3C5ZA

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
202
Chain Sequence
DSVTQTEGNVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALVISNTNKVVFGTGTRLQVLPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR B3K506 Alpha Chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
total genus 36
structure length 202
sequence length 202
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zA01
4OSUL 1BBJB 3V9FA 1CGYA 3NA9L 3OWEA 3RZCD 1N6QL 1ACYH 2VQTA 4KHTL 4OLXH 3IF1B 1QR4A 3T0EE 5DUPL 1QSFD 3WLBB 3TFKD 3I75B 4UBDD 3IXTA 1I9EA 4BSVA 3M17A 3V4PH 1NPUA 3L7FA 1BJ1J 4G43B 4J1UB 4MZ2A 3C08L 4WEUD 1T7WA 2NY6D 4NWTH 4AJ0A 2R1WB 4OI9A 4BZ2H 4I3SH 2VDOL 4XGZA 1CF8H 1G1YA 2VISA 4HF5L 5HJ3A 4M7KL 1UWXK 4EI6A 4JPKH 5SWQB 4WI7A 4WFGE 5EU5B 5GS3A 4AG4L 5DMYA 3VRJA 3BGMB 2AP2A 4OSUH 1J9CT 3NA9H 2AQ1A 4KHTH 4MS8C 2Z92A 5DUPH 4U1KB 1YN7A 3QIUB 5D2LB 2WUBL 4PYGA 2EE2A 2LFGA 2HT2D 4EI5C 3IDNA 1XGPA 4EUPH 4R4FL 2AQ2A 4Y8DC 3EYOB 1LO4L 4F7MA 2VWEE 1KXVC 3NBNA 4M7KH 4HIIB 4Y16C 4CU7A 5J9PA 3ZDYF 3W9DB 4AG4H 1TZHB 2A83B 3MNWA 5D1ZD 3G6JE 1FAIL 4Z78B 4PTTB 4G9FA 4NGHL 4X6FA 3U1SL 1B4RA 4YHOH 5L9DL 4MJ4A 1PKOA 3HC0A 3MNVA 3QWQB 1YMMD 5I18L 1JN6A 2WUBH 5BCAA 3U6RB 2VDPH 2FGZA 4WWID 1TQCC 1LO4H 2ZUWA 3SDYL 5C0GB 3HZMA 1A4JB 3F12A 5IHUH 2V5MA 3ILPA 3EYVA 1Z2KA 2ZUTA 2KQMA 2RQ8A 4NGHH 1EAPB 3U1SH 1BEYH 3N1MC 1MCFA 5L9DH 4P59L 3RGVB 1T89C 5I18H 4GW5A 3ZT5A 3S96A 2V5SA 3BT2L 4WWKC 2N1KA 3SGKA 3SDYH 2DDQH 4NC0B 3PQYA 1E6JL 3DROB 4DW2H 4FTVA 5A2JH 1P6FA 2N4IA 4GH7B 3MLRL 3QUMB 2WIIB 3RGVD 4GKSB 1F6FB 1VPOL 2R0ZL 1ZLVH 4P59H 4ISVB 5FA3B 3RVXC 3QDAA 4HKJB 1XIWA 2CKBL 3B9DA 3TIDA 2H8PB 3U0TA 3B8SA 2V7NA 3BT2H 4KFZC 3O11B 1A3LL 3O81A 2Y6SD 4LNVA 4P2RB 2KBGA 3WNLA 4NKMB 1Q8MA 4XBGA 4ZODA 3O6FC 1YNTB 1E6JH 1H0DA 3DUSA 3RY4A 3VMPA 1IEBB 3U9UB 3B8YA 1A6TA 3MLRH 4BSJA 4PJBB 3QEGH 5EUKB 4LMQI 2IH1B 2EEDA 4PTUA 3OKDB 2Z91B 1VPOH 4LAQL 1P4IL 1I7ZA 5INDB 4ONFH 3QXDB 4P3DB 1L0QA 5D5MA 3H9HB 2YUWA 4EJ1C 4L9LB 4P2RD 4QCIB 3DARA 4I18C 1A3LH 1SY6H 4P5TC 1U58A 5DK0B 4UT7H 1QKZL 5I66A 3CFBA 1U8HA 1T0MB 1T04B 4X6DF 5E2TH 4PJDF 2VTFA 3WL9B 4BH8B 3HG1E 5IWLC 4E5XB 3BQUA 3WSQH 3G04B 2EC9U 4PRNB 2ZOKB 2XPGB 3FZUC 4UQ2A 4LAQH 5D96B 5B39G 3VXUE 2FBJL 5C0CD 1N0LA 3P0YL 4Z6AT 4LU5L 4J3VA 5SWSB 3V52L 5L88H 1JV5B 5JMRA 2EXYD 1QKZH 3HZYB 4N0UA 3HLAA 3THML 1YMHB 4NZUH 4UNUA 3RWIB 4DGVH 1WT5A 4GRLC 3T0XA 1CDCA 4Y5VB 4MJ6A 4DKFH 5H2BA 4F7TB 4Q97A 5FO7A 4P23C 3FQNB 3S5LG 4YNYA 4RRPA 5L7XL 1R5VB 5SWSD 4LLDB 2NY3C 3KR3L 3PL6A 2Y25A 4LU5H 2WBJC 4PJHB 1FGVL 4KVNH 4KMTL 3GB7B 2LU3A 4Q9BA 2NX5D 3TP4A 3IGAB 3RNQB 1EHLH 3S97C 1CGSH 5ADOH 2ZUVA 1GXEA 2F53E 1J18A 1TPXC 1WICA 1UWEH 4RGOH 3UTZB 1UT9A 5D7LA 4TNWK 5DJYA 5EZJB 4ZNEE 4KMTH 4GQPH 1A6ZB 3VE0B 4WHYG 4RMRA 1BHGA 1KB9J 5ERWB 1I4FA 5IJVB 1I8MA 1ZLUK 2Y23A 4QHKI 1YEIL 3V7AG 1ZHBA 4HXAH 2XKUA 2XTJB 3S7GA 2HN7A 4FQHB 3SE4C 1KT2A 1OGAD 2HT4D 4ALAH 3NAAL 1M7XA 3QCTL 3ARBA 4FFWD 3D48R 4Z7QE 4OB5L 3HUJE 4P2QB 3EOTH 1VCAA 4JFXB 4LASL 3RKDC 3DXAB 4Z7OF 1EPFA 1LP9B 2V9QA 5D93B 4WDIB 1BMGA 1CLOH 2XTJD 4G7YH 1FFNA 5IHZA 4LCIL 4PJ5B 1UH2A 2ADFL 5ICZA 1S9VB 3IFOB 1OM3L 3QZWG 3KPOA 4UINL 5JW4N 4UV7L 3QG6A 1AIFB 3NAAH 5CJ8A 1MWAA 2BMKB 5DMGD 2NR6C 2EIZB 4P2QD 4Q9RL 4OB5H 4P46C 5EOCJ 3DXAD 5ESAA 5JOFA 4U1NB 4LASH 5FO9A 3L1OL 3BEVB 4U1MB 2P42B 5I19L 3VFVB 2CK0L 3G08A 4Y4HA 4G8EA 5CD3B 5E2WL 1JPGA 1YPZB 4MA1B 2ITCA 2UZIL 1RZFL 4PBVC 4Y2DB 4N8VB 1H15B 4N9OB 2HTLD 3PHSA 4GQ9L 4UINH 2NW3A 3SDDB 5EZOL 4J3TA 4UV7H 1OAXL 3NMEA 5J3HD 1JWUB 5LGJB 1T1YA 4XWGL 4Q9RH 4DVBB 3DUUB 4JFDE 3IDYC 3GMQA 3ULUD 1TVBB 2VKWA 3KJ4B 3QRGL 5D7KE 4ZAKB 1RMFH 4XVJL 4NQTA 4RNRB 3WLWC 2CK0H 5E2WH 1MJUL 5C7XH 1A1NA 3A6CH 1JYWA 1T7VA 1CD8A 4Y2DD 3G6AA 4NCC1 5C0DA 5SX5H 1IGYA 2AK4A 1L7TL 1KIQA 5DGQA 5EO1B 3GDBA 5IHLB 3UTTB 1ZS8A 1MVUA 1IQWL 1OAXH 3IJYB 15C8H 1MHCB 2R0LL 3O6LL 1XZ0A 4H25B 4XWGH 4ZAKD 3D0VA 3AB0B 3CFIC 5HHNA 3NACL 2XZZA 4XVJH 3TBVA 4Q6IC 1CD0A 3KG5A 5IV2A 5EO0B 1VERA 3BUTA 4RAUA 5CGYD 1OHQA 2SEBB 2D4DA 4NQXB 4X5XA 1Q9KB 4YGVB 2FSEA 3T3PF 2AAVA 5C09A 3UTTD 5HI4D 5BW7C 5DF0A 4NC1C 3CSGA 1IQWH 1KGCE 2QJDA 5GJSL 4JZJC 3K8LA 3O6LH 1ZVSA 3PJSB 5F6IB 5C0IA 2Y9RT 2XY2A 5MEQB 4ODUA 2ARWA 3CH1A 3D0LB 3NACH 2YK1L 1D6VL 5FM5M 1KELL 1F90L 1IEHA 3H0TB 5CMAB 4IOIA 5EG6C 3D85B 3RX7A 2ITDA 1R3KA 3SGDH 3OQ3B 4KGJA 3CVHA 3VFUB 2GSGA 4M5YH 5EU6E 2FDBP 1UB6B 5IMOB 2YPLB 3OKKA 4JM2B 3TO4C 1C7TA 1HKLH 4YDKL 5KZCB 1T0NA 3W5NA 4I4WA 3PIQA 1D6VH 1VGEL 1ED3A 2EIEA 3P9MA 4GT7A 5D2NE 4C57C 1S9YA 1KELH 1F90H 3UDWA 1KJVB 5ESVA 3MMEA 5SX5K 3CLEL 4S1QL 4RQQB 3LKRA 1UG9A 3OF6A 5I8CB 1ZSDB 2JB6A 3DYPA 4EXPX 1OT1A 5JNYB 2YPLD 1MWAL 2R2BA 2Z8RA 3MOAL 4QXUL 3UJIH 4HZLB 1LO3H 4MA8L 1TVHA 4ZXBD 4UMGA 5CD5C 1H5BC 1RFDL 2RJMA 5JW3L 3L5WA 4YDKH 4OM0H 5B3NA 1G7JA 1CD1B 1X5KA 5E4EC 3SDXB 1UVQB 4O02L 3LY6A 1QVOA 4YHIB 2KKQA 4LPVA 4OFIA 1CVSC 2HRPH 2QSVA 4L4TB 3T8XB 3JBG7 1JNJA 5CZVH 1EEZA 3HC3L 3CLEH 3NGBC 5E03A 1B9ZA 2IADA 2Y72A 3O9WD 5IKCB 3VFMA 4I2XB 1GRWA 1HHJB 4M5ZH 1MWAH 5DI8A 3WNKA 1S7RA 4YC2C 