4LLQA

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
99
Chain Sequence
ASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords mutated CH1
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 99
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqA00
2XZQL 4X9IA 4MJIE 4Y1AD 2SEBB 1YYLH 1F4XH 1RIVL 3P11H 3RZCB 5M7QA 4HWBA 2V7NA 4HS6B 4H0HB 3DV6B 4K9EL 4R96A 3KPLB 4WWKC 5EBMA 3R0NA 4OZHF 4UV7H 3VFOA 4K3EH 2YHGA 4MCYA 3GSXB 3FAXA 3RIAK 3X14B 2BSTB 3H9HA 1X4ZA 5LXGH 2ZCLL 3ILQC 3O8XC 1CXHA 2QQNL 3RVVC 2HWZL 4Y4KA 3RGVD 5C08D 4LSTH 2VLKE 3IDMA 5E0QA 3MROB 3CCHB 4M6ML 1BD2E 4S1SL 4IDJL 3VXSB 2WQRA 2VE6B 3BUYA 2P8MA 2YSSA 4ORZC 4CAGA 4F58H 1P7HL 3KDMB 4IRSC 1AHWC 3C9NA 4P46B 1U8JB 2QHRH 5HHOD 3S9DB 1W72A 1LP9E 3Q48A 4I0PC 4OLUL 3U0PB 3G6AA 5FV2A 3IFLL 3JWDC 4HFUH 5HPMB 4JZOA 1ZLWH 4GAGL 2YK1H 3TZVA 3C60A 3I3BA 4N0YL 4Y5YB 2FR4B 5I19H 1YEJH 5DC9B 2OZ4L 4KI1A 4MX7A 3FB5A 1G9NL 2ARJA 4R0LC 4ZOCA 1MJ7H 5FYJH 1CR9L 1EUUA 4NUGL 5CJXA 2X4QB 1WWBX 1N7ML 4Z76A 3BN9C 4UIMA 1NBYB 5E2VH 1G6VK 4J2XA 5GRJH 2W0KA 1RZFH 2RB8A 3BKCL 3GJEB 2W65B 4JO4H 3QG6B 1NBQA 1A02N 3NZHH 2PXYA 4XPBH 4F33B 2HTKC 4DOHB 2PR4L 3QUKA 5GGRA 4RGOL 1FNSL 3QH3B 3PDGA 5HVHB 3I75B 4K3HA 4KVCH 4V1DD 3WHXB 4MJ2A 3SPVB 1ES0A 4U1KA 5E8NA 5F7WC 4Z18A 3CFJB 3MRPA 4HUWB 1N0XH 4X80H 2VZ1A 1LDPH 4LCUB 3ZKXC 1WBYB 3JZ7A 1EFXB 3WNMA 1TMCB 2GT9A 3FOLA 2NY6C 4HWZA 3TH3T 1HEZB 3D3VA 1OAUH 2PTUA 3ZYIA 4E41A 5I71B 3CC5A 3A6CL 1QPXA 4Y4KD 2DQUL 1NAKH 1TPXB 3HHRB 2OP4L 5GSRB 1TQCB 4M62L 2X1OA 4Y4HA 5EBGA 1A6VL 5IJVA 4TUOB 3P4OB 1NEZA 4PS4H 1CK0H 5F7FA 4J3WA 4N68A 1FLRL 2NY5H 4OM0L 5TE7L 2EYRB 3IF1A 5E9DB 5D7LB 2UYLA 1UCTA 1DN0B 4PP2A 3TT1L 4S0SD 3MFFB 1CFSA 2EDKA 1I9RH 4Y16C 5DHYA 1ZTXL 5GGQL 1YEFL 3BPCB 3TZVD 3C60D 5HYQB 4JJ5B 1R3LB 3OSKA 1GXEA 5CLWA 5D7IF 1F3JB 1L7IH 2W0FB 3RY4A 4QHMA 1PAMA 1R3IL 2Q86B 4LCWA 5GS2D 5LGJB 4OBRA 4JAMB 4E9LA 4X4ME 1MFEL 5J11B 4WWKB 3MRGB 1IEAA 1EDQA 5DA0B 3MCLL 1CWVA 4XNZC 8FABB 3NCJL 3OAYH 1ZHBB 4MQ7A 4G7YL 4JM4L 3NABH 3V0WL 4OIBA 1HNGA 3WIFA 4K55A 2PXYD 1SEBA 2BY0A 4PP1C 3GM0A 2DLTA 1Y18B 1TJGL 4RDQG 4YNYA 3MGOA 4X7EC 3UJJL 5CHNB 5HGHA 2Q8BH 4HXAH 4JZNB 5IQ9B 2NPLX 3HFML 1UADC 1YDPB 4Y5VB 5DS8A 3VXSE 2EO9A 2VWEC 1OP3K 1MNUL 5DJAB 2XY2A 4AEIH 5HHPA 4PJCB 4A2LA 4KDTC 2YOCA 4K94L 5D4QA 3MQIA 4HUUA 3D3VD 1J0JA 3G5ZA 4E41D 3KPTA 3EFFA 3V0VA 2HJKB 4M7LT 4LASH 2IH3A 3TYGH 3V6ZB 4FQHA 3SCMB 3V52H 3VG9C 4YDVB 1KIRA 3C87A 4YHKH 4NO0A 4KK6D 4Y4HD 1UJTA 1T2QL 2Y5EA 3WIHA 3O9WD 4HEPG 5D6CB 3OX8A 5BVPL 1Z9LA 1FO0L 3O41A 4NZJA 3D85A 1JGUL 1TCMA 2A73B 3O0RL 1ONQB 1JBJA 3DVNA 3S5LA 1CDJA 3WUWB 3SDDA 4PJ7A 5BW7A 5FO8A 3D9AH 2IG2L 4OF0A 4OIIH 1OOAA 1OF2A 3LRGA 1TVDA 2F58L 4JKLA 2MWCA 4RA0C 4KHXH 4DOHE 1ZANH 4PG9A 4CBPA 4AH2A 2GKIA 3BKMH 4HLJA 3TIDB 3CH1B 4LCWD 3ZKXB 2A38A 1JGLH 5KSBB 3EO9L 5I1GL 1EJOH 3ILPA 4PGJA 4EI5C 2HYMA 1YY8A 4LVOC 4ZO7A 2D31B 1INDL 3WKNA 3QDJB 3L5HA 2X9XA 3LKRA 5J13B 1NMAH 5T3ZH 4MD4B 1FL3B 2Y07H 4PYGA 1S7XA 5JOPD 1PQZA 1X3DA 5FA4A 3U83A 1RURL 3INUL 4KY1H 3RIFF 1P53A 2VUOA 4WTWA 1Z9OA 3SGKC 3GB7B 3CPLA 5F7EH 1UXWA 4PY8J 3RVUC 4JFDA 4YHOL 4YHYC 3U9PH 4M93C 3TBVB 2IFGA 3RL1B 3WV0A 2ZSVA 2FDBP 4DVBA 2IADB 5C92A 1BD2D 4Y16B 4CW1B 3I50H 1NL0L 3C6SA 4MB3A 1YYML 1BZ7A 1HILB 1MQ8A 1KIQB 1FNFA 3BO8B 4HPOH 3SE4C 4D9LL 1DQLL 5HHXL 3DX6A 1K3IA 3WUZA 2GITA 4NO0D 2VH5L 1ORQB 1KG0B 4E5XB 3AM8A 3BZFA 3HE6C 4OF6A 4UIKH 1MAJA 1JPGA 5ENWB 3MLWH 5JW4N 4NNPH 1F6AA 3D85D 1BVZA 4G9DB 1C16B 5DEFB 1YEIH 5DMYA 3PDOB 2I26N 1AE6H 2VERN 4YHNB 1CFTA 3GKWH 3IJSA 3HC0A 3SDDD 1BECA 1CD1A 1F13A 1KT2B 1MAKA 3MJ7A 3D1MC 3LIZL 5K9OA 3OR6A 1KTLA 2AJYL 3BPNC 4CMMB 2QL1A 3VGDA 1JTOA 1BFOA 4LNRB 4LSSL 3ZHDA 4NCC2 3QUXA 2RHEA 4KRPC 5MENA 4NSKA 4PJ9B 5DR5H 2IPTH 4XCFL 1G1YA 2VSDA 5HDQL 2FL5A 1GGUA 4FXLA 5IVZA 3CVHH 4DGVH 2BVOB 5HHVL 2EEBA 2OSLA 2Q6WA 3JTTB 3QFJA 3G08B 3KYKH 5TH2A 4FQJH 1GSMA 2GI7A 3MROA 3RA7H 4PJCE 4XNQB 3JV0A 3AREA 3CFKB 4JFZL 1FL6A 2NZIA 3QEQA 1NLBH 3IFOA 2EE3A 1U8JA 1P9MA 3HMXH 4PJFB 1UCBH 4JFDD 3B8YA 3MGTB 4M3KB 2PCPB 4K7PY 1QRKA 1DE4A 5HHQB 2EDQA 4P5KA 1DBBH 4P0DA 4J8RA 4Y5YA 1P7QB 3T3ME 4XP4L 3T4YB 3WLWC 4J6RH 5CCKH 5E5UB 4BYHA 1IAIM 1IGCL 2R0KL 4RMSA 3VD9A 1I3UA 4ZUSA 2VZOA 4U1SB 3WHE1 1A14H 4NKIL 4RGMB 2HFGL 3IJHA 4HQQL 1C08A 3K2UL 4MMXC 1EEYA 15C8L 4G6ML 3UDWA 4YXHL 1XH3A 4FQLH 4NOBA 5J1AB 5KSBE 5GPRA 4YQXL 3HB3C 3NGBB 4M9OA 2D0GA 1S3KH 3SPVA 4ZS7H 4GBXC 1VEMA 5ICXA 4ZG1A 3FO2B 1RZJH 3P2TA 3BD3A 3P9WB 4HUWA 3F8UB 4TPRL 3WSQH 2ARJQ 1WISA 5DC4B 1JGDB 5JZ7C 4YBQC 1D6VH 4YHYB 3QUXD 1UH4A 5MEND 5CP7A 5BMFH 1YY9C 2ZUYA 4GAYA 4J3SA 3QFJD 1QFOA 3UBXB 5CEZE 3VI3E 2J2ZA 3DO3A 3O6FC 3NIFE 1JI2A 2R0LL 4R8WH 1FYTA 5KVEL 1ZSDA 2Q8AH 4XPGH 1VFUA 5GJSL 4X8JB 4BM7A 2DWDB 3QEQD 1N5YH 3HE6B 4R2GB 1NDMA 1TQBB 3CLFH 5KJRH 4WU7B 1MFBL 3ZSSA 2B1AH 5E9DA 5D7LA 3GZKA 4XMPL 4PGZA 4F7TB 4QHKJ 2WK2A 4ZTPH 1QLEH 3BPCA 2Z4QA 5J6GA 2X1QA 1DVFA 3TN0C 1J0IA 1FH5L 1KV3A 2DDQL 3QAZC 5A2FA 3BPNB 4JZJA 3QR2A 3GIVB 3QULB 4M5ZH 4WU5A 2P24B 1KJ3H 5LAXB 4PB9L 1A22B 4JAMA 