3C5ZA

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
202
structure length
202
Chain Sequence
DSVTQTEGNVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALVISNTNKVVFGTGTRLQVLPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords TCR B3K506 Alpha Chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 202
sequence length 202
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5zA01
1EVUA 3O2DH 3G5ZB 4XBGB 4NC0B 4HPYH 1JMZA 3FRPA 3HLAA 1PYWB 4F8TA 3VDCA 4RX4A 5TE4H 3HAEH 1QLFA 3ARSA 1T4KB 5FKAB 1RUKH 2DIBA 3CFKB 4OCLC 4BSWB 2ICEA 1YEDB 4NKMB 5HHNB 3IDMA 1RZKH 2IPUG 4Y2DD 4AIOA 2DQHH 5DK0A 4KJQC 3KJ4B 1B3JA 3KR3H 2D7MA 3BGMA 4Y5XB 2GJ6B 5HGDB 3HG1D 1BOGA 5HDOA 4EIGB 4Y89A 4QRTB 1A6VL 4FQ1L 5FO8B 4MSWB 4B5EA 5C0FB 4OZIA 5GS1A 3UTTE 4GBXB 1JPFA 4MD4A 4TNVF 2Y5EA 4GXVL 1H9VA 3SO5A 5T3XE 2HN7A 1DQLL 1QKZL 1P4IL 5TE7L 3VRJB 3T1WA 5JPNB 2FO4B 1DQQB 3SQBA 1DBML 4Q9BA 5SX5K 3NCMA 5C2UB 2ADFL 3JV4A 2PXYA 5T1DH 4ZAKC 1FYTD 1NGXA 5HDQL 5CSZB 3QXWA 3I6GA 1S7TB 5J89A 5ID1A 3VFTB 3EFFA 3L9RB 1MJUL 1QTYT 1KTDA 1UZ8A 1WSST 2UWEB 1I1CA 3ARVA 3C8DA 1J1OH 4RMSA 3BH9A 1ONQA 1TPXB 4V2CB 4QNPE 4XNUH 4KY1H 1AXTH 5HHQB 5KTEL 4NZTL 3Q2CA 5JR1H 5KAQG 3PF2A 1C5DA 1BQSA 2VDML 4WUUB 3SKOB 4U1SB 3S96B 2VC2H 3QFDB 3ZTJG 4QRPB 1NDGA 5DRNA 4NN7C 3IB4A 4OCSL 2PF6A 1G7HB 4PGDB 2E6QA 4AM0B 4AENB 2FX8H 4JKKA 3P0GB 1LMKA 1Q0XH 1YMHB 3OKKB 3EJZC 4GUPA 2ARJQ 5E8EB 4ZSOB 2NCMA 5JOFB 1JGDB 4JO3L 4QNPF 4Q9RH 3PXJA 4LEOB 2HFEB 4JLRA 5BXFB 4KC3B 3HG1A 5F9AC 1XIWB 3KPTA 3H7BB 4XMLH 3KPQA 2VR9A 4G9FA 1ZWIB 3E6FA 1I7UA 1WUNT 5EFIB 3BSZH 1FN4B 3HC4L 4PBXA 1C5BH 5E9DB 2X1WL 3L95B 3CMOH 3MLXL 4ISVA 2AK1H 1OWWA 5IFAH 5I71C 5EZIL 4HGKC 3L3GA 4YGVB 1FYTA 1NC2B 2CKBB 2OJEB 1U93A 1FSKB 3LY6A 2DIAA 5SWZE 5GGUA 4E41D 2WBWB 5IGXL 5D7JD 2YOCA 1I4FA 3MRFB 3BAEH 4MDIB 5IMOB 3MLYL 1XEDA 4YWGH 1KJ2A 2IALA 2ARWA 1QEWA 1LE9A 4JDZA 3O3DA 4RFEA 1QZ1A 4G6ML 2W07A 1TZGH 1MPAH 4QRRD 2VABB 5HD8D 2XKNA 3L5XL 4ZUVA 1A1MA 1UEYA 4QRUB 3HPJA 5IVZA 2MKWA 2DM3A 5I76B 4IRSD 2UY7A 4KI5D 2VERN 3MRLA 4AZ8A 1OTTD 2ZWLT 3UYRL 3LQAC 2V7HB 1W0WB 1BVKA 4GT7A 2HP4A 4DN4H 3RJQB 5B39G 3GSRB 2GSGA 3P4MB 4QOKE 1I1AC 4N8VA 1H5BA 1DE4B 1DTUA 3T8XB 3U1SL 4OF6A 3ZSTA 2DI7A 1A5FH 3FT4B 2DS4A 2P8MA 4MXWH 1R3HB 2CUMA 3AC0A 5JUEH 4PGEB 1UT9A 4JEGB 2QQKH 4QO1A 4YUEL 3QG6A 4X80H 5AZ2H 4KRLB 4XAKD 1JWSB 1EVTC 4PS4H 4YQXH 4Y16D 4N0RA 3P0VL 2OX5A 5TDNB 4DZ8A 5CJOL 4QXTA 3AY4A 2QTEA 4LSRL 3U4EA 3HC3L 3JV6A 4LCUA 2WLZA 3S4SG 1MAKA 3TO4D 2XKSA 2DQGL 5CD3B 5FV1L 2XZCH 2F5AH 3BVNA 5IEHA 1OD7A 3EYSH 3EYQC 3FQWB 1JGUL 3GHBH 3VXUE 4I5BB 2XT1B 4OSUL 4XP9L 1VESA 4KK6C 1HEZA 4LSPH 5C71A 1T0MB 1IC7H 5FYJD 2R23A 3D5OF 4BZ2L 1EMTH 5DD5H 4HFUH 1S3KH 5DZNA 4JO2H 2JB5L 3W5NA 1F11A 3PQYB 4NOBA 5HHOB 4ZNEA 4JRYB 3J7HA 3ZE2F 4IRSA 4ETQA 1E27B 1X9QA 5IROA 3WO3B 2UUDK 1GJIA 1AC6A 5DF0A 1OW0A 5GGVY 3GIZH 3C9NA 3VXTA 1KCRL 1NUDA 5IW3A 1KB5A 1CXKA 2AJSL 5T3ZH 3WMSA 3X11A 4FTVD 1GSMA 2YD6A 4I0KA 4KJPC 2OXHA 4HKXB 4OCXH 5TE6H 5A2FA 1VKXB 5FO7A 3OKDA 4XRCB 2J8OA 1TCMA 2XFXA 2Y07H 2HJKB 3U0TA 4JFEE 5MERA 1U8PA 4D8PB 2YEZB 1XGRA 2VITA 4HIJB 1J1PH 2CJUL 4NDMB 4HJGA 1BVLA 1W2KT 3F12A 3RY6A 5IHZB 1FYHB 3IDGB 4NP4L 5A16A 5E4IA 3IS1X 3STZB 2CR3A 3KYNA 1EERB 3FOMA 4MVBC 2ESVE 4OQTA 4JFHE 4JN1L 4JM2F 1JPSH 5FXCH 1FG9C 4LLUA 3TO4A 5H37H 1QBML 1ITCA 5TFSH 4C54A 4KDVA 4M9PA 2DKMA 1DL7H 1JFQL 4P99A 5JDSB 3I02A 3MGAA 4G43A 3RY5A 4WGVB 5CP3A 2MJWA 4PRIE 4HS3B 2VSCA 1QSEB 5DK3A 3TIEB 2JELL 4LBEA 4RBPK 5E8OA 43CAB 2N4IA 4CMHC 1EO5A 3LKNB 3WFBL 3M17A 4L3EB 1XT5A 1CGVA 4OD2A 1ZLUH 5BS0E 5I0DA 1KUMA 2HLFC 3HS0B 4G6JH 1A7OL 3TA3C 5GGQH 1DQLH 1QKZH 5JW4Q 1TFHA 9CGTA 1ROWA 5D96C 3S3SA 3HLAB 1MFBH 2H45A 3B83A 3DOSA 1QLFB 3CDFA 3C5SB 5I1AA 3RWDA 3T0BA 1KIPA 2ICEB 3QHFH 4U6HB 4FQQA 3U2SB 1YZZA 2NTSP 3IDMB 4BZYA 2MQ0A 1J0KA 1MJUH 2EDDA 3SPVB 4IRZH 4NQXA 3VJ6A 3BGMB 2QKIA 4OGYL 2O61B 2J12B 2D7TL 1WZMA 4J6RL 4BFIB 4OZIB 4H88L 2VDMH 3TWCH 1JPFB 4G8GE 2P5ED 4XPAL 3O3BB 3ZYOA 3DMMC 4WEMB 1HXMA 2HN7B 2BY1A 3I6LD 3MCKB 3TP4A 1X4XA 5I1EH 3SGKA 4GQPH 5C0GA 1EFQA 1Z3GL 3JV4B 2E7CA 3MV7E 5JXAH 3EOTH 3P40A 5A2KH 2FIKB 3S35L 3UC0H 1FO0A 2PW2A 3LN5B 4M6ML 3KLHD 3EFFB 1UZ8B 3SKMA 2K3TA 1H15A 2XIDA 2BSSA 4J3VA 3BH9B 1ONQB 5F7FA 4HGMA 3BWUC 4FFYL 2Z31C 4JPWL 5CZVL 4PB0L 4L4TD 1A3RL 1KB9J 3CAFA 3GSVB 3T0EC 1FRGL 5E5MA 1C5DB 4HC1A 5K59F 3D87B 2P42B 2JCCB 1NCBH 2OR7A 5LXGH 3SCMC 1QRKA 1JWMB 5EZIH 3C08H 5JHDB 3HKFA 2NY3B 3WFDL 2LE9A 3DGGA 2NYYC 4KGJA 1NQBA 5GRUL 5IGXH 3VXUA 3IDJA 4ZO6A 2ED9A 3QEQE 5C9KA 3LKRA 3MLRH 2VR5A 4JLRB 4G8EA 5I8CA 1KBGL 1CGSH 2V9RA 3KPQB 3OG4B 4G6MH 3IETA 1MQKH 3MRJB 4G9FB 4UUJB 5E99L 1I7UB 3DVGA 5F1NA 3KPSD 1YPZA 4M8VA 4HIHA 3C2AL 4ISVB 2E9IA 1ZT4A 3WE6A 1EHLL 4JN2A 4ZUWA 3TN0D 1CS6A 4N8CH 1E4KA 4OLZH 1A9BB 4Y5YA 3CDGA 4H0HB 3FTGB 1UC6A 5GSRA 1A6WL 2ZJSL 4YDJB 1LP9A 2FEDC 4APQB 1IQWL 1OAYL 1YEFH 5JDJA 3QDGB 2XZAH 4EI5C 2EE6A 1LEKB 4MA1B 3T3PE 1I4FB 2N1KA 2FWOB 1KJ2B 2CLVB 2IALB 1HE7A 2R56L 2FO1A 1NEZG 1QEWB 1LE9B 4JDZB 1OAUH 5AG9A 3O3DB 4GAYA 1MJ7H 