 2CPUA 4HALA 4ZUSA 2LU4A 5IB1B 4EZKA 3ENEA 3FQ2A 3KXFD 15C8L 3PABB 3S3SA 5JYMA 5EO1B 3TV8A 2Y7OA 5DQJB 4JW3A 2EEAA 2YAOA 1MCFA 3WTVA 1Q1JH 4I48B 4LMQI 5DJ8A 4GMTL 5LKNA 2WJ5A 4HZLB 3V7MA 4D9LH 4AT6B 1YPZE 3N1MC 1JK8B 3GZPA 4NKIH 5HPMA 4QHPA 1MWAA 4EN3B 3CVHL 5H35B 4GH7B 1MFNA 3SKJL 4TULL 4X4MA 5HHOD 3RILA 1XEUA 5I17B 3U25A 1R6VA 5E1AA 2QFPA 4XMPH 3LN4A 2DD8L 1P7QA 4PR5B 3TN0B 4YWGH 2VH5H 3SZKC 1OSYA 1KCLA 2HTKD 1PSKH 3E6FB 4Y19A 3RPBA 4NN7B 5GGTA 1YY8B 2CPCA 3WIFB 2VZOA 2H32A 4LDEB 3L3IA 3DROA 1QSED 3Q43A 4I2XE 2O6FA 4DP1X 4UOW1 4DO6A 3V4VA 2IH3B 4ZAKB 3PL6A 4QHLB 1HHGA 1G7PB 5AB9A 1WGOA 1HL5A 3VWJC 3VXUE 2APVA 3WO4C 3CHSA 4Q7DA 1S7RB 1XEDA 3AADB 4EUPG 4WO4A 3WS3B 3BJLA 3BUPA 2DQHH 2ILLA 1G1YA 43CAB 5JOFA 5DD0H 1R4XA 3SPIA 5HXMA 4QAMB 1EX0A 1EXGA 4YR6B 1L3WA 1OP9A 3BQUC 4X0KA 5D4HA 5DVPA 4AYFB 3K5RA 4W6YB 4ZS7L 3NJNA 3UBXB 2OL3L 1D5ZB 3E2HC 5EEWA 1S7WA 3HE7A 3KLSA 3QQ3B 4X4KA 2E0PA 3OMNB 1KXTA 3G3LA 2DKUA 1HXYA 2ZCHL 4I8DA 5CSZA 4MKTA 5D72L 4AVIA 4UDTA 1O75A 4M4RA 3UZQB 2FL5A 3NQIA 3GS0A 2X2IA 3QZWG 2IPKA 3VSUA 4A2HA 4JFPA 1IGIL 5FYJL 4N5UA 4ZX3A 1XGYL 3PHSA 3U4BH 1JZ4A 4JO4H 4KH9A 3V9EA 3FB7A 4OCSL 1BW8A 1ZHKA 3ZL4L 1Z66A 3QG7H 4TQPA 4GIPD 3W0WA 1KPRB 2CR3A 3L8QA 2DQTL 2BSDA 5DR5L 4ZX4A 1XF2B 1UKTA 1A7NH 2NZ9D 2NY3C 2HVKB 4JB9L 2AEPH 3U2SA 1JZFA 2QR0B 4TOYH 5IW6A 3CV5A 5KVMC 4QYOB 1J0HA 3B6SA 2YGQA 4FULA 4DTGL 5I1CL 4JM2B 1P4IL 1AS7A 3D39D 4G80A 2Z1KA 5GGVH 4K9JA 1T0PB 1NGZB 3LXUX 1DQKA 1F8TH 5FYKH 1OCRB 1OLLA 5IFJB 5EN2A 4ZFOB 1TEGA 1BVKA 3GPSA 2BJMH 3QS3A 4BXVA 4BWTA 3FSZA 1NUFA 1OM3L 3HOGA 2CLRB 2VN7A 3JWDH 4OIIH 4KK6D 4Y2LA 2O5XL 2DL2A 3NCYP 4GKNA 5C2BH 3RVXD 5IJBC 1A6TA 5KSUA 3QIWB 2OMUB 1GZQA 4PJIB 5G55A 1XGRA 2DLFH 4WW2F 5CUSH 5AZUA 3NOIA 4ZW7A 1WVZA 2PPAA 2MWCA 1LE5B 4MSWB 1AD9B 1DEEA 4JFHD 3S36L 1PX4A 3MBWA 1OF0A 5EUOB 1INDH 3RG1C 1TTFA 1WT5C 4HH9A 2UWEB 2WHVA 5SWQA 5L4JA 3CZUB 3FULA 3HFFA 1DLHA 3QEQE 5CCKL 3VVVA 4KRPD 3CG8A 4PJDB 1OAZL 3P2DA 3LEVH 1HYSD 1C5BL 3FNKA 5KYYA 4BM7A 3ZGIA 4RETB 4V1DD 1W91A 4DGVH 4NP9A 3PQYE 4PJHF 1N2RB 2VM4A 5FYKD 2X4PB 5F9AC 4KPHH 5BVPH 3CWGA 5I71B 2PXYD 1KLGB 1QLRA 5D7IA 4DSYA 5JHMA 1KG0A 2FJGB 2HZHA 3B9VA 4JO1H 4NQEA 1U41A 2ORBL 2K3HA 4WW1B 5DVLA 2IMMA 12E8H 3NTCL 4I3GA 5DO2C 2HT4D 3CVIH 4PJ9A 4XO3A 4IDJL 4Z7QB 1QR1B 1MJJA 1MHCB 1PD0A 4NQQA 3EH4B 3JV5A 4N8VG 1G1CA 3HE6D 3N41B 1YN7A 3EOBB 1OEZW 5IVXB 3PHAA 3WHXB 4MWFA 3OAZH 2I26N 5C08A 5I8OL 1I9IH 4X7EC 3BT0A 2ZX9A 3D5OF 5KJRH 2EZ0C 1TFHA 4DO5A 4UV4H 5GZNC 3VNYA 3T2PA 3QDME 3B9KD 1IGTA 2O61B 5C0RH 5EU4A 3VWKB 5DLML 5I8EB 1HSAA 1OALA 2ZF9A 1FG2A 4UQ2A 1ZVHA 1XCWA 1KIUB 2NY0D 1ECZA 4JUTA 3Q8FA 3EXJA 2AV7A 2EYRA 1YECL 3RY6C 2MHAA 1MFMA 3RZWA 4ZG1A 1A47A 1EGJA 2HH0H 4X6FA 1NCNA 3GINA 3NJJA 4XNMB 3ZL1A 1LILA 2XWJA 3V0HA 3X17A 4IIZA 2ZYIA 3DX1A 6FABL 3RWIB 5D93B 4GFXA 3RI5F 4PQXA 4HEPG 1QQDB 4YHKH 5IFHL 5CD3B 3EBAA 2Z93A 1JGVH 1ETZB 2UY6A 1U2HA 4NBZB 3G6AA 4OD2A 5KEZA 4IW4C 1KXQA 1XB6A 3BZDA 1Q9LA 3R4DA 5AALA 1PQZA 3BCFA 3K80A 3U2JA 5I6OA 2NQDA 2J4WL 5KANG 4ZO7A 3QI9C 3IYLW 3ZZQA 4QI3A 4PJAB 4C83A 3ILQD 4YDMA 4MZ3A 4N90E 4XMLL 5IJDC 4G72B 2CRZA 3P0VL 5DMGC 4Z7NE 1MLCA 3WJLA 2BNQB 5LO7A 4YHNB 2PCXA 3I6GA 4PIBA 1MVUA 2E7CA 1WEJL 3BT2H 3WE6B 3ABZA 2EYSA 3C87A 3SCMD 3VRJA 4Y5YB 1N6UA 2VR6A 4GAGL 4K3JH 4XTRD 4JS7A 4DF9A 1GOGA 2A77L 5BZZA 4YNYA 3S5YA 4G83A 1EZUA 5CU5A 2SODB 4KKBD 3FRPG 4Q6IA 3MJ7A 4ODHL 1OOAA 3VFRA 5HYSA 5BV7C 2COVD 3L3HA 2OXHA 1UVQA 1OB1B 3DBXA 3TNNA 2YWZA 5DWUH 2XPGA 5J3HD 2OKMA 3G6JF 4PJ8A 4GG6B 3TESA 3O45B 5E08L 3CPUA 4WGVB 3MRIB 4YXLL 1D9KA 1Z5HA 2F5AH 4MXQD 4Y4HB 4PGCB 2A83A 3KPMA 2A0LD 5T3ZE 3OKNA 4C58B 5D1XE 4LK4A 2YWYA 3F7RA 3S35H 5BJTB 4ZXBD 3UTZB 4MD5B 2PWGA 1JGDB 4JDZB 4JFFD 3RWGB 3QIUB 1YEIL 5I0XA 3PU7A 5DWPA 4L5FL 1IGCL 3MO1A 4ZJ9A 4ELMA 3IXTB 1NUNB 4NHUB 1SHXA 4OQTA 2WQVA 4S2SB 4L8SC 4GPVA 4LLVA 2Z31B 1IX2A 1FNEB 4G8GB 2ENPA 1SJHA 3T0EE 1R3LB 3TF7C 1NH6A 2PO6D 1BVLA 4Z3JA 3SQRA 1FJ1A 3EZJB 3FOMA 4IRZH 1Y1DA 4PRHE 3P0YL 2N1KA 3FMGH 3FUMA 4MAYC 4MJ4A 5FKAB 3WY3A 1OCWL 1KJ2A 3F12B 3MNWB 2JJTC 1IAOA 5CP7A 3SDXA 1DVZA 2UZIL 3NIFF 1DFBL 1I7ZB 2VE6A 5IBLD 5IW3A 1M6OA 5D70L 1UB6B 3AY2A 3FPYA 4CA4A 1FFPB 2ITFA 5I8KH 5EEYA 1IM3B 2VUOA 3H55A 3IMSA 1I8KA 3S2CA 5ID0B 1UACH 4JFDB 3IU4H 5AVXB 1JGEB 1T89A 2JFCA 1IT9H 4J8RB 1HCZA 2W1NA 4JPVH 1M1XB 5F3HB 4MB4A 2YPVL 4NT6B 2EIEA 2FEJA 1JI1A 3FS9A 4R96B 1NBYB 1MWOA 2Y36L 4OFVA 1ICTA 2DQEL 3HFMH 3UIYA 5E00A 3ROOA 5ENWB 1A0QH 1N19A 2CA4A 1S7TA 5AVVB 3GMPB 4LVNC 5ICXB 4JO3L 5D7JD 5FUCE 2DAVA 4P3CL 4R7DA 1C5DA 5EZLA 1YNKH 2J6EL 4QRRE 