5I6XB

X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB02
4MD0A 4KK6D 3MRIA 4P4KD 3KPRE 3BP6B 4LMQE 1EAJA 1BFOA 3H9YA 2RHEA 5L2KE 1WBXB 4JDZA 4DN4L 3MRPB 3VG0H 1CU4L 1ORSA 2BNRD 1LP9E 1V7ML 2AQ1A 2BHYA 1FE8L 3LEVL 2PXYA 4J4PA 2H9GA 3MRHA 5KSUA 4PREA 4MCZA 5IHBA 4KFZC 1P7QA 1U3JA 3DX8B 2X1OA 4UV4H 3D9AH 3BHBA 2FL5B 5CHNB 2HWZL 5E94B 3EO9L 4J3UA 3HUJA 4PJ5D 5IM7A 4JQVC 4MD4B 4WRLA 4P9HL 2JELL 3VFWA 4U6YB 3BMVA 5LBSL 4AMKL 3NCYP 4JHWL 4MB5A 3H9HB 4WO4D 1J7VR 1U93B 2FB4H 2NY5C 3BD3A 5J1AA 4OD2B 1XH3B 3EOTL 4TRPH 3RIAK 2DN7A 4PJHB 1VENA 3ARRA 3T3ME 4NZUH 4N9OB 4JFXA 3E3QE 5EZJA 1CT8A 1OL0A 2IFGA 3OR6A 3O3DA 4PRAA 4JGJA 3MJ9A 3P30L 5I0DA 5K9QI 5IHZB 3NTCH 1QHPA 1ACYH 4P3DA 1C8PA 1OP3K 5TFSL 4O58H 1R0AL 1ZVYA 4FQXB 4DWHA 1MAML 2BXZA 1F02I 2Y07H 3P4NA 1K3IA 3QB7C 3D0LB 5EZOH 5E94A 4N0YH 4ZFGH 4G8GB 4HWBL 3UBXA 5DJZA 3SQBA 1KOAA 1FYHB 5D1ZC 2XY2A 4ZSOB 1QNZL 4HJGA 4KQ3H 4MNHA 5DLMH 1C12B 1H15A 3RVXC 4Y4KD 1F45A 5DVOA 4FQLL 4OGXH 1JMXA 5HVGB 1JPFA 3SDAC 2C3GA 1IMHC 2YD3A 4KKAC 2V5YA 1KT2A 2Z9TA 2ZNXA 3RDTA 2P8MB 2J1KA 4CW1A 4G8IB 1S7TA 3MQIA 4NFCA 1DEDA 4P46C 4X4MA 5TDPB 5E6ID 4HG4K 4J3TA 4WCYL 1BAFH 4N0CD 3BH9B 4LEOA 1PQZB 4PD4J 2W0LA 3F12A 4BQ6A 3EOAA 5BV7H 4N8PA 3M17B 2VZ1A 4HXBH 3U4EB 3WLBB 3G04A 5KOMC 4QHNA 1JGEA 1K8DA 5F1NB 3QIWC 4U6TA 1KEGH 4E0RB 3CLFH 1AR2A 5FYKE 1W0YT 2FZ3A 4LLQA 3RY6A 1RZJL 1QFUH 3D87B 4J6RL 2EYRB 2H45A 3L5JA 3O4OB 2XQYG 1NCNA 4Q2ZB 2DQGH 3HA0A 2LVEA 5I1IH 2QQNH 3KPSB 5FGRA 3VXSE 4PB9L 5AYUH 5GSRA 3O2DA 4M7ZB 2F54A 3QEQE 4PYHA 5EO9B 1T66C 1JGVH 2ZP0T 5DYOA 4NQCA 3GO1H 4KZEH 1W72L 4ZAKD 4F33A 5E00B 3PIQB 4Y4KB 2EH7L 3TEUA 1WISA 3BIKB 1N8ZB 4CRPA 2JE8A 5C0AA 1JMZA 5D5MF 3WJLA 4Y16C 3WHE1 4DTGL 3T65B 5EUOA 3RWFA 4UIMA 4KRPB 2NW2A 2EXYD 1YY9D 4ACPA 3N1MC 4V1DB 4M00A 5JR1H 3H9SD 4ODVL 4X6BB 3DETC 4H8WH 5BOZG 5LGHH 4H25A 3QQ4B 3VWJB 2OTWB 3RPKA 5HGBA 4B7IA 3CFIC 5KSVA 1KLGA 1D5BA 1HINL 4TUJB 5K33A 4MDIA 3BIAX 2XZQH 5DFTA 2I24N 4ZS6C 3NFNB 4GMSL 1LGVA 3IU4L 3LVEA 1K3ZA 3LDBB 1BJ8A 4KQ4L 4W70A 4YXKL 5DK3A 5I8EA 4U3HA 5ACZB 1X5GA 1EIBA 4X5XA 3P73B 3TJHC 2DJUA 4CNIB 2D7PA 3L3KB 3LN4A 4I48A 5J89A 3OSKA 4XVUD 1FYTA 2XN9E 4KTYA 3RWCB 1MJUH 2KZWA 2EIBA 3NTCL 5GS1C 4PRPB 3I6GA 3IDNA 4YR6A 4M1GH 1AQDA 1DBAH 3EDEA 1KIPA 4LSRH 3T0WA 4R4BA 4F2MB 4OZGB 3HTLX 3LN5A 1KTLB 5KN5A 2F9BT 1HYSD 4M7LL 3VXMB 2OMBA 1GRWA 3QUKA 4H26A 4L5FL 1J5OH 1KCVH 3RWHB 2VAAA 1IBGL 4FG6C 4QOKD 4HIIB 3HZVB 3V95A 5TQ0H 3X3FL 2MCG1 4EUPA 4CNIA 4UBDD 5J7CC 3MPCA 1EBPA 2F74B 4J3XA 1U8HA 3W5MA 3KXFE 3DMMB 2EZ0C 4OZHB 5SV3A 2EE9A 4L4VD 3TN0A 4JFEB 5D5ME 1DSFL 1P9MC 4HCRL 4RMUA 4XNUH 2NY3D 4PLNC 1XIWB 1D5MB 5CEZH 2BOCB 3KPNA 1NC4D 4PRHA 5D7LA 3RVVD 1AXIB 2P8PA 3V5KA 1KJVA 3NPZB 2CKBA 5T1LA 5T3XE 4P3WA 2V17H 4R7NA 3MRDA 5EG6C 3WLWC 4N68A 3QHZH 1S9XB 4ZUUA 1AHWB 4PJHF 3L9RA 4XPHH 1NCCL 5DJCB 4K8RC 4KRLB 2DQEL 5D1QD 3L95A 1YPZE 5B22A 1JZ7A 2Q8BH 1V3LA 4TPRH 3I75A 4Y16B 4NSKB 1HQ4A 5FKPB 1I9EA 1PG7W 3MV7A 4Y1AB 1DBJH 5D6DC 5AWNH 2BRRH 4OLVL 3X3GL 3F6IA 4U1HB 2BVTA 2EDOA 3C6LA 1YMHB 3BXNB 4MNGA 1RUPH 5IEHA 2UUDH 5J8OA 3OG4B 3QIBB 5JTWA 2R1WA 1T89C 2FX8H 2Z31C 2X4PA 2PN5A 1W72A 5HHVH 5ETUA 1RZGB 4X6CA 2IG2H 3LDBC 3FONB 3WUWB 2GSIB 5C0AE 2EDYA 5T1DH 3QP3A 1QLEH 5ICXB 2NXYD 4XPFL 5T33L 4HBCH 4R90H 4LDOB 3VXUE 5EIIB 1G6RL 3S5LG 4FXLA 3RX5A 3C8DA 4ZFFA 1X3DA 4KTDH 1EH9A 4XBEH 1A3LL 3JV0A 2VXTL 2IH3B 5HHMD 1ADQL 2DJSA 2W07A 3QEQB 3WFBH 4LSUL 3NOIA 2R9HC 1ORQB 2LTQC 5IEHB 1V7NL 2ZKHH 5FV1L 4NQSA 5JOPD 4Z7UB 2O5YL 3TH2T 2Q6WA 1EERB 2M2DA 3CSYB 3LCYA 5KS9A 1S8DA 3PDDA 1MCHA 1BBDL 1CICC 4R3SA 3ZKQD 1R5VB 4N1CA 3GMNB 3DNKA 4JM2A 4JZJB 4YAQA 1NEZA 4APQB 4W6XB 3D48R 5ICXA 3C60D 3RWEA 3LKRA 3BT2H 1NCUA 3MLXL 3PQYA 4FQCH 1J8HE 1F90L 1CWVA 4JQVA 4NGHL 4G6FD 4S2SA 1BFTA 1AO7B 5I1IL 5KSBA 5BZWB 4PB9H 3GHEH 2NR6C 4Z5RA 1T5WB 4ZODA 4HFUH 3VFPB 1M7DB 3VDCA 3TFKC 1Y6MR 4ONGL 3KPOA 4O2CB 1YY9C 3AXLB 1Q9KA 3GBNL 1BZ7A 4WW1B 5T1KD 5E0QA 5ACMA 1W72H 1NUNB 5I1DA 4D0CB 4GXUN 1JFQH 1S8DB 1D6EA 3DXAD 3F12B 2VDPH 3QCVH 2C5DC 4ZO9A 4DAGH 5C08A 3D39B 3RNKA 5FKPA 1IGIH 3MV7B 1RULL 9CGTA 5KANG 2D4DA 3B8SA 5JZ7C 4HKZA 4S11A 1NGQH 2CDEA 1QA9A 4QEGA 1DN0B 3QIBD 4HCRA 1ZS8B 1OPGH 4TVPD 5DJAA 5ECJE 4M6NL 5EOCL 5IQ9B 3S96A 4LPYA 3K8MA 3BD5A 4JFZH 1XR8A 4JFED 5EU7E 5IB2B 1CIUA 4NUGL 4FQQA 1IQWL 1A21A 3I6KA 1C08A 2GITA 5CGTA 4NZUL 5JPMB 3ARZA 2BDNH 5DT1L 4HWEH 4X9HA 3DURA 3W11D 1WFOA 3HAEG 3HE6B 4OCXL 4XVSL 3L5WB 5DZNA 4LNRB 3QI9A 4ISVA 1G7HA 3RNKB 4CMMA 1KPUB 4YHML 4M6OL 3IETA 1KCSL 1MAMH 3STLB 2Q8BL 3NIFF 2V7HB 4AYFA 1PLGH 5EOCJ 1A9EA 5EZOL 4PJIE 3QUMH 1CI5A 2DMCA 4MNGE 4WWID 4HH9A 5EORL 1AGCB 4ONFL 4OKVA 5F72S 2OSLB 1ZLUH 3W5NA 3ULVH 2NZIA 3MBEA 3WIFA 5CAYB 3STZA 2RJMA 2OJZL 1QG3A 3QXWA 1Q8MA 3TBWA 3VU2A 4X6CE 2R1YA 4YDLC 3H7BB 4Z0XB 4R97B 2Y36L 4M7LH 1A2YA 3FQTA 3P11H 1U2CA 5EWIL 4GH7B 1BZ9B 3VI4E 4O5LL 1VKXB 1ND0B 2J6EH 4H1LH 3GZKA 4U0RB 3WFHA 4MWFB 1MUJA 1X5AA 1OAZH 1OGTA 3DVFA 3UPRA 2JCCB 1PY4A 2R2HA 4UOJA 4XPGH 4NO0A 3I2CH 4YHKH 2F53B 