4RFEB 3QT2A 2KQMA 4BZ1H 4WEBL 1RZIA 3K80A 4OGAC 4U6YA 1YQVL 5CWSA 1TQBC 2ZSVB 4ZUVB 4I3GA 1A1MB 3RAJH 5CJOH 2YPLD 1GXEA 2HRLA 3MJ9H 5DRXA 2J7LA 2XA8L 5IVZB 4RNRA 3FFCE 4L8DA 1XGQA 3MRLB 3FN0H 2IQ9L 1JRHL 3IU3A 2DQGH 4LU5H 4XGZA 3GSOA 5D1XA 4PJBA 5C9JB 3FAWA 2ZG1A 1TDQA 5KOMC 4N8VB 4OSUH 1H5BB 4LSQL 3MRRA 2ZCKL 5IT2H 2P8MB 4PRPE 4HWUA 3T77A 3CSBA 3V7MA 3JWDC 2EDKA 1FL6A 2PETA 4AK1A 4P9MH 3QG6B 5GGVH 4V1DE 4ZFZB 1QACA 1HHJB 5DVKA 1CLOH 1QFWL 1VCAA 4E5XB 3F7VB 1EGJA 1YC7A 4DZ8B 4KVCH 2ZG2A 4QXTB 4HQQH 3U4EB 3CVHH 4M1CC 4RMWA 1OP5H 1LE5A 4YXLL 3RKDC 4LCUB 2AJSH 3IJYB 3KLDA 2AJ3A 1OGAA 1ZOXA 3O2VH 2X89D 1P6FA 1OAZL 2XWJA 1BPVA 5BVPL 5IEHB 5I75C 1YY9D 3HMXL 5JIHA 1HKFA 1OTUC 3PHOA 1IKFH 4FFZH 3JTSB 1CGTA 1FQ9C 5JQHC 3OB0K 1HEZB 1T1XA 2CJUH 3UTTB 3SE4C 1HHKA 4GMTL 5D7SH 4XZUA 1NPUA 3WLWC 2DN7A 4M3KB 2GY5A 5GGRA 4DEPC 5F7LB 2VIRB 5F7KC 3QUYD 4ZFOA 4OUUB 5J6GA 4JN1H 2DKUA 4ETQB 2LTQC 4Z5RA 4PTUB 4MJ6A 2YD9A 4NQDD 4OIIH 3MV7A 4N1HB 2XZQL 1M1SA 1HCFX 3HE7B 3VRLE 5GJTH 3C9NB 3OMZA 3VXTB 1LK2B 1KB5B 3X11B 1CXIA 1RIUL 2OK0H 4U0QB 5I73C 3QZWG 4YO0B 3LMJL 5B4MC 3D39E 5FO7B 1C08B 1VFOA 2JELH 3OKDB 3VH8A 2XFXB 3TBTA 2PYEE 1CDYA 3W39A 3AUVA 5MERB 4A6YA 3UTSE 1XGPB 1XGRB 1OY3B 4U1IB 3IFNL 1A6UL 1BVLB 4F7TB 3F12B 3TH4T 1IAKA 1WBZA 4AYFA 5A16B 5DD6A 4DFHA 1AD0B 3KYNB 5DFVC 5CJ5A 3R8QA 1EO7A 3VRLF 1QR4A 3ZHLA 1HHIA 5ESVA 3BO8A 4R90L 4XC3H 2FEEI 4LLUB 1I9JL 3D3VD 4OI8A 2X89A 4LAJH 2BOCB 4POYA 3QEQA 2OP4H 5ISZE 3WS6C 3MOAH 4DFIA 5AAMA 3S3PA 3DI2B 3KYMA 4BQ6A 2FLRT 3ILPB 1O5DT 1DEEB 1IGIL 5E8OB 3I9GH 4ODTL 1RK0A 2F19L 3N1FC 1B0WA 1NGPL 4XPAH 2R0WL 1U2HA 2BNRE 1ACYL 1I3RA 1FFQA 2HRPH 3T04D 3NIGE 4UDUB 4C56E 3SDCB 1Z3GH 1HHGA 5FYKL 2G2RB 3T1FA 3RWDB 3L5IA 5KSBA 3WKNA 4GO6B 3ARFB 4G6FB 3S35H 4S11A 3SDXF 4F58L 2YPKB 4M6MH 4G6KL 4MYWB 5I16A 1TZIA 5T1LD 3VJ6B 1ZLWH 4LLWA 4N68A 4PB0H 5B39A 2QKIB 4U7KA 2B5IC 1FRGH 2OL3H 2J1KA 5EIQA 4LQ1A 4KHTL 3NIGF 5FM8A 1EHNA 1V7NH 2VWEC 1YMME 1JHKH 3FFCA 2XXCB 3PGFH 1G0YR 5C0GB 1HQ4B 3CU1A 4P57B 5IP4A 5IVXF 2J5LC 5HVGB 5T3ZE 4WCYL 4QOKB 4F7MB 1L7TH 2PW2B 2QBWA 5DUBB 3RJDA 4CN4A 3S4SA 3WFZA 4BQBA 1OTSD 3OAYK 4KRPC 2H9GB 3O6ML 5IMKA 4PRPA 1QO3B 2BSSB 4WWID 3WDIA 5L6YL 2Z91B 4LNRA 1FZJB 3O9WD 4V1DA 4YDIL 5E5MB 1H8OA 3PNWB 3C2AH 2D0FA 5KBNC 3T0EE 2DYPB 4LIQH 2YA2A 3QJFA 5JHLL 3DLQR 3HNSL 5GGSA 5E9DD 3HI5L 2ZJSH 1IQWH 4HS8L 1RI8A 5E00B 1JWUA 1MI5A 2WLYA 4NPYB 1JIBA 1PGRB 2BVQA 5T1LA 4KUCF 1CXLA 4XAWL 3VXUB 3GFUA 1C5CH 3A6BL 3LKRB 4OJFH 3B9DA 3FQRA 4PJ7E 1RJLB 1U3JA 3O0RH 4Y4FC 1SMOA 3JWOC 3ARBA 4HCRH 3ZKQD 5GS2H 3MZGB 1HOCA 4WEBH 1CDGA 3IETB 2SEBA 4NN5B 3HZMA 3BPOC 3LKOA 3C09B 4NYLB 3DVGB 2J88H 4WENB 4HIHB 5AUMB 3TM6A 4OZHE 5DMKA 3ZKXB 3WE6B 5I1DA 2VLRE 1SEQL 1A47A 4JN2B 3NTCL 2IQ9H 5BV7B 4Y5YB 5GXBB 3CDGB 15C8L 1FP5A 2ZUYA 1U3HC 3NFSL 2YMXL 4BH8B 5DGRA 3TBSB 1MJ8H 3H3PL 4PJ7F 4QXWA 3VWKD 3VXRE 4PV9A 5CGYD 3HZKB 1KPVB 4NC2B 1JZ8A 4HXBL 1J12A 2PYEA 4LKCA 4O2FB 3PV6B 3UPAA 1U95A 3TZVC 1RZFL 3MLSH 1AD9B 3LQAL 4U1KA 1T7VA 1G9NH 4GAYB 2XOTA 4OZHF 4OF8A 1RZIB 1J0YA 3BD4A 1VFBB 5D72L 3ULUC 4U6YB 3MYZA 4LVHC 5CWSB 1I3VA 5EU3B 2ESVB 4ALAL 1M7XA 2A77H 3QQ4A 4UTBH 2W60B 2A9ML 3IF1A 3RWHA 1XGQB 4L8SB 25C8L 1OT1A 1D5ZA 4XGZB 5D1XB 5ISZA 3VI3E 4RGND 1MHHA 1BD2E 1RUAH 3OAUL 1LDPL 5BVPH 3UDWC 2HFGL 3LKSB 2E7MA 2ICWB 4WV1A 5IR1A 4YHKL 3MRRB 4LRIA 5IB3A 2AGJH 4GMTH 2R69L 3B5GA 5BS0B 1IM9D 1MCIA 3QIWA 3VFSA 4ZG1A 4PGJA 1NCAH 1F4XL 2IFFL 3NA9H 4OFYA 3GMQB 1UQSB 4KZEH 1CL7L 2AK4D 2GHWB 1A4JA 3D48R 4YR6A 3V6OA 3O3EA 3WDJA 4C56A 3S37L 3UPCA 5B8CB 3VRIA 1RUQL 5HHMD 3VI3F 2X10A 1LE5B 3OB8A 5GPRA 3EJYC 2IGFL 4NT6A 5ADPH 2D0HA 2AJ3B 3ARGD 5TGBA 3LMJH 3NAAH 3CGTA 3F58L 4GG6F 3H6JA 3PHOB 5IK3A 5IB2A 5MI0C 2WQRA 1IFHL 3FQUB 4HUNB 1T1XB 1MCWM 2NY5H 3IFNH 2NY0B 1NAML 4XZUB 3JTTA 4JCMA 4M62L 4ZTOL 4PJ9A 4I77L 1KEML 4ZDHB 5GGRB 3GEWB 3DRQA 4ZFOB 4D0CA 5J6GB 1YC8A 3IGAA 2MMXA 1J86A 4WU7B 4Z5RB 4L5FH 1RZJH 4H5SB 1KGCD 4X7EC 3MV7B 1PG7W 2JIXD 2DQJH 2O5YL 1MREL 2V5TA 5C6PB 4OV5B 1N2RB 3MC0A 1HYSD 4NO3A 3MSPA 2Z4QA 3DECA 2X9WA 4M6NL 4CBPA 4H20H 4RFNB 5JOPE 2IAMD 2AI0H 3P3YA 4JPVL 1UACH 4NQCA 5GISL 5CEXA 5HYFA 2BHZA 1P9MA 1Y0LB 3VH8B 3TBTB 1FGNH 3MV8E 4ODTH 4A6YB 4W4OC 2R0WH 3RVUD 1NCCL 1RZGA 2AK4A 2L7UA 1IAKB 1ACYH 1Q8MA 2VLJD 1WBZB 4ZO8A 1FNLA 4GRLD 1CD9B 1MCLA 3GI9L 5CZKA 3LV3A 5GZND 4X9FA 1MCJA 1NGQH 4P0DA 1QFWM 5JORA 2QHRL 4OLXL 1GHFL 1HHIB 5ESVB 2ZUUA 3MNVA 5M7QA 3BO8B 5E2WH 5FGBC 3TC9A 3VXNA 3TVMC 1EV2E 2BNUB 4PJ8C 2EXYD 3QEQB 3PDDA 2FATL 4WFFE 3U0PA 4RAUA 4MB4A 5DURB 2AKRB 2A83B 4PJEE 4WNQA 1RVFH 3NACL 1A6ZA 1U8QA 3QO1A 1PKQA 1RK0B 4WW1A 4CU7A 1NANH 1NEZA 3V6ZB 4KROC 4N0FB 1MLCA 2EDYA 4ZOBA 3GUTA 1BQHG 1EJ6A 5LGKA 4P23B 2CLRB 4KKLC 5L8JB 3HAEB 3LDBB 1CF8L 3MLZL 3SDDA 2JIXA 4F8QA 1BMGA 3DHMA 3KPNB 1HHGB 3T1FB 2BHUA 5IM7A 5KSBB 3EZJB 1MUJA 4MAYA 2YSSA 2HT4C 3U9PH 5CJXC 4O4YL 3BYTA 2EDRA 3QHZL 1CR9L 3QWOB 1NJ9B 5I16B 4PJEF 1OPGH 4N0UE 3SJVA 4RCAA 1ZGLP 3V4PL 2OZ4H 4LLWB 5B39B 2EH7H 1UADC 3CDYA 1R3LA 4F15C 4P59H 5CUSH 5E2VH 3IYLW 1A64A 1QLRA 