1AIFB 3QO0A 2A6IB 2K7QA 3MRGA 1T66D 2F19H 3CNKA 1IQWL 1YMME 5EOQH 2XWJB 3T3PE 5I8CA 3D39B 5IEHA 4PRIB 1C5CH 1OCWL 1I1FA 1PKOA 2ICWA 4XNMA 5BS0E 3Q3GA 1G1CA 1TVBB 1YMHB 4QRTB 5AD0A 2Y36L 4HIEB 3GMOA 4YIQB 3KYOA 1MFCH 1UM6H 3WUWG 4P2QB 4W81A 3RGVC 5CHNA 3PABB 4UINL 5ERWB 4WI4A 4F8TA 5IQ9A 2D3VA 3UPAA 2D2OA 3WO4B 1PG7L 4Y5VA 3G6DL 1V7MH 4ZS6C 1IQDB 5GGRY 1XCTA 1MCCA 4MGXA 4PTTA 5DJAA 4DZ8B 1HDMA 5ETUB 2Q3ZA 2ENYA 2UUDH 4PJFE 5C0BB 1FG2B 4NM4H 3ULVC 2BY2A 4JPKL 1P4LA 3C5ZB 3GDBA 5ID1A 1WT5C 4DGIL 1P1ZB 5E8PA 4DAGH 1BIIB 3SY0A 5I1IL 3L3JA 5BJTB 1FYTD 2C4XA 2C3VB 4ZPVA 4X4ZA 1RJYB 2BHYA 3F12B 1ONQA 1S7UB 4OZGA 5E9DD 5D7LD 1IC4L 3TPUB 2H1PH 3WUWA 4PIRF 1U0QA 3RAJH 4B53A 2IBZY 1SEQH 4QHNB 4JFQB 3EO1A 3WFEH 1IT9L 4PJEF 1DSFH 5A43C 5BXFA 1QHOA 3FFDB 1DVFD 3P73A 4J4PD 2BVTA 4FQQB 1J1PL 2O5XL 5IP4A 3LB6C 5EU6A 4J3VA 5SX5K 2YPKB 2EH8L 2CGRH 3CH1A 3OTTA 2LU4A 3A6BH 1U8PA 1MI5B 5EBWB 1I7RB 3JBG7 3SKNB 3HAEB 2Q7NA 5EO9A 4NNYB 2I60H 3G6JF 4FQ1H 3HC4H 1KLUB 3QDJA 3JWOC 3I6KA 3N0PB 2HLAA 3DRQB 3BDYH 1PX3A 5KSVB 4KI5E 5JW5A 4JLRB 4CRPA 4NKOA 3LCYA 4YX2H 1DLFL 4MSWB 3O6FB 5T1DL 2YKLL 1IC7L 1EX0A 3BEVB 2X1WL 4FZ8L 3RVXD 5IG7A 3GB7A 1JWMB 3PV7A 5I18L 3IXAA 3EYFB 1G0XA 4PGDA 3TBVA 3VFTA 4WEBL 4HBCH 1NCDH 5FUZL 4NQEE 4KPHH 2IADA 4LSVL 5H94B 4RAUB 2DLFH 4KKBC 4XVJH 4LLVA 5CWSB 5D7JB 1CLZL 1KIQA 3F58L 2ZG1A 5K59F 2ICEA 1T7XA 2VKWA 1VACB 3IS1X 1T3FB 5I1JH 1LNUA 4PJHA 1AXTL 1X5XA 2VQ1A 3S96B 1G9MC 1JPFB 4IMLB 3X11A 4E5XA 3THML 3DO7B 2I5YH 5CIPH 3OG6B 5ITFA 3NTCH 4JHWH 4G5ZH 2UVEA 4LLYA 4Z0XB 4EXKA 1C16A 5DVOA 1CI5A 3OXSA 3PDOA 2X4RA 1WCBA 2E5EA 1YPZA 4OGXL 5L7XL 2VXTH 5IM7B 2FH6A 3VJ6B 1BAFL 1JPSH 4TNWK 3D39E 5ESQB 3VDAA 4QTHB 4WI3A 4XVUC 4PRIE 3I6GB 2ORBH 3K4AA 3OZ9H 5DC0A 4BQ8A 4PJAA 5EU6D 2BJMH 3O4OC 2X4UA 4P2QE 4LNVA 1T83C 1Y6KR 4I4WA 1SY6L 4WUUA 1LILA 3QCVH 3L7EA 3T04D 4HK3J 2Z91B 4HZLB 1A7NL 4X9BA 2VR9A 3MODH 4RWYH 2AKRA 1KUMA 4CDGC 3ZE0E 4GMTL 3QDJD 3G08A 1F4YH 1S7SA 2FO1A 4M6NL 3ZYZA 3SDYH 1X5IA 5D8JL 4P3CH 3BXNA 5FCUH 4R4BB 5CZVH 2H9GA 4YHLL 1XZ0B 3O6ML 1I1YB 1MRCL 3BH8B 4PLKD 4NYLB 4JVUA 5F7DB 5IT2H 1S7QA 3SKOB 3PV6A 4P4KB 4L8CA 2PCPA 5IF0A 3DX7B 5HHQA 2OTUB 3LV3A 2VLRB 1KB5B 3MTRA 2AXHA 2GFBA 2Y72A 3H2WA 4BZ2H 4OUUA 3MXWH 4AM0A 5C2BH 3P77B 3KNBB 1MCOH 3QISA 5IFHH 1Z0MA 2EC9U 4U1SA 1KPVA 2FB4H 3UBXG 2FX7H 3MR9A 2FX9L 2IEPA 1MJ8H 3SKJH 4DKAA 4POUB 4RFEB 1NUGA 2Y25A 3HG1B 1PZUB 4MAYA 3TBWA 1A0QH 2CLVB 4TSAL 4LCYB 5DUBA 4OM1L 3NCYS 4E0RB 4K3DH 4OBSA 5SWZB 4AEHL 1LO4H 1MI5E 1NCNA 4J23A 1A4KB 1U8HA 2VXVL 5FOBB 1U9KA 4RRPG 3FO2A 1JNJA 4BSWA 3PGCA 2QQKH 4I48B 5F6HJ 2P5EA 4MDJB 3SDXA 2YC1A 2VITB 3CU7A 3EDDA 4G43A 2E7BA 1MOEA 5E8DH 1MJUH 1AO7B 3I6LE 4WUUD 3EJJX 4HW6A 1E4KC 3WDIA 3GBNH 2DQEH 1MSPA 3FT4B 3VU2A 2IF7A 4NCDA 1QFPA 1EVUA 3VXOB 3FRPG 3EYUH 1CCZA 2GUOA 4AL8H 3L3HB 3H9YA 4PJBB 5E00B 4ZUWB 4GXUM 4X8JA 2XV6B 4LRIA 2JJWA 2GSIA 2R1XB 4NKMA 5C0AA 1JTPA 1M6OA 4WU7A 4HLZG 2OXGA 5IVXF 3ARRA 4RRPA 4OLVH 5I1KL 1JF5A 4UUJA 3I02B 5E03A 4Q74A 3SGEI 5I1EH 3BP5A 3GIVA 5BW7C 1YN7A 1WZ1H 4PRNB 1OAKL 2YWZA 3R06B 3UO1H 1TIUA 5F96H 5DK3A 1UH3A 1AIFA 1NSNH 3O4OB 2E9IA 2HA1A 4GJTB 3VD7A 4L9LB 4KVNH 2Y1VA 4TSBL 3V4UH 1I3GL 3K1KC 3QPQC 4WO4A 3ZKMC 3U4AA 4M43H 5AUMB 4Z7NF 2XKUA 1I1AB 2A77H 5AWNH 5F3BB 4OGYL 4KKAC 2ZOKB 4NQVB 4MB5A 3SHSA 2GAZB 3L7FB 5L8KB 3ULVE 2P5ED 1BQSA 4M02A 5IB1A 3M07A 1Q9WA 4QF1B 3ARWA 4Q58C 4DZ8A 3BH9A 4Q0XL 3GI9L 5C0BA 4EEEA 2EXWD 3MV01 1S78D 1N4XL 1BF2A 2DLHA 3RWFB 1BIHA 1P1ZA 2VLRE 3JWNC 1YEEH 3H0TB 1ZWIB 1J0HA 4ODHL 4AIXA 4R2GD 1JPTL 3T0DA 1RJYA 3HNTL 5C0AD 5DUPH 3GFUA 1A6AB 5GQBA 1Q9OA 2CD0A 3TPUA 4OSUH 4LKXB 4F7CB 2F5AL 1CZ8L 3GO1H 3MNVB 1JNLH 3AM8C 3UJIL 1VB9A 1RU9H 3HG1E 3GBMH 2J8UB 2HVJB 3FB8B 4XNYL 4YZFF 3VFGH 5F7UA 4ZD3H 4TVPE 2GTWA 3BW9A 4R7NA 5HYJA 1WTLA 1ZT7B 4JFHD 1UM5L 4HS8H 5EIIA 4NZRL 4X7SH 4O2CB 3LEXA 4X6CA 2LU7A 4J12A 4IHOA 4ZFZA 3DI3B 5GRVL 3V5DA 5F7HA 3EO0B 4R9HA 1Z3GH 3OKDA 5GRYA 1CL7L 3SKNA 4EUPH 4NPYA 4HK0B 2R4RL 4JQXC 2W92A 2VDQL 3S6CA 2HT4C 2A83B 1JWUB 5DK0A 4FQXA 4WO4D 5KSVA 1XGRB 1AO7E 2OCFD 1WZMA 4XPAL 5TJWK 2CDFB 4L1HA 4MQTB 5L8JB 2DAVA 3HNVH 2WM0A 4U1LB 1TVHB 3LKOB 2AP2A 4I5BA 4XVSH 5EOCJ 3G5XB 4DCQB 3TCXA 1B0RA 1JWMA 3MLRL 4TULH 3EYFA 3AREC 2CRIA 4MYWB 4PJBE 3KPRA 3MLYH 5CBAA 2WMPA 1E4XL 3O3BA 2BNQA 1IGFH 5INCA 4YK4C 4YHIB 3WIHL 4HJJH 2YN3A 5F93C 5C6PB 5FDWA 5C0BD 3QUMH 4OKVB 3BHBB 5D7JA 3WN5B 2CJUL 2X7LA 2XZQH 3ARSA 1ZLUK 1CU4L 1T21B 5MEQB 1RIVH 3TWCL 3QQ9D 1AR1C 3FO1B 5EZJA 3IDXL 3DO7A 1J12A 4K9EH 2CKBL 1KGCD 1JV5A 5D6DA 4MXQD 4RNRB 3MOBL 4NN5B 3AXLA 1HCFX 1DJSA 2MKWA 3OKOB 5FYKE 2ZCLH 4ZNEA 2QQNH 2HWZH 2B20A 4M6MH 1K6QL 3UDWC 1HWGB 4IDJH 5HYJD 2ERJB 4A6YA 4Y7MA 1FFNA 3HI1B 3MNZB 3LEVL 5TGBA 5B3JE 3VWJA 2IC2A 3MZTA 4BQCA 2C4FU 3VFPA 3D2UA 4G8EA 2X4SA 2YA0A 5DZNA 4OLUH 1P4BL 3IFLH 4LBEA 1NKRA 4GAGH 1JF1B 3QNZA 1A4JA 4N0YH 1MUJA 4OCSL 5D70L 2Z31C 4FQXD 2OZ4H 4RZCA 4HD9A 3B5HA 1DUZA 1G9NH 1CGYA 1X7QB 5F9AC 5DMKB 1G6RL 3K0WA 1B9ZA 4QY8B 5HD8D 3L3IA 5JNYA 4R4BA 1S8DB 3AMLA 1CR9H 1K2DB 4ZUUA 