4TSAL 4PJIB 4HEPG 5DD6B 5IHZA 4MVBD 1CQYA 4GW1B 2E7MA 3CUPB 3MRLB 4KJQC 4JM2C 3HI5H 2FX7H 4KUCD 3X13A 3ECBB 1TPXC 1MJJB 1BIHA 3MCKB 4DUWA 5I17A 1DQTA 2FLBT 5C08B 2EIEA 2BVPA 4YBQD 5CIPH 5DVLA 5DHVB 4ZG1A 3H0TA 4YHNA 4B53A 1KYOJ 5D7IE 3UPRB 3MV9D 4LSPH 2H3NB 2QQQA 1N26A 1W0WA 3SKUD 1MFAL 5DJYB 1ZEAL 1KLUB 4TYUA 3GUTB 3LKSA 4KKAD 2P5EE 1YEKH 5ID0A 2HRPH 4KK8C 5TDPA 1RHFA 4JREB 2GITB 4XP6H 4XWGH 1RZIB 2VDLH 1FPTL 4PJAB 1BM3L 3DUUA 4QTHB 3UJIL 4EDWH 1P4LA 1ZHLB 2W9EL 3QDGB 4KRMB 2IGFL 1UB5B 4O51A 4X6CF 5HI3C 3EBAA 1U42A 2GK0A 4PJ7E 2HN7B 4KKLD 3ZLQC 3QUMA 5DUBA 1J8HB 2V7HA 1OTUC 5F1NA 4P23B 1EA9C 4WFEE 2FNBA 4MYWB 1W0WB 4M1DL 1KLUA 3AROA 3IRZA 1OP5H 4IMKA 2W9DH 5DFVC 3GUTA 3SQOH 1N5AA 2VWEE 2EIZB 3O11B 1XF1A 3SGJA 4G9FD 4JG0H 4WI3A 1NEUA 3R1GH 4IRJB 1RZ8A 1PKQB 3MRCB 4P99A 3FQUB 2DKSA 5DK2A 4UQ3B 5FO7A 1JVKA 5HYFA 4LEXH 3BPLC 5INCA 1UB5A 1CQKA 1DLHB 3FONA 5IJVB 5MEOA 1JL8A 3RWHA 2FLRT 4JN2B 5KTEL 2NY5L 3MGAA 1FAIH 4LSRL 3QXAA 5FO8A 4QT5A 5J0BA 1OGAD 4B7LA 2CUHA 3L3HB 4Z18A 5FHAL 4EJ1C 1IL1A 1UCBL 4MB4A 2ADGA 3KR3H 4LGSB 1GPOH 4P59L 4WI7A 43C9A 4NKIL 3E8UH 4R2GC 4HAFA 2FHCA 1D5BB 3HNTL 4YHZL 1CK0H 4X0KB 2WUBL 1I3RA 1HHGB 2BVQA 1UM4H 1URLA 3DRTB 2FZ3B 2IH1B 2OX5A 4GUPB 1NEZB 4HUXB 2A83B 2C1OB 3LZFH 4ZUSA 3TO4C 2KUTA 5IB1B 1FHGA 1RK0A 3WFEH 5A2FA 5EOCH 3KXFD 1ZVHA 5B38A 5F9WB 2GJ6E 4LHQB 4XPHL 1GAFL 1JPGA 4EXKA 2X7LA 4ZO7A 3VGHA 2EE3A 4FQIL 2WM0A 1KIPB 1IC4L 4PRHE 5J11C 3RY6C 2IAMD 1HIMH 4KRPC 1M6OA 3GSWA 5MP6H 3D69A 3DVNB 4RQQA 1NCWH 4P4RA 5TDNB 1BQLL 5A2KH 5I15H 3UYRL 1U36A 1MREL 5CUSH 4HX1B 3GKZA 2DQHH 3LQAC 4JE4B 4DGIH 1D7FA 5D6CB 1WBYB 1E4XI 2X1PA 1AP2A 5HGHA 4FG6D 2D9CA 3JSSA 4ZFFB 1R5WA 3MLWH 3O8XB 1T5XA 1HWHB 4EKXA 5JNYB 2FO4A 3MRNA 3MLUL 5IMMA 4R8WL 2XZZA 4EI5A 1IGYA 3RVWC 3VWJA 3E2HC 1IM9D 2IMMA 3WS3A 1DFBL 1UA6L 4X9FA 2YXMA 4U7MA 2BFVH 5H8DA 6FABH 5I8OL 5IK3B 4YEFA 4S1DC 3JXAA 2H41A 5T5FL 2QBWA 4ETQB 3CMOL 1P4IH 1U8LB 1AE6H 1RSFA 2QKIA 4ODTH 3UTTE 3BYYA 2K1MA 3IRPX 3REVB 3ZKSD 4YHKL 1ED3B 1I1AA 3GIZH 4NZTH 4F7MA 5DO2C 4KRNA 2YWZA 5H35B 5FUZL 2CH8A 4Z78A 5KZCD 5L2JA 4H5SA 3QQ9C 2DQFB 1J12A 1MH5A 3HCVA 3LKOA 3HI5L 1NGZB 2J3SA 4X6DE 3G5YA 4LFHG 1RJCA 3MRGB 1MSPA 2VXQH 3QQ3B 2VLLB 1F4HA 5TQ2H 2JJVA 4M3JA 5HHOE 4RGNE 5F1SA 3RVTD 3FO1A 4PTTB 3S5LB 3T1FA 3QJFB 1NAKH 4MS8D 1LO0H 2W38A 1N59B 3ESVF 4I2XB 1UYWL 2ATKB 4ETYA 2X7LB 1EVUA 1VGKA 2NLJA 4OKDA 4TNWF 4JCMA 2VDLL 1RK1B 2AEPH 2MQ3A 2VL5B 3KXFB 5HDBF 3U7YH 1D5XA 1T6WA 4QRPB 5IM7B 5KVFL 3E8UL 4LLUB 3FRUA 5C7XH 1F6LL 5B3JF 1I4FB 4YHZH 4QWWC 1IC5H 1IGML 3ARWA 3DHMA 1U93A 4QXUL 3JV4B 4TOYL 5C0GA 4X4YB 1U41A 4LQFH 4P2RB 2XG5A 4ZDHA 2DQCL 5DUMH 1N5YL 2DQUL 3NPSB 2FGWL 5CD5C 3F5WB 1DE4B 4ELMA 3MRMB 3ROOB 5DJ2A 5EB9A 3VE0B 4RFEA 4OLWL 2DDQL 5GPRA 1HSBA 1JF1A 1KGCE 1V7NH 4MJ4A 4NZDA 1IKFH 4CMHC 3LKQA 3KPSA 1KCSH 2CO6B 5I74B 5IROA 4PJAA 1UXSA 2YMXL 1CU4H 2LQRA 3VFVB 2YOCA 3UDWA 4ELKB 3BKYH 1C12A 1HILA 2H8PA 4OGAD 4AEHH 1QLFB 5KTEH 1AI1L 1BEYL 3JV6B 4NO3B 1FZMA 2N4IA 4PJEF 4XNMA 3BIKA 4PJGA 4BFIA 4NZRH 1T2XA 2JELH 2GJ6B 1CD1B 4X6EA 5JIKA 4FQCL 2A77L 5E99H 4PJIA 5DD6A 3RWFB 4BQBA 1NGYA 2COQA 4PB0H 3VE0A 4OUOA 4JFHD 1HXYB 3FN0H 3MLUH 3QIBC 4APQC 1D5ZA 3GHEL 5HBBA 1U8KB 3PWUA 3I84A 3P0GB 2UYLB 5GGVY 2IPKA 3L5IA 1ZV5A 5E9DE 5ESAA 1QSFB 2CKBH 2XIDA 4IBLT 4JPVH 5C6TH 1T1ZB 3TZVA 4U6VL 1YEIL 2ZPKH 1CF8L 2YK1H 4PJCE 3GMOB 4ZAKC 2EDEA 2A9NH 5CJOL 5C0FB 1GZQB 3SGEH 5BOPA 1P4IL 3DTXB 2HKHL 4KDWA 5IJVA 1SJEB 4GQ9H 4XHJC 1OP9A 1C16B 1L7TL 3ULUE 4YC2C 1XEDA 1P6AB 1QFWI 2Y6SD 1HHHA 5IB3A 5D2LA 4DCQA 1JHTA 3OJDB 1G7JB 5EFIB 5IBUB 1I3UA 3MACL 1FVEA 2J88L 4U0RC 4L8BA 1E6OH 5DC4B 5J06A 3FHQA 1D6EB 1BOGB 1YUHB 1DUYB 4RGMC 4DW2L 5DT1H 4JFFB 1T21A 3DO7A 3I6LE 4MNQB 4PGCA 3QCUH 2JJTA 2HN7A 3FO9A 2IBZX 3TC9A 5C07A 2HT2C 5F21B 4K3HA 3C87A 4Z7WB 4M6OH 3OF6D 3HZMB 3GMMB 3MOQA 2BVQB 3EJZD 5JDSA 4KMTL 4PJEE 3S96B 3K2UH 1SM3H 2A73A 2Z91B 4YFDB 1JPSH 5CHNA 4HZLB 1X5YA 1RJYB 3WHXA 3HUJB 3V6ZB 4YE4L 4OM1H 5D1ZD 2BFVL 5J9PA 4X7DC 1U8PB 4MJIE 5B39G 5E7FA 5EU3A 1FFNA 2WBJD 1G1YA 4JFFE 1LHZA 1LNUB 4HS6A 4PRPD 4LLYA 4POZD 4YUEH 3PWPB 1AE6L 5FM5M 5I8KH 1E4KC 2B2XL 3KHQA 5CZXD 3RUGF 3H0TB 4NYLB 2UVFA 4ELME 1QO3A 1TZIB 4KRPD 4KVNH 1MRDH 4I9WD 1HKLH 5D6DA 4X80L 5E6IC 5F89B 1OARH 4UBDC 2FJFA 2QR0B 2RR3A 1RIVL 2FYYB 1OF2B 1AC6A 3LQAL 3MGTA 3MC0A 3ULUF 2VSDA 4LL9A 35C8L 2PUQT 4I18A 5IESL 1I1YB 4G7YH 3EOYG 2MCPH 1A7BA 2HKFH 3MREA 1G9NC 4QTHA 4KJYA 3RFZC 1RIUL 4IRSC 5C86A 5FYJE 4Y4KA 4ZS7H 3O41B 1I7TA 1J05B 1LE9A 2VLJE 4M9PA 4OSUH 1OSZB 5D93B 3CFEB 1X5IA 1HINH 4Y2OA 4PJBA 4ZPVB 4G8IA 1DQQB 1XGYH 5GZNC 3H42H 1X7QA 1B3JA 3DX9B 3T3PE 3QEUA 1EV2E 5KANI 3L7FB 5E5RB 2DM3A 4M93B 2WUBH 4U1IB 5CKGA 3SJVD 5JXED 4F3FB 4PB0L 3RGVC 1QFPA 1I1YA 4KHTH 4O2FA 1K2DA 4I0PC 3RPIB 1O7SA 1JWMA 3MRDB 5C7XL 3N06B 1NCBH 2D7NA 3U46B 2YC1A 1GC1L 3G04B 5FHBL 4HUWB 1RZJC 3UO1H 3ZKXB 4CKVX 3T77B 2ATPB 1QRNB 4N8VA 5ESQB 5EZIL 4U1SA 4GW4B 1CF8H 4G80A 2APBA 4YGVB 4KI5D 4PRDA 5SWSB 4XZUA 3WO3B 5T1MB 3QG6A 