1MAMH 4GRLA 3MOQA 3GBNL 4Y4KD 1UCTA 4IMKC 3CNKA 1GIGL 1FFNA 4LVOB 2DMKA 2R9HD 3HNVL 4JQIL 2EIBA 5JHLH 3BKYL 3W11D 3L3OA 5DT1H 3FFCB 4XVUC 5ITBL 4YHYC 1PLGH 3MRMA 3HI5H 4K9EH 4R26L 2VWEE 4R2GD 4XCNA 1J7VR 4MD5B 5F3BA 1QBBA 5TF0A 3BP7A 1KJVA 1CDUA 4XAWH 3HUJE 2ZSWA 3PGCB 5I1KL 1YY8A 3S4SB 4XTRD 1VEMA 3EOBA 3AVEA 2VE6B 3LEVL 5D1QB 1XGUA 5IMKB 4PRPB 2ICWI 5F7MC 2NR6D 2I5YL 3DUHA 3O6FB 4LNRB 4QXGL 1OF2A 1VFMA 3FT3A 1A1NA 4JPIA 4HBCL 2HKFH 1GL4B 4V1DB 3RZCD 3R8BB 5EOQL 3WFCL 1RZ7L 3FRUA 5KSAC 1GRWA 5EZJB 4XHJD 3QISA 4NBXB 2H26A 3L7FA 2BNQA 4ODVH 1N59A 1G9MH 4HWBH 4TUOA 3S88H 4HZLA 1QQDB 5D1ZC 5GGSB 3HUJF 5J6HA 5FAAA 1JGVL 1MI5B 4ZYKA 5DJXB 2BVQB 4ZS7L 2L4OA 4HXAH 3ARZA 4U7SA 4R4ND 3ZKNC 5C3LD 1FBIL 3FQRB 3QPXH 2J6EH 4LLVA 3LQAH 4I1NB 2XQBL 3QZWA 3TNNA 3CZFA 5EO1B 1WGOA 2ZCHH 4EUPH 2SEBB 3HZMB 3LKOB 4OF3A 4S1DD 3I2CH 1A1OB 4OZ4A 2Y36L 1DQTA 3NIFF 1UM4L 2YK1L 1FCCA 2QQLL 4G7VH 2C1PA 2ADGA 2GK0B 2A9MH 5I1DB 4X6EA 4RFOH 4I0PC 3KPRE 4UTAL 1KXVC 3LSOB 2VYRE 2PYFA 3QUMH 1LDPH 2RCSL 3WJJA 4M7KL 3D39B 3C6LC 3B9VA 3UZVB 4ONFL 2PYEB 2DLFH 1MCPL 3H9SE 4AEHH 4XPFL 1JGEA 1M7IA 4Z7WF 2ORBH 3UTPE 3MRBA 2BCKA 3GMNA 2VR4A 4UQ2A 2Z8WC 2J3SA 3MJ9A 2K9UA 8FABB 3NA4A 3SDAD 4PJCE 3S37H 2OR8A 3GB7A 4Y2DC 1DUZA 3EW3B 3X13A 3QQ4B 1IGFL 4MZ3A 1J8HA 1INDL 3PGDA 4Z0XA 3IF1B 1YYLH 3QULA 4CVXA 2IGFH 1UZ6E 1RIHL 1F58H 1BHGA 1E4XH 3U82B 5ISZB 2BSTA 3MRHA 1MHPH 2NX5A 3FFDA 5DK2A 4AT6A 5HYJA 1P4BH 2X4QB 4BM7A 1QRND 4WV1B 5IR1B 5TQ0L 1GVIA 2B1HL 3HZVA 1YN6A 5ALBH 3S34H 3BE1H 3QIWB 3VFSB 2B8OT 4M62H 5F8QC 3BOVA 3WNNA 4F7CA 1DEDA 5C2BL 4ZTOH 5IHUH 2BNRB 3PHSA 4PJCF 3ULUF 4DGIL 2PNDA 1F6AA 2KZWA 4RMVA 4YR6B 2GW5A 2PR4L 4LIQE 4LEXH 5DD1L 5IQ9A 4C56B 4JFXB 4E9LA 2A6IB 5HSFA 1QSFD 1MREH 3VRIB 2VXTL 5T3XD 4XPGH 1G7JA 5MENE 3BKCL 3PHQB 4XNXH 3DSFH 4NT6B 4M6NH 4DOHE 2D7NA 3UO1L 1BECA 4G5ZL 4N0UA 1KV3A 4WI8A 1S5IL 3NCEB 1IGJB 3BKJL 4OQ1A 5E8DL 2FBJL 4DQOL 1VERA 5IB2B 3SY0A 5FECB 4GJTB 2DL2A 4LMQE 4R7DA 2EICA 3JTTB 1ZK9A 3NPZB 3QUXC 4PJ9B 5I18L 2DQDL 4BK4A 1L0XA 4ZXBA 3NOIA 4XPHH 2VKWA 1BX2A 5IQ7L 5IBTH 2PKDA 1TJHH 1TIUA 4D0CB 3W82A 4OLXH 1GHFH 1OP9A 4PUBH 3VXOA 2JKXA 3JVGC 2YA0A 4OKDA 7CGTA 1A0QL 4KKAD 3U83A 4GMSL 4HT1L 2C3VA 5DJ0A 5GRVK 5AG8A 3E3QE 4NO3B 2EC8A 2Z4QB 4CUCA 4FP8H 3MNZB 3RIFF 4KKNA 5L8KB 5E6ID 4QXUL 5E56A 4NQCB 5CEXB 3CIQA 1B6DA 3U7AA 5GIRB 2FNBA 2ILLA 4CKVX 2Y23A 5ERWB 2E27H 3GI8L 1TJGH 3X14A 5J11C 1HDMB 1RZGB 3LRSA 2WIIA 3OX8A 1DQML 4PRHD 4PYHA 1CF8H 2VZ1A 3LV3B 2FD6L 3F5WA 3QIUD 2FR4B 2CO7B 5JORB 2XTJE 4POZD 1QLEH 4HH9A 4OLWL 3MNVB 3S9DB 4XNYL 5AYQA 3AM8A 1JYXA 3BW9A 5D7KE 4MNGE 4L8CB 1U58A 3QDMD 2GAZA 1F5WA 5ACMA 1RJZA 5CBAA 3T09A 1T6VN 3WHE0 5SWZD 3ARFD 1P7QA 3V4PH 4RAUB 4XB7A 4DWHA 5L88L 5L0QC 3Q6GH 4QY8A 3P2TA 3ZMRA 1A6ZB 1IARB 4KAQL 4HKBB 1U8QB 1PKQB 4WW1B 3VXMA 1SQ2N 1NEZB 1GIGH 3GUTB 5J13B 1I8IB 4ACPA 5H35A 5ITBH 2FSEA 2VLRB 3KJ6H 2EDOA 1SJEA 3KG5A 3SDDB 4W70A 4JO4L 1MOEA 3VCLA 3OWEA 1XCTA 1MUJB 4MAYB 3VXRB 4LSUL 5E6IA 4P4KD 1L6XA 1SYSA 5I1KH 4WFGE 3M45A 4PGCA 1FZMA 1DLFL 2DBJA 5BQ7A 1DDHA 1JPGA 1FORH 4Y0GA 3O41A 3H9SA 3DIFA 3VG9B 2VH5H 4OZGA 1T3FA 4WFED 3OKOA 5F8RC 1AE6L 1KC5L 4CVWA 1YJDC 2OL3A 5HGAA 4Y16C 1I85C 4N1CA 4DTGL 1R3LB 4HBCH 2DBLH 5BW7C 1GGYA 2HLAB 5EOQH 4BFGA 4HF5L 3NCJL 1AQKL 3SBWA 4PRDA 3G5VA 4PRHA 5HI3D 1FFNB 4O2CA 3QIUA 1NMCC 1F42A 1D9KA 4YH6A 3MV9D 2X6MA 3L3OB 4Q2ZA 4NZRL 2RAMA 3G6DL 4LLMA 3KLSA 2XY1A 2EZ0C 1FZOB 4TPRL 4ZTPL 5SWSD 1BD2B 2P45B 3QDMA 2CK0L 3V0AC 1JHTA 1ZMYA 4WU5A 4ZS7H 1KJVB 4DGVL 1LEGB 5IMLA 2ZSWB 2ID5A 1DVFB 1JNJA 1FBIH 3DHJA 5E1HB 1H3PH 1FG2B 1KYOJ 5MP6L 2EE3A 4PG2A 4PD4J 3VA2C 2NZIA 2BVTA 2VXSH 4WRLA 3DROA 1A1NB 4JPIB 2Y36H 3IS0X 2IQAB 2YK1H 3B9KD 3MNWB 4G9DB 4LQFL 4MAUL 5F6IC 4YZFE 3FB7A 2BNQB 3L7FB 3JWOL 5HY9A 3WSQL 3U36A 3MBED 2HH0L 4TUOB 4P5TA 4HZLB 1IM3B 3V52H 5IVNA 4XX1E 3Q5OA 4Z7QF 3U0WL 3TBYA 4GLRH 5L7XL 4P4KA 4DKFH 4M7KH 2VISB 2VTFA 4ZYKB 3FOLB 4P46D 3RGVD 1TQCC 4PJGA 3TT1L 2Z8SA 5IESL 3G04A 4JM2D 3TBWA 3GJFK 2FLBT 4OD3H 4OAWA 2NXYB 1MCPH 4TUJA 1W0YT 3NGBC 4XPFH 5F9DC 3PWNA 2ITDA 1DP0A 3CZFB 5IF0A 3L3KA 1MFCH 4U1JA 5FO9B 3SE9L 4JFED 4YZFF 4OZ4B 1RJCA 2MOVA 4TSCH 5EOCH 4I4WA 4N5EC 3V79C 5D2LA 1JHLH 3VFPA 3DUSA 2YZ8A 2F74B 1ORSB 1A6PA 1I7RA 2I24N 2H2SD 5SWSA 2YRLA 1DR9A 3QG7H 5E1AB 3VFWA 3ULUL 2PYFB 1NGYB 5E8NA 3DO7A 4LHUB 2FX9H 3UJTL 2F54A 1B4JL 3MQIA 5F9OH 5LG1A 3FHAA 3QDJE 2PO6A 5TQ0H 1NL0H 3MV8B 2B1HH 4MLSA 4P48A 4PRID 1V7MH 4N0CD 4PP1D 4LPVA 1JGEB 4GAGL 3HRZA 1GGCH 4UAOB 1XH3A 3MRBB 2BCKB 2J8UA 3D9AH 5I1IH 2ZP0T 3B9KA 3OKLA 1II4E 4UQ2B 5D7LA 4V2BA 4MCZA 3HE6C 5DD1H 4YDLC 1YEHL 1UKSA 2O5XL 3CK0L 3IDXL 4Z9KB 4L4VE 3MBEA 3QI9C 5T33L 2VXTH 2MPAH 1BQHA 4Z0XB 3BKCH 3NFNA 3QULB 4NRXA 3R4DA 3VGEA 3WUZA 3HMXA 4DK6A 4JFQA 3RGVA 4G5ZH 2AQ1A 4JM2A 3LEYL 4FQ2L 3MRHB 2NX5B 5IHBA 1RSFA 5E8DH 5HYJB 4DQOH 3JBG7 3IDYC 4KQ3L 1IQDA 4XP5L 1IAIH 5DZOA 5MHSD 5B3JE 3HZVB 4PRNA 3VGAC 2DDQH 2VAAA 1S9XA 3BKML 3K7UA 4F7CB 4KJQD 1FDLL 5I18H 2DQDH 1U8OA 1KTKE 3WD5H 4LCWE 1F6AB 1CQKA 1T21A 5I17B 3LHPH 4GSDL 4D3CH 