4YO0B 4NUGH 1G7JB 4NQSB 5I8OL 3WNNA 2IBGA 1N7MH 3FAWA 4NYLA 5HHMB 3SKOA 3H7BB 1I7TB 3DJ9A 3BKCH 5FAAA 1H3PL 4JVWA 3KPRD 4QO1A 4U1NA 4HPYL 1RY7B 2YD5A 3MRDA 2BNQD 4DKFL 2PR4H 4RGOH 3GIZL 1FNSH 3RGHA 1MQKL 4XWOD 1P5VA 3IGAB 3U6RB 5D7JD 2PTTB 4ZOEA 4ZAKB 1QG3A 1AFVL 3MACL 3D0VB 4FTVB 1CICB 1DVFC 4PV9B 3RWHA 3MRNB 4MQXC 1QLRB 5AAWA 4JZJC 1YC8A 1C7TA 1CDHA 2X4TA 1BPVA 4MNHB 1X5HA 2NNAA 4ODTL 4H88L 5I1LB 5B38B 3SGEH 3TV3L 1Y0LB 1ZE3C 2D9CA 1QR1A 4OZHB 5SWZA 1OP5H 3A6CH 5MEOB 4LLWB 4U6XB 2DQUH 4KU1A 5FGSA 2OP4H 2YPLA 5FDYA 3VWKB 2HG5B 4M62H 4EI6B 3ZE2F 5MP6L 1A6VH 4CJ1A 2VQTA 3WXVL 4F37F 3DLQR 4Y2OA 2BOBB 1UA6L 4APQB 5SWSB 2EDOA 5ELIA 1A1OB 1FLRH 4OM0H 5TE7H 1S9YB 3D2UD 2Q3AA 4WFHE 3UTPD 2FCBA 4NN6C 3TT1H 1UB6B 4UQ3B 4X6BA 1ZTXH 2NYYC 5GGQH 1YEFH 4QHUB 1J8KA 5KSAC 3BISA 3GSOB 4NBYB 3RTQC 4C55A 4B7IA 4U6HB 2EDHA 5JXED 1H5BA 1INEL 2A6KB 5DO2C 1R3IH 2N7AA 1MFNA 1EFQA 5JO5B 3MO1B 2APXA 1MFEH 1RVFL 1ZA3A 1SBBA 1TZHA 3ZKSD 3MCLH 4RMWA 2EE9A 1IGTA 1REIA 3NCJH 3B6SB 5EO0A 4G7YH 4JM4H 4DZBB 5L2JB 4OZIB 4RFNB 3V0WH 1CE6A 3BYTA 3OKLA 4JHBA 4L4JA 4QHKI 2UWEF 3H9ZA 2AV7B 2BOCB 4LVHC 1TJGH 1PYWB 3BJ91 4WFFE 5B8CB 5I66A 4FG6D 3UJJH 3R06A 1ZHLB 3IFPB 3HFMH 2OR9L 2AJXL 4NC0B 4O02L 5EFIB 4L9LA 3KXFA 4LCCC 1D9KA 4YFDB 1MNUH 4YAQB 1NGZA 4K94H 1QKZL 3PWPA 5KS9F 4UBDD 1CGWA 4OJFL 2E6QA 4HV8B 5SWZD 5AUMA 3ZTJH 1FZOB 4PGEA 1EVTC 2YPLD 1DBAL 5BVJB 5F3BA 1T2QH 3LY6A 3DTXA 2PYFA 5D93B 2VDRL 3VXTA 5BVPH 1FO0H 1W8OA 2RR3A 1JGUH 5F44A 3O0RH 1RPQA 4MA1C 1QFUL 2B5IC 4MAUL 2BMKA 1L0XA 1RUAL 4LQ1A 4NO3B 4FQ2L 5C0CB 1EGJL 1T2XA 4HDIA 3CK0L 1H3GA 1NCBL 2LAGB 5HHME 2IG2H 1CQYA 1BOGA 4QRUB 5IMOA 5GZOC 2K7PA 2F58H 5HXMA 4Z7UF 2UY6A 4PY7B 1MCNA 1ZT1B 2MSPA 5DGQA 3MNWA 1CGSL 5D2LF 3D0LB 3PWLA 5D7IB 4NFCA 3EO9H 4LSDA 5I1GH 4M1CD 5BQ7B 5KVGL 3MLTB 2NY1C 1A6AA 1INDH 1DLHB 1U6AL 5DQDL 2J8UA 4XXDB 2VZVA 3VFNB 3DURA 1N6UA 3P4NB 3F7RA 1HHJA 1RURH 3INUH 4OZHE 3DVFA 3IDYB 1JYNA 3F7YB 5FO9A 4I18B 4XB8A 4GT7A 1AJ7L 2ADGA 2BSSA 2ZG2A 4L9DA 4X6EA 4YHOH 1HXMB 2XACC 4RQQA 3KXFD 4NQDB 1D9KD 5SWQB 3NH7L 1VGEL 3TIEA 3SBWC 3FN9A 5GS1B 5SWSE 1QBLL 3DUUA 4HKBA 1JWUA 1NL0H 3PWPD 1YYMH 3M1BB 5JDSA 4ETQB 1K4DB 3GI8L 3WLBA 4POZD 1MCBA 4FOMA 1UB5A 4HUKB 2CDFA 1K4CA 1DQLH 1LK3L 3NFNA 4D9LH 5HHXH 2XNAB 4X0KA 2YN5A 3QEHB 2D03L 2VH5H 1VEPA 4CJ0A 3G5XA 4DCQA 1C12B 2CIIB 5K9QG 3QHFL 3EAKA 3FQXB 4NDMA 4M6AA 1O5DT 1CGVA 2F53A 3UTQA 5HHNB 1WV7T 4ZPTB 4Q9QL 1JHTA 2VAAB 3VFWA 4F80A 2RAMA 2D7QA 3UX9B 3OF6A 2V5YA 1CDYA 4LVHB 4Y2DA 4OD1L 3LMJL 3WN5A 3LIZH 3T0VA 4OZIE 2AJYH 5CD3B 5F7MC 1F4AA 4LSSH 3AU1B 3FO1A 3RX8A 5ICZA 5D1ZA 5E8EA 1GVIA 4DKEL 5A2IH 4RISL 3VXNA 2XXCB 2V7HB 1MHHB 3MSPA 5E5MB 2W1NA 4XCFH 4ORGA 1BZ9B 5EPMA 5HDQH 1J8HB 3OKOA 3SO5A 3VXQA 2YEZA 4GFTB 4GQ9L 5HHVH 5L88L 3MZGB 4PJ5B 3ZKNC 4MAYC 2A6DB 2EYSA 3BDXA 3LSOB 4OCXL 1L0YA 1YNLL 1G7MA 4JFZH 1D5BB 5DFVD 5F9JA 4I0KA 2VTFA 3QI9B 5H2BB 5C0JA 3RUGF 1EAPB 5F6IC 3LEYL 1YEHL 1AGDA 2B5IB 4G6AD 3FRUB 2DQJL 1OWRM 5F88A 4NC1C 3EJZC 3CVHA 4B0MM 2ITCB 3G5YB 3I3EA 4K8RC 4XP4H 4UNTA 5MI0B 5B38G 4LP5A 5C0CE 5DMKA 4WEUD 1IGCH 3I84A 2R0KH 2EXWC 2J1KA 5CEZL 5T3ZD 2QHLA 2B4CC 1GJIA 4NKIH 3PWJB 1I3RB 4QGYA 2HFGH 4HQQH 2UV3A 4U7MA 3K2UH 1KCVL 1K5NA 4P2RE 1UJ3C 1PZ5B 2F53D 4KQ3L 3DRTB 4Z78B 1IAIL 15C8H 4G6MH 3HMXA 4YXHH 1UWGL 3O4LA 4XCEB 3GSVA 5D7IE 5F9WC 3RJDA 5BZDB 5F7YC 1WICA 1AGFA 4M4PA 4S11A 2GJZB 4ZXBB 4YQXH 3VXMB 1U8MB 3OF6D 4KMQA 1KLFA 1T0MB 4UDUB 3LKPB 4LSQL 4Y2DD 1KXVC 3U6RA 2PTTA 1U93A 4QKXB 5EUKB 2V5MA 3KYAA 4QHLB 4O2EA 4PJIA 3MXVL 3E1F1 3B83A 5IHUL 4FTVA 4TPRH 5EN2A 3SJVB 4D0BB 1SJHB 5E95B 4LIQE 1QLRA 3E6HB 4DUXA 4K3JL 4HCRA 5DHXB 3CFBB 1GGCL 3FONA 4WV1B 5CBEA 1Y0LA 2WBKA 1AXIB 2VL5A 4G7VL 1VGKB 3TFKC 3V0AC 4LLWA 3ES6B 1WBZB 4F7EB 5DQ9B 2HG5A 1WWWX 4H1LB 4P3WA 2EZ0C 1X6NA 4GKNB 1A7PL 3B9AA 3KR3L 2R0LH 4TUKL 5KVEH 4BH8B 4WO4C 4N9GA 5GJSH 4MCZA 2BOBA 4JHZA 4APQA 1RZIA 5EU3B 3BYYA 4M7LL 4Z7WA 1MFBH 1S9YA 2V17H 3TPKA 3RBSA 1SQ2N 3OB0H 5I1AA 4XMPH 1OTUC 1U36A 3RY6A 4GW5A 4PB0L 4N90E 4UQ3A 4LGRB 4LPUA 4NRXB 1UH2A 2ESVB 3QDHA 3LQAL 1RJZB 1JF6A 3GBLA 1R24B 1F4HA 4NQXB 1ZEAL 1FH5H 2DDQH 2ATKB 5IMKB 1XF1A 2XZZA 1JRHI 3B2VL 3KHOA 1BGXL 4JKWA 4PB9H 5FM5O 4X5WB 4OIAA 3O3EA 3B8SA 1YN6A 5CILL 3QJHB 1SBSL 3O2WL 1IQWH 4CVZA 4OFVA 5L2JA 3RI5F 1OCWH 4MXQC 3O4LD 3W9EB 4YHZL 1HI6B 2AV7A 4LKCB 1J8HE 2Y36H 2XKNB 4JCMA 1JZ6A 4QXWA 1R5WB 4WJ5B 4MJ5B 4IOFD 3M17A 1MFDL 4PJ5E 2FSEB 2VJXA 4UINH 4ZAKD 3B3IA 1AQDA 3TVMC 4OF8A 1QFHA 2PKDA 5CEYB 4FTVD 2BVPB 2QADD 1PG7H 3L9RA 2AABL 3G6DH 3CZFB 3GJFK 1AD9A 5F8RC 2N7BA 4JM2F 4JN2A 5C0GB 5F6IB 2WUCL 1MY5A 1YQ2A 3L5WA 1NGXA 3C6LA 2DIJA 4HV8A 1WITA 3RWGB 1BFVL 4JPKH 1OGTA 4CADB 1NGWB 1YC7A 4DGIH 1XF5B 2IQAB 4UT9L 3V6FB 3JVGA 3QWRA 5I1IH 1KJMB 4LRNL 5E1AA 4KMLB 4APQD 3LOWA 4S1QL 3T0EC 3DETD 5AG8A 1N59A 1VKXB 1IC4H 4KUCF 1OAZL 5F9WB 1XGPB 1IT9H 4KC3B 2GCYA 4OD3L 3SDAA 5C0EB 4XGZA 2DQFA 1XEDA 1JYXA 4Q6IA 5ID0A 3MRLB 4YC2C 1K8DB 1XFPA 4XCNA 2IMNA 4ZFOB 3P40A 5J0BA 5ACMA 1T1WA 1J1PH 3VXME 2O5XH 3FT2A 5C71A 2X42A 2EH8H 4Y5XC 