3MLRL 3TVMC 1AH1A 3FQXA 4L8SC 2QJDA 4YZFE 3VI3F 1PFCA 1WZ1H 4ELMF 1XF4B 3SQOL 1RY7B 1TJGH 1PDKA 3V4VL 5IQ7H 4K94H 3UTZA 4AIZA 4Z7QF 4OIAA 3TBSA 3X3FH 1CXIA 2GJ6D 4WGWB 4I5BB 2VDQH 3UAJD 5CWSB 3PQYD 2CR3A 2ED7A 5ISZB 2H6PB 3CZJA 4KKCC 1NC2A 2YBRB 2OR9H 1J10A 2FX9L 3AS3A 2ZUTA 4AENA 4YFLF 4K7FA 5HHNA 4YXHH 1I9RH 2WWKO 3MV7E 2PTTA 1AQKL 4HW6A 2HH0L 4LSSH 3VXSD 3SGEI 3C60C 3O6LH 3MRIB 4LVOB 1HNGA 1N5AB 3QQNA 1JZ8A 3B6SB 4LCYB 4FQ1L 3LY6A 4JREC 1Y0LB 4UI2A 2C9AA 2OTWA 5HGBB 3KLSA 5J6HA 1ZT1B 4NKDA 4TUJA 3ARGC 3EDKA 5EOTA 1UKSA 4PJHE 1EK3A 2P5ED 4MNQE 4KK5C 2KH2B 2C3VB 1LE5B 4M62H 2ZPKL 1B0RA 1DEEA 4DZBB 5IFHH 4GG6E 2XXCB 3RVUC 2YD5A 3FO2A 2FATH 4UAOB 1H3TA 1JGUH 4B41A 5MEQB 4M4RA 43CAA 2YUZA 3NIGE 1JPST 1MCCA 3LZFL 4Q9QL 1INDL 1DUZA 3DRQB 1N6QL 2IAND 3QCTH 3S98A 1PG7L 2DL2A 3LQAH 3ARGA 4X8XA 3FFCE 4K3GA 5IMLA 3TO2B 4WHDA 5GRXG 3QNXB 4NNXA 1BZ7B 1TETH 1VACA 2D31B 4OT1H 4WW1A 2GTWA 3O3EA 3IGAB 1NBZB 1RZKH 3MMEB 4NT6A 2APVA 1BBJA 3VD4A 5ANMB 3BN3B 4U1LB 5ENWB 3SJVB 4Y5XA 1CD0A 4PG9B 5JMRA 5FYLL 5EZLB 2IH1A 4OLXH 4GAGL 1GGBL 5F71A 5ICZA 3VJ6A 1NFIB 5IEKB 3Q2CA 4GRLC 2HFEA 1AY1H 3I50H 2RGSA 4NJAL 1G7IA 1NGXB 1C1EL 1ZWIB 4M8QB 2R69H 1G0DA 2I60H 1AD0A 1A3RH 1PJ9A 3DIFA 4XNZC 5CP7A 1ADQA 1AFVH 3JWDH 2EKSA 3ARSA 2DICA 1VFBA 1FRGL 5ILTL 2ICES 3U0PB 4A6YH 3D2UA 3H8NA 1JJUA 2K9UA 5HYJB 1KN2L 3S88H 1DQML 2YBRA 5E6YA 2GI7A 2YPLB 1K8IB 3WO4B 3TFKD 3DOSA 5HDOA 1Q72L 3X12B 3NBNA 1UQSA 3CZFA 2FIKB 3REWA 4K9EH 5FHBH 1QACA 4NSKA 3GSVA 1I7UA 1FVCA 1KEMH 1CG9A 3N0PB 5EZIH 4KVNL 1CD9B 3CLEH 5CGYD 2AERT 4LLMB 4P9MH 4HUUB 2CPCA 4R96B 4MXQD 5EBMB 3HC3H 4IS6A 2OSLA 3BUTA 4HFWB 2H2PC 4HLJA 3VW3L 3PE9A 4GBXA 1T1YA 5MENA 1C7SA 1BJMA 2DLTA 4HQQH 1KLFA 1A4JA 4GRWE 2YA1A 3P4NB 3U7AA 1SBBA 2V2WB 5BW7A 5DRZA 5ETUB 1NGQL 5FGBC 2DMKA 3D2UB 4LCCB 4JM2D 1U6AL 3WUWA 5IK3A 3SDDC 3IDMB 5TH2A 5IG7A 2NZ9D 2E9IA 1MFBL 1N3NB 2CUMA 4JFZL 1KIRB 1JF5A 2BC4B 2OMNA 4Q6IA 3OKEB 4RAUB 3QUXB 5CCKL 3BKJL 3VRIB 2EDQA 5F7YC 4RNRB 1QFWH 5GZOC 3O6LL 4RX4A 2CRYA 1IC7L 3PWJB 5BVPL 2AAVA 3G5YB 2RQ8A 3LIZH 3IJYA 4CN6A 3BHBB 3O3EB 1GZPA 3ZHLA 4M43H 3CSYA 4P5TC 3QDJD 5ANMA 4DKEL 1MOEA 3LRSA 5CBAB 3NCMA 5E2VL 3FCTB 3UO1L 2VZOA 2UWEA 3LHPL 5EBLB 3MJ6A 3T4AA 3UTOA 2VJXA 3VFSA 4KI1A 2PW2A 3PGFH 4PJIF 4YWGH 2P42B 4MHHG 2H3NA 3VRLF 2ENYA 3QRGL 5FCUH 2VQ1B 3VFNB 4DK3A 5EWIH 5GRVL 2XYCA 4Z5RB 3WDJA 3KXFA 1NLBL 3S35L 4PYGA 2J6EL 4M1CC 2BVEA 4BKLA 4PPTA 4QTIL 3FT2A 4ZXBB 4KXZI 3BKML 1GGCL 5DMIL 3I2CL 5HYSB 2H26A 5FF6A 1WSST 3QHFH 4F9PC 3I9GL 4NCC1 1JRHI 1CZ8L 5CP3H 4XBGB 5J12C 2W60B 4NFBA 1MLBA 5EBLA 1IAIH 4I13B 4YXHL 4WCYH 1P69B 2A6DA 2JIXB 4NM4L 2ATPA 3NFPB 4N8VB 3B5TA 2R56H 4LBEB 4BSVA 2R2HB 2P45B 3D3VA 2XA8L 3CFJB 2F53A 3DETD 4IJ3B 1FZOB 1XR8B 2VC2L 3ARPA 4PJEA 4DVBA 5IB5B 3RVWD 1DBBH 4LGRB 3I02A 1RV6X 4K23H 1HNFA 2AGJL 5HPOA 1ZA3B 2EDWA 5FOBA 1PX4A 4P0DA 4LCCC 2W0FA 2VDRH 1LEKA 3SOBL 2X4UA 1KCRH 1DVFD 2PF6A 4PRHB 2ESVE 4YH6A 3MYZA 3MXWH 1NGPL 4Z95H 3AU1A 3PGDA 4CGTA 1GJIA 1WJ3A 5CGMA 3S88L 4UDTB 2HRPL 3U7WH 4QKXB 2UZYB 4XNYH 3WLBA 1U3ZA 1A6AB 3R0MA 4NCDA 4ONHB 3EGSB 1XGQB 3NZHL 3EO1A 1FO0A 2VDKL 1G7PA 5KW9H 3V0VB 5JQHC 4XP9L 5FOJA 1TNNA 4YEEA 3MJ8B 5DJYA 4LCWA 3QCTL 4QLRA 2D3VA 2ILLA 1J8HD 2LE9A 1RIHL 3OKNA 4LCYA 3U30B 2R1XA 1NCAL 4ZFOB 3BMWA 4HLZH 1QBBA 2EXWC 2R0LH 3BP5A 4FQHB 4PJ8D 2XQYK 4F2MA 4DTGH 2OL3B 5JIIA 2OR7A 1A6ZA 4LRNH 1SJXA 5F97E 3JZ7A 2EYSB 4XX1G 4G6AD 2AJVL 2NX5D 4JHAL 3WNNA 2GK0B 4N9GB 3A67L 3QIUA 1FCGA 1N8ZA 1S9KC 2DRUA 1UZ6E 1U91A 5HVWA 3F7YA 5C0CE 3JTTA 4G8GD 2P5WE 2W92A 4NO0D 1AR1C 2DBLH 4X9GA 4P2RD 4KJPC 5JW4R 1BJ1J 1TQBC 3T2QA 3PQYE 3PWPD 3EZ8A 2RAMA 4I3SH 5EU7C 4HWZB 1RZ8B 3U0WH 3BOVA 1B0GA 3MREB 5D7JA 1M71B 3MLRH 2ZUQB 4KJYB 1JGDA 4Y88A 4BH8B 1MLBB 3R06A 2IQ9H 4GMTL 1HOCB 4AG4L 4JHZA 4ODWB 2A9MH 3PHOA 3GMMA 2ZG3A 3CNKA 3S36L 3SJVA 3ZKNC 1NCDL 5ABDE 4H0GA 1BGXH 2DQJL 3PWVA 5L7XL 1G6RB 5EU6E 5EZLA 2HAZA 1FO0L 2XXMB 1A9BB 1AP2B 4X99B 1OY3B 4CJ1A 4KI5E 2DLGA 5F7LB 4JY4B 1ZLUK 3T0VA 3S34L 1J18A 3SBWC 3UZVB 2XPGB 5EO1B 4PP2A 1QRKA 2R2BB 2GUOA 3TWCH 1S7SA 1YYLL 2HKFL 2HH0H 3VCLA 4B5EA 3HHRB 4PY7B 2R0ZH 4XMPH 5FECB 2R0WL 4XNUL 2GTZA 3IYLW 3ZKXC 4KKNA 2O61A 5JOFA 1CFBA 3C9NB 4K3EL 3WKNA 3U1SL 3BE1L 3BQUC 5BW7C 3B9EA 2F15A 1SEBA 2M8XA 3CDYA 3TNMB 1W8NA 1OW0C 3K3QA 4MD0B 3MUHL 3P0YH 1YEFH 1KIQA 1QPPA 2YR3A 3PWNA 3PHQA 5HI4D 3TP4A 2XFXA 2MFNA 1XIWA 1F3DJ 3ARQA 4OCSH 2ZG2A 3VFTB 4Y4FC 2X4NA 2OL3A 3HE7B 2QQNL 1KTRL 4HT1L 1HCFX 1XR9B 4ORGB 4YDJB 5GRJL 5HDQH 3RWGB 4JFDE 1RZFH 2VDNH 1ROWA 1FC2D 2ARJB 4PY7A 4BK4A 1V5JA 3QUYD 3LHPH 3P30H 5LAXB 3G08B 1YEHL 2ADJA 4Y4HB 1A47A 2ZSWA 4U1GC 4YBQC 1C7TA 1BLNB 4OCYH 4KDVA 2FJGB 4WU5A 5CJXC 2RBLA 3MTRA 1D9KB 4ORZC 3MLZL 2X1WL 2DWEB 1H9VA 3TIDA 1M05B 1MVUA 3VG9B 3BPNC 4D2NA 1WLHA 4OFYD 4LVEA 4QRSA 4OQ1A 2CGRH 5E2JA 1XGUA 4WTXA 5D72L 3CMOH 4UINL 3KLHC 5JORA 4PV8A 3CFCH 4LKXA 5I19H 4OZGF 2DL9A 5HHQB 2D03L 3VXSB 3DYOA 3I9GH 1SYVA 3O3UN 4PJ9D 4WO4A 2CDGA 1Z9OA 1UQSB 3D25A 5DGRA 5EH1A 4ZSOA 3STBA 2P5WA 