5I6XB

X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB02
4U7KA 1RZ8A 3VE0A 3ARBC 4HK3N 3CMOL 3QEGH 2A0LD 3GHEL 4PB9L 5DMIH 3ULUF 4P9HH 1NMCC 2IH1B 5BS0D 4OLYL 3ARBB 2BXZA 4XNMA 1HINH 1DLHA 4ALAL 5FYJU 5T3XL 1NMCB 2IWGA 1TZIB 5LWYH 4LKXA 4HIJB 4UIKH 2R56H 5GS0H 3PGCB 3LB6C 2V9QA 2YC1B 1ZT4A 4UV4L 2CRMA 5F7MC 5I73B 3FO1A 4MJID 4OCXL 2VDRL 5JXAL 1OAKL 1D6EB 4H1LH 5IBTH 5EU6B 5I2IA 3C2AL 2ORBL 3F65A 1SY6L 2VDNH 4YHNA 3BRFA 4KVNH 5F7NC 3TC9A 5D71L 1NCUA 3TIDA 3RZCD 2A6DA 2ZUWA 3FN3A 3RWIA 5BW7A 4AL8L 4LSUL 4TUOB 1ZVSB 3OJMB 2EE6A 2WW8A 2YMXH 1X5YA 1GZPB 3CX5J 4PJ7E 2X4PA 4OLXL 4V1DA 3TBYB 5T3ZL 2VDQH 4NM4H 1A3QA 3UJTL 4DK6A 4ZSOB 1TDQA 3BH9B 1KIRA 2Z31A 4EI5C 5I8EB 5IVNA 1R5IA 4J2XA 5A3IC 1LEGA 1J05A 2HN7A 1HSAA 4EI5B 2FBJL 2E9BA 4GAFB 1W0WB 5C0JA 2OZ4A 3RAJH 1X4XA 2AGJH 2IAMA 5KS9B 1UWXH 3DJ9A 1U8LB 5BZWA 4NQVB 3CFDB 1WZKA 5BZDB 1MFEL 5EZIL 2P44B 1PQZB 4PPTA 5JOPD 1BZQK 1AQDA 4PGCA 4Z0BL 2WP3T 2PYEE 3GKWL 4MD5A 4G9DA 4NKQB 4IS6A 5DVMA 3VJ6B 1YEHH 5H35A 1YYLL 4U3CA 4JPIB 4LQFH 5JIPA 5HGDA 3L95B 4I4WB 1FFRA 2Y07H 4PRPE 3LN5B 4XCNA 4S1DD 4PLJD 4KUZL 3TVMD 3QDMB 5I1IL 1DDHB 4AENB 1NANI 5C0BE 2DQFB 4WHCA 2Q87A 5KSVA 4WFEE 2O93L 1QO3A 2QSCH 3BP4B 3V6OA 3GHBL 4FXGB 3V95A 1IZKA 2ZUUA 3OZ9H 5LGJA 3DXAE 4HLJA 1HHKB 1KTDB 3BIKA 1FDLH 1DBJH 4OV6F 2EEBA 1XAUA 4MD0A 3MRFB 4F37F 5D72H 1KT2B 3BZFB 5C0AE 1L7IH 3WFBL 4IRSA 4JM4H 1PDKA 3OWEA 5ITBL 2XG5A 5GZND 4POZD 2WM0A 5E8DL 2QHRH 3U6RA 4WUUD 4P5KB 1CGSL 1FE8L 4TN9A 3EDDA 4OLZL 4DFIA 1JF5A 4JFFD 4Y16C 3OKKA 4JKKA 2XV6B 4Z7UE 3G6DL 2JB6A 4CKVX 4Y4HC 4Y16B 3TYGL 4JRYB 3C5SA 2YD3A 4JE4B 1E6OL 3I2CL 2A6JB 4GRLD 3PQYB 4X99A 4YNYA 1I4FB 2R0WL 4U6VL 4Y4HB 4XI5D 1IT9L 1QUNA 5DHVB 3GJFH 1CK0L 3QI9A 5C0GB 1G9ML 3ARPA 2VDOL 5HBBA 1EHLL 2AXJA 1MCBA 5E1AB 2IH3A 4OD2B 1TVBB 2XXMB 1RZJH 3CUPB 4L1DA 3UPAA 5JW4M 3KPQB 4HKXA 4YDLC 3RIFK 2E5EA 1YMME 2F53A 4HAGA 4YGVA 3UAJC 3LKQB 3RJQB 4JHBA 3WN5C 1F3RB 4X6EA 4YDLB 3HNSL 3REWB 5IOPB 5KANI 4G6FB 4ZNCD 2J8HA 5FUOH 3WN5B 3BKJL 2F5AL 2XRAL 3RY6A 2HT2D 4XPFH 1U0QA 4HQQL 3WL9A 3C6LD 2Q76A 4QKXB 3NFNA 4JM2F 1INDH 4PJEF 2GAZB 2JKXA 5F6IC 4D9QD 1PLGL 3BZ4A 1RZFH 2CRIA 5IUSA 4YHLL 4H88H 4RNRB 1I9JL 1ADQA 3RWJB 5C3TA 5F6IB 4O02H 4ZSOE 3C5ZD 4YDIL 4OB5H 4HUVB 3QIBC 2Z8VC 4WTWA 4N1CA 3LPFA 3O0RL 3BXNA 4WTXA 4J7RA 4PV8B 2IG2H 2WBKA 4K9EL 3TO2B 2VLRE 1QR1B 4TULH 3QYCA 1GAFH 1G1YA 3QIBB 4BH7A 4M43H 3FRUA 3V0AC 1UQSA 1R5VB 3NABL 4XGZB 5E24E 5C08A 1R3JB 5KS9E 3V5DA 2CMRL 1FQ9C 2Z91A 2WNGA 1QFPA 2YRPA 4L9DA 2ZPKL 1ZGLP 1REIA 5JPNB 3MA7A 2WK2A 1CTOA 4GW5A 1S78D 2OLDA 4G42B 4HK0A 4FRWA 4KJQC 4XMLL 4HDIB 1ZLWK 5KG9A 3S36H 1UB5B 4YXKL 1QPXA 2PCPB 3S4SB 4NPYB 1X5HA 3IU3A 4K3DH 4JO4L 3GKZA 1I85A 1QA9B 3W5MA 1FO0H 1IGFH 2CGRL 3A6BH 1WBZB 1HHHA 5EZJB 2YD9A 4GMSL 1U58A 1NGZA 4LGSB 3UDWC 5E6IC 2NY6D 3QUZD 4PJBB 4FXKB 5I76A 1CYGA 4M8QB 1ZE3C 2HLAA 3ES6A 4C56A 3WEXB 5E6IB 4XRCB 5D5MA 4JRXD 2ZOKB 4CN6A 4K3GA 3SY0B 6FABL 4M3JA 1N4XH 3OAYK 5L2JA 4WFGD 1CR9L 1QQDA 4NUJA 1EGJH 5E9DA 1BZ9B 1BJ1J 4NKMA 4NFCA 1L6ZA 5ADPH 1FFPA 1IKNC 4YBLC 1QLRB 4LPYA 1MLCB 4MNGB 2V7HA 3KPSD 4Y5XA 3GGWB 5EA0H 4JRYE 3UJJH 4ZO8A 4YBLB 3JBG7 1LD9A 4EDWL 4O9HH 2P8LA 3PQYE 3KLAB 4PB0H 3MV9B 3K2UH 5EBMB 1Q9KA 3NN8B 4JFPB 5ID0A 1EHXA 4DGYH 3IAGC 3ESVF 2JCCA 1KGCD 1S7UA 3KYMA 4U6HA 3TCLB 1EHAA 1HCVA 4X7FC 1II4E 2BVYA 1RIVH 4RWYL 4LCUB 4JLRB 4I3SL 4JFZH 2PW1B 3V8CA 2ZJSH 5KW9L 1BEYH 2BSED 5DK0A 5CZVL 3NCJL 1HDMB 4U1LA 3W11C 1IAOB 3D25B 43C9B 1MFBL 5EWIH 5FYLL 1T2QH 3ARDA 3EBAA 4KPHH 2CD0A 3M8OL 4Y4FA 3QQ4B 5CMAA 3L3GB 1CFVH 3RDTC 1F8TH 5C1MB 1NUNB 1VB9A 2XKNB 5FKPB 2DQCH 3RDTB 2VOTA 1XGPB 4U1KB 1GXEA 4QXUH 3G5ZA 3T0VA 5EUOA 3KPLB 2AW2A 1W72B 4KKBC 4WW2C 4DN4H 1EXUB 1QFUH 3F7YB 43CAB 3WKMH 4HUXB 4WW2B 4KHTH 3IU4H 4HF5L 5M7QA 3FO2A 3HE7C 4G6JL 3TJHC 4EUPB 5E2VH 1T21A 3RWHA 4TTDC 5DMJB 4DQOL 4Y8DC 3T1FB 2VDPH 3RWFA 2I9TA 5IESH 3MRCB 2VQUA 3HE7B 1VFBB 4FQJL 4MDIA 2YA0A 3T0WA 2CDEA 2AV7A 1YZZA 2HT3C 3OR6A 4H5SA 4P9HC 4PRBA 3UYOD 4GAGL 4TSAH 9CGTA 1J5OL 2P43B 3U46B 3ZDZF 3JSSA 2YA1A 1MCFA 3C60C 4NJAL 4XVTH 2PXYC 3IVKA 4HLZH 4L5FH 5TFSH 5GS0C 2HTKC 4NO3B 3VD3A 3C60B 3HMWL 2YKLL 3WFCH 2CIIB 4KI5E 2A74B 4MQ7B 5FF6B 3FZUD 4ZQKB 1IE5A 4LASL 4M5ZH 3T3ME 1YN6A 4WU5B 1U95B 4QT5B 3TPKA 1AP2A 3S5LB 2MTPA 2P24A 1EEZB 5DO2D 3PP4H 5H94B 4NWUL 4UT9L 4TSCH 1QG3A 4PY7A 4NT6B 3PDOA 4XAWH 2AJXH 3NCMA 4YHKH 3VWKD 2VAJA 1P1ZB 4J6RL 4Z7VB 1AGDA 1QOKA 5IEHB 4LARL 3SE4C 3OXSB 5DDHB 2HG5B 4L8CB 3I6LD 1A7OL 2ZKHL 2R29H 5TE7L 3KPNA 4IMKA 4RFOH 2XA8H 3V0WH 4LHUB 2F5BL 2FIKA 4LU5L 5T5FH 2EKSA 2JJUA 5I1JH 2CSPA 4KRPC 3NIFE 3MJ8B 5FGBA 5T5NF 1T22A 5E5MB 4LLWB 4MNGE 1N64L 1JNHB 1FG9C 5AYQA 3IDMA 4GAJH 4KRPB 3D0LA 2NY4B 3SGKA 3V9FA 1TXKA 4Y2DD 1SJHA 2HT4C 2Y9RT 1MQ8A 3CH1B 5A40E 5T1KA 3MV9E 4MD4A 3TNMB 5KJRL 1YNLH 1T83C 3HG1D 2HKFL 1NCAL 3FQXA 1I7TB 1RJLB 4XBPB 3FQWB 4LQ1A 4PD4K 5GZOC 3VD7A 2KZWA 3GFUA 4HUKB 4F58L 2WBJD 4FFVD 4M7LT 3V4VH 2BRRL 2R8SL 5HHQB 3HPJA 4P3CL 4JDTL 4YHOL 4N1EA 4J8RA 2AJYL 4D9RD 