3TBYA 4G8FA 4DUWA 1OP9A 3KVQA 4KK8D 5BQ7A 3OKMA 1M1SA 2C7UA 3TJHD 4UI2A 3SJVE 4P2OB 3BZ4B 4Q2ZA 3MUGB 3VFNA 2E7MA 4MVBC 2FYYB 1H3TA 3P4NA 1DLFH 4W4NA 5GZND 4ZFFB 1J5OL 5T1DH 2EC8A 2YKLH 5DQJB 1IC7H 1JMXA 1QRNA 2RFXA 5A16B 3JUZA 1QUNA 1TFHA 2NXZD 1TXKA 1S7RA 4FZ8H 4AJ0A 5I18H 5L0QB 3Q5OA 1QEWA 2ADJA 1FVEB 4WEBH 4NQDA 4Z95L 5FUZH 3VWJC 1T5XA 4LSVH 1M71A 3U4EA 5GS1A 3L5JA 5DMIL 3WE6B 2VSCA 3C6LD 4ETQA 1K4DA 2VZUA 3MLPA 3KPMB 2BVQA 3G9VA 1CLZH 3QQ4B 2HP4A 3F58H 4YEEA 1E28B 3MV7B 4M7ZC 5EOTA 1L7TL 1AXTH 1NBZB 2ESVE 1A9EB 5JPNA 1SHMA 3QWRD 3THMH 3EJYC 5C9JB 5I1HL 4W4OC 2FHCA 4ZYKB 5INDA 5E94A 5HI4D 4Q6YA 1T1YA 3N9GL 4LEOB 5MHSE 1JZ3A 5IB3B 4LHQB 4XI5C 1A7RL 4ZPTA 1Q38A 1TZGL 2VAAA 3DUSA 4LLDA 4KTYA 4V2CB 3P4MB 4OGXH 5L7XH 3DBXB 1BAFH 2HFEB 5DRZB 3SDAD 3RKDD 3PQYB 3GSNB 1MVUB 5CD3A 2VKXA 2FJFA 3O2DL 4HH9A 3KJ4B 5FK9B 4ELMB 4PJEB 5FEBA 3TVMB 3H8NA 4C83B 3UTTE 3LKQB 2BNUA 1MCQA 1ORSB 3STZA 3PHOB 1AC6A 5TE6L 2A74A 3O3UN 2HVKB 1SY6H 1U3HB 1F58L 5CIPA 3UPRB 1A7NH 3G9AB 3ULUD 4GMTH 5DJ6B 4HJGA 3MRCA 5E4EC 1K9TA 2X9WA 1IAOB 2XZCL 4M6NH 5D8JH 3FN3A 1P84J 3ESUF 1T22A 5AZEL 3UTSB 5FIEA 4NC1E 1V8HA 1MIEL 4YHLH 1QRND 3O6MH 2XTJB 5H8DA 1MRCH 2NY0B 3U0TB 1W0WB 3T0EB 2VDNL 3QXTA 3B9DA 5IIEA 3K8KA 2LV4A 4NQDD 1FQ9C 1KC5L 2R56L 4MS8C 1P4IL 1UQSB 3LH2L 4U6YA 5I16A 1GZPB 4X7TA 5EZIL 4IMKA 2ITCA 5KZCD 3GMLB 3IU4L 5DURD 4PJDF 1I7UB 5T33L 4YC2B 4PRPA 3TA3C 3MOQA 4DTGL 5E2WL 3QIUB 2FX9H 4HIHB 3PL6A 4Y5XB 3PWJA 1OTSD 4H1LG 2EXYC 2QTEA 2OK0L 4TSAH 5IW1B 1PZ5A 3ARZA 4OM1H 4CVXA 4XCEA 2NY2D 2ZJSL 4RMQA 1P6FA 2DI9A 3QZWB 3OBAA 4AEHH 2KZWA 3MFGB 3RIFK 3RP1A 1U2HA 2VXVH 5ESVB 2NY5C 5C6TL 4XNXL 1HQRA 4F3FA 4X7DC 1A6WL 4DEPC 4KKCC 4KK5C 3DGGA 2Z9TA 5J7CC 5H37H 1YNTA 1Z9SA 2BSED 3DHJA 3BRGC 3CH8A 3VD5A 1LO5B 1HH6B 2BDNL 4KKLD 4QXGL 3HUJF 2XOTA 1LEGB 4GRWH 2F8XC 1ZS8A 4O51A 5BV7L 3KPSB 1D9KC 4PJ8A 2YUWA 2M2DA 3OKEB 1NANH 1QFWM 4POZC 1ZKAA 2QV2A 5T1LA 1NAMB 1LO2L 3HZVB 4PG2C 2FIKA 1EA9C 4PLOB 5AYUL 2HFFB 3OQ3B 3KS0J 1W0YT 4H26A 2YUXA 2ZNWA 3PNWA 3TNNB 2YD6A 5T5NF 5EC2A 2MKLC 1RJZA 1F97A 5I1KH 1R24A 1GPOL 5E1HB 3QWOA 2ATKA 1JWSA 3UYPA 4PRPD 1OAKH 3NCEB 4FFVD 3IU3B 1SMOA 2D0HA 1KULA 1YJDL 1KB5L 3PL6D 3PQYE 3QNYB 3VFVA 2DQCL 3SQBA 1WIPA 4OFDA 4TSBH 1I3GH 4PJEE 4RWHA 5FYKU 3VMOA 1RK1A 3W5NA 2BRRL 2I07B 3W9EA 2PW2B 4LKCA 3KPQB 4UV4L 2ZCKL 2YR3A 3WBDA 2JCCF 4Y0GA 1EEUA 4OGYH 3MRRA 1J87A 1U41A 3IKCA 4NM8L 3BN3B 3G6JE 3VE0B 3UTSE 1IEBA 4JM2A 1CXKA 1WZLA 4Q0XH 2XTJE 3GSQB 3S34L 3E2HB 3GI9H 1PEZA 2PW1A 1LE9B 4XAWL 3T0EE 3W39B 2DYPB 2FD6L 4G6AC 4NQTA 4J3UA 1UVQA 1N4XH 4PJ8D 4PRAB 1CBVL 4Y89A 3TA3B 2HH0L 4I0CC 4TRPL 1A64A 1KJMA 4J7RA 5T1LD 3Q1SL 1W8NA 4ODHH 1HE7A 1JVKA 1JPTH 4LOUC 3G04A 3HNTH 4BELD 4PREA 4F15B 1D6EB 3T77B 3C08L 2VABA 1U8QA 4IS6B 2F5AH 1CZ8H 3UJIH 4JY5L 1I8KA 4QWWC 1LK2A 1OP3H 5K59E 4XNYH 2FX8L 1XF3B 2C1PA 3PIQB 5MERA 1OSPL 5KANI 5DJDA 1MHEB 5IVXB 4YXKL 2VLJB 1KNOB 1UM5H 4NZRH 2B1HL 4UDTA 5HGDB 5HI3D 4W6XB 3LDBB 3U7YL 2CLRB 1CL7H 2X40A 5B4MD 2XWBA 4XBPA 25C8L 5DD6B 2R4RH 1WFOA 2VDQH 1PG7W 1K8IB 5D1ZC 5EB9A 3BKJL 5K33A 1ODAA 1U8IB 4EVNB 4JANB 4RAHA 5FYKL 2FYYA 4JRYB 1AQKL 4XPAH 5DQJA 1QNZL 1TZIB 1AXSA 2FEEI 3JV6B 3MLSL 1GAFL 2XWTB 3KPSE 2Z8WC 4ESKA 3MLRH 3U46A 1DQQB 3QUZC 2GYSA 1B4RA 4PJXA 1M05B 1X4XA 2P49B 3MJGX 3T08A 3NZ8A 4JR9L 1A3QA 1E4XH 4N8PA 3JTSA 4NO2A 2I27N 5I6XB 2Q7YB 3U9UA 3WIHH 1S9XB 2MOVA 2H26B 3KPMA 4Y4FC 4Z7VB 2CJUH 4NCC1 1A6ZB 3U30C 4P23A 1CU4H 3O45B 1HNFA 3MV7A 1MLBB 3TWCH 2E7CA 1EBPA 5I73B 5JMOC 3IDXH 4FFZL 2CKBH 2W9EL 4GG8B 1R5IB 4LEOA 2QBWA 1FYHB 3MOBH 5EBLB 1GHFL 5C9KA 3CXDL 4WW2A 3ZHLA 5DVLA 2ICWI 5HGBA 2QSVA 5C0ND 3DBXA 1BOYA 1BJ1J 1EEQA 1XIWB 3RWCA 5KAQF 1IGIL 4U1MA 2QR0B 4ZO9A 5IBUB 4J3TA 3RWJB 1K6QH 2FZ3A 3PP3K 5DDHA 4X4YA 4H0GA 3QUMA 4KJWD 5IW6B 1S9WB 5FYJE 5I9QC 1RHHA 2AI0L 3LEVH 2VC2L 4ELMA 3RHWF 3O11A 5CD5D 4Z9KB 5KN5A 3PHOA 1FVCB 2DM4A 2YD2A 5T3XD 1U3HA 4NNXA 3K1DA 1U8LA 3UPRA 1P4BH 3HPJB 1XR9B 2ADIA 3V5KB 1NMCB 3CAFA 1BMGA 3OJVC 1P84K 3OKNB 1A6PA 4OCSH 5D70H 1HXYA 4U05A 4ELKB 2H2SD 1XCQA 2EYTA 1G6RH 2RBLA 4GQPH 3QZWG 5DT1L 1S7VA 4PRHA 3CSYB 5I8OH 2DQHL 4K7FA 5IMMB 3O3AB 3U0TA 3D87B 4P57A 3MV9A 4G8IA 1H3PH 5F21B 32C2B 4HPYH 1RZJC 4DKFH 5BZWB 4HUVA 3GIZH 3RRQA 5C07B 1MQKH 2DJ4A 4P23D 1AFVH 3EHBD 3MV7D 4KRNA 4ZTOL 3MACH 2OZ4A 4CN6A 4NRZB 4W68A 4HUMB 1H0DB 5IVXE 2JJSC 1RJLB 2VLJE 1IJ9A 3ARYA 5GGSB 3V4PL 2R8SL 2HT3D 4YFEA 1OQXA 3MJ8B 4URTB 2B0SL 4ODTH 4H88H 4YXLL 5JHDE 2NY4C 1FZKA 3TV3H 3WFZA 2FHFA 2GJ6E 3E6FB 5B39A 3QZWA 2AJSL 3DMMC 4OFPA 5ICYB 3TJHC 1I9JL 3GUTB 1N8ZB 2XPGB 4FXGA 5MEPB 1KJVA 5MP6H 2H3NA 3RDTC 3AVEA 3WXVH 2AXGA 5F3HB 3TCLA 1UA6H 1A6UL 5DJCA 5GZNC 3WJJA 4I13B 4NZTL 2HN7B 3BJLA 4JFYA 2EIBA 2YD8A 1U3HD 3VRIB 3GGWB 4Z7NE 3QUYB 3B9VA 3A67L 5DRNA 3ARGB 4U0RB 4U33A 2HAZA 2VL4A 1AGCA 3WEXA 2EDJA 4JFEA 4Y4FB 3D6GA 4R7DB 2GTZB 2AJZB 3L1OL 1INEH 1TDQA 3C6LC 3MRFB 1XGQA 5ITBL 1ZGLP 4K71C 1UKSA 1NAMA 3IXTB 4IRJB 3F6IA 3EYSL 3WJLA 2I9LB 5FUCE 1RVFH 4WHTB 1E27B 2CSPA 2OTWB 2I25N 4X6DF 3DYMA 3JVGC 2VYRE 5FKAA 3JV5A 