4LLQA

Structure of redesigned igg1 first constant and lambda domains (ch1:clambda constant redesign 2 beta, crd2b) at 1.42a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
99
Chain Sequence
b'ASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTGPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mutated CH1
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 99
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4llqA00
2FEEI 4ERSL 1RUKL 3DGCR 3EJYD 4KKLD 2R1YB 5F7EL 1JTOA 3FT2B 4N0YH 4QCIA 2IPTL 2J88H 4PRDA 2FL5A 1C16A 4QRQB 4HXBH 1FL3B 1A6PA 5DURB 5MEOA 1JGEA 4K9EL 5C2UB 3TIEB 5GGTL 4R90L 5IK3B 4QOKB 4OT1L 1V05A 4ZUTB 1MJ8L 5DD1H 4K3GA 3H9YA 2MJWA 1QSFD 3MRNB 3VMPA 1W0WA 2D7OA 3Q6GH 3QULA 1FGVH 3H3PL 1NBYB 1ZOXA 5EBLA 4L3AA 1YEFL 3D3VB 5GISH 1S7UB 5EZOL 1AC0A 3ARFB 5KOVC 2ZG3A 5ACZA 4P3DA 5DO2C 4H26B 1JE6A 1WBZB 4GG6F 1B4JL 5JQ6L 3DX8B 5C0RH 2VZUA 3MLRH 1VENA 1GPOL 4YBLB 1AGCA 2V9RA 3ECBA 1S7XA 3HE7B 4HQQH 2VLKA 3O2DL 3A6OA 2OJEB 4YE4L 3D25B 3NCMA 3O6MH 1H5BC 1HSAB 1GAFL 3U9PL 4FQ1H 3A67H 4HT1L 3GMMB 3KNBA 5D7SH 4JHBA 2VQTA 2WUBH 1G6RL 4PY7B 1FIGH 1H15B 4WTZG 4XCYB 5SX5H 5FA3A 5H37H 1EGJH 3CC5B 4K7FB 3S9DB 1NMCC 4KZEL 2OL3H 2R0LH 1NC2B 1S3KL 3O9WB 5KBNC 3DX7B 3MACH 2Q7YA 4WO4A 2EKSB 1FAKT 5J1AB 4JQXC 2J12B 4EBQH 2GAZB 1YJDL 5GSVB 4C54A 5INDB 5B21A 3VFRB 1MIEL 4PJFA 5FAAA 2YPVH 2G9HB 4ZO9A 5I6XB 1P7KB 1W72H 5JW4R 2NXYB 4LPWA 2NY7H 5AZEL 4L4VB 4LLVA 3N85L 4HK3N 3ZDXE 4URTB 4XNUH 5IK3A 1BGXH 1OLLA 3VXPA 1VEMA 3RWFA 2FH6A 3V6OE 1F8TH 4ELMB 3EYSH 2QL1A 1SQ2N 5DC9B 2CJUL 4UOW0 3NIGF 1INDL 4JQVA 1MFCH 1XGQB 3RZWA 1G9NH 1TZGL 1F00I 3C08L 3D3VA 3D85B 5BRZB 3BD4A 1S7UA 5IGXL 1JPGB 3DWTA 1U3ZA 2R39A 1B0GB 3ARFA 1KCRL 2RBLA 5D6CA 4H26A 3ZTNH 1WBZA 4L8SB 3TYFB 2X4PB 1UVQB 3HI6L 3VG0L 4Y4FA 3D25A 2I07A 1V3MA 4FHBD 4AZ8A 1LK3H 3BGFC 1IMHC 1HSAA 3F7YA 4X7EC 1KCLA 2K7PA 2QADC 3BHBB 3GMMA 3PJSA 2OLDA 3GSUB 4U1IB 3NTCH 4YWGL 4P2RE 1FRGL 2A73A 3QUZA 4OLUH 3BGAA 3S34H 3GM0A 3CC5A 2JJTC 1GXEA 1OCWL 2AJUL 2M2DA 4FTVB 5E8DH 2AABL 3O9WA 3IU3B 2UZXB 5EUOF 5C86A 1GSMA 3DI2B 2EKSA 1JV5B 4EOWH 2F54E 4UOJA 5BMFL 5J1AA 4Y5XA 5D2LA 3VRLF 5ILTL 2CRIA 1FFRA 5GSVA 2WUCH 1AD0A 2CDFB 3S37H 1NGXB 1N64H 5ALBH 1P7KA 4LPUA 4O58L 3WIHA 3CXHJ 3ZKNC 1QPXA 4NBYB 5FM4A 2OR8A 5F1IB 1I3UA 3SKOB 3ZKQD 4NNPH 1EUTA 4LRIC 4ONHA 1X5XA 4Y4HB 1ZLSH 3V52L 5HY9B 3I6KB 1T1YA 4NDMB 4NQSB 5IEKA 3CVHB 1Y0LB 3HC4L 1S9WB 5I8EA 4DZ8B 2HT3C 5ENWB 4TSBL 4RA3A 2YKLL 5AEAA 4LSSH 2DL9A 2QR0A 5I17B 3GM8A 1R0AL 5EU4B 5F88B 1T04B 4KY1L 3IF1A 3UZVB 4FFZH 2VMFA 2YD6A 1QACA 5CSBA 4AQ1B 1B0GA 3JWOC 3ZLQC 1YN7B 1J0JA 2KZ1B 5EO9B 4OFYA 3VRIA 4JZJB 4ZNCD 1PZ5A 2V6HA 5DUMH 3ULVE 2KBGA 2X4PA 4FZEH 2QLVB 4JREC 4ZTOL 3ESUF 4P2RD 3SN6N 4R3SB 1YEIL 3NCJL 5MEQB 1ZTXH 4WW1B 5HYEA 2CUHA 3CXDL 4NHUB 2CD0A 5DJ0B 2F54D 2IPUK 5AYQA 4L8CB 1MFNA 4TSAL 4PTUB 3QCTL 4R4FH 4P9ML 1A8JH 1XIWA 1RPQA 5GRXG 4ZFGH 2ZUSA 3UC0H 3TM6A 4IRJB 3IU3A 4Y16C 2WINA 5AWNL 3GUTB 3B4NA 4HDIA 4JKMA 2AVGA 3BZDA 5B22A 4KROC 1WWBX 4LSVH 4O2EB 1A7BA 3RDTC 1HHJB 3UTOA 4F8QA 5I19L 2DI9A 4GXVH 4JY6B 1E4XH 4LBEA 4XRCB 2AQ3A 1CBVH 4NZJA 5HDBF 2P44B 3LN4B 3C5JB 4PV8B 1T2QL 5DRWB 1OHQA 5HHVL 2E6PA 5F1IA 3SKOA 3MROB 4EI5D 2Q20A 2V5RA 5ICYA 3CZFA 4U2ZA 3I6KA 4NQSA 5DFWH 3JWOH 5I1JH 3R4DA 3WFHA 1RZJC 1OT1A 3EHBC 1S9WA 4GAGH 2HVJA 1RJLA 4QT5B 3P0GB 4HZAA 4Z7VA 1EBAA 3IDYB 2FGZA 5T3ZH 3VD9A 5FUCE 3LKSA 3I3DA 4HGKC 5F88A 2NZIA 1SYSA 1T04A 4HGWB 4PIRF 3ULVD 4PLKC 4GXUM 1HH9B 4TUOB 4CL7A 1NDGB 3CH1A 3BKYH 1P6AB 1BF2A 3AY4A 3ALPA 5EZLA 5K59E 2DLEA 2AJSL 1T66D 4JZJA 1RI8A 2D4FA 5GS0C 4J3VA 1HH6B 2AJZA 1MCFA 4XP9L 1CLYL 4M03A 1U95B 4OUUA 4LSRH 3G04B 4CVZB 1QBML 3WNNA 1RK0B 4NQUA 2OMBA 2HAZA 5FYKL 1NBVH 5MEQA 3IDGA 4I18B 4U1HB 4XP4H 4WW1A 5FB8B 2A77H 2QQQA 4NHUA 2R0KH 4WO4C 4PTUA 4ODHH 4M62H 2B2XH 1FNEB 3QDHA 5EPMB 4IDJL 4OTXL 4G3YH 3BIBX 1F4AA 3U6RB 3BO8A 4UTBL 4OKVB 4FQJH 1BD2A 3L7EB 1TQBC 4O2EA 1Z9MA 2Q8AH 3N1FC 4LVNC 2Y5TB 1ADQH 1MWAB 2Y6SC 3LEVL 1QFUL 4XRCA 3DECA 3KHQA 2J3SA 4PV8A 4N9GA 5E00A 3KPRE 4I3SL 4KKBC 2FHBA 4YDKH 4KK5D 3LPWA 3RVTD 4HWEH 1RIVH 3FCTB 4N0UB 1QZ1A 5DMGD 3SY0B 1YNTA 5IWLA 2HN7A 4DKAA 4JQVC 2GQHA 4HX1B 3V6BR 1Z2KA 1MREL 5KS9B 3ARFC 4GMSL 1ZHLB 4HGWA 2NY4D 4QHMB 1HH9A 1DBML 2ITCB 3OKMB 5DHXB 2NMSA 4KGJA 4YBLC 5I8CB 2VH5L 4NC0B 1DEEB 2V7HB 4Y4FC 4LCYB 3QZWG 1Y18B 4JFXB 4ODSL 4XP1L 1B0WA 4X6BB 2AK4B 3IFLL 1U95A 3UPAA 4JFQA 1WZ1L 4CVZA 4N1HB 1RK0A 5C0AE 3SDCD 4YZFE 4N68A 4XT1C 3MV8E 5HDQH 5EA0H 3RVUC 3B9DA 2XFXA 4U1HA 5FB8A 1MH5B 1BPVA 4U7SA 4PJHE 3QUZC 43C9B 1IC5H 5FFLA 5ICZB 3HC0B 2DTSA 5E95B 3RI5F 1FFOB 5HYFA 2HWZH 1FNEA 5AYUL 5I15H 4NQDE 3ZHDA 3PL6C 4N0YL 2QHRH 3PDOB 4WHCA 2V9TA 3GBNL 4Y5XC 4RCAA 4G8IB 5DWUH 4HXBL 1VESA 3E3QE 4WI3A 3FL7A 4AEHL 1J7VR 1NMBH 2D4DA 3FHQA 3AS0A 4MDJB 3T8XB 3L5JA 1XCTB 3HS0A 3KPRD 3ZYOA 6FABL 3QDGE 5I6XC 4JB9H 1MWAA 5DD1L 3BAEL 1I9JL 4JM4L 1LMKA 4MD4A 3AUVA 5IB2A 3Q6GL 3NIDF 4P4RA 2I60H 2HKHH 3RA7H 1WV7T 3L3GB 1G7LA 1S7VB 1TVHA 3HMWH 4JRYB 1QSFA 5GISL 5DJ2A 3VCLB 2GW5A 2Y7QB 2HLFC 3KLSA 4DKEH 