3B2UC 5F9JA 3DROB 4Z6AT 2W9LA 5CGMA 1ZHNA 1F3JA 1V3MA 2R2EB 3RFZC 1KV3A 3SE8L 2YN3A 2XI9A 3GSNH 3EYUH 2VZUA 5E95B 3INUL 1R3LA 1JTPA 2Q20A 4U4BA 2C4XA 4AM0A 1E4WL 3MNWB 2BOBB 4Y4KD 1CE1L 1IM9B 3TN0A 1EBAA 1ZEAH 2WP3O 3S4SG 4X6FB 5DJ8B 2J3SA 5GGTH 4HPOL 3NOIA 1CLYL 1T1ZB 5EBGA 3VGHA 2P8PB 3MUGA 5A16B 1IGIH 4TSBL 3T0XA 1CFBA 4PTTA 2ICWJ 4PBWD 1YNKH 4XNZC 2RGSA 3CD4A 4YIQB 3WIFA 3V5HA 4LSTL 4OGYL 2XFXA 1N5AB 5J57B 1DP0A 4MXVF 1KG0A 2ZCHH 3IFLL 4AQOA 3QHZH 1MJUL 4XNZB 5CHNB 3WLWD 1JGDA 5KSUB 1QSFD 2B4CL 4PJHF 4FQ1L 3HR5B 4P2OD 4KDTA 1U3HA 1RZJC 1T20A 5B21A 5DFWH 1CD8A 2CPCA 4F80A 1NAMH 1VEOA 1C1EH 3G9AB 2AJUL 5DI8A 4HJGB 1NMBL 4Z7WA 5A2LH 3KR3L 2COQA 5IV2A 4NDMA 3D6GA 2FNBA 1TENA 5FKAA 2IQAB 1E28B 5HYJA 4XT1C 1KB5A 2NY0C 4U1NA 1U8NA 2DQTL 1S3KL 3I3DA 5I1GL 3P4OA 2D4DA 2GJ6B 4URTB 2NY0B 1CXIA 1ZA3A 4CVZA 1UADC 4JY6A 4M61A 5I19H 3G6AB 2YN5A 1KSRA 5FHAH 5DRXB 4APQD 4F7TA 4TPRL 4X9BA 4D94A 5F88A 2R1YB 3CVIH 3DI2B 4PJ8A 4DGVL 1B0RA 1FNEA 1T1YB 1JYXA 1YY9D 3MMEA 4MVBC 5AUMA 1C7TA 1Z5LA 4JKLA 1NL0H 1ZHLA 1MHHA 1GSMA 4LAJH 2HJLA 1RFDL 5MERB 4UV7L 1KFAH 1JGUL 1YPZB 5J12C 3AMKA 4Z7VE 3BPNC 4KXZI 1V3KA 3LEYL 4WUKH 1I8IB 4RX4A 4ZFGH 5F89A 2AK4B 3BPNB 2ZZUT 3QUYD 5DEFB 4YXHH 3D3VA 5FA4B 25C8H 3VXSA 4HXBL 4XPHH 2NY1D 5JUEH 5IG7A 1YEKH 3QXUA 1B0GA 2YZ1A 4NNXA 1EO5A 3B6SB 1YMHB 5ICXA 4XP1H 4G9FD 4LHJB 2H3NA 1DBKH 1QBMH 4K8RD 2APBA 4BSJA 5ELIA 1QYGH 5KVEL 4OQTL 4MJ6A 4KH2A 1T6WA 4NO2B 4N0UA 2A73A 3LMJH 2LQRA 5IHLB 1OAZH 3AY4A 4EUPG 1GZQB 1BOGA 2VLKD 1SM3H 3MSPA 2OSLB 3ARFC 2P8MB 2W65A 1ETZB 1AGCA 3LRHA 5C8JB 3HMXA 5SWQA 3ZKMC 1A7RH 3IJHB 4GUPA 4TVPH 3ARFB 1FO0B 5GS1A 4Q9QL 1BJ8A 3PHOA 3DMMD 2EZ0D 3CFKB 5KAQF 2IBZX 4QXGL 2D4FA 4ORZC 1P7KB 2CR6A 1VENA 4MWFA 3G6JA 4I8DA 4K3JH 2AXFA 1IQWL 3QPXH 3QNZB 3RVTC 4KZDL 1I3RA 1Q72L 1A6PA 4LPXA 5C9JB 1MJ8H 4IOFC 3AU1A 1IEHA 4MAYC 4OZFA 5GSRB 3HC4L 4ZUVB 3QNXA 1ROWA 4H1LG 1G6RH 4ONGL 3MRBB 2KH2B 1WAAF 2ATKA 4GG8B 4MAYB 2F8OA 1UENA 3S5LG 3VMOA 2O5XL 5H37H 3MRDA 3JXAA 2LABA 2YR3A 4NQED 3IFPA 2WUBL 2HFEB 5DMGD 5IB4B 1HIML 4FQ2L 4WHDA 1OP5H 3OGOE 4Z8FH 2Y72A 5DMYA 1DL7H 5I16A 4YO0A 1ONQB 3PUCA 4O5LH 3ARTA 4DW2H 1T5XA 4QRTA 1UWGH 2Y7QA 3HZKA 5F96L 5CGYC 3NA9H 3C8DA 1GGIL 2AQ3A 5C0CD 4NWTH 3RRQA 2DLHA 2ZCKL 3RVVD 1DQDH 4PREA 2YSSA 3V4UH 1UWEH 5E03A 1PSKL 3KPRE 3E6FB 2GTZB 5IW6B 3LY6A 4GBXC 5CINL 4LCCA 3LKRA 4OLVL 3I6GA 4I3RL 1CIUA 4HUWB 4O2FB 2YXFA 2UWEE 2OL3A 3CMOH 3U1SL 5DZLA 4GBXB 2G75B 2DDQL 3GHEH 3QJHA 2GW5A 1BBJB 4KMQA 3F5WB 3E8UH 3QA3B 4KRMB 4OLYH 4NO5A 5GGSA 2XN9D 4EZMA 4HIIB 5T3XH 3FB6A 5E2TH 5FECA 4RA0C 2VR9A 4DCQA 3QEUB 4BSVA 1ZGLA 3QHFL 4L4VB 4UV4H 3VXNB 3QXAA 1VKXA 5HGBB 4PRNB 1X5IA 1TETL 4OCXH 1UVQB 3X3GL 3DUSB 1EAPB 2VDRH 4JFEE 5JXAH 2BJML 2GSIB 2Z35B 3O4LD 1XF4B 2GUOB 3C2AH 1YPZE 2F74B 2ORBH 4TUKL 1QLEL 4N9GB 3QUKB 1NC2A 5D71H 2C4FT 1BFOB 1KLUA 4IBLT 1BHGA 2N4IA 2AK4E 2X4OB 4OAWB 4AL8H 5D2LB 1AGFA 1ZS8A 2C1OB 3LKOB 2W9DL 4GLRH 2CDFB 2X40A 1BQHG 3GK8H 4OLXH 5T3ZH 2PYFB 5EPMB 4MQSB 2BHYA 4PJAB 5E8EA 3MA9L 5EZLA 4KK6D 2XICA 3WHXA 2XACC 4M5YL 1MWAL 2R1XB 5JPMB 2NYYD 3T08A 4OI9A 5J1AB 3BN9D 4YFLI 4GG6F 1JV5B 3U2SB 1XF5B 5ESQA 5JXEA 3MNVB 1WFNA 1P5VA 1TIUA 3CDGA 1OHQA 3DETC 4PRIE 3C09C 4F7CB 2PW2A 3BQUA 1MFEH 4OCMC 5ESAB 3GMRA 5EZIH 4BH8B 2EXWC 1AE6L 4Z0BH 3C09B 2BZDA 1MPAL 1FV1A 3VRLF 3GKWH 4ZAKA 1SEQL 1OAUL 1NGYB 4O4YL 1OGAD 5GGSY 3OB8A 1B4JH 1I8LC 1CFQA 3THML 3K0WA 4PJ7A 5IFJA 4J3XA 4Y5VC 1WICA 2FGZA 1CLOL 4PRDA 3NPZB 3KS0H 3BPOC 5EB9A 4L8SA 5DHYB 2ADFL 3QUXC 4RDQG 3RI5K 5L8LB 2N56A 4Y5VB 4OZHB 1AGEB 5F7KC 4JQVC 3BPOB 3GHBH 1P53A 2M8XA 3BO8B 5MENB 1G6VK 4XXDB 3QUXB 4R26H 4HHAB 1FPTL 4P23A 1XGUA 4UAOC 1JPGB 4WHTB 4QHKJ 3UZQA 4D0CA 3QIUA 1A1MB 4Q97A 1KTLB 3STLB 3Q5TA 4UAOB 3GJFK 5ITBH 1HZHL 4HJ0C 2VISB 2PYEA 1MAJA 3NACH 1NC4A 1JHKL 1CGSH 1FE8H 2X4RB 1I1FB 4JKMA 5CJ5A 4OLZH 2YEZB 3NCEB 2OTUA 5I8CB 3BUYA 4PRPA 1YY8A 3PWVA 4FHBD 4ONHB 1Z0NA 4QHKI 4QO1A 5I15L 5DEGA 1H3WM 4OZ4A 2X4UA 3G6DH 3O9WA 4XMKL 1MCHA 3UBXB 5H2BA 1PY4A 2A83A 2FATL 1PFCA 3VGAC 4NCDA 4R96B 2GK0A 5C0BA 3I2CH 4MYWB 1NEZB 4LNVA 3SPVB 1M1SA 4PJDF 2R0WH 4U6VH 3VGAB 1YA5A 5JORB 1DBML 1IT9H 4JFDB 1CK0H 4LSDA 4U1SA 4O2CA 1G9MH 1MH5A 4NZJA 4ORGB 4GKNB 3DXAA 4UT7L 4WEBH 3U7WH 1LEIB 1AIFA 1XZ0A 5HHOD 2RBLA 5J1TC 2FSEB 2DD8L 1G7HA 5C0AA 3AS1A 3GSNB 2ARJB 1BMGA 1A64A 3R0NA 5JHDD 4X5WB 1TJHL 2LFGA 5INDA 1CF8L 2AKRB 3GSXA 4M6ML 3QH3B 3W39A 4F3FA 3HNSH 4RAUA 1AXSA 1MI5B 4UUJA 4OLUL 4Y89A 1FJ1A 1EH9A 3OR7A 4Z7UA 3LVEA 2W60B 4LRIA 4HX1B 2DTSA 4A6YA 1U8OB 2F5AH 2XRAH 3WFHA 2R0LL 3TNNB 4HQQH 5DYOB 2RFXB 4WFFE 3DVNA 4PJIF 5HDOA 5E8NB 4RZCA 5D2LE 3SO5A 1PLGH 4J4PA 4LAQH 5DVLA 3T0DA 5FK9A 3GSRB 4YHLH 2ESVE 4PRHD 5D1XC 4UQ2B 3SDDC 4PJAE 4YDIH 1ZHBB 4CADB 3ARGC 4KKNA 1DN0B 5ISZD 1SJEB 1UFUA 1ZSDA 2IH1A 3LD8C 1NAMB 4P9MH 2CH8A 3O0RH 4C59B 3ARBA 4P3WA 2ITCB 5D1XB 3SDDB 2J12B 3IB4A 3O6FD 4K9EH 3ARGB 2VLMD 2QTEA 2AAVA 1YMMA 2OQJB 3LD8B 3H9ZA 3OF6D 3V5KB 1TZIA 4G7VL 1HXMA 4HIJA 3KLHD 1C5DB 3MACL 3NABH 1IZJA 