3TNNA 3MV9D 4MA7L 3LHPL 1KOAA 2H6PA 4LARL 2E6JA 2R23A 2ZKHL 3CJJA 3FQUA 4P49A 2EDYA 1I1RA 4GSDL 1DFBL 4MXWL 3CZJA 5IEKA 1MJJA 4NHUB 4OV5B 2FNBA 1CDIA 5I17B 1BX2B 4GLRH 3SDAC 3IU3A 3RKDC 2W60B 4NBZB 2HKFL 4Q6IC 5DHVB 2OR9H 2AJXH 2Z35A 2IH1B 1FGVL 4O02H 4HUXB 3WO3B 1Q1JL 4X5XB 2NQCA 4YZFE 2F54B 1VENA 5DJ8A 3WS3A 4CNIB 1QKZH 3WNOA 1INQB 5BO1L 4OJFH 1AGEB 4YPGA 1SYVB 2DLGA 1F4WL 2Z92A 1DBAH 2OJEB 4XCYB 4LP4A 2Z8VC 4UQ2B 1G7PB 4HCRL 4JFFA 4HHAB 4GAJL 2VDRH 1OVZA 4Q9CA 5JW4M 1HHKA 3ROOA 1MCKA 1QFUH 4MAUH 3WS6C 1RUAH 1I8LA 2J88L 1EGJH 2QSCL 4FQ2H 1ZLWK 3PJSB 3CK0H 1NCBH 1ZHNA 3NCFB 4L4TA 5J12C 3AUVA 4WY7L 3W11D 5IKCB 3U82B 5DJZA 5TDNB 2AK1L 4GRLA 4JFED 4RGNB 4PBWD 4TOYL 3QXDB 1B90A 5C07E 1CGSH 3R1GL 5I76B 1F5WA 4KAQL 4EN3B 4D9QD 3OL2A 4Z7OF 4XAKE 5KVGH 3KPNB 3HE7C 5ILTL 1FO0A 4XP9L 2NY4B 1LGVA 1A1NB 4X4XB 1OTSC 3PGFH 1U6AH 4G8GA 2DLEA 3NPSC 5DQDH 2GJJA 1CLOL 3PIQA 4I8DA 4BZYA 3T4AB 4G42A 2NY2C 5FB8B 2ZOLB 3RDTB 2UWEB 2N56A 4MZ2A 2DN7A 1QA9B 3KGRA 2Z8RA 1SJXA 3IRZA 3O2VL 1AJ7H 4Z6AT 4WI5A 3SDCA 2X4OB 3LPGA 5J8OA 3NH7H 5D5MA 1VGEH 2P7TA 1QBLH 4HS3A 4O58L 1U95A 5KSUB 4JANA 4MJ6A 3GI8H 2DBJA 5HJ3B 4NGHL 5IMLB 2IGFL 3FT3B 4JRYA 3B9KB 5D1XC 3RVWD 5JPMA 1BJ8A 4EIZC 1LK3H 1TTFA 5E5RB 2D03H 4NBXB 1Z0NA 2NY3D 3IETB 4JFFD 5IBUG 3DARA 3QHFH 1GGTA 4YDJB 3HNSL 2PYEA 2Q87A 4Q9QH 4RA3A 4ZO6A 1JPST 4XC3L 4XWGL 1O0VA 5JORA 1S9XA 5JLZB 4L4TD 2IALB 4UTBL 4OD1H 2DYPD 3LMJH 4Z7VA 4P5MB 1F3RB 5C8JB 1MCEA 3S7GA 1IGYB 3FCTB 3L3GA 2VMFA 4IMKC 1QSEA 3VCLA 1ZGLB 43CAA 4RISH 2HRLA 3ECBA 4F9LA 1R5IA 4Z7UB 3L3KB 1VEOA 4GQ9H 5L88H 3PL6C 1CG9A 1KTDA 4OT1L 3VXUB 2YBRA 1R6VA 3P0YL 1KN2L 2P48B 1WAAA 2F54E 3C2SA 4OCXH 1IE5A 4WNQA 2YD9A 1YNLH 1A6TB 5E6YA 2WAHA 1S9WA 1WK0A 5JIHA 3SE8L 2AK4B 4M5YL 1PKQB 3ULUL 1FFOB 1KN4L 2X6MA 4NZUL 3ZYOA 5CLTA 2H32B 1ZA6B 1HN1A 4JRXB 1FVCA 3BD5A 1NFDB 4RBPH 1I8MB 3LEYH 2V9RA 1YEHH 4JO2L 5DK2B 4FXKA 2DQJH 1N64L 1ZLSL 4JKPL 3ZE2E 2X1PA 4F7PB 5IWLC 4GG6F 4QCIB 5D2NB 1G7QA 3T0WA 3BSZL 3I9GL 4ELKA 2RCSL 2ATPB 2G2RA 4JRYD 3DSFL 5CEZH 2CIKB 5BRZA 3GMQB 1U92A 4PJ8C 4LGPB 4RGNE 3O3AA 1E4WL 1KCVH 1ND0B 3B43A 4BFEA 1C8PA 3HE7B 3RL2B 2PYED 5C2UB 4KQ3H 1IAIH 1T7YA 2FJHA 1UWGH 4JO1L 32C2A 3IJYB 1T5WA 1FN4B 3NFPB 1BQHB 3CFEB 3UZQA 2JF1A 3PWVB 4LSQH 1GYAA 4L3CA 3KYMA 3MXVH 3OGOE 4XP5L 5IHUH 3WFBL 1OSZA 4AG4L 1QSED 1RJLA 3CX5J 4YDKL 4N0UB 5IHLB 3O3DB 3MBXL 2UWEE 4Y88A 4K3JH 2F15A 2JK5B 1NC4A 1ZOXA 1GGCH 4D8PB 4HKXB 1RIHL 4JG0L 3PUCA 5E24E 3VFMA 1QFWI 2VLMD 2XN9B 2G75A 4P2YA 1IL1B 4EDWL 1XIWD 3TBTA 5JQ6L 5TPWL 1JJUA 5D1XB 1A7PH 4NWTL 3KR3H 4TUKH 5EUOA 3ARDB 3BOVA 5F3HA 1N6QL 5EZLA 4OD2A 4B41A 1BVKB 2WBJC 3HZMA 4M7LH 4N8CL 4QRQA 3QSKB 4OZFB 5KS9E 5EIVA 2EKJA 4E42B 2HT2C 4NKDA 4JG1L 1TTGA 1XGUB 3GGWA 5TDOB 5I0DA 3IAGC 4PB0H 4WW1A 3VGBA 1IM3A 1TJHL 1HKLL 4XBGB 5C0FB 3V95A 3LQAH 4GRWF 4JM2C 3RUGB 4GRMA 5ALBL 1ZEAH 4PTUB 2GTZA 1T1ZA 4EKXA 3FQWB 4GUPA 1L0QA 3B2VH 1BGXH 3IXTA 4IRJA 3K8MA 3WCYA 5DJ0A 1T0PB 1E27A 2WZPD 2AXJA 5CILH 2CLZB 1SBSH 3O2WH 5I8EA 4D0CB 1S7TB 1KBGL 4NKQB 2YRLA 1A3LL 4N8VG 1IBGL 2P8PB 4YHZH 5AAMA 3Q6FA 5C3LD 4Z7UE 5ADPL 3FFCA 5I8KL 3BWAB 3DXAB 4AT6B 4NHUA 5D2LE 4XPHL 1MFDH 2ITDB 2IWGA 4BQ9A 3VXUE 2NLJA 4W6YB 1JCKA 1UWXH 4XXCA 3BMVA 2AABH 3MRHA 4HUXA 1DQJB 4X5XA 2WW8A 2WUCH 1FCCA 2AK4E 1WZKA 2OBGA 2WWMD 1YUHB 2DTSA 3M45A 1NC4D 1PKQE 4MD0A 4CNIA 5CGTA 1UXSA 4MNQB 5JTWA 3BIKB 4JRXE 3NIDF 1T4KA 3DX8A 1OWWA 3MRBB 1BFVH 2J5LB 2ZCHL 2E8YA 5DVNA 5HI5D 4XCYA 4UT9H 1T04B 1G7PA 3NBNA 4LRNH 5CKGA 1Q94A 4N8VA 5D2NE 1ZK9A 1KPUB 3OGCA 1N3NA 1HKFA 1MH5B 5F1IB 1J10A 3IAPA 4S1QH 5I0ZA 4RAVA 3JV4A 5ACLA 2FO4B 4U6VL 3RNQA 5HYIA 1OAZH 3SO3B 2E7HA 2Z93A 4ODWA 4OD3H 3ZT5A 5IV2B 3QJFA 4QEGA 1DZBA 3PWUB 1F6LL 3HTLX 4M8QA 5HY9B 4PGCB 5CSZB 3AGVA 5I76A 4GKZB 3MREA 3L95A 4P23C 4IRJD 3KPPB 3KPNA 1QO3B 4PJGA 3W9DB 2R15A 3REVB 3F7VA 2IAMA 2CK2A 4N0UE 1X44A 2HT3C 1G7HA 1X5YA 5IVOA 3QEUA 3FFCD 3W81A 1KJ2B 4F37K 1J5OH 3QA3B 3MRMA 5FB8A 3UTOA 3MMEB 1D5ZB 3AY4C 4OI9A 3F6LA 5CUSL 2XN9E 3ZDXF 2ZUQB 3SE3A 1DDHA 3IVKB 4XRCB 1VPOL 3FQRA 1OD7A 2X4OA 4K3GA 4KROC 3SQOL 4MJIB 4Z95H 4QXUH 3ULSB 1OGAB 1MRFL 3EOBB 1SVCP 4HLZH 5DMIH 1RULL 1ZHKB 4MNGA 1MCJA 2EKSA 5HJ3A 4K9EC 3UEZA 1KCSL 3BP7B 4ONHA 1BVLB 2X10A 3FT3A 4KJQD 3QNXB 1CFBA 1FSKB 1L7TH 1U8KB 1WIOA 5GHWL 3RPIA 1SJEB 4MLSA 3RUGE 1JMZA 4I9WD 3HR5B 3IETA 5I1HH 2VLKB 5CP3H 2AXFB 3NFSL 3N9GH 3VH8A 4KK9C 1A7QL 1A7RH 3V5HB 4GW1B 3SEPA 2JJUA 3WFHA 5T1KB 1NC2B 1CLYL 4P3DA 4EXPX 3QRGL 1RK0B 1YEDA 4S1DC 1MLCB 3CD4A 1LP9B 4KJYA 4GH7B 3TP4A 4M7KL 1IGYA 4HMCA 3GNML 3O2DH 1EPFA 3W0WA 3DXAE 3HZYA 1R3JA 3LZFL 4RDQF 1HH9A 5TE6H 1VFAB 1NCUA 1F58H 2NW2B 4I2XA 4PJ7F 4LDLB 1G9NC 1R0AL 4ZFOL 5F97E 2E8ZA 4UNVA 3MC0A 2WNGA 3QHTC 1QSFA 5D72L 1FBIL 2FGZA 1KEGL 4ZDHA 3S37X 5T3XL 1A6TA 1F02I 2EDXA 3GMPB 4MNQE 5AZEH 1NGYA 4JPWL 1MIEH 4LQFL 1TTUA 3ZMRA 3RNKB 4LPXA 4JFPB 4X6FA 4YR6A 1SYSB 4QGTA 2VDNH 1NFDA 1I3VA 2DI7A 4LPYA 2OI9C 1VADA 1KC5H 2R56H 1MCPL 1P4IH 3WJJC 3GSWA 1SY6A 3OAZH 4TUJB 3LH2H 2PO6B 1H3VA 5ISZB 1WWCA 1HZHL 4F7PA 3TO4B 