2B0SL 3SY0A 4B7IA 3GEWB 3K81A 1Z3GL 1KEGH 1EUUA 1CU4H 3MBEB 2PYFA 4ZO7A 2IQAA 4DOHE 1IAKB 3O6ML 2ED8A 2XXCB 3DVGB 4UBDD 5EU5B 3KLHC 1RUAL 4QHMA 3RTQD 2WP3T 3WXVL 2ITCA 3MUGA 3OKMA 5C0AD 2C7UB 1YZZA 5I8CA 5D7SL 1YNLH 1MJJA 3MV8D 1CQKA 3IFOB 2WUBL 2V7HA 2Q8BH 4U0RB 2XKSA 1BJ8A 2YC1A 4LCYA 4M43H 4JFOA 5J57B 2PW1B 1ZGLB 1T89A 1LO0H 2GJZA 1EGJL 1S9VB 2GSIA 3IAPA 4KJPC 2OL3L 4NM8H 2N1KA 3BT2L 2HJLB 2V2TB 4NQDD 1U3HC 2CLVA 2WNGA 3SDYL 3QQ3B 1MH5A 1F11B 3M45A 5IOPB 2GT9B 2IPKB 4HFWA 43C9A 1XIWC 2D2OA 1FHGA 4EBQL 5C0FB 5ICZA 2E9JA 1HIMH 1GGCH 1QP1A 5E94B 3OAUH 2XPGA 3F62A 1KJMB 1RZFL 1RD6A 3QDGD 2J6EA 4HGMA 3PDOA 3TCXA 2XIDA 3KR3H 4G8IA 1NGQH 5CEYB 2DL2A 2GYSA 3CFBB 3RKPA 3KPMB 5C0CE 3GGWA 5T5NG 2E6QA 4MDJA 3TN0D 1BGXL 1CL7L 1XCTA 3NIFF 3MRFA 4Y4KA 1JK8B 4TVSa 2YUXA 3EYSL 1WBYA 3HNSH 4FP8H 3VI3F 4XMPL 2OS7A 3U46B 1KN4H 3WO3B 1S7VA 3U9UB 1A7PH 1OPGL 5KSVB 2IH3B 2ATPB 4ACPA 4ALAH 3TH3T 3RWIB 1TENA 3O0RL 5J11C 3MRKA 3DURB 3QIUB 1NL0H 1KV3A 1MHCA 3D18B 3A0OA 4POUB 2ICCA 4PB9H 3AXLA 1XF5B 2VDOH 3AY4C 3DVGA 1DQQA 1LK3L 5I1CL 3VFWA 4JZJC 2DTML 2EC9T 3B9AA 1A3RL 1ZA3A 3MPCA 4P2RB 2AEWA 1PFCA 1RZGB 3IFOA 1MAJA 1DLHB 4OKDA 3NTCL 1Q1JH 5ESAB 2OR7A 1ZGLA 4PB0L 3CFJB 3Q1SH 3S34L 2F54B 4Q6IA 1IC4L 2APWA 4KDWA 4QRTB 4OIBA 1IAIL 2JB5H 4KMQA 2EO1A 1UB5B 4JQIL 1F3JB 2FSEB 2Y9RT 2UWEB 5EBMA 1F11A 2NY3D 4TYUA 4MAYD 1Q72H 3K80A 1BZ9B 3QWQB 5C0CD 4IEFB 3S37L 3U79A 1EXUB 1KJMA 2X4SA 4JRWA 2ORBH 2V5SA 2ZUYA 1LE5A 3I85A 3ZKSD 4PJBE 5IKCA 3ARWA 3ARVA 3QO1B 1WBXB 3KPMA 4NNPL 3SE3A 3CVHH 1VFAB 2GCYA 3Q48A 4XNQA 4ENEC 1JK8A 4MDIB 3E0GA 4MA1B 3MRBB 1RJZB 3MLSL 4EI5B 2DIBA 3EOYG 2VAAB 4BQ8A 3X14B 2DBLH 4XPHH 1EAPB 3U46A 4HS6B 3U9UA 1DDHA 5IWLC 3ABZA 2GK2A 1S9XB 2XOTA 5FIEA 2IH3A 3VU2A 2DM3A 3VRJB 2V5TA 1F4HA 1WWWX 2ATPA 3KJ4B 4NOBA 5DJDB 2NYYC 1NCUA 2WAHA 4LSTH 1T1ZB 5DUML 1RUMH 3TFKD 1XF5A 2PXYA 1ZT4A 3MR9B 4YHNB 4NZUH 1KTLB 2YMXH 4JKKA 2O5YH 1ZTXL 2LTQB 3LSOB 2X4NB 4P2RA 1QFOA 4G42B 1H8NA 3MRDB 2CO6B 4HH8A 4IHOB 3LRHA 3DSFH 4R4FL 1U41A 3CFJA 3S5LG 2F54A 3O3DB 4DTGL 4LEOA 4ZFGL 1WLHA 1MIMH 4TPRL 1OARH 1U2HA 4Z0BH 4HCRH 1F3JA 1EBPA 3KXFE 1IEBB 2ITDB 5F93C 5DD5L 4M4PA 4LSVL 5D8JH 1ZS8B 3NA4A 3CLEL 2JELL 1CIDA 2X4QB 4UDUB 3EJYC 4KKLC 1AXTL 3ILQC 1NGWB 3DO3A 4R4ND 3JTSA 1SVCP 5GRUL 4HH9B 3F8UB 3BE1L 4JVUA 3VXQB 1KACB 4BUGA 1VFAA 5CBEB 3JWOL 5I1JL 4MDIA 5MEPB 3MRBA 4XWGH 5IHZB 4GAGL 4EI5A 1A1NB 1OAZH 4X7CC 5L88H 3OKNB 4QXGH 2RGSA 4MNHA 3KYKH 5T3ZL 4PP2B 5CJQH 2VXUL 3X14A 4WI4A 1LO5B 5HXMA 1UYWH 4U1GB 2O61A 1EAPA 4FQHA 4JVPA 4HS6A 2IBGA 5F9OL 4A2LA 1BIIB 4OF6A 1S9XA 1AO7E 2XWJB 3BKYL 5EUKB 5DJ6B 5F3HA 1TTUA 1FORH 4F7PB 2NY4B 4X4XB 5DJDA 1K85A 2QKIB 4U1LA 4O2FA 2VDKH 3G5YA 5IROA 1KTLA 1NMAL 4LMQI 1NBVL 5DTFA 4P3WA 5F89B 3LSOA 2X4NA 4PV9B 5E1AB 2A77L 4U49A 1IZJA 1T89C 4I2XB 2NW3A 3SDCB 4AIXA 1XGTB 4PJFF 4CRPA 1PSKH 5IT2H 3KXFD 3RWEA 4PJ8D 4IHOA 3BKJH 3QFDA 2P8PB 4ODHL 1MCPH 4M62L 5A2FA 2SEBB 4JGMA 4GS7B 4PGBB 3X3GL 5E2UL 5JUEH 5IB3B 4FQJL 2ITDA 1C7TA 5E8OA 1XF2B 2Q8AL 1ZS8A 5D96C 2AV1B 3X17A 3TGXA 1DUZB 1S7SB 1G9EA 3OGOE 4J2XA 2X4QA 4UDUA 1QFWH 3KPRB 8FABB 3RVXD 1NGWA 4PJIA 4FQXD 2LQRA 3CNKA 3B3IB 2I5YL 2P8LA 4Y4KC 5IVXE 4YDKL 4HH9A 3S7GA 2L0DA 3HI5H 3NAAH 5FK9B 1JGUH 4HWEL 3F7RA 1RIVL 3C8DA 3T2NH 5MEPA 1AO7D 1V3JA 3BPLB 2E9WA 1ORSB 4JPIB 2C1OB 4CDGC 3Q5TA 5GS0L 3RUGE 1EEYB 1LO5A 4DGYL 4FQQB 1CDYA 3EFFB 1BIIA 5TDOB 3LRSB 5EUKA 1C5BH 3GJFK 4U1MA 1QKZH 3HNTL 4X4XA 5C0DB 1JF1B 3KDMB 5CD3B 4E42A 3LN5B 2QKIA 5C0AB 3RVVD 3L3DB 4GRWB 1IJ9A 4MXWH 5I1HH 4ZQKB 2P46B 3MV8B 1PKOA 5JIKA 2NY5C 2YBRA 1VADB 4PJHB 1UEYA 35C8L 4PD4J 5EORL 3BZFA 5D2LF 4U0RC 4ZUWB 1CVRA 3CMOH 4N0RA 4JFFE 3SDCA 2E8YA 2WIIB 1IC5L 4NQDB 4Q6IC 4O9HH 4XPTL 3PE9A 4X5WA 3VJ6B 4ONFH 3BN9D 3D0LA 2P8PA 2C1PB 2SEBA 1AGEB 2QHRL 3O2WH 5GRZA 2CKNA 5DWUL 5IB3A 5K9JL 2D7TL 3QDGB 1ZT7B 4NQCE 1HILA 2AEPL 4OJFH 5CWSB 2J4WH 2X9XA 1N5AB 2AV1A 2FBJL 1S7SA 1MUJB 3VXNA 3WIIH 3AVEA 4F37F 4LKCA 1N26A 3TN0B 1QEWB 1T5WB 3KPRA 4NPYA 3QT2A 3SE3C 3C5SA 4G6KH 4DVBA 1T21B 4NUJA 2FWOA 5AD0A 2I60L 3ZT6A 3RA7L 4XPBL 2BSED 3QI9A 1TJGH 3H0TA 1NCBL 3FZUD 3OKLB 1L9MA 1ZSDA 3TPUB 1DBJH 2F8VA 4DKEL 2YSSB 3RPIA 3ZE1E 4DOHB 4JO1H 3EOBA 4RZCB 1CU4L 2C1OA 2C3VB 5DGQA 5HYSB 2EIDA 3U4EA 5JXAH 2P5EE 3VFPB 2NY5H 3ZHLA 3EFFA 5TDOA 2FGWL 3KYNA 3LRSA 1NANI 1ZAGA 4WCYL 1S9KC 1UM4L 1YNLL 4JFDE 2OZ4A 3RTQA 5FM8A 1J05B 1JF1A 3KDMA 5CD3A 4M43L 2PXYC 3LN5A 1MCWM 3S88H 1AR1C 5I1GH 3L5XL 4NKDA 4NM8L 3TBYA 4YXKH 3L3JB 5E24E 3DUSA 1Q8MA 3ARRA 2PN5A 3LPGA 3QEUB 3RJQB 4ZUWA 2YD9A 3V0WH 4HJJL 1XAUA 5L9DH 1BFVH 2WIIA 3NA9H 3PHOB 4WUKH 5EU3B 4B41A 4G9DA 4NQCD 1HIML 3FQRA 3RGHA 2NY3B 2E7MA 3OAUL 1DVFD 4MAYB 2C1PA 3REVA 4LCWB 5IBTH 5F3BB 1YEGL 3WIHL 1SY6A 3H9SE 1MCDA 3UAJD 2KH2B 3C60D 1NGQL 3QNYA 3QDGA 1ZT7A 5IF0B 5TH2B 4OCSL 4PRHB 3VFMB 5DHYB 2AGJH 4Z7VF 3W9DB 4RGNE 1MUJA 1YMME 4MWFB 3OWEA 5F7UA 4JO3L 3DLQR 5HHXH 2V2XB 4FP8L 4PJ7E 5HGDA 3VI4E 1T21A 2D7NA 3MA7A 4LLMA 1ED3A 4N5ED 3RL2A 2DLTA 4R96A 4U3XA 2DMKA 2P5ED 1EDQA 4EI5C 1A9BB 3OKLA 4NNYB 3EDEA 2RCSL 5DYOB 3OBAA 5J4MA 