3FU7B 4XT1C 4Z0BH 1MCCA 5FFGA 1OGAD 3RIAK 1JGUL 4DWHA 1ZA6B 4TNWK 1GGBH 3SB3A 2IADA 3AGWA 2I07A 1X5LA 4NQVB 3GEWB 1K5NB 3O3EA 3QARA 1FZMA 3HPJA 3HTLX 1MCOH 4HBCH 2HJKA 4Y5XB 1D6EA 1I8MB 3JWNH 4KOCA 1C7TA 4NRXA 1YY9C 3SPCA 4HUWA 4K4KA 3UYRH 2XFGB 5LVEA 4NPYA 3EYUL 1CGTA 2FLRT 3OWRA 3P54A 2F0CA 3Q9PA 1TXKA 2BHZA 2EH8H 1OW0C 2MPAH 4NQUA 4LCUB 3M45A 2APTA 2WP3O 3KYOA 3HG0A 2VDPB 3DV6A 2P5ED 4WO4C 1T04B 2DYPB 4KJPC 3LRKA 3SE8H 1F2QA 1Y18B 4Q56A 2W0LA 3MFFB 2J8UF 3NGBC 3T1FB 4N0UB 4GKSB 4FQXB 3BO8B 4YSPA 4XPBL 3NEOA 3QZMA 4CVXA 2BH0A 1EHLL 5KSBB 5ABDE 3IPFA 2YAHA 1HC1A 1MCQA 3T3MF 2XETA 4Z5RB 3ML9A 1L0YA 5DI8A 4UINL 1ZHBA 2CDEA 2KPWA 2MCPH 1U30A 1PAZA 2C8NA 1E9PA 1JZ8A 1XFPA 2P42B 4PRPE 5D7LD 1NGPH 5I74B 2YJQA 3BXNA 5T3XL 3NRPA 3OHXC 2ZXBA 5ICYB 1LK2A 3H9SE 3GBNH 5MERB 1QP1A 2YQ3A 3H9HB 3NA4A 1VJSA 2HFFB 4LCCC 3NESA 2VDQH 4PJCE 3O4LB 1WZAA 1CDHA 3O3AB 5F1OB 2OMTB 1BZ9A 2E27H 2VW7A 5KS9B 4AJVA 3BUQA 3U0TB 3BKYL 3TCXA 2PTUA 3CVBA 4DP8X 1XO8A 4AQ8A 4EIZC 1EJOH 2B15A 1AXSB 4LCIL 3VXRA 3RBGA 2R7EA 1UFGA 5FFOA 3F05A 4HWBA 4WI9A 3ATFA 3IMWA 3VFWB 2ZUQC 3Q13A 4G7SB 5ALCH 3ZKNC 1AGFA 1SYVB 2L7QA 4KTEL 1F4HA 4MA7L 3HN5A 2A9ML 3H3BC 3QQXA 1QSFB 4IOIA 2ZXEB 1E6OL 4BXSV 1N0XH 4R5TA 1ZEAH 4XODA 4Y1AA 3KPSD 1NIDA 2PWFA 4PEEA 2AKRB 5A16B 1S5IH 2V9QA 1SGKA 4I85A 5EWIH 3KPLA 4UBDD 5I1JL 2EVFA 2XACC 1MW2A 1RUQH 4QY8A 2VDNH 3T09A 3BZFB 4XVTL 1TQVA 3MGOB 1N59A 3F7VB 2A5UA 4G7RB 3CHPA 4XPGL 1J1OH 3CLEL 1CYXA 3WXWL 5D1ZA 4MD4B 3K6DA 4NWTL 4IU3B 4OGYL 2BLFA 4FMFA 4H2CA 3FSVA 3R8QA 3QQDB 4L2LA 3KLAA 3UYOD 2LVCA 3WTWA 3AXIA 1T5WA 1PYWB 2GYSA 1NCIA 1PD6A 3HMXA 2V7NA 5TDNB 3CSGA 5D7LE 1NIBA 3BRGC 2ERJB 4YFLI 2CRIA 4L0YA 3QPQC 2OYPA 1FYTE 3MKGA 4HIEB 4OZGE 4WUUA 3BPNB 4M8QB 3OWEA 1NIFA 2Z8VC 2D0HA 3AU1A 7PCYA 4K5MA 4PB0L 1FL3B 1UM5H 1JBJA 5IFAH 3NSJA 4HKXA 2VO5A 3UC0L 1JPFB 3MJ9L 4FG4A 5I2IB 1Y6NR 3BEVA 3SGJC 3OZ9H 1CK0L 4R7XA 4AMWA 2BP0A 2R9HC 5EC1B 4WHTA 1ZHNA 3CZEA 5DK0A 1SVBA 2XN2A 1FLTX 2FUTA 1E8YA 3KXFA 5DRZA 1RJLB 1VERA 5KBMA 3FFCB 1NMCC 2KDGA 4G70B 5CLXA 5KWYC 3T0BA 2WXQA 1EHAA 1K8IB 2XVLA 5DEFA 2VABA 3RFZC 1E5UI 4U6VH 1QO3B 2G5BA 4XO8A 2F7OA 4H1LH 4X7TA 1YEFL 4FTVE 1EBPA 4CDGC 4PJHA 4Q4IA 1I75A 2WPGA 2HT2D 4UU9A 5IB5B 3ULSB 3GB7B 3QJHB 5HHOA 1HZHH 1N7MH 2MNJB 1GHFH 3POCA 4H8WH 4GO6B 3BCDA 1WAEA 1W72B 3F7QA 1FZKB 25C8L 3QULB 2YD2A 1IC4L 3H4HA 1MCEA 4NJAL 3L17A 4WI4A 5JQ6H 3O2VL 5IV2A 1GGYA 3AAZA 3EJUA 3ETBF 2AFNA 2WSPA 1SJEB 2ZKWA 4QRQB 2FEDD 2PCYA 4GRLC 3IFPB 3V6FB 1YMHA 2FBRA 3HJEA 3VXPA 1QSEA 2XI9A 3BSZH 1AZNA 4HIJA 5IY5B 3BVWA 3MV9D 4G6AD 4PIRF 3VGEA 1LXMA 1A5FL 2I24N 1BFOB 4ORGB 3QEUA 2QKIA 3MJ8B 4K7PX 2VLRB 2CIKA 1D5MB 2VAAB 3MCYA 4UT7L 3LEYL 3W57A 3TL5A 3TTSA 4NNPH 1E4WH 4G8FB 3TLRA 4HUUB 3K5SA 3H4FA 5HYSG 4Z18A 1KBKA 1FVCB 1TJIH 4FFVC 4P2QD 1ZHLB 1ADQH 3BD4A 1QBLL 3JBG7 1MDAA 4Y9BA 3WFHB 1AZUA 4JM4H 3CPLB 3W5MA 4K7FA 4HFUH 2V3FA 4JFTA 4L4VE 1THAA 2B77A 2J88L 5GGRA 1VCAA 4R5VA 3S34H 1F6FB 1JK9A 5EPMA 2W65A 1S9KC 2WYZA 2BHUA 2VITB 3NP3A 5LLIC 4IJ3C 2HT3C 1C9SA 5E8OB 4H20H 4NUQA 4E41E 1P4UA 2JQZA 4LHUB 1A6ZA 1JNHB 4X80L 2N1TE 3HBPA 3A22A 2ZUTA 1I1FA 3MLSL 1KUMA 3KYMB 4LLYB 4XCCL 2I7OA 1U8JB 2B9BA 4H26B 2D0FA 4LF3A 2OLDA 3LZOA 1D3CA 3R7RA 2VN6A 1DO6A 2JI2A 4QHMA 1WWCA 5CFHA 2F19L 2EDHA 1NCDH 4K23H 3LKPB 1KTLA 2H2PD 4MVBC 3SDAD 4HIIA 1ZLEA 2AXFB 4JFUA 1DO5A 3LTVA 1FBIL 3D18B 1JNLH 3O6FC 1DE4B 5L4MA 2FBJH 1CXHA 4PHXA 2RACA 2I5YL 1AXIB 1ZE3C 4QRPE 3D39A 1AI1L 4IGBC 2X4OA 3HS0C 5ERWA 4YPJA 2WXMA 2ATAA 4DO4A 3LRGA 5I1LA 5K5YA 3DXAD 2BSTA 3WXVH 5GRZA 3NJHA 1OZUA 3C8KA 4PB9L 3TWCL 3IFLL 3ZTDC 3INUL 3GMNB 5I30H 2GCYA 5CJOL 3T8VA 3V0VB 3JV4B 4WV1B 2L7EA 2B3RA 5DUJA 4LSPH 6PCYA 1RZ8A 3IDGB 2J1ZA 2GC4C 4ZUUB 1WYJA 1A1NB 2AI0L 2SEBA 2Z91B 4YK4B 5TH2A 1EANA 3G6JA 5I6NA 4JQIH 5IMLB 1U95A 2H5UA 3KPNA 2VO8A 2HTLC 4F2MA 2XWXA 2IO5A 1BF8A 4F37K 1U93A 3RIFK 2NW2B 1JZGA 4M1DH 3EYFA 4XVUC 4HV8B 5F7EL 1OP5H 3WUWA 2EDDA 4YDZA 4H4NA 3BH9A 4YZFF 2EE2A 4AEHL 5C9KA 1SHSA 3E6HB 3A6BL 3FO9A 4KRLB 4QF1A 2C9RA 4LLWA 2NY7L 4YXKL 5HI4D 4FYSA 3PWLA 4LOUD 3B3IB 3JYCA 3J8F7 3BUYB 4Z7UB 3M7OA 3SE3A 4LAQH 2P43B 1I85C 2OYLA 4PYGA 3MBEC 5KYWA 1BD2B 2HRPH 4ICXA 1T89C 5C0CB 4ADIA 2YR3A 2XWBA 3MODH 1T5KA 3PFQA 1CBVL 1EUTA 1IEBB 3NFSL 4V1DA 1JNNL 2HJFB 4CU7A 2UY7B 3P77A 1A4JA 1P2CA 2G5RA 3QIBD 4PJBF 4WFFD 2R0WL 1ACCA 1R3HB 2DQJH 2VDOB 5J89A 2PXYA 2RBLA 4R83A 2MNWA 2B5IC 4XC1L 1UJ3C 2EC9T 2WBWB 3KHOA 4ZSOB 3EUDA 4M61A 1C16B 2ZKHH 4HISA 4BA0A 3KLDA 1H19A 4KDTA 3UGXA 5ISZE 1HL8A 4ORZC 3VFNB 1L0QA 3IPBA 4UYQA 4O4YH 1Q9KA 5FM5O 1F11B 