4QYOB 4P2QD 5GPRA 3LKNB 1DVFD 5C09B 2CMRH 4U1HB 4IDJH 3MV01 5ADOL 4YFLF 1K9TA 1BLNB 1ZWIB 5IB5A 1U6AL 2ZPKH 4LRNL 2OX5A 5C0DA 3VH8B 1JWMA 2MCG1 3QIWC 4LPTA 3ARXA 2JELL 4AJ0A 4DTGL 1AHWC 1JBJA 4TUOA 2HMIC 4EXPX 4RMWA 4XMLH 1HEZB 2VH5H 1MELA 3QIWB 4YXKH 1TJGL 4OLWH 3C9NB 5DS8B 1AHWB 3VXUB 3H7LA 4ZSOA 1YEEL 1PYWA 3BH9A 4H20L 2R23A 4HS6A 2CGRH 2R69H 1F4XL 1KUMA 4GMSH 1Z2KA 2VLRA 1BWMA 4EI5A 4NQXB 3RKPA 2V9RA 5MENE 1W0WA 4OZFG 3HHRB 3EZJB 4CGTA 1RJYB 4ERSL 4PS4L 1JMXA 5KS9A 4NQVA 4XPAL 4MDJA 5BZDA 2VDML 6FABH 4G8GB 5JW4N 1QZ1A 4OBRA 2UYLB 1N7ML 2X1PA 1TNMA 2V5RA 4Y19E 1CR9H 3JZ7A 3VRIA 1S9VB 1N6UA 4Q0XL 3OSKA 4LEOB 4X7TB 4JPIA 3HI5L 5TGBB 4I4WA 3SJVE 4KV5F 1MJ7H 4X6CB 1JRHI 4WHYG 1AD0A 5IMKA 5HI4C 5SWZD 3EJJX 1DDHA 4AENA 1OARL 1R3KB 1BQLL 3LS5L 4EDWH 2DQFA 4Z95L 2VYRE 3VXMB 1FVEB 4GT7A 3SCMC 5HHMD 4QF1B 3BP4A 1P9MA 4ZFFB 4JFDE 1PZ5B 1S5HB 4FXGA 4O2EA 3EHBD 4DVRL 4JR9L 2K3TA 4RWYH 3SCMB 3QR2A 1KTDA 4I3SH 2RCSL 5MEPB 4AEEA 5KOMC 4HLZG 2D0HA 5KW9H 3NCJH 5DQ9B 2B1HL 5I66B 2YD6A 5D7LB 5EU5B 2X1XR 4FNLL 1JJUA 1NKRA 1RHFA 5BRZD 1WZ1H 1CICC 2H2PC 4P5KA 4YHIA 4YHPB 3M8OH 3U9UB 2MKWA 5C92A 1MI5E 5FYJD 4FTVD 4JFOB 3QCVL 4XWOD 3IAQA 1G6RB 4JFQB 5GISL 2XZZA 3FN9A 1WWBX 5J89A 1CICB 3V8OA 1VFAA 4Y16A 3VDBA 4JRYA 3MLTA 3RIFF 1J86A 3DO7A 3PQYA 3FFCD 1I4FA 4Y4HA 3MRJB 4WCYL 4N90E 2Z9TA 3EZ8A 1KULA 5DHVA 5CD5D 2VDLL 4KQ4L 2BY3A 3G5XB 2Q1EA 4U6XB 4R4NC 3U7YL 5E1AA 3U4BL 3KLSA 4L29B 4OD2A 5JR1L 3F12B 1FL5B 3CUPA 3S6CA 4V2BA 1UM6L 1F6LL 1BBDL 3L3OA 1GIGL 3SKMB 3DOSA 3PWPB 2B0SL 4FQJH 1A3RL 3IRPX 1CLZL 2Z0BA 3L3HB 2ADJB 3JTSB 5IOPA 4YEFA 2FO1A 3UROR 4CMHC 5C09E 3WCYA 1J5OH 2IJ0C 3O6KL 3VCLB 1MCEA 3WN5A 2O26U 1MIML 1D9KC 1S7TA 2IADB 4CMHB 4QCIB 2EXYC 2ZUXA 4LLVB 1D9KB 3RGVD 3HMWH 2GAZA 2YKLH 4AIXA 4ZNEA 1HE7A 1N2RB 2XWBA 3LKSB 4J3VA 4UTAL 1VEMA 4NQDA 3FQRB 4RNRA 3IDIB 4Q6IA 3VXUE 3F7PC 5FM5O 4WU7B 3D39B 5HI5D 3V6BR 4HUVA 4G7YL 3RWGB 3T3PF 4PV8A 2Q6WB 1ITCA 3KYNB 1C12B 3VI4E 1QR1A 4NWUH 4UT9H 3QIBA 5DJXA 1CT8B 5J3HD 4ZXBD 3SGDH 1D5ZB 4J6RH 4MQTB 4OF0A 4Q7DA 1R3JA 3TBWB 3GBMH 1FGNL 4DKEL 4W70A 4D8PB 5J6GA 4LARH 4EIGB 1MCWM 4FQIL 4G8GE 4CAGA 2HP4A 5HPOA 4PJ9C 1A7OH 2ZKHH 3ETBF 5TE7H 4P46D 1NPUA 2E7HA 4M03A 4MNQB 1EX0A 3RU8L 1HNFA 5JPNA 4BKLB 3EYFA 4PJ9B 4UMGA 1HH6B 4HDIA 4X6CE 4N1HB 2NY5L 3VFTB 1SVCP 4F7EB 2PCPA 5IB3A 2VABB 3PGFL 3Q48A 1QA9A 4PD4J 3TA3B 1P4LA 1CBVL 1WBZA 2BSSB 4NC0B 3VXME 3M07A 1ZTXH 5FO8B 5KJRH 2QQNL 4MCZA 2XTJD 4G6KL 5JW3H 2HKFH 1NCAH 4YZFE 2JF1A 1BVKA 3WFDL 5CJOL 1RVFL 5EOQL 3WEXA 3WUZA 1Q8MA 3QBTB 1IRAY 1UCBH 4F58H 2ZOKA 5HD8C 2BRRH 4QNPF 2R8SH 3FRPA 2PTTA 4HUUB 4P3CH 4JDTH 4YHOH 1RZIB 1LILA 1J88A 3NIGF 5BJTB 3T0EC 4X5XB 3IETB 1BZ9A 3I6KB 3RL2B 1J8KA 1QEWB 4TVSa 1FNGB 1QLRA 1N8ZB 1MLCA 5B22A 1YEIL 4MNGA 5I8KL 3N85H 3LS4L 1JWUB 1E4WH 1F97A 4P49A 3O45B 1IGYB 1CE1H 2VITB 1WIOA 2CK2A 3MV9A 4HPOH 4P0DA 2FX7L 3NN8A 1CLYH 1XF3B 4JFPA 3ARRA 3I9GL 2HKHH 5TE4L 3QEQE 3RWEB 4TSBH 2QHLA 4JLRA 4LCUA 5H8DA 2PW1A 4KI1A 2YWYA 2DS4A 2VLJD 2WUCL 5B3NA 4LSTH 4NBZB 5KSAB 4OGYH 2FR4A 3MJGX 1RUPH 3IFLH 3MRQB 1TVHA 1MJUH 4V1DD 4LPWA 1IAOA 3PWPE 3FFDA 5TE6L 3D25A 3L6FA 4BZ1H 1G9MC 4JCMA 1DEEA 1U8QB 4FQ1H 1G7JA 1G9NL 1F13A 4KROD 4ODBD 3U79A 1NSNH 1L6XA 5KSBE 4PJ5B 5I8OL 2MQ3A 4KDWA 6CGTA 2XKNA 4HWUA 5FKPA 5E99L 1BFTA 1XGPA 3MUJA 4U1KA 1I9RL 1IL1B 1MCCA 3KPLA 4PYHA 1W72A 1Z0MA 4DKAA 2CLRA 5ID1B 1S3KH 1TCRB 1EXUA 4X6BA 5I1GH 1MRFH 3F7YA 43CAA 4FQPA 5C0ND 3MZTA 3PL6C 3QO0B 4A2MA 4HUXA 3D39E 4X5LA 5MHSD 3MO1B 4J23A 3ULUC 3PL6B 2XZQL 4DGVH 3T1FA 3IXAB 4DZBA 3VGGA 3P9WB 4GRMA 3HE7A 1VFBA 4HWNA 3ZDYF 5ICYB 4NRZA 2A1WL 1RFDH 3TZVC 3O8XD 1NGWA 4UV7H 1JGUH 3GI8L 3BW9A 1N6QL 5FYKL 2D7TH 2IANB 1JI2A 2QR0B 3FO9B 3TZVB 5IWLC 3U46A 1F90L 2ADIB 5HDBF 4J12A 4XZUA 5C86A 2H45A 3BRDA 3EO1B 4MB5A 5D1ZC 2PXYA 2CIIA 3SKJL 1IARB 1SBSL 2I5YH 2UY7A 4IRSD 4LLUB 1WT5C 4MQ7A 5FF6A 5D1ZB 4NHCL 5EFIB 3S9DB 3T2OA 3L7FA 4XH2A 5F3BB 4QT5A 4I0CC 5F21B 5KVEH 1EEZA 4OQTH 1FN4A 3X13B 4HMCA 1MFCL 4UBDD 2A0LC 4NZDA 3T65B 4JN2A 3ZDXE 4ETYA 5HGHA 1DSFL 3DGCR 2A9NL 5GRUL 1CGTA 2PUQT 1JVKA 5HY9A 2H26B 4NKDB 4CVXB 3GUTB 2EYRB 2DKMA 1CDIA 2YPLE 5IEHA 1JE6A 1KIQB 2DWDB 3MODH 4Q9QH 3OXSA 3GMNB 5DDHA 2HG5A 5DEZA 4L8CA 4PJXE 3ROOA 2R4RL 5IJVB 3E6HA 5IM7A 2HA1A 4S11A 3C08L 4LHUA 5CSBA 4QXGH 4EJ1C 2FHFA 3KYAA 4MJIB 3F6LA 3OG6B 3T0EE 3ZSTA 5J8OA 5E5MA 3VFSB 4LLWA 1IQWH 1ZA6B 4KZDH 1Q72H 3RZCC 1HQRB 3KNBB 1GRWA 3MOQA 4KZEL 2W9EL 3CH1A 1XFPA 3RZCB 3HC4H 4WVRA 1JWSA 1K8IB 4ONGH 3GI9L 3TNMA 1DQMH 1HHJA 4X4YA 2DYPD 1A4JA 1BJ1H 8CGTA 3DUHA 3LSOA 1RJLA 4C57C 4YPJA 1BM3L 5D1QA 1JNNL 2WUBH 2FEDD 1HIMH 1XGTA 2I60L 4FQ2H 4X98B 3JWOH 5F70A 3MRHB 5HHQA 4UNVA 4KY1H 3WNLA 3RVXD 5DD5L 3ILQD 5F96H 3LIZL 5CCKL 1GGIH 1MFAL 2R2EA 1A1NB 3JVGC 1KPVB 4PJ5E 1ZAGA 3DX9A 4OFDA 1NBZB 1P5UA 4XNUL 3K8LA 3MR9B 2B7DT 3D2UB 4LNRB 3CFCL 3FHAA 3W9DB 4S1DC 1IM9A 4PLJC 4ZG1A 1E27B 3TVMC 4I3RH 4RGOH 3IFOB 4X6FA 4F8QA 1UKQA 2CKNA 3BI9X 1T1ZA 1U8IB 4OKVB 2DDQH 2CDGB 4GKZB 1U3ZA 3TVMB 5A16A 3ZT5A 