3HZVA 3UBXI 2E7HA 4JFDD 1OF2B 4QYOB 2C3VA 1U6AL 4PB9L 1B2WH 2WP3O 2OSLA 2VDOL 4ISVA 1VFMA 2YRLA 1KCUH 3VFPA 1RIUH 1ZT1B 3KJ4C 2VIRB 3ME0A 3MUHL 1RSFA 1Q9WB 4ZUVA 2Z4QB 3W5NA 1K4DA 1T66C 1J05A 5IROC 5FCUH 3Q1SL 3MLUL 5EC2A 1LO3H 1W2KT 4WI2A 4ODUB 1CDCA 3BP6B 3DNKA 3TBSA 1G7QB 4U1KA 5DMKB 2YD3A 3L3JA 1T03H 2JB5L 4LLQA 4EUPB 3SDXB 3OHXA 2R1XA 1DN2A 4HKXA 3H9SD 2ADJB 3NFPB 3CVIH 3PHOA 2C4FU 5EU3A 4PJBB 4XC1H 4XH2B 4PGDB 4MAYA 3CK0L 5FGRA 2ORBL 4RGND 5F3BA 5F44A 1NLDH 5SX4I 4C4KT 1YMMD 4ZUSB 1I9RH 5C0CA 1BM3H 1N0LA 2ENSA 4XAWH 3O6KH 5TH2A 1RUPH 4PJCE 4TVPE 3VFMA 3CVHL 5DHYA 2D9CA 3EFDL 3W5MA 2HTLD 1FL5B 4XMKH 2H8PA 1QBLH 4MJIE 5T3XE 5C0IB 3MXVH 1PEZA 2VR4A 2V7NB 4XPHL 1G7JB 1GGYA 1MFBH 4HPOH 4M1DH 3ULVH 3GNML 4OFIA 3BEWB 3RX8A 4NJAH 3CLFH 4NNYA 3CX5J 4NSKA 4ONGH 5DYOA 3WS3B 5DMGC 1JGVH 2FIKB 2HH0L 3QIBA 4G8EA 4WUUA 4PBWD 4H8WH 4QRUB 1OF2A 4QYOA 4K3JH 1JNHB 3BKCH 1OAXL 1MFEL 3D69B 1U8OA 4CJ1A 4N8VB 2KQNA 1MY7A 3RGVC 2GY7B 2VIRA 2O5YL 4PJDE 3QPXL 3BZEA 1EO8L 4LLWB 1LQSR 3KPLA 1OGAE 4HUXB 3EOAA 4P5KB 3KJ6H 3U1SH 5HHOA 1QLEH 3FT3A 3P0VH 4M48H 1JPSH 3D2UD 2CIKB 1YEJL 4PJ8B 3BP6A 1G7QA 1MIML 3SDCC 3B43A 4X98B 1KENL 4WTXA 3SDAD 2VERN 2Y06L 3K8KA 3QDJE 1KLGB 4OGYL 1LEIB 5INCB 2M1KA 4HIEA 4PJBA 4TVPD 1WTLA 5A2KH 1CFBA 1OGTB 4XH2A 4PGDA 3BWUC 3TNMA 4E5XB 4ZS6D 5KTEL 5L7XL 4NFCA 5DLMH 4MJID 4OFKA 5I9QC 5T3XD 1CL7I 5E99L 1QTYT 1A0QH 3GBMH 2WK2A 3INUH 3T0XA 1RY7B 4JFZH 1JZ3A 5L88L 4LLYB 3OR7A 1UCBH 4QXGL 1NH6A 3QI9C 4P3CH 4UINH 2DQTL 5CJQL 2BC4A 3I9GL 1AO7B 2V7NA 1FBIH 1UYWL 4JFEB 4S1RL 1G7JA 4PPTA 4XNZB 5EN2A 3S35X 3BPLC 3WJJA 3BEWA 3NPSC 3L95B 3T09A 4M5ZH 4WVRA 1GHFH 4Z0XB 5JIPA 4UNTA 4WNQB 5I66B 2MCG1 4YDIH 1OGAD 1IKNA 1WZMA 1JNHA 1CLZH 4RQQA 5HI4C 2VDKL 3RBGA 4UBDC 5EH1A 4N0FB 1REIA 5GGVH 3T3MF 3RTQC 2Z92B 4TN9A 4C83B 3TCLA 1JHLL 4LLWA 1OOAA 1BHGA 2W65A 1FZJB 4BM7A 1ZA6A 1CDJA 1TVBA 3QUKB 4HUXA 5CHNB 4YDVB 3R1GL 3QDJD 3V2AR 3BKJL 1IAII 3WKNA 1MCPL 2ID5A 3KXFA 4PJ8A 2DQHL 4GOSA 1VCAA 5FUOL 1OVZA 1LEIA 1KLGA 1ZK9A 5INCA 1MWAL 4NGHH 3E3QC 1GJIA 1OGTA 4U7KA 3MRLB 4AL8H 1QFWL 5IVXB 5DVKA 4PS4H 2Y72A 5DVOA 4DUVA 4JJ5B 3EGSB 3U4BH 2O5ZH 1PG7X 1MLCA 1BJ1J 1OTTD 2LU3A 3NAAL 2AERT 1JGUL 4FQXA 3J7HA 2E9BA 3RUGB 3BFOA 3GSRA 4JKPH 3SGDI 4LLYA 2WM0A 1LVEA 4OV6F 1R3HB 1KPUB 3HZYA 3TEUA 1AO7A 1U8IA 4NBXB 3QQ9D 4YK4C 4OZHB 1A64A 2APTA 4JAMA 3WIFB 5SWZA 2GUOB 2VQUA 4P5MB 4YDLB 4GRWH 5CJBA 1II4E 3T2QA 4NQVA 4WNQA 5I66A 1G7HB 2HJKA 3BRDA 4LFHG 2BOCA 3FO9B 4PRNB 3WFBL 1D6EB 1Q94A 3DYPA 3MGAA 4RNRA 3DI3B 3JXAA 4J3XA 4JFFB 2ESVA 4KK6C 1DBKH 3I50H 5A2IH 5C0ND 3QUKA 5LAXB 1C5CH 4GXUN 1FLRH 2HRPL 4ONFL 3ZDXF 2YXMA 1X7QB 3LKQB 3PNWB 1GGUA 2HFGH 4NQCB 5HHPB 3FB6B 1U8LB 4R4BB 3B9KA 2J8OA 2R2HA 1I1YA 1DVFB 4WHTB 4OI8A 1MHPH 2FD6H 3MO1B 2FX7H 4IRSD 4OJFL 2NY3C 5F9WB 4TTDD 4MAYC 2J4WL 3C60B 4GW5B 1M6OA 2QQLH 4WU5B 3CFCL 3F12B 4HC1A 1Z5LA 4JKWA 4N8CH 3RZCB 4PFEA 5KZCD 4I48B 5IVXA 3GB7B 5BXFB 1R5IB 4KMTH 4S0TD 1SMAA 2P5WE 2IADB 4CVXB 1MI5B 1NAKH 1NUNB 4NRZB 1F4YL 2A6KB 3RUGA 4JO1L 4D8PB 2P5EB 3C2SA 1D6VL 4QXUH 3MLYH 1PKQE 1QRKA 5E9DB 2F9BT 1FCCA 3B6SA 4MCZA 2NY5L 4JFDB 4BH7B 3QIBC 2VNCA 3VXOB 2LVEA 4QO1A 4M8QB 1I7RB 2GUOA 5EBGA 4EKXA 3AMKA 4FQPA 5F7DB 3MLXH 2VL4A 3LS5H 4KKAD 3DYMA 1GL4B 3H42H 3THMH 3WMSA 2R4RH 1G7HA 1E28B 3P40A 3QWRD 4FN0A 4MNGA 5I1GL 4PRNA 1D6EA 3TFKC 2LU7A 3LN9A 3G5XB 4YXKL 1P9MA 1JZ6A 4HIHB 1QBBA 1W0VA 3S35H 4WUKL 5T1DL 5C1MB 1GOHA 43CAA 3JV0A 4K8RD 1MCSA 1XZ0A 3L5WB 4OQTH 3LKQA 4S10A 4HS3B 5IBTL 4FOMA 4NQCA 3FB6A 4QRRE 4R4BA 2APVA 3O4OC 1I4FB 4WHTA 5A40E 1BOYA 1XT5A 2P5WD 3NGBC 1YMMB 3QH3B 4M4RA 4LSPH 3C60A 2AGJL 2PTUA 4WU5A 5D2NE 4PJ7B 4S1DC 4DW2H 4MQ7B 5IFJB 4G5ZH 3P0YL 1LK2B 5BZWB 3ZYIA 1GZQA 1R5IA 5HHXL 3WJLA 4R4NC 2E7LA 2B1AL 3IDNA 1QFHA 3PIQA 4CVXA 1WK0A 2EYTA 4WEBH 2CLZB 1VEPA 1EVUA 3L3IA 4NRZA 5C2BH 3GKZA 4GUPB 1U92A 2A6KA 1NEZG 2YZ1A 4R26H 3GDBA 2DQDL 5GZND 2P5EA 5TDNB 3WJJC 4ODVL 1B2WL 4OM0L 1RIUL 3RWGB 1ROWA 2CUIA 4BH7A 2VC2L 1IEHA 5B3JE 3VMNA 4DGIH 1PG7H 1IKNC 4UIKL 5F7DA 1JGDB 5CUSH 1OAKH 1B6UA 1YMHA 5FCUL 1E28A 1LO3L 5GGRA 5A3ID 4DCQA 4EUPH 5TE7H 1E6OH 4XTRD 5HGAA 4XCFH 2OP4H 1CGYA 1N2RB 3D2UB 4XWOC 4QRRD 1RFDH 1Z0MA 1K8DB 5GGVY 4IIQA 3TO4D 1DQLH 4PJ8C 1XR9A 4R9HA 3H9SA 3SDAB 5DMJB 4PJIF 1RZIA 3H9ZA 2OCFD 5M94B 1SEBA 5CILL 3ZYJA 5DRZA 3BQUD 4PJCB 2X4OA 1QR1A 5IR1B 4XAWL 4DWHA 4HKJB 4OCYL 2XWBB 2JIXD 4MJIB 4MAUL 3REWB 4RMSA 2BSRB 4A2MA 3NBNA 3U4AA 3SDDB 2DB8A 4PJ7A 1SBBA 4D9RE 4OCMC 1MCRA 1LK2A 3G08B 5C3LD 4KVCL 4FQXC 3VFNA 3BVNA 2CLZA 4S2SA 3CSGA 4NUGL 1QHPA 4HPOL 4M1DL 1NGZB 3ULVL 5HI5D 1HI6B 4NJAL 3CLFL 4JHAL 4ONGL 3GRWA 5TDNA 4H8WL 4K3JL 4CNIB 25C8H 3BKCL 1CF8L 5FYJE 4PJDB 1IGYB 3RWHB 4OD3H 5CMAA 3TBVB 1A7NH 4NWUL 1XR8B 2G5BA 5B39G 4G8FB 1K9TA 1KC5H 4WJ5B 1E4WH 2BY1A 1WAAE 1MLBA 5GS2H 2KKQA 3DTXB 3BZ4A 4UV4L 3WUWB 1JGDA 1IC7H 3KJ6L 1I8KB 2A0LD 1RURH 3ARTA 3RVVC 1JZ5A 3U1SL 1OWWA 4XPGL 4EEEA 5FV2A 5C92A 4ZPTB 3QDJB 1H3GA 1EFXD 5DR5L 3D2UA 5SV3A 4LP4A 3E6HB 4MXQD 2FZ3B 1K8DA 1CDUA 5I1DA 4LAQH 3HG1E 4YNYB 3VDCA 4DEPC 3BN9C 3SDAA 