1JVKA 4QXUH 4MA8H 4NFCA 3QCUL 4MD5A 4LVEA 1MAML 5D1QC 3ZE0E 5B21A 2V6HA 1DVFC 3NZ8B 1CXKA 5I74B 3SY0A 4NKIL 1KPUA 3IFNL 5CHNB 2F8XC 2JCCA 1T1ZB 4OFYA 3HC3H 3V5HB 3VXPB 2XN9B 5FO8B 4MXWL 2YD2A 3IETA 3FB5A 4PLNC 3B9AA 4WEMB 3BN9D 3GMLB 4KI5F 1QRKA 4OZFA 5JPNA 4AH2A 2ZJSH 5CIPA 2CDFB 4OFPA 1S9XB 1HQRA 4NT6B 4BQ9A 2OSLB 3D3VA 1EVTC 4OZHB 2WSKA 3GKWH 3IFNH 5KSAB 2X4UB 1KPVB 4U1GB 2HKHL 4HGWA 1FL3B 4O2CB 4X7TB 5IM7B 3HS0A 1MFCL 4PRIA 5BV7L 4UOJA 2FX8L 4MXWH 2NY2C 4LK4A 3VFPB 4CJ1A 1M05B 1ZHKA 4YIQB 3DJ9A 2XOTA 3RPKA 2DQTH 3QDJA 4NHCH 4HHAA 4NNPL 3BKYL 4PJ7F 3KNBB 1VFBA 2HKHH 1Q0YL 4B7IA 4HJGB 3U9PL 5AG8A 5B8CA 3GSOA 5CEZD 3T1FA 4GG6A 4ZFOB 1K4DB 1EIBA 1OP5H 1CICC 5KVEL 2ZUQB 2N7AA 3CVHL 3L3GA 1AGBA 5T1LA 1FFPB 5I75C 3LHPL 4R4ND 4N0CD 5IMKA 3ALXA 1KNOA 4R7NA 5EC1B 4NNPH 4U3XA 3RJQB 1XGQB 3BKYH 3CCHA 3M1BA 3JV4A 1V7NL 4IRSB 2ARJQ 2CUMA 3U9PH 1LD9B 1AR1D 4PV9A 3VXSE 3WUWG 3A6OA 5DHYB 1SJHB 4NUGL 3WKNA 1WFUA 5KVEH 3BGAA 5C0JB 1RJZB 3DMMC 3NIGF 3LHPH 5JOPD 3ARDB 4LGPB 1SYSB 5CBAA 1JF1B 2P4AB 4NNXA 4IRSD 1AGDA 3W9EB 2PXYC 3F65A 3BVNB 1UM5H 2PO6A 1V7NH 4O2EA 4QRQA 4CN4A 5I8EB 4KUZH 2WWKT 5FUCC 3D39B 4XPTH 1LO2L 1QLEH 2B39A 5DXWA 1KLFA 2P8LA 3B5GA 1MCPL 1N5YH 3VXNB 3ARDD 1R3JB 4GAFB 4KKNA 3V5KB 4HAGA 4DEPB 1PY4A 1OD7A 2JJVA 3IJHA 4G80B 2X4SA 4XCEA 4JY4A 5IB3B 4GSDH 4RWYH 5IFJB 3TF7C 1FNSL 4GG8A 5CSZA 4KJYA 3P4NB 3UYOD 4PYHA 5ITFA 5C8JA 5BJTA 3CIQA 2KZ1B 1BFOA 4JRYE 4RAHA 4RMTA 3BP6B 2OTPA 3EHBD 4G9DB 2UWEE 5DA4A 1K5NB 1OP5K 1INEH 4XP9H 1MCPH 4PRAB 2R39A 3EDJA 4P9ML 3LQAL 3P4MA 5I71B 2BY2A 2GJ6A 4NP4L 3ARRA 4F15B 3RL1B 3LMJH 2VJXA 4OAWB 3TNMA 4JO4L 5E08L 1WAAF 2PNDA 1FBIH 4BH7A 1FNSH 2XKSA 5E8PA 4WFFE 3O8XB 1KPRA 2MNUA 3RU8L 5ABDE 5CP3A 3MRMA 4KQ4L 2BVQA 3I6GA 1U92A 2JB5L 1QBLH 1X5FA 5DEFA 2P5EA 1KCVL 3RNKB 3BGFB 4I0KA 1N3NB 2Q86A 3LQAH 2CIKA 3N85H 4JFFB 1WITA 4OZFH 4NP4H 1JWSB 3JXAA 4UTAL 1KG0B 4KKLD 4JO4H 1NFDF 5FFLA 1ITBB 2V2WB 4XPAL 3O8XD 4XMPL 1JGDA 1WEJL 3IDGA 3MOBH 2VSDA 2PYFA 4W68A 4J4PC 2RCSH 5LCVH 1T4KB 4NRYB 1UB5B 1U3HA 2C9AA 3EOBA 3ZSTA 1EUUA 3G5ZA 3PWJA 4HIJB 3UPRA 3HR5B 3NFNA 3HAEG 4Y5XB 3VGGA 4LSSL 1F4AA 2QR0B 4NDMB 4XPAH 4S11A 4V1DE 1OP3H 4XMPH 5ICYA 3HRPA 5ACZB 5IFHH 2LE9A 2WMPA 5KSUA 4F7CB 5K9QI 3CFEB 4XMKL 5F71A 2G75A 2WZPD 4PJEA 5GHWL 4ZMAT 1NDMB 3ALWA 5F7EH 2CO7B 4X83A 4QRPA 1C8PA 3BKML 5TDOA 1NGYB 3VA2C 4ZOBA 5JXEC 3D6GA 4PBWD 3VXUD 2IANB 2WP3T 1K2DB 3UBXG 1S7VB 4Z7NF 2HWZL 1U36A 4LSSH 4OF0A 4HWEH 5GZOD 1B0RA 1HSBB 5EIQA 5M95B 3O4LB 2R0KL 2OTUA 2XNAA 4QWWD 4X6DB 4Z76A 4Q0XH 4PJDB 1DLHB 3R8BB 3GSRB 4PJXA 4R2GC 4XMKH 2G5RA 3C5ZC 2D9CA 4JAMB 2F5BL 5DJ8B 3T2NH 1SJEA 5F9JB 5JO5A 43CAA 4NNYB 1BP3B 2IAND 3QEUB 4M1GL 5ANMB 4ZFZA 4U1IB 1NANI 3FCTB 2AI0L 1BM3H 4U1JA 2FJHB 3RL2A 3W2DH 3VH8G 4LVNB 1FSKB 3O4LD 4CADB 2EKSA 5GGRY 5J13C 3LCYA 1AHWB 2OJZL 4UUJB 1JYVA 5DR5H 3VWKD 2F5BH 5L0QC 1XGTB 5GRXG 3RBGA 1GOHA 2GHWB 2F53D 4KV5E 1J1PH 1PKQE 2EZ0D 4QXWA 5E24E 3WCYA 4LHUA 4PJCA 1NBYA 3BPOC 4WJ5B 4JHWL 2BVPA 2APTA 4CJ0A 2JIXB 3FFDA 5E2VL 1OP3K 2OJZH 5KOVC 3HUJB 2Q1EA 5T3XE 3IDXL 4H26A 1CDUA 1ZT4B 3WXVL 1RULL 1I8KB 2HRLA 3QIBC 3V6FA 1B6DA 3KS0H 3GSWB 5E94B 3SCMA 5EUOF 5T1MB 4WU7A 4FTVE 4R4BB 5I9QC 4G8GB 1G1CA 5CS7A 1LO5B 2HG5A 3VG0H 2JIXD 5FB8B 1QFOA 4JHWH 4LHJB 4D9LL 5E7FA 4EUPG 3CSPA 4RMWA 1MF2H 1NGQL 1EUTA 1FYTA 4LBEB 1LDPH 1SBSL 5HGDA 2C4XA 3DVNA 4OCRH 2HAZA 5H35A 1UJTA 2L0DA 4P5MB 2DQJL 3WXVH 1RULH 5T1KB 5D8JH 1I7UA 3ULVH 1QQDB 4FMKA 4MCYA 5DQJB 5T33H 2O5XL 1GL4B 5I0DA 4IJ3C 3V0VA 4LCCA 3X13B 1MIMH 1OAKH 3KYAA 1MCRA 3CVIH 4D9LH 4MWFA 2ADGB 4GJTB 3W0WA 1T7YA 1SBSH 4D0DA 1S7TA 3ARGC 5D5ME 1V5JA 1G9EA 5J8OA 2YS4A 4WV1C 4U2YA 2VLLB 2Z31C 3QUYB 1FN4A 1G9NL 1M7DA 3NFPB 2ENSA 3RY6A 2O5XH 3HE7D 3RDTB 3MLUL 1Q94B 2R9HC 5K9OB 1FC1A 3RVWD 2FEDD 1CXFA 1E4KC 1M71B 4PRHA 5D7KD 4LLUA 1CFSA 4LSDA 1Z3GH 3LAFA 2YUZA 3HE6C 3F6IA 3RUGA 3OMZA 3Q48A 2H2SD 5JHDB 3LB6D 1N0XL 4KY1L 1G9NH 2R2EA 4YUEL 4H0GA 4N0UE 4NSKB 3TN0A 3O3BB 4MNGA 4XHQA 5BO1L 3P3YA 2Q76A 4HKBB 2H6PA 1CD9B 1QSEE 5BZDA 1G7HB 1I3GL 2NXYC 3TT1L 5IOPB 4M6AA 4RCAA 3DO7B 2WINB 4MDJB 3VI4E 4OJFL 1S9WA 1N5AA 1TCMA 5DD1H 2VZOA 4PGBB 1LWRA 3QH3B 1H9VA 1JJUA 4HPYH 1N0XH 1CT8B 1F4XL 4WUUB 4YUEH 2CLVA 1A8JH 1X4XA 2ICWJ 1WZMA 4R7DB 4G8IA 1I9JL 1KIRB 3MRBA 4F37F 5BO1H 1KGCD 1EXUA 2DRUA 1JRHI 1PFCA 4PGEB 3OXRB 1VA9A 1I3GH 3P4LA 4WNQB 3TT1H 3MCLL 3DV4A 4PJAE 2QSCL 3BJ91 2DQEL 1BJ1H 5IESL 2I9TB 4LLWB 2B7DT 2PUQT 3K4DA 3PDGA 5F97E 2P45B 3I3EA 5E9DB 5FGSA 1T5XB 3ESUF 2CRMA 2F8VA 4HK0A 4ODTL 1XGYL 5FK9A 3BESR 1F4XH 5D6CA 3TBTB 1QP1A 5MENB 1A6UL 1TFHA 2LV4A 2V2XB 4IRJC 1I9JH 3D1MC 2X4PB 4TVPL 1U8QB 1RUKH 3FTGB 5C0FB 1CFNB 5EU6D 1E6OL 3MCLH 2QHRL 5I15H 4BQ8A 4QTHB 5DS8B 5E9DD 4HWUA 5IESH 5HYJE 4NRZB 5JMOC 1EZVY 3MRFA 4OKVA 2A6DB 4ODTH 1FG2A 2QL1A 1XGYH 3FB8A 1LEIA 1OQXA 1A6UH 4Z0XA 5J6GA 3MRIB 5LG1A 2K1MA 5DJAB 1IVLA 4TVPH 4PG9A 1EHNA 2XWBA 4HUWB 1SMAA 3HPLA 1E6OH 1FNFA 2NLJA 4MNQB 3GM8A 3UEZA 2VH5H 4XCYB 5FYKH 3C6LB 4QHKJ 5EN2B 1NCBL 1RJYA 4OIIL 4Q6YA 2ZG2A 4JCLA 4WU5B 5I1KH 1RUAH 4NWUH 