3HG1B 4GKOA 4L4TD 2DTSA 4P2RA 5FA4A 3TA3D 3DROA 1WT5A 2E9BA 1WAAF 1X4YA 1ZSDB 3BDXA 1QRNE 1MWAA 3C60B 4FRWA 1XCQB 3FQWA 4PR5A 4M6ML 3DYPA 4GBXB 3QFJE 1M7IB 1S7TB 2B8OT 1MFEH 3WXWL 2X41A 4P4KA 1YEGL 1HHJB 4EOWL 1VACB 2D31A 3T4YB 1JZ6A 3SDXE 4EN3D 4U6YA 4HIEB 4CL7A 3CMGA 2EH7H 2F58H 4J6RH 1A4KA 1C5CH 4GMTH 4AY0A 3HG1E 3T09A 3RUGB 2CSPA 3QFJD 4EI6A 5C07B 2A6DB 2VE6A 1VEOA 1CD1A 1IC5L 3QDAA 4HDIA 5EU5A 1AC0A 1VA9A 4UMGA 1I8LA 3OX8A 4P3DB 3PWJA 4KGLA 3WIFB 5CEYB 4PJ9B 3N1FC 2DIAA 3FB5B 4OGZA 4UAOC 2ZJSH 4ZOEA 3OKOA 2MQCA 2VERN 2XKUA 5DUML 3JWOH 3AXLA 4QRPA 4L8CB 3R0NA 3VXQA 3CIQA 4FFWC 4P57A 1HHKA 1OPGL 2YPLA 5LCVH 4DZBA 4KQ4H 4YHOH 3FB6B 3SDCC 5EU6B 5D7KD 2QKIB 4Y5VB 4LLYB 5GS0C 5D8JL 2AW2A 4UT7H 4K7PY 5D70L 4NYLA 4U1NB 3O4LA 2I9TB 5I16A 1I85A 3X3GH 5I1LA 5KVDH 4RISH 4RMWA 4BFGA 1EEZB 5DJ2B 2FIRT 3ARYA 1T1YB 5MENB 3IU4H 4P2QE 4L4VA 3TN0D 3QYCA 4J1UB 5DRZB 3P4LA 1B9ZA 1I7ZA 1EBAA 4LARH 4NQEA 5ENWA 5EU4B 1T4KB 4D0DB 3GHBH 4D9QE 5FO7B 3T1WA 2V7NA 3D6GA 3EUUA 1T0NA 3SDXF 3WIHH 1MI5B 4LPTA 3M45A 1WGOA 4NDMA 2LVCA 2CUIA 3MJ9L 1Z6JT 4OIIH 4U0QB 1XCQA 2I25N 2NLJB 4OI7A 5BS0A 1FNSL 4HC1L 1V7MH 2CGRL 3RWDB 4YC2B 1R24A 3UC0H 2A9NL 4LVNB 4O2CA 5DEGB 4FQXA 1CDBA 4L5FH 1ZMYA 3OAUL 1J5OL 1MCBA 5D7LE 5IVOA 1RUQL 2BSTB 3RPIA 4IRSA 5FYLE 4O51B 4OD3H 1KTLA 5KN5B 1VFOA 4S1DD 4NDMB 4P23C 5CS7A 1MI5E 1MY7A 2XTJC 1HHGA 1NKOA 3TNNA 4OF8A 1WF5A 4KTEH 2E7HA 1IM9A 2VWEC 1J87A 3L3DB 2PYEB 4LMQI 5E95B 4JJ5B 2J5LB 3QDMA 4QY8A 3WIHA 2WBKA 5C8JB 3RJDA 2F19L 2BVOA 3O6FD 3P77A 3W82A 5BV7B 4IOSD 2Y1VA 3ZYOA 1TNMA 2D0FA 3BZFB 3OJMB 4TVPE 4QRQB 1QEWB 3FMGH 5HDQL 1HSAA 3RWJB 1EPFA 3NZHH 4XVJL 1BJ1H 4XP9H 4X83A 4WDIA 1DQLH 3SDCB 1FAKT 3V6FB 1A7PL 1OT1A 4XBGA 3S3PA 2P4AB 4K3JH 4JFXB 3DVGB 5IOPB 4PGDA 2J8UA 2ZOLB 3HNVL 1NFDA 1BM3H 4HSQA 4OTXL 4C83B 4M7KL 4O2EB 3HI6L 4W4NA 4X98B 4OBRA 4LSTH 3TNMA 3Q1SL 3VXPB 5JHDB 1LK2A 1DANT 2ICEA 3O2DL 4UQ2A 3SE4A 1ONQA 3O6FA 1NFKA 3I6GB 1T5XB 1OP3H 4GG8A 3WLWD 2D03H 5C3LD 2VXUL 1BAFL 1QR1A 4WGVB 3ROLA 4ZFOL 1J0KA 5SWZD 1YECL 1ZKAA 1G6RH 1MQKH 2BVUA 2NY7H 4HHAB 3V0WH 1RIVH 5C09E 4HKXB 2CIIA 1ND0A 5E00A 3U48A 3E2HB 2PW2B 4XVSH 4G9DB 1EUTA 3IS0X 2OXHA 2GK2A 3DGGA 2EDBA 5GJSH 3TM6A 1HK6A 4X99A 2R23B 4ZUSB 1T66D 1MVUB 3EKCA 3KPTA 1P7QD 4GXVH 4PV9B 1FL5B 4DGYH 4QXWA 4NQUA 1RU9H 4MVBC 1KXVC 4J12A 3OV6A 4JVWA 2PYFA 4MZ2A 4U31A 3MCKA 1VGEH 5CWSA 3MRCA 3BT2L 4PRBB 2OTUA 5CMAA 3NH7L 3LQZB 4UQ3A 1NGPH 3QSKB 5BXFA 1MAJA 3HMWL 2DLHA 5GRVK 2EDJA 2Q76B 4FNLL 4G6KH 3ULUD 3IXTB 2QQLH 2Y9RT 1UG9A 1XGRA 2VLRD 4RBPK 4NOFA 3ULVE 5D1XD 2I5YL 4BQCA 3T3PF 1CK0L 4ZUVB 2ADFH 5TPWH 3MRJB 2AK1L 3L3HA 3O8XA 1YN6A 4N0CC 5MI0C 1CCZA 1QBAA 3GMQB 3IDNB 4YR6B 4ODXA 1B6DA 4JFDD 5L8KB 5EO9A 3V52H 4Q6IC 4BUGA 1P6FA 5E2WH 1ZHLA 1S78C 1KPRA 2VABB 2HVJA 1G7QA 4YHIA 3SDDA 4X8JA 4M9OA 3RTQB 4QHKJ 3RZCC 2YPLE 1FORH 1DEEB 3HFML 5I1JH 1NCTA 4OLUL 4M48H 3P4OB 4N5EC 2VDQL 4JR9H 3A6CL 4XCYA 3GSNA 2OR8A 3VDAA 1IQWH 3CSGA 4UT9L 5T1MA 1U8HB 4Y5YA 1OQOA 1FDLL 2EDXA 4PGJA 1WEJL 3KJ6H 1BFOB 4OZHE 1RZFL 2VDNL 3FKUS 3RGVD 4Z7QE 4PJGE 4WW2A 2AEIT 1M4KA 5D5MB 2YD4A 4LVOC 1TQBB 4OCXH 2VISA 3AS0A 4OCMC 3BRFA 5CUSL 1TENA 1SBSH 1V3MA 3VWKD 4HS8H 3U6RB 5F7NC 2ZCHL 2QL1A 5GS2D 3L3GA 3RWIB 1A7QH 1F4XL 5IJKC 3QBTB 2J5LC 5HHQA 2GTWB 1T7WA 1R3LB 5GGTA 1XF2A 3O2VL 1BBJB 5FKAA 1TPXB 3V5DB 1CXEA 3HPJB 2AKRA 2NY3B 5CJ8A 4JM4L 3DGGB 2OS7A 4UINH 2HFGL 2C1PA 2VSCA 4CMHB 1RURL 4JN1L 4AEIL 3QI9B 4OCNC 4XI5C 4OTXH 1EO5A 1PYWB 1FZJA 5E4IA 2DYPA 4GAJH 2NY0D 5JMOC 4U1HA 3NVQA 1ZVSA 3AY4A 2CLZA 3F8UB 5T5FH 5EBGA 4Z0BH 5IWLA 4FN0A 3RL2A 5C0CB 5LVEA 4G6MH 5I1CL 2EYTA 4ODTL 3S36X 4Y4HC 1HXYA 3ZE0F 3OXSA 4KKCD 1EEYB 4RZCA 3IDUA 4HUWA 5DA0B 1NC4B 12E8L 2VXVL 1JBJA 5L9DH 1ZAGA 2R0WH 2F5AL 1GOGA 1T2QH 1F4AA 4JQXA 3OQ3B 1G6RA 1VADB 4MXWL 4ODUA 4X4XB 4KTEL 1HXMB 1KSRA 2AABL 1DBJL 1RZKL 4E41B 3TT1H 2NX5E 2XY1A 5BQ7A 2FWOB 3BWAA 3CVHL 3VXRB 5EU5B 4X7SH 3BN9C 1AKJA 3MA7B 3RVXD 1FZKB 2PKDA 3HB3C 3MRHB 3PP4L 4PRIA 4DGYL 4OZHF 4P2YA 1A4JB 4JRXE 5CFHA 4YX2L 1XF3A 4NWUH 1DVFA 4GQPH 1PSKH 1MWAH 4Z76B 3RZCB 2FEDC 4WTZG 4APQA 4D9LH 1TMCB 4N90D 2LAAA 1UM5H 2VN4A 4JRYE 3QPXL 1AFVL 3O45B 1IRAY 1U8MB 1MHHB 4QGTA 1F4YH 1HH6A 1Q1JH 4G42B 2AEQL 4M5YH 4MAYA 3MLZH 4MD5A 3QT2A 1H5BC 4CDGC 1JV5A 3VXTA 4E41E 1IM9B 1Q72H 3C60A 3UJTH 5JO5A 1I1FB 4FP8L 3V4PH 2DI7A 2BMKB 2AK1H 2AJ3B 1P7HL 2W1NA 2HMID 4DKDC 5HTSA 4JRYD 1CLYH 4P9ML 1W72B 4RGND 4UZGA 3D0LA 1IC4H 3LMJL 1YMMB 1ZHBB 1JWSA 1SY6L 2XWJB 1I4FA 4PTUA 3W39A 3ZE0E 3HMXH 4DEPC 4FZEL 5HYQA 1T0NB 3RTQD 3Q5TA 1Y18A 3HFMH 1IKFL 4XX1E 3BH8A 3SDAB 4U1MB 1XZ0A 4F8TA 3G9AB 3V6OA 1RAMA 4R96A 1FYTD 4YXLH 1DQJB 2HJFA 4RMSA 1VPOH 2O5XH 3DUSA 5E8DL 5JPNA 1JN6B 5DJAB 3OX8B 4ZOCA 4RFEB 5KSUB 1WAAA 4P59H 1LO4H 5DZLA 1P84K 1O7VA 3MUZ1 2VZ3A 4P2QA 3OXRA 4EUPG 2V9TA 3WJJA 1UWXH 4NZRL 5KSAA 3ZZ1A 5I1HL 5BS0D 5FK9B 1FIEA 8FABA 1UM4L 1Z9LA 1OM3H 1U95B 1KNOA 3GMRA 3QCVL 3NFNA 3SE9H 1P1ZA 5D7IB 2WSKA 2FHBA 2DD8L 4JY5L 3TNNB 4PJGB 1RUQH 1QSEE 1AKJB 5E08H 3WNMA 1AD0B 