4MSWB 3EJZD 1KELL 1WBXA 3GB7B 2J5LC 3VI3E 4YQXL 2OP4H 5ERWB 3GIVB 4YIQA 1MCPL 4U1GC 1YECL 5F9OL 2J5LB 1OF2B 5J13C 4WY7H 2Z93B 5CHNA 3P4MB 3ULUE 1JUFB 3X3GH 4U1GB 3BEVB 4OZIF 2OR8A 2WMPA 5D7KE 4ZOAA 2BJMH 5DJYB 2F19L 4HIXH 1S7QB 4X7SL 5IBUB 5J13B 4QGYA 3N9GL 3RUGF 4OIIL 3LHPL 5KTEL 1T6VN 2IANE 2ZNXA 2CXGA 3ULSB 5GZNC 4POZC 2J88L 1B9ZA 4GW1B 4PJBF 3WDJA 1XGRA 4PBXA 2ZWLT 2VXQH 3M17B 1EO8L 4HJGA 3BP5B 3KPRA 1H8SA 2W9DH 2IQAA 4WUUB 1E28A 3MROB 2UWEA 3CXDL 4JFFB 5C0RL 1DCLA 3MA9H 3V2AR 3QFJD 4X9GA 3OMZA 4M5YH 1MWAH 4GRLC 3VFOA 3LN4B 1TJIH 4HPYL 4PJEB 4XI5C 3G6AA 2PETA 4GRLB 4JDZB 3T04D 5L2KA 2R1YA 3M1BB 4H8WC 4ZYKA 1SYSB 4JFEA 5I30L 5MERA 1X5FA 4E42A 3KYKH 3N0PB 3OX8B 1YPZA 1AE6H 3FMGH 1NFKA 1ZMYA 5BS0E 1A7BA 4Z5RA 4HBCL 2OZ4L 1QBLL 1I8IA 1FFNB 1KIPB 1X6NA 2AEIT 3QAZC 5I1LB 5J4MA 2HRPH 1V05A 2AK4A 2EH8H 3ARED 4TTDD 5DEFA 3HR6A 4N0FA 2GSGB 3THMH 3QAZB 2OR9L 2UUDH 3S3PA 2FO4B 4MJIE 1B3JA 3STBA 5DRNB 3C6LC 3B43A 1MEXL 3FT3B 3PDDA 3LOWA 4LCYB 1OP3K 3B6SA 1YMHA 2VDKL 1GL4B 3UYPA 1H3TA 3C6LB 3BIAX 5DJZA 3K8KA 4TRPH 1CQYA 4NO2A 1FPTH 2B39A 3GO1L 3C5ZC 1VHPA 4PRIA 3OAZH 3S34L 2E7LA 1Q9LB 3LH2H 1OAYL 4JDVA 4U1JB 3S37L 3DV6A 3C5ZB 1ETZA 3BWAB 4D0DB 4OIBA 1HZHH 3CK0L 5E6YA 3WJJC 3I3BA 3ARFA 4YE4H 1JHKH 5EBLA 3QDJA 4FMKA 4QGTA 2EDHA 5I15H 1U93B 3CFKA 1HYRC 4TQEL 4YHZL 4QRPB 5FAAA 3VWJD 4C55A 3F7VB 1P7KA 1B90A 2EDQA 4OM0L 5CKAA 1ACYH 4BQ8A 5T1DL 5JOPE 3DX7A 1S78C 1L0XA 1RUAL 1DBMH 4HKBB 4HCRA 4DAGL 4QHLB 3KVQA 5GSRA 3TP4A 4ZUVA 4UT7H 5MEQB 3SO3C 1CDJA 3MRBA 1PY9A 3G04A 2V2XB 3AUVA 3DRTB 2DD8H 2C1PB 3SO3B 2NY4D 3VXTB 2Q86B 4UNTA 2HFEA 2C7UB 1RZ7L 5IB4A 4KVCL 3MUY1 3ULVD 1CF8H 2NY6C 3QUZC 1MCKA 3ET9F 4M6MH 5F7EL 5EUOF 1O7SA 3EKCA 1P4IL 4OLUH 1B88A 1I7RA 2NY6B 3QUZB 1ONQA 1EAJA 1QNZH 4ETQB 2F15A 1U3JA 4HIHB 2QKIB 4GH7B 1KJ2B 4NP4L 5EZOL 4XXCC 1DQQA 2R0LH 3EYVB 3ZSSA 4JRXB 8FABB 3BGMA 3OJVC 2ADGB 5GZOD 3L5XL 2RB8A 3S96A 4TOYL 4OCLC 2VN4A 4WUUE 4HUWA 4O2FA 4O00A 4JFFE 4KGJA 4EBQH 1CXEA 2G75A 3V7AG 1BBJA 3KJ4C 2AXGA 3QA3A 3KPSB 3CLFL 4PJEE 3FOLB 2MOVA 3MGOB 5C2BL 1JN6A 1OM3H 4HULB 3KJ4B 4HIIA 5DJDB 2MFNA 2FEEI 1ADQL 2X44D 4G7VH 3DX6B 3UPCA 1WUNT 3QEUA 3MACH 1ZT1B 1F11B 5HGBA 3U82B 4PRNA 1T03H 3CPLB 3PV7A 5FB8B 2EIEA 1UVQA 3ULVF 1EAPA 3DHMA 5ADOH 1XF4A 4NUGL 1KEML 2F74A 5D7IE 1NCDL 2DWEA 1U6AH 3EW3B 4ZO7A 4LRNH 2IEPA 2R4SL 1WBYA 4KXZH 4OFIA 2HWZL 2JELH 2OMNA 3RTQD 5IMMB 5TQ0L 5D2LA 3SKUD 3LKOA 1WF5A 3QCTL 3O6ML 5CD3B 2MQ0A 2ESVA 5EPMA 2DBJA 3VFWB 4N5ED 4PJAA 5F93C 4RCAA 3JUYA 2Y23A 2R1XA 5JPMA 3ZE0F 4I9WD 1F4XH 3BH8B 4ODVL 4M7LL 2Z92B 1INQB 3SE9L 1I1YA 1XF5A 4QHUA 4F8TA 3VMPA 3MCG1 3H3PH 3MNVA 4OKDA 1EJOL 4D9QE 4ERSH 3IKCA 4PS4H 2GJ6D 3CFBB 3PIQB 3RWCB 5DD0H 4F7CA 3G9VA 4XPAH 3T77A 4Q6YA 2VDMH 1BWWA 5CZXD 4BH8A 1A6TB 1FL3A 4OT1L 3JTTB 3RI5F 4GMTL 2OR7A 4I18C 1MJJB 4LSSL 1WCBB 1KPUB 4UT6L 2GT9A 4YXLH 1ORQB 4Q0XH 3DYOA 1W8NA 3WIHH 1NGYA 3KHQA 2RHEA 5EO0B 3I50L 3LDBC 4I18B 3CH8A 1J9CT 3SGJA 3FQNB 5DC9B 5FDYA 3BZEA 4YFDB 3ZYJA 3LDBB 1IC4L 1I8LA 5DK2B 3LS5H 1BQLH 5DHYA 4C54A 1QKZH 1A6AB 4Z95H 4KK8D 5CBAA 3FZUC 3BO8A 5MENA 4XX1E 4DVRH 3O3UN 3DBXB 5CWSB 3VFMB 4FS0A 2RJMA 2A9ML 2RCSH 4Z76B 3TM6A 3P9MA 4WHTA 5IEKB 1A1MA 4R8WL 4RDQF 5DO2C 4HGKC 1KTLA 3STLA 3H3KA 4FNLH 1H8NA 2VISA 4Y19A 1HI6B 4GRWE 1Q0XH 1D3CA 1I1FA 2IPKB 3VWKC 1EVUA 5EO1B 4BSWA 3ARVA 5GISH 3SJVA 2JJVA 3Q5OA 3NZ8B 5KVDH 5DJ2A 3A6CL 4ZPTB 3UBXA 3GDBA 3VWKB 2DKUA 4FFWD 3JWOC 5FM8A 5EBWB 1MCJA 4JRXE 2YD2A 3QWRD 2FZ3A 1AXIB 2X70B 1RK1B 1WZLA 5E2UH 4JFDA 4WFGE 3GMPB 5LAXB 2NZ9D 4KK9D 5D8JL 3EJYD 4ORGA 4GKNA 3ILPB 3U7YH 3N1MC 3U4BH 1LEIA 5CJXC 3K1DA 5JR1H 4Y2DC 2BHUA 4MMXC 1JK8B 1R0AL 1UM6H 3KPSE 4QEGA 3MLRH 1BBDH 3GSNA 1GIGH 3VXSD 4Z7WF 3U9PH 2E6QA 4Y2DB 5IB2B 1NMAH 1A3RH 1JHTB 1NDGB 1CLZH 3QH3A 5AZ2L 1MI5A 1XGYL 2XY2A 1KGCE 1MAMH 2BMKB 3DIFB 3HG1B 2E27L 3MRRB 3BYYA 3O6KH 1VCAA 2WBJC 4FFVC 1MIMH 1U8OA 3LQAL 4MX7B 3TNNA 5HYFA 4PJHB 5DYOA 2RFXA 2WBJB 2VL5B 3PNWA 3QO1B 5E8NA 4KRNA 4UTAH 1XF2B 3BKCL 3GSRA 1A7PL 1IM3B 2BK8A 2LTQC 5AAWA 2YZ8A 4Y4KC 4PG2C 4U3HA 1KB9K 1NAMA 5HYSB 3FQUB 1W8OA 1WEJL 2DQHL 2GJZA 3O3BB 2ITCA 2LTQB 3F62A 5D1XA 3V0VB 3ULVL 1OTTD 4Y4KB 2DI8A 3ARGA 2R0KH 1BJMA 2VR4A 5FGCB 3L3JA 1P7QD 4HKZB 1C5DA 1RY7B 4FFYL 1A6WL 4EN3D 2VMFA 1A8JH 5C09A 1FGNH 1U8HB 2D7PA 2BC4A 1SVZA 4FQIH 5BV7H 4JZNB 1MWAB 3WLWC 4P99A 3QUMA 1T2XA 1FYTD 4JPKH 1SMAA 2WZPD 3VH8A 4F33B 3ECBB 4P2OC 3OKOB 4RRPA 1N3NB 5DJAB 1E4XL 3HI1B 1P4BL 1QSFB 4S2SA 4K71C 2ZUQC 4HBQA 2NY5H 4P2OB 3MLYL 4LIQH 3RL1B 5ESVB 1AHWA 3VXUA 1AXTH 3PGFH 4K71B 1UCTA 1H3PL 4J3TA 1CZ8L 2HFTA 1CBVH 4UU9B 2EKJA 1F4YH 4ODWB 4PLKD 5DMKA 2YHGA 5CLWA 2HYMA 4NQXA 1KBGL 4IOIB 3WFDH 4CBPA 5CJOH 3V7MA 2ICCA 3S36X 1RVFH 5EOQH 4APQC 7FABL 4HWZA 3PDGA 1YY9C 4G8GA 5B39B 5K33A 3O2VL 4APQB 4GQPH 5F7FA 3BIBX 4P4RB 5D6CB 4W81A 1S9VA 4XCYB 4LEOA 5TGBA 3H42L 1UZ8B 2XWTB 4X6CA 2APXA 3W9EB 4DVBB 4K94L 4G8FB 3HAEG 4M9OA 1AKJB 2CK0L 3LS4H 5DRZB 3QUYC 5JW4R 4DFHA 5E4EC 4I0PA 1R3KA 3LKPA 1OW0C 2EXWD 3QQ9D 4FZEL 