2ATKA 1X5LA 3JUYA 3BW9A 2A6JA 2VO5A 4JZOA 5HVWA 2R4RL 4UDTA 5F96H 4BK4A 1OAZL 4K7PX 5HGAB 3SGKC 4YXHL 3LSOA 4XAKE 4GRMA 1FORL 3QCVL 4BM7A 5IEKA 2APVA 3OKMA 3QWOB 3P0GB 2BVOB 4O9HL 3QQ9C 2DOCA 4AL8L 1PD6A 2VOTA 3MRGB 1U95B 3C6LD 3REVB 3H7BB 4N8CH 2E8ZA 3AY4C 4L3EB 4D0CB 1MCDA 1IGIL 4HMDA 2GAZB 3MV9E 4OIIH 3K46A 1XIWC 2HLAA 2EE3A 3NFSL 1UC6A 1S7QB 1IZKA 2VR5A 4H20L 1OAZH 4F57L 4ODWB 1B0GA 4YXHH 3ZDXE 1FORH 1NC2A 1IBGL 3QCVH 4NBXB 1ZT1B 2XWJB 35C8L 3BZDA 4O9HH 3EYQC 1Z0NA 1CVRA 2AKRB 1ZA6B 4L3ED 4AL8H 4KTDL 1QO3B 1IGIH 5FUOL 3JTTB 4J6RL 3SKUD 5FM5O 1HEZA 1K8IA 4BZ1H 3IB4A 2VDRL 2E7MA 4YXKH 5IB1B 4RFOL 3P11H 2EE9A 4NHUB 4WW2A 1BD2A 4WI8A 3EJYD 3NPSB 4H20H 5TF0A 5JXAH 4PRBB 4AM0A 1JNNH 1A7PL 2W65A 2UUDH 35C8H 1S7UB 3PXHA 1S7XA 4TTDD 1RZIA 1EAJA 5K9KB 3STLA 4UILL 5HVHB 2XYCA 5C09E 3WFZA 1IKNC 3BQUC 1NCAH 2W60B 2WW8A 5FUOH 1D9KA 4P4KD 4J6RH 2CLZA 5AWNH 4JG0H 1ONQA 5EOTB 4L4VB 4YHNB 2VDRH 4J3UA 3TCLB 3I2CL 4KI5D 1MCWM 2NNAB 4OZIF 1KTLB 4Q2ZB 5DJCA 4ZFGH 1J5OH 5IMMA 5F7DA 3SOBH 3VG9C 1WT5C 4MAYA 1JTOA 4PJ7B 4PJ9B 1OB1B 4UILH 4WHCA 5ID0B 1AGFB 4GBXC 2UYLA 2DYPB 3JUZA 3WIIL 4LOUC 5F89B 1ZHNA 5IW1A 5BVJA 2YR3A 3A6BL 3I2CH 4GUPA 3VXSD 1HCVA 1RURH 3EGSB 2VLKA 1XAUA 3F7PC 4PJ9D 1BVLB 4BKLB 5KSBE 4AK1A 3EKCA 3N9GL 4R3SB 3CZFB 4ZUTA 2DYPD 3T4AA 3C8HA 3QFJB 2VDKL 1JIBA 2KDGA 3MO1B 2ZCKH 3AAZA 2FRGP 4GRWE 3WIIH 4U6VL 3IS1X 5TGBA 3GEWB 1KYOK 2W0KA 3FO9B 1S3KL 3A6BH 5I1JL 4M48L 3ZDZF 1TZGL 5DUBB 4MJIE 5DVOA 1AXTL 4XNZB 4M6OL 5B38A 1UCTA 4UZGA 1WFNA 3E6HB 5JW5B 3SKMA 1D5ZA 4Z7UA 3VXMB 3V0WH 4LDLB 1CL7L 3VRIB 3ME0A 5CLWA 3QFJD 3QO0A 3MNZB 3W39B 1FPTH 4HJJL 5ISZB 1CZ8L 1QHPA 3QUXC 3QFDB 2Y36L 4YHLL 4QRUB 4ZDHB 1RJCA 1JPSL 3GGWA 1S3KH 3D2UA 3AS3A 3DI3B 1ORQA 4GAJL 5I1JH 4M48H 1TZGH 3RTQA 1AXTH 1GOFA 4M6OH 3VXMD 4EVNA 2DQHH 1HWHB 2BVYA 3OGCA 4HWZB 1CL7H 1IAIM 3RWFA 3LV3B 3MLVL 5ISZD 2JCCE 4I0PC 3FOMA 4CVZA 4OI8A 1NLBH 1CZ8H 5SV3A 2A77L 1A2YA 3ARUA 2GK2A 2Y36H 2I24N 5EOCL 4WFFD 1YEJL 3QDMB 5DGRA 3DIFA 4PJ8B 1U0QA 2ZSVB 4XCNB 1R5WB 2I27N 5ID1B 3ARFD 2R23A 2AXGB 1F11A 4CKVX 1GZQB 3CDGB 2B2XH 2Z4QA 4RAVA 3IDMA 2KH2B 3MLVH 4Y4HC 2IFFH 1HNGA 1CU4L 4PR5B 1FV1A 3QDGA 5HD8D 4YAQB 1KFAH 1MHHB 3TO2A 4JGJA 2A77H 1R3HB 3CC5B 2XY1A 1C5CL 1SEQL 1IAIL 4NM4H 4QHLB 5EOCH 4PJ8D 1UQSB 1YEJH 3ZT6A 5DZOA 3LDBC 4HFUL 1JMZA 1T2XA 2ICEB 5K59E 5EA0L 5HDBF 4C56E 5KSVB 1AD9A 3RWEB 4LLVA 4OIAA 2Z0BA 3GHBL 4ENEC 4YWGL 3RA7L 1CU4H 1NFDB 2FNBA 2PW1B 1QZ1A 2NXZC 3C5JB 4GG6E 3BIAX 4FA8A 4NBZB 4V1DD 1JI1A 1IAIH 5ICXA 4OQ1A 1EV2E 3RWHB 4LF3B 3O45B 3QYCA 5BZWB 1IE5A 1F6LL 4LPTA 3BIKB 3BOVA 5I2IA 3MV7E 4ZS7L 3FQUB 3JSSA 2CDGB 4RFNC 1JGLL 4KPHH 5EA0H 1BX2B 1LHZA 2I26N 4MD4A 3K4AA 4YWGH 3RA7H 4YHYB 4BELD 2I9LA 5FF6B 9CGTA 4NN5B 1KJ2A 1ZV5A 4JM4L 4NBYB 4OF7A 1DSFH 4F9PA 3MJGX 1BQHG 4RWHA 3P77A 4ONGH 3FO0L 3NCBB 4GAYB 3IFPA 3B2UC 1JPST 1UCBH 5F3HB 1NGXB 3BJLA 1HWGB 4IS6A 3QI9A 1UJ3C 5IMLA 4JJ5A 3ECBA 3DETD 5A3IC 4L8CA 1OSZA 2Y7QA 2VSCA 4N8PA 3T65A 1P4BL 1UWGL 3VFRB 3D25A 2UVEA 4IHOA 3IRZA 3MA9L 3FO0H 5J1AB 1ERNA 4HS6B 3BI9X 3MRLA 1WCBA 1NGPH 4QXTA 3GFUA 1JGUL 3BZ4A 2C4FT 2E8YA 1PG7W 1SM3L 1MI5E 5DUMH 5F7MC 4PD4J 2IGFH 3CX5K 4WO4A 2Q6WA 1XR9A 1LVEA 1UZ8A 2ZG3A 1R3IL 1UWGH 2CRIA 1H3UA 3R8QA 4QHUB 3B9KA 3GSNA 3MA9H 3U4EA 1X44A 1W0WA 2YC1A 4X9FA 3BISA 5DDHB 1JGUH 1IAKB 1U41A 3RPIA 1A5FL 2PCPB 2FO4A 4OCWL 4OCLC 1D5BA 5HYIA 5HI5C 2A2QT 3L3DA 4ETQA 3BEWA 2HJFA 2P5EE 2WLZA 3QG7L 4YBQD 1G7LB 5SV4A 3G6DH 4FXKA 4WTZA 4X7DC 4FQ2L 2J88L 3S6CA 4ELMA 1X3DA 4FQXD 5EUOB 1I7TA 5ENWB 3MODL 4O58L 1GGBL 5B3JF 3K80A 2MFNA 3LRSA 3NIDF 5JZ7D 4L3CB 4X7SL 4LIQL 1RZKL 4S2SA 1EJOH 2JJTA 2VKXA 3GMPB 3QPQC 4N68A 1JZ6A 5D6DC 1D5IL 4JANB 2A6KB 3LQAC 5FKPB 5FKAA 2J88H 5IB5A 3S36H 4EI5B 2PYEB 3MODH 1MFAH 2CDEB 2VC2H 4O58H 1GGBH 1ZT7A 3LQZB 43C9A 1E4JA 4JHAH 1F4YL 1KJ2L 3VFWB 4Y16B 1YZZA 5E8DL 4QRPE 4LIQH 25C8L 3BWAA 4MS8D 4YHKL 1WJ3A 3OX8B 3HCVB 4EI5D 2PYED 5KS9F 3ABZA 4OV5B 3OR7A 1VKXB 1DE4B 2DLFH 1DL7L 4RIRB 2ZSWB 1DBKL 1TQCB 1YYLL 1BZ9B 1BBJA 2L7JA 4Y16D 4L8DB 2I07A 1CG9B 3P0VL 3U0WH 1F4YH 1QSED 1KJ2H 5E8DH 5FOBB 2CJUL 2MWCA 4G8FB 5B8CC 5DJZA 4NQDB 1NUDA 4G43A 1HH6B 5CSBA 4LCYB 2BOBA 3WNNA 3FO1A 3NCYP 1DJSA 1IM9B 1HNFA 4JN2B 3F8UB 1HZHL 4I3RL 4D8PA 3QR2A 1WFOA 2ORBL 2XIDA 2ERJC 5SWQA 2XRAL 5EU5A 4WWKB 1N64H 1DBKH 5FHAL 4F58H 5D1ZA 4OCNC 4DZ8A 2IF7A 2DS4A 3P0VH 1A6AB 4XP1L 4U1KA 3TPUA 4NQDD 1JK8A 4OCYL 2BNRB 5TFSH 1YMMA 4HXBH 5FOJA 2IQ9L 1IM9D 3GSNL 3WS6A 4CU8A 3CFCL 4XCCL 3MFFB 4HUKB 4I3RH 5IHBA 1PJ9A 4PJCE 4WWKD 2HFFA 4ZPTB 4LKCA 2NY4C 3W9DA 2GJJA 2NY0C 5IVXA 1T1XA 4RA3A 5FHAH 3N1QC 1J8HB 4GW4A 1D5MA 4PTTA 2PO6C 5F21B 4R96A 3VJ6B 2X4RB 2GEEA 1NFIB 3EW3B 5HHVL 5BRZB 3O6FB 2VLJE 5B39B 2HJKB 1N59B 4OCYH 2IQ9H 2BSTB 3GSNH 1NBQA 2BRRL 1P2CA 5HYJD 4XCCH 5FYLE 5EU7E 2J4WH 2WANA 3MXVH 1J8HD 3IAGC 4JREC 3UTQB 4K3HA 5FYJU 4P5TB 5BRZD 4NYLB 2YPVH 3O6FD 1S8DB 1AQKH 5HHVH 3B9VA 4M03A 4MLSA 1TITA 1ZANH 1LDSA 2AJYL 1MQKL 1Z5LB 3WE6B 4ONOA 3BFOA 2Q8AH 5JTWA 4F2MA 1RJLA 2CLRB 3IFLL 1HINL 4KUCF 3V6BR 4LLAA 1LK3L 2L7UA 4KGLA 