2YN5A 3B9KC 4C4KO 2FEDD 2GITA 1CICC 2XKNB 4WFHE 1R5WA 1AE6L 3GHBL 4I0PB 4LVHB 5J13B 3DJ9A 3MJ9H 4PJCA 5DLML 4D9RD 1DP0A 5IR1A 3R0NA 4WEUD 1MAMH 2CDEB 4YGAB 1VFOA 1A0QL 5CFHA 5JMRA 2R0ZL 4MJIA 3REWA 1ZLWK 3GBML 4YHIB 5ADOL 3TVMA 2R0WL 3G6JE 3INUL 4X9IA 3IXTB 1X5YA 2DQEH 3SGJA 4JY4B 4UILL 3ZT5A 1Y6MR 1UCBL 3G08A 1P6FA 3CFEB 4Z5RA 5B8CA 4UINL 1YEHL 4MNQA 5A16B 1MRFH 2EDHA 3PGFL 3TWCH 5FYJD 5LBSL 3ZE2E 1NGZA 5IHUL 3DOSA 2N7BA 4J1UA 4YZFF 1XF3A 2AQ2A 1KYOK 4K71B 2DQCH 1GHFL 1NFDA 4ODTH 5JR1H 4KDVA 1FSKC 2ZCKL 1UWXH 3RWHA 1BP3B 4OF7A 5EO0B 3ULUE 4QWWD 4LRNH 4YDLC 1XR8A 1OGAA 1MFDL 5GGSA 4X6FB 5DS8A 4WJ5A 1MCQA 4G7VH 5JZ7D 5IVNA 3FQNA 32C2A 4LIQE 5DJAA 1HHKB 1CTNA 1CR9H 1U58B 4L9LB 5T1KB 3HG1D 4WFEE 2Z8WC 5TGBA 4WFHD 4RMWA 1J0IA 4RBPK 4UMGA 5D1ZD 1DLFL 3EZ8A 1EJOH 3E6HA 1KNOB 2FZ3A 3RHWF 4XGZB 4HC1H 1BAFH 1LO4H 3OGCB 3QXVA 2VDLH 1FNLA 4YNYA 5ECJE 1ONQA 2D7PA 1KIQB 3FOMA 4AL8L 3BEVB 4B0MM 4C56A 1UZ8B 2AJ3B 3UAJC 4PS4L 3U48A 3BH8B 3GSOA 5KZCB 4WIQA 3O6FD 4DKFL 2O5ZL 1EIBA 2FATH 3MUZ1 1NCDL 3GMNB 4KV5E 4YHIA 1WFNA 2JF1A 5K9QG 3IXTA 3WJLC 5DMYA 2E7LC 1CFSB 4JY4A 3AAZB 3ZE0F 3STLB 3KYOB 3CFEA 4P5TD 5CEZE 3NIGE 2MPAL 3RNQB 1JWSA 5F1NB 4OIIL 5EU6A 5A16A 4TQEL 2AJVH 4MQSB 1Y6NR 3PQYE 2UVFA 4MS8D 1MHHA 4TOYL 3ULUD 3FO0H 2Y1VA 3MLTA 5C3TA 1FDLH 1EJ6A 2QQNL 5I76B 4PJGE 1BWMA 4AJ0A 1TIUA 5D70L 3MRIA 1P7QA 4MHHI 5IJVB 3UTTE 3UYOD 1PW3A 4ZSOE 3GO1L 4JJHA 1DTUA 3W2DH 3E6FB 2V2WB 3P30H 4WFED 5LG1A 4JPKH 4OGZA 1DBKL 3I50L 3O45A 3FTGA 2AV7B 3LS4H 3PWUB 4RMRA 1FL6B 4MD0B 3S97C 3SKMB 3BH9B 1FLRL 4LPXA 1YA5A 1U58A 2FRGP 3KPOB 2OR9H 3UTSB 2MTPA 5EUOE 5HSFA 2HFGL 1SEQH 5MP6L 5D7IF 1CE1L 4Q2ZA 4H0HB 4IIQC 4ZYKB 1LEKA 4BZ2H 1YC7A 2FD6L 1RJYA 3IS0X 2H2PD 1GC1C 2R15A 4XGZA 3MREB 5IVZA 3VRLE 4BZ1L 2Z35B 1TLKA 4DGVH 1KIQA 2P5WB 4IRSA 3OXSB 1R3IL 4OF3A 4KJQD 4RGNC 1UZ8A 4KMTL 2AJ3A 3O3AA 5KAQG 1NEZA 4HFUH 1NAKL 2EDXA 1L7IL 1UWEH 5CEZD 1HWHB 3FFCE 3QEHB 1PKQB 3PQYD 2HTLC 4Q9QL 4D2NA 4NCC1 5KVFH 1CFSA 4TULH 1DE4A 3STLA 1INQB 3L1OH 3KYOA 4C57C 1ZVSB 3RNQA 4G7YH 3UTTD 4TRPL 4K55A 1ODAA 3TBWB 3WNLA 4H5SA 1MHEB 3MLXL 3LS5L 2ZPKH 2ERJB 2R4RL 5IJVA 2IFFH 4EVNA 2EIZB 2ZCLH 1LE9B 3VXTA 4X7SH 3F5WA 5JQHC 5E6ID 3E6FA 2V2WA 4LQFH 2DDQH 3EYVB 3QWRA 4RFOH 1BEYH 1T0MA 1UB6B 1CDBA 4PJBF 3I75B 5GIRA 1MFAL 3PWUA 4DQOH 5DK0A 15C8H 3ARUA 2VWEC 3SKMA 3S35L 3OXRB 3BH9A 4FFYH 1P4LB 1L7TH 1WC7A 1F4WL 3OV6A 4ZFOB 3TO4B 1FZKB 1GOFA 1IBGH 2Y4SA 4HXAL 3T4YA 1D5ZB 5F1KC 3KPPB 4ZYKA 1UKQA 5D2NB 1R3JA 3SDAC 3BQUB 5E2JA 1DBBH 1SHMA 2PW2A 4YHKL 3W9EA 3UTZA 4TNVF 2UYLB 3FB8A 2JIXB 2P5WA 3FFCD 4G43A 2XZCH 1JWMA 3OXSA 4ZS6C 4G5ZL 1EHXA 4JO4H 3A6CL 5HDBE 3O4LE 5EZJB 4W6XB 4L5FH 2YR3A 5SX5K 1HN1A 3TVMC 1S8DB 1DQDH 5GRJH 4J23A 1ND0A 2AEIT 5C0EB 3SGJC 4CBPA 3CFDB 2X6MA 3P4OB 3QEHA 3M1BA 1PKQA 4NO2A 5B8CC 4NN7B 1F97A 1T1WA 3FMGH 1NAMA 4R26L 4JPVL 2YA0A 1V5JA 1P2CA 4YXHL 4NZTL 1FJ1B 1D5IL 4X4ZA 4EUPG 3UJTL 1UJTA 3TBWA 2EXYC 1I1FB 4QHNB 1TJHH 1VB9A 1H3PH 4JG1H 4OLWH 1HOCA 2PKDA 7FABH 2EIZA 3K3QA 4WY7L 3BRFA 4JFYB 3QUYA 4JKLA 1RUQH 4XCFL 2R1WA 4GQ9L 3EYVA 5E03A 4NWTL 3U0WL 2YD4A 5F7YC 3HNVH 4HJGB 3GMPB 4KJWD 3KHOA 3NACL 1X5KA 2W59A 1EFXB 3OXRA 3QBTB 4L29B 5IMMB 1R24B 4PJAA 5AG9A 1P4LA 4QRRA 1MCJA 2DQIL 2ZUVA 3OG6B 2F19H 4TVPH 3HA0A 3TO4A 1OQOA 4JFHE 4CW1A 4QRPE 5ERWA 2ED9A 3O4LD 1Z0NA 5D2NA 5FOBB 3VXUB 2P48B 2KQMA 3NFSH 3AFLA 1BVLB 4BK4A 3CXHK 2JIXA 5DJZB 1ZHKA 3MRMB 4ORGB 3VXRE 3RWDA 3EDKA 3UDWA 1YC8A 3C5ZB 5EZJA 2QEJA 2MSPA 2COQA 3N9GH 2EH7H 3QRFM 2EC9U 3W11C 5C0EA 1OTTC 4N8VG 3CFDA 3P4OA 4MD5B 2X70B 5BS0A 2Z93B 4U3CA 4G6AD 3UYRH 1RZKC 4CADA 4IOFC 4I77H 4IRZH 2XZAL 3F6IA 1QVOB 4XCEA 3FFDA 1X5LA 4OD3L 4LCCB 1A7NL 4X4YA 5A2LH 4L3EA 1D3CA 1RZ8B 5FV1L 1Q9OA 4KKNA 4NZRL 3V8CA 1Q38A 4RX4D 5T1MB 4LLAA 4KTEH 2XY1A 2WWKT 2ZUQB 3SE9L 3SPVB 1KPRA 3IB4A 3SEPA 3D87B 5JHLL 5HD8D 3FQWB 1IAOA 4JFYA 4L3CB 1F45A 1UWGL 1MRDL 2CMRL 4NYLA 5C0NC 3AB0B 4JFHD 5ITFA 4QRPD 5IHBA 2N56A 1JPTH 4KGLA 3DPBA 5IW1B 4LQ1A 3GMPA 4OM1L 4LAQL 1EFXA 2P8MB 3L7FA 5IMMA 5IVXF 2NTFB 4GLRI 4EI6B 3GI9H 1FZOB 3VMOA 4PRPE 4UB0H 3PV6B 4KXZI 3MJ9L 2BNUB 5HPMB 4FQIL 3VXRD 3BGMB 1MAML 2VSCA 3RUGF 4IRSC 2DLHA 5DK2B 1MNUH 1BVLA 5IB1A 1HHIB 3GK8H 3O6FB 5B38B 4MVBD 5D7LA 5IVOA 2DQEL 3MRMA 3R8BB 3O2VH 3SOBH 2EDRA 3WNMA 1YECL 2D0FA 5H35B 2HVKA 1D7FA 3GSWB 4M6OL 4W68A 1LDPH 4GG6B 4X80H 3ZDYE 2JK5A 3NCEB 4P5TB 1AGBA 5JW5A 4MD5A 5F9AC 2JJSA 3BPOB 3VH8G 2DQCL 3H3BC 4X4ME 4F7MB 3CX2A 4HPYH 5DDHB 1BIHA 4KUZH 3T0AA 3HAEB 5DEGA 1QVOA 4RFNC 2OTUA 3EO1A 1WAAA 4WEMB 2GSGA 1JTTA 4LRNL 5CJOH 1WWCA 2HG5A 4U2YA 1I9IH 5EWIH 3ZZ1A 4PLNC 2W60B 1OD7A 1AQKL 1FE8H 2A1WL 3LOWA 4KKAC 5JLZA 3CCHB 4RGOH 3QR2A 2XN9E 1DZBA 4P9HH 5DUPH 1M05B 5AAMA 4FXGB 5FM5M 3FQWA 4C59B 2XNAA 1EEZA 4XCNA 3UZEA 1U8MB 5IFHH 4PRPD 2X4TB 3MJ6A 3DGGB 1D5XB 5BCAA 3HG1A 3MQIA 1EJOL 3VWKD 4D3CH 5E08H 4HC1L 4OGAC 5D1ZA 2NTFA 2H9GA 4LPCA 5SWQB 4K8RC 4EI6A 4H25B 4FFVD 4GW1B 5TJWK 3UTQB 2BNUA 2VL5B 3ZE1F 1KXTB 5HPMA 3WN5B 3LY6A 3Q6FA 3BGMA 5D7JB 3G6JA 3NN8A 5IHLB 2Z91A 5D6DA 2O93L 4R8WL 3MJ7A 4NKIH 2ATKA 4U33A 