1MCRA 3D50A 1HOEA 5F7AA 5GZOC 3HE6A 1A6UH 2BIHA 2AABH 1CGXA 3K71B 3PAUA 3WAKA 3BN9D 4U2YA 5K9QI 3O41B 1V55B 1JUFB 4M5ZL 3O8XC 1BOYA 4WFHD 3QCUL 1JNJA 5B1CA 5ADOL 3NZ8B 4MYWB 1QLFA 2APFA 3B9KA 1JL8A 4M6MH 1VPOH 3G5VB 2RB8A 3UJJH 2HFEB 4D0CA 3UTSB 5JPMA 1FFRA 1XX9C 3V52L 2XU9A 4B50A 2RQ8A 1HJCA 4HUNB 5LWYL 2R8SL 3BIAX 1RU9L 3IJSB 2G0LA 2V2WA 2ZX7A 4BWWA 3B5GA 2AJUL 4EI5B 4BFGA 5GGRY 2WLZA 1P5VA 5FKPB 3IDIA 5B1JC 4JL1A 5LGJB 1B4LA 2N59A 3OJ2C 3HZMB 3SJVB 3WJJA 2QPSA 3FTXA 1QWUA 4PY7B 4H8QA 3CFUA 2EDEA 2W80C 4KXZH 4JN1L 3QO0B 5ESVB 2N01B 1HCYA 5IZ7A 4C4KT 3SYOA 2JB5H 5C09E 2E76C 3ARDB 1J9RA 2D03L 3GSNL 2IDSA 4L9LB 3V8CA 4PCKA 5E2WL 5E8DL 4YBQD 2PNDA 5L2JB 5JQIB 2GJ6E 4UIMB 4IU2B 5FO7B 1VFBB 2BVQB 2UXGA 4R5XA 2O4EA 4FFZL 2F74A 2OX5A 1FVDA 1ES0A 2YD6A 3Q2CA 4WU7A 5DHXB 3F83A 4QJ3B 1J1XL 3HPLA 5G2NA 4AEIH 5I0ZA 3TEYA 3HZVA 4PLNC 5L4IA 4ZS6D 4OFPA 2CBTA 1KJVB 3SCMA 2UXFA 4LQFH 5CBAB 3GIVB 2J8UA 2X4TA 5PAZA 2K70A 2VR3A 3QNYA 1S78D 2WOBA 2XTLA 2Y2TA 4FHKA 2BMKA 2VKXA 3F2LA 3IGAA 5ILTL 4A37A 4JDTH 1X9UA 2MTPA 5EORL 4AQ8C 3BEWB 1BMWA 3UPAA 3SDDB 2JCCE 1EAPB 4F57L 3BWAA 5ACZA 3N55A 3ARYA 3GXUB 3QZLA 3DETC 4FQCL 2CNYA 4V2CB 3TJEL 2GSIA 4KJYA 1HYRC 2HRHA 5F44A 3E7JA 5SX4H 2HVJB 4QIRA 3D4CA 1FNHA 4FI7A 4ICWA 4ADGA 2MCAA 3RX5A 3Q6GL 4YMPA 5C0JB 2VSCA 4OLYH 3TJPA 1MW1A 3GTTA 4CILA 5JA9A 4F91B 5CCGE 2FX8L 3MNMA 2LAGB 1DBKL 3ZMEA 1WE5A 2ZOUA 4LPVA 1K2DA 4NM4H 4I4WB 1B3JA 4ZXBA 4OF8A 3ZPDA 1CICC 4JFFA 1VSCA 1UEMA 1YYMH 3GEFA 1RZFH 1OF2A 1TO4A 5EC2B 3VRIB 5FHBH 2L3BA 2P5WE 5IMKA 3QJRB 4YDIL 1M2VB 1YN6A 4FYQA 3LZPA 3CC1A 5J1AB 3GLZA 2YEZA 5C0BD 1NAML 3KPRB 2PO6A 5BCAA 4ZOBA 1M3IA 1OKEA 3I2CL 4KX9A 1ZT1A 4DGYH 1ZT4A 5G4MA 5GGVY 1RAMA 4APQC 4HW6A 1X9RA 1VGKB 4W6WB 3VGAB 2A9BA 4L1LA 4GQ9L 5JUEH 4O02L 2PMZA 4Q74A 2QJDA 4P4KC 3EJSA 3KJ4C 3LKQB 3WKQA 1QPPA 4DW2L 1GS7A 4HIQA 3VFOB 3VD5A 4RISL 5ID1B 2BZCA 3F04A 4LL9A 1I7UB 2C1PA 1Q94A 3L2MA 4E9QA 5GS1A 5IQOA 3O9WD 4K94C 3H9YA 1EHNA 4G7VL 4TNFA 5AG8A 1YDPB 1TOXA 5JLZB 3QO1A 3M8OL 3TVMB 2X2YA 1JHKH 1KCRL 5EUKB 5TD4A 2IPUG 5ITBL 3BVXA 3U4EA 1H0DA 5FUOL 1MRFL 4KTDL 3DVGA 3WO3B 4D94A 4IRZA 2PYEB 2KL6A 4R97C 4RVBA 5I5RA 4UDUB 4RAVA 2XDHA 5D7JA 2A4EA 1RURH 2BS9A 5CZKA 3HA0A 4PP1D 3IDNA 5TDOA 5I8CA 3IVKA 3OKLA 4C54A 2P52A 3BHBA 1E3FA 1OGAA 4JFZH 1ZA3B 1FL5B 5EZIH 5AB1A 1HK6A 1N8ZA 4JJHA 5C07E 1U3JA 2B7DT 2UUDH 2DDQL 4LSUH 1SM3H 4HJGA 4MJIB 3S2AA 5CS7A 3RRQA 2OP4H 1H3PH 1QFWH 4KKRA 3SIKA 2JB6A 5KAQF 2D31B 1TTAA 1IQWL 2E3VA 3CK0H 3GDCA 2WLIA 4DGIH 4ECNA 5DD5H 5ACMA 1R3IL 3C08L 3QWQB 3W38A 1W0VA 2F2HA 2PW2A 1ZSHA 1WFJA 1A3LL 1X7SA 4MXWL 2YD1A 2J21A 3KGTA 4JZJA 5KW9L 2IH1A 4AW7A 3CDCA 5F96L 4XX1E 1SLVA 3ABKB 2YD8A 3GGWA 3SQOL 1F6AA 2AXGB 7CGTA 4LP8A 4Q0XH 2P5EA 1J48A 4XCYB 1INEH 3WDJA 2BNQD 2ED7A 4N0FA 1H5BA 4A2GA 1SLUA 3KYKH 3NCBB 4XCNA 2IQAA 3ESVF 5I1AB 3N42F 1SEQL 1F4XH 1CG9B 1NC4D 4XB3A 1M4KA 4DPCX 2ENQA 3LY6A 3SBRA 3BE1H 4AEEA 3SPVB 2MEJB 4OJFL 2JJSA 5IHHA 1WIPA 4DFIA 3S3CB 4Y16B 1AHMA 5JO5A 3U46A 4P3DB 3CN0A 4LASL 1MUJB 3N2JA 4W9ZA 3OJDB 2VQ1A 1F56A 2VIRA 1G1OA 1CL7L 4FEIA 2OQJB 5T33H 4JFYA 3FU5A 1FAKT 3QDHA 4M3HA 3OSKA 5D7LA 4AGOA 1T5XA 3MNZA 2HPTA 2QGBA 3FT9A 4F5CE 5FIEA 2CJSA 4PJIF 4XVSH 1A6VL 3QISA 1IUZA 1QPKA 3I6SA 2YFOA 4OCXL 3EG9A 2GBAA 4Y5VC 1SEBA 2P3YA 3DVNB 1U92B 3QR1A 1Z2KA 5CSGA 4RMRA 5C0DA 3RTQB 2PCFA 5EUOF 5CKAA 5C3LD 1KENH 3WUWG 3MRDB 4N9GB 5F88B 4P5KB 3LS5H 4LMQE 5EFIA 1P9MC 5E2VH 3HB3B 4DN4L 1TCMA 4G8GD 1J86A 4FHBD 1S9WA 2Y06L 1IB5A 4N6RB 3FUHA 2V17H 5CO1A 1XF5B 3QHZH 1IFHL 3SGKC 3T65B 2FCBA 4WFED 2FB4H 4GSXA 4JY6A 2AQSA 3VXMD 4WI7A 3KPSA 1NGXB 2OTWA 2OI9C 1F97A 2DIBA 4POYA 4Z7QF 3R19A 1I1YB 3PWPE 1T20A 2QPUA 3RGVC 3OGCB 1LO0H 1WISA 2IF7A 1EO5A 1OAKL 3QR2A 4NYLB 3RVXC 5MHSD 3VRLE 1EEZB 1JZ5A 3RWDA 4LOFA 2VLLB 2AAAA 4MB1A 2DEXX 4RGMB 4DHLA 2W60B 3FU6A 4HIPA 4N86A 3S0PA 4L48A 4A39A 4NSKA 1QKZL 5A40E 1CURA 5DMIH 4DUVA 4D0DB 2VR5A 2DLEA 4NN6B 4W9CC 5T1DH 1XHHA 2FAUA 2DQ6A 1WIUA 2YLHA 2FO4A 4BZ2L 3ES6B 1MRDH 2AAVA 2VDPH 2HFGH 5C0IB 2OULB 4I77L 2YK1H 2G4EA 2R27A 3SDCC 1AY1H 5I9QB 1QFOA 3WFZA 2GUOB 3CZNA 3M1CA 3NYKA 3ARBD 5E1HB 5CCJA 4Y7MA 5I6PA 1LO4H 4IKNA 2CO6B 1KNOB 4QHNB 4NLHA 4OD1L 4RFOH 4JFOA 5D7SH 4G8IB 3V0GA 4B9IA 4RCAA 2XWTA 4DPAX 3BGMA 2BCKB 2LOEA 1JPGA 2AK4D 4JANB 4GQRA 4TVPH 3W11C 1WITA 3GD1C 1HXMB 2AQNA 5E1QA 3KR3L 5DD6A 1AIFA 2PF6A 5AL8A 4M5YL 3ZK0A 3JZYA 5LGHH 3HE6C 4TSCL 4HQQL 4ZUTB 4PGJA 5L4FA 1JD7A 1PY4A 1QZNA 4L29B 3V8OA 3VXSD 3JTTA 2B4CL 4AGMA 2Y7QB 3IJHB 4FLQA 4AH2B 4XBEL 5L88L 1DBMH 1S7VA 5DUBB 1Q9OA 3HG1B 1RZKL 3UJIH 4UTAH 