5IQ9B 2P5WA 4G8GD 5FYKD 3ZKSD 3W0WA 2APTA 3CVHB 5K9JL 3Q6FA 1EEQA 1A0QH 1O0VA 4HT1H 5ESAB 3F7YB 3CJJA 4TRPH 2GQHA 2RIKA 1G7JB 5F3HA 2YUZA 5E4EB 5DA4A 1GPOL 3DXAD 1J0ZA 1WBYB 1ZA3B 1Z5LA 4R3SA 4N0UB 1FC2D 1A3LL 5B3JF 2EIZB 1DQDH 5DSCB 5DMGC 12E8H 3O4LE 3SY0B 3C5JB 2KQNA 3ZT5A 4PJXE 2F5BH 4R7DB 1M4KA 3KXFE 2AJUL 5F6HI 4WJ5A 2P44B 4KK9D 1DQMH 3QNXA 1T7ZA 4ZXBB 1WIUA 2AJYL 2ICWJ 5HDBE 1QPPA 2ZNWA 3CD4A 4EOWL 3MLUH 4OLWH 3U7WL 4PIRF 3OXRA 1FVDB 4XNYH 3U30B 3MLWL 5DJ0B 5BMFL 1CZ8H 3P4NA 1JYWA 1F3JA 4HAGA 3JWNC 3I50L 1EEUA 5C07E 4UDTA 3BQUA 4CADB 4NNYA 4PJXF 4PP2A 5LAXA 1AXSA 3EJZD 4NRYB 1IKNC 3VI4E 4NQED 3QHTC 4BSVA 4XNZC 5SX5H 3TN0C 1E6OH 5HDBF 5DURD 3X14B 1A7BA 5IBUG 3OX8B 2XNAB 2CIIA 2OXGA 2W9EH 3O8XC 4OZFH 4JO4H 3T2NH 1KLGB 3NPSC 4KK5C 4O5LH 3D69A 1FH5H 4I9WE 4P23D 4KK8C 1F8TH 3Q1SL 2X44D 3BW9B 1IC4H 3DXAA 4OFIA 5H94A 3VA6A 2F53A 4WI3A 2GAZB 1MCSA 5ITFB 5FIEA 4ZAKA 4U1LA 3VI4F 2HTLD 3ARYA 4FNLH 1G7QB 1P7QB 1AE6H 1OP5K 4DVBB 1HH6A 5LCVH 4YBLB 2FHBA 1AQKH 3Q0HA 5C7XH 5D2NE 4HS6A 3VXMB 4NQVA 2PN5A 3ARPA 1U8KA 1J9CT 2X9YA 2BDNL 5H35B 1I8KA 1TCRA 2FSEB 3QIBB 4PLNC 1SJEB 5DHYA 1CGXA 3LIZL 1CE1H 2R8SL 1MFDH 4ZTPH 2N7BA 5JQ6H 2EKJA 1ED3A 3MBXL 1HIML 1GZPA 1T03L 3VDAA 3P73A 4YHOH 2GKIA 4OUOA 4XPBH 3TBVB 3V4VL 1SYSB 4JANB 2I60H 3IXAB 1D5IL 1CTNA 1NKOA 4OCRL 1JPGB 3GK8H 3H9SB 3DIFB 3FT2A 4OZGB 4HKZA 3AREB 3BUYA 2OL3B 4TNVK 5HGAB 4CVZA 3QCVL 4M7ZC 2A74A 4LLQA 3K4AA 4WY7H 5DO2C 2I9LB 1I1AD 1CG9B 4RMUA 3MJGX 4A2LA 4PRDB 4HULB 3G5VB 4MAUH 1FIEA 2XACC 3LN4A 1D9KB 4KDTC 4NWTL 5IWLC 4Q2ZB 1LO5A 1FV1A 4LLMB 2YD8A 1T1ZA 1YY9C 5F9JA 2AEPH 2FJFA 3QXDA 3GHEH 7FABL 4FQPA 2R1YA 2EXWC 1JN6B 1CBVL 1IE5A 5AYUL 4WU5B 2IPTH 5IMLB 1OAXL 4Z77A 2FJGB 4YAQA 5FYLL 3QUYC 4EXPX 2VSDA 4ZUTB 3DROB 2DQEL 3SE9H 3V5KA 1UVQB 3T0DA 4GS7C 3EYQD 4EN3D 1EX0A 35C8L 4EDXA 2A73B 5DLMH 1K4DA 4NOFA 4KK6D 2OJZH 1JPST 5HY9B 4B7LA 3PIQA 5MENB 4MXVE 1ZTXL 4RSVA 2NLJA 3MFFA 3QRFM 1P84K 1YEIL 3KYOA 1P7KA 3EJJX 4JDVA 4PJGB 4MNQE 3EYOA 2J6EA 5IJKC 3TBWB 2XKUA 3IDIA 1LHZA 1TLKA 4OAWB 1N6UA 3UXFA 4EUPA 4P2YA 4IOFC 3L7EA 5C09E 4JVPA 3PWNB 4X7SL 1YEKL 5IF0B 3L3KB 4G3YL 3MGTA 4U1JB 4R97C 4QCIA 3QO0A 3UTSD 2O5XH 1OLLA 4M00A 3VFRA 4JY4A 4I4WB 1XF5A 2IBGA 5D2LB 5T33H 4MXVF 3DUSB 5EUKB 2DI9A 4YXHH 1X5AA 1QVOA 1PZ5B 4K8RC 1JI2A 3QUMA 4PG9B 1U92A 3E1F1 3VFWB 5EZOL 2EO1A 5E8NB 3MOBL 5HYIA 3DO7B 2ITCA 2F54B 3KJ4C 4XMKH 2NY4D 3L3HA 4TSAL 4U6VH 5CKGA 1VACA 2ARJB 4KQ3H 4Y5XC 3ULVC 4XP5H 1B88A 4O02L 2PO6B 3BXNA 4K3HA 1EO8H 3VW3L 2C5DC 5BZDA 1KCSL 1J0HA 3WLBA 3HRZB 5I1JL 4GBXC 1XH3B 3CLFH 3PXHA 3MLPA 4UT6H 4JREB 2J8UB 2NW2A 1KPRA 3TFKD 4OF0A 5D7LB 4Z7UE 1BIIA 1N3NB 3WNPA 5K9JH 2DM2A 3RUGE 3PP4L 4DUWA 4I2XE 5HJ3A 1D6EB 1RUMH 3NFNB 3P11H 4ERSL 4GAJH 4MNGB 2LVCA 3RDTB 2F8XC 1UXSB 4JFQB 3C60B 1CK0L 2AXFB 2HT3C 4K7FB 5JA9A 4LSSL 3I75A 1KIRA 1CDBA 2VDNL 4YHZH 1TPXC 1NAMA 3GO1H 1IQDB 4DVRH 3RWJA 2DWEA 3GGWA 3K74B 4PRNB 4Z7UF 2VAAB 3ZYIA 3VGBA 1S9XB 4O9HL 2I26N 3CMGA 4KHXL 4KV5E 1ZHLA 1CFTA 2BRRL 2N7AA 1Q9OA 4X7TA 3ZHKA 4OT1L 1T21B 1U8IA 2VDQH 1CFVH 5EORH 2P5WB 5J8OA 3W0WB 1A7RL 3UBXA 3ME0A 4WHTB 4XXDB 1YMMD 3QWRD 5BMFH 1KOAA 4JG1L 3OR7A 4RBPH 3DMMD 1A7QL 5F3HB 3RL2B 2CDGA 3D0LA 4PJ5A 1IGCL 5IB4A 5HYSG 4EBQL 1RFDH 5F1KC 5I30L 3PG2A 4WTWA 1Z5LB 4R3SB 2BVPB 3P77A 1XIWC 5T3ZD 4X5XA 3SDXA 1GCFA 4KV5F 3VXSA 4KUCD 4NQSB 4WJ5B 4DAGL 3QXVA 5DUPL 4XP6L 3CFEB 1CDJA 2I25N 4JQXC 2VZTA 4ZO9A 2HTKC 4KZDL 2V5MA 3CSGA 5JOEA 1EJOL 1MJJA 3T0ED 3OXRB 1ZS8B 3TA3A 4J3XA 5SWQA 2FCBA 1G0XA 4EI6A 2OCFD 4MA8L 4M7LL 4GOSA 4LP5A 1F3JB 1WCBA 3SCMD 1J0IA 3P9WB 4UDTB 3BQUB 4M9OA 1N4XH 1IAOA 4PP2B 5LAXB 1AXSB 3A67L 1GC1C 1R6VA 1KT2B 2X4RB 4HEME 1U2CA 4H26A 4QHUB 2HFFA 5J1TC 2WWMC 4P9HH 5D7IE 5ANME 5C0BE 2BDNH 2PUQT 1VGKA 4LRNL 2CIIB 3K2UH 2OSLB 2IF7A 5EO0A 1MSPA 5DJ2A 4GFTB 3QWRA 4IRJD 5I2IA 4TVPL 1AIFA 1OD9A 5EULV 3DMMA 3NZ8A 1MFNA 4H1LH 4RGOL 4JHZA 2E3VA 5CGTA 1P5UA 5BRZA 1MH5A 3ARDD 4KRNA 4XVSH 4MJID 4OCRH 3ZDZF 3DX6A 4ZAKB 1MRFH 3SOBH 5EU6D 4KMQA 3GSWA 1I75A 3QCVH 1K6QH 2FEDD 3QNYA 1KN2L 1BBJB 5D7IF 1HH6B 4XCYA 4EI5D 1T80A 1YNKH 2DLEA 5FA4A 5BOPA 3A0OA 2W91A 4NQVB 4LARL 1SY6L 5FCUH 1VEPA 2Z31A 5DJ8A 1YJDL 1I9RL 4JFOA 3FCTB 4Z18A 4HG4J 3HFML 3BN3B 3NFPB 1J18A 1MIMH 4S2SB 5C8JA 1ED3B 1PX3A 1GZPB 2XI9A 1CBVH 5AYUH 3P73B 3KPLA 4HJ0D 2BVEA 1BZQK 1OAXH 3QDJB 1UEMA 4BKLA 2VN4A 1ZGLM 4WO4D 5DJYA 2YC1B 1A14L 3VWJD 5CSBA 4XPTL 2VNCA 4HKZB 3BUYB 3V5DB 4UBDC 4CVZB 4JFYB 2A74B 4X6DE 1FZKA 3S8WA 1IMHC 5K33A 1QFWI 4XP1H 5KVFH 5FYJL 4L4VB 1KCVL 2VLME 4FFVC 3MA9H 1CD0A 2VXUH 5TF1H 4HMCA 4FG6C 3ARGC 4HX1A 3AAZB 4CDGC 1LO5B 1SVZA 1ZTXH 4MQ7A 4DZBA 4JFFE 1T1ZB 1WZ1L 3MX0A 5JZ7C 2FJFB 3QXDB 2QADB 4MWFA 1YEIH 4NKIH 4WW2F 1ZANL 2R1YB 4JFDD 4J12A 3MRDA 5EU6A 4Z77B 4ELKA 4X99A 4M1CD 5JIIA 5DVNA 3RKDD 3QP3A 1NFDF 4Z0BL 4EI5A 4G3YH 5HGHB 2AAVA 3PL6A 1MHCA 2GJZA 3GZKA 1UJ3B 3LS5H 1I9EA 1OTUD 5INCA 4EDXB 4IS6B 5IW1A 1K4DB 5JMOC 1J5OL 2Q7NA 5C0NC 5CILH 5C08D 1DANU 2CK2A 3WLWD 3PIQB 1FFOA 3W9DA 1K5NB 3EBAA 1JZ5A 1BJ1H 5D5ME 3BT2L 4PRAA 3D2UB 4HLJA 