4FRWA 1RMFH 1HHIA 1FPTL 3OJDA 4JDTL 5B38A 1BWWA 1G84A 3QNZB 4A6YB 5BOZG 1FIEA 2ICWA 2X41A 2BK8A 5AG8A 3VI3E 2FIRT 3ZSSA 3DO7B 3BESR 1ZLUH 2AJVL 3E8UL 1KB5H 1TPXB 3ZL4H 4PJGB 4P5TA 1UACH 5T33L 4KHXH 4O02H 2A74B 4FFWD 4U6XB 1B88A 4JZOB 1A6WH 1J9CT 2AXGA 2E8ZA 2R23B 1GOGA 1FNSH 1LNUA 2MNUA 5DDHA 5GZNC 5JO5B 2R29L 5E2WL 1CFTB 1U8JB 1VPOL 3KLAB 2XN9D 1AP2A 4Z77B 5IESH 1P1ZB 1RV6X 3P30L 2MCPH 5ETUA 4MA8H 3C6LA 4UDTB 5E6IB 5K33A 2DQUH 2OQJB 1K8IA 5EUOB 1TTFA 3QUYC 1X3DA 3EO9H 4OCRL 4QHUB 1M05A 5DJXB 2OR9L 3AU1A 1A7OH 1SEQL 3FT4B 5JNYA 4XTRC 1U8MA 2X4TA 2JJWA 3DGGA 1D5XA 1I3GH 1NGYA 4PJ7F 3DYOA 4NQTA 4OBSA 1VKXB 3VI4F 4YAQB 2AK1H 1ACYH 2OI9B 5GS1A 3QEQB 3TO4C 3JWDC 5J6GA 4PGCA 4V2CB 5TE6H 4H25A 1DL7L 5D2NC 1LHZA 1RULL 4OGXL 1A1MB 5FYLH 4K3EH 3FFCB 3G5ZB 1QFWM 1AGDA 3F65A 1RJCA 2ARJQ 3UJJH 3V95A 1ZEAL 3UDWC 1FG2B 5AZ2L 1UG9A 5KVFL 1UJ3B 5DI8A 3T3PF 3K4ZA 4A6YA 4DUXA 1J8KA 3ARBC 3X12B 1IQDB 5K9KA 3L1OL 3PQYA 1DANT 1EK3A 4JDZB 3BJLA 4G7YL 5IMKB 3DV6A 2XZQH 1JWUB 5MI0C 1C1EL 4PJGA 3NZ8B 3MRJB 2KL6A 4RMVA 4U6XA 4JZOA 3UTTA 1WFUA 2YD7A 3IGAB 2R23A 4ZSOA 2ZPKL 4GKZB 1CFTA 2ZCLL 5IMLA 1BZ7A 2P24A 1C12B 4Z77A 3BIKB 1S7WB 1P1ZA 4ODWA 5HHME 2DDQL 1BEYL 4NQEA 4DQOL 4I3RH 4GW4B 3IXAB 5CZVL 1YNKH 1GC1L 2XTLA 1RZ7H 1AJ7H 4PJCF 2A0LC 4G8GB 1JHTB 4Q0XL 3TO2A 4PR5A 3C8KA 4Z78B 1FG9C 4JY5H 3FT4A 2DYPA 3PHQA 3K4AA 1OAUH 4UT7H 2VLRA 5IBLC 4R7DB 2AS5M 4ZAKB 3FAWA 4XVSH 4ZFZA 2YEZB 1SYVB 4YAQA 4FXKA 3O4LB 3O41B 1P84J 4WENB 1CGUA 1MCWW 2XZCL 1CK0H 1J10A 4QRSB 1MJ7H 3KYMB 4OV5B 1A1MA 4L5FL 4QHLB 1I1AB 1X5GA 3MJGX 3KPNA 5GRJL 5D71H 4OD1H 1IM3B 1NFDF 5KJRH 1R6VA 2VLKE 1T1XB 5DT1L 2QHLA 2ZOKB 3QWOB 1MPAL 3UBXB 4L8DA 2BVYA 3FMGL 3ZT7A 1PVHA 4X7TB 2X42A 2VXQL 5T1LD 3X12A 1IQDA 4M1GH 1NC4D 2BMKB 3IDMA 4JDZA 3NCFB 5DK3A 2JJSC 4OLZH 1JBJA 5HGGS 4Y16D 3WO4C 1TETL 3LMJH 3NZ8A 3MRJA 1X44A 2BVUA 5HHMD 1HYRC 3LQAH 5JOPE 3DXAE 3MBXH 1TJHL 3RDTD 2NCMA 4JG1L 4OLWL 1ZGLM 1AI1H 7FABL 4OB5L 4U3HA 4XBPA 3OF6D 1RUKH 4NKOB 1C12A 2JB6B 3BIKA 1S7WA 5F7EH 2Y23A 2H26A 2IPTH 5TDPB 5HYJB 4F37K 3IFPB 2ZUQC 4PJFE 3IXAA 4APQA 3FQTB 5JORA 1G7IB 4K9EH 3MNWB 5GGTH 5ANME 4QRPB 1GYAA 1JHTA 2F19L 4TVPL 1MJ8H 3AB0C 4KFZC 2YXFA 1A6UH 5I1AB 5E0QA 1FCGA 4HG4K 1OP5H 1NFIB 4BFEA 5D1ZC 3D6GA 1C5DB 5T3XL 3H3PH 4Q9BA 2YEZA 4OZFG 4PLKD 1YEFH 1SYVA 2J1KA 3VXRB 3VFSB 1LILA 3O4LA 5B3NA 2VLKD 4IMKA 1B4JH 3O8XD 5JQ6H 3KYMA 5DJCA 4UNUA 5D6DC 1S78D 3JV6B 4YE4H 2EH7L 3H6JA 1IM3A 3MYZA 5LWYL 2ENYA 1BBDL 4UZGA 5LGJA 1T1XA 3U9PH 2ZOKA 3QJHA 2E9IA 1R3LA 4HT1H 4YJZL 2B5IB 4CDHA 4WO4D 2BMKA 5JOPD 3DXAD 4X83A 4ODXB 4KZEH 2WZPD 2ZUTA 1QYGL 1ZV5A 4Y1AE 3ULUC 3VFUA 1AH1A 2APBA 5DQJA 5CAYB 3DVNA 1BVKA 3F6LA 4RX4A 3VA2C 3C6LC 1MIEH 2AEQH 5D2LE 4I4WB 2XICA 1CZ8H 3GMRB 5CCKL 3ZHKA 4LSDA 4OFPA 2VLJE 1JPTL 5AZEH 2NY0C 4PRPB 4KKBD 1A7RL 1G9MC 3FQTA 3MNWA 4PTTA 3N85H 4CMMA 4JGJA 1ZLVK 4CUCA 3I6GA 1KJVB 3RIFF 3VWKB 1KF9B 3H9HB 1WGOA 2FJFB 2H3NB 5I1AA 3T65B 5GS1C 1N59B 5ALCL 4CJ0A 1CXLA 1KFAL 2CJUH 3SO3B 4MJ6B 1C5DA 1QSZA 1MQKH 3HR6A 3LEXA 2H2PC 4NQXB 4U1JA 4X8JA 1IGTB 3FB7A 5EIIB 3DRQA 1TZGH 1F3DJ 3C08H 4RRPA 5FYJU 3ARQA 1WICA 1HHGB 2P7TA 1KCRH 3LZFL 5CP3H 1K4CB 1RZKL 4Y4FD 3SOBL 4KJQC 1VFBA 3S8WA 1WSST 3HI6H 3JV6A 1LDPL 3VG0H 3TZVA 4PYGA 3RVWD 2XRAH 1SJHB 1F6LL 3LDBB 3QFJE 4PUBL 4QLRA 4M6AA 5T5FH 3RVUD 2DRUA 1NMCB 5EDXA 3FOLB 3T0EE 2P42B 3QUZD 3HAEH 5I1LB 3L6FB 4Y1AD 5C9JB 1MCIA 5HYQB 2XT1B 2BVEA 1KTDB 5D1QD 1M71B 5BVJB 4ODXA 2NY6C 1OCWH 2AJUH 3PL6D 2AABH 4XP5L 3S3PA 5EWIL 5IUSA 3WS6A 3IETB 2WWKO 3B8YA 3P4NB 1EV2E 3ALWA 1XF1A 2VLJD 1S7RB 4X6CF 3MRRA 2ICWJ 2RJMA 1NLBL 5DXWA 2XWTB 4X5XB 2NW2B 4TNWF 5DUPL 5ILTH 1FN4B 4UUJB 4PJ9A 5K93A 2EEBA 4I4WA 5FHAL 2VITA 4XBEH 4HWBH 1JRHL 3CDCA 5F70A 3RX7A 1U0QA 1CGXA 2WBWB 3RY6A 5D5ME 1KJVA 2HLFD 3VWKA 6CGTA 5HVGB 2CR6A 5E70A 2ZOLA 4MMXC 4NRYB 2WBJD 1Y6KR 3T65A 2OI9C 2YKLH 1I7UB 5C7XL 2X1XR 4TUKL 4KHTH 1R0AH 4NQXA 3KLHD 2JLLA 5FA4A 3KYAA 4H88H 4Z7VE 5CEZH 1RMFL 5DD6B 4A6YH 3QFJD 1OP9A 1M7DA 1K4CA 3UEZA 2AJXH 3T0ED 2BVOA 3DV4A 1HQRB 5KSUB 12E8H 4ZTOH 1NUGA 1SJHA 4YEEA 1ZLWH 3ZL4L 4X4MA 1NCAL 3NCJH 1A7QH 3NABL 2FLBT 1U3HD 1OTUD 4YPGB 2C9AA 2DLIA 3VGFA 1FNSL 5C9JA 1XIWD 4JO2L 1YEEL 4TSAH 4P9MH 1KIPB 3P11L 1M71A 5BVJA 5CLWA 1AIFB 4PJAF 2XN9A 5IW6A 2DQUL 4PD4K 4EN3D 3P4NA 1MF2L 2IGFH 3EO9L 2NW2A 4JRXA 4PG2A 2IMMA 5F7KC 3DRTB 2R4SH 4K8RL 4NO3A 1BD2E 3BP5B 1D5MB 4JR9L 1PYWB 4OBRA 4APQC 2I9LB 1N8ZB 4OCXL 1T2QH 2D03L 2BY3A 5L2JA 3PWNB 1QO3B 1EHAA 5HHVH 2AK1L 4KJWC 3RX5A 4HUWB 4FZ8H 1P5UA 5ICXB 5CZKA 5TE6L 2CXKA 3WNOA 1UXSA 4NFBA 4TTGA 3NFNB 2BOBB 2VQ1A 4K3EL 3EJJX 5EC1B 1I7UA 3UX9B 3WEXB 4JN1H 3EDFA 1B0RB 1N6QH 4H1LB 3VGDA 4ODBD 1WEJL 5JPNA 3OPZH 4IMKC 3I02B 3UJJL 1NAML 4F7EA 5DD6A 1RK1B 5B3JF 2BNRA 4HD9A 2EDOA 3P2TA 1HQRA 1TCRB 1NANH 1WWAX 5KSUA 4XP9H 3OR6B 1CLYH 1JUFB 1LD9A 2VE6A 5E8PB 5T1LB 1DQJB 1S5HB 1NC4B 1RVFL 2CDGA 5FYKH 2MMXA 5GHWH 4YPGA 3KG5A 3QCUL 5ACMA 2AQ1A 4OZIE 4Y16B 1JPFA 4RAVB 1IKFL 5HHMB 2D31B 2RFXB 3GSNB 3RDTB 4QCIB 2XTJE 1IEAB 4IDJH 2FL5B 1BD2D 4I3RL 4UTBH 3IKKA 2EKJA 1F90H 1CGVA 