3O4LB 4PRNA 1MFCL 3FQRB 3AAZA 1INEH 1K9TA 5E2TH 1FL5A 3VXOB 5DHYA 4KK9D 3A6BL 1CGSH 2NY6C 3MJ7A 2X70B 3OHXB 4H20H 2ITDB 3F7QA 4J3WA 1CXFA 4NRZA 4MDJB 3RIAF 4WDIB 3AFLA 4PJBE 4S1QH 1FH5L 2JK5A 5CSGA 1G9NL 4YHYB 3BDYH 4H26B 3G5ZA 3MRRA 1A6WH 2BCKB 4AH2B 1FFRA 5CEXA 1CN4A 1I1FA 3CVHA 5D1XA 4HFWA 4QHMA 3QHFL 2P8MA 4NQXA 3TT1L 4RGOH 1X5ZA 1LK2B 4QHKI 4JZOA 1QFOA 3O6FB 2OZ4L 3KPRB 5GRZA 5IUSA 2ITCA 2HJKA 3UYRH 4IOIA 4FXGA 4LCWD 2W9LA 2PR4L 2PYED 4XP4H 4DOHE 2DQTL 1F6FB 5GQBA 2BSTA 4JKKA 1KJVB 4P46A 1S7UB 5B8CB 6FABL 5I8OH 4IRSB 1FE8H 3LEVH 4DEPB 1T21B 3DO7B 4MNQA 5FAAA 4F80A 5J11B 4RAUA 3CX2A 2Y06L 5F7DB 2V6HA 1RZKC 3C6SB 4NZTL 4DZ8A 3IKCA 3TYFA 4PFEA 4NKMA 4XPGL 1KCUH 1K6QL 1NQBA 1T1WB 2XTJD 4BYHA 5K9OA 1S7XA 1MCSA 4HC1H 4IHOB 2H2PD 1BF2A 3C6LB 2FO4B 2PCPA 1RJYA 3WHXB 5FOBB 4OLWH 5AD0A 4M5ZL 1SY6A 1IGFL 1OP5K 5IIEB 4JRYB 4P46B 1I8KB 3VFOA 3QDGA 5J13B 2H32B 2XWBB 3BSZL 3TT3L 2V7NB 2Z92A 4RBPH 1KNOB 4UB0L 3S4SB 5T3ZE 2CK0H 4HMEA 4OZIA 2XG4A 1GZQA 3V6OE 1NCAH 1ZT7A 2DWDA 3DI2B 5DHXB 3BGFB 4PJBF 4BJLA 3C8KA 4G8EB 1VHPA 1U8LA 2Y7QA 1KEGL 2V5TA 1TDQA 5GRWA 1QBLL 3CVHH 3DMMA 2UY7A 4K71C 1NBVH 1TFHA 2HVKA 3TN0B 3LS5H 4WU7A 1AIFA 3CH1B 5DEGA 4BQ9A 5MEPB 1JPGB 1GSMA 1T0PB 4LCIL 4FNLH 4GG8B 4PJFF 1RD6A 4ZAKA 5DD5L 2VNCA 4JFFD 5AYUL 3HRPA 3DSFH 2P5EA 4QXGL 5B4MD 4NUJB 4Y4FD 4CU7A 1AGFA 3TJHD 2NPLX 3IFPB 3LS4L 2VH5L 1CFTA 1H0DB 3UYPA 3PWLA 1WIOA 4HUVB 1OAQH 1UZ6F 5FUCC 4EXPX 5DEZA 4U6HA 3O3BB 3V7AE 1FG2A 3GMNA 3SKMB 1NAMB 2DQUH 4PJDF 1JNLL 1CDCA 1I9IH 2HVKB 1RI8A 5DJ8B 3I02B 4KDTA 4LLWA 4AG4H 2BY1A 4FFZL 3DVIA 1IZJA 3E3QC 3ARBA 4MJ6B 3EDFA 3GEWB 1I8IA 4GS7B 1QSVA 3EAKA 3SDXB 2W91A 5I1AB 3PWLB 5IROC 5JOPE 3MUGB 3FRUB 3V9FA 1FNEA 3PP3H 1SYSB 3B9KC 3ZMRA 2YPLD 4HS8L 1Q9OB 5FYKL 5IF0B 4KJPD 1MHPH 5C6WH 2A83A 5D4QA 3SE3A 1MRFL 1KB5H 3FQXB 2QR0A 4JAMB 4OZ4B 5JUEL 2D2OA 1IILE 3QA3A 3SKOA 2XZAH 2IBZY 2OQJB 4I9WE 3BP5B 1UCBH 1NANH 4K07A 2ZOKB 4JVPA 4X6DB 4NPYB 5E8NB 4EQ2A 1BEYH 4LPWA 1E6JL 1V05A 4S1SL 1EEYA 4OF6A 1IGJB 3FHAA 2BNUA 1JIBA 4HJ0C 4RGNB 5JXAL 3O6FC 3BUYB 3P9MB 3SE4C 2FJHB 3QIUB 4KMQA 3UX9B 3F7YB 1OSPH 4XHQA 4WI5A 3FN0L 3LV3B 3O0RL 3DXAE 2VMFA 1XH3A 4JHBA 4Y1AA 3HS0A 3CFDA 1MFCH 1S5IH 2QSTA 3QO0A 5ADOL 1UZ8A 3OGCA 4JANA 5LXGL 3OR7A 1Q0XL 3QEQD 4PRIB 4OCWH 2FATL 4POZC 5CEZL 4FQIH 2FBJL 3G5XB 3KDMB 3QAZB 2AXFA 4ZUTB 3AREA 4DW2H 4N5UA 4OFPA 2QSCL 3BESR 1U8KA 1EJ6A 3CX5J 4UILL 1UM6H 2VZTA 1TJHL 4BK5A 4NQDD 1PG7H 2A74B 4P2RE 4N8CH 5GXBB 8FABB 3WN5C 3B9AA 4AT6B 1A6WL 4OUUA 2IFFL 2R29L 5ISZD 3L6FB 2X42A 2YS4A 4OGYL 4OV6F 5D93C 2VE6B 4YX2H 3ALXA 4KMTH 2ZCLL 5C0ND 3VXTB 2JJSC 1I1AC 1OD7A 5DQ9A 1EGJH 1NC2D 4YK4B 2B1HL 5CKAA 4YLQT 1TXKA 2F5BL 5JXEA 3TH3T 3FB5A 1IAKB 1GGBH 5I71C 4HS3A 1IAOA 2BJMH 2HLAB 4RZCB 3DVNA 2AV7B 3M1BB 3SEPA 2Q6WB 3SDXA 3TN0C 4PGZA 4J8RA 5D2NC 2GTZB 3DSFL 4CVXA 4Z7UF 5I1AA 4NT6B 3AVEA 4U3XA 5HHOB 4G43A 2NY2D 1WCQA 3OKYA 3RIFK 4R3SB 2Y4SA 4CVZA 1JZ2A 4POUB 1KENL 1MIEH 4H0HB 3OAYK 3DV4A 2P47B 1MVFA 3IU3A 4XCCH 3V8CA 2Q8AL 4LVHC 4KUZH 4KPHL 3PABA 3DJ9A 5T5NF 4HGMA 3QXUA 5JDSB 3D3VB 4O02H 1BWWA 3UJJH 1XIWD 1MCKA 5J4MA 1L6XA 3QWRD 3W81A 4Z7VA 5GGRY 3IAPA 4GJTB 5SWSD 5CZVH 3BSZH 1FNFA 2GSIA 2VXQL 1QYGH 1A5FL 4RAVB 3F7VA 4X80H 4L8DB 3ZDXE 5D7SH 4U49A 2F5AH 3O81A 1F3JA 1H3WM 2HT3D 3JWDC 4HS6B 4IM8A 3GMLB 2FX8L 3E6HB 3UTSA 3VFSB 1MUJB 2C4FT 3BGMB 4YBHA 3H42L 5C0AB 2DBJA 4Z6AT 4AMKH 4WV1A 5LKNA 2QEJA 3MV9E 1Q9LB 2APXA 4PLOB 2CLVB 1FYTE 5LWYH 4HKJA 1DL7L 2X4QA 3VFGH 3T0EA 3PP4H 4ZS7L 4NJ9H 5IB2A 3TBTA 4JCLA 5EO0A 1NCBL 3JVGA 1U8IA 3BZEB 1U3HA 1SMOA 2AJSL 1DN2A 2VH5H 3DECA 2LU4A 3BPOB 4KTDL 3GIVB 3OF6A 4ODUB 5F96L 4Z7UE 1MCJA 1KIRA 2ZKHL 3LPWA 4NIKB 1KBGL 1LK3L 2W59A 4Q9RL 4QHNB 4L9DA 3RBSA 2E7CA 1ZSDA 3W9EB 2WANA 3VRIA 1ZGLM 1BVKB 4HWBH 2JF1A 3WJJC 5C1MB 3QDMD 2BSSB 4PJ8B 3ZSSA 1OAXH 5IQ7L 1T5WA 4TNVK 4IIQC 1GC1H 2Y25A 4XNQA 1LO5B 3GB7A 5D2LF 3V6ZA 5IB4A 2E3VA 2ADGB 3V6OC 3JTSB 1AO7E 4GW5A 4L4JA 4C55A 2NTFB 4D3CH 1T4KA 4D0DA 4TQEH 4M03A 1CTOA 3BKYL 2X1QA 4G42A 3VXUD 1KJ3H 1OWWA 1MPAL 2XTJE 3W2DH 1P1ZB 5D7IA 5C07E 4LIQE 1OGAB 4WHCA 1T6VN 4QGYA 4JQIH 5CGYC 3P3YA 3HRZA 3MXVL 4YFLI 1EZVX 2EO1A 2JCCF 5CIPA 3KYMB 1P2CA 2FECI 2RFXA 2XZAL 5E99L 4BH7A 1JE6A 3LB6C 2O5XL 2VLKD 4LOUD 4EZMA 3CDCA 1XF4A 5F3HB 3A6OA 2FX9H 3CDGB 3L3IA 1IE5A 2YUXA 1MELA 1RHHA 3C2AH 2V5RA 3AC0A 2H26B 4KY1H 3RAJL 1EXUA 4L8DA 4KK9C 1X4XA 4LSSL 2PTVA 4XTRD 3JV6A 4JPVL 1VFUA 5C6TL 2A0LD 1OSPL 3TZVD 5BVJB 3BH8B 3SDAA 2YD1A 1QSZA 2A6JA 4I2XE 4CVUA 4K94C 1F8TL 4ODSL 4LAQH 5CJQH 2XACC 5E03A 3L5XL 5FA3B 2A6KB 2NY0C 4LIQL 4JFPA 2HTKD 3KPQA 3UBXG 5IFAL 3U7WL 2CJUH 3TT3H 1JNHA 5MEPA 3TPKA 4Z7VF 4ERSL 1IM3B 4XPTL 3HNVH 1ITBB 4LVHB 1Y0LA 5CP3A 3KYKL 3FFCA 5CBAA 3RWJA 3BDBA 5DYOB 5EORH 2FECL 1FFNB 5D2LE 3G5VB 3GDBA 1VSCA 1NAMH 2CQVA 4UDUA 5DDHB 1A7OL 5JR1L 4Z8FH 1J8KA 2G60L 4MWFA 4W68A 2GEEA 4HPYH 1TQCC 5SWZA 3PXHA 3S35X 2AKRB 4GAGH 2R0LL 2W65B 3AREC 2IFFH 2R29H 4QYOB 4BSJA 3O3BA 4C56B 2V5MA 5EDXA 3QDJB 1FO0B 1GHFH 3JWNC 2X4SA 