2ZUWA 1IGYB 2DM2A 2CMRL 4M7ZB 4PJBA 4A66A 2W9EH 2ZICA 4WLCA 1TJXA 4ODBD 3V0DA 3MOBL 4G11A 5JPMC 2MTAA 3UZEA 4X8JB 5CWSA 2FECL 4FE9A 1TCRA 3SPJA 4NRZA 4IM8A 5DQ9B 2CUIA 2F54D 1GIGL 5JXAH 3IDYB 1B6DA 3LQZB 1U3HB 1JP5A 2C7UB 5D1XC 4KHXH 5E99L 3S3DB 3WOVA 3DUUB 4D9QD 3FF7A 2FR4A 2JIXB 1PFOA 3KGRA 4FLSA 4TVPD 4QKXB 2H9GA 5H94A 4DQOH 1BFVH 2VDLB 5TGBA 1LDPL 3MV9A 4FAAB 4AQ1A 4LPYA 4HULB 1U6AL 3Q48A 4ONGL 5EIVA 3HVNA 1JD9A 2FTAA 5KVDH 1RZGA 2J73A 3QG6A 3A3YB 4MCYA 1FCGA 2VQUA 3T0EC 1G6RH 5KYXA 3FQTA 1FA4A 4BH8A 3QC5X 1N0LA 3D3VB 4OFYD 2XG5A 3H9ZA 1T22A 3EJCA 4P2QA 4U1GB 4LKXB 4H1LA 5F72S 2CJUH 4PVBA 7PAZA 3MREA 4K5PA 1LL1A 5LDUA 4Z3HA 3SOTA 5EEVA 4JPIB 4U1IB 2AK4E 5AUMB 1YQVH 3QGVA 3P9MA 2ZAIA 2YBGA 3K72A 3QEGH 2DI8A 2HG5A 3BC9A 1U8PB 4P5SA 4Y2DD 4FERA 5DK2B 4DKFL 1F3RB 1CDUA 5GRUL 4YHIB 3B56A 2F53B 3SO5A 2EXWC 4IRJC 1CFBA 2KZWA 1X4XA 2CBQA 4IEFA 5B38B 3MNVA 4ZMOA 4ODVL 5EEXA 5D2LB 2FZ3A 4OUUB 3FQXA 1J18A 1T66D 4PS4H 2OCJA 3BSZA 1IBHA 1GY1A 4UTBH 4M29A 1L9TA 5K9JL 3KYAA 4BCYA 1RSFA 3SOBL 1PW3A 5I23A 3AWGA 4DP9X 2MMXA 4R7VA 1F0LA 2A4ZA 2ZXGA 2C9XA 2OA9A 5B8CA 3SDAA 4I3RH 1PCSA 2WWKO 1PG7H 3DGGA 3UEZA 1DJIA 2YBRA 4Q58C 1QW9A 1ADQA 4MQ7B 5TF1H 4G7YH 1WTGT 5FUCC 3L5IA 1AGDA 5T5FH 1BZOA 5TDPA 4YDKL 3ESOA 4M43H 1KN4H 3BW9A 4CADB 1AD0B 1H15A 1MRCL 3DXAA 1X7QA 4I18B 1M7DB 3BDXA 2WXJA 3EJYC 1SXCA 4DP6X 5IB4B 3V0IA 1QA9B 4KQ3L 4CU8A 2YSTA 1R5WA 3DJSA 1IKFL 1OSPH 5SWSE 1JRHL 4JDEB 4LGPB 1W72H 4X98A 4HCRL 4FJ6A 3QJFB 3PIQB 5BRZB 4P06A 3BAWA 3EOAB 4O51B 2FO1A 1JDDA 3FCGA 1C5CL 1AR1C 1JPST 5DVKA 1OAYL 5J13B 5F7BA 1F41A 3MGTA 4S1RL 4XCEA 4YLBA 5EIIB 1RZ7H 1PGRB 4XPHL 5F89B 5GS1C 1NCCL 2HKHL 4KX8A 1BVNT 4EQ2A 4EXKA 4HPYH 5BS0E 2DQGL 4CSZA 1L5GB 2WLLB 2LU3A 4J4PC 1SXNA 4WHDA 2H41A 3QIBA 3ZE2F 1MNNA 3MRQA 4N0CD 1W15A 3B9DA 3N1QC 2CE6A 3MQIA 2WXPA 5D1QE 5F7WC 3WYRA 3EFDH 4EPSA 5T1LB 2JCWA 4KI5D 4MHHG 1MREL 2MKWA 3EFOB 3ZYIA 4G9FD 4JQIA 2BERA 3L9EA 4Z78A 4A2MA 3UZVA 3P4NA 2FIKB 3E6FA 4TNVF 4GO8A 2JKRM 1KTDB 2CHXA 3GS7A 3N1GC 4NQCD 3EJZD 3WIFA 5IP4A 2Y0SA 5KSBF 3QAZC 4XBPA 1NM9A 2V9RA 4ZMXA 3GHBL 3IGKA 4W9LC 1XR9B 3BAYA 2X9XA 4WTWA 4F93B 1UWGL 1UURA 2DTML 2C4XA 4WJG3 4YX2H 6CGTA 4JG9A 1KIQA 1G7PA 4FLRA 5J6HB 1VKXB 4MXVE 3STLB 3VA2C 4KQ0A 5DJYA 4LLUB 4OV6F 2AJXL 4YSTA 1HCVA 4AL8L 4N0RA 1WFTA 3WS3A 4X6DE 1MFUA 4FF9A 3TCLB 1KIRB 3AT8A 3SY0A 5A3ID 1J05A 2AZAA 1NCHA 1P6FA 3JWNG 2X10A 4R8WL 1QTYT 4M6OL 4U6HA 5FX3A 5IM7B 1G84A 2Y7NA 1ECYA 5AKRA 3UBXA 3MTXA 4LKCA 2ZQKA 3WEOA 2MNUA 3WIAA 3QQ3A 3GSRB 5BO0D 3U4KA 1OARL 3M1OA 1NA8A 4WWKC 2DLHA 3ZZ1A 4LHUD 1ODAA 2ZP8A 3BPOC 5HGBA 1R1CA 2EIZA 5FECB 4TRPL 2NY2B 1P5UB 1SXAA 1OB0A 2R4SH 4TQ8A 3L1EA 2G75B 1R5IB 3TA3C 2A73B 2VZVA 2ICWB 3MDJA 5HJGA 3LIZH 5EZJA 4X2UA 4B97A 1J8SA 1MFAH 3CZFA 3ATBA 4NP4H 3GSWB 3QZNA 4Y4FC 3S96B 5BO1L 3L4WA 1XD1A 3PHOB 3LYRA 2TSAA 2DL9A 3ESMA 5EB9A 3FUKA 3QR0A 4LLMA 4KQ4H 3HEIB 3TO4B 1P7KA 4KX7A 2FIRT 3EYOB 2ADGB 3KEHA 4FL4C 4HMDA 2QR0A 4QTIH 4ZW8A 3QEHA 1P0SE 4JJ5B 4ZDHB 3BVNA 5DD1L 3N40F 3X2QB 3WLBB 5DJAA 4PMFA 4ZRGA 2XTJD 3GK8L 4LPXA 5IG7B 1TENA 4JRFA 3ISWA 4OI8A 1O9ZA 1DBJH 4XH2B 5IKCB 2FYYA 5DU7A 3QNXB 4XO5A 1BM3L 1AP2B 1D5IH 2AQTA 3QUZC 8FABB 3F6JA 3ELQA 3GBML 4NO3A 1DSFH 5IQ9A 2A74C 1MF2H 2B14A 1WD9A 1JDAA 2ADJA 1DQQA 4TKWA 2VSKB 5AVYB 3R4RA 2K9UA 1J11A 5B21A 3BAEL 4OGAC 1EQWA 2NXZD 1TQCB 1S3KL 4TUKH 5LN8A 4HUCA 2XWEA 3GLAA 1PPIA 4L0ZA 4JRXB 1E4XL 1N67A 1OK0A 3GJFK 4HOZA 2DH2A 4E42A 3ARED 3MUJA 5SWZB 3GMLA 4HGWA 4FXKA 3CX2A 4AYID 4Y4KC 5D2NA 3RYMA 3FT4A 4HT1H 4WCYL 2X4UA 4LU5H 5HY9A 2YSSA 3QUXC 4EKXA 4X8XA 1T0MB 3NEEA 1YEHH 5C0BA 2BX5A 5TQ0H 3KW8A 4YHOL 2EIDA 5AOZA 3QCTL 2AJVL 4G6JL 4XN1A 1UQSB 1MPAL 2GKIA 2X4PA 2FWUA 2YEQA 2WUBL 1PDKA 5GISH 4AEFA 4QLWA 1KLGA 5F7NC 1LEKA 1B2YA 3UTQA 5C0FA 4KI5F 2NY6D 4LB8A 1FORL 4G3YH 5DC4B 2N0KA 4MJ2A 3RDJA 1KGWA 1KLFB 1P4LB 4DOHE 5D5MB 4PTTB 1BEYL 1E40A 4KROD 5BQ7A 5J4MA 2K7QA 4XZUB 3GSQA 3TT1L 1A3RL 3W3BA 4LLDB 5DS8A 1HAWA 1FGNH 2EQDA 4JQVC 1AXTH 1AO7B 3G04A 5F9OL 3O9WA 3BPCB 1A7QL 4WJKB 4NNXA 3T0XA 3W1ZA 3FUFA 3UROR 2J44A 3OKMA 1PBYA 5ESAA 4M62L 4K3GA 1EJ6A 2J71A 5A43C 3E2HB 4MNQB 2XZQH 4GAFB 4L4TB 2O61A 4RNRB 2DQIH 2ZWYA 3U36B 4M93C 4P46A 4XBGA 5I8EA 1MI5D 3AG1B 3UTSD 2OTPA 5DJDB 4FNRA 5EO9A 1S5HB 5AL0A 2AEIT 5DRXA 5GIRA 3CU7A 3QJOA 1GR7A 5GGUA 2ESVB 4HUVA 1GC1H 1A4CA 4ABVA 3FSOA 5FDWA 2P24B 4XP5L 2OR9L 5T8IA 2J1XA 2R69H 3L3KA 4XNMA 4H1LG 1QTPA 5C6PB 1HEZA 3L7FB 5EN3A 4GBXC 4M7LH 3BFOA 1WZMA 2FNWA 2YN5A 5IMOB 2IFFH 5I0YA 3MXVL 5IESL 4GUPA 3Q5TA 1U8CB 1CR9L 4PLOB 3KVDD 5CD3A 3MPCA 2KZBA 2GIYA 