1MFEL 4AEEA 1H3TA 1MHEB 3U7AA 4JHBA 3B4NA 2C1OB 3PGDA 4P5TD 4JY6A 4MVBC 4L5FL 1HHKA 3V4VL 2BJML 2EDHA 1OAYL 4IDJH 1U3JA 3QBTB 1EHAA 2B8OT 5C9JA 4ISVA 4U33A 2OK0L 1MQKH 5TQ0H 4GRLB 1BIIA 4JY5L 2H8PA 3IFLH 1HINH 3FZUD 5DJ0B 3FQXB 5GGSA 1FZMB 3O11A 4P23B 3AS0A 3Q5YA 3ULVC 1MFEH 1A4KA 3L9RB 1YECL 4Y4FD 5TE6L 3UJJL 3VGAC 4ODBD 3TVMC 4AEIL 1YNTA 5GSVB 3RFZC 1J88A 2AVGA 3I9GH 2NY3B 4HMCA 2WBJB 3O0RH 3V4VH 2IH1A 1OAYH 2D9QB 2JELH 4GRLD 3OKDA 2BHYA 2E7CA 1GGCH 3RUGE 1KBGL 5KTEL 2APFA 2JJSC 4LCUA 4P23D 4XVSL 1F4HA 1P9MC 5DJXA 4CL7A 5TPWL 1JP5A 4QCIA 3BP4B 3HNTL 3BD4A 5C0CA 2O5ZL 1U3HC 2XXMB 1TPXB 3FOLB 3UJJH 1INDL 4AEIH 4Y1AE 1T0MA 1T04A 2WBJD 4NO3B 3WL9A 3CSBA 1MJ7L 5E1AB 4OCSL 1RK0A 3C09C 4PRNA 5F1SA 4CW1B 3EYSL 2ZOKA 5HHXL 3EJJX 3D9AL 3MLTB 1KBGH 5KTEH 2DBJA 4KTYA 4M8VA 4AQ1B 3HNTH 2B5IC 5SWSA 3WEXB 1G9NC 3L3JA 2QADC 1S78C 3HZYA 4HS8H 1INDH 2PW2B 2KPNA 2MKWA 4JGMA 4K3EL 4QOKB 1MJ7H 3P9LA 2NX5A 4KXZH 5KVDL 4OCSH 3EYSH 1AO7A 5HHXH 1ZK9A 1EO5A 3ZE1E 2HFGH 4OZGE 4J8RB 1WLHA 1R5VA 3GRWA 3IKCB 3SKJL 4PJHA 1TCRB 1YEEL 4I5BA 4QTIH 3FT2A 4WUKH 4OGYL 3QEHB 3I6KB 4K3EH 3IGAA 4HLZG 3VI3F 4OZIB 1ZA3A 1F4WL 4P46B 3RKDD 3RNQA 5KVDH 4CGTA 4P4RB 4ZO6A 4LCWE 5GRJH 3UP1A 4XI5C 2EDKA 4QNPE 1HDMB 2ICWA 5DQ9A 1OGAA 1DQDH 5EZJA 2FEEL 3SKJH 3QQ4B 2Q7NA 2FH8A 4MQXC 1BWWA 1FFRA 4JRWA 4L4JA 3TH3T 4X7EC 3WN5C 3VE0A 2ADIB 4TNWF 1E28B 4FQPA 4P46D 5IJVA 2YZ1A 4MJID 4U1LA 3MGAA 4I1NB 3BPCB 1T21A 4Z7WF 2VE6A 1UYWH 1FO0A 3IDYB 1RHHB 3FRPA 4TSAL 3BIBX 4BYHA 1XF3B 2YRZA 1FQ9C 2VDQH 5DD0H 4LLYA 2DWEB 5BQ7A 2VDML 2AJXH 1X5HA 2W9DL 2OLDA 2AJSL 3KPNA 3RQ3A 4WGWB 3PG2A 1XCTB 5HPMB 1MRDL 2MQ0A 4JM2C 4GMSL 5CUSL 2AJZA 4U6HA 4S1RL 4R8WH 3DXAA 3SCMC 3TBWB 1OTUD 2IQAB 1LP9A 3GBNH 5E4IA 2RFXA 5F7KC 1FZOA 1LE5B 3WLWD 4O2FB 4FN0A 4A6YB 2VXSL 1HIML 5DFTA 4Q6IB 1WBZA 5FYJD 3U48A 4KRMB 2VDMH 3ZL4L 4XX1E 2W9DH 1HOCB 2AJSH 5AZ2L 3WIFA 2HH0L 5C1MB 2EIZA 3MRRB 4FQ1H 4D0BB 1MRDH 2DLGA 2IH3B 3ZT7A 1YY9C 3ARZA 3WS3B 5J1SC 1MCBA 5CUSH 1RIHL 5DJ2B 1T20B 4U1NA 3QP3A 4S1RH 3BEVA 4HKXB 4U1MA 3VFGL 3VFVA 3RWDB 1U2HA 1HQ4A 1BFVL 5CD3A 3B43A 1YPZA 5A16A 3EOAA 5D1XC 4JZJB 1A7NL 3X14B 1E4XL 4M62L 2E7HA 3ARPA 3KPTA 4Y2DA 1I1RA 4N8VA 1HIMH 4ZD3H 3T1WA 2X2YA 3ZL4H 5AZ2H 5DHXB 5JA9A 4JFEB 2Y07L 3LKQA 4XHJC 1RIHH 3WYRA 1KTDA 4ZAKA 2VITA 4N5UA 4RNRA 5EC2B 2BZDA 1BFVH 3C6SB 5DRNB 3BRDA 4P2OA 1A7NH 4M9OA 5K33A 4C56D 4M62H 5FGCB 1O0VA 1J87A 1MH5B 1LO0L 3GJFH 1NEZA 3Q5OA 3EYFB 4PS4L 2P5WE 4X4XA 5F1IB 3ZKMC 1A7BA 1CIDA 1B88A 4ORGA 3GRWL 1QFUH 1P4LB 2R2HA 2AK1L 1MHCA 1JZ4A 4H25A 1IT9H 2Y07H 5FCSH 4RGMC 5HDOA 1MCSA 4Z0BL 5CJOL 1T80A 3TN0C 4QT5A 4RGNC 4XBPA 1DBML 3TO4D 3MGTA 3QUZC 5KSAC 3QDHA 5I1EH 3L3KB 1MAJA 2XFXB 4NQXA 4OLUL 1H5BB 4L8BA 1XGRB 4YGVA 1LO0H 2A74A 4J2XA 2ATPA 5E4EB 4U1HB 1CYGA 1O7SA 5C0BE 2ZUXA 3AROA 4HFWA 1WGOA 4DJMA 2AK1H 1RZGB 3NGBB 5D7SL 3PJSA 3QNYA 1MHPL 5CJOH 2N7BA 1ZEAH 3BPLC 4M6NL 4MJ5B 1NKOA 1AFVH 4Y88A 4YC2B 5AUMB 5CD5D 5D7IA 1A3RL 1MCIA 3H0TA 4OLUH 1FO0L 5CMAA 1AE6H 5D1QB 1HXYA 1PG7X 4YBLC 1HYSC 1DVFB 1V8HA 5L2KB 5HHPA 3FT3B 3FB6B 5HHOE 3GJEA 1T22B 2ESVB 3VFUA 4UQ3A 5IMOA 3FAXA 3QA3B 1FVEB 1IGMH 4U05A 5L2JA 2XWTA 2P8PB 1MHPH 4ZXBA 3NCJH 1F97A 2H1PH 2HTKC 1R6VA 2W9EH 4NQEE 1WCQA 5E7BA 1EGJA 1FO0H 1KB5H 1KXTB 3E6FB 3U7WL 1DVFD 3X12B 3WJLA 1MI5D 1Q9OB 3J7HA 3GJFK 1FVDB 5IIEB 4WENB 3SDAC 1YEHL 1ZSDA 5I8CA 1KIPB 1S7WA 3KPSE 1FL5A 4PUBL 5JNYA 3QQ3A 3O9WA 3HC4L 5E8EB 5BOZG 4K7FA 3TZVC 5EBWA 2J6EH 1SHMA 3MCKA 2G60L 1ZWIB 1CD1A 1RZ8A 3SDXA 3ULUL 2NY2B 1WBYA 5FDYA 4Z8FL 4ZUUB 4U3CA 4YEEA 1AP2B 4D9QE 3WUWB 1YEHH 4BFIB 1QYGL 2XQBH 4CMMB 3E0GA 4I2XA 4PUBH 3B5TA 2XXCB 4DOHB 4MA7L 3KVQA 2APBA 3Q6GH 2NY2D 4XP4L 2E3VA 1CICB 4LSUL 2MSPA 2B1HL 1H3PL 1GOGA 4GO6B 4WFEE 2CSPA 4LDOB 2J8OA 1OSPH 3HZVB 3QDGE 5I75B 4Z8FH 3EJZC 1UM4L 4OD3H 1L6XA 1FVCB 5FO8A 5GZNC 4ZYKA 5GS1B 3GMLA 3KWWB 3IU4L 2E9IA 4MA7H 2BSSB 4U7SA 1CICD 4LPWA 4PJGA 1LK2B 1S9XA 3GSQA 4XP4H 3SO5A 4CDGC 2B1HH 4H5SA 3KXFE 3DMMB 3VA6A 4JKPL 5IG7A 3L3IB 2DQFB 4HJ0C 4CVXB 4JRXA 5KVGL 1BOGA 4R26L 1KTKE 1FL3A 4UIMB 3T0BA 4KKBC 4JN1H 4X7TA 5IM7A 4Z7VE 2PXYB 2G5BA 5HPOA 1FNGA 4XH2B 5JDSB 2J8UE 5C6TL 4PY7B 4S1SH 4XXCA 3R06B 1WWBX 4FS0A 4X5WB 4HCRA 4QY8B 3GUTA 1WSST 2GIYA 3JVGA 3LKOA 4WW2C 4YIQA 3MCG1 3GIVB 3DMMD 5HHQA 3MYJB 3EYUL 4PGCB 4JKPH 3WFBL 1G6RB 4TSCL 3C60A 5KVGH 1NBZB 5LBSL 2X70A 4U6YB 2PXYD 3STZB 4CN1A 5C86A 3O2DA 4MAUL 3ARED 1A6VL 2GUOB 1K4DA 3C8KA 3TIEB 1D9KC 4LSPL 2VLRE 4KDVA 4Z77B 1OAQH 4RFEA 5C6TH 4DUXA 2WK2A 2X4OB 1FFPA 3OAYH 1BIHA 1I1FB 1NCNA 4YFEA 4FFVD 1MLCA 1LEGB 5EC1A 3MRDA 3EYUH 2VRAA 4MA3B 3LD8C 3PWUA 5KS9B 3WFBH 1X4ZA 2XI9A 2J8HA 1P7QB 4WHTB 1BZ7A 1EGJL 4MAYC 3JWOL 4PJIE 5LBSH 1LD9A 4MAUH 1KSRA 4X80L 1AR2A 5DHYA 1A6VH 1SJHA 4GKZB 1C1EL 2CXKA 1R0AL 2EDFA 1I9IL 2D7OA 1RJZA 2BHZA 1OCWL 3TJEL 1KCRL 2VLJB 2Z93A 3ARDA 3NABL 3FFCB 3RRQA 3HAEB 1RK1B 1UA6L 1NSNH 5F7NC 2AV1B 3CPLB 4JFPB 1P7QD 1T6VN 5I8EA 1DQJB 4WEBL 3TYGL 3KLHC 2AJVL 1UFUA 2DICA 1IGCL 4LEXL 4X80H 1AGEB 1MCOL 1C1EH 1R0AH 1YY8B 2F5AL 3TJHC 3ULSB 2X1PA 3F6LA 