3UCRA 3REVA 5D71L 1BF8A 2DIJA 4O5LH 4OV5B 5B38B 1BD2E 3MUY1 4LNVA 3ZL4H 4Z78B 2JCCE 5IB4B 2UZXB 5LWYL 1ZTXL 1OAZL 3KPNB 4H88H 5D7LB 4Y0GA 5KSBE 2CKBB 1UT9A 1QBMH 4TSAH 3UJIH 4EDWL 1F4WL 5GRUL 4OZFH 1NJ9A 3BEWA 4F7CB 5GS1B 1INQB 2HA1A 1ZLVK 5IT2L 3U0TA 25C8L 3EDDA 5IW1A 1OWRM 1QVOA 3BKCH 5F9OH 2Z4QA 2G5BB 4UTAH 3OBAA 3I75B 5H37G 5DFWH 3QDMB 2Y7QB 4QY8B 5C08E 1NL0L 2QQKH 4BH7B 3NACH 3QH3B 3ULUH 3NAAH 4IOFC 1MRDL 4OFVA 2HG5B 4PV9A 2N56A 1WVZA 1JGLL 1T2JA 5IMMB 2BERA 5T1LD 3C8HA 1V8HA 3IXAB 5DQ9B 1BGXL 3RI5K 3GI8L 3MRBA 3KLAA 2X9WA 4JRXB 1SVCP 3LPGA 4Z7VE 5C0EB 5CD3A 2Y5EA 2LU7A 5E8EB 1Q9KB 2NXZB 1YEKL 3G6DH 4FOMA 1RZGA 3HUJF 4CVXB 1RIUH 2VZVA 1X6NA 5M7QA 3F6LA 2E7LA 1QRNA 5ESQA 4R4ND 4XMKH 3BAEL 5HHOD 1XGRB 1T1XB 3BI9X 4N0RA 4YFEA 4NKMB 4OQTH 4UTBH 3UTSE 3RZCD 1L7IL 1YYLH 1J1OH 3OB0H 2F74A 5C2BL 2C1OA 1CE6A 4X5WB 3ULSA 3EO9H 5DVKA 4PJ7B 3MXVH 3O11A 1KGCD 3HI1B 2YPVL 4KDTC 2Y5TA 1SQ2N 3CCHB 4OBSA 3WXVH 2XKSA 2YD7A 2J8HA 3BE1H 3D3VD 3LH2L 3EOTH 1KLGB 3IFOB 2AJ3A 3QO1A 2HLFD 3IDGA 3MLTB 5HHXL 3V2AR 5IW6B 3VD7A 2VABA 2B5IB 3CSBA 2BSRA 4KMLB 3X14B 5SV4A 2E8ZA 3LKQB 3AB0C 1TVDA 4LHJB 4LPXA 1NC4A 5ANME 1JTTA 5HSFA 2YRLA 5FECA 5ISZE 1WFNA 4MD4A 3EOBA 3QJHB 1R5VA 2O61B 5F88B 3LRHA 3CFEA 2AXGB 5HYJD 4MJ5A 2XNAA 3J7HA 1RZ7H 3QIWD 4U1KA 3GMLA 4ODSH 3UTSB 3MLVH 5HVFB 1IL1B 3FOMB 4PJGF 4MGXA 1I9IL 3MFFB 2E9WA 4LLAA 5C0CD 5E2VH 5I76B 3QR2A 4JFOA 1WFUA 1TJGL 5EULV 5I73B 4LVNC 4FFZH 3KJ4C 1HE7A 4X6DA 1IAKA 3HE7A 4JPWL 3IFOA 3QO1B 2B4CL 4R90L 2NY0B 3TGXA 1KB9J 1GVIA 2WQ8A 3QPQD 1U58B 1W0VB 5HYJE 1FIGL 2CMRL 1RUAL 1WZKA 4RGNC 3VXME 1L9NA 1MCOH 4HUKB 1WC7A 1BMGA 3UBXB 5AAWA 1R3IL 4N5ED 4PLJC 2AJVH 2XQBL 2VLKA 4MLSA 3VFRB 1MREH 1K4CA 2X6MA 3VXNA 2EDNA 1QP1A 4G3YL 2E7BA 1HDMB 2JCCA 1UC6A 2C3WA 1BBDH 4RX4D 2F53E 3DRQA 1T2QL 2PW1A 3ROOA 3VXMD 1OOAA 5JORB 4HXBL 4S0TD 2R2BA 4JRXA 1OCWL 5FUOH 4FQQB 1IAMA 1KCRL 1ZTXH 5CD3B 2ZUVA 2Q8AH 1UA6H 2C4FU 1MHEB 3LN9A 2X70A 3OHXA 4LSVH 3UMTA 3WE6B 4KI5C 4AENB 1WTLA 3PJSB 3V7AG 3RHWK 5J12B 4D0BB 5IT2H 3WXWH 3WN5B 5C09D 4W6WB 4XXDA 4YK4C 3SO3C 5IFHL 4L3AA 1W8OA 5F9OL 3EYQC 4OUUB 1HIML 2V9QA 3SHSA 3BVNB 4PJ7A 4E42A 3HZMA 5C70A 2Y5TB 4HH8A 1JFQL 4URTB 5D5MA 4WV1B 1GGIH 3TJEL 3E1F1 5F1KC 3WD5L 1T20A 4JRWA 3BZ4A 3DIFB 1IEAA 4ORGA 1ZLSL 1D5ZB 3O9WA 3OKDA 4OF5A 3QULA 4K8RH 3GBLA 5HGDB 2BK8A 4LPCA 1S78D 4HIXL 4JY6B 1QEWA 1TETL 5KBNC 1L9MA 2VLRB 5I66B 3RQ3A 1A6VH 2KKQA 2CIKB 5IVXE 1I85C 4CAGA 1WCBA 2BNQB 2GIYA 2L4OA 1CLZL 3HKFA 3QDME 4KUCF 4NKOA 1DFBH 1OAUH 4F9LA 4GKSA 2WNGA 5C0FA 4ODHH 2Q3AA 1UH3A 5BMFH 5F6IB 4OQTL 4UTBL 3LMJH 5DD0H 1LO0L 5DQDL 3DI3B 4LRNL 2CLRB 5HI5C 4GW1A 5CBEB 4OIBA 1SJVA 2DM7A 4H88L 3KWWB 4JHAH 3QDGD 3ARFB 1P7QB 1HYRC 2AEPL 4F15C 4Q0XH 3VH8A 4PJFB 2WZPD 3ES6B 4F58H 1MFDL 1H8OA 4IJ3C 4ESKA 1CFNB 5EN2B 4R4FL 4FTVB 4D9RD 4QOKB 4HGKC 3P0VH 3ROLB 4P2OB 1CDJA 1OAXL 1IGMH 5FV2A 5D1QC 3O8XD 4JO4L 5SX5H 4GKSB 2P8LB 3TBVA 1WITA 2GHWB 2WW8A 3OR6B 1A9EB 5TQ2L 3HZKA 4S2SB 1PZUB 4RNRA 4EBQH 3TPUB 4HH9B 4I3RL 4LKCA 2WUCL 3LKPB 2EXWD 4JB9L 2NZ9C 3WFDH 2EDLA 3MBXH 4F37F 5I18H 4OI8A 2FD6L 5F6HJ 1KJ3L 5FGCB 1N0XH 3CDGA 3VH8B 4A2MA 4OCRH 1RFDH 3O2WH 5C0BA 1U8PA 4NQCB 1QSFA 2EDFA 3AMKA 4AIOA 1QYGL 3DV4B 4N0UB 2AI0L 4UT6L 4K3EH 3OB8A 2DS4A 5HI5D 1YYMH 2CO7B 3L1OH 3ESUF 4H8WC 5E1AB 3SGKA 4XAWH 1YPZA 1WBXA 5H37H 4ZQKB 1KT2B 2Y72A 3P0YL 4BQ8A 3TWCL 3SKMA 3RAJH 1C5BH 1CFVH 3GSOB 2DAVA 4UUJB 5I8CB 2FJFB 4U1JA 1CBVL 4ZOAA 3C2SA 3CU1A 3UTPD 3OJVC 4L3ED 5L8LB 1YY8B 3EYVA 4HG4J 1FBIL 4ZXBA 1ZOXA 4NJ9L 4P57B 3GGWA 4LAQL 5CJQL 3NIDE 1BOGA 3TA3C 2P8PB 3RP1A 4XRCB 2H1PH 1YEFL 2Q7NA 1A1OB 1GIGL 2W60A 2IADA 4Z7OE 4UV7H 2H2SC 5FB8B 2PR4H 2JB6B 3IJHB 4GLRI 2GJ6A 4X6EB 1BD2D 1RUKL 2E9JA 3GSNB 1R3JA 1KJ2L 3EYUH 1NAML 1FC1A 3ZDYF 3KLDA 5J6GA 3P77B 1LMKA 2WQRA 4HXAH 5DK0A 2BOBB 3FRPG 5MERB 3UTQB 1I3VA 4OLYL 1DBMH 4DVRL 3HI6H 2EC9U 4N0FA 4QXTB 3BKMH 3Q0HA 3I3EA 2BHZA 3AU1B 4HJGB 4MNHB 1MI5D 5I2IA 3X14A 4GG6F 5F6HI 4OJFH 3T4AB 3H9SB 5DMYA 1KELH 3U82B 1JPFB 4ODWA 4XBEL 4WO4C 4JG0L 1KTDB 4P2OD 1T04B 3T0DA 4EEEA 1F13A 2G5BA 2MTPA 1D9KC 3ZTNL 4LASH 2ADJB 4XMLL 4Y4HA 2Q86B 3QG6B 5BMFL 5KVEL 3GI9L 3R8QA 1T1WA 3RDTC 2JIXD 15C8H 3FB8A 1UJTA 3MGTB 2Z35A 4FFVC 5GGUB 2HKHH 3OR7B 3HPLA 3EFDL 1NKRA 2AGJH 3F7RA 4A6YA 2DQIL 5IVXB 3MA9L 5C0EA 4X7TA 2IQAB 1DQDL 4Z95L 1SMAA 5FM5O 4NO5A 3KPSD 3NIDF 3QQ3A 1PG7X 2FSEA 4OZIB 1FNEB 1UXWB 4XNYL 3N85L 4M6MH 1AXTH 2IPTL 1YJDH 4QYOA 4C56A 2VDMH 3HG1A 4WTZA 3RA7H 4Z7OF 2C26A 1WBYA 5T1KB 3CVIL 4KH2A 5L0QB 3WD5H 2R2EB 4JLRB 4WW2C 5B39A 5F93C 5BZDA 1YMHA 1MCDA 4P5MA 2LFGA 4PJFE 1WBZA 1II4E 3F58L 4XXCC 1FVDA 5EC2A 2VITB 4G6FB 3DHJA 1UEMA 3IDGB 3MLTA 1LO2H 3OAUH 1N0XL 3FT4B 2MOVA 3G9VA 2XV6B 5CMAB 1I75A 1CS6A 3KPOB 4RMTA 3CXHJ 4OB5L 4IRZL 3RZCA 3EOBB 1A6AA 2J12B 1QKZH 1NDMA 1YEDA 2IANB 3PHOB 2EDKA 4OZFB 3MCLL 4A2LA 4WU5B 4PJDE 4OM1L 1MNUH 4KZDL 1I7RB 4UT7L 5DVMA 3B9VA 2VUOA 4XCNB 5DD1H 3VGFA 2HWZH 4V1DA 4I0KA 4YGAB 4OFDA 2AXHA 3O8XC 1J9CT 5LBSH 3GSXB 3F5WA 5DVNA 5BV7C 1J1PL 