5GGUB 3I6LE 3VXMA 2NY1C 1FVEA 5IVXF 3QUYB 1UXSA 1XR8B 1PZ5A 4M6NL 5E4EB 2FCBA 1S5HA 4ZOCA 3I9GH 5TE4H 1NC2D 2HLFD 1FZKB 4Z0XB 2NY1B 2XWJB 4P2YA 4OSUL 2WUCH 2WIIB 4K8RC 2L4OA 4LSVH 3FKUS 1FNHA 1XCTB 4YH6A 5DQ9A 4WTZG 3DPBA 4G9FB 5CP3H 1MUJB 5TE6H 3IDGA 5EU5A 1CU4H 5IBLD 3DYPA 3BKML 1JP5A 1GOGA 1UT9A 2UVEA 1G9NH 2E7MA 4YHPA 3U9UA 1DBBL 4NKIL 3HG1E 5JA9A 1G6RA 2VLKB 1CICA 5I8OH 4MXVE 3OXRB 3B9KD 2ITDA 2ENSA 4LVNC 1J0KA 4WDIB 4ZFZB 2EH7H 3QJFB 3DMMC 5IT2L 2YD8A 4I2XB 2EZ0C 3FOMA 1I9RH 5EUKB 4LVNB 1LWRA 3MRJA 4D9RE 3ELAT 3DMMB 4OZGE 4WNQB 3W82A 4P2RB 4NQTA 3QEQA 4P4KD 3R8BB 5HSFA 3G5XA 1CN4A 3CLEL 3WUWA 1ZV5A 4L4TD 2R39A 4L29A 2IC2A 3F12A 1FL5A 2P1YA 5CEXA 2ZSWB 3HE6B 1KB5L 1UJTA 2XZQH 4BJLA 2Q8BH 5LCVL 3TGXA 3U0WL 3VGEA 1K5NB 3PWPA 4D2NA 1PX4A 4JZJB 3GRWA 3HZVB 5FGCE 2A1WH 5FYJH 3L3HA 3DTXB 5IW1B 2YUZA 3JTSA 1MRCL 2GY7B 3GNML 5DMGC 4CMMB 3IJSB 4BFEA 5L8JB 5KSBA 3VCLA 4NQEB 3DSNA 1F90H 1GCFA 2IADA 4LFHG 5F8QC 1MFDL 4P23D 4PRAB 4QCIA 4BA8A 5B38A 1D9KA 4IRZH 5HI3C 3PWJB 3K2MC 3RVVC 5EIIB 3FQRA 5F44A 5HHPB 3IDIA 3MUZ1 1NC4D 2GI7A 4WU7A 5C0CB 3D39A 1CI5A 4HC1A 3RWGA 3VXOA 5CAYB 4AT6B 4KJWD 5D7SL 4XNQA 4NQSA 3BRGC 5IFAL 5F7DB 2A9NH 2CLVB 5GRUH 1CXKA 1NKOA 1D5ZA 4D8PA 4FZ8L 4GG6B 2VTFA 2FWOB 3SDDD 3QXDB 5EU3A 4HUNB 4MA8L 3HC0B 2OJZL 4FQQB 4BKLA 1KJMA 3C08H 3D18B 4NGHL 4PJ9A 2P42B 1BQSA 1HH6A 1AR1D 3KDMB 4YDJB 2EC8A 3KYOB 3O4LB 3VFTA 3RIAK 3WFEL 2ZUTA 2X4NB 1UACH 1U36A 5HHNB 3N1QC 4QRUA 4KZEH 5ECJE 2W9EH 4FQXA 1A6ZB 5A1AA 3MZGB 5DRWB 5GGVY 4OFPA 5DSCB 1GVIA 2K9UA 3GI9H 1HOCA 2NCMA 1A47A 5FO8A 4KK6C 3OKEB 32C2B 4BZYA 1LDSA 1YEFH 3D87B 1S9WA 1NEUA 5DWUL 2NYYC 3EFDL 3BN9C 4A2LA 1CL7I 1JNNH 3NA4A 1PW3A 2XQBL 1LK3H 3P0VH 2YPLA 4U0RC 3RQ3A 1EDQA 4XVJL 3H8NA 4G9FE 1NBYA 1WAAE 5IGXL 4PJXA 3RPIB 3OB0H 5BJTA 4U0RB 1NUDA 3IETA 4LLQA 4P3DB 5DD5H 1T4KB 3BGAA 3TJEL 2MHAA 3I6KA 2P47B 3LIZH 3RL2A 1MFAH 3T0EA 3HI6L 1FNGA 4IRJD 2VLKE 2OI9C 4M9PA 2J7LA 3VXPB 1YMMD 1UZ6F 3T2QA 3VXRE 4XNUH 2W0KA 1JWUA 4QXWA 3O45A 1MCSA 3CFCH 1IGYA 1L9MA 2OI9B 2VITA 4I2XE 5SX5K 4K7FA 1FVCB 3WS6A 1OGAB 2W91A 3MGTA 5CILL 1XF3A 3MV8B 5KN5B 5FV2A 4M00A 5D9SA 2QSQA 3RWEA 1UKSA 4JKPL 1VPOL 4MHHG 4PJDB 1KELH 1U2HA 2I9LB 5DD3L 3SDYL 2G2RB 1T0NB 4YQXH 4W4NA 1GH7A 1VFUA 4RMTA 1MCPH 4LCWD 3CFEB 5FV1L 5EC2B 1YECH 2OL3L 2NXZD 3MNZA 1AC6A 4GLRI 4TVPD 3KXFE 3WS3B 4OJFL 1ZT7B 4AH2A 5AG9A 1S5IL 3ZL4L 3ORJA 4OIIH 3LHPH 4HIEA 3WBDA 4ZTOL 4DKDC 1RUKL 4PJ5A 4NQEE 5DUML 3CGTA 1EO8H 4B41A 5EIQA 1Y6NR 1YQ2A 1KJVB 1DUYA 1KN4L 2DKSA 1IL1A 5F7WC 1GGCL 2AV1A 3CXDH 2BNUA 2B8OT 1TCRA 5IHUL 5IROA 4PJIB 5C7XL 2Y5TB 2Z8RA 4HPYH 5C0CE 3UTSD 3NVQA 1LE5B 3MO1A 3AM8C 2R1WA 2NNAB 3P40A 3PL6A 1EUUA 4YDKH 2UZXB 4KTEH 3GSWB 3IXAA 5TH2B 4JO3L 2IALB 2EEAA 4YUEH 4P57B 4ELKA 3MYJA 5ICYA 2CO7B 2RR3A 4M62H 2XIDA 1ITBB 4NYLB 4YC2C 5DQDL 4AIZB 1M7DB 2IANA 2Q7YA 5HHOB 3IXTB 3TZVA 4GG6E 1QBLH 3MLUL 4HSQA 4YC2B 1JIBA 2XN9E 3MLWL 1J1OH 3OAZK 5TDOB 5IWLA 3V6FB 3EO1A 2OR9H 2WWMD 3CX2A 1NUGA 2EC9T 2WBWB 5JNYA 2EDFA 4LLUA 5BV7C 4H26A 5D1ZA 3O4LE 3WV0A 1MEXH 5EFIA 2VDKH 1AY1L 5E2JA 5F3BA 5BV7B 3Q3GB 2JK5B 5B4MD 5T3XD 4KDVA 3ROLA 2ATPA 4DGIH 3X13A 1M05B 1S9XA 5IHZB 2NY5C 4XC3L 3GO1H 5D7JD 3HRZB 3OKMA 4KU1A 3QRFM 3IAPA 3RP1A 4X4XB 3S34H 1LE9B 1OAYH 4G5ZL 3S37H 4LBEB 4R7DA 1FFQA 3O6FC 1F3DJ 2H26A 4NKDA 3ARUA 1UB6B 1IC5L 4CVXA 3GUTA 4Q9BA 2B20A 4LGPB 5BS0A 3S35L 5ISZB 4AMKH 5ACZA 5IK3B 3V6ZB 1KIQA 1HILB 3KLHC 1I3VA 2OXGA 2VAAB 5I1EL 3GMNA 3LRSB 3O6FB 2OK0L 3PP3K 1OY3B 4ZODA 5IJVA 2WWKO 1YC7A 3J7HA 1DVFC 1JNJA 3MX0A 4TQEH 1NJ9B 4OCRL 3O2DA 5T3ZD 4MJIA 3R06B 1DVFB 2V17L 3DI3B 3R1GL 4FOMA 4PG9B 4PYGA 4OM0H 3GSQB 4S1QH 1B2WL 2IPTL 5T1DH 4ZUUA 1E6JL 1RUAH 4XPGL 3KNBA 2P7TB 3Q0HA 3REVB 1X7QB 4LKCA 4MNQD 3EYOB 4DAGH 4NO0D 4GXUN 3VFVB 5CUSL 3RZCA 2HRLA 3EIFA 1OGAE 1K8IA 1GC1L 12E8L 5EC1B 1JFQL 4PJDE 1IC7L 2Z8SA 4BFIB 1RZ7H 1SMOA 3TA3D 4KVCH 4H25B 3C6SB 4QRQA 4X98A 2WLYA 3MBED 5DJCB 2SEBB 4NQDD 3MJ6A 2UZYB 5F7EH 2FECL 4N9OB 4YBQC 3EFFA 1QFWI 2W59A 4QRSB 5J6HB 3DSFH 2YS4A 2Y36L 5J56B 3OTTA 1HKLL 4HWBH 1JF1B 3U0PA 4NP4H 5EZOH 2FX8L 2VIRA 1A1NA 3R8QA 5KVGL 1KPVA 2BCKB 1NBZA 1JZ5A 4K2UL 3MR9A 4DN3L 4LNRA 5EN2B 3X14B 5HD8D 4TOYH 1J10A 2X7LB 4A6YL 1CFTB 3IFOA 5AYUL 5B38G 3VFPB 2OCFD 2QBWA 4OKVA 5E0QA 4UI2A 5F72S 1HKFA 2CDGA 4GKZA 3TVMA 4MSWA 2MNUA 4PJIE 3GB7A 1UEYA 2OYPA 3CLFH 1VFMA 3EDFA 5ERWA 3GIVA 4LP4A 1HSBB 4JPWL 3EHBC 2XNAB 1OF2A 5HHMB 1EFQA 2FD6H 2Z93A 3P4MA 5DR5L 4GO6B 1JUFA 3BEVA 5IIEB 5DJYA 3SDAA 1S7QA 3CVHA 4PR5A 4ZDHB 3KAAA 1YDPB 3HS0B 5KSAD 3DRQB 1I3GL 1LK2B 2WLZA 1BFVL 2OTWB 2R4SH 1G7PB 3SGEI 4YR6A 1DANU 1KCSH 3PE9A 3M17A 2HWZH 2NY7L 5JHDE 3BP5A 5JIIA 3CMGA 5TQ0H 1BD2E 3O6LH 4XC1H 3RVUD 4XWOC 5BRZB 1T0MB 4EOWL 2V2TA 3GJEB 4WUUA 4M02A 3O6MH 3QQ3B 3MROA 1KEGL 4JJ5B 4E5XB 4FTVB 4OCNC 5IVOA 2NQCA 1KJ3L 1DQTA 1VACA 5TJWK 1WJ3A 5LBSL 1CGXA 2UVFA 4LEXH 3LN4A 4HV8A 4JM2A 5TPWH 3TCXA 4ODVH 4M7LH 4PJEA 4ODSH 2BXYA 3SE9H 4GSDL 4XPTL 1OT1A 4HT1L 4GRLA 3GMQB 1U8JB 5CD5C 3IDNB 3FFCB 1IJ9A 3M1BA 