1RXLA 4O9HL 1A9VA 2I85A 4JCLA 4HOWA 7FABH 5MP6L 1WH0A 4AW4A 4MD0B 4FQQB 2GTWB 4KKAC 1J5OH 4XI5D 4F8PA 2VXQL 1A7RL 1ETB1 1K4CA 1A66A 4OF6A 3DRTB 2C3GA 4JQXA 3MXWH 3CTTA 5FGCE 3LQMA 3O81A 4TUUA 4FFTA 4JJOA 3ATAA 3TEWA 4NQDD 3ARFB 4TUJB 5KVFE 4FFYH 2BNQA 4P9HC 4AIZB 1CDIA 2NUTA 2VLJB 1SXBA 3FB8B 3ZKMD 5AZEH 1XD0A 4BA8A 4XNAA 3P3TA 1B88A 5EZOL 1NC4A 4WTZA 3DHMA 3QC6X 1J8HD 5ESQB 3T4AA 3QUMH 4F8TA 2Q5BA 2WIMA 4RSVA 3FU0A 1DVXA 1CFQB 1U8KA 4B9JA 2EACA 3TPUB 1CXIA 4RQQA 4IOFC 2DPKA 4CGUB 3L95A 2H3KA 1UWYA 2OJEA 2OZ4H 2P8MA 5KG9A 5KVEL 5HTSA 4NO2B 3VGHA 1UKQA 3WY4A 5ADPL 2CXGA 5HHNB 3MUGA 3BUTA 1IGMH 4PJGB 1MJ7H 1F90H 1G9NH 3MLUH 3QFJB 4RIRB 4PI0A 5EG6C 3HLAB 3NT0A 4A6YB 4JY5L 1ET7A 4FG6C 2QFRA 4XHQA 4BFKA 4XWOC 2X28A 3LJ3A 1U21A 4NKMA 3AZUA 4MD5A 1JGDA 1TTRA 1WF5A 3CFJB 3LRHA 5CJ5A 2HRLA 5I73C 3FT0A 2XJKA 1UZ6E 2G2RA 1CYGA 3FSAA 4Z3FA 3OMAB 3OQ3B 4Z7UF 4BKLA 2GB2A 4HZ1A 1ULVA 3HC4L 3VB8A 5F6HJ 4A2FA 2X6BA 4U6YB 5MEQA 4NM8L 4OM0H 3LH8A 1RK1B 4G8GA 4YXHL 3GM8A 1JDCA 5G5DA 5CILL 4S1SH 4BH7A 4M6NL 2K3TA 1YMMD 1LMIA 1ZDQA 2JLLA 1FVEA 4DAGH 5ANME 2R51A 5FKAA 3EAKA 4YLCA 4MA3A 4P2RE 2Q86B 2X7LB 3VXMA 4JGNA 3BYYA 1K85A 1BLIA 4NQDE 4U1KB 3H8NA 3V4UH 4NQXA 2J5LB 3RL2B 3TH3T 1SN2A 2VN4A 2A9DA 1LO5A 4K55A 5DYOA 4NHCL 4C56E 3KBPA 4AENA 4K8RL 3JZ7A 3ZTJH 1DEDA 1S2EA 4HU2A 4ZFZB 3V5DB 32C2A 5EF2A 3GZQA 5F7DB 3N40P 4WY7L 1QR4A 3C5ZD 3GIZL 2GBTA 5HHQA 3B1TA 3V6OE 4YFLF 3ESNA 4A6YL 4JEGB 4LBEB 1HHKB 2GITB 3JV6B 4N8VB 2PTTA 4TQHA 3T2QA 4S11A 4P23B 2ZNWA 1NBYA 5SV4A 1KCVL 2ZX5A 1PZ2A 2AJYH 4XXCC 4OJDH 1LYQA 1B0RB 1XAKA 5FW6A 3MGAA 3QQ9C 1NBVL 5DTFA 2R0KL 1KB3A 3MLRL 4HKJA 1JHTB 2PYED 3T6ZA 3ARBA 3MYJA 1VCBC 1WAAE 1JJUA 4U1HB 1E4JA 4NZTH 4NNYB 1KCUL 2M8XA 3IKCB 5LNGA 4HHGA 4Z0XA 5TF0A 3MFGB 2AK4A 3HI1A 3ZHFA 2N0MA 5DUPL 1Z3GH 1KB5B 3MLTA 1ZA6A 4MGXA 1WFOA 2Q1EA 1Q0YH 2ZWKA 3KAAA 1WUNT 3TBSB 4OCNC 2A6DB 3H7BB 4Z95H 4MJID 3UBXG 3NA9L 1N4XH 4WWPA 3BKJL 3IU3A 4TNWF 4KZEL 3O6KL 1ZLSH 4CRPA 1YEDB 3KHQA 4TUOB 3VXSA 2O5NA 4LOEA 1RIVH 2QADD 3DECA 1F4WL 1XWVA 1OGTA 1WBZA 5JIIA 5KBDA 3KDMA 1KBVA 1JN6B 4JREC 5KAQG 1QX1A 5IR1B 3JVFC 3H54A 1G7JA 4XMKL 4R4FL 4Q8BA 5I6XC 4NKDB 2V3DA 3A23A 3L5XL 5EH1A 5BV7B 5DJ0B 5IHZA 1KACB 4WI0B 3BKCH 1Y18A 4N68A 3ULVH 5LBVA 4AXWA 1OTUD 2F54A 3T1FA 3X12A 1IEHA 1FRGL 2WZ5A 2NXYB 1U8HA 2CBMA 1KJMB 4GKSA 3ZLQC 3MRRA 2CDGA 4G5AA 4CNIB 4L1DA 1ROWA 5C86A 3HNVL 5LXVA 5KSBA 4TLTA 4RGOH 3U2IA 3M86A 2G3XA 2FUQA 2KC0A 3QUKB 5DZVA 3ARZA 1DDTA 2ZAHA 4Z5RA 4AY0A 1BGXL 3G5ZB 3OKDA 3SYAA 3DJ9A 1KOAA 1HJBC 3WKMH 3JQOB 2X53A 4MTMA 3V0EA 4V33A 4C59B 3EBGA 4LGRB 1KB5L 4D3CH 1P84J 3NJFA 1X5AA 3DSFL 1I9JH 1X9QA 4OFYA 2DJSA 4JRYE 2WUCL 4GNKB 3TT3H 3V5HB 2PUQT 4YBQC 1NPNA 5AKVA 4M48L 3S37H 5GS0L 1LEGA 3H9HA 4XNXL 4WI8A 4UTAA 2HFFA 3RVWC 1X5ZA 1E6JL 4L37A 1IU1A 4PJXE 1AHKA 3RTQD 5HDWA 4HFWA 2V4LA 4MAYB 4YE4H 1M1SA 4Y2DA 1KYUA 3FJTA 3F58L 1HL9A 3BJ91 3OG4B 4FKEA 4NPJA 3V9FA 4LDLB 3VI4B 1RUML 4RMQA 5KUMA 3ULVD 2DTSA 3LPPA 1FC2D 1OWWA 3T3PF 4D0BB 1I4FB 1ZT7B 4E9RA 5LAXA 5IVZB 5LG1A 5C7XL 4HSQA 5K9OB 2VLKE 4OZIA 5IHUH 2C1OB 2Y72A 2NY4B 1SYVA 2Q3XA 4G1MA 1MCLA 2WXGA 1NDGB 5BS0A 3MZTA 1XH2A 2CGRL 1M56B 3NFNA 2X2HA 2QELA 4XN4A 1OPGL 4K9EC 3H53A 2JSFA 3IDXL 4AI7A 1E5CA 3WJMB 1MCWM 2XN9D 1M7UA 2QBWA 1G6RA 4ZMVA 3S3JA 3CDGA 2ARWA 1T1XA 2BVYA 3OAUH 5C0ND 3N6YA 2M2DA 5DGQA 3VM7A 5D6DC 5TQ2H 5DJ8B 1QASA 1F58L 3E8VA 2NY5C 2X1WL 4LSDA 3GDBA 4GXVL 4LVNB 4PJEB 4HPHA 5HPMB 1MWAB 2XV3A 3IDMA 3NZHH 3QQDA 5E1AB 1PYWA 5I66B 4N1EA 2A1WH 5JXAL 3B7TA 1P7QB 2CJTA 5TDNA 4NAMA 3L45A 4AQAA 4Y19B 3U82B 3EFFB 1JYVA 3H6JA 1U8IA 1KCSL 1RZPA 1YEJL 2H32B 3MA7A 3L3IB 4UTBA 1FAIH 4R3SA 3FT3A 3DROB 3NABL 2O5YL 1FL3A 2XYCA 2FLMA 4KNQA 4PBDA 5FAAA 2GK2A 3BPLB 3V4VB 3KL0A 4PMEA 2E4FA 3GM0A 3PL6B 4LPCA 5CLYA 5KSAC 1AZBA 1DJZA 1IAII 2VDLH 1S4IA 3FB5A 4HLJA 3MRFA 2DWDA 4QT5A 1U3YA 3MRJB 3QWOB 4TULH 1NOAA 2GY5A 3MV11 2AEQH 1FFTB 3CDZA 4ODTL 4P2YA 3Q1EA 4WO4B 4X5XB 4A7QA 4F27A 2ZPKL 5T5FA 3MLWH 5B3SB 4WSJA 1JPSH 1JF6A 3L4UA 1UA6H 3TNMA 1CI3M 3NGBB 4GUQA 1ZGLM 3MSPA 2HKFL 4J6IA 4YSCA 3HG1D 4ERSL 1H6TA 3NJXA 4G82A 3O4OB 4ZFFA 2VDML 1S7WB 3HE7B 4KY2A 5FPIA 3L3OC 3F7PC 4P46C 1D5BA 3JWOH 3MOAL 3BP5A 1KXTB 5AOMA 4N5ED 4B7IA 5CSZB 1NPJA 4GKZA 1CF8H 4M4RB 3HC0A 4GSUA 4G9FA 2FL5B 5K9KA 3D4YA 1FNSL 1I1AC 2V5MA 2IPKB 5IQ7H 1GCFA 1A02N 5CXPA 4JFPB 1DUYA 4NQCA 1IAKB 4BCXA 1DVFD 2X4QA 2VSMB 3D85D 4IBTA 4KXAA 4C57C 4LCWD 1RUKH 4IBYA 1FO0L 3IFPA 3FB7B 5DFVD 5JIHA 1ZHKB 3WNPA 3BFQG 4LCCB 3EO9L 1O7VA 5KTEH 1HSBA 2R83A 4X7SL 2ZP0T 3IGFA 2OL3H 3QDJD 1BFOA 3U9PH 4ZO8A 