1BFOB 1AJ7L 1MCNA 4XNYL 2AAVA 3CU7A 3JWDL 2YK1L 4ENED 5DGRA 4O51B 4F3FA 5HD8C 3BP5A 4O4YL 2BVQA 2BHZA 1N8ZA 4OF5A 1W0WB 2Y07L 4XVSL 1FNGA 1FVEB 1A47A 1K3ZA 5EBLB 5HDLA 1QO3A 4I3SH 1U8HA 4P3DB 5J06A 1O7VA 4UNVA 1QSFE 3WDIA 1AGCB 1S7XB 3JTTB 2VLKB 2BDNH 1MREH 1I75A 5EC1A 4J4PA 1B0RA 4H1LA 1W8NA 5DFVD 3B2VH 1CXFA 5F6HI 3I02A 2EYSB 1DBMH 5DRXA 1RK1A 3WNPA 4MVBC 1A4KA 1WAAF 2VH5H 3TBTB 3TZVC 5DQDH 4GMTL 3MGTA 4ODSH 4PJEE 5FA3B 4XP1H 3EZJB 2IAMC 4XZUA 3P9LA 5GSRB 3FB5B 3IFLH 3KS0J 4OLZL 1WZ1H 3KVQA 1DQJA 1EO7A 2QJDA 2BRRL 4WO4B 1VEOA 3C09B 4LGSB 3DXAB 3DARA 4MQXD 2XTJD 2F58L 4X6DE 4QXTB 4R97C 4ZO8A 1CD1A 4HJ0D 4MZ2A 3LQAL 3MBXL 2CKBB 2EDFA 2IQ9H 4X9HA 4CGTA 2D31A 3GSNA 3TJEL 2CO7B 1TQBB 4DK6A 5AYUH 4PJFB 3T3ME 3WS6C 3RDTA 3ILQD 4LVNB 3GBNH 1IEAA 1DQTA 2XKUA 3OF6A 4YGVB 1M7IA 4LLVB 4DVRH 4AEHH 5SX4H 4PJ9C 1JCKA 1BFOA 1VGEL 4EQ2A 4HF5L 3VXPB 6FABH 2O5XL 4LU5L 3G6JF 4O51A 3RWFB 2PETA 5FHBL 1UM6L 1NBZB 3BAEH 1I9JH 4JM4H 1A6UL 5FDWB 3UO1H 2CGRL 2X09A 3FRPG 1I8IA 3VGGA 4KZDL 4BZYA 3RY6C 2AP2A 4MQTB 1FVEA 3VWKC 5C6TH 2A6IB 2NQCA 4UV7L 3E2HC 4GKNB 3ZE2F 5D6CB 3P9WB 5IW3A 1EMTH 4FFVC 2B0SH 3SO3C 3WD5H 3KAAA 1Z3GH 3JTTA 2DJ4A 4Y4FB 3O8XA 2I07B 3N1GC 4XVUD 1RUAH 5FYJL 3ULUF 2EYSA 3QDAA 3WXVH 3F7YB 4YLQT 3PJSB 3TBTA 5GRVL 2BY0A 5E4IA 3CX5K 3PF2A 5LKNA 3LDBC 2A73B 1HDMB 3QUZB 4KVNL 5GSRA 3FB5A 2PF6A 2Z0BA 3BT2H 3TJHD 3X3FL 3DXAA 4F57L 4FFWC 3U7YH 3SDYH 3PL6B 4OLXL 1U8PB 4QXTA 4Y5XB 1G7MA 4OF8A 5D2LB 2CKBA 3ROOB 3EAKA 2VLJB 4L9DA 1AD0B 5DVLA 4YC2C 1RZFH 2VZ3A 5DEFA 3GMLB 3TP4A 2AEQL 1CZ8L 3WLWC 2YPKA 4RA0C 2Z31A 5CP7A 5ANMA 4WU7B 3MA9L 4YGVA 4PG2C 4Y4KD 3S4SB 3QQ4A 4ONHB 1T1YB 1CL7H 4QTHB 3IJHB 4KV5F 5IEKB 4MB4A 2OTWB 2RIKA 1CFNB 1NBZA 2VLLA 5I8EB 3V6FB 5FDWA 2QR0B 1MQKL 3EYQD 1T7YA 4XMPH 4LARL 3O6LL 3L9RA 2A6IA 3IF1B 1OPGH 4GKNA 1VSCA 4Z6AT 4KTYA 4B50A 1AGFA 3G9VA 1LEGA 3VRIB 1NPUA 3VXSD 4YHLL 1PZ5B 3QFJB 3O0RH 4PJGF 3HAEG 5J1TC 2XRAL 4WRLA 3T0EB 3ARXA 5I1CH 3P77A 3WBDA 5T5FL 2DTMH 1A3RH 3ULUL 2OK0H 4X0KA 1U3HB 1KTRL 4YBQC 2BZDA 1HDMA 4LIQL 4PB0H 4Y1AA 1XIWB 2QTEA 1IC4H 4PJXA 4P0DA 3PV7A 1IAIH 5D1QA 2WINB 4ESKA 4JQIH 4HDIB 5J56B 3PL6A 4M61A 1U8PA 4HULB 5C08A 1K2DA 4J3SA 3ROOA 4EN3B 4OLVH 1EEUA 1LP9E 2VLJA 1LO2H 1GZPB 2X5PA 2X4RA 3GMLA 4LBEB 1T6WA 4XBEL 4HWBL 2QSTA 3H7BA 4WU7A 4WWID 5D5MB 5E5RB 4M7KL 3S4SA 1AD9B 1YEKH 5ICYB 2UVEA 3CZFB 2IH1B 2FJHA 4QTHA 3IJHA 2OTWA 3WFHB 3MLSH 5SWSA 4K3DL 4QGTA 1CFNA 3V6FA 2X9WA 2BSTB 2HVJB 3BUYA 1RJLB 3U30B 3F7PC 4Z7VB 3LKSB 5L6YL 1OM3H 2HP4A 3OQ3B 4KHTL 4G6JH 3SGDH 3M17A 2WBJA 1SYSB 4WHYH 5J11B 3WSQL 4H88L 5F1SA 5CEZL 5L2KE 3CH1B 4A6YL 2VZ1A 5C8JA 1YY9D 5EZLB 4BSVA 1DSFL 1WJ3A 2AJXL 4J4PC 1AKJD 2PXYD 3QFJA 2AJZB 2P45B 1AR1D 2XYCA 4PRIE 4OUUB 12E8L 2WIMA 3T0EA 1NKRA 1L6XA 2B7DT 5DJYA 1A7QL 1WIUA 2W9EL 3IDGB 1TQCB 1X4ZA 2V17L 1OW0A 3QUXC 5CIPA 2JKXA 3QCVL 1U3HA 5E7FA 3STZB 3B9EA 3QUMA 4GRMA 4DTGH 3LD8C 2BCKA 4Y2DA 4TPRH 2OJZL 1OSPH 3BO8B 1JJUA 3EYFA 5AAWA 2IGFL 4YHYB 2IC2A 1BD2B 5DD5H 4ZS7H 2D3VA 4EN3A 3IYLW 2R4SL 3CLEH 2JELH 1GZPA 1AXTH 4IBLT 3QA3A 3VFGL 4N9GB 4XAKE 4UI2A 5E00B 5D5MA 5K9OB 3F7VA 3T0VA 1H3VA 5GRUH 3EOTH 1AD9A 4FZ8L 5J12C 4PJIE 3ARPA 3BE1H 2HT4C 2IH1A 4LGPB 1WTGT 1CE6B 3CGTA 3WL9A 5L2KD 1YNTB 2HN7B 4P46C 2APFA 1KBGL 2BSTA 5J0BA 3CPLA 4V2BA 4H1LH 5JDJA 3C9NB 4JN1L 2VXUH 4LHUG 4L4TA 1N6QL 4HUNB 4PRID 3OPZL 5F9OH 4F7CA 4HS8H 4YUEL 4M93C 4F7TB 4YFLF 2NX5E 3O8XC 2YOCA 3F58L 4Y5VA 1S78C 1S7QA 4HWZA 4AENA 4XPAL 4N1CA 4JFQB 5BZDA 5L0QC 3CDYA 3O11B 4HUKB 5SV4A 3IAGC 3UXFA 4MJ5A 1NMAH 1A6ZB 5FEBA 2YWYA 5GHWL 2XFXB 2W91A 2EZ0D 4N0CD 1HCFX 3AM8C 4LVEA 1CS6A 4ZOBA 2XTJB 3O3UN 3STZA 2PTTB 3C09C 2MOVA 1A2YB 3BOVA 2VXSL 4GT7A 1J87A 3X3GH 4KQ3H 5E2UH 1HEZA 1F90L 4XAKD 1U91A 1X5AA 1F4XH 3DROB 3HS0B 4OCNC 4B5EA 5BJTA 4KMLB 5I74B 3B5HA 1JRHI 1A6AA 1IGFL 2H32A 2Z31C 1URLA 4J3WA 3PABB 3O2DA 1JNNL 1HXMA 1RZJH 3MRHA 4MD4B 2F74B 5EU7C 1KG0A 5IB2B 3SQOH 5IV2A 5LJYH 4OLYL 3WHE1 4P4RB 4JZNA 1KT2A 2I5YH 5K9OA 1G7LB 1RQ5A 1TVHB 1QSFB 5DJ2B 5H94A 3P4LA 2EO9A 3LV3A 4KUCF 1G6RA 4YXLL 4YEFA 1CE6A 1CFVH 4GKSA 1UC6A 4HUMB 2NZ9D 2HJFB 4I5BB 2DOCA 3HCVB 4PGEA 2BDNL 1FH5L 2PYFB 2NX5D 1GH7A 5GS0H 2IQAB 3C9NA 1PY4A 1HE7A 2W0FB 3PG2A 2CSPA 4DGYH 1UA6L 3B2VL 4WTZA 4PLOB 3RGVD 1BQHG 3MUGB 1X5HA 1QSEE 4PJEB 1MJJB 4F7TA 3HNTH 3ZTJH 2YC1B 5DQDL 4JFOB 4NFDA 3OSKA 1J11A 3IKCA 1JMXA 2GJZB 2GSIB 4X6DB 3RVWC 4Z7WE 4OZIA 3O11A 35C8H 5EORH 1A6ZA 4K94C 2CLVB 1JMZA 2NR6D 1O5DT 5CEXA 4HFWB 3K46A 4KI5E 3RWJA 2IQ9L 4M3JA 4XPTH 5E5MA 3BP4B 1NSNH 3DVFA 2QQKL 2PTTA 2XPGB 5D1QC 1EHLH 1Q0XL 2LAGB 1A2YA 4D9QE 5D96B 2MHAA 4LNRB 2VDNL 2LE9A 4GAJL 5K9JH 2D7TH 4U1SB 3HR5A 3WFCH 4DVRL 1AXIB 2AEPH 1R3KB 3GGWB 1MOEA 3DROA 3V0VB 2DBJA 2Q86A 2FBJH 3MRFB 2YPLA 4R7NA 4Y4KB 3MV11 1QBAA 2WSKA 3WYRA 2CK0L 1AHWB 3PABA 5IB5A 3KWWA 1T6VN 1WBYB 3UO1L 2F74A 3QI9D 2DKMA 4RAHA 4XBGA 5C6TL 2X4UA 4XPBH 3FAXA 3IFNL 4QHKI 5CBAA 3ZDYF 1NCBH 3IRZA 3V5HA 5TF1H 1FNHA 2ZG1A 1EMTL 4LDEB 1QSED 5E8EB 3WD5L 2HJFA 4I5BA 3HCVA 2WBJC 3LKNB 3MRKB 4PJ5A 3CSPA 4OCWH 1YYMH 4EQ3A 2OYPA 1MHCB 1WCQA 