4S1RL 1EJOH 4WO4A 3TWCL 3UYRL 1SYSA 5GSVB 4PRHE 4LIQE 5D7IA 5CSGA 3JV4A 3T3MF 1EHNA 4GMTH 5ISZE 4YDVB 3A67L 1T04B 3KJ6L 3GIZL 4UT6H 1KIPA 3B5TA 4N0YL 1G7IA 1VADB 3B4NA 2VLME 2DM7A 3I50H 4GQ9L 5ITFA 2GSGA 4R3SB 1D6VL 1BF8A 2P5EE 2VE6B 2DLTA 4P2QE 2WINB 5EOTB 2FO4A 2VN7A 1MSPA 1IC4H 5EORL 1FNLA 2DQJL 1T5WB 1MHCA 1VGEL 2PNDA 4S1SL 1G0XA 3RGVC 5GGQL 4LCYA 3H9SE 5EOCL 4Z18A 3SKNB 4C4KT 3LQZB 2HAZA 4KV5E 2VQ1B 1CGVA 2DIJA 4RISL 3QPQD 3RGVB 5JW5B 5BO1L 1DQJB 2BY1A 4CU6A 1DANT 3VA2C 4G80A 4L8DA 4AY0A 5HI5C 1CTNA 3P0GB 3Q1SH 3WIIL 1P6FA 4R8WH 5C6PB 4U1JA 3F8UB 3O3EB 1QLFB 1NCBH 4D0DA 1A3LL 5GRJL 3B9AA 4R7NB 1CL7L 4IMLB 2DQIL 5J3HC 1G9EA 4PJGF 3AB0B 3K3QA 3SDXF 1A6VL 4DUVA 4WJ5B 4ZXBC 1QACA 3QZWG 4WW1B 1X3DA 3BMWA 5IR1A 2BNQD 1RUML 1U93A 3WJJA 1RQ5A 3HNVH 3DVFA 5B3JF 4M3KB 3A6CH 4MCYB 4ZXBB 3E0GA 4JFYB 1B0WA 3GSUB 3UP1A 3F7VA 4P46C 3W0WA 4RBPK 1NDMB 4MJ4A 3WXVH 4OI8A 3OGCA 4RGMC 5I73C 1I9IL 1PGRB 4P46B 4W68A 5FYKU 4WV1C 3QCUL 2AQ1A 4RGMB 1XF1A 5D8JH 2FIRT 4F9PA 5MEQA 3LRGA 3MOAL 4WV1B 2IF7A 5DUBA 4UDUB 2NY2B 4UNUA 4YHYC 4NZRL 2V2XA 1R0AH 4R4BA 2C1PA 3ARQA 3HZYB 1FORH 4NFBA 5SWZE 2HFGL 2HJKA 5K93A 3KPMB 4KJPC 4L3EB 2FJGB 4P5MB 3I3EA 3WFZA 4YHYB 2HFFB 2XTJC 5HHME 4HWEL 5EU4B 5I17B 2VUOA 1XGYH 2XTJB 5CIPA 2E27H 1NLBL 1KTKE 1IAII 2APTA 3QUZA 3H9HA 4PJCF 2Y06L 1UH2A 1HXYB 1KXVC 4PBVC 4HIHA 3LQAH 1KJ2A 3RA7L 4JRXA 4XHJC 1U8MB 1D5IL 2BDNL 5ICZB 4TUJB 1JHLH 1P69B 3B2VL 1KB9J 1AQKL 4FXLA 5D6DA 1LO4L 4LMQI 1M6OA 1MCIA 4IM8A 2WAHA 3SGDI 4BZ2L 3BKCH 4JZOB 5F9WC 3MJ9A 4XNMB 5FYJE 4FTVE 3RVWD 2FJHA 3FONB 1J0ZA 2X6MA 15C8L 1BOYA 5F9WB 1WEJH 1WSST 2DQHH 3KPSA 5CBEB 3D2UD 3IDJB 3FOLA 4XCEB 3ULVH 2MWCA 1ZLSH 1E4KA 3FFCE 3DX6A 1PAMA 5FYLD 1AJ7L 5M94B 3HRPA 4F9LC 1ZT1A 5I2IB 1F11A 1A6WH 1MIEH 3TBSB 4YHNB 5FB8A 5BW7C 3T3PE 3PGDB 4DKFL 1Z9OA 3HA0A 4IJ3C 5J11C 3TIDB 2CUIA 1MVUA 2VLJB 3RWIB 4J3SA 4ZS7H 4IJ3B 5J11B 5GRVL 4V1DB 4XNXL 3MBXL 1K6QL 4KROC 4FFZL 4HFWB 5JMRA 5SV4A 1J0IA 1DQLL 4Y2OA 4BQ9A 2BY0A 3UTZB 4WGWB 1LEGB 2NLJB 1J05B 4KROB 1W0YT 1IBGL 5K9JL 5F1IB 1G0YR 5T33H 4JN1L 4XP5L 1CZ8H 1PKQB 2NZIA 2Z92A 1INQA 5IQ7L 5IF0B 5I6XC 3D85D 1KBGH 5E8PB 5C0NC 5D2NC 2CKBA 1LQSR 5JIKA 5I6XB 3WNMA 3CFJA 2J4WL 5D2NB 5FIEA 3RWCA 2DTML 4MD5B 4ACPA 1ZLUK 3BSZL 2KL6A 1A6TA 2A38A 5H35B 3O2VH 5DT1H 2XTLA 2VC2H 2YWZA 1MJJA 1KPUA 3AFLA 3OJ2C 3O8XC 4UTBL 1ORQA 2W0PA 4U7MA 1OAQL 1LEKA 4I18A 4L8BB 3FQNA 3O8XB 2ICEB 4K94H 3MRNA 4QNPE 4WEUD 4WENB 5KSVB 3ALPA 2CK0H 1QO3B 3NIGE 5DK2A 3D9AL 4I13B 1K2DB 2XZAL 4ODXB 2PO6D 1LO0L 4FZEH 1A6AA 4FQCH 3NCBB 4Q2ZB 4IOSD 4M6NH 4IRSC 4KGLA 2HVJA 4MD0B 5CWSA 2OS7A 2CR3A 1D5BA 3TT3L 3UTTA 4IRSB 4Z76A 3B8SA 5I1HL 5EU6E 1RZGA 4E9LA 3OBAA 3AGVA 3QXWA 4EDXA 2NTFB 1S7WA 3RNKB 1NLDH 1MHEB 4X8XA 2AJSL 4UBDC 4QLRA 3BKMH 1H0DB 1HI6A 3VGFA 2DQGL 3EGSA 4MA3B 4BYHA 3KPOA 3PJSA 2IPKA 3TT1L 1UM4L 1NCCH 4NKIH 2XTJE 5EO1A 1G1CA 3NZ8A 1CVRA 2BOCA 5ETUB 3UTPD 1QFWL 5L2KD 4YNYB 4UB0H 3T0AA 2DMKA 3IS1X 4XVUD 4MJ5B 5IT2H 5EBWA 1EEQA 5FOBB 3H3BC 4JFED 2X70A 1RK1A 5I1CL 1QR4A 2IH3B 1S8DA 4QRPD 4WIQA 2EDOA 5LAXA 3MLXL 4NJ9L 5JO5B 2O61A 4LOUC 4I0KA 1K4CB 4WGVB 1ACZA 4RWHA 3GMOA 2D7MA 4XP9H 1OPGH 1W72L 3VD9A 4UIMA 5LCVH 4L3CA 4X6EB 3U0WH 1S9YA 5CJXA 4XP6L 3RY6C 4RGND 2FDBP 4KUCD 1JHTA 5I18L 1WWAX 5TDPA 4XBEL 2UWEF 2DYPB 2BMKA 3GNMH 3DIFA 3HG1A 3MRRA 2FEDC 4JO1H 3QDME 4JVWA 4N8VA 4XCFH 3P73A 2VLJE 3FAXA 3D1MC 1MFDH 3ZDYE 4CL7A 4ZUWB 1Z3GL 5K9KB 1SQ2N 4LSQL 4JPVL 4S10A 4OZIB 2WBJA 1NCTA 4V1DE 3RVXC 4Z7OF 1J7VR 3QO1A 3ILQC 3RUGB 2MPAH 4NOBA 4OZGA 4UILL 1EERB 2I27N 1DBAH 1XF2A 4P9HL 4L1HA 2P48B 1IM3A 3BXNB 4YGAB 3QDJD 5HDBE 4AEHL 1HINL 2W1NA 4X7DC 4BH7B 5SWSD 1FAIL 1PKQE 1OAXL 3FQUA 5D7SH 5GS0L 4Y4KA 1G7QB 1XH3B 4NC2B 3UC0L 1F2XK 4W6XB 3V5DB 3EJZC 5F71A 4R9HA 5IBTL 5IFAH 5ACLA 5FM5M 1ULVA 2J2ZA 4XMPH 4KUCF 4XP4H 1U8HA 5D2NE 3L5WA 4FZ8H 2H2SD 4JHZA 3BP7B 5L9DH 4JZNA 4F15B 2DMCA 4GW5B 5A2IH 1CLCA 5MHSE 1FC2D 4ZD3H 4MA8H 2OJZH 1A5FL 2YMXL 3ECBA 3OKOA 1N3NA 5DQJA 2VDQL 3IU3B 2DBLL 3CU7A 3U4EB 2VZTA 4HGWB 5ESVA 2X9YA 3OB0K 1S7SB 2EO9A 5A2JH 4M1CD 4QOKD 3ES6B 1U42A 4PJFA 3BE1L 3EFDH 2N7BA 1J0HA 2D7NA 3DECA 3QFJB 4OZFH 2UV3A 3MLZL 2XQBH 5L2JB 3I02A 1R3HA 3LEVL 1FZMB 2NTSP 4XVJH 5B39A 5IGXH 4APQA 4LQFL 1CWVA 4Y5XC 2V7NB 4P4RA 3FB8B 4MNHB 1FFPB 1QBAA 4XCYA 3VFNA 2V7HB 4PIRF 4Q9RH 3TJEH 3EOBB 4Y5XB 4OFYD 2VWEC 4P5TA 3HI6H 1UZ8A 2XWTA 3SDCD 3W9EA 1LD9B 2P8LB 5BOZG 4WHYH 1Q9KB 2DI7A 2QSCL 3AREC 1XGQB 2BNRD 3TH4T 2IBZY 3PWUA 1XIWA 5GGUA 1TNNA 5C2UB 5SX4I 5CILH 4ZO9A 3AREB 3ZKQD 3WLBB 1XR8A 5LG1A 5C07D 5T1LD 5FO7B 1OW0A 1CXLA 4Z0XA 1VPOH 5DK0B 1Y18B 2XWJA 5DD3H 4MXQD 2P5WD 3F7RA 4U1LB 4CJ1A 1K3IA 2WV3A 2WIIA 1OB1B 4JM4L 5CEZD 3ARYA 1PG7H 1XCTA 5INCA 1WCQA 1HNGA 2B5IC 4JHAL 2GKIA 4G9FA 1WTGT 1ODAA 1WAAA 2ESVD 3IF1B 4C4KO 4OJFH 2WQ8A 4L3AA 2GEEA 2B5IB 3ZKXC 4D9LL 3BD5A 2ZG2A 3UTQB 4CN1A 1X6LA 3E3QC 1MY5A 4ZTOH 3NTCL 2VLKA 1PVHA 3ZKXB 3BVNB 3OXRA 2BSTA 4H1LB 3VXRA 1OTSD 1IAIL 3G5ZB 4KMLB 5EUOB 1DR9A 3QJFA 2R9HC 4I2XA 4OZIE 4EI6A 5EUKA 