1MFAL 1ERNA 3GMMA 3LRSB 3IU4H 3UZEA 4U1JA 4L4VB 5T33H 2NTSP 4IRZL 2APTA 1CQKA 2NX5A 3ALXA 3BQUB 3B9KD 4G80A 2LAAA 3S4SG 4DTGH 5HYEA 5E2WH 3GMQA 5I1DB 2R0ZL 3MUJA 4L8DA 4HK3N 5HYSG 4P4RA 3ZTNL 3CFIC 5CMAB 3NCCB 4QRPB 2OK0H 3STLA 3RL2A 4GS7C 3CFCL 1Q8MA 4JFOA 5FA3A 2XICA 3WJLC 1CT8B 2ZJSH 4JDZA 4OZFG 4AMKL 2EICA 5GSVA 4POYA 2APBA 4NZDA 1Q9KA 3WFCL 4JGMA 1NCCL 2DOCA 4XNXH 1LEKB 5C6TH 1A6WH 3QIWB 2JB6B 3CX5K 3W0WD 1I85A 1GL4B 4XH2A 2BDNH 4QXGH 3O3DA 3LN5B 5IK3A 2CDEA 4KQ4L 2FJGB 2LU3A 1RUMH 3GSNL 3N1FC 1AGBA 1LVEA 3S4SA 4D0DB 5BV7H 3QEGL 2GK0B 1H3XA 4MWFA 3G5VB 3K7UA 5HYSA 1QSFD 3KWWB 1OGAE 2NXYD 3GMRB 5CJ8A 4OZ4A 3EIFA 4HC1L 1IM9B 2GHWB 4WGVB 2X70A 4QXTB 1LO2H 3UAJC 3P9LB 3RVWC 5D7KD 2R1YB 3V4VL 1KXQE 4P5TA 5AYUH 4BFIA 1MPAL 4JRXD 2NTFB 4I3RL 2V5SA 1HSBB 3FZUD 4XBGA 3Q2CA 2FEDD 4LF3A 1GPOH 1ZMYA 5TDPA 4PTUA 3EYQC 1I8LC 3ARFC 3ARPA 1K85A 4LCIL 5IBLD 2NX5D 3EOTL 5IR1B 3BRFA 4K94C 5JOFA 4R26L 4ODXB 1YJDH 4GRLC 1Z5LA 1ADQL 1KB5H 3QFDB 2DQCH 4O5LL 4AK1A 3R4DA 3N1GC 1AY1L 4O9HL 4JFXA 1FNEB 2BRRH 1VERA 4IJ3B 3HI6L 4UV4H 2AQ2A 2ZCKH 2X4NB 2X4PB 1T89A 1FV1B 5K9QI 2R2BB 1HINL 2YD1A 4LLQB 1WJ3A 3QIBC 1QACA 4OCNC 5TF1L 2F8OA 4NM8H 5I1CL 1CD8A 3QDGA 4ACPA 4JPIA 2ID5A 2ZUUA 1UZ8A 3MJ9A 3N1MC 4HULB 2OI9B 3BE1L 4PLJD 1FNHA 1A1MA 3BVNA 3S34H 2ADFL 3SDCC 4XAWH 1B2WL 5F7KC 3UJTL 2FD6H 3HUJB 3TO2A 1A9BA 2XN9D 4IDLA 2DICA 4NHCL 1CBVH 4Y19B 3DHMA 1DQML 1U8OB 5GGSY 1RJCA 3UTZA 1T04A 2HH0H 4XHJD 3RVTD 4QYOB 5ISZE 1CGUA 1ETZB 4TRPH 5IOPB 4S10A 2VZSA 2VIRA 3Q1SH 1ZLVK 2BSRB 1SMAA 2JJTA 1KELH 4C57C 4L4VE 2LE9A 4DVRL 1NFIB 5E8OA 3EYVA 4P5TD 1H3UA 2O61A 3C08H 3HZKB 2DJUA 4N5ED 1OTTD 4JY5H 4M1GL 1QQDA 2NZ9C 3DROB 5DRWB 5KW9L 3MYJB 2IPUK 2FX8H 3DVGA 4QRPE 1MWAB 1OSPH 1NAML 2VISA 2HLFD 4YXKH 3O9WA 3T8XA 3K80A 3PWUA 1U42A 3C5JA 3H9SB 4ZSOB 3DV4A 2B1HH 3KYNB 2MCPL 3NPZB 4UTAL 4GKZA 2C1OA 4QRSB 3U7YH 4ODSL 4L8SA 4BKLA 2ICCA 25C8H 4JDVA 3REVA 1JGEA 2MQ0A 3BKJH 3RQ3A 4F9LC 1KIPA 3MBEB 2Q76B 2NR6D 3TM6A 5FYKH 4ENED 1HHGB 2OJZL 2I9TB 3BGFC 1AQKH 12E8L 1F3DH 4GW4A 1QNZH 4BQ6A 2WSKA 2APVA 3MLSH 1GAFH 2D9QB 3AS3A 2IPKB 5CGYD 1R5VA 3QQNA 5FF6B 3H3BC 2APWA 3ARBC 1JUFB 3QDGD 4MJIA 4JY6B 3ULSA 3O8XB 1RIUL 4JR9H 4N9OB 3TF7C 1A7BA 4RCAA 1J9CT 1B0GB 5JOEA 2FH8A 1ZHKA 2AGJL 2AQ1A 3GMNB 4BA8A 2OYPA 4O2FB 1BVLA 5IB5A 2W9DL 3ARFB 1YQVL 4BUGA 4IIQA 3CFDB 4IRSB 1AHWB 5CGMA 1KSRA 3TYFB 5JA8B 1S7WB 3FB6B 4FFZH 4JREC 1AD0A 2E27L 1NUNB 4NQCE 1NJ9A 4NT6B 4RMUA 2W9EH 4J3XA 2VLKA 4I0PB 3RI5K 1BD2A 2IQ9L 4DWHA 5FKPA 1U58B 1GHFH 3CXDH 3OXRA 1R3KB 2R9HC 3DIFB 3P3YA 4PJDE 4PV8B 3VFRB 3PHQB 3EBAA 1NCWL 3CDGB 2V2WA 1IGIH 4OI8A 1NC2A 4R0LB 2F74B 1LP9A 3QIBB 2ZSWA 1LWRA 5JW4R 2AI0H 1NLDL 2VC2H 2QKIA 4HX1A 1FNLA 5E6IC 1VFOA 4NRYA 4P9ML 4OZGF 2IMMA 3VDCA 2BCKA 2NW2A 3P9MB 2CKBA 3EGSB 4UU9A 4F2MB 3BEWA 1JHKL 2L7UA 3PGDA 5J3HC 2WWMC 1T20A 1D5XB 4ISVB 2MMXA 5JR1L 3D5OF 3FO9A 3PWNA 4LLUB 4XC1L 5DJ2A 4MA3B 5DT1H 5DD3H 3HUJE 4OGZA 4Z0BL 1V05A 9CGTA 4WFGD 5ANMB 1F8TL 2DQHH 4Y19E 1MCWW 2NY6B 1XF2B 2IANB 2OQJA 2MFNA 1GC1L 4MJID 5D1QA 3NN8B 4DQOL 5DWUL 3BP4B 3L3DB 1WC7A 1HOCB 2PO6A 3C5SB 3LN4A 1JZ5A 4QLRA 4ZOBA 5H35B 3VMPA 2J6EA 5DYOB 5GS0D 5IHZB 2FATL 4UNUA 3BQUA 4QRRE 1H8NA 4ZTOH 4OCRL 3MV8B 3PE9A 5FHBL 1DP0A 1G6RA 2COQA 5L9DL 3NIGF 4R4NC 4HKJB 5EO1B 3S98A 1MCSA 2PUQT 2JIXA 3V4PH 1R3HA 2XFXA 2VLKD 3H9SE 2R8SH 2WINA 4ZSOE 4BH7B 3C09C 2B0SH 1FJ1A 4YXLH 1T7ZA 1Y6MR 1CT8A 1JFQL 4H20L 5L2KB 1AP2A 3WNLA 2AJSH 5LGKA 5DJXA 3REWA 4PRDA 3BZEA 1I9JH 3OR7B 4PJHF 3BGFB 3U36A 1NC2D 5DLML 5LVEA 3VXRB 1A6UH 2DL9A 4P59L 4XBEL 4NZTH 4UOJA 4XNZB 2E9JA 3HPLA 3T1FB 1EBAA 3ARBB 3LN5A 1DUYB 1ZV5A 1YPZF 4HWUA 4PGBA 4DK3A 3CUPB 1CFVL 1JHLL 3A67H 1JYVA 2CDGB 3DWTA 1HQ4B 5LG1A 2JCCE 2CRYA 4X4MA 5DSCB 4JGUA 2SEBA 4WCYL 5D9SB 1ZT4B 3KWWA 3RZCA 4YPJA 1YMMB 2WIMA 4HS6A 3L1OH 3DV6A 4PJAF 1KPRB 5ITBH 3KPLA 4AYFA 1FG9C 3ZDZF 5BS0B 4KJQC 1KLGB 3P9LA 2VR4A 3EYSH 3GSXA 3ZHKA 3X14A 2XQBL 4WVRA 4YUEL 2BSTA 2NTFA 3CIQA 4XZUB 1T03L 4MA7H 5D1QD 3LHPH 1CDCA 4LARH 2WUBL 5EU5B 4HG4J 3CCHA 2ZKHH 3VG9B 2PO6D 3PDDA 3VXSA 4GSDH 2VE6A 1DFBH 4MXWH 2YUVA 4ZQKB 3D18B 3KDMA 1KEML 4P46A 3BQUD 4FMKA 2LABA 3SKMB 1OPGL 2WWKT 2HKFH 1J05B 1GGBL 1FGVH 3QCTL 3U0PA 4OAWB 1Q1JH 1XF4B 5HPMA 1A3RL 2JIXD 4QRPD 4HIIB 2OL3B 4N0CC 1FNGB 2FR4A 2ZPKL 5BO1H 3FMGL 1N5AB 2ICES 2RIKA 1OAXL 4NOFA 2AS5M 2X4PA 1F4WH 3IDGB 4LPVA 3GSRB 5FYLE 4L3EB 2IAMC 4P9HL 2X4QA 4HCRH 3QIWD 4G9FB 3QXWA 1NBYA 4GAJH 4EI5B 3M8OL 5T5NG 1PY4A 5GJTL 3GJEA 1A8JH 1BWWA 2W65A 4LVOB 1VFBB 3VFUB 5KG9B 3QG6A 1EZVX 3ROLB 4F33A 3RWIB 2J88H 2QSCH 5ANME 3SE3C 6CGTA 1CFNB 3QH3A 4IOIB 4G6FB 1CE1L 1KCRL 3I75A 4Z5RB 3WHXA 4WY7H 2IANE 4U1HB 4L8BB 2AK1H 3CFJA 5EDXA 1FFQA 3RZCD 4TOYH 3HLAB 4LCUA 2VB5A 3PG2A 3SDXF 1IM9D 2Z8SA 1WBYA 2LVEA 3R1GH 1EFXA 4QNPF 2G9HB 4KAQH 3QP3A 4M93B 1RUPL 3LQMA 3HI5L 3DECA 1HHHB 4OFIA 4XPTL 2XYCA 2DD8L 1CGXA 5ILTH 1G9EA 1HEZA 4XP9H 3HRPA 5A40E 3MV8E 2HRPL 2DI8A 3SGDI 4XVTL 1CLOH 4FFWD 4TNVF 4X6DB 5GSRA 1MWAA 3T2NL 4EQ2A 1EGJA 5IROA 4LLMB 3VXSD 4CMHC 1FPTL 4TUOA 3P4OA 