2NXZC 4LOUC 1I8MA 1ES0B 3AXLB 5ISZA 2W0FA 5HI4D 2P47B 3IDUA 3IDXH 1DQQB 2ZSWA 5JHDA 1IL1B 3VFWB 1O7SA 2A38A 2F5BH 2OTPA 5H37G 2FO4B 4TSCL 2R69L 2FGWH 1ZA3B 4PJEA 4WCYH 1UM4H 3ZE0E 1I8LA 3GMOA 2HFEA 1MCKA 3T0EC 1YEDB 4MSWA 1YPZA 5ESQA 3MCLL 4KI5D 4XC3L 3QHZL 4LAJH 4Q6IB 1FO0A 3L5XH 4X6DA 3MOBL 4LKXB 1OW0C 4N90E 4DFIA 3PWPD 2HMIC 1ZANH 3BX7C 4D9QD 3U7YL 2BVPB 1OTUC 4QNPF 4HJJH 5EBMB 2MQ0A 4M5YL 5F9JB 2W1NA 1JZ7A 3DBXB 4Y2DC 3BP4A 1G0YR 1SBSH 4Z7QF 2A9ML 5TPWL 2X4SB 4OFVA 4TNVK 4RIRB 1YEGH 1LE5B 4LNRA 1P4IH 3WIHH 1P69B 5IKCB 4NT6B 5DD0L 4UTAH 3GMQA 4EN3C 4U1SA 1ZWIB 2DKSA 1AFVL 1R3KA 4OCSH 1XFPA 1HXYA 5EOTB 3V0VA 1J1PH 1IGJB 5ID1A 2GCYB 4XNQB 4WWKD 5D7IE 4NC1C 4QF1B 4X7FC 1AHWA 1A4JA 4C58B 1CGTA 4JO3H 1DBAL 1P53A 3LKOA 5FGSA 1DDHB 2ARWA 5HJ3A 3U30C 1YQVH 2RCSH 1JYVA 5E8EA 3CDGA 4KJYA 5I16A 3LKNA 3V5KB 1U6AH 3HPLA 2DD8H 3VXSA 1ES0A 1QR4A 2PXYB 1ZT4B 4WUUE 4KK6D 1IL1A 1TZHA 2FO4A 2PCPB 4N90D 1KJ2A 1NJ9A 5C0BA 4Y5VC 5BV7C 4PY8J 2OK0L 4POZD 3SE8L 3DIFA 1YEDA 1TZIB 5CS7A 3MLUH 5CZXC 1TQCC 4LEOB 4LKXA 4LF3A 5HHOE 4FMFA 2BVPA 4S0SD 4OI9A 1LP9B 3MUJA 5TE4H 1UXWA 5F9JA 1MRCL 5FKPB 4ZDHA 3DBXA 1BFTA 3OMZA 1HHHA 4OLVL 3SJVE 2L7UA 1LO2L 3CK0H 2FECI 4RIRA 2AKRA 2VXVH 4YHYC 4NT6A 4XX1G 3JTSB 4M7JL 1ZWIA 3GI8L 4WV1B 1YEKL 5EOTA 5I75C 3EFDH 1IGJA 4MXVE 4WHYG 4JM2A 2FLRT 1E0OB 2QSQA 3Q3GA 4QF1A 3MRQA 2NTSP 4RDQF 3BD3A 1I1CA 4OIAA 4MNHB 5L2KB 4J8RB 1OM3L 1UWXK 4G6JL 3QZWB 4WFFE 4FQHB 2O61B 4QTIH 4DJMA 2ZCHH 3QIBD 1ZLVH 3GNMH 1NCNA 4WUUD 3LAFA 5F3HB 1BOGA 2MQ3A 4PRIB 5DF0A 2HH0H 4IJ3C 4QY8A 4U1LB 4XXDA 3VA6A 5GJSH 3AS3A 3V5KA 1JN6B 2VXTH 1OAXH 4YHZH 4O2FB 1MFEH 1AKJA 3KPTA 3G5YB 5DFVC 1YJDC 5DTFB 2VDML 2PCPA 3QPXH 1EO8H 5HHOD 2NW3B 1R5VA 1FYTD 1INEH 1RHHB 1SMOA 2DQFB 2FBOJ 3RWEB 3QISA 2J8HA 3QFDB 1TZIA 3GKWH 2ILLA 2B1HL 1DEDA 4FQ2H 1YEJH 4AM0A 4U6TA 4U6YA 3SJVD 3MXWH 2X7LB 4D9LL 1OSPL 3CDFA 3IJYB 5F72S 4MQXC 1QLRA 2XTJC 1KENH 4MJ4A 1FFNB 4HUUA 3VFVA 2Y06H 1LP9A 4M1CD 4OGYH 4HJ0C 5DRNA 5E8OB 4ZS7L 5FKPA 5EG6C 1YUHA 1T20A 4M7ZC 4BQCA 4S1DD 4XNXH 4G9FE 2WANA 4P57B 1UQSA 4X9BA 3VD7A 3NCCB 5KVDL 3RAJH 5KTEH 5L7XH 4BH8B 1SJVA 5KSBE 3BPCA 3BMWA 1EO5A 4PJIB 3MLPA 3PUCA 3VWJC 3WE6A 2P8LB 5E99H 3MJ8A 5I74C 3EOTL 4WV1A 5TQ2L 1FVDB 2DKUA 4WFFD 5I8OH 2BJMH 1RU9H 2D7MA 3OKKA 2DQTH 5L2KA 2ICWI 3I9GH 4J8RA 3S96A 5DC4B 4S1RH 3QZWA 3RWCA 5HVHC 4HS8L 5ITBL 5JMOC 4U1MB 4PRIA 2IF7A 1C7SA 5ADPL 3RGVB 3FONA 4E42B 4I9WE 1H0DB 5SWZE 2L7JA 2C4XA 1JN6A 2V5MA 2YBRB 1I8LC 4XVUC 3BZFB 4XWOD 2B8OT 1JHLH 2VLME 1PJ9A 4BELD 2ESVE 3GSNL 4YR6A 4P4KD 1RHHA 2DQFA 2Z8RA 4X5WB 3R1GH 3D0LB 4XNMA 3FJTA 3EYOB 1Z9LA 4HAFA 4HBCH 1F58L 3S3JA 3BPNB 1MQ8A 2X7LA 2DQHH 4G9FD 3ZDZF 3TJHC 4KQ3L 3IJYA 4AG4L 4OZGE 5FUOH 4UQ2B 1VA9A 1FFNA 1HILB 5BRZE 3OB8A 2JJUA 4WHDA 5GZOC 5I9QB 1F4XL 4WI5A 1MWAH 2BERA 2PR4H 3VXNB 3PWVA 3D9AL 4P57A 2M8XA 3FRUA 4LKCB 3DETD 3VW3H 5F7NC 3QXUA 1RZJL 4BH8A 1KIRA 5IQ9A 2ADFH 4NPYB 3C5SB 3SQOL 4DVBB 2VUOA 4NUJB 2FWOB 5AD0B 3QI9B 1NC2D 3H0TB 1AHWC 1FVDA 1ZSDB 1CFVL 3RPIB 1HKFA 1DANU 2FR4A 3BUTA 2E6JA 3PGCB 3EOBB 3EYUL 3NPSB 4YIQA 3W81A 4I9WD 1QSEB 4LPTA 3ZMRA 4U31A 5SWZD 3EYQC 3U4EB 4AMKH 1PQZA 1X5ZA 4BK5A 1G0XA 3SBWA 3PXHA 4F9PA 2NX5A 5LVEA 1KLFA 3KYNB 2HLAA 3QEGH 4PJXF 3RGVA 3RTQB 5F9DC 3FKUS 4Z7WB 3LCYA 2VLMD 1H0DA 2ESVD 3WFBH 1RIHL 1W72A 4NKDB 1UFUA 3TBYB 5KN5B 3DUSB 1HNGA 3SCMD 4MNGE 5BO1L 1QNZH 2CKBL 3NZHH 3SKJH 3LKRB 4G9DB 1A6TB 2HRPH 5BRZD 3T04D 1NSNL 3FQRB 4U6VH 3B9KD 2J6EH 1QA9A 3EYOA 4DAGL 1CICD 1EHLL 3REVB 3HE6A 3WNKA 3KGRA 2EYRA 2E7CA 3QNYB 4UQ2A 3WFCL 2VRAA 5GGQL 3HRPA 1GGBL 4YFEA 1I1RA 3CFCH 3VD4A 3D39E 1I7TB 5JW3L 3VGHA 3NCYS 2GJ6A 1U8NA 4WWKB 5HGDB 1FC1A 3MA7B 4LLMB 1ED3B 3RL2B 3BP7A 4R96B 4JM2C 2C3HA 4HIIA 2JTDA 5TF1L 1EA9C 1F4YH 1JTPA 3OJ2C 4EXPX 4LSQH 1UEMA 1UZ6F 4YK4B 5CLTA 3LQMA 2VABA 3HZVB 3X13A 4OAWA 1D6VH 3PGCA 2H1PL 4OCWL 1YYML 4GRLD 2YUWA 3TYGH 1QSEA 2OSLB 4ISVB 3IDXL 3QB7C 5D7KE 4AIOA 2F5BL 4AT6A 2IEPA 5HI3D 4K94L 2X89D 4ZUVB 1YY9C 1CGSL 1K4DB 3HB3D 4I0KA 4P2YA 3PP4H 4Z7WA 4LNVA 2IG2H 2KUTA 3RY4A 1N5YL 5EC2B 2B4CC 1MEXL 3RU8L 2DM4A 4AQOA 1CDHA 3TBSB 3LIZL 4U1KB 5KN5A 1JNLH 4LLQB 1ZANL 4WFGE 3OHXB 2R1XB 4HKXB 5E4EC 4LGRB 3LKRA 3PWPA 5T1DH 1A6TA 3K7UA 3V4UL 1SBSL 4NP4L 5D5MF 2D7QA 4M00A 3D39D 3LB6D 4P23A 1P4IL 4GLRH 4E41A 5C0CB 1UH3A 4S11A 2IALB 4K7PX 2DQJH 2PO6A 1A5FL 2W92A 4UTAL 1IC1A 4AYFA 5D7IB 5JIHA 4H20L 1J1PL 1VACA 1I7TA 2H8PB 2JCCA 2NPLX 5EOCH 1MCEA 4KTDL 3TH2T 3P0YH 4JE4B 2WMPA 4WV1C 4WWKA 3U36B 1EPFA 2B1AH 2FNBA 1NDMA 1QFPA 4IRJD 3JUZA 2NNAB 4NSKB 1YQVL 5D7KD 3QIBB 4G8EB 4LHQB 2DQDH 4WUUB 4BA8A 1ZMYA 4NN6C 3ZKXB 2DD8L 4Q7DA 4ODVH 4LK4A 1U8OB 2J8UA 3VXMA 4OM0H 3K2MC 2DWDA 2VC2H 4IMLB 4YFLI 3S5LA 4U05A 3BZEB 3T3PE 1MVUB 4KAQL 1T3FA 3KPLB 1IRAY 3N50A 4WFGD 1ZGLP 4UIKH 4M6NL 3EOAB 5F8RC 5HHOB 5EOCJ 3FT3B 1UM5H 1WCBA 2PYEE 1JP5A 4HKZB 4YFDB 1N6UA 3NVQA 4DKDC 2CH8A 3TNNA 2VWEE 3HZKA 2X9YA 3SJVB 4JPWH 2EZ0C 4N0CC 5TE4L 3O4OB 4EZMA 3T0DA 4P2OD 3OKDB 4HIEB 4EDWL 3NGBB 3TNMB 3V7AG 5CILH 2VXVL 3QG7L 4ZFFA 3X11A 2A6DB 3ZYZA 5KS9E 2IALA 1WIPA 4OCYH 