1HHIB 4HDIB 1H8SA 2VLJD 1PAMA 2DQCH 1R3JA 1M1SA 3TJEH 1KCRH 4NQSA 5CBEB 5KANG 4JDZB 4MB5A 4J23A 5DEGB 4JQXA 1KLUA 4MMZC 3VXQB 2YZ8A 1HXMA 2EC9T 5F1NB 3G5YA 4JDVB 5IFJA 5FYLD 4F8TA 3FQRB 3T09A 3TYGH 4X9IA 5L6YL 1CK0L 4P9HH 2AJVH 2PR4H 3AMLA 3QEQE 5HYSG 1JGVL 3MUGA 4ERSL 3UTPE 1MCOH 1K5NA 5I0ZA 2CKNA 2WUCL 4PRAA 1J0ZA 4J4PD 1U8PB 3OAYK 5ILTL 4BFBD 1HHHA 2GTZA 3PGFL 3MRHA 5EBMB 3CXHJ 4WHDA 2EICA 2BSED 4MDIA 1KN4H 3WJJC 5L6YH 3O8XA 2FYYA 3GO1L 1XF4A 3ETBF 3MXWH 4XNUH 1BJMA 4ERSH 1X5ZA 3IDIB 3VFNA 1A1OB 3PWPE 3SJVE 2WUCH 4NCDA 4YX2L 1N3NA 4R2GB 2A9NH 4UOW0 2KZWA 5CJXA 5EO9A 4KK6C 2YRPA 4HCRL 5ILTH 3DBXB 5DYOB 4DCQB 1KG0A 1BZQK 2DMCA 2PTUA 3SDCA 5K9JH 2P24B 5EFIB 1NAMA 2AABH 2V2WA 3VD9A 1A21A 1IGFH 1WIUA 2W59A 2XICA 1T2QH 2EE6A 1QA9A 4ZQKB 3O2DL 2ZUYA 1QSFE 4NRYA 5J13B 4HSQA 2YHGA 4G5ZL 4R2GD 1U8JA 1WV7T 1TJIL 5IBLD 4KUCD 3C5ZD 2QSTA 3MLYL 4M61B 2OL3A 5A2IH 4FZ8H 4QXGH 4HIJA 4IMLB 5ESQA 3VXUA 5L0QB 4Y5XA 5BS0B 1CDJA 4X6BB 2ZNXA 2BNQB 3O3DB 4F37K 5IW6A 4YHPA 4PJFF 8FABB 1M7IB 2QR0A 4EUPB 2YD9A 3GSXB 1AC0A 4F7CA 4Y1AD 3AXLB 2MKLC 4X99B 4NKOB 4J3OC 3ILQC 1NGYA 4S0TD 5J4MA 1TJIH 5ITBH 4U49A 3UTSB 3DI2B 4LGRB 5BS0D 1YNKL 4OD2B 3TA3C 4GW1A 3CU1A 3RDTC 1QLFA 4P99A 5SWZB 2AJ3B 4FQJL 3O4LA 5KN5B 3QIBB 4R90H 1T7XA 2EDWA 4PJDA 3VXRB 1U8LA 2V7HB 5I9QB 2F9BT 1DBJL 5D2LE 4TUJA 1CL7I 1YEFH 1OAUL 2RGSA 5DJ8A 3AMKA 1YC7A 4Y8AA 3VWKA 3Q5TA 4F9PC 1AXIB 1FZKA 1FFOA 3RIAF 3S3JA 3UTSD 7FABL 1AH1A 2DIBA 3QEUA 3OJVC 1YNKH 2F53A 3GKZA 3LIZH 1B3JA 4PLKC 4AT6A 2GT9A 5DSCB 5SWZD 2ZPKL 3QIBD 4JO1L 4CADA 3U30C 4NQVB 1Y0LB 5J1TC 3VXRD 1UM6L 1UH3A 4ZNEA 4TQEL 1G7QB 5MERB 4IJ3B 4UUJA 1C12B 4YBHA 2G2RA 1DBJH 1ZHLA 2ICCA 4X4ME 1XGTA 3MREA 1L0YA 5C92A 7FABH 5JORA 3RBSA 4G42A 4LCWD 4YR6B 3WHE1 1JPFB 4GAGL 3CMOH 3DHJA 2COQA 3KYOB 5EU3B 3ARGB 1UKQA 3VWJA 3L7EA 4RZCA 2ZPKH 3QAZC 4WV1B 3ZO0A 4C55A 1U6AL 2Z31B 4WJ5A 2A9MH 4M7JL 4E42B 1I1CA 3EFDL 1UM6H 2JIXA 5BXFA 4TQEH 3HUJA 5IVOA 3U36B 4FQCL 1VGKB 3O3AB 4EQ3A 1ZT4A 4F7PA 3O4OC 4JFZH 3KPRB 3MC0A 4JHZA 1I8KA 3ARGD 2G9HA 4GAGH 3S35H 3B9KC 1FNEB 5E94A 3HE6B 2LQRA 5T1MA 1H8OA 1WBXA 2LAAA 3BH9B 1ORSB 1IAII 1AXSB 1U3ZA 4N0YL 5F44A 5FB8A 4W6WB 4M7JH 3EFDH 4G6AC 3OKOA 1NAML 5J12C 2OI9C 2EDEA 1P5UA 2VN7A 5INCB 4XB7A 4LBEA 2R9HD 4FQCH 4Z7WB 4OCXL 3KPRD 4S10A 4DGYL 1Q9WA 3GHEH 4DZBA 2NXYB 1KULA 1UH4A 5DWUL 1XF2B 3HE6D 3MTRA 4P2RE 2OL3L 1QQDA 1A7RL 4XWOD 1F42A 3HE7A 2EEAA 4BSVB 5C0NC 3RZWA 3AUVA 4PJBE 1KENH 4RISL 2ADGA 3L7FB 4FQLH 1NAMH 2QHLA 5EIIA 1AJ7L 3S98A 5MP6L 4JFDA 4PGZA 2NXYD 4XGZB 5HJ3B 4EI6B 4MQSB 5DWUH 3VRJB 3MUZ1 4YPGA 2PTVA 4TULL 2JJTC 2OL3H 1Y18A 3NFPA 2YD4A 5IP4A 1A7RH 3A67L 2Z92B 4LLQB 4Z5RB 1CXIA 2DMBA 2IMMA 4M8QA 1NDGA 5K9OA 3ARTA 4RISH 3IDNB 1XGPB 5F8RC 1GYAA 3ARYA 1M71A 5MP6H 5DRXA 1C5BL 3DVGA 3DO3A 2VDLL 2LAGB 5J11C 8CGTA 5J9PB 4CMHC 5DFWH 3PWNB 2DM4A 1F8TL 5SWSE 5JDJA 4UBDC 4X6FB 1Z0MA 4GXUN 4KMLB 3A67H 3HC0B 3MNVB 2PTTA 1EMTL 4IRJD 2CRYA 3DO7A 2WINA 3GMRA 1NBVH 3UMTA 2YBRA 3TH2T 3HZMB 3RJDA 2VDLH 3ZE2F 1NCCL 3QH3A 1I3RA 4EDWL 3FN3A 3ILPB 3EYVB 4PJHE 4POUB 1F8TH 5GSRB 5HBBA 1GGUA 1YA5A 4XRCA 1MCJA 1KIRA 5C0BD 2ZOLB 3ULVF 3S88L 4LKXA 4GW5B 5HHOB 3OXRA 1V3JA 1YEGL 3S96B 4F9LA 4WNQA 5EU6A 1NUGA 2XQYK 4IIQC 5AZEL 3L3HA 3OKNA 5D1ZC 4OD1L 3SE3A 1JF6A 3PQYB 1GC1L 1NCCH 1N8ZA 5E9DA 1WTLA 2EDXA 1DR9A 4EDWH 1T5XA 2IPKB 5D2NA 2YA2A 2L4OA 3TBTA 5I1DB 2GFBA 4I9WE 4O00A 1TJHL 5HHOD 4O51B 4C4KO 1XIWB 3FTGA 5C0FA 3TIDB 5DVKA 3U0TB 3O2WL 1NL0L 5DVLA 4IRZL 2XTJE 3LN4B 4R0LA 1EZVX 4EOWH 3QQ9D 4ELKB 4XBGB 2QLVB 3FQTA 4NQED 4WRLA 4NRZA 4PGDA 2VABA 2A6DA 2J5LC 4FFZH 4KRPD 4PJEF 3CU7A 4P2QE 3MRIA 4PTUB 3DYOA 3DXAE 5GXBB 1RAMA 3P4OA 5H37G 2X4NA 1XH3A 4OT1L 3SGJA 1NL0H 4FFYL 2IPTL 4PJ5E 5IB4A 2IALB 3DX6A 1U58B 1AI1L 3B2VL 5JLZA 3C6LA 1Q0XL 3EYQD 1I9RL 3OGOE 1TMCB 3ZTJH 4PJXF 1WQVT 1DUZB 3RVVC 4NKDB 3BQUB 4XNZC 1IEAA 4WI2A 1F45A 1CE1H 1U91A 4UQ2B 1CS6A 3ULUE 1YPZE 4K3JL 3QXAA 2QQKL 5IQ7L 4OT1H 3UYRH 4M00A 4FFYH 2IPTH 1U95A 4NN6C 1AI1H 3B2VH 4UNVA 1Q0XH 1SQ2N 3HPJB 4DKEH 3HLAB 2H32A 5DQDL 3VG9B 4ZTPL 2P8MB 4NZJA 4MJ6B 1OW0A 1X5AA 2E7LC 1Z9SA 5J6HB 4GBXB 4YNYB 3X3FH 1IC1A 1GZPA 3VU2A 1KJ3L 1OARL 2ZUUA 1ZA6A 1LEKA 3OAZH 4YHMH 1XFPA 3UTTE 1INQB 4P4KA 1TJGL 2Q20A 4GBXD 1CDYA 3PP3K 3OHXA 4NHUA 4LOUD 1TVDA 2P48B 2QV2A 1QFWM 4EN3A 1RUML 4L29B 2VLRB 3U0PA 2EXYC 1KJ3H 3CUPA 1OARH 5DJYB 3PV6A 5FDWA 1UGNA 4WI9A 4IEFB 4X6CF 1HSAB 4KMQA 4ETYA 2DB8A 5I16B 1I4FB 1I8MB 2FJGB 2EH8H 1ZHBB 3QUXB 2HN7B 3VXSA 2VLRD 1F2XK 1RUMH 1KT2B 4F7EA 5FA4A 3QIWC 3GNMH 4YQXH 2Q8BL 4PJ7A 2GTWA 2NY5L 5E8NA 5FV1L 1LGVA 2GK0A 3B83A 3PABB 4LLMA 3V6OE 2BVEA 1RIVH 1X9QA 2YPLE 3QUXD 5C71A 1FFNB 1RVFH 4ZUWA 3EGSA 2P7TB 4HUUB 1FE8H 5C0EB 3S37L 5T5FL 1FCCA 2RBLA 1MWAB 3RWCA 5LGKA 2DQUL 2Q8BH 3LH2L 3CZFA 3N0PB 1XF5A 1W0YT 4OLWL 5C0RH 3WFEL 1FZJA 3QFJA 2V5YA 5FO9B 4I0PD 4Y4HB 4G8EB 2GJZB 1QSVA 2ITCB 2F54B 5DUBA 3T3ME 1A64A 4CVUA 3E6HA 1X4YA 2C3HA 2NW3B 3O41B 3SDXE 2UWEA 3HI1A 2OR9L 3VXMA 3S37H 5T5FH 1AC6A 5FV2A 5IB2A 4L4TE 4X9HA 4OLVL 3K3QA 4JVUA 5F7YC 3MNZA 5ISZA 