1MEXL 1UA7A 4G6KL 3BLKA 4ZW5A 2VAAA 4NZUL 1V3KA 3CSBA 1JZ7A 1M2OA 3EBIA 3CN3A 3FTZA 2BZ7A 5FGBC 4OF0A 5HVHB 3O2DL 5IW6B 3MUHL 4FNTA 1KGYE 3B6SB 4A7SA 1PL3A 1KBGL 1E9OA 3WKYA 4YHZL 2Q3ZA 1JFQH 4G80B 4NZRL 1XL4A 2HLAA 3DRQA 4PJFA 1YZZA 5L2KD 5EBWA 2LU7A 3LZLA 5FYJH 3PG2A 4E9VA 1OO2A 2EO1A 1TQSA 2DW5A 1VGEH 5EN2B 3CXHK 1YLBB 4MAZA 1BVKB 3TASA 3ULVF 2BNUA 1ACXA 3FCTB 1JZ3A 2F58L 3D8MA 2V8LA 1N26A 3N43B 3UACA 2DQDL 3H6AA 2YARA 4F2FA 4Y2OA 4D7PA 2BM3A 4JB9H 1SVCP 4UQIM 3TZVC 5FR3A 5KSUB 3B2PA 1GZQB 1MHPL 1CL7I 1ONQB 1U8JA 1UOVA 4H26A 1IBBA 4QXGH 4ZMYA 4PGEA 2X4SA 1A14H 1S46A 5AQ0A 1XGRB 2GBVA 5I1CH 2P8LB 1P4IH 3NSCA 1L7IL 3W37A 2KUTA 3DC0A 1KF9B 2G9KA 4N8CL 2Z4QB 5DMJB 1DEEB 3FQWA 3VTTA 4RRPA 3AQYA 1J5DA 1OE2A 5PCYA 1BLNB 1EA9C 2ZONA 5DHVB 5SWQB 4UF7C 1DLHB 2NPLX 5IROD 4P5TC 3CC5A 5C71A 5KYYB 4RGND 4BFNA 1RKRA 5FYJD 3QPKA 2WJ7A 4OY9A 4D7BA 4GUOA 1TKWB 2ICCA 1QLRB 5D7IB 2HLFC 1DVQA 1KG0B 4NQEB 5TE6L 1OTSC 2Z7ZA 3QDJE 4RDBA 1KEMH 1CPUA 4PJ9B 3SBWC 2EEDA 4FQJL 4DFHA 1MFDL 4DVRL 4NLAA 4NC0B 3ZDYE 1MJJB 5IWLA 3S36H 2NLJA 3C2AH 3IDGA 1CXLA 2VQTA 3HUJF 3OPUA 4H0LC 1YN7B 3RB5A 3ZO9A 5CLZA 3ROLA 1WBXA 3KW7A 5C08B 2FX9L 1DQDL 5BRZD 4EEEA 1OAZH 3WLWD 3MRGB 1NMCB 5M7QA 4ZYKB 1C5BH 3OLEA 4WWNA 4CBZA 3LIZA 5EF1A 3HRZA 1MW3A 4HV8A 1M71B 3AREA 4GMSL 5JNYA 5I1KL 1IGTB 3SDYH 2FWOA 2IH9A 5EDXA 5EU4B 1SLWA 3Q2VA 4GKLA 3G5WA 3RB7A 4GINA 1HSAB 4XMUA 4PJ5B 4AM0A 1A4BA 1EAJA 4UQ2B 4Z7UA 5F8RC 1ZVSA 4I1PA 3ZE1E 2D7OA 4U3CA 1I3GH 3ULAB 4S10A 2AV7B 2CQVA 4KK9C 4P57A 2EYRB 2OMVA 1TFPA 3CHOA 3PHQA 2MHAB 1YNLL 5E9AA 3C9NA 2YIHA 2HJFA 5EMYA 2GBUA 4X6FB 1F13A 5I28A 3TBYA 4WEEA 3ABLB 4FJYA 3MRNA 3T5WA 3FQUA 5A2LH 3EO0A 4OB5L 3NSYA 3VFNA 3ARBC 3FAXA 3K8LA 1ACYH 2UY6B 4RGNE 1ML0A 3K6OA 1CFTA 2Y6SD 3E8UL 4OD2B 4FMVA 1Q9LB 5DJXA 1A7PH 1G9MC 3BVVA 1IKNA 1PQZB 3D34A 1J10A 2CGZA 4KO5A 3CXHJ 4ZO9A 1YECH 3KWXA 5FA4A 4WFGE 3EOTL 5CJXA 2W5PA 1LWHA 4WNQA 3FT2A 4DIXA 1MLCB 4HPOH 4R4ND 5J06A 4IKKA 4IIQA 4R26L 3I6GB 2ID5A 1MVUB 3G5VA 1PEWA 1MI5A 1FZOA 3UTSA 3VRJB 2XJLA 4JZNB 4YAQA 2AERT 4FCAA 3Q8EA 1NMBH 5DHEA 3ZUNC 2BY0A 2E7DA 4IBWA 2Y2WA 1WC7A 3MJ7B 4Q6IB 3OKOA 4YFDB 3VFRB 5HYSB 2E7HA 3L3HB 4YJZL 2J4WH 1KBWA 1EGJL 2OXHB 1UVQB 3DBXB 1YEGL 3TNNB 5BUAA 4KVCL 1Q72L 2XPGB 2BRRH 3HZMA 4YBLC 3FAWA 2LQRA 4PJ8B 5CGMA 1M42A 2BIPA 4PY7A 2Z7UA 3F3HA 2CO3A 2OJZL 1D9KB 1FGVL 5B3JF 3CMGA 5MI0C 5ESVA 4GRWE 3KPMB 3RJQB 4KHTH 5AYUL 4MFHA 4KXBA 4UM9D 1E2VA 3VGFA 1HX0A 1MCBA 2IXQA 3AVEA 4GAGH 3WE1A 3K6SA 1GAFH 5AENA 4M1GL 4IGBB 4YSQA 5ANMA 3MO1B 1U0QA 5HVGB 4ELMB 5E5LA 2BXZA 2YQ2A 5FO7A 2BVQA 4NQDA 1XBDA 4BK4A 4ODHH 2OV0A 3B5TA 4XN5A 4LLVB 4QHKJ 2IPTH 1DZBA 4LPTA 1ZV5A 1DVYA 5BOPA 1FJ1B 2IMNA 1KJVA 2NY1D 5KJ4A 1EMTL 3BAXA 5E08H 3NFPB 2IDCA 2X3CA 1J8HA 2BY1A 1JERA 1HH9A 2R69A 1CXEA 4ENEC 5K69A 1KJ2B 4JPWL 3SYPA 3Q3GA 2ZF8A 3SGEH 3ELAT 1IAOB 5CP7B 3SDXB 2X3AA 2JKXA 1X5YA 2JJWA 4LSSL 4WW2C 1ZLWH 3ILEA 1A9EA 3IBEA 3GXIA 2VE6B 2YN3A 5LG6A 3WAJA 1M6OB 1IGCH 2DQFB 2W38A 3DA0A 2VDKL 3HC3H 1DJYA 3EIFA 4MA8H 3WGVB 4RFNC 5JOPE 2X6VA 5E03A 3VI3F 4AQEA 5C0JA 1I9RH 3MVSA 4LEXH 3MBEB 4NFCA 3K46A 3DOHA 3LPOA 5D1QC 4JRXD 2QQKH 5JW4N 2QSQA 1TG8A 5DQDH 4KZDH 3FQYA 1LNUA 1I31A 4FFYA 4L8CB 1CLVA 1ZSDB 2C9SA 2X2UA 2B5IB 2FD6L 2UZIH 3VTMA 1DL7H 4KKQA 1DFBH 5E00B 3ROOB 5M94B 1BQ5A 1S7TB 2VC2B 2C7FA 2VZTA 4OQTL 4QTFA 2WWNA 2UWEE 3SE9H 3VE0A 3CFEA 3QUMA 2TRHA 2X0WA 3UP6A 1YMMA 1C5DB 4PJDE 4R7DB 4BQ9A 1JRHI 1EH9A 5EZLB 2Y3AA 2P44B 2WLKA 3GJEB 2H3NA 3KJ6L 1G7QA 3TBWA 1OK8A 4IOSD 3ET9F 2OZ4A 5AW8B 2I07B 2W9DL 1MHHA 4NGHL 1NGQH 1I7TA 3O3EB 1WZ1H 1AHWC 2VLME 2QVKA 3U1PA 2CO4A 3QFDA 1FZMB 2EDLA 3HPJB 3IWVA 1JXDA 2HJKB 3THMH 1D6EB 3DBSA 2Y36H 3VWJD 2AQPA 4NRXB 2VMFA 2BS8A 4NPYB 3VX1A 3DO4A 3DHUA 1AO7D 3VG9B 3C5ZA 1NANI 3GZOA 5IVXE 1EXUA 3BVTA 2FT8A 2WSKA 4JO3H 1OAQL 3Q2LA 2HAZA 2EUWA 4QXVA 2AGJH 1DANU 1KCKA 3BQUD 3FO0H 3UMTA 5B3NA 2WIIA 3DV6B 3BKMH 2BVOA 1JGUH 5ALBL 1EAQA 1FP5A 4L4TD 1U91A 2VUYA 5EUKA 4WK2B 1SHMA 4ZQKA 2DQMA 3NACH 1BIIA 5HP5A 1UT1A 1OV8A 5LGYA 2AK1L 3N0PB 2PYEA 5E6IC 4CVXB 5DSCA 3ARPA 4YDLC 2LW3A 4GP8B 5DI8B 3EYUH 2ITCA 1ZHBB 4F7PB 2J8OA 5E4EC 3O3UN 3QZPA 3AACA 3NZSA 1E9PB 5AEAA 2F7QA 5DURD 1OY3B 1AFVL 3H85A 5J5EA 1NCAL 5K39B 3BXNB 1LP9F 1N18A 3KLQA 3LMJH 1MCSA 3REWB 1DQMH 2NY3D 1LK2B 2JJUA 4UQAA 5FO9A 3RY5A 3TH4T 3MV8D 3BESR 3IAPA 3D2UD 1KJ3L 2LU5A 4LHUG 4KKPA 5D7KE 4XPBH 1QLEH 3QDGD 1NWOA 4ZOEA 4CVUA 4OI9A 2I60L 2L7UA 4Z7VB 1SLXA 2ODIA 4L5FE 2BXYA 1R33A 3TFKC 2AXGA 3VXRB 4PJAE 2R7EB 3BMVA 2Y69B 2NTSP 1YUHA 1LHZA 2VLJD 5MEOA 1AGFB 1CG9A 1X6LA 2YLKA 