3JSSA 1CLCA 4ZG1A 5D7IA 5IM7B 1ZHBA 2F15A 4MAUH 4D0BA 1H8OA 3MRGB 3O3EB 4ORZC 4XCCL 1XGYL 2K9UA 4ZPVB 5E1HB 2EDDA 2CLRA 3OR7B 3I84A 5FCSH 1MCLA 2AK4E 4KVCH 3U36A 2BC4B 5HGHA 4LDLB 2AXHA 2EH8H 2Q76B 1BFSA 4WI6A 4Y88A 4MB5A 1U3JA 4NUGH 4QTIL 1XH3B 2ZCHL 5EN2B 3ILPB 1SJEA 1CQYA 2W0PA 3MNZA 4JHAH 4UQ3A 4MNQE 2NNAA 3FQUB 2NY1D 4MHHG 1I3RA 1TDQA 2NZ9C 5BV7L 5D9SB 3I6LE 4OZIF 4IS6B 2DF3A 3SBWC 5GJSL 4F9PC 1CF8H 2VXTL 1NFDE 4RQQB 4KI1A 4D94A 4YHZL 3QPQD 4NWUH 4XVTH 2PYED 2F5AH 4IMLA 3TCLB 1MVUA 2W65B 1ZA6B 1TVBB 4UV4H 1INEL 4R0LB 1ADQA 4MA3A 4YHMH 4HLZH 5JIIA 1HNFA 2Z9TA 1NUFA 5GJTH 3GKWL 1FYTA 4P4KB 4XPGH 3OB0K 4FQ2L 3KXFB 1AY1L 4HKZA 3MXWL 3RIFK 3UPRB 1T22A 5DR5H 2NR6C 5LCVH 4JRYE 3HC3L 3CMGA 4Y0GA 3SJVA 4G9FB 4V1DE 4HW6A 4NRXB 5J8OA 1E27A 3BPNC 3HE6C 4F2MA 3OKDA 5IB4A 5KSBB 3I2CH 5FKAB 4XNXL 1G9NC 1CT8A 3RAJL 1AE6H 3GHBH 4K23H 3K2UL 3MZTA 4MLSA 2A6DA 1A02N 5IMOA 3TVMD 1T7XA 4C56E 1MSPA 2AK4D 1ZLUK 1MLCB 5IM7A 2R0ZH 3KPQB 2NLJB 5ADOH 3MRGA 4FQXB 2R0WH 3O3EA 5I8OL 2BJML 1RU9L 3GSRB 2HTKD 4MCYB 1N0XL 1WFOA 4ZPVA 4MNQD 4UILH 2ZZUT 2HT2D 1BQLH 3MLVL 4LFHD 5CJXA 5J89A 1H9VA 3I6LD 3HZYB 2P43B 1YEHH 4YX2L 1U8IB 4MZ3A 4PJEF 2Q76A 4ZXBD 3V4VH 1YN6A 2MKLC 3PWJA 4ZNEE 3PGFH 5LBSH 4OZ4B 4K7PH 4JAMB 1XH3A 3ILPA 4M7LT 5IHUH 3FN9A 1YPZF 5SWZB 5EU6E 3FQUA 2R1YA 4X6DF 3RP1A 3FT2A 2EXYD 5D9SA 4NQVB 2Y25A 4IS6A 4QRQA 2HJKB 1FL3A 2BOCB 2ZCKH 1Q94B 4RNRB 1N3NB 4TNWK 2ESVB 3TIEA 4KC3B 1MFDH 4QOKA 1BJ1H 5F71A 4ZUTA 3SCMB 4R0LA 3ARGD 4BUHA 4JRYD 3MRNA 4V1DD 5MHSE 4KI5C 1ULVA 4HBCL 1NBYA 4OZGB 4P4KA 4O5LH 5FOJA 4DEPB 4KRPC 3WCYA 3B9KB 4DN4L 3UPRA 2R2HB 1I1YB 1CICB 3MBED 1DLFH 1XGPB 1KEML 2YRZA 4G9FA 3DUUB 3DX8A 5KVEL 4NRXA 5E7BA 1M6OB 4C56D 4Q9RH 4P23C 3HE7A 4HWNA 5KSBA 5GRYA 1Z5LB 2OJEA 2PR4L 5FKAA 2VN4A 2PO6C 3VW3L 2ADFL 2A83B 3I3EA 3JZ7A 3D5OF 1Z9SA 4DKFH 3W11D 1KULA 1NCDH 4PY7A 1H15A 3KPQA 4Q58C 2NLJA 4Q74A 4XCYA 5F7WC 3OTTA 3DVIA 4WWKC 1OLZA 4K7FA 4RMUA 1NC2A 4MCYA 1X9QA 4IOFD 5F96H 1P84K 5EU6D 3DX7A 5KVMC 4S1SH 2MPAH 4AMKL 3B6SB 4MCZB 4OIIH 4TQEH 5KW9L 4GRLB 1FSKB 3IDIB 4OZ4A 4F58L 2GAZA 2OZ4H 3H3KA 2UWEE 4TOYH 1P7QD 2ICEB 4I13B 5INDA 3VFRA 2YWZA 2QQNH 4S1QH 4RSVA 3QEGL 5F7MC 2G9HA 5D70H 1FO0L 4OD2B 1IGCH 5F6IC 2DM7A 4MNGB 4L4VA 3GO1H 5MHSD 5HYIA 1TITA 1N3NA 4ZOCA 1IGIH 4BQBA 1CIUA 3HLAB 4FS0A 1QNZL 3C2AH 3NZHL 3SKJL 1W0VB 4CKVX 4POZC 3SCMA 4ELMA 1PAMA 4K3HA 3HN3A 43CAB 4U6VL 2J6EL 2YD1A 1SY6H 1XZ0B 4OZGA 1XGQA 5FO8B 3VGAC 5MP6H 4UOW1 3D85A 5BRZA 3BSZL 1CE1H 1JPGA 1CICA 3QIUD 4X6CE 3WXWH 3D39B 1XGPA 2E27H 4JM2F 4XB8A 3MV9E 4L8SA 3DUUA 3TYFA 2DN7A 4BZ1H 1PZUB 3ARDC 1UVQA 1QSVA 5ID0B 3EJZD 1R3IH 5DD3L 1GZQB 4JG0H 2A83A 3IDNB 3PIQB 2EYTB 3BHBA 1L7IH 3L3IB 3GSUA 4U1IA 1TXKA 3WFZA 2JE8A 1U92B 1JIBA 4Q9QH 4LSQL 3A6BL 2Y36L 4FTVA 2YA1A 1JV5A 2EDNA 3DMMC 4NC2B 4ELKB 3TYGL 1KPVB 2XACC 1U2CA 3D48R 4TRPH 1KJ2L 3BMVA 4GRLA 3IDIA 5B4MD 1PY9A 2FH8A 2VDQH 2ICEA 2CDFA 1NGXA 4I0CC 3ZKXC 1BREA 3PP4L 4OF0A 2IG2L 3U2SB 1YMHB 3NH7L 4OD2A 2X89A 1ZVHA 5GGRB 3VDAA 4DCQB 1J18A 1LP9F 5HGAB 1QG3A 1JNLL 4Y4HA 5HY9A 1B3JA 5KVGL 4NDMA 3HLAA 5FXCH 1OP5K 3CVHA 1MFAH 1Y0LA 3R0MA 3N0PB 1O0VA 4IIQB 2Q3AA 4DZ8A 4OGAD 5ENWA 1XR9B 3JVGA 3MV9D 3H9SB 2ZJSH 1RZIB 4GH7B 5I17A 1F4WH 4U6HB 5EU4A 2PUQT 1SEBB 4P2OB 4RAUB 4PJAE 5FO8A 5DRZB 4HXAH 2X4OB 4XHJC 1QR1B 4YQXL 1AR2A 2DQJL 1YN7A 2CXGA 5EO9A 2J5LB 4RGNB 3D39A 3ZO0A 4M1CC 3KPSE 4YHKH 5GXBB 5ID0A 5EOCL 5GS3A 4R3SA 2GIYA 3A6CH 5GRVK 1N6VA 4LPYA 4CN4A 3VFNB 3BVNB 4UIMB 4F8TA 4S2SB 4Y2OA 5DJ0A 8CGTA 4L8CA 5DFTA 3UROR 1WFTA 3SGEH 1PG7W 4I2XE 4MGXA 1GIGL 5MERB 5CGYD 4HIXH 5CJXC 4ETQB 4JPVH 1MCOL 4ZOEA 5D93C 4IRJA 4LPVA 3W39B 1CD9B 3RIAK 5BS0E 3GUTA 2NY1B 4B7LA 4ELKA 4YXHH 1KPVA 2G5RA 4NZTH 2B4CL 5CMAB 4HCRA 1J12A 2RB8A 4PGJA 2HKFH 2GFBB 1D5IH 2EXWD 2G5BB 4GAFB 1F6FB 1HHJA 1A14L 5JW4M 2C5DC 1MLBB 4DN3L 3UJTH 3C87A 3BZ4B 4JY6A 1ITBB 4K7PY 4L3EE 2PYEB 3QUYD 3U2SA 5HHQB 3LN4A 3C5JA 5DRWA 5E2VL 1UM5L 1V3KA 4WY7H 1I3VA 3K1KC 3MROA 3O81A 4R0LC 4GQ9H 2AXJA 2UZIH 3LVEA 1VGKB 2DIJA 4J6RL 4NWTH 3U0WH 1KN2L 1NCTA 4JPWL 5I1DB 3NACH 3B5GA 4P4KC 4QT5A 1T2XA 1IQWL 3GSQB 3MODL 1A3LL 3KPSD 2GITB 2DQIH 4U6HA 1R5WB 5DHVB 4P2OA 2XG5A 4RAUA 4Z7UE 5IFAL 4TUOA 4E9LA 4FQLL 1NDGA 4ZUUB 1ITCA 4CN6A 3HE7C 2K1MA 3TVMB 1HH6A 3G04A 1U9KA 3DETC 3ARBD 4GRWE 4HMCA 5IIEB 3QO0B 5B8CB 4Z5RB 4I18A 1WIOA 5D7LE 2EH8L 2R9HC 5BS0D 4MNQB 4UIMA 4AEEA 3P73B 3O9WC 2OMNA 5JXED 5LGKA 4J1UB 4W70A 4ZXBB 1XF3B 5MERA 1DFBH 4ETQA 1NFDB 5EPMA 2J88L 3PWLB 3J8F7 2XZAH 3W39A 3U6RA 4L3ED 3PHSA 3MOQA 1BLNB 4OKVA 3V6ZB 4HLZG 3L7EA 1UENA 2GFBA 4XVTL 1OGAB 5GGSB 4N8PA 1UH4A 5C9KA 5L8LB 5DS8B 3RKDD 2F5AL 2W07A 2Y5TA 3T1FB 3FQNB 2NXYC 32C2B 4NZRH 2FX8H 5DJAB 5T5NF 4YHML 2PYEA 5HHQA 1QOKA 5GJTL 3SE9H 1FGVL 2J7LA 1FZMB 5HGBB 5JHLH 3ARGB 5TGBB 4V1DB 3Q5YA 5KANG 3SCMC 2DMBA 2P4AB 1UWGH 4RWYH 5IBLD 1MRDH 3FCTA 1VGKA 2CMRH 4N0UA 5LCVL 1CCZA 1QD0A 1IAIM 4JN2B 4EDXB 5C0RL 3MLRL 4OM1H 4HX1A 4HQQL 1ZHNB 2KPNA 1ONQB 2X1OA 3I2CL 3GSQA 3Q0HA 5KS9A 2VDPH 3FOMB 1ETZB 1ZHLA 3D0VB 5DHVA 4K23L 5CD5D 4C56B 1MY5A 2EICA 4L8SC