5L8JB 3GMQB 2VDNH 4H1LA 1RZ7L 4I2XE 4QRUA 5F7LB 4ZDHA 2F54D 2O26U 4ZUVB 4NQCB 2NXZB 3G6AB 4MSWA 5JQ6H 1IGYB 4YXLH 1KIUA 4I0CC 4K71C 2AK4B 4U6XA 1KIQB 3ARFA 3ZKXC 3LKNA 1MAKA 1ZS8B 3QT2A 1KEGL 4OLVH 4RFNB 2UZXB 2D0HA 1XZ0B 4HAFA 2XN9E 4M02A 4ENED 1RZ7H 4NQCD 3HZKB 4KXZI 2H32H 2NXZD 3UC0L 4RAUB 4TSBL 2ZUSA 4PJ8A 4UT6H 4X5XB 5ID1A 2EO1A 5GGTA 3SJVD 2AXGA 4LEOA 5IFAL 4P2CG 1GZQA 4OZHE 3ZMRA 1DN0B 1KEGH 3J8F7 5KJRH 1BVKA 1FIEA 4G6KL 2FLRT 1WAAA 4MMXC 4YAQA 1ZVSB 1MHHA 3GK8H 5GRWA 2O61A 1R3HA 1UJ3B 5CEZE 4ODUB 5D72L 2IWGA 3QHTC 4HIEB 4QHLA 5DD3L 4V1DA 3UC0H 1Q9LB 4TSBH 4ZFFB 1CFTA 4DN4L 1E27A 4IOIB 1DQMH 1MCQA 5KSVA 3RKPA 3HI6L 1GGIH 4HEME 2ITDB 1R3KB 3B5HA 3L5XL 1GPOL 2R0WL 4WGVB 4G6KH 3CVHB 1H8NA 1YUHA 1NFDA 2AXFB 2DI7A 4P2OC 2PW1A 3OKKB 4K8RD 5DMJB 1DN2A 2C3VA 3BSZH 3BHBA 5F7UA 5D72H 2CGRL 1T0NB 3PIQB 4ORZC 4I3GA 4LF3A 1N6QH 1S9YB 4YZFE 4P3WA 1WUNT 5BZWA 4EIZC 2AEIT 3MMEB 2CDGA 5JOPE 1BX2A 2M1KA 4X98A 5H94A 2FEEI 4N9GA 1G9ML 2DMKA 3C08H 3L5XH 1GPOH 2DTML 5IF0A 1JPTL 1G7PA 2VDOH 4PJFB 1RPQA 4HF5H 2FJFA 3PP4L 3SE8L 4DQOL 1ETZA 2QQNL 3L5WB 1YNLL 2CGRH 2EDTA 1G7JB 2E9WA 2ZG1A 3DURA 1DBAL 1R24A 3QIUD 4HX1A 4X6EA 1EEZB 1BAFL 1I7RB 3OF6D 2B1AL 1NGXA 4OIBA 4TNVF 3MRQA 2IADB 4R4FH 1G9MH 5DMKA 2DTMH 1JPTH 2OJEA 1CWVA 4JFYA 3D39E 1PKQA 3U2SB 3MGOB 2PN5A 3SE8H 4DQOH 3VFRA 3RI5K 3IDJB 2F19L 1FAIH 1YNLH 2Z8SA 3CFJA 4K55A 4GXVL 5HI5D 1FIGL 4MHHG 1KPUB 4POZC 1QBAA 5IVZA 1BAFH 2GCYB 3NIFF 4NO2A 4O5LL 3O6ML 3G9AB 1P5VA 3E3QC 1SYVB 1U93A 4ZXBC 3RHWF 4WW2F 1QEWA 3ZDYE 2F74A 3FQWB 5JPNB 4OZFB 1JNHA 3GSUA 3KPLB 5HGGS 4HGKC 3MA7A 4PG2C 3QNXB 1QTYT 3WJLC 1HQRB 3LEXB 5DLML 5E70A 3L3OB 1FIGH 2D7MA 4OFYD 3PHOA 3O9WC 4HGWB 3QUKA 3QPQD 4MGXA 5GGTL 4O5LH 3O6MH 2Y5TB 3HS0B 4PRIB 3H9ZA 5HGHA 4FQXA 1A6WL 1G0XA 3T0WA 2YMXL 2PCPA 4P9HC 4NUJA 5DJ6A 1FLTX 3L95A 1CLCA 3QDJB 1UEMA 4HHAB 1BVZA 2W0FB 4JFFE 1N2RA 2R0ZH 1VFBB 2CKBH 1NC4A 4E0RA 5B8CB 3GSOB 3T1FB 5MHSD 4ZTOL 5ENWA 2D7TL 1MVFA 1WWWX 1A6WH 4ODXA 3L3GB 1AGBB 5TDPA 4L3CA 2ERJB 4JFHD 4NO5B 1EA9C 3QDJD 2WQRA 1KNOB 1UZ6F 4Z9KB 1NMAL 2VAAB 1F3RB 4R7NB 4V2BA 5GQBA 5C3TA 2AS5M 3CCHB 3GMPA 3JV4B 3M1BB 5T5NG 3F5WA 5AD0B 2I5YL 1P4IH 1QSZA 5CINL 1FDLL 5ADPL 2XKNA 2ICWI 4EI5A 2PYEA 4NOBA 3DV6B 3VFSA 3BDYL 1J1XL 3LQZA 1PQZA 3TNNA 4HBCL 2HMIC 2JLLA 4YDJA 1REIA 5DURB 4Z7UF 4QRRB 3VFWA 2NY4B 5IK3A 3C5SB 3I02B 2NY0B 5CBAB 1QSEA 4NNXB 3UTOA 1AGDB 1X6NA 2PO6B 3E1F1 5GS2H 2IANE 4AY0A 1ZLVK 3WBDA 2I5YH 3OX8A 2BK8A 2FBJH 3HCVA 5CINH 1FDLH 4RBPH 5ADPH 5EU4A 1JUFA 2OZ4A 4OV5A 3T0EC 3JVGC 1LE9B 1DE4A 3P0YH 3O4LE 3V5DA 2P8LB 3L6FA 4X6DE 1FJ1A 4K9EL 3BDYH 4PJDE 3V52H 4P49A 5DURD 4OUUA 4QRRD 2NY4D 5GGVY 3THMH 2MCPL 3C60C 4MQTB 5FOBA 2X4TB 4G8FA 4JREB 4K23L 2E6JA 2PO6D 3IJHB 4NQDA 4JY4B 5ANME 3KDMA 4PJAA 4GG8B 3P40A 4PRPB 1IM9A 4KJYB 5CSZB 5ITFB 5T3XL 1NMBL 5L7XH 1BFOB 3KR3H 2D03L 4WWKA 4K9EH 1FGVH 4KU1A 1JWMA 3P4MB 3SKNB 4HUNB 2DBLL 5FYKU 2MCPH 2GJ6B 2VWEC 4FP8L 4K23H 1CGTA 3NN8A 2XZQL 3OR6A 4PRPD 1N6UA 1PX3A 2A1WL 1OWWA 1OTTC 5T3XH 3WFDL 5HYJA 1XMWA 3MRMB 3MRJA 2BVQB 2R69L 3RX8A 1IL1A 1KV3A 2P47B 5DEFB 1EFXA 1G7IA 4ZO9A 3AVEA 4I9WD 3OB0H 4ZO8A 4MXQC 2Q86B 2GJ6D 3VGAB 2ZP0T 2CIKB 1NFIA 5ETUA 5BRZA 4AEHL 3TVMB 5B39A 4MVBD 4HKZB 1YEIH 2BFVL 5I8OL 1JHKL 2IFGA 3WXWL 2B0SL 3NCEB 5CKGA 1ITCA 4G8GE 2W0PA 2PYFB 4RBPK 3QJFA 1WZ1L 1C16B 4G6ML 3QCTH 3ULVD 4JQXC 3UTQA 1VACB 4I18A 4LPCA 3UAJD 1U3HB 4P5TA 3TVMD 1P69B 1S8DA 1RUQL 3H7LA 3V8OA 3S5LA 4AEHH 5E0QA 3PWJB 3NFNB 3T2QA 1Z5LA 2FHCA 4MHHI 4PJ5D 5EZIL 2W38A 4LCIH 3C09B 2P43B 2ADFH 1D3CA 3RWJA 3WXWH 4AMKL 2B0SH 1OM3H 5KSUB 2XA8L 3MV9A 4PJEB 2ED7A 4Y4FA 4G6MH 4LSRL 3OKEA 3ZKND 4Z7OE 3KPMB 3JWNC 4XPGL 5DD5L 5TDOB 2B5IB 1BQSA 2MHAB 1QLRB 2HLFC 3FN0L 2QADB 1RUQH 4P3CL 3X17A 3L1OH 4QYOB 5I19H 3WKML 2JJWA 4NJAL 2HJLB 1P6AB 4GRLA 3BD5A 2CPCA 2FIRT 1B0RB 2UZIH 3VXOA 1RZFH 1BFTA 2OTUB 3VGDA 1FZMA 3SDDD 4P23A 4Z76B 2YD3A 4MLIA 3DLQR 5KG9A 2XA8H 4GQ9H 4PJXB 3HKFA 5CJXC 5EZOH 2OZ4L 1WIPA 1WC7B 1PBYA 1MIEL 4LSRH 4MCZA 4XPGH 1S78D 43CAB 4WW1B 3SDCC 3IDUA 3FN0H 4ZFZB 4N1EA 3QRGH 1OPGL 4P3CH 3INUL 4U1JB 2A6IA 2CO6B 3BXNB 4NJAH 1IAOA 3QHZL 1MJUH 3DVFA 5JHDE 2EKSB 3KYMA 2R29L 5GS0D 3EO9L 2K9UA 1L7TH 1EH9A 4GFTB 4OV6F 4QHNB 5SX4H 3MROA 3MJ7A 4PP1C 6CGTA 1MIEH 1YDPA 4F80A 2R0LH 4M7ZC 1ZAGA 3WN5B 5GZOC 3D5OF 4JR9L 5DVNA 1OPGH 3INUH 3ZHKA 3QZWA 3OSKA 4L8SA 3QHZH 1T03L 4LHUB 3LZFL 1NBYB 5I1CL 3K1DA 2R29H 4XI5D 4WUUE 4EEEA 2XQYG 1U8IA 4Y5YC 1WISA 1W72A 3EO9H 3OBAA 3WEXA 3SE4A 3U4AA 5CEXB 2VL4A 4H26B 2PW2A 3PHQB 5DTFB 1B0WA 4NN7C 4RMUA 4MQXD 5GJSH 1LQSR 3OJ2C 2IAMC 3V6FB 4ELMF 3SCMB 3IXAB 5E6IC 4LHUD 4PPTA 3CXDL 2YK1H 3GZKA 4WU7B 5E9DE 3D18A 4KK9C 5C2BL 3T3PE 3FN9A 1T03H 4X6CB 1QOKA 5I1CH 4C54A 5KSBA 5MENE 3D85D 1CN4A 5I1HL 4NZDA 1TCRA 3CXHK 1FYTB 4KKCC 4QF1A 3PDOB 3DVNB 5C0AB 2PETA 2BERA 5H35B 4JM2D 3I6KA 3X11A 5JHLL 2EZ0C 1K8DB 4X8XA 4OZIA 5KZCD 4JFQA 1I7UB 4MJIA 2EYTA 2GI7A 4TVPD 4MCYB 3HRZB 3IVKB 1BPVA 2Z35B 5IQ9A 3CXDH 4NJ9L 3V0VB 5GRZA 1VGEH 2OMBA 5C2BH 1BQLL 5D1XB 4OBRA 3N1FC 1QPPA 1KCUL 3QQ4A 