2IQ9L 4Q9QL 4IOIB 2B39A 3UOAB 4H0GA 4UOW0 2BOBB 4L3ED 3VMPA 2H47C 2QPDB 1N70A 1TMCB 5B4MC 3WDIA 5IJKA 4RMVA 4W9HC 2EIBA 1V7NL 4P3DA 3KPLB 3ZTNH 4QY8B 1MXDA 4LL1A 4OJCA 1B0IA 4NUGH 3CNKA 1N59B 4GOSA 4YUEH 5HGHA 3G6DL 5LBSH 5HI5C 5JHDD 4MCMA 4GG6E 1RV6X 1JIBA 2B1HL 2F8VA 3MBXH 1NAKH 2WZ0A 1ZLVK 3UFIA 4BGLA 1BVNP 5E8PA 4KTEH 4JKMA 3UCRA 2FQDA 1BP3B 4LIQH 2H1PH 4PJ7E 2VNCA 3N9GL 1T5WB 4IMLA 3UBGA 2V7NB 2BY3A 4D8OA 1G0XA 3TH2T 3KPPB 4JUSA 4PCSA 3IFNL 1AQDA 5JR1H 2R0LL 2ZXDA 2VW4A 4JO5A 1R17A 4P4KB 4WUUB 2E74C 1ZANL 3KG5A 4OF7A 3AU1B 4HWBL 4CMHB 4N6RA 2HKAA 1I8LA 2H1LM 2WTOA 3QDGE 1RH8A 3ZDZF 4HKXB 3QVAA 2ZCKL 3CLEH 2XA3A 4LSTL 3IKKA 1EBAA 2BP0B 1NGXA 4F7MA 5JPNC 5J6GB 2XN9A 4WHTB 1ZHNB 2EZ0D 5D5MF 5DK0B 5GZND 1E4XI 3IN2A 2YKKA 4HU8A 3UXFA 3OGCA 4KK5C 3KXFB 5DRZB 3VFTA 3K0YA 2YPLE 4A63A 3NCFB 4FTDA 2AJ3A 3DO7A 4DEUA 1GS8A 2VLLA 1HEHC 2G5BB 4C55A 5E6RB 5L0QC 1THCA 3UMNA 1EFXD 1QBML 4PJHB 3E0GA 1F1AA 4JFDE 4UU9B 4MMZC 1NGWB 2PABA 2RTTA 4E2OA 5HHOB 3COOA 3C60C 3HMXL 3LD8B 2OW6A 1L3NA 4JM0A 5DEJA 3V6BR 4ODUA 3EGXA 5C0IA 3MA9H 4OM1H 5BV7H 2NW3A 2NOYA 3CDYA 3AAZB 5IV2B 3VFUB 1OT4A 3PWJA 4IKIA 1J0ZA 2GJRA 3AS1A 3HUJA 3L6FA 1YMHB 3VXPB 1QSEB 4KY1L 1VENA 4YHML 3UG3A 4F9PA 3GQFA 1C1EL 4JANA 3IMUA 1RULL 1KYOK 1C12A 1BZQK 2QKIB 3QEUB 3QI9D 3H7LA 4F8OA 2D7MA 4WHYH 2EVGA 1NM4A 5IGXL 3RUGE 4UV7H 1H9DA 1CB4A 3MRCA 5CIPH 5DMGD 5T3XE 4A68A 3I9AA 3Q2NA 4PP2A 1WG3A 3FRUA 2E7BA 5CD5C 1ZTXE 4RMBA 4NJAH 2BNRD 3VG0L 4AH2A 2EVHA 4CUCA 3O2VH 5GGRB 1X5XA 4X7DC 3HG1A 3LKRA 2Q2LA 3GT6A 3TM6A 1JK9B 5EPMB 1IGYA 2O6PA 1QRNE 2W65B 2GJPA 4U0RC 2B2XH 1MFCH 1RPQA 4N2NA 5F9JA 3ZT6A 4TTGA 5I1GL 4AMKL 5LCVH 1RJCA 3J7HA 1U2YA 3I02A 3LQAC 3CFCL 1A6ZB 3OQRA 1I1FB 2DY2A 3LEYH 3L4VA 3FF8A 2XRAH 4LF3B 1VLXA 2C7UA 1DVFA 2F5BL 5JA8B 4LVHC 3LDBB 4N0UE 3D85A 4LCWA 2WQWA 4QRAA 1CFMA 3TJHC 1ZOXA 1QABA 4QHMB 5F1KC 5F6IC 4AKQA 1GSKA 1IC7L 3CVHA 2WWMC 3FL7A 3BGFC 3NSXA 4NOFA 3QDJA 3O6LL 4JFSA 1U33A 2ZXQA 4HIIB 4UANA 2PR4H 1TZAA 1OANA 3MRBA 4JHAL 3W9DB 4NC1E 2VW6A 4OIFA 4Y9FA 4Z7WE 2NX5D 1G7MA 4JL2A 4NENA 3FKUS 1EWHA 2FEEL 1Q1JL 3D39B 3V0AC 2X4OB 4XCCH 4HJIA 1V5JA 1JHLL 1SOXA 4QKTA 5I1LB 5L2KA 2BSTB 5B7EA 1GKEA 3T6WA 4R0LA 5D71H 3C8KB 4NKIL 4N4YB 1R47A 3GI8H 3JT2A 4MAYD 1ZLUK 1FLRH 3O4LE 1XH1A 4MMXC 4TS6A 1YA5A 1A6AA 5M95B 2H0PA 4FI8A 3B83A 3GFUA 1RZ8B 3MV7D 2OI9B 5ELIA 3ETTA 4U7MA 5KS9E 1MQKH 2K45A 5TH2B 4YWGL 4U4IA 3G6JB 3FTVA 1XBRA 2N3JA 1U95B 1T7VA 2ODHA 3KPNB 1PSKL 4N2DA 4F2MB 3DIFA 2YJLA 5GGTH 1FBIH 3IGLA 2X9WA 3UAEA 4DEPB 2KI6A 3TX4A 4UNVA 3V6OC 2HX8A 3HIZA 3TTYA 3LXAA 1AI1H 1ID5I 1OGPA 2VR7A 4XN9A 3FO9B 4KXCA 2OL3A 3Q8AA 1QSFE 2IJ0C 4QF1B 1BDYA 3RAJH 4LLWB 4KVNH 4U3SA 3PWLB 1UUNA 1B0GB 3BD3A 3TWCH 3RWFA 3INUH 4EI6A 3MV01 4FNPA 3RZCC 4UB0H 5CJOH 4E68A 2X2JA 3KM2A 5KYWB 4KRPB 1SQMA 5IROA 3IB4A 3VYOA 1UTDA 5HYFA 4MQ7A 4KTYA 1MFEL 2DQHL 3LHAA 4V1DB 2DBJA 3KBEA 3NPSC 1A4JB 1XH3A 3P77B 5DD0L 4G5ZL 1W2KT 4FZEH 4DP4X 3KH3A 3N91A 3GXFA 1OSZB 4FA6A 4UT9H 1LWJA 2EJ1A 4FOMA 4N2HA 3IRCA 4OZ4A 4TMPA 2BP5M 5F7EH 3SHSA 2NNAA 1WGVA 4M61B 2NNCA 4ISVA 1TQBC 2AF2A 3ZDXF 4Z7NB 4ZTPH 2DJ4A 4LEEA 5FC9A 5CEYA 3EYQC 1UWXK 2OTUA 1Q9KB 2EDWA 3GRWH 3IRPX 3HE6B 2HB0A 4HYTB 4HX1A 5BQDA 3US0A 4OVUA 5FM8A 3VI3A 3FTSA 2CCVA 3P4LA 4G43B 2NTFA 3RJDA 1YY9D 3EOAA 4NB7A 2B8OT 3DIDA 3NFSH 4RFEA 3U4BL 4O51A 5EOQH 1IBYA 4LDCA 2IAND 4R9HA 1QLFB 5CCHE 3B9KB 4HBQA 2EDTA 5LHDA 4KNTA 4F92B 1WHOA 3MRPA 5E1IA 4D0CB 1A7NL 3BH8A 4X6BA 5JPMB 4MRBA 5DJCA 2NY0B 1UB5A 3GPEA 4OSUL 4KJPD 4TOYL 1LLAA 2DICA 4YHYC 4ZO6A 2R23A 4JO2H 4N87A 3ZE0E 3MI6A 3FFCE 5ITFA 4H8VA 2V2WB 4PVMA 4JPKH 1BFTA 3VSQA 1T2XA 1QUNB 1Z9PA 1PZ3A 5GGVL 2VJ8A 3L4XA 2CLVA 2IBZY 1P5VB 2FATH 2X6CA 3IDIB 3MMEA 5E94B 1F8TL 5FYKL 4N6QA 5LAPA 4XP4H 4A38A 2APSA 2D7PA 3LH2H 3JTSA 3QCUH 2BJML 2HMIC 2JV6A 1DQIA 3KS0J 3FC8A 3JWDL 1GYVA 3Q8CA 4OIIL 2KDYA 5FA3A 1VESA 1QEWA 1TDQA 3TXAA 5C2BL 5DRWA 1SOSA 2RMNA 1D6VH 1EFQA 2IWFA 4PGBA 2EDFA 3PGCA 1MIMH 4L8DA 5K9QG 2Y7MA 3FBKA 1YYCA 1RVFL 3T8MA 2DLFL 3FFDA 5CUSL 3K2KA 4HJ0C 1PD1A 4HXBH 4FA7B 4HWEH 4IRSC 4E9LA 3Q6FB 5AG9A 2F74B 3GYRA 2OX5B 3MN8A 1ES0B 3EYSH 1XB3A 2Q20A 3AWFA 4WU7B 3UTTD 3HPLB 4ZD3H 1INDL 2VR4A 1U8OA 1VKXA 1FSKC 1IC0A 3F65A 3HZVB 2VLRE 4OLXH 4PWFA 4P9MH 4R2GC 3STLA 4LLUA 2VRKA 5DHVH 3SCMB 4AJYV 2MH4A 4QXWA 3GMOA 1JMXA 2X4TB 1CS6A 3QNYB 1IEAA 4JN1H 3ARXA 2BMKB 3KL3A 5JMOC 3IGAB 1DZ0A 4I3SL 4QHUA 3ZKND 3GSNH 2QHRH 4KPHL 3OL2A 5BVPL 1AE6H 1NFIA 3II3A 2IANE 3BWAB 4JO1L 4F15C 4O58L 3X1GA 3OJMB 4J2QA 3GSXA 1EHXA 2CKBL 1X5KA 5A7BA 2GSIB 4KJYB 12E8L 1E7UA 1K72A 3L5WA 