1RK1A 2EC9U 4GKZB 3T2OA 4N1EA 4TSAH 2FECL 2Z93A 1I1RA 2Q76A 1XCQA 4X4ME 4HH8A 3VW3H 3TV3H 4EUPB 5JOPD 1QD0A 1KCSH 3L7EB 4W4NA 4ENED 4MDJA 5A40E 5I1JH 3S6CA 3KXFB 2MTPA 2R29L 4JKPL 4U3XA 4PB9L 5B38G 4ELME 4QCIB 5GHWL 5CEZE 3VFRB 4JY4B 4LHJB 3C2SA 3PP4H 1SHMA 1WWWX 5F7EL 1QVOB 1BIHA 5I8KL 3QUMB 1FNSH 3IFLL 1P7HL 5IFHL 4JFDA 2Q3ZA 3QA3A 1U8LB 5LWYL 2FBOJ 3OB0H 5HVHB 4PR5A 5DFVD 1ZHBA 4WFHD 5ACZA 2OTUB 3V4UH 4R0LA 5EDXA 2VDNH 2XWTA 4PFEA 3RGHA 3V8CA 3LRGA 4WHCA 3K4DA 1SBSL 3H0TA 1MCHA 1X5HA 3BXNB 4OV6F 3WO4B 1YEJH 2D9QB 4LKXA 4WFFD 4RRPG 4O9HH 3EDJA 3WLBB 4MX7A 4R4BA 5F9WB 2H41A 4NHUA 2BRRH 2NW2B 3PDOA 2Y5TA 4PJDA 4HK3J 5C08A 3SE4A 1LO3L 2VJXA 3TYGH 2ZKHL 3EO9L 2C7UA 4LPXA 1IGMH 4NKOB 4K3JH 1NMBH 4M48L 4OLVH 1V05A 1KELL 4NHCH 1U8NA 3D18A 5J57B 4Z95H 2BHYA 2BY3A 2R4RL 3QEUA 1FL3A 2W38A 3O3AA 5I30H 4R8WH 3I75B 4Y8DC 1NBZB 3RWIA 1EH9A 1S8DA 2V2WB 5C0CA 3ULVF 4JVWA 3RA7H 2EH8L 2CR6A 4UIKH 3LOWA 1EFXA 3RWJB 2Q6WA 3GGWB 2BVOA 3W11C 5FDYA 1NANI 3U4BH 3KPPA 1I9IL 2CGRH 1FNAA 1ZHLB 2C4FU 1Y6KR 1Q9OB 1WITA 3EYUL 2GUOB 1EJOH 3DVIA 2NPLX 4G6AC 4JJ5A 5C0IA 1ZT7B 1Q72L 2NY3C 3UBXB 4S1SL 1PBYA 4QRPE 2R4SH 3QFJD 5BZWA 4HJJL 4UV4L 1E6JH 1S7RA 2HG5A 3A6CL 1OAKH 3MXWL 2R1WB 2CDGB 3D0LB 2ICCA 1UYWL 4FZ8H 4LHQB 5CFHA 1WLHA 1I7ZA 2UWEF 1L0YA 5GSVB 3BRDA 1CLZH 3P77B 3Q5TA 3R0MA 1YNTA 4X5XB 2GTZA 4FQXD 1LNUA 3BJLA 3A67H 1N5AA 3DO3A 1IC5L 1S7QA 2R2HB 4XHJC 3WS6A 2DLIA 3VXSB 4J3WA 3FB8A 3PP3K 2G60L 4N9GB 3OHXA 4LRNH 4LGRB 3CLEL 2AABL 1HSAA 2OTWA 3U46B 4JPKL 3WKML 3LKPA 5DQ9B 3RU8L 3TA3B 2JB6A 5SWQB 4AQOA 3M8OL 4APQC 4EI6B 1RZ8A 1LK3L 3VXQB 4PRBB 5KSVA 1WCBB 4MA1C 5IB5B 1DN0A 2BY2A 3DWTA 1MF2L 1F4HA 1IAOB 4UNVA 1LO2L 1M6OA 1F4WH 1KCKA 1Q0YL 3RNQA 5J4MA 4RDQF 4UINL 3RY4A 1D5XA 3GSXB 1HINL 3VMPA 1BZ9A 4H26B 5T1KD 2HFFB 4ONGL 4OD1L 3MYJA 1XMWA 4I3SH 1JP5A 4OZFA 5I66B 1FLRL 3K81A 4PY7A 5DJ2B 3QFJA 1IEAA 5I2IB 3OAYH 1AIFB 5D5MA 4MA3A 3OAZK 3NZ8B 1ULVA 1EAJA 1LEIA 1U6AL 4RISH 3C8HA 5BRZB 3KPRD 1UKQA 1JYNA 4ODSH 3F7RA 4MD0A 4NFDA 2I9TA 5C09B 1UH4A 1D5BB 2ZOLA 3N0PB 1U3HD 3SDAC 2X2YA 3N1QC 5KS9A 1YQ2A 4XCYB 4U0RB 2G5BB 3PWUA 2EKSA 1G6VK 5FYJH 4WHYH 2UYLA 3CFBA 3FMGL 3TZVD 2Z31B 5MEQA 3ZL4L 3L3IB 3WXVH 1AJ7L 5DJ8B 4JGMA 4ODHH 3UTOA 3HN3A 1T66C 3ULUD 5J9PA 4JFPA 1ZANH 5C8JB 1LO4L 4LLDA 1RMFH 1AGEA 3KPLB 3BIKA 3NN8B 4CMMA 1OLZA 1IGTB 1JF1A 3WFEL 1AY1L 1X6NA 1NFKA 4M5ZL 4Z0BH 4TUKL 3OKMA 4EDWH 1RJYA 2MCPH 2MHAB 5F97E 4WI7A 4XI5C 4AIXA 1OGTB 5AWNL 1ZLSL 1CL7I 4MXQC 5E70A 2A6JA 1FZKB 4NN6B 4Z7UB 4K71B 4Y4FA 5EWIL 1NFIB 5EIVA 2R2EB 4HZAA 4OTXL 2IJ0C 5A43C 2AS5M 1SM3L 3RUGB 2Y72A 1NGWA 2D3VA 1W72H 4I2XB 3PQYE 4HX1B 4Z7VE 4MQ7B 1T7YA 2C4XA 4MMZC 3HE7C 3QSKB 2J8HA 1AHWB 1GGIH 1NSNH 1JZ2A 1E4XI 4MWFB 4H0IA 4M6AA 4OIAA 2N56A 3D85A 1FPTH 5FOBA 2OR9H 2BERA 3MRDB 2IANE 2QR0A 4J23A 1XGTA 1DLHA 1M71A 1V5JA 1FO0H 4ELKB 4X99B 2WBJB 4NQUA 1ZXQA 5J12B 1U3HA 2XN9E 3PWPA 5HYSA 2P7TB 3UJJH 3RIAF 4ZD3L 4HGWB 1S7SA 1X4YA 6CGTA 3EUUA 1MLBA 2W9DL 4MS8C 3X3GL 3QUZB 3UEZA 4J4PC 3E2HB 3PL6B 1MHCB 2EE9A 4B0MM 5INCB 5T5NF 1T5WA 5IW1B 2IH3A 4EXKA 2O5ZH 4P5MA 1Q9LB 5F7EH 3B8YA 4HK0A 3UBXI 1FFOB 5IFHH 4L4JA 3ESUF 5I1HL 4PBWD 4N90E 2VDOL 3WIHL 2ED8A 4NWUH 1RK1B 4U2YA 5J06A 3ROOA 1MRCL 4N0YL 2HWZL 2FGWL 4Y19E 4RWYH 1QFUL 1XCQB 4NO0A 1SBSH 3ZT7A 3ZYJA 3OKEA 5ID0A 4BQCA 4K8RL 4L1HA 1ZHNA 5ICYB 3QCTH 3UDWA 3BESR 4MDJB 2W9LA 1RUPL 3BZEA 2X40A 3HPLA 1C1EL 1LILA 5C92A 3GNML 3CX5J 4NIKB 4QYOB 4FRWA 5CAYB 2APFA 2ZKHH 4KVNH 4PJIA 3EO9H 1GAFL 5M95B 3ULVL 4UILH 3SDCC 3DBXA 1DANT 4M48H 2HKHL 3O81A 4LPUA 3H3KA 1KELH 1PQZA 3INUL 1T0NA 3ARFC 4YIQB 2IG2H 4NM8H 3MJ7B 4IBLT 4IDJL 2XTJD 4PR5B 3CXHJ 2P24B 3IDNB 1IT9L 2EC9T 3W2DH 1BFOA 5C1MB 5KVEH 4R0LB 4JE4B 4OI9A 4UIMB 2AJVL 2XWTB 4QTHA 5D7KD 1AQDA 3VFUA 5L2KA 2DQCH 4LKXB 1FFPA 4KTEL 4PJ8D 5I75B 4MX7B 1CXFA 5D7IB 4R4BB 5C0BB 4PLOB 5IBLC 2NW3A 2IMMA 1EUUA 4OZIE 5FUOL 4PJDB 2AEQL 4KTDH 2NNAB 1WWCA 1FAKT 3ZYZA 4P2RA 1Q72H 2C7UB 5E6ZA 4PGBA 4HJJH 1Q9KA 2ATKA 2X9XA 1KTLA 4KROD 4M5YL 3X12A 1J1XL 4HUWB 4M93C 2D4DA 5AD0A 1U8NB 2YR3A 2VQ1A 4YEEA 3VGFA 1K8DA 4KKLD 3O3AB 4MGXA 3T65A 3ULSA 1DBJL 3VG0L 3RWIB 5DVMA 3L5JA 2B20A 3FO2A 5H2BA 5C0CB 3QWQB 3HHRB 1AGCA 5FUZL 3WEXA 1BOYA 2HT4D 1EFXB 2Q6WB 4OZIF 2BVOB 5I73B 4GKNA 3OPZH 3KPPB 4OFKA 3S36X 5EBMA 4M4RA 3S36H 3CLEH 2AABH 1PX4A 3MLVL 4DW2L 5GRVL 4Y4HA 3VFVA 1XF4A 5B3NA 4JPKH 4W4OA 5C0IB 1MNUH 4JJ5B 1ZSDA 5IKCB 3IU4H 5EC2B 5BZWB 4X4XA 4UV7L 3M8OH 4MJ5B 2LVEA 2W59A 3IFOB 4HUXA 2L0DA 1S7RB 2HG5B 1LK3H 5ICXA 5CIPA 3DVNB 1HWGB 3QUKA 5EU4A 1I7ZB 4YFLI 1MF2H 2AXGB 1TJIH 3TVMA 4ZNCD 5LGHL 1Q0YH 1YNTB 1R5IB 2IPKB 5ETUA 2CKBL 3R06A 4Y1AD 3HG1E 4X6DB 5E2JA 1WEJL 4UU9B 4NN5C 3PJSB 3C09C 3FB8B 5I15L 4HKJB 2IADA 4ONGH 4PLKD 4TQEH 3OHXB 2JCCF 4QRQB 4YHLH 1HSAB 3ZKXC 1VGEH 2C4FT 4K23H 4NCC2 4Z7VA 5KN5B 4P46C 4MJ2A 3LKPB 4DGYH 5BV7C 1E4KC 4F33B 4F57L 1GC1L 2HJFA 5KSAD 4WWKD 5D71H 5HI4C 4NNPH 3CXDL 2NTFB 5ILTL 1FYTE 5J56B 3MLTB 1RZ8B 1JMXA 3ZTJH 1XGYH 5KVGL 4OF7A 1PG7X 5GRXG 2Q20A 3FB5A 1BEYH 1DN0B 1S9YA 2IMNA 2CDEA 5F89A 3MUGA 