3MRMA 4NQCE 4OM0L 3CGTA 3NCYS 3SDYH 4JDTL 4L4VE 4HHAA 1S7SB 5INDA 1C08B 5HXMA 1OB1A 4RQQB 1F4WH 5GRUH 5DRXB 1BWMA 3DV6A 4N9GA 2X4TB 5FO9A 5T3XD 4ZS6D 4WNQA 1U91B 2YPKA 3N1PC 5E9DD 5GGRB 4DQOH 4ALAH 2BNRB 2IALB 3GM8A 4QT5B 3PNWB 3FB7B 3C09C 2Y23A 3BN9D 4NKOB 3CPLA 5FCSH 1EO7A 4YHLL 4U1MA 3KNBA 4RRPG 5JXAH 5F9WC 5F7EL 3HE7D 2WWKT 5I16B 3Q1SH 3H7LA 2X10A 2ZSVA 3QDJE 5HVHB 4A6YB 4R7DB 1NGYB 3FO0H 4GAFB 1YEJH 1ZXQA 1KUMA 1XF3B 4ZNCD 3U0PA 1GC1C 4P9HH 2J8OA 4F7CA 5HYJA 1MCPH 5C0BE 5I1DB 4Z0BL 1QSFE 2R0ZL 4XMPL 5FEBA 1EHXA 4HBQA 4HULB 5B3NA 4JPIA 4XGZA 4YGVA 4HEME 2EECA 2X2YA 3VRLE 4Z7NE 2CRIA 3NFSH 3QO0B 3IVKB 1BFVH 3PL6C 2VO5A 1LP9B 2NMSA 2HMIC 5KVEH 1ZS8A 1JCKA 2MKLC 5L2JB 1ACYL 2DLEA 1I3GL 4PJ9A 1CR9H 3LH2H 1KXTB 3UROR 4WFHE 1I8IB 3DMMD 2EE2A 1WZ1L 4MQXC 2R2CA 3MA9H 4WFED 5I66A 4GW5B 2ICWB 5T3ZL 4MDJA 4MJIA 1NGWB 3WBDA 5TE4H 4OGXL 4MB3A 5GGSB 3E6HA 2XTJB 4JAMA 4BFIB 1WV7T 3RKDC 2UUDK 5HHPA 1JGVL 3MROA 1CDGA 4E0RA 2FWOA 3BWAB 2HTLD 4EI5B 3NPSC 3LSOA 3TIEA 1EAPB 3EYSH 5IBLC 2GT9A 3MBEB 2MHAB 2GJJA 4ZYKB 2ESVD 5EIQA 4WHYH 3B3IA 4K3JL 2CDFA 2DQCH 3GJFH 4KUZL 4ODHL 1YECH 1U3HB 2NY7L 1VB9A 4M7KH 3AUVA 2WP3T 2ICWI 3BP4A 1T7YA 2VL4A 5IBUG 2NYYD 4WI6A 4NBXB 5DTFA 4F33B 1PEWA 5GGSA 3WS6A 2FBOJ 5C0RH 1HZHL 2VLMD 1AR1D 4E42B 4EVNB 4MD5B 5FM4A 1CD8A 1XGUB 4M62L 1A0QL 3O6KL 2GYSA 3OKLB 1ODAA 5I1GH 2DLFL 5IQ9A 3UDWC 1UH4A 2E7LC 1QPXA 1AD9A 3HR5A 4UQ2B 1WIUA 4JO4H 2ZWLT 2APTA 3JWDL 5JW5B 4IDLA 4H25B 1G7LA 2WAHA 2H32H 4TSCL 3I85A 4EOWH 4IRJA 4N1EA 2YRPA 5I17B 3FQUA 4PGCB 1MJUL 2MMXA 5INCB 1CICD 4HZAA 4ISVB 4POYA 5IBLD 1IEBA 3PDOA 1YA5A 3RA7L 1KCKA 2LTQB 3KR3L 3VGEA 4C56E 2RIKA 4DQOL 3CLEL 4JDVA 2AJSH 4WUUE 3FL7A 4PRHD 4MQSB 5C0JA 3H3PH 2E6QA 4DN4H 4BUHA 4IMLA 3RVUD 4P2OC 1KBGH 5CJOH 4HWBA 5E2WL 4G6KL 4NQDE 4IOIB 4YDVB 3S37L 3ZDZF 4I4WA 3BRGC 5HHOA 3TVMD 4ZFZB 4C56D 3PGDB 3SDCA 1A3RL 4HAGA 5E6IB 1FVCB 1S7VA 5HD8C 3PWPA 2FEDD 5AZ2L 2GCYA 1MNUL 4JO3H 2J4WH 3K4AA 3P9LB 1GAFH 3CC5A 1FRGH 4GRLA 5ILTH 4XVUC 3WFHB 1CGSL 1QA9B 1AKJD 3U2SA 4HC1A 4PJDA 2Z4QB 4NP4L 5J56B 1N4XL 4HJJL 1NEZG 4XZUB 5DD0L 5JLZA 4G9FA 4V1DE 1XF5A 4H0IA 1UWGL 1OTUD 3OKNB 1VFAB 1R24B 3W2DL 5DJ8A 3QULB 1LVEA 4NC1C 5KVGH 1U3HC 2AQ3A 1HKFA 5KSVB 5H94A 1WIPA 3VGAB 3FB6A 4F58L 4R0LB 4FQXD 2BRRL 1PSKL 4KK6C 3ULUC 3VW3H 1FDLH 1QLFA 4PJHA 3GHBL 1Z0NA 1CICB 3BGFC 4LK4A 3QUXA 2YD2A 4ALAL 3B83A 3WDIA 4QRRA 4YE4H 5DRNA 5F9AC 1IARB 5C2UB 1U6AH 4RDQG 4GAJL 4ZD3L 1Q1JL 4PY8J 1HCVA 4GS7C 3OPZH 3SDAD 4NN5B 1LQSR 1OAYL 3OKLA 5CZXC 3QFJB 3JUYA 1RUMH 5HGHB 4YUEL 1FV1B 2IG2L 4ZNEE 3RNQA 2YD9A 1CLOH 2N7BA 4WWKB 3PWUB 5HD8D 3KPSE 5CCKH 5GSRB 5J9PB 1F42A 4TSBH 1BVZA 1GOFA 3DGCR 2IC2A 5EU3B 5L9DL 5FDYA 2ZUQC 1I8MA 1YN7A 1NCCH 3GMOA 4Y19E 1EJOH 5E8PB 3ILPA 2C3VA 3KHOA 4CADB 3B9DA 4UT6H 3HMXL 4YQXL 1DDHA 1EFQA 3SO5A 4HJ0D 4ZO8A 1YYML 3CJJA 1JTPA 3MRQB 1FSKB 5J1TC 5AWNL 3G6JF 4HUXA 4O2EA 1A7OH 3VWKC 3JBG7 1I1AB 3RGHA 3GB7B 1D6VH 3MRLA 3HN3A 4IHOA 4XWOC 5IR1A 1RUPL 3ZYZA 2HT4D 2R1XB 5I76A 3GSRB 4R7DA 1AGEB 3U9PL 5GJTH 1NAKL 1X44A 2AXFB 1RVFL 5EUKA 4TN9A 3S35H 2M26A 2XN9D 3QPXH 3CC5B 2VLLA 4WFGE 2DTMH 2JJSA 4WO4B 1Z2KA 4XPFH 5T33H 4K7FB 1Q9OA 1ITCA 3BP7B 4JJ5A 4JM2B 4HF5L 4JZJA 4YAQB 5FO8B 3Q48A 3MGOA 3LS4H 1U3YA 4PJEB 4DVBB 5KVFH 3KPRA 2B7DT 4RA0C 3FQNA 3S3SA 2QADC 1UGNA 5L2KA 3U30C 2WIIB 1YNKL 1UM5L 2PW1B 2E8YA 3BGAA 1R3KB 5DD3H 4DGVL 1M7IA 4NWTL 2IBBA 2AK4A 1RK1A 2W0PA 3TVMB 1H3GA 1NL0H 3RGVA 5EOTB 3NAAL 4OLYH 5C07D 5CEZD 3U4BH 1PZ5B 3P40A 3T4YA 5L0QC 5LAXA 1ZHNA 3GKWL 4FP8H 3V4PL 3C6SA 3EGSA 3IFLL 3SE8H 4G80B 4U1GB 4U6HB 2VDRL 1G9NH 4JFPB 2DM2A 4PRDB 1E27A 3MV8B 4RMRA 5DR5L 4XCEB 5JHDA 5IB1A 3SKNB 1BHGA 3EFFA 1ZA6B 2HJLA 2VOTA 3G6JE 3MROB 5CEZE 4OLZH 1QSEB 5JO5B 2OCFD 4M1GL 1AI1H 5JA9A 1EUUA 3RRQA 1IVLA 3EFDH 3L3OA 3T0EE 3QWOB 4XP4L 4UOW1 2FL5A 5C0DB 1NBZA 3MMEA 4OZFG 4TULL 2A77H 4L4TB 2HLFC 1KTDA 4ODVH 2APWA 3DUHA 5I8EB 2GW5A 4KJWC 2QSVA 1P7KB 4HKBA 5D1QA 3C8KB 4G8EA 4MLIA 4HX1A 5GSVA 1S7QB 4PJBB 1FYTB 1BQHA 3LQMA 2DIBA 4JZNA 3EJZC 3H3PL 4KAQH 2XZQL 4TTDC 3QNZB 2L7JA 3STLA 1ZANH 3CVIH 3DX7B 5M94B 3EJYD 4U1NA 1IGCL 1K6QH 3G6AB 4AEEA 1FNLA 3I6LD 4N8VG 4W81A 5TF1L 1CLOL 3L3GB 5F7HA 1RZ7L 1DLFL 3H3BC 4EN3B 3EYFA 1D5XB 4NHUA 1HI6B 5D2NA 5IGXL 4NO5B 4JY5H 5ALBL 5ITBH 1IJ9A 2ARJA 4JG1H 5I1EH 1S7WB 5LGJA 4Y4KC 4TTGA 4FTVA 5L2KD 4I3SL 1W2KT 1X5LA 2CK0L 1T1ZA 5AAMA 2XT1B 4OLUH 4O4YH 5GGQH 4NP4H 2UV3A 4Z77A 2YHGA 2R2EA 5D7KE 4WHTA 4HKZB 1PYWA 4UT9H 2EICA 4JKLA 5DD1L 1U92A 3MNVA 1DE4A 1UENA 1ORSB 3ULVL 1TZGL 4NBYB 1ZLWH 2BMKA 2QTEA 5HHMB 3S36H 3L7EB 1D6VL 3ARGB 1SBSL 4HIHB 2X05A 4LCIH 2HVJB 1S7RA 5FGCE 4BA8A 3MRGA 4NJAH 5IKCA 1A7QL 1F4XH 1HHIB 1UFUA 2Y36H 4Y19B 5B3JE 3BIBX 4FZ8L 1HWGB 2PO6B 2Z31D 1DSFH 3O4OC 4XP1H 2BSED 1PKQE 1QQDB 3NN8B 4HK0A 3S34H 1IGTA 4JFFA 2H8PB 5EPMB 5TDOB 1OCWH 3SCMC 4N0UA 2DTML 4S1RH 4K2UL 5C9KA 3FO9B 3TV3L 1T7XA 2D7TH 3R8BB 1E4WH 4WHTB 4Z7WA 4I2XA 4WW2B 1NLDH 2DQEH 5F7EH 4TVSa 1LP9F 3WS3B 5EUOE 3UTTA 4NRXB 5BZWA 1ADQH 3C5SB 5IMOA 5BRZE 