5FYKD 4S1QH 1CXEA 3W0WB 2VXQL 4ZPVB 5C0AD 3KHOA 5GIRB 2C1PB 1MFBL 3HFML 3BAEL 1E28A 1MSPA 4MNQE 1YY9D 3VWJC 5JHLH 4U7KA 1KC5L 3MOAH 5DC9B 3TWCL 1FN4B 2D0GA 1RFDH 5JW3H 1M7DB 5DEZA 2E9JA 1I1AC 3VDCA 3ARXA 1VFMA 3MLXL 5D1XD 4NJ9H 2K3TA 4L4TD 4O02H 4WVRA 5E5UB 2HFEB 1IM3A 2DL9A 3S9DB 2A0LD 1CFSB 4LLUB 5K9QG 3IJSA 5DHVA 2BHUA 3HFMH 3BAEH 2VXVL 2OCFD 2H3NA 4MXVF 4FNLL 4XHJD 3TWCH 3QCUH 4XT1C 5HYQA 4XPBL 4L3EE 4UU9A 4RGMB 5LVEA 1LE5A 1P7HL 2VLME 1MAMH 4A6YA 3TN0B 4KK8C 3MLXH 4MNGB 4RGNB 4QRTA 3IU3A 4NKIH 1HHGB 3QUZB 2Q76B 2OP4L 4OBSA 5F9WC 5CCKL 1HOCA 5MEOA 2EIBA 3O2VL 2XN9D 5I1IL 1NUFA 3WS3A 3ZKMD 5GGSY 3CJJA 1S9WB 5DJ2A 1T20A 3NZHL 2D7QA 5C07B 5BW7A 2VIRA 4ZSOB 1U8NB 1MUJA 4JZJA 3HE7C 4AIOA 3M8OL 3AGVA 4RGND 5MI0C 3QUZD 2HVJB 3RVWC 4G8IB 5KSAD 4C56A 5IVXF 3MRBB 3BPLB 4UT9L 2OP4H 3OL2A 3BRGC 1NJ9B 1I8IA 2E6QA 5I1IH 3MBXL 3QWRA 1W72L 5C07D 4YBLB 1MFCH 4KI5E 5DC0A 3OV6A 1U8OA 5BV7H 1J1OL 2FX8H 5EC2A 2NY7L 1PX4A 3FRUA 3ZTJG 5DRNA 5FK9B 4NRXB 3TO4A 3M8OH 3RWGA 3MV7A 4L1HA 5HGBB 2YOCA 3PUCA 2DWDA 4L4VE 4JFOA 4HGMA 4UT9H 2RB8A 2D7NA 3MV11 1Q0YH 1TTGA 5GS1C 2IBGA 3CNKA 1W72H 2VUOA 1EEYB 4APQC 3SDAB 2X40A 1H3XA 1ZVYA 2NY7H 2RIKA 2VYRE 3CVHH 3MRFB 3QRFM 2GQHA 4OKVB 3TZVB 4PJ7E 1FG2B 2XFXA 5JPMA 2AGJL 2Z8VC 1BGXL 2YUXA 1DP0A 1LEIB 4Z0XB 1XGRA 5J6GB 2HTKD 3DVIA 3P73A 3VFTB 4X5LA 3KPPA 4JZNA 4QEGA 4PG9B 3SBWC 4U1HA 2XWBB 3FB7B 3HPLB 3UYPA 4EXKA 2YPKB 3SDAD 5JW4Q 3K8MA 2WV3A 3C2AL 1M6OA 4ODVL 4M3JA 4NUGH 4W4OA 3TBSA 1R3LB 4XNYL 3TZVD 2IBZY 4GRWH 5BMFL 1NMCC 2OMNA 2ATKB 2A6JB 1OTSC 1BGXH 1JZ7A 4QRSA 4UDTB 3QFJE 3Q3GA 5F88A 3EZJB 3MRNA 4KK5C 1DVFA 3QNZA 4GRMB 1MI5A 1T3FA 1MOEA 3D39D 3SE3C 5DFVD 2JK5A 3OKMB 1T22A 4K7PY 5FYJL 2KL6A 2FCBA 5DMIL 5D2NC 1LO2H 3IT8D 4TTGA 4FXLA 3NIGE 4ODVH 2P8PA 32C2A 5HHMB 3VXME 4XNYH 2CMRL 3EFFB 3MRKA 3BP7B 5ISZE 4LRIC 3E6FA 1A7QL 3X12A 2LTQC 4A6YL 4YDVA 3C9NA 5E8OA 5IIEA 3VD3A 3EJZD 1KIPA 1NC2B 2LABA 1CBVL 1WTGT 1NUNB 5I8KL 5HHMD 4HH9A 5GZND 1XT5A 2QTEA 4YJZL 5DHVH 5DRWA 3MR9A 4P9MH 2X89D 1HEZB 1K8IB 1QACA 1N26A 1HH9B 4WW2B 5CIPH 1A7QH 1BD2B 3SGJC 1UXSA 1CFQB 1AP2A 1KUMA 4AM0B 5E08H 4CVWA 4HJ0D 3QDME 2W65B 1CBVH 2OM5A 1S7XB 3ZTNL 4KKBD 1RZIB 3RU8H 5I8KH 4KQ4H 2JB5H 1A7OL 1U8KB 3I84A 1D9KB 5ALBL 1J05A 1KCVH 2CLZB 4JFFD 3BRFA 5KAQG 1ONQB 1S7SB 3STBA 4PREA 1B6UA 1WAAE 5GISL 1WFTA 1BJ8A 1G0YR 3WFHA 4UTAH 1AQDA 3LD8B 2QKIB 2FGWL 4BQBA 2O5YL 1CGVA 5DJCB 1WEJH 2NTFA 4EIGB 5F7DB 1AGCB 1EVUA 4MAYB 1D9KD 4UAOC 2BSSA 1A7OH 1NGWB 1VFAB 3KPQA 1ADQA 3SPVA 1ZHNB 4Y4KA 5I17B 5BVJB 3L3IA 1NFDE 2DQFA 2DQDL 5ALCL 5GISH 4XXDA 1A9EA 3LEVL 4GUPB 3BX7C 4LMQE 5HYSB 1ND0A 4UIMA 4TTDC 4PV8B 2VLKB 2FGWH 3ARVA 1QBBA 4XH2A 4MAYD 3AU1A 1NEUA 3AREA 4B5EA 3GBML 1FH5L 4PY7A 3R06A 3RIAK 4P4KC 2J1KA 4TUOB 5GHWH 1C08A 1VFOA 3T4AB 3BKMH 1TZIB 3AAZB 5TGBB 5CILL 4EN3C 4GLRH 3GMNB 1AD0B 2DQDH 2FO1A 1V3KA 4JEGB 1NBZA 2D31A 4U6YA 2VLKD 2HWZH 1LP9F 3SO3B 5B38B 5EZLB 5DRZA 4JDTL 2GUOA 2R0KH 3BH8A 3SKMB 3KLHD 1DANU 4Z7UB 3OJDB 1BBDL 3ES6A 3GBMH 1FH5H 4CAGA 1IFHL 4LVHC 3QO0B 2FL5A 3TJHD 2YEZA 4LFHG 1GHFL 1LEGA 4M1DL 5KVFL 4Z7NE 4M1GH 5CILH 4A2MA 1JNLL 2K7QA 3QXUA 1T6WA 1SEBA 2AI0H 3GGWB 1ORQB 4WHTA 4HT1L 1M4KA 1CGUA 2RR3A 2DLTA 3ULUF 4NZRL 1Y6NR 5DK2A 5LAXA 4EVNB 1KCKA 1BBDH 3RP1A 3AS1A 3FOMB 4CVZB 2VLJA 4XC1L 1A14L 4DGIL 1A2YB 1IGJA 1G9MC 5KW9L 1F2QA 3DIFB 1TQBC 1PW3A 2YN5A 4HT1H 5MEPB 3WUZA 3UO1L 5IT2L 4CBPA 1AGEA 1F11B 2F58L 1E0OB 1NLDL 4X8JB 3V4UL 5E2VH 3ULSA 2Z4QB 4X4YA 4RAVB 4LVOC 5C2UB 5AAWA 1WZLA 2MQCA 3IDXH 4J4PA 1FV1B 3NCFB 5CP3H 5CLTA 3TM6A 1A14H 3TO2B 3UBXA 5LXGL 2NTSP 3LVEA 4KK6D 1N4XL 4G8GD 1PYWA 2VL5B 2X9YA 1IC7L 2BC4A 3UO1H 1KJMB 5IBTL 4RX4D 2F58H 1AD9B 1NLDH 1CLYL 4LLVB 2AQ3A 1NGQH 3HB3D 3MV8B 1MCLA 5T1KD 3VH8A 2DQJH 4TPRL 5EUOE 5LXGH 1ADQL 5ICXB 3PGCA 1N4XH 3SN6N 5T3ZE 3HI5L 2IG2L 3ARFC 2UZYB 1KOAA 3TA3B 5I2IB 3KYNB 4ZO7A 5IBTH 5D7IF 3MV8D 1A1OA 1CLYH 2OXHA 1F5WA 2I60L 4XVTL 2I9LB 3C5ZA 2CIIA 3ILQD 3VXTB 1KJ2B 3OXSA 3QUYD 3OJMB 4TPRH 2PYEE 5HI3D 4DCQA 5EFIA 3HI5H 3TA3D 2IG2H 1KLGA 3P77B 3CFDA 5DZLA 3RDTD 4XP5L 3W81A 3DX9B 3TBYA 3IFPB 3MLUH 4ZQKA 3U30B 4Y1AA 2NYYC 4OZ4A 1FNHA 3S4SG 1P1ZA 1V05A 4IS6B 4JJ5B 1UADC 5E6ZA 2Y7QB 5I1GL 4M61A 1MRFL 4F8QA 3WO3B 5JHDD 1DQQB 5IR1A 5BS0A 1F58L 3D25B 4FQIL 3O3DA 4IHOB 4KY1H 8FABA 4NM8L 2AXHA 4EUPA 3JWDL 4PLKD 2ZCLL 3F7VB 3HN3A 4M4PA 4HD9A 1DBBL 4XP5H 3VCLB 1P84K 1WCBB 3QAZB 3KLAA 4QXTB 4NQDE 3BZ4B 5T5NF 1BREA 4HC1A 2R1YA 1H3WM 2YD8A 5I1GH 4OJFH 2EH7L 3O3EA 3UTSA 2EO9A 2Q6WB 1XR9B 3WDJA 4OD2A 1UZ8B 4UI2A 3O4OB 3AFLA 1F58H 4WUUD 4OZGA 4FQIH 2C7UA 4NM8H 3QIBA 3JWDH 3B9KB 2ZCLH 3GSNB 3DRQA 4ZOEA 1NCTA 3D69A 3VXRA 1W0WB 1DBBH 1X7QA 1OGTA 2YC1B 5FYLL 3EDFA 4JVWA 2BNRE 5D4QA 4MYWB 3U7YL 5J12B 4JJHA 2OI9B 1NGZA 2QSCH 3RPIB 1NAKL 2DQEH 2EDOA 3UX9B 4LCWA 2FH6A 1JHLL 4ETQB 5MEND 3B9KD 1OD9A 1J8HE 3JV0A 4K9EC 1MCEA 1FG9C 1F6AB 1G7QA 4PJGF 5F1KC 5BRZE 2JE8A 1C12A 3LKSA 4FXKB 4G6AD 4U7MA 5LWYL 4ELMB 1DUYA 2H41A 2VQUA 1X5XA 2QHRH 2X1QA 3GSVB 1XGUB 3V2AR 3LRSB 4HS3B 3F7YA 3QULA 4AIZB 5EU3A 2DJ4A 3ARGA 4KI1A 