3ALXA 3OZ9L 1HCVA 3TYFA 3FO0L 1M6OB 3RNQB 3IDUA 3HA0A 3CSPA 1L4IA 2PW1B 5CCKL 2NMSA 1HN1A 1XZ0A 2BSED 2CUIA 1JPTL 4KPHL 4LCIL 5DUMH 5DEGA 3AS3A 2H2SC 3ZL4H 1U8JA 4OZFB 5B38A 1EHXA 3SGDH 3BHBB 4XNQA 4PY7B 4H1LA 1IEAB 4MMXC 4L8SC 5D5MB 2CKNA 4MA3B 4GLRI 5JW5A 1EUTA 4X8JA 2B4CC 5D1XC 1LO4H 1LEIB 5F1IB 1KCLA 1JV5A 4Y19A 4OCWH 3GIVA 5EG6C 4I0PD 4GW1B 3UMTA 1A9EA 4MD0B 2R0LL 4Y1AA 3CH1A 2R15A 5DVOA 4M8QA 4ZFFA 5ADOL 2VZSA 2ZOLB 4KUZH 5AWNH 5KZCD 3MPCA 3O6LL 1AC0A 2ZZUT 3K3QA 1G7LB 3MUY1 3DUUA 4RGMB 1AR2A 4ELMB 5DMYA 3PWUB 4S1RL 4KRPB 3C6LD 4RRPA 4XWOD 4GQ9L 3CFBB 3C5ZA 5MEQB 2D03L 4LVNB 2VL5A 1I3GL 5B8CC 4UB0H 1BM3L 5MEPA 3MXVL 5E2UH 4FZEL 3RTQA 2Y6SC 4P2QD 5J9PB 4JFPB 5EU7E 3DX8A 4LLDB 4UI2A 1KN4L 1L7IL 4CMMB 4E41E 4GRWH 1JF1B 5D1ZA 4Y5VC 1CQYA 4P5KB 2OMNA 1KJ3L 2X4SA 5I8OL 4M7JH 4BSJA 1A21A 1RJYB 4Z7NF 2NY0C 2DM4A 2W9DH 1TETL 1KCUH 2P48B 3LS4L 3X3GH 2UZIL 5FM4A 3EIFA 2A6JB 4AEIL 4M6OL 4Y4FB 3MROB 2DD8L 2VZOA 4Y88A 3SEPA 4QRRE 4J3TA 5C0AA 1GGBL 4P2OB 3IFPA 3PABA 4LCWD 2NQCA 4ZNEE 3OGCA 3L3JA 1S7WB 1WTLA 5I1HH 1FNFA 2V7NA 4Q6YA 3GSNL 3WIHH 2DIJA 1MRCH 1A02N 4NJ9H 1MCDA 1FGVH 2HWZH 3WUWG 4IIQB 3LAFA 4RFNC 1YN7A 3D85B 1A7PL 5HPMA 1FVCB 1QFUH 2GTWA 4Q9QL 3UROR 2QR0B 4I3RH 4K7PL 4KJYA 1DLHB 1G9EA 4KK9C 5HDLA 1IAII 4Q6IC 1EK3A 2NY6B 2RGSA 1RUPH 2F58H 1WF5A 1XR8A 3WNOA 5IB1B 5JNYB 1MLBB 3C6LA 1C1EH 3O4LD 4OGXL 2BP3A 1X6LA 3U9UA 2B1AL 4L9LA 4XAKE 1T5WB 5A3IC 5IMMA 1FFRA 1CCZA 2IH3B 3MR9A 4HMDA 3AU1B 3O6KL 2HKHH 2VDRL 4HK0B 1HH9B 4P2QA 1VSCA 5DGQA 5F7DA 1CD8A 1INEL 3QUXD 4JKLA 3SQOH 4Y2DA 3OSKA 4Q9CA 3ROOB 3RWFB 3BZFB 1MIEH 4MZ2A 3V6BR 3N1PC 2DTSA 4HPOL 4LOUC 3QRGL 4NO0B 4P3CL 4AIZA 4B53A 5C07D 2VLKD 4U6XA 1LO0H 1BQLH 4F9PA 3DX9A 4YHIB 5LBSL 4YDVB 3DV4A 3HPLB 2V2TB 4U05A 4HMEA 5K9KB 1REIA 4P23C 3RNKA 3T08A 4XCCL 3L3DA 1VFAA 3LDBC 4PJIB 1J10A 1MWAL 4H25B 2VLLA 2WUBL 3DBXB 5DJZA 2W65A 3RI5F 1RZKC 1PQZB 4YXKH 1AR1C 1K2DA 1T0NB 2HTLC 5TPWL 3VU2A 4EVNA 1VHPA 2CIKA 1U91A 1GOFA 1OARH 1F4YL 2R1XA 1BFOB 4FTVE 3ZLQC 4X5WA 3MRQA 2C1OA 1NUGA 5DR5L 2H1PL 4QTHB 5E2TL 4FXLA 4Z8FL 3VFUB 1OSZA 4X6CA 1QYGL 3BZDA 1FFPB 2VXQH 4R4FL 3V0VA 1RAMA 2NXZB 5CS7A 5C6TH 1AKJD 2IH1A 1AI1L 1G0DA 1CFQA 2GEEA 3MLVH 3SDYH 2XA3A 1UM6L 3MACL 4X7CC 4LVOC 3FHQA 1MEXL 4HV8A 1QBLH 2P46B 4IDLA 5D70H 4P2RB 4TVPD 4WI4A 5LQBL 1JNLL 4LLYA 3QUXA 1QSZA 1I1YA 2AVGA 3MREA 4UV7H 3OJ2C 1Q9KB 2HVKA 3EO1A 1KTLB 1FL5B 3GSUA 4FQCL 3KPMA 5AD0B 4DN3L 4RA3A 2VDLH 3KPOA 2ERJB 3AS1A 4JHAL 1UWXK 1AFVL 3ULSB 1DUYB 2XWBA 5D1QC 1N6QL 5H2BB 2QSCH 2FEEL 2VLKA 4IJ3B 3B5TA 3MRPA 1AGCB 4YE4L 3O6FC 4QHNA 3NABL 5I15H 2OI9B 2BC4A 5D8JL 1E28B 1JNHA 3WXWH 5CGMA 3K8MA 1JVKA 3QEGL 4Y4HB 1WC7A 5EO9A 3VFVB 4ZUSA 1XF4B 5AAWA 5K9OB 3IVKA 4OCYL 4ETYA 3B2VL 3IAPA 4CNIA 2OBGA 4F57H 2Y25A 1G1CA 3V9FA 2R0ZL 5HVWA 3GRWL 4MB3A 3W9EB 3LCYA 4E41A 2OQJB 4NQTA 5D9SB 4NKDA 5D7JA 5AEAA 2EDEA 3EFDL 4K3GA 5ICXB 4S1QH 4XH2B 1EZVY 4JY6A 2DQUH 2Q7YA 5EBWB 1T2QH 4EN3C 4OB5L 5F70A 1E4WL 3FO0H 5FCSH 1Q9WB 2EZ0D 5I19L 5ETUB 2KUTA 4QRSB 3BPLB 4FABH 1AKJA 4LCIH 1JPTH 4YDKL 1R3KA 3LKQA 1DQJA 2LU7A 4QRRA 3HMWH 1KNOA 2IADB 4JB9H 2CRZA 6FABL 5GRYA 4F37F 3MMEB 2EYRA 4O00A 1YPZE 1KJ2L 1K8IB 4Z7VB 1H3UA 3I6LE 1UCBH 1UH3A 1ADQL 4MCYA 3P0YH 3GJEB 2DQFA 3RIFK 1BLNB 2FIRT 1HKLH 2HJFB 1HILA 1NC4B 4XHQA 3F6IA 1NGZA 5FFLA 3QQNA 4JY5L 2PCPA 3B43A 2IANB 5EA0L 5T5FH 1LP9E 1E0OB 1W0VB 2XN9B 1NMAH 5F89B 4O58H 3MUGB 3L1OL 3C8KA 4KMTL 3TT3L 3R1GH 3FQNA 4MNQD 5JO5A 4X6BA 2JJWA 2WMPA 4LP4A 1SY6A 1SBBA 1IJ9A 4YK4C 1G1YA 4RZCA 1OCWL 1XZ0B 4FQJL 5DEGB 4GQ9H 2AV1B 3FQXA 3BGFB 4Y16A 3M1BA 1I85A 1U8JB 2I07A 4OKVB 3ABZA 4XNQB 3KLAA 2YD2A 2NY4C 4H1LB 2LAGB 1HQRA 3QJHB 5JW5B 1I1FB 1D5MB 4N5ED 1KN4H 3VFGL 4YHYB 4Y19B 4D9LL 3QNZA 4NZUL 3GIVB 4PJBE 5JPMA 2CRYA 4LSVL 5I8OH 1A9EB 3TFKC 4EQ3A 1F00I 3L5HA 4M8QB 4ZFFB 1A6VH 4FQ1H 4UNUA 1TETH 3LS4H 3QIWC 1ZA6B 3DUUB 4AEIH 2NY1B 3VE0A 3G08B 1Y18A 4GRMB 5GRJL 4GXVH 3KPSE 5EZLA 4D0DA 3JXAA 3ROLA 3C5ZB 5FA3A 1GGBH 5FGRA 1P4IH 3DX7A 5TE7H 4TSBL 4XCFL 3B3IA 3D25A 4LAQL 1DBMH 3GJFH 2ADFH 4KKCC 2D7PA 3GSNH 3RTQB 5HDQH 1FE8L 3HE6D 3H8NA 5T3XL 4FTVA 3QI9D 2H6PA 1OGAE 1CLYL 2FZ3A 5D1ZB 5DK0B 1KEGL 2X4SB 5KTEH 1BOGB 3HI6L 4NZTH 4AEEA 5I1GL 2WUCL 5GS1B 4PJ9C 2WBJD 3HC0A 2ATPA 1WFUA 2B1AH 1O7VA 3CFJA 4MD4B 1W72A 1CYGA 5C0AB 4LF3A 1JTTA 4FFWC 5HHPA 4OCSH 3PABB 1RIVL 2YPLE 1FJ1A 3EO0A 3OGCB 2BMKA 3IRPX 2PXYB 2V7NB 1A2YA 1NGXB 3I6GB 4O51A 4AG4L 4JO3H 1YN7B 5HPMB 5ID1B 1YECL 4TTGA 5ALCL 4K55A 2C3HA 4KJYB 4X4YA 1B4RA 1KTDB 1P9MC 2X5PA 2BVUA 1T83C 4C57C 3NH7L 4OLYL 2GFBA 2E9JA 3T0XA 4S0TD 5LBSH 1XR8B 5K9QG 5J1AA 3AGVA 3HC4H 2E8YA 4YEFA 3V6FA 1EA9C 5DMGD 3ZKMC 2VQTA 5DHXB 3U9UB 3HNTL 3MLXH 4L9LB 2XQYG 3CFDA 5IMMB 2NY2D 1MWAH 3DSNA 5DRNB 1NDGB 2YUXA 4HWZA 1JTOA 5TPWH 5F7DB 3CX2A 3HE6A 2YA1A 1JL8A 1YEEL 4Y2DB 4GUPB 1NAKL 4HSQA 5KJRL 1RULL 4J3SA 4DKEL 5DR5H 5IOPA 2G9HA 5E2TH 3MLYH 3QDAA 5L9DL 4Z8FH 5IW6A 1UWEL 3HG1B 5C0EA 5F96L 1D6VL 3BZ4A 3HB3D 4U6XB 2MQ3A 1MELA 2X4TA 3DX9B 3E6FB 4IRJC 2P5EA 3MACH 3DV4B 3V7AG 5DRZA 3MCLL 4ODWA 2MSPA 