4NQEB 4ZNCD 4JGJA 5L2KE 3KYNA 4P46D 4TTDD 3MRQB 3O2VH 3RWDB 2EYRA 4QRSA 4GO6B 2BNRE 1DN0A 3MFFA 5HSFA 4WDIB 1RZ8B 1S9VB 4LSPL 4HGMA 3VXRE 4MLIA 5HYQA 4JJ5A 1R3LA 4O58H 4KXZI 1OP5K 2HJLB 1F3JA 1Z6JT 2W0FA 4NGHH 4S2SB 3WFDL 1HHGA 2I9TA 2IGFH 4J4PA 2Q86A 4C56B 5J57B 4N1HB 1YZZA 5LGJA 4DN3L 1ACZA 4WWKA 5DEGB 4KRPB 4M7JL 4N0FB 5KVDL 5FF6A 8FABA 1OAQL 1ZHBA 4RMRA 2JJVA 3HNSH 1X5GA 1FIEA 2D0FA 3MLVL 4LDOB 5CINL 4XC3H 4XWGH 2VWEE 1Y18A 2Y6SD 3VW3L 4UTBH 1U91B 4O2FA 3FZUC 4UB0L 4KH2A 4IRSA 4Y19D 4JZNA 5EU4B 3QQ3B 3TYFA 1S7WA 1YDPA 1JGVL 4Q7DA 4Q9RL 3MRIB 2CKNA 1KTKE 1EFXD 4KMTL 2R0WL 5IFAL 4I0PA 1C5DB 2ED9A 4PJCA 3LD8C 4MA8L 3BKYL 5T5FL 1W2KT 3QO1B 4WHCA 2HJKA 4LPWA 3V6ZA 4OT1H 3SCMA 4RIRB 4D9RE 3OPZL 3MGAA 5E7FA 3P0YH 4YDVA 1KN2H 4R0LA 5D6CA 3SE8H 4M5YH 3X12B 4M61B 3ULUH 2A73A 1KN4H 1DEEB 4NZUH 4L3EE 3S97C 3EGSA 4JO2H 3V6OC 1Q9LB 4G9FE 3BWUC 5IB2B 1N64H 1ZLSH 4JKPH 1BP3B 3HCVB 2GK2A 4BSVB 3U7WL 3BGAA 4HWEL 3MBED 4GBXB 3BSZH 3I9GH 2RCSH 1F6FB 3EYOB 3VD4A 4X6CF 5IW3A 3DSFH 3TIDA 2DJSA 2XT1B 4YGVB 3KLAB 2AAVA 1EV2E 3VFSB 5KSBA 4WWKD 2DS4A 1E4WH 1DCLA 2Y06L 1CIDA 2D31A 3QG7L 2R2HB 3BP4A 1P5UA 5CEXB 4JO1H 3ILQD 2F19L 2VQUA 3RVVD 1JL8A 4MD4A 5IFJB 1FL3A 2CR6A 4NQUA 4OLZL 4PRBB 1C5CL 4Y4KC 3FQNB 2AV1B 3BI9X 4H25B 2B2XL 4IRSD 1P2CB 5BOZG 4X6DE 2DQGL 4XP5H 3WFBH 4MJ4A 4AG4H 1U8NB 4YDKH 3RL1A 2FWOB 2EDWA 3MBXH 1PD6A 1NDGB 3OKKB 4I0PD 4U7KA 3T65B 4BH7A 2GSGB 2VOTA 4Y16A 4CW1A 2R1WB 4S1RL 5E56A 4AENB 2P5WB 1BLNB 1HILA 1RIHH 4MDIB 3WHE0 2VDOL 2KZ1B 3HRZB 4JG0H 4HJ0D 1F00I 3BO8A 3IDNB 3U4BL 3SCMD 3TN0B 3ALWA 3MLZL 3QAZB 3OR7A 5FXCH 4EDWH 3TZVC 3C60C 1QYGH 5JQ6H 5TPWH 4QOKB 4ETYA 5LQBL 3NA9L 1ORQA 1KG0A 4NWTH 3VGHA 2A0LD 5AZ2L 4IM8A 4Y1AB 4DK6A 5ENWA 4OTXL 3BN9D 1N6QH 3ISWA 4HAGA 4G9DA 3VRJB 4FA8A 5DEFA 4N8CH 4WFEE 4C56E 4YHNA 2J3SA 3AB0C 5DEZA 1DUYA 5CJXC 4YWGL 2MHAB 5TQ2L 3V2AR 1VCAA 4JG1H 4HWNA 1CFQB 2XXMB 3LVEA 1PSKL 2HTKD 1KT2A 1TJHH 3QDME 1HKLH 3AS0A 3ZZ1A 5DSCA 4DFIA 3OJMB 4CMMA 5D9SA 2PXYC 4LNRA 5E99L 3RGVB 3LRHA 1YMMA 2O93L 1GZQB 4NUJB 3ZE1F 4PR5B 1MHPL 3H3PL 2AEWA 2G5BB 4PJ9A 4BQBA 2YUZA 5GISL 3AS1A 2BVOA 3C8KB 1UYWL 2NY6D 5HHOB 3JTTA 1JTTA 1KBGH 3LD8B 4HG4K 3TBSB 1A3LH 2JJTC 4R3SB 1IBGH 1D5MB 5ADPH 5I8KH 1TENA 4XNQA 2DWEB 3CFKA 3D18A 5C09E 4XPHH 3RHWK 1T0NB 1H15B 5C70A 4PJFA 4KK6C 4Y4HC 4WI2A 3O9WC 3NA4A 3SGDH 2Y4SA 1RHFA 3MGTA 1FNAA 5CEZD 3FOMB 5GGVY 4K2UL 5JMRA 5K9KB 4Y16D 1YNKL 3GSUB 1HK6A 5EZOL 1P7QA 2A2QT 1C5BL 4JY4B 2V2XB 3T4YA 3F7QA 2DMCA 4H5SB 3IDGA 2ZCHH 4YHML 2V2TB 4V1DB 1IAKB 3UYRL 2YS4A 2F9BT 4JDTL 3OB8A 3IDIB 4KXZH 4EI5A 1X5ZA 2V7NB 1E6JL 1HCVA 4R96B 5J1AA 4U6VH 3ROLA 5EBMB 1HYRC 4H1LH 3VFOB 3K2MC 4OF5A 1LO0L 4Z5RA 1MRDL 2JTDA 1MCDA 4KHTL 3CX2A 3T2OA 4L8BA 4CU8A 4Y4KB 2XA8L 1CDUA 1KXTB 1YMMD 1EHXA 3IDMB 4EBQL 1ITCA 4EDXB 1S5HB 1JGDA 4GRWB 1J7VR 1OM3L 5BS0D 3BUYB 2P8MB 2YSSB 4PJ9D 1W0VB 1HHHA 3BPLC 2Y5TB 4FFYL 4OQ1A 1PW3A 2R39A 3UBXA 1W72B 1U3YA 1MCHA 2FBJL 4F57L 3G6AB 4GKSB 2P1YA 4JZOB 3SE4A 4NFBA 4L5FH 1CD0A 3IFNH 2P5WE 4NQEA 1FAKT 5EU7C 2DWDA 2VRAA 3HE6A 3SDYL 5JIPA 5CUSH 4MX7B 2ARJB 5TE4L 5C7XL 3BRDA 1VPOH 4QOKE 5DMGD 4F7TA 3SQOH 1S9VA 3VA2C 4ZUVB 4Y1AE 1UGNA 4UIMB 1MRFH 1KYOJ 1RULH 1GGIL 1P7QD 4LSRL 1Q0YL 4R90L 4M4RA 4OCYL 4S2SA 3SDDC 1KCSH 3CLEL 4OLXL 1X5LA 3QULA 3QUKB 5GGRB 2P24A 5LAXA 3MJ9L 1DBJL 5GHWH 3FO0L 4JCLA 2FHBA 4YBLC 5DD5H 5F1KC 2A6IA 3A6OA 3W2DL 1ES0B 4U1KB 5E8NB 3E8UL 3P0VL 5C08E 2XWJA 3MRPB 3NFSH 3D39A 4EI5D 2FX7L 3FRPA 2X9YA 2HTLD 3SKJL 1NH6A 4PRIA 4CVUA 3OB0K 1A7QH 2C3WA 4GG6E 1TVBA 1YMHA 3QPXL 4OGAD 4QRTA 4Y8DC 4HIEA 2GT9B 3FOLB 4HWZB 4YIQA 4P2QA 5HHOE 3L6FB 1CLYH 3D3VB 4JB9L 5D1QC 3PHSA 3QRGH 4E41B 3ZL4L 3PABA 3CC5B 5ERWA 4C54A 3QT2A 4M7KH 3GNMH 1YEKL 1KFAL 4Y4HB 4NIKB 1LMKA 1IQDA 3LZFH 3RVUD 2YZ8A 5I2IB 5IJVB 1C5DA 1NEZB 2WLYA 4KI5D 1G7IB 5ETUA 4QT5B 4NC2B 5CP3A 1FG2A 1R0AH 1MELA 3IF1B 1AC0A 3HAEG 4PUBL 4PP2B 3C5ZA 1CFSB 1Y6NR 5D72H 1E0OB 2EECA 1FBIH 5EC1B 5DHYB 1KEGH 1K3ZA 2WP3O 3V6OE 1BIIA 3CMGA 5T3XH 5BJTA 3WDHA 4X9GA 2KUTA 3S88L 4NQED 2C3VA 4JPWH 4LQFH 3HE6D 1IKFL 3V8CA 3F12A 1DEEA 1S7UA 4LGSB 3O2DA 4V1DE 4LCWB 3MCKB 3P4LA 1KJ2L 1Q9LA 1ULVA 1JN6B 4JFQA 4QHNA 2J8UF 5IB2A 1MCPH 2M26A 3FFDA 4BSVA 1HZHH 4MQ7B 1MFAH 1FE8L 1LE5B 3EYOA 3WIFB 4IRZH 4FQQA 2CUMA 1SEBB 2D7PA 2YPKA 5EULV 4YNYB 3MGOB 1CTNA 4KUZL 3UMTA 2R0ZH 1MI5A 5EBWA 1I7RA 4KRPD 3RZCC 3HAEA 3ZTNH 5HGHB 4NNYA 3D39D 3RY5A 1KLUA 3CFCH 5GS0L 4GRWE 1CDGA 3QUXC 4PRID 4KDVA 1MCRA 1TNMA 2A6JB 3DRQA 2Y9RT 3WMSA 4JLRA 1M7IB 4AMKH 4PRBA 5HHPB 3IB4A 4MSWA 3O6FA 3WFCH 5C0IB 4P2QD 1C1EL 1NCCH 4HUUB 3BEVA 3G5ZB 3EFFB 3V0VB 1FDLL 4FQHB 4B5EA 1DL7L 1DBML 4AZ8A 1KIRB 2CO7B 2C4FT 1IFHL 2VDLL 4NO0B 4U1IB 1JNNL 4KQ4H 3OX8B 4P46C 5H94A 3T65A 4RAUA 4MMZC 1P9MC 3KLHD 3DVIA 3D85B 3GSNH 3LQZB 1KCLA 4IOSD 3HRZA 5CWSA 3DVNB 3DYPA 3IDNA 3S5LB 1VACA 1T3FA 3C5ZD 2J8HA 3SDDB 2MNUA 4PJ7B 5J89A 4Y5YC 3S96A 5FO8B 1JPFA 4G6JL 4IMLA 4FQIL 4HC1H 4YBLB 1OF2B 3ZDYF 5IB4B 3X13B 5FGBA 4Z0XA 3GHBL 2KKQA 5JDJA 3V4VH 4PG9B 4AH2B 3AS2A 1MPAH 2MHAA 1T66C 2OR8A 3NIDE 