1VEMA 4S2SB 5T1DL 4RMVA 1BLNA 2A73A 1IQDA 3U36A 5C0ND 1T1WB 1DCLA 1MFNA 4IOFC 4MNQD 5LWYH 1VGKA 5IB5B 4WTWA 5DJDB 3FT4A 1E4KA 4JQIL 1ZT7B 3KJ6L 1J7VR 43C9B 1NCBH 4HUXB 1ORSA 4OLXL 4XZUA 3LN5B 4YBQC 5I6XC 5J11B 1GH7A 1HILA 4CMHB 4I48B 1WZKA 2R4RH 3BWAB 5DA0B 5T1DH 2CR6A 4FQXC 1SY6A 5INCA 2BDNL 3VRLE 4I3SL 1YJDL 1WIOA 1CF8L 3SKOA 4JPKL 5JZ7C 1KN2L 4XNMA 1A1MB 3MFGB 4JQIH 1XF2A 2VLMD 2DAVA 4L1DA 2I07B 5EULV 1T5WA 3G6JF 2NW2A 2ZZUT 5ACMA 5DJZB 3NFSH 2Y1VA 3V7AE 4YO0B 2BOBB 2NZIA 2BDNH 3FO1B 4F57H 4NFBA 1IBGH 1YJDH 1QPXA 5JUEL 4D8PB 2DL2A 3DWTA 1KN2H 3H3KA 4HC1L 3WO4C 2YSSA 4KTDH 2MOVA 4OFDA 5KVMC 4IIQB 3WHXA 1L7IL 5D1ZB 4YHOL 5I76A 4DZ8B 1VHPA 4LLQA 4Z5RA 3TPUB 5B4MD 2VZVA 1JK8B 2OR7A 2P5WA 2OBGA 2BOCB 2D7PA 4RFOH 1YMMB 2VDPL 4BFEA 1Z9LA 2H26A 5I1AB 4IRJA 1MEXL 2WWKO 3MRCA 3MBEA 2WLYA 1A7PH 5JUEH 4LPYA 2HFFB 4LKCB 5IHUL 1KCSL 4HC1H 2HT3C 5IVXB 3PWNA 1HI6A 1T1XB 3CDFA 2BNUB 3QHFL 4ZUSA 4GW4B 2J12B 1D5MB 4BQ6A 1L7IH 1BEYL 3LKPA 4L4VD 4R96B 1RIUL 4Y2OA 3I6LE 1LILA 4FXGA 3EUUA 3NCYS 4QOKE 2J5LB 5C0BA 3QO1A 5DVMA 4DTGL 2DLHA 3PL6C 3MUY1 2FECL 1YN6B 4W6YB 1MEXH 1P2CB 2GSIB 5TH2A 2DDQL 1ES0B 3BE1L 3FO2B 5FGBA 5CGMA 4DW2L 3F62A 1P53A 2FBOJ 1KCSH 3REWA 4AENA 4R97C 3QHFH 1IC4L 4NPYA 5GSRA 4NCC2 2IPUK 4PRDB 1K6QL 5CP7B 4N0FB 1RIUH 3U4BL 3GIZL 2ZOLA 5HHOA 4GKNA 1UXWB 4F2MB 4OZIE 4DTGH 1RJLB 3WDIA 1JZ2A 3CX2A 3TYFA 3DTXA 2VR9A 4RRPG 3BE1H 1GCFA 2VN4A 2UUDK 1ZGLP 4MNHA 3PGDB 1QFHA 2IPKA 4NQEA 3PE9A 3N9GH 4JY6B 4NN6B 1IC4H 3AY4A 3QEGL 4HQQL 1HHKB 1WWAX 5I1DA 2VDKH 1K6QH 3U46B 3U4BH 1A0QL 4U6VH 5C9JB 4TOYL 3GIZH 4O51A 4KZEL 1V3LA 3KPSA 5ACLA 1BIIB 4ONFL 3RVVD 4AIXA 1YEKL 1EO8L 4Q7DA 4YEFA 3ARBC 4FZEL 5DK3A 5BOPA 5GGSB 4URTB 1SY6L 1KYOJ 3LN4A 1A4KB 2ADJA 4UT7L 4ELKA 5C9KA 5FYJE 5A43C 5E2TL 4RSVA 4S1DD 4HJJH 3OKYA 4HQQH 2X41A 4HV8B 3LEYL 3WSQL 1J0IA 3ZDZE 1A0QH 1W0VA 4YHLH 4TOYH 4KZEH 2FR4A 1U8MB 1JPSH 5EPMB 1ULVA 1YEKH 4GAJH 5DJXB 1EO8H 4LCUB 4FZEH 1VADB 1CE6A 2IALA 5C0CB 2ED8A 1TTUA 1CFVL 5L88L 3T77B 1F3JA 4NKQB 4QHMA 1D6EA 1JHTA 4NZUL 4DGVL 1ZLUH 5EOQL 3LN9A 1CTOA 1OLZA 4DKFL 1DUZA 4Y19B 4NKDA 1IKNA 3LEYH 1RK0B 2ARJA 3G5XA 2WP3O 3GJFB 3QDMD 5F3BB 4NC1E 5IBUB 2R1XB 1YEDB 4Y4FC 1UEYA 4LQFL 1C5DA 1CFVH 4KVNL 3VMOA 3L3JB 3VGFA 2Z9TA 2X09A 3HPJA 5CWSB 2BY0A 3KXFA 1IARB 3QIWB 2P8MA 4Y19D 5EOQH 3BZEA 4JFEE 3P9LB 5FECA 3QJHA 1EHLL 2NX5B 5J6HA 1CGSL 1ZGLB 5ADOL 4GBXA 1C5CH 1AO7B 1SEQH 4Z7VA 5D7JA 3R4DA 3ROLA 1UWEL 2WBWB 2J8UA 4HFUH 4RGOL 1KB9K 4NQUA 4LQFH 4NOFA 5FGCE 3UPCA 4I5BB 4CNIA 3QIWD 1INQA 3FT2B 3GHBH 4Z7QF 2KQNA 3HUJF 2RAMA 2C5DC 1ZA3B 1AO7D 3I50L 3Q6FB 4E41B 4HXAL 2XT1B 4EBQL 2NZ9C 3VD7A 1RZJL 1JF5A 4W4NA 4RMQA 5E00B 4TNVK 1IRAY 4ALAL 1XCQA 3GMOA 4L29A 2OQJA 2VLRA 3K1KC 2ICWB 5HDBE 5BV7C 1IC5L 3QXTA 1OGAB 5DQ9B 2ENYA 5FM8A 4AYFA 4ZS7H 1P7KA 1JGLH 5L8KB 4P2YA 3EOTL 1HSAA 2Q7YA 2B4CL 3QQNA 1AY1L 3K7UA 5I16A 4L8SC 2FJGA 3TGXA 1CLOL 4U1LB 4E41D 3VGBA 1T21B 2VE6B 4G7YL 2DJUA 1FO0B 1KB5B 3CSYA 3I50H 4JM4H 4PJIA 3QUXA 3EO0A 3TPKA 1MLBA 4EBQH 1RZJH 3GI9L 3OKLA 4LLYB 5BQ7B 1DFBL 1IC5H 3KPNB 5JIPA 4BFGA 3RHWK 2VZSA 3L5HA 4K71B 4N0RA 4HUVA 3PABA 2AJZB 4U6HB 3ZKXB 5L2KE 2B4CH 1AY1H 2ESVE 4EDXA 1VDGA 4I0PA 4KQ3L 5HDLA 2RFXB 1P4BH 1XR8A 2R2CA 3B3IA 3UDWC 3VFOA 1FZOB 4XCFL 4ZS6C 2P7TA 4X9BA 4BSWA 4HUUA 3GI9H 1WBZB 5C0EA 3JV6A 1DFBH 4OTXL 2X9XA 3WIFB 5HVGB 4MZ3A 4KH2A 2CUHA 3E2HC 2LU4A 4CUCA 1OQOA 1SM3H 3WNOA 1I1YB 4WCYL 2EXWC 1RMFL 1MQ8A 2FWOA 1HQ4B 5JW4M 5A16B 2VQ1A 2GJZA 3EOAB 5C7XL 4KQ3H 3A6CL 2F54A 1R3IH 4Q9CA 3QEQA 4XCFH 1QRNB 1LNUA 1JZ8A 3CX5J 3O41A 4R9HA 4A2LA 3EO1A 4OTXH 15C8L 4PP2A 1OTUC 5SX4I 3T08A 3LKQB 1B90A 1KTDB 4WCYH 2VITB 1BQHA 3A0OA 1A5FH 4ZUVA 4NQCA 4DOHE 4OCWH 4P2OB 1QRND 3H9SE 4XC3L 3G5VA 1IGTA 1I75A 1NEZB 3QG7H 1K4CA 3PWPA 4X4XB 3SJVA 5EBLA 4XNQB 4ORGB 2EYSB 4Y7MA 1G7MA 2R2HB 4FQ2H 2FZ3A 5TE4L 3CZJA 5T3ZD 3DGGB 4QT5B 3HZKA 4N90D 4P2OD 4XBPB 5GGVL 3MGTB 1Z6JT 3UXFA 4CU6A 3S8WA 2GITA 4X7SH 4XC3H 5GGRB 2FIKB 3I85A 4L8BB 3RZCA 1RZKH 5E5MA 4LPXA 4XTRC 1I3VA 1QSFA 2A74B 2ATPB 4U1SA 1JTPA 1JGEA 2IEPA 1D5IH 1DN0A 1ZVHA 5I1LA 4HFWB 5DO2C 1ZE3C 4GS7C 3I3BA 1BOYA 4P57B 4M5YL 5B3JE 3WFCL 4LRNL 2EDYA 4G6JL 3NIDE 5TE4H 1UJ3A 3QNYB 3BP5B 2MCG1 1HKLL 5M7QA 4HIEA 2W07A 4JO2L 5GGVH 5FUCE 1FNLA 1Q9LA 2X42A 4OZFG 3IF1A 5D7IB 3WLBA 4ZFFA 3I75A 1CXHA 5KAQF 4KVCL 25C8H 3DECA 1CTNA 4D9RE 1HXYB 4J1UA 4YHKH 3VD4A 5HHPB 3GJEB 2R1WA 1UKTA 2AXFA 3UJIL 3WFCH 4LRNH 4UQ3B 1LO3L 4G6JH 3FONB 4H0HB 1DL7H 5L2JB 2XWTB 1YYLH 4OM0L 4ZXBB 3BGMA 4JO2H 4YFLI 3KHQA 1RY7B 2HRPL 3DHMA 3ZE0F 5CZVL 3MV01 2CJUH 3QIUA 5D2LA 4KVCH 3BO8B 4OGAC 2FATL 4POZD 5KS9E 1GJIA 3BZFB 1S7WB 3EYOA 1FL5B 3QQ3B 4M5ZL 3O9WB 3ZYJA 1HZHH 4PJFA 4K7FB 2IMNA 2ORBH 1VSCA 4OLZL 5GGUB 3MOQA 5EBWB 3K74B 4HIIA 5CAYB 4EKXA 2CR3A 1L6ZA 2UVFA 2XRAH 3MCKB 3QXWA 1TZHA 2A83A 1PZUB 4FMFA 4Z78A 3CH8A 1RZ8B 3K2MC 4XP6L 1WBYB 1A02N 4XP1H 2BNRD 3FFCE 1I7RA 2R8SL 3UZVB 3ZZ1A 3U6RA 4X4MA 2FATH 2P49B 3RVXD 4KRNA 4W4OC 5E56A 3CFCH 1FGNL 3ZHLA 5C0GA 3U2SA 4JKLA 1A4JA 3MGOA 4OLZH 5AG9A 2ZJSL 3FL7A 1OWRM 3IDJA