3L5XH 3NCYS 4URTB 3L3DB 5F7HA 1CFSA 5T5NG 3ARDC 4PYGA 3SDDC 1OQXA 3WIIL 2VLLB 3CFIC 1N5YL 4FQCH 3L3GB 3UYRH 1FYTB 4E42A 1K2DB 3VD5A 3LRHA 1A7NL 1ZVSA 1IAMA 4EVNB 5FF6A 4YJZL 1JZ4A 1U93B 1U91B 5E94A 2X4NA 5KSBE 5GGUB 4GRWE 3O8XD 1N6QH 1M05A 3MRQB 4KK5D 4X5WB 5F72S 4XWGL 3U1SH 4KH2A 3VG9C 1FNEA 3P9LA 4WTZG 3X3FL 5INDA 3SKJL 4KK8D 4ORGA 4X6CB 2J4WL 4EQ2A 4L4TA 4M61A 3V0VB 43C9A 4YUEH 3BMWA 3O2WL 3OR6A 4QHKI 5C0RL 2O26U 1NKRA 2XKNB 4HV8B 2DLTA 1H8SA 3P0VH 3I3DA 2Z35A 4LLAA 5JIKA 4HJ0C 3HPJB 4LLYB 2FHCA 1I1YB 3MREB 4LSRH 3HC3H 5KSBF 2HVKB 3EO1B 4WO4C 5EOCJ 3OKYA 3GSUB 3KPMB 3VWJC 2DQTL 3D3VE 1Q94A 1X7QA 2VDKL 4YHPA 2CMRL 1BVKB 3EFDH 3T3PF 2Q3AA 4NKQB 1DVFC 2GSIA 3B2UD 1H3WM 1F97A 2XWBB 1E4WH 2GSGB 1JGUH 5I19H 1VFUA 1R24A 4XP9H 2DRUA 3MRPB 2DOCA 5BJTA 5TQ2L 3FKUS 4YDKH 5IIEA 4BZ2H 3KPSA 2JB5H 4IHOA 1JNHB 3B9AA 3PWJA 1WC7B 3IVKB 1YA5A 1MY5A 1ADQH 1F6LL 4EIZC 3TN0A 4JQVA 4CNIB 1R0AL 5DO2D 1AXIB 1HZHL 3JV6B 4HWEL 1KCRH 1MRDL 3MRGA 1PEWA 4E41B 4JFFD 2CXKA 3O8XA 5EA0H 1J88A 2DLGA 4NKDB 5D7JB 2M1KA 1BBDL 3BVNB 1MI5E 4R6UA 4B50A 1BREA 1LD9A 2NXYC 3WUWA 5BV7L 3NMEA 2EXWD 5HHVL 3WNMA 1BJMA 1JYVA 1OCWH 4K94C 3RBSA 2GCYA 4FQJH 1R3KB 2R23B 3LKQB 1DQJB 5I74B 3ZTNL 4QRRB 1MFEL 1MCOL 4NP4H 4UOJA 1P2CA 1ZKAA 5L0QB 1F11B 3G5XA 2YPLA 2QLVB 4KKBC 5HI5D 4IRSB 4D9RE 4YBQC 3IJSA 1G84A 2GT9A 2DQFB 1QBMH 1ZVHA 1HILB 1JFQH 3UAJC 4G8FA 3PWLA 1J05A 1NCWL 2PCPB 4ENEC 4FQHA 4JRXD 1XF3A 1AO7D 4QF1A 1OSPL 4NNXA 3FQNB 4X6BB 3WFBH 5FM5O 3AROA 4J7RA 3U0TB 2B4CL 1U8PB 4P4RA 2VITB 5GRJH 1IRAY 4HJGB 4CN1A 1WT5A 1A7OH 2ZCLL 1CICD 5E0QA 4J1UA 3FQXB 1NFDA 4Y16B 3M1BB 5IG7A 4IOFD 3FOMB 2MWCA 1C7TA 5CEZD 4X98A 2IBBA 4L3AA 1HQRB 3KYKL 5T3XH 3TO4B 3NCFB 2YD4A 2R39A 4HUUA 4KDTA 4PREA 5IWLA 5BOZG 3I02B 3QNZB 4XBPA 4G43B 4KI1A 5JPMB 4K8RD 3HCVA 4QWWC 2AQ2A 5F7WC 4OGYH 2ZUQB 2ZOKA 3HI6H 2D7TH 3OJMB 4LBEB 4J6RH 4JZNA 1OAQL 2LFGA 5DEFA 2WUCH 3M17B 3EZ8A 4HFWA 4H88H 4OM0L 4OD2B 1Y18B 5ICZA 3ULVD 2GJ6D 1DJSA 1OHQA 5EZLB 3QUYA 4D0DB 1OM3L 5IV2A 5EU5A 5FA3B 2BRQA 3BN9C 4NQDA 3V6OE 3B3IB 1T5XA 3F62A 4GBXD 4XVTL 3SGJA 5I1AB 4A2MA 1C12A 1KIPB 4QHLA 3L5WA 5E4EC 1P1ZA 3BP5A 3MUJA 3S35X 4P2OD 4FQQB 4FTVB 8CGTA 4ZFOL 1ZV5A 2H6PB 5ALCH 4U6TA 2FZ3B 1F6FB 4NQXB 1URLA 4IMLA 3HZYA 3NH7H 3L6FA 3EGSA 3OTTA 4FFYH 2AV7A 4JPWH 5CZVH 1OQOA 1A3RH 1S7XA 2HT3D 4QTIL 5IJKA 2BJML 4PJAA 1N64L 5GRWA 3E6HA 5EPMA 4OI7A 2A1WL 3HNTH 1EEYA 2MNUA 1W72B 5FUCE 1Z9LA 1CDCA 1HXMB 4XBGA 3WIHA 3K2MC 4MA7L 1FJ1B 3WFDH 4WUUD 3TF7C 3EDKA 3D3VA 1YEEH 4Z76A 3H9HA 4LNVA 4FQXC 4NCC1 5GRUH 4QRPD 4FQLL 1RULH 3DETC 2EE2A 4RGNE 1FO0B 4Q74A 1YEDA 1QSVA 1UWEH 1MCKA 2WZPD 1KBGH 5F96H 3SKMB 1D6VH 1H15B 3GM8A 3DYMA 2JJVA 4PJHA 4NQCE 2GFBB 4XBEL 5E99H 5FYJU 4YX2L 5C0JA 5J1AB 1Q1JL 1TNNA 3MCLH 2GJ6A 1XIWD 3CU7A 1PSKL 2BX5A 3AS2A 3PDGA 4FXGA 2X1QA 3CFDB 2AK4E 5C0FA 1EHLH 4GBXA 2EDWA 2HYMA 1N5YH 2NY7L 4QKXB 4ESKA 3O2DL 1A7NH 3AM8C 1A6WH 5HHME 1B0RA 4YDLB 4HPYL 3DGGB 1WFNA 1OAYH 2YD1A 2HTKD 1WK0A 1DQQA 2RQ8A 3ILQC 5TE4L 3LZFL 3A6OA 1RUKL 5IOPB 1NC2D 1F2QA 3IDJB 3X3FH 1S7TA 2R56H 5DI8A 4G8EB 2J4WH 5I8CB 5CLWA 3O3UN 1RZKL 5F7UA 3VFTA 2FJHA 4YBLC 2UWEA 2X4TB 2YUWA 3KR3L 2P5EB 4U1GB 1YQVH 5F1NB 3ZDYE 1PKQE 4YFDB 1YPZB 4ODWB 5DRZB 4D2NA 5HHQA 2X4OA 3QIBC 3N50A 2YN3A 3NIDE 4R7NA 1CFSB 4UT9L 2XA8H 1ZT4B 1T89C 4WUUA 4X4ZA 4ZUWB 4U1SA 3S96A 1KGCE 1JRHH 2WWMD 1ZVSB 2VDKH 5GSRB 4D9QE 5E94B 1LP9B 2EDLA 4ODUA 4PGDA 1IC1A 4LK4A 5DWUL 1M05B 5T1DL 3UZQA 1PAMA 1YMHA 4LSQH 3OKKA 5E8EA 4ZSOA 1FNEB 3P9LB 2ZCKH 5INDB 5JOFA 1JGDA 3AREC 3ZDYF 2LU4A 4L4TB 3SJVE 3O9WA 4M61B 3N85L 43C9B 4LEOA 1NBYA 5BXFA 2XYCA 2V9TA 1XIWA 4YPJA 3SBWC 3S3JA 3FN9A 2RFXA 4YHNA 2EEAA 3OR6B 1FIGL 4XNUL 1QFWH 5GJSL 3V8OA 1ZWIA 4KY1L 1AXTL 2CQVA 1D9KC 4YC2B 2ZUWA 2Y06L 5LVEA 1FN4A 5DRXB 5E9DA 3BJ91 1WJ3A 4RNRB 1HZHH 4YXLH 4L8DB 2WIMA 2WQ8A 4JQXA 4OM1L 1NCTA 2VC2L 4X7FC 3IU3B 4YHPB 1Q94B 1X7QB 3DYPA 3GSOB 4JZJC 4BK5A 1OAZH 3GMRA 4YGVA 4PJBB 1NC2A 2CKBA 1TVBA 4UQ3A 2GSIB 1RY7B 3HMXH 2C26A 2FX8L 4PG2C 1A8JH 4L8BA 4YNYA 1Q0XL 1R24B 5D4QA 3IKKA 5DZLA 4RQQA 4MDIA 5HYQA 3T77B 5IIEB 3KPSB 1FL6B 4IHOB 2VMFA 4XMLL 1PJ9A 2QHLA 4UBDD 2XZQH 1CIDA 3BSZL 1WZKA 2E9BA 2BNQE 1C5BL 3PQYD 4AEFA 3CMOL 5HHOD 4FFVD 4JRYD 1N0XL 2AK1L 3MRGB 5I76A 3VWKA 5IFAL 3CC5A 1OGAB 1Y6MR 3MGOA 2WNGA 1RIUH 2E6JA 4FG6D 5TJWK 3NPSB 2XWJB 3BIAX 5CD5C 5FOJA 1U8MA 1W0WA 2VL4A 1OSPH 5JZ7D 3FN3A 4HUKB 3CUPA 1JCKA 2B4CH 3H2WA 3GSRA 1A6UH 1HHKB 2GCYB 3BAEL 4ZPTA 4YWGL 1JZ7A 1P2CB 3D1MC 1R3HA 4XP4L 2YPLB 1CFNA 1JWSA 3UPRA 1JJUA 1TZGL 1MPAL 3E3QC 4MJ6B 4R90H 1I9JH 1WICA 1WVZA 1V8HA 1KSRA 1FHGA 4G8FB 3PWLB 5C0ND 1MCCA 2BXYA 4N90D 2PO6C 1XF3B 1G9NC 4QF1B 4M43L 5IUSA 4NNXB 5AZEL 1IGIH 4JGJA 1IM9A 3FZUD 5I8EA 4OM0H 4KGLA 3W39B 2F19H 4LDOB 4P4RB 1IL1A 3FQWA 1VA9A 4JREC 2PTUA 1NGPH 4I5BA 1QSED 2JLLA 1GGTA 1A5FL 3B5HA 1T0MA 4MXWL 5DD6B 2GYSA 2XTJC 5IG7B 2DAVA 4L3ED 5EUOE 5JUEL 2QQKL 5FYKH 4X80L 5AZ2L 4X98B 2Q1EA 1UH2A 5EBLA 3RDTC 1J8HE 4YQXL 1E27A 4F58H 4PREB 3C60C 3ARGA 4G6KH 4RX4D 4XVJL 3HCVB 2NX5E 3KYMB 3MCG1 5HYJE 2ZOKB 2XZCL 