3WFBL 4TPRL 3VMOA 3BPNB 1KV3A 5FYJD 1M7DA 2AP2A 2CXGA 3MRKA 2JJUA 1FFOA 1JNNH 5HVHC 2E6PA 1DR9A 1OLZA 3O3AB 4I0PD 4DGVH 1GOHA 3FAXA 1YJDC 3KYOA 4NQED 1NMBH 4UIKL 4F37K 4FMKA 2FEEL 1LEKB 5FK9A 3GIVA 1G1CA 3FT3B 1UCTA 4UDTA 5C9JB 4LSQH 4HT1H 4JPKH 2Z0BA 3IU3B 5L88H 1LD9A 4JFEE 4G7YL 1J0IA 3O4LE 3SE3C 4HDIB 1B4JH 5F6IC 4LU5H 1KPVA 4XPBL 5JW3L 5C0CA 5JUEH 5D7SL 1FL3B 2P24A 5T1DL 3TO2A 4UB0H 4XNQB 5K9OB 5DD5H 1I3GH 2X09A 3WNPA 1NSNL 3MZGB 1IM3A 4MAUL 3UAJC 3PL6B 1L0XA 1FAIL 1E4JA 1X5HA 4R26H 5IVXF 5CZKA 1P53A 1J86A 3DLQR 5HYSG 3ARDC 1KIUA 2GKIA 1FGNL 2VLKB 3FT3A 4PJCF 3ARBC 4JM2F 3VJ6B 3WIIH 5DHVA 3RU8H 3ME0A 4I8DA 1JGEB 2O5YH 5D1XC 4IRSD 4KU1A 1GPOL 2Q7YB 1CT8B 2GFBB 2VIRA 3ARVA 3MRQA 4PRAB 4QXGH 3VWJD 3MSPA 1XF5B 4WUUD 1JZ4A 1HH9B 3FZUC 4WVRA 2YUVA 3B2VL 1T7VA 1VFAA 4JEGB 3T0EB 5IB5A 2V9RA 1LK3H 1S7RB 1JHKL 1R3HB 1A14H 3BZFA 3T04D 1UWEL 3QAZC 3QPQC 4NGHH 3IFNH 4XC1H 2ICWA 1LEIB 1CFNA 1EFXB 5EN2A 1N4XH 3U4BL 3JV4A 5TDOA 5LCVL 4GKZB 1Z9SA 3I3DA 5MEND 4QRTA 2OTPA 3NCBB 4FZEH 1EHLH 5GISL 5GS3A 2F53D 4P46D 4XVTH 4OCRL 1IFHL 3TO4B 1WWAX 4M4PA 4EUPB 4OLZL 1I8LC 4L3EB 1IAIL 1OF2A 1LO5A 1YN6B 1EGJL 3CFKB 4I18B 2JB5H 2E27L 1LO4L 1QFHA 4ZFOA 3KYOB 4MCYB 1UXSB 1ZHBA 3PL6D 5KSAC 1PKQA 2R4SL 4K71B 4WFFE 1IEHA 3MR9A 3HLAB 2V2XA 3VD5A 1DBKH 3B9KB 1PZ5A 1FZMB 2VZSA 2IANE 5CINL 3THMH 1A6TA 5HJ3A 1DCLA 1OAKL 3VXRE 5ADOH 4MQXD 1F6AA 5IF0A 1SEBB 3KYMA 1MHCA 3EHBC 4UU9B 2EYRA 1AD9B 3HR5B 4OV5A 2BVOB 2ZZUT 4YHMH 4PRPA 2EIDA 5JW5A 5D8JH 5DI8B 2NY2B 3CXHK 4HZLA 3UC0L 1F8TH 3GBML 1ZA3A 5E2TL 1YC7A 3H7BA 4Z0XA 4NQEB 5EU4A 4WI4A 2C3XA 4GG6B 2FX7L 3IDYC 4QOKE 5IW6A 4ONFH 3BEVA 3RWIA 3PF2A 3GIZL 3IFPA 5LQBH 5DMJB 1INDH 4CN1A 2V2XB 2AJUH 3QFDB 2BVYA 1SJHA 3PHSA 5AZ2H 5DRWA 4LSQL 4PJ5E 3INUL 5BS0B 1G7PB 1A9BA 2RCSH 3S9DB 1CFQB 3ZDYE 1TZGH 4Q97A 5BRZB 4JGUA 1RK0B 1RVFH 3JWOC 3IDJB 3OJDA 3MRFB 1JNHB 1TJHH 2KQMA 2R0KL 3EO0B 4RMQA 3RDTD 1FPTH 2ZSVB 1BQSA 3WSQH 3DX6A 2L0DA 1KPRB 2BY2A 2DYPD 3QNXA 2OI9C 4R4NC 2H32A 1U58A 1W0VA 2ZCLH 3IGAA 5DWUL 5TGBA 3ZL4L 3ILPB 1ZHNB 4ZTOL 1AO7D 3TCLB 3MRRB 4Y2DB 2W65A 4LBEA 4J4PD 2ARJQ 3P73A 4QWWD 4LLQB 2PNDA 4PJ5B 2D9QB 1JHLL 5DURB 3VI3E 1FZOA 4PJXE 4P5KA 3WEXB 4NN5C 3HG1D 4MMXC 1JYNA 3WYRA 1LP9A 3WKML 3QXDA 1OTTC 4TOYH 4NPYA 5E8NA 5C0AD 1JHKH 2B5IC 3GMPA 2FR4B 1A14L 3L3OB 1MFAH 3RIFF 2VLKE 4TVPL 4PRBA 4JO1L 4HS3B 4XAKD 1GL4B 5D7JD 1XF2B 2YEZB 4J2XA 5JW4M 5MI0B 2BP3A 3QUMB 3GJFA 3DVGA 5DUBB 5HGGS 4XP6L 5KAQF 1XFPA 1YQVL 3SGDH 3LEXA 3AY4C 1QQDA 2A0LC 1A8JH 1U8QA 4ZPTB 3MO1A 1EO8H 3F65A 3MJ8A 5K9JH 4C4KO 4KZEL 5JW3H 4OZHA 5CZVL 5T5NG 4XCFH 5GS0H 3CAFA 5GIRA 4GXVL 4BFBD 2MPAL 3IDXL 4ODBD 1H3PL 3K4ZA 3ARFC 1CYGA 1JTOA 3MRBB 3MV01 5DJDB 5F70A 2JB5L 3BEVB 4PBXA 2ORBH 4HKXA 3S4SA 3WUZA 2YPVH 1ZANL 3NH7H 4LF3A 2Q3ZA 5JPMA 4IMKC 3SY0B 3BPLB 1QOKA 5KS9F 4DN3H 1WCBB 2BNQA 3R1GL 4NQVB 4WTWA 2CD0A 1KG0A 3WJLC 4IRJC 2X4RA 4GKNB 4HUNB 4PUBL 4RRPA 1N5YH 3OKEA 1CGXA 1OAKH 2MNUA 3TF7C 3RWCA 5IGXH 3SKNA 1MWAB 4YXKH 3MV7D 2XICA 5DC0A 2DMBA 1YEHH 1FZKA 3QUZB 5FDWA 1MF2L 2EKSB 4HLZG 5J6HB 1HYSC 3GK8L 2P46B 3UTPE 4D3CL 3KYKH 4BSWB 1DVFC 4XH2B 5ACLA 5FHAH 4C59B 1LE5A 4NFDA 1S3KL 1A7RH 2HFFB 3BPCA 1CXLA 2EDHA 3DRTA 4W4OA 1N6UA 3ZKMD 2AXGA 1F58H 4FMFA 2BNRA 2IALA 2DQHL 2R4RL 2HG5A 3CPLB 2CMRH 3T2PA 2CDEB 5C6PB 3FQNB 3QISA 1E6OL 3D3VE 1AJ7H 1J0ZA 4L9LB 4P5MB 3UBXI 2OBGA 1WEJH 3KJ6L 4APQD 4NQEE 1BQUA 1RMFH 1IBGH 3RL2B 2E27H 4JQXC 1CZ8H 3O9WC 5T1LB 1QFWM 3IJSB 3MOBL 4WEMB 5IMLB 2ZCHH 3KPLB 4HV8B 4Y5VC 1MPAH 2I5YH 3MNWA 1CDUA 3NFSL 4BSWA 2I07A 3FAWA 1CXKA 1FL6A 2UY6A 4RMVA 1QUNA 3RI5F 1MJ8L 2XTLA 5ID1A 1X5JA 2GAZA 5BS0E 3HAEB 4Z7NF 5AZEH 3BKCL 1IKNC 5ICZB 3D9AL 5EC1A 4XNMB 4YHNB 1KFAH 2XFXB 3FTGA 3ZSTA 5T3ZH 4X7FC 4LCWE 4WUKH 3U6RA 1TZHB 4PR5B 5IP4A 2IEPA 4EIGB 4M61B 3V5HA 3MOAH 4LCUB 4LSDA 4U1JB 1CDYA 4GRWF 4DGIL 2VL5A 3S7GA 4AZ8A 2ADIA 2X1XR 5EO0B 1L0QA 5TF1H 5BRZD 4WJ5A 3PL6A 2UYLA 4MCYA 4QOKA 5ALBH 4RWYL 5ITBL 5LQBL 1EHNA 4PD4K 2HFTA 5IFAH 1DJSA 1NGWA 3CZFB 3REWB 3OAZH 3ZO0A 3RUGA 5SWZE 4K8RL 2DYPB 4HK3N 3EJJX 1MLCA 4QRRB 1EO8L 2X4OB 1KJ2A 2GSGB 4Y5YC 4O9HH 4H5SB 3RDTB 5EBMA 3PDGA 5JA8B 1N2RA 2X44D 1CLZH 1QNZH 1FNHA 1RJLA 5ICYB 3SCMA 1GH7A 2MPAH 3IDXH 4UU9A 2FYYA 3EYFB 2G60H 4FQPA 3VXOA 2XWTB 5DMGD 3JTSA 5I0ZA 2BJML 4JFDA 4S0SD 2NTFA 3EIFA 4PTUB 3ORJA 5IFJA 3RY4A 5I1GL 2DLFH 4M1CD 3U4EA 3RKPA 1HXMA 3LOWA 1JHLH 4JFHE 4DN3L 5SWZB 1SJHB 1T04A 3TV3H 3ZYJA 2NR6D 3JTTB 4MSWB 1NLDL 4G8FB 3OZ9H 4YIQA 1J0JA 35C8H 3SCMB 2YKLH 3CFKA 1EHLL 1H5BB 1QSFD 4R2GD 2AABH 4U1IA 2X4UB 1K2DB 4R4BB 3G6DL 3PJSA 1MEXH 5HHME 4AL8L 4UIKH 3OG6B 1SY6H 2WLZA 4M3KB 2EE6A 1BECA 5TE7H 3TZVB 2Z93A 1H15B 3PIQA 5EA0H 2FD6H 1G7MB 3B9KA 4EI6B 1IT9L 5J57B 3C5JB 2Q76A 1T83C 5HJ3B 4Y7MA 2VKXA 2JB6A 3IJHA 3U7YL 1G9EA 1UADC 1QVOB 5HGAB 3IXTA 1EFXD 1MWAL 3NA9H 3UP1A 3EYQD 5DJ6B 1PD6A 5CSBA 5D1ZB 3T0BA 4J3SA 4JFYB 2RB8A 1MCWM 5IHUL 4G6JH 4LKCB 5TE6L 3DSNA 3IDIB 3WO4C 5KJRL 4ZMAT 4XXCA 1ONQB 4YBLB 4FXKA 5E4EC 2AEQH 4M5YL 5DHYB 4YHYC 2IJ0C <