1KN4H 1GGCH 3K74B 3VWJC 1IFHL 3WNKA 1RK0A 4LFHD 3RUGE 4PJBE 1A2YA 5EULV 1RZJL 1J18A 5IHUH 3VWJB 1NFDF 3MREB 3JWDH 4MHHI 4M8VA 3RWFB 5C7XH 3X11B 1UGNA 3U83A 1FYHB 1F6FB 5C70A 2GITB 3S98A 1OTUC 3Q5YA 3WO4C 2ZSWA 2CDEB 3M45A 3HZMB 3GBNL 1T7XA 1N5YL 3OR6B 5JOEA 2OXHA 1RURH 3WO4B 3KXFA 3HZVA 3L9RB 5JHLL 1FIGH 3DTXA 5IW1A 2NY4C 4M4PA 5DQDH 1S7VB 3BX7C 4JGMA 4N0CD 2YUXA 4CMMA 3IJSA 3IVKB 1JPST 3ULVC 4NQEA 2KDGA 4H0IA 3VRJA 2FL5A 3MLWH 4JB9H 3TIEA 4G6AD 1Q38A 4PRAA 5C6WH 1MCRA 4O02L 4OB5L 3VXQA 4Z78B 2Z4QA 4L9LA 2P24B 4Y19D 5HHPA 2F8VA 1AY1H 5C0CA 5CSZA 2EYTB 3QULA 4NOFA 4GFTB 4AT6A 4XC3H 4KAQL 5GS2D 1FP5A 1GGUA 5L6YL 1AGDB 1Q9WA 5KOVC 5F7DA 2DQDL 3RIAF 2PN5A 3WD5L 3QFJE 4HS3B 7CGTA 5DFTA 3D5OF 1LO5B 3KPNB 1BQHB 3S35H 4GG6A 5E7BA 2FWOA 3OJDA 1J1XH 1UYWL 4QHMA 1CQKA 3H6JA 2OK0H 2FIKB 2XN9A 3RWDB 3HC0A 3TBVA 3DV4A 4XAKD 1EEYB 2O5ZL 3D18A 4KC3B 4OCRH 4OD3L 3IDMB 3AXLA 3TO4A 4JFXB 3R1GH 4PGBA 4YX2L 2JTDA 3KDMA 4YDJA 2VXVL 3KYOA 3O4LA 3A6BL 4Q9CA 1AO7D 2IPTH 1QVOA 2VWEE 3OG4B 4MAUL 2X4NA 2YUWA 4XPGH 3QDGD 5F9AC 5T1KB 3RTQC 4U6TA 5HHNA 3GM8A 1FAKT 2C3HA 3FQXB 5CUSH 1FZJB 5DRWA 3RTQB 12E8H 5J1SC 4N5EC 3BWUC 3WIHA 1O5DT 1XEDA 2AVGA 32C2A 2NY3D 2D0GA 2VZ1A 3GJFB 3GSVB 1FNFA 2ICWI 4XHQA 4KTDL 1IC7H 4X0KA 4NM8L 4HCRL 3HPJB 1F6AB 1A21A 3I84A 2UZIL 2X4QB 1CXHA 4J8RB 4U05A 3OKNB 5E94A 5DURD 1L4IA 1RIHH 2ID5A 1H15A 3WNNA 2XKSA 1HKLH 3QWQB 5CZXC 1R3LB 4NNPH 3L1OL 2FX8H 3UJJL 5KVGH 4I1NB 3VXPA 1QP1A 2E7CA 4XB8A 1OGTB 1ZGLM 1NAKH 3ZKSD 5EUOE 2NR6D 4K2UH 3E3QE 4DN3H 4DGYL 1FC1A 2VQTA 1QRND 2V6HA 3MUGB 4A6YH 4ODTH 1FVCA 5E5RB 1YYMH 3QISA 5DZOA 1OGAA 5AYUH 4JFZL 1SEBB 3V5HB 4U2YA 2XFXB 4PJDA 1AKJD 4JGUA 1KG0B 1CFNB 1M7IB 4KDTC 2X4TB 4KK8C 3QNYB 1T0NA 1INEL 3PG2A 1JGDB 1RV6X 4JPWH 3CFEA 4C83B 2M26A 2HJFA 5EC2A 3U0TB 3CXHK 3K81A 5BQ7B 1T2QL 5ENWA 4KPHL 2CUHA 3UPRB 1CFVL 2N7AA 1F58L 4ELMF 4GKSA 5DI8B 4QWWD 4Z7WB 2GFBA 5JDSB 1I3GH 2Y1VA 4QXUL 5FKAB 4AEIL 1KIUA 1YUHB 1MOEA 4LVHC 4QTIL 1FGVL 4U1NB 2NX5D 1UM5L 5FCSH 4DN4L 4KKAD 5E00A 1QFUL 3WKML 4LVHB 1HWGB 3RBSA 4PJ8C 4KKLD 4CVZB 4FFWC 4JY6B 2PTUA 4K7PH 3P77B 3IU4L 4Z77A 5JA8B 1KJ3H 2QSVA 5E2VL 5LBSH 5F88B 3RKDD 3WE6B 4PJ8B 4PJIA 2J6EA 2UY6A 1FNEB 2Y5TA 5CEZL 5AZEL 1RMFL 3ESUF 1LE5A 4GSDH 2NNAA 4HT1H 2NZ9C 2ICES 4KK9C 3EJYC 4OD1L 4S1RH 4DUXA 3TWCH 4P2RD 4P57A 5ALBH 3O41A 4HXAL 4I0PD 4B7LA 3JUZA 3ZE0E 2DF3A 2E8YA 4NYLA 1M7DA 5T1MA 2VLLB 1CG9B 2Y25A 3HE6D 5TFSL 3A67H 3GIZH 2EECA 4LF3A 2EICA 4N0YH 3VXSB 4ZUSA 5JHDA 3H9YA 5DJ6B 1BD2A 3ARWA 3V6FA 4GQ9H 3ZLQC 4M1GL 1D6VH 1I8KB 2C4FU 3CCHB 1CE6B 3MOBL 2H3NB 4QXTA 4ZPVA 1V3JA 3SHSA 4S1SH 35C8L 5GGQH 4E0RA 4N0UB 2A73B 4TSCL 3BD4A 1BOGB 5BO1H 2BVQA 5IHZA 4XAWL 4DEPC 5GS1C 4YHKL 3G5VB 1AGCB 3KHOA 3HRZA 5HI3D 5SWQB 1CD9B 1LE9A 4DEPB 4PRHA 5GS1B 4LBEA 2E6PA 1OTTC 3ZYIA 1UB6A 3PHOB 5DD6B 1A3LH 2R29L 2D0FA 5GRJH 5ISZA 3STZA 4CNIB 5IKCA 4RMSA 1CL7H 5IK3A 2DQIH 4I9WE 4Z7QE 1R3IL 3LRSA 4EN3C 4UZGA 5T5FL 4WWID 5A2FA 1RUMH 3OF6A 2V2WB 4MWFB 1K8DB 1CDHA 3FB7B 1P7QB 4H0HB 3IYLW 4EIZC 2AXFB 2P5EA 4EN3B 4P2QA 1TZGL 2EE2A 3RNQB 4PB9H 4AG4L 4GAJL 4HH8A 2EYSA 2GJ6E 3R06A 2D7OA 1H5BC 4PG9A 3GSQA 4OZFB 1QBBA 4POUB 3H9SA 4ALAH 4AEFA 1I9IH 2P7TA 1JYVA 3REVA 1FYTB 1H5BB 1OLZA 1MFNA 1X7QA 1YNLL 4LSRL 3TESA 2AERT 3VFVA 1U8PA 3QCUH 3MOAH 4P2CG 5EC1A 3NIDF 1OAKH 1TPXC 1LNUA 4D3CL 4HEPG 1SY6H 2DRUA 3VFRB 5IVXB 2MKLC 2HFGH 4PLKC 1TPXB 4BFIA 1S7XA 3CNKA 2QSTA 3C6SA 3QT2A 5DJCA 4LSUH 1OSZB 4OFVA 1T5XB 2Y7QB 3HZKB 4QRSA 5J6HA 1NLBH 3L3DB 3GSNL 4LLYA 3UJTH 4PREB 4JVUA 4JQXC 4Z7WE 5HHXL 3RA7H 5GHWL 1TMCB 1I7UB 4E41D 1D5IH 1LMKA 4LCCB 4Y1AD 2BDNH 2BCKA 3I6GB 2MJWA 5K59F 2FBJH 3B2VH 1AQKH 5EN2A 1LO4H 2R2HA 3HKFA 4BZ2H 4TTGA 1BZ7B 2X7LA 1CFTA 1CGYA 1IGIL 4RFNC 2YBRA 4NO5B 15C8H 1U8KB 5MI0C 2B1AL 1AD9A 3PWLA 4RFNB 1MCDA 5KSBF 3MV7D 3MRPA 3QQ9C 2ZCHL 3VW3L 2L0DA 2GK2A 5SWZA 1VKXB 4OV5B 1HSBA 5MI0B 1OD7A 5I9QC 2HLFC 1N26A 1YYLH 2YA2A 1AJ7H 3B5GA 3MV8D 4XVSL 1UA6L 1FCCA 1CIDA 2VKWA 1V5JA 4KUZH 1NAML 3B83A 1A1OB 1NC2B 3JWDC 5I9QB 1KLUB 1G7MB 5I1IH 4FQXD 4N8PA 3CFIC 1YDPA 4JHWL 5IBLC 1TQCC 3BOVA 2OTWA 1G7PA 1WITA 3OKLA 4XNXH 5EU7C 3MBXH 1K6QH 3N06B 4AYFA 1EV2E 1TQCB 1FG2B 4IIQC 4FFZH 4MMZC 3GJEA 3WHXB 1DQLH 1OQOA 3B9KC 3QQ3A 4E5XA 3QUML 1IBGH 4IIQB 1MAKA 3V4PL 4LPUA 1BVLA 3MRLB 4XP5H 3B9KB 3WFBH 2BVEA 3E2HC 3BJ91 1YN7A 5E8DH 3B3IA 4WWKD 5IQ7H 3CDGB 4P4KC 3FFCA 1OOAA 1KYOK 1OP3H 3E2HB 1KFAL 4MZ2A 3KPTA 3NCCB 3HLAA 3CSYB 4P4KB 1YNTB 1HH9B 2I07B 1FV1B 3D0VB 2DTMH 1CFSA 4F7PA 3BSZH 3TYGH 4L4TB 5AD0A 1E6OH 5K9QG 4ZTPL 4OLEA 1T04A 4JFHD 4LK4A 1CFQB 2ZG1A 4UTBH 4L8SC 5IFJB 25C8L 1VADA 5L0QC 1OAQH 5JUEL 4PFEA 2MSPA 1ED3B 3MFFB 2VDOH 4R3SA 2H1PL 1WFOA 3RZWA 4G8EB 4L8SB 4CVWA 1EHLH 5L0QB 2VE6A 4NRYA 2WINA 5EOTA 3T2PA 4XP1L 4P23C 3ZYZA 1T5WA 1WLHA 1F3DH 2X41A 2ZUSA 2XZAH 1LO0H 5DLML 1RHHA 2BVPA 1FZOB 4P23B 3LQZA 2G9HB 1IEAA 1FYTE 1XGUB 2A6KB 3PABB 4MA1C 4GJTB 4WFHD 4L4VE 5KBNC 4M7KL 4PGEA 4D0CB 5HGAA 5AG8A 4MA1B 5I1HH 3BDBA 3BKJH 5IB1B 1NC4B 4KJWC 4KTYA 4R0LC 