5JIIA 4I3RH 3KJ6L 5IM7A 3IS0X 2VXSL 3VJ6A 3ILPB 5CKAA 2XQYK 1RFDL 3HB3D 3CGTA 1YY8B 4S1SH 5ESQA 4QTHA 3I6GA 4GBXD 3LKRB 1WWAX 4LCIH 5HVHC 3EOTH 4YFLI 1PQZB 4XP6L 3MJ6A 4LHUB 2G5BA 3D3VE 3ET9F 4R26H 5FA4B 4AY0A 4YBQD 4E41E 1MI5D 5GGVL 2Z91A 4HZLA 4O5LH 1YY9D 4U2ZA 4U3XA 2J6EL 3CPLB 1UXWB 1AY1H 4KRMB 3TBSA 4JFDB 4O9HH 1DR9A 2WIIB 2ZSVB 4LMQI 5JXEA 1WT5A 3HI6H 4DVBB 1KCKA 4FQPA 1BQLL 3O6FD 5I71C 3C6SB 1HINH 2CXKA 1BZ7B 1XZ0A 3I6LD 1I1YA 1OQOA 5TF1H 3BH8A 1TQCC 5F7DA 3MYZA 1B3JA 2HJFB 4P4KA 4PD4J 5I1CH 5HPOA 1V5JA 2C3GA 2GITB 2UY7A 3Q5TA 4I77L 2BXYA 3DX7A 4YE4L 1RAMA 2OTUA 2VLRA 1JPGB 1KB5A 3BE1H 1RZKL 1UEYA 2ADFH 4PLNC 5DGRA 1B2WH 4LCWE 3UJTH 1T6WA 1CFTB 1OY3B 3IJSB 5KOMC 3P77A 3HC0B 4NHCH 3ZDXE 3KNBA 1CD1B 4PJIF 1DQMH 3LPWA 4JQIL 3MJ7B 1VHPA 4RFEA 3HG1A 5K9OB 3OR6B 1KTLB 2X09A 4J4PC 4LLAA 4DVRH 3IDIA 1BFOB 2CLVA 4LCYA 1RZ7L 4OKDA 5JOPE 4TVSa 4LFHG 3VA6A 5J11C 4E0RA 3QUXB 1T80A 4M1GH 4NSKB 5MENB 3RX5A 5KW9H 5E2UL 4WI8A 1HIML 2FL5B 1A4KA 5IVZB 5FOBA 1NAMH 2OSLB 2Q6WB 2W91A 1BQUA 2J7LA 3QFJB 3SOBL 2AERT 2XZAL 3NAAL 5TH2B 4I48A 1RI8A 3K3QA 2C3XA 3FN0L 4EDXA 4MDJA 4JN1L 1S5HA 2MCPH 1GGYA 1YECL 2VITA 1QBAA 4UTAH 4Z7WF 2ZUTA 3AREB 4ONFL 4ZS6D 1FL6B 1W0VA 1J88A 1AO7A 4ODSH 3RVXC 3QEQB 2Y5TA 5EU7E 3IFOB 4XNUL 4Y5VC 4YK4B 3FT4A 4H8WC 5JUEL 1EO8L 3ULVD 4GKSA 5DZLA 3VXOA 3GJFB 1DE4B 2JELL 2OJZH 4UT7L 3L3HA 4P5KB 12E8H 4PJBA 4ZUTB 4J8RB 5E00A 4ZUWA 4HJ0C 4HXBL 4BZ1L 1NEUA 3SCMC 2HKHL 2R1XA 1IZJA 3H6JA 4LK4A 4PJ7E 4ZUSB 4P4KD 3WIIL 2A0LC 3CVIL 1FC2D 4HSQA 4OZIF 1A5FL 1KYOK 1LD9B 1SJVA 4ZUVA 2AVGA 1RIUH 3IJHB 2VLRD 1C08B 5A2JH 1NGQL 3DNKA 1EEYB 2YA1A 1NEZG 2AGJH 3I02A 1XH3B 4PRNA 2W9DH 1YQVH 1FP5A 1F90L 5J6HB 2X1XR 1MAML 2CQVA 3LB6D 2F5BL 2E27H 3HG1D 1T83A 2CH8A 5E2JA 1QTYT 2HFTA 2O26U 1TCRB 5ICXB 5D7SL 3D48R 4OCWL 4TVPD 2IQ9H 4DUVA 4KV5F 1T2JA 4TSCL 2D7NA 4KTEL 3ZO0A 2Z31B 5CP7B 4KTDL 1NCWH 4RFOL 2I24N 3L6FA 5I75C 1I1AA 3PP4L 4GAYB 4JFDE 4NQVA 2ZOKA 5J13C 2GAZA 3L7FA 2RJMA 1NLDH 1MEXL 5FFLA 2OM5A 4QF1A 5I2IA 1FYTB 1ZSDB 4P9MH 4GXVL 1MWAL 1AO7D 4PLKC 1G7IA 4QT5A 2VDKL 4M3JA 1NDMB 1MVFA 1JHKH 1CIUA 2BP3A 4KKBD 4KWUA 3RWFA 5EC1A 5KBNC 4P2RB 2Z4QB 5JR1H 3LPFA 5J6GB 4XC1H 3H0TA 1DVFB 1ZWIA 1E4JA 3BIAX 4LFHD 4Z0BH 3VGEA 1F8TH 4JZJB 4WU5B 4LKXA 4F7CA 3MNVA 3ULUF 3MCKA 3QO0B 1GC1H 3T09A 1JN6A 4DQOH 5DWUH 2HVJA 3FB8A 1EAJA 5I8CB 2VR5A 5IEHB 1BJ1H 1ZT7A 4G3YL 1LE5A 1I1FB 2ICWB 4XNMB 5FECB 5C6WH 4XVUD 3Q3GB 5GIRB 4O2CA 5MENE 2FATH 5CS7A 4HKZB 5AD0B 4ZO8A 3EO0A 3GMOB 4OCRH 3S5LG 3KYOB 5FYKD 4WHYG 5FHBH 3QFJE 5L9DH 5DMJB 4HK0A 3ESVF 4ZFGL 2VXUL 4NN6B 5I15L 1E4KA 2A83A 5E2TL 1T1XB 2A6JA 5HTSA 4PJ9C 5KSAB 1JFQH 3RTQB 1XCTB 2D7MA 1ACYL 1XGRA 4H20H 4JJHA 1M7IA 2D4FA 4PTTB 3QEQE 4TQEL 1HDMB 3QBTB 5C0IA 1I1AD 4U1LA 1TVHA 3LKOA 3NVQA 3JWDL 3U0WL 5DLMH 1EEZB 1P4LB 5ID1B 4ERSL 5GRVK 1HYSD 4P59H 4XBEH 5E8PB 3TGXA 3SY0B 1EMTL 3L3JB 4OB5L 3LQAC 4U1IA 2ICWJ 3FHQA 4ZPVB 4YHIA 1CFVH 1JHLH 4LHUG 3LQZA 5DMGC 4OKVA 3BHBA 1G84A 4UOW1 4OZGB 1T21A 5F1OB 4WCYH 2K9UA 5MEQA 4WUKL 5FO7B 3EO1B 5BXFB 2DB8A 5IB4A 3X13A 1IZKA 5FYLL 3P73B 4LCCB 4RNRA 2XQBH 5EU6B 4YUEH 4RGMC 1F2XK 5IUSA 3MOAL 1T03H 1OLLA 1U8PB 2DLIA 2WUBH 5EO9B 2P47B 2HTLC 1P7KB 5K9JL 2G5RA 3HI1A 3I6KB 5I75B 2HLAB 3MNZA 4OGAC 4U3CA 3NGBC 5JW5B 1KEMH 4UAOC 4NKOB 2B8OT 2D7OA 1OPGH 1PX4A 4LHUA 1JI1A 5E6ZA 1E6OL 1GGBH 3QCTH 4MA1B 2XG4A 1FIGL 1CLCA 1A3RH 3WNKA 5IG7B 4LU5L 5J4MA 1V7NL 3IXAB 1JF1A 1UM4L 4Z7QF 4PGDB 1FYTE 1WBXB 2ZPKH 3VFTB 4KI5C 2BZDA 2WIIA 3FMGH 5HVWA 1WQVT 1OAXH 2C5DC 1X7QA 2P8LB 2KPNA 3K4DA 1PEWA 4QY8A 1CF8L 1S78C 1S8DA 1K2DA 4P9HH 4WFHD 4YO0A 5E9DE 5D7LE 1G7JA 4LLVB 4NQSA 1URLA 4PD4K 2ICEB 4GOSA 4I3SL 1LNUB 4PJHB 2HJFA 1S5IL 3H7BA 3M8OH 1I7TA 2NY1B 2VQ1B 5GJTH 2V6HA 4LRIC 1Q0XL 3X11B 5JXAL 3BD4A 4R2GC 5ITFB 1TQBC 4JPVL 1XT5A 4LLYB 4M1DL 1CE1H 3MLXL 1KCRH 3OXSB 2UVFA 2X4RB 3IGAA 2MPAL 1WCBB 5DD0L 4ZAKA 1YPZB 3D0VA 1IGML 1CICA 5KVMC 4PV9A 3MRNA 5CFHA 1RUPH 4MNHA 3HI5H 1UWEL 4XPTH 4JQXA 2DD8H 2N1KA 5I1LA 3P0GB 5B38A 4PJAB 4WFFD 2X4UB 4OZHA 5KOVC 1Z9MA 3QPQD 5MEOA 2HRPH 4I4WB 2EEDA 4U6XA 3WNPA 3ZKMD 4WUUB 3L7EB 4XVTH 2QSTA 3B4NA 2CRMA 3VWKA 4TN9A 4EI6A 1J1XL 3T2NH 1WF5A 1WTGT 4Y8AA 2AKRB 1N2RB 1FPTH 1S7SB 2A1WL 3QHZL 4KKAD 5GGTA 5SWSA 1A1OA 2AJUL 4HFWB 3BXNB 2P42B 4LHUD 3U48A 5KANG 2H9GB 1CDBA 1UB6A 4ODBD 4LSPH 2P43B 3WO4C 4QHUA 2EDRA 1S7QB 1IAMA 3GSOA 3PV6B 4L8CB 1MY7A 4U6HA 5IF0B 3GJFA 3KLHC 3WFDH 2BFVL 3LV3B 5DHVH 2A6KA 2YD4A 4XPFL 2VUYA 4ZUTA 4ONOA 2GFBB 5JO5A 4DN3H 3MO1A 4JQVA 4OUUB 3C5ZC 1TJIL 4OZGE 2OL3L 4AM0B 3QQ9C 4M7JH 4C4KT 2K1MA 5HHMD 5KVDH 1OAQH 4WTXA 5F8QC 1KPVB 3B6SA 4DZBA 3MR9B 4OZIA 1LD9A 3MLVH 3QCUL 3TNMB 5CINH 3IAQA 4MAYB 3TBWB 2BOCA 5E70A 2BHZA 5JA9A 1PYWA 5DUBB 3AROA 3UTTB 5EORL 5EU6E 4DN4L 5B8CA 3VW3H 5B3NA 1DBKL 4UB0H 1ZHLA 2PNDA 5J6HA 3IFPA 3QB7C 4UAOB 1CICD 1U8HB 1JGVH 5EFIA 1NANI 3QDJE 4Q9RH 2MCG1 1TCRA 4KMTH 2R0WH 3PGCB 4BSWB 4YAQA 5IFAH 1NUFA 5L6YL 2P5EB 4MA8H 2HT4D 3BKYH 3SDXB 2YC1B 5T5FH 3QXAB 4G43B 1BFSA 2Z31A 1QBML 3LN9A 1FZOA 3OPZH 1RMFL 3S3SA 1ITBB