1YUHA 2F5AL 4QTIH 5JXEC 5DEFB 1JNNL 1VKXA 4HFWB 3EYSL 4WTZA 3UTZA 5EIIA 4C83A 4KHTH 3GHBL 5ICZB 4LCCA 2GI7A 3LB6D 3QUYB 2YEZA 2AQ3A 1I3RB 5EU5B 5IV2B 4NDMA 3GJFA 4LSPL 1IC7L 3GSNA 4NQDB 5IHZA 1EMTL 3IAQA 5CEYA 1B90A 2ED7A 1S3KL 3IDGA 1PW3A 4JO2L 4M7LT 3AB0B 4PTTA 1A6AA 4QHLB 3BP5B 4GRWB 4WCYH 3TLRA 1QFHA 2QEJA 3BP4A 2IAMA 1TZIB 3O6MH 5DTFA 5JDSA 2NY5C 3GIZL 3HZYB 5L6YH 5ESQA 4PJFA 5T3ZL 1F45A 5E95B 4HS3A 1S7XB 1QSEA 1INQA 4OCXL 4PJAB 5TE6L 4YDIH 3TIEA 1X44A 2VLJA 3E6HB 1PY4A 1EEYB 1I8LA 1UA6L 2Y07L 5GS0D 3SO3B 1RZJC 3G6JA 4CW1A 1G6RL 5E08L 1J1PL 2NY7H 3HS0A 2DICA 3SE3C 4R97B 4U1MA 3HNSH 4HD9A 4LSTL 3D3VB 4HS8H 4Z76B 3H9HB 1ZHKA 5ENWA 3BDXA 5JHDD 3C5SA 3LZFH 4G6AD 1IZKA 1JPSL 3BQUC 2NY3D 4RMRA 3A6BH 2YS4A 1KPUA 4U6HA 4U1NA 4PLKC 3U2SA 2FHFA 5TFSL 1QRNE 1DL7L 4PJHB 1Q38A 2E8ZA 1OT2A 2L7JA 3SPVA 5C0JB 1WAAA 1HSBA 2O61A 1MWAA 5BO1L 4FXGB 4WWKC 1IEHA 4UT9H 3LPFA 4BFIA 4G9FD 3QXTA 1SEQH 3BPNB 3QJFB 3NTCH 3O3BA 1WWAX 1QSFE 4G6JL 2QSQA 5GGQL 15C8H 4XXCC 1B0RB 4F3FA 1MHEA 3NFSH 2YMXH 3MCKA 5KVMC 3H3PH 3FQTA 2V17L 1QP1A 1MFBL 1JWUB 1RHFA 5DWUH 3RHWK 5T1LB 4HXBH 4BELD 3QHFL 2FIKA 5DI8B 3MO1A 4APQD 3LN5A 1HXYA 1RZFH 3UCRA 3ARBB 3N85H 4POUB 3QDGD 2J2ZA 2FJHB 1HOCB 3BD5A 4IRZL 5D72H 1FIGH 4Y4KA 4ODBD 1MVFA 5GJSH 2X4OB 3VXME 4ALAH 5A2LH 3DJ9A 2Y06H 4R7NB 5DMKB 3GSVA 3SGEH 2A0LC 3TWCL 2BOBA 1ZEAL 3MJ8A 4OM1H 5B21A 2HMID 2JCCA 25C8H 1JWMA 4JKMA 5JHDA 3OAUH 4ODUB 3PP3H 3EOAA 4Z6AT 2YZ1A 5I1EL 5GRZA 3RVVC 3WNKA 4PV9B 2HFGH 5JA8B 2VZ3A 2APBA 1BJ1J 5JXAL 3EOTL 4MHHG 4LKCB 4XWOC 4YHKH 3RZWA 3VH8G 2R69H 3UC0L 1U95B 3O9WB 2KKQA 3VMOA 4U1KB 1IGYA 4OZGE 1NBYB 1F4XH 2IFFH 3RZCA 5I0ZA 1KULA 2RFXB 4YHNB 3I6KA 1CL7H 1YEGL 3FONA 2CPCA 2Y9RT 3MRJA 4NGHL 3K4ZA 4K9EC 4UUJA 5EUOA 3SGDI 2V6HA 2EDBA 3S37X 5DJCA 3O4OB 4PRHE 3IXTA 3ECBA 3GRWA 3X17A 3F8UB 1RUQH 2DJUA 4CU8A 2QADC 3RWHB 1IILE 1N0XH 3JWDL 4BJLA 2AERT 1NCBL 1CGYA 1D5ZB 4JCLA 5LXGL 3B9EA 3DTXA 1NCNA 3C08L 3GMRB 1MHHB 5JMRA 1A9BA 4UQ3B 1TVBB 3FTGA 3QDME 3F58H 4YDJA 1T66D 4APQA 4OZGF 1EDQA 1IFHH 4L8BB 4YNYB 3QDGA 5IFJA 1QPXA 4FMKA 2IBZY 5DHVH 4RQQB 1LEKA 5IB3B 3T0WA 1NAMH 3NVQA 3OKNA 5KANG 5HYQB 2FWOA 2CLVA 3MLRL 1UJ3C 4I77H 3OAZH 1KEMH 5KSUA 4GW4A 4XP4H 1ADQA 1G9MC 1CGSL 1A4JB 3O3EB 2EDJA 3UTTD 1MQKL 1NBVL 4XI5D 3HAEG 2V2XA 1UZ6F 4JHWL 4MXQD 2O5YH 2ZSVA 3EOYG 3BWAA 4K94L 1CN4A 3ETBF 3VWKB 4WI6A 3CC5B 3MGOB 3QCUL 2Y4SA 1E4JA 4JPVH 4N8CL 5TGBB 4OLZL 5GISH 1U8MB 3EDDA 1TXKA 4M43H 4PJGE 5AZEH 3HE7D 1N7ML 2EEDA 5C9JA 3CUPB 5IK3B 4AQ1B 1YEFL 4WFEE 2XZAL 3ET9F 4KU1A 1NCCH 1JF5A 4ZPTB 5I6XB 1ODAA 5HTSA 3GI9H 3SDAA 1GZQA 3DRQB 4GH7B 1OAUL 1NEUA 1MJ7L 4BZ1L 2W0LA 3IGAB 3WBDA 1H3VA 2D9CA 2QHRH 1CFNB 3MV9E 5D2LE 3AFLA 4ZFZA 1Z2KA 4MS8D 3UPRB 1HHJA 4J4PD 1U8HA 4E5XA 3F7VA 1F3DH 5HVHC 5DJDA 3SN6N 5SWSE 4RGNB 3RAJL 3MJ9L 4PJGF 3UJIL 2FATH 2FYYA 1O7SA 4XVJH 3ZE2E 1IEBA 1QRNA 2F54E 3FN0L 3IJYA 4LU5L 3WO4C 3NACH 1B9ZA 1JNNH 4OCMC 1IM9B 5I8EB 1WTGT 2KDGA 3DPBA 1IL1B 4ZPVA 5F9WC 1YNLL 3JTSA 1GOGA 2AK4B 3K1DA 5D2LF 3UTTA 2J8UE 2YKLL 5IT2L 3CZJA 5D7LE 1T22A 3OG6B 1QSFA 3MLZH 5DQJA 3LN9A 4P9ML 5GGVL 5HHMB 2VIRA 1CVSC 4OUUA 5EBLB 1CLOL 3VXNB 4PTUA 4O4YH 3ARGB 3QHZH 4KVCL 1CR9H 3SDCD 2JE8A 4HQQL 4KXZH 3HE7A 3VFMA 1LDSA 3CVHL 1LK2A 4G6FD 5E5UB 3U0PB 1X5ZA 2DLHA 1CIUA 3O2VL 5D2NC 4WNQB 1YUHB 4YO0A 1C08A 2J8UF 3QO1B 1L0QA 5EIIB 3UTZB 4C83B 2MCG1 3GBNH 1UA6H 2Z8RA 4LCCB 1IKFL 4FFZL 1G6RH 5E08H 1MLCB 4JQIH 3HNVH 1XGPA 4U1IA 1X5GA 3BKYH 2ENYA 3GJFB 5LGJA 3QAZC 5D7SL 4F7TA 4NZDA 3T2QA 3GSNB 4R26H 4J4PA 5CEYB 4LSTH 2JIXB 2P5WE 4X7DC 2JJSC 3W0WE 5IBLD 5D93C 1AD0A 3CFCL 4PTTB 1A6AB 5IM7B 2OM5A 1PD6A 4JZOA 2ZG3A 2YSSB 2E6PA 3BP4B 4OIIL 3KYAA 2IAMB 5F1OB 3RVWC 3TESA 3CSYA 3LEVH 1OB1A 4JR9L 5DTFB 5GJTL 2BOCA 3SJVB 5ESQB 2I5YH 2XQYK 1UGNA 4PJFB 4QXGH 4QOKD 3QDHA 2OK0L 3STBA 2E7HA 1INQB 3WFCH 1QLRB 1RZ7H 3ILPA 1BAFL 1DEEA 5BO1H 2VLJB 4GRLB 3G6JB 4CW1B 2JTDA 1T1YA 5TDOA 2FRGP 4U1MB 5D6DC 3MRMB 4XCNB 5ABDE 4GXUM 4GXUN 2DTML 2DYPD 5F3BB 1JGVH 3BEVA 4UDUA 2V17H 1ZHKB 3T4AA 5ENWB 3SDCA 4P3DA 3BP7B 2G2RA 3RIAK 5C70A 4HUVA 5SWZA 3ARFA 4XC3L 1YY8B 1KPUB 4W6WB 5F7NC 4U1NB 3EOBB 2YPKA 1XGUB 2XQBH 1S7VA 4NC1C 1OP3H 2H32H 1XF1A 5MHSE 2OP4L 2WWKT 3AMLA 3MOAL 3VXUD 1OF2B 3FT3B 5TDPA 4TULL 1R3JA 1HSBB 1MWAB 3FRUB 1UM4H 1KJMA 4FXKA 2QQLH 3I84A 3I9GL 1T2JA 2H26B 3WN5C 2K1MA 5FYKE 1N59B 1ZEAH 3RPIA 1FAIL 1X5JA 1P5VA 3SHSA 4UTAH 1QBAA 1X5YA 2HRPL 4JVUA 4F3FB 1MHEB 5EH1A 5J6HB 2XRAL 2E5EA 5K59E 2RCSH 3FQTB 1HQ4A 5FB8A 3DXAE 4I18A 4P57A 3BIBX 2F53E 4ONFH 5HI4D 3MO1B 2F15A 4QOKA 4F7MA 5DC0A 1HXYB 4LLVB 4TTDD 5DUBA 1GH7A 1TENA 3QZWB 3TNNB 4U0RC 1KFAL 1CT8A 2H9GA 1QO3A 4Y4KB 1YEGH 4NGHH 2Z91A 1FZJA 3MV9A 5K9QI 1IGFH 2OL3L 2C1PB 2ADGB 1INDH 3PNWA 4R2GB 4X6EB 2BOBB 2DYPA 3MJ8B 3JWDH 2IBZX 1RIHH 2ESVD 1V7NL 4JFHD 4MLIA 1JHKL 3PGFL 3OJDA 3KDMA 3EOAB 4HEPG 4BUGA 2VB5A 3CPLA 3NBNA 1QA9A 4YFEA 5E00A 2AJXL 2PTTA 4NPYA 1S9WA 4XCEA 5D1XD 3LD8B 2F8VA 5CZXD 1L7TL 4F7EA 4NN6C 1IGYB 5C2BH 1M7IB 4NQEE 1RJLA 4K71C 3RZCB 4DGIH 4F80A 3GMNB 3I6KB 4WI9A 2PR4H 3FONB