3O3EA 1OQXA 1QLFA 5IVXE 5TDNA 1UXWA 2OTUB 1YY8B 3PWVB 4R7NA 1RULL 4HGMA 5DEGB 2DQGH 4R0LB 4AIOA 3UJIL 3MFGB 4LVOC 5H2BB 3TT1H 2A6IB 2A83B 1UM4H 4LLMB 3BHBB 4LP5A 1I9JH 1QFWH 2K7QA 4MCYA 4ZXBA 4LVOB 4U1IB 4JFYA 4S0SD 4KK5C 3ZE2F 1NDMA 4PP1D 5IFHL 5FUZL 4U1SB 3AS3A 2EDTA 3KG5A 4WI7A 2ED8A 1G6RL 4P46A 2RQ8A 4HS8L 4U31A 5I1CH 1AR1C 4I3GA 1AIFB 1A0QL 1EFXD 1ZKAA 3EYSL 3PGCA 4OGZA 3MLXH 2YC1A 3VDAA 1G7HB 2X10A 1J8HD 4MZ3A 4WV1A 5J06A 4UDUA 1D6EA 4X6DF 4MGXA 5GJTL 5INDB 3QG7L 5EU6A 3GSXB 4J1UB 3HZYA 1KCVL 3KPMA 4P5MA 1CD1B 4RAUB 1AXSB 4UUJB 4XP6H 2HFFA 3OR7B 1SBBA 3O3AB 3NH7L 1ZVSA 2NW2B 5EU4A 5I17A 1LP9F 2VXUL 4XBEH 4ZFOB 1GZPA 4NWTL 3TBYA 3B9EA 4JO4H 1BGXL 1HXYA 3GRWL 5I8EA 3FT2B 4RZCB 1Z3GH 3DO3A 4LSQH 1U8MA 1F4AA 4JPVH 3DHJA 4PGDB 5ICZA 4TUJA 4OZHE 5FHBL 3IDXL 3SGEH 4UILH 2GCYB 4IRJC 4QRRD 5GGVL 4JZOA 1ZSDB 3E8UL 5EU7E 4MXWL 4HJJL 4YBQD 1YEGL 2FBOJ 3DGGB 4AEHH 3FONA 3RJDA 3WJLC 4IRJB 4B53A 1U8LA 3CFDA 1YMMB 5E2TL 1FAIH 1A6UL 2DLGA 1OAXH 1PQZA 1HXMB 1T66D 5CBEA 4XCEA 3IDJA 3AVEA 2H32H 3UC0H 3VDCA 1U91B 3UO1L 3VJ6A 4FG6D 2J8UF 4EVNB 1CXFA 1IAMA 2ZCLL 3L95A 3LN5A 3TBSA 4WI6A 4HC1L 5IB5B 1RUQL 4U3XA 5C0DB 4NZTL 4F9LA 1JWMB 3PGDA 3QDMA 2NXZC 2KPNA 5I71C 2JIXD 4L4TE 2VLJA 4LCWB 3ARZA 4QY8B 1FFOB 1A5FH 1KCLA 2NXZB 3GK8L 1MCQA 3BEWB 2DI9A 5I71B 3VMNA 4HFWA 1PYWB 2DBLH 4FMFA 2R23B 4HS6B 1HHKA 3UTZA 5DVOA 2NLJA 2QV2A 2CJUL 1QSED 3MRFA 5F1IA 2VLRB 1I1CA 5CZVH 1KT2A 5HYEA 3BZFA 2AJZB 1PKQA 5D4QA 1MFBH 4ZMAT 5L88L 5FYLH 5IF0A 2BY2A 5E8PA 3BE1H 4BELD 4MDJB 2YPVL 3ZHLA 1BPVA 1D7FA 2CLZB 1IEBB 5FYKD 3MLZH 5M95B 1FVDB 3HUJF 1CCZA 3LEVH 5D2NA 3VRIB 1A9EB 3UTSB 2VZ3A 4P59L 4CW1B 3KLDA 2A6JA 1B4JL 1G0DA 1PEZA 3UCRA 1CDGA 2AP2A 1AD0B 3U36B 5EO9B 5IMKB 2APFA 4TNWK 5C0GA 1P9MC 4L8BA 1MREL 3K4AA 3O8XA 2ICEA 1QFWM 2F54D 4HF5H 1TVBA 4G6JH 2JB5L 3HFML 4K3HA 1C08B 4DQOH 1X5JA 3WHE0 1K2DA 3BESR 4O2EB 4ODXA 4PLOB 2WWMC 3KPQA 1P7HL 3SDAD 1L0QA 4R26L 4U49A 4Q2ZA 3LKQA 4R4FL 2FB4L 1UZ6E 3REWA 4GAGH 2RIKA 1WWWX 4D0BB 4ZOBA 1G84A 5B4MC 1CDYA 1N59B 1VGKB 2NTFA 3NACL 4JHAH 4NJAH 3RNKA 2VJXA 4YHIB 3VA6A 1MHEA 4N0RA 5D7JC 4MJ2A 5DA4A 1H0DA 4BFGA 4MA3A 4D9LH 1P84J 1GHFL 5D7JB 1VFAB 4JM2D 1IGJB 4JY5L 5JZ7D 4LASH 3NTCH 3MLTB 5ETUA 3RWJA 3DO7B 1IAIH 5J7CC 4GXVL 3RX5A 4MJ5A 4WO4D 4HMEA 5FOBA 4CDHA 1Z6JT 5GS3A 3TO2A 5L7XL 1IFHH 1FBIL 4WEBL 3U7WL 5HJ3B 4FP8L 2DQUL 1R5VA 3D48R 4OGAD 4XGZA 5JO5A 3L3OB 1K4CA 4HWBA 4LPVA 5E1HB 3BDXA 5TQ2L 4F7MB 4CN4A 1CVSC 1T7ZA 3GBNH 3JV6B 1N5YH 4NBYB 1XCQB 4IHOB 4NO0B 1F42A 4W6WB 5JHLH 2F5BH 4LU5H 4G42A 1S7TB 1I1AD 2DYPA 2NY2D 1UB5A 5DA0B 3TA3C 3S4SA 1D5MB 1N64H 4NPYA 4W6YB 3MBEC 1WWCA 2X89A 4L3ED 3ULUL 4Q6IC 1RI8A 4LCWE 4ZUWA 5K9KA 2XWBB 4LAQL 4OZIA 5EZJA 1N0LA 3MBEB 4TVPE 4NQDB 1JGEB 4KJPD 1BQUA 4Q6IB 3RUGA 5C3LD 3VFUB 5HXMA 1ORSB 2VSDA 4PJBA 4YLQT 4JREC 4FXKA 1JZ3A 4P9ML 4M8QA 1Y0LB 3UDWA 1FNSL 4Z7NF 2BSRB 5FDWB 5E6IA 1R6VA 3SBWC 4XRCA 5D7IF 4NQCD 1IGTB 4JREB 4RSVA 5DJXB 5DD1L 3SY0A 3QQNA 4JANB 4U1MB 5TF1L 5D7LE 3WNPA 2AJYH 1G7QA 4XHJD 1XH3A 2OM5A 1A7NL 4KAQH 5L6YH 3WDIA 3W0WD 4K55A 5J6GB 3MXWL 4IDJL 2DQDH 3QB7C 5GRWA 3WD5H 5B8CC 3SE8H 3INUH 4KI5C 3GGWA 1UYWH 3BP7A 5ILTL 1MNUL 2C3GA 5B8CB 1IKNA 3UTSE 3EYFB 5BMFL 3KLAA 2VH5L 1PBYA 5EBMA 2X1WL 4PTUB 2O5ZH 1T80A 4OLWL 5IB3B 3AS0A 4OD3H 1V7ML 3TCLA 5KSAC 4YX2H 2VXVH 3WSQL 3U4EA 1P4LB 4HGWA 3L5IA 2G60L 2R69L 1QHOA 4MAUH 1S7SA 3RVUC 2IGFL 4MCZB 1HDMA 4NIKB 2CXKA 3O2DL 3KPPB 3EOTL 5HVGB 43C9A 1BVKB 2B4CH 2GHWB 2Z31D 2LV4A 4ZS6D 3QQ4A 4KTDH 3ALWA 3L3GA 1JZ4A 4NM8H 1HK6A 1M7XA 4HCRH 5CJQL 2PTTB 3QFJA 4Q74A 3C5JB 2UZIH 3WHE1 3S97C 2AJUH 2DLIA 1FZMA 1NMBH 4X9FA 3KR3H 1EZVY 3V79C 3RDTA 2KQMA 4OIAA 2V7NA 2IAMD 4JKWA 5T3XE 1H3VA 3FB8A 4MNHA 2G5RA 1MJ7L 4OQ1A 3H2WA 1FH5L 2DQTH 3FQTB 2IMMA 3EOBA 3TH3T 4HFUL 4BUGA 3L1OH 3VG0L 3O81A 3T8XB 4PJGB 1F2QA 1IAIM 4WW2A 3SDXB 5EIVA 4EUPA 4TPRH 2M1KA 3HAEH 3MRGB 1XGQA 1DLFL 3MRCA 1BECA 4GRWF 2BP3A 1KXTB 1V7NL 4N8CL 3AREA 3WLBA 1GGTA 3CXHJ 4EKXA 2Q3AA 2XYCA 5FO7A 2CRYA 1A02N 2FR4B 1Y18A 2P49B 5T3ZE 1TVHB 5GJSL 3L5JA 1INEH 3FFDB 4K9EC 1F4WL 1OB1A 1OSPL 3L6FB 3LEYH 4X4ZA 1VESA 1ZK9A 1DEEB 4JCLA 1RAMA 3P4LA 1FLTX 1I9EA 3QPQC 1G7JB 1WZ1L 4MNQE 5HYQB 4NO3A 5JLZB 1B6UA 3IF1A 3ZE1F 1F58H 3VGBA 4HXBH 1JPTL 3C60A 5HGGS 2ENYA 5IJKC 4LPCA 2A74A 3UTQA 4XBGB 3UTOA 4ZQKA 1HHIB 2W07A 4S0TD 4AEIH 3BVNA 4H1LA 4CU7A 4WU5A 1U95A 4QTIH 4RQQB 1FGVH 3S5LA 4ZNEE 2H9GB 2CLRB 1UM5H 2B2XL 3CVHL 4X6BB 4HKJB 4PJCB 4NQDE 5H94A 2OBGA 2BNQB 4NT6A 5CFHA 3K46A 5KZCD 1X4YA 1KN2L 3VWJA 2WANA 3MREA 3NMEA 1P1ZA 1TZHB 5CEZH 3MCLL 4DZBB 3X11A 4Z7VA 5AZEH 1RMFH 2GITA 4GRMB 1KLGB 2H8PB 1H3XA 3QI9D 4NRZB 3HZMA 1NGWB 4OD1H 5F6HJ 3BW9B 3P9LB 3SE4A 2EDYA 2FHCA 3L9RA 1ZLVH 4HXAH 3MJ8A 1S7VA 4G43B 3UZEA 2F53D 5CZKA 4XZUB 1JNHA 5DTFB 4LOUD 4CDGC 1JYWA 5I0ZA 5F6HI 1A7QL 2PXYB 4Y8AA 4HK3J 2H32B 3UTTD 1JZ7A 3GSOB 5EH1A 4M1GH 2DM3A 1D5XB 4H8WL 3LCYA 1JTTA 3L7FB 2O5XH 2OMBA 4XH2B 3EOAB 1I7TA 3MOBH 4Z78A 3O3DB 3CU1A 4XBPA 2X05A 3FQWA 4JAMB 35C8H 1T83A 1FN4B 4B7IA