4PUBH 3QJUB 5E56A 3PDDA 2A6KB 3SGDH 3V6ZA 2ROYA 4FGMA 3KPQA 4M3KB 1J1XH 2Q6WA 2GHZA 1LP9A 1EZLA 4BK8A 3IMVA 9CGTA 2IGTA 4HIHA 1CZ8H 2AV1A 2W94A 4POUB 4ZFGL 4UM9A 4ZNEE 4ZXBB 1I9IL 4UMGA 5IJKC 3CDFA 1AKPA 4BD4A 2G75A 4QRRB 3QQ4B 4TL4A 1UXSA 1H6EA 5KJRL 5ILTH 1OF2B 1GKOA 1WCBA 2P4AB 5AVZB 5C3IA 1DCLA 5DD3H 3T04D 1YN6B 4KUCD 3FUJA 3DJTA 5CZVH 3OAYK 4P07A 2CUAA 1J5HA 1SJXA 2HN7A 2YEZB 4HK0A 2PO6B 43C9A 3Q6GH 4PJEF 3QPQD 1ZT1B 1ZT4B 1FWXA 1W0WA 4XE0A 3Q01A 2Z6FA 1TPXB 2MOVA 2QVFB 3PP3K 5IG7A 3WN5C 2CDFA 1DBKH 2HH0L 4Y2NA 1U8NB 5KANI 5IKCA 3U7AA 4KKNA 1X5GA 1YEKL 3PYCA 8FABA 1RZIA 4EBQL 2R9HD 3WIHH 1UATA 1QMUA 1Z9MA 4YDIH 1UZ8A 4YHKL 1KN2H 1YAZA 5FM4A 1PLCA 2APBA 2EDBA 1JGVL 2IBBA 2G60L 2CO1A 2C1PB 4YDVB 1Q94B 5GS1B 4F7EA 2P9RA 1JXKA 1NAMH 2Z92A 2FHFA 2DM7A 4AYMC 4OZHE 3QO1B 3I74A 1ZV2A 3F5WA 4CVZA 3X1FA 2WQSA 1K8DB 2E46A 1B2WH 2XZZA 2WQUA 4PJ5D 3U4EB 5IFJA 1H0DB 1MN4A 3DWTA 1GRWA 2XZAL 3DVGB 4CDHA 3BT2L 3T77B 4JFED 3HG4A 4GEJA 9PCYA 1VADA 5D7JB 4K3JL 1P4BH 3ZMNA 1BD2E 5C0CE 4OLEA 2I7SA 1IIIA 3IDNB 2AITA 3CZJA 3HN8A 5TDOB 1J9TA 5I8CB 3OKLB 3BHBB 1OGAB 4GRLD 4IOSA 1IAIH 2EUZA 4B9ZA 1Z9LA 3G9AB 1N8ZB 1H8LA 2CO2A 4K5LA 4ZSOE 1P4LA 4LAJH 5D5MA 5FW8A 5ABAA 2ENYA 2JB6B 5ITBH 3N85H 4OV5A 3RL1A 2I9TA 3VWJA 3QZBA 2WLIB 2B59B 1NFDF 2ZOWA 2F5AL 1LMKA 4FA8A 1W0VB 2E8YA 1JZ2A 2PW2B 1YHPA 3BZ5A 4FFVD 1AO7A 3CSTA 5EV7A 3RBSA 5IVNA 2XVGA 1UJTA 2ZKXA 3S35L 4JZJB 2IH1B 3DOSA 3UJTH 1XSKA 1BJ8A 2EINB 4ZOCA 3GGWB 3BQUA 1M9WA 1F6AB 1ZE3H 3WY2A 2P5EB 3QT2A 5A6IA 2EAEA 1G9HA 1SMAA 4L4TA 3HR5A 4N0FB 4J1UA 2IQAB 4XCNB 1P7HL 1NL0H 4H40A 2PETA 2DDQH 2HT3D 2QSTA 1E5BA 3DJRA 5DJDA 4R4BB 4A67A 4B9FA 3Q5OA 3FO2A 1AZRA 3FQRA 1ZS8A 4N1HB 1NOLA 5E9DE 1XGUA 3C6LC 4ZW6A 4BIKA 4OCRH 2EADA 3BLPX 4U1JB 3FMGL 1UH4A 4I1RA 3C08H 4MNHB 1J1PH 1YYLL 2LE9A 2W95A 3C2SA 4QOKD 4P5MA 4PJ7A 1UWEH 3U46B 4BZYA 3DMMC 2VERA 1LE9A 4DH2A 5F96H 2VQ1B 1NMAH 1WA1X 4GG8A 3N43F 4HAGA 4LVEA 4ONFH 4IK7A 4CN6A 4FADA 1BQKA 4JFYB 3RX7A 3UTPE 1EXHA 3EDDA 4FQ2H 5D7LB 3SJVE 3L4ZA 1D5XA 1T5XB 2DIAA 3HS8A 1TNNA 2RCSL 3MNZB 4BV1A 2K6WA 2EDJA 2P1YA 1XB8A 4MVBD 5DJZB 4FABH 3GO1H 5I8KL 2MPVA 3MV8A 3D2UA 1PKQE 3O6FD 4XVJH 5AOKA 1SEBB 1UACL 3CXDL 2XN0A 1AZCA 3IU4L 2P8PA 4FQQA 5F7LB 5C0DB 1N6QH 3QDGA 4HUKB 1IT9L 2PCFB 2RJMA 4IS6B 4F58H 4IGBD 3NZUA 4JPVL 4XBMA 2RFXA 4OJFH 4KUCF 5KVGH 4FP8L 3VD4A 5D7HA 1MVYA 3DKHA 1YJDC 1S9WB 2VLJA 3HFML 3PPSA 4JG0L 1HZKA 3BMWA 1A0QL 1QTSA 5I26A 5JXEC 2GT9A 2AJSH 5D7IF 1F02I 3I6LE 2HTLD 2JTDA 2AEWA 3QJTB 1A6VH 4JY6B 3PWNA 4FTVB 2F1EA 1F3JA 1WS7A 4L3EA 1YNKL 4Z0BL 3KPSB 4OCXH 2OTWB 4JX0A 4XVUD 5E7FA 2DOCA 2DH3A 4J3OC 1U3NA 1EZVY 1T20B 1GGBL 2WLYA 4I89A 3WS6A 1MFVA 3T4YB 1L9NA 4XP6H 1KY7A 3RWDB 1WT5A 3H2QA 1MCOL 3T2LA 3CE1A 3U30B 3QUGA 4HBCL 5JHDA 5LNDA 2VDQB 4DN4H 3QUXB 2YAPA 4MX7A 1ESOA 3MBED 4NSKB 3UYRL 4B3VA 4U1MB 3CXFA 4QOKE 4PG2C 4FKKA 2VXUL 2EH8L 3CFKA 4EN3C 3OKEA 2MPAL 1JE6A 3CFJA 2FO4B 1NCGA 2X5PA 3ISYA 3T6QC 3P73A 4AK1A 4HHWA 3N1FC 1BBJB 4ONOA 5MENE 2BWIA 5AW9B 3TN0C 4RGNC 4OI7A 3QNZA 5KYUA 3AUWB 3RUGA 3SE8L 4NDMA 2IWEA 1TYRA 1OAKH 3QFGA 2ZYSA 4ZMQA 4IJTA 4NQSA 1ZS2A 4NCC2 3VGDA 4LRIC 2WN2A 1Y1UA 5EIIG 4JFOB 2FO8A 3KPRE 2CGYA 4XNUH 5DHDA 3STZA 4F2EA 2XWTB 5GZOD 4L4VB 2FGWH 1QEXA 2P48B 1AVAA 2X7LA 4ZAKC 1IE4A 3O8XD 5DD6B 1AIFB 2VDNB 3HCVA 4U49A 4GLRH 4X6CF 5GZNA 4OCYH 5J7CC 5FDYA 5LBSA 3T8XA 4E41B 4FLOA 2Q9OA 1TZGH 1NGPL 3LVEA 3QK0A 4M93B 3JTTB 4ZUWA 4URTB 1SNRA 3D87B 4EIBA 1Q9OB 5F7DA 4FQLH 2FJFA 4KOBA 3SE6A 2Z0UA 1EFXA 1HNFA 4FZ8L 2VDQL 1LWRA 4GI6A 5GQBA 4PJBB 3VJ6B 5TFSH 5I5JA 3RY6A 1HHKA 5DZPA 2VL5A 2ZWZA 3HZYB 3VH8A 1T4WA 3VFPB 5CWSB 4XPTH 1TCRB 1N12A 5DT1H 2OW7A 4OGQC 4LL4A 4NRZB 4GT0A 1EJOL 1UXWA 3KR3H 4POZC 4N20A 5INDA 4NO0D 5IOPA 1AZZC 1OCZB 4AVHA 4Z7WA 3FH8A 4IHOA 4TSCH 5L8LB 4WTXA 1VFAA 1ZKAA 3LRMA 1XF3B 4NWUL 2FR4B 3P3YA 4QRPB 2D3NA 4PRIE 2H9GB 5H94B 3QXVA 1W9XA 3FT1A 4DKDC 5L88H 4AQ1B 2JNZA 1N0XL 2AJZA 2FQGA 3NDYE 1ZEAL 1T2QL 2ENJA 1JVLA 1RZGB 3QI9A 5IUSA 3V4PB 4MCYB 3S5ZA 1TZIA 1S5IL 4I9XA 3ZYZA 5IW1A 2GSMB 5EWIL 3MOBH 5KYXB 3FQTB 3K2IA 2VDNL 4BH8B 3U9WA 5I1HH 4MASA 4GY4A 2XG5B 1T22B 4P2QB 4MS8C 4H1LB 5HHME 2WM0A 3A4FA 1L9MA 3MREB 4I1NB 1XCTA 2WXNA 4UZGA 5EU6E 3ZQWA 2P47B 1A25A 1J1OL 4JM2C 2BNRA 5HPOA 1XXFC 1GJUA 3ULUF 2QTEA 4JCWA 1VZGA 3IN0A 3WHE0 5ICUA 3P9MB 3K72B 3U6RA 1KBPA 4LNVA 1QI3A 4HETA 4AYEC 5FB8A 4ONGH 1KGUA 1MZZA 1ASPA 4Q6KA 4CC0A 5EF0A 1M7IA 1OZTG 4IEFB 3VD9A 3DETD 1GSMA 3EADA 1IILE 5TE4L 3HG2A 3PPEA 1X5FA 3SYCA 3FQXB 3BVUA 5I18H 1JWUA 3US1A 1KJMA 2NR6D 3QIWC 1L9RA 1KTJA 4CNIA 1UM5L 5IFAL