5I6XB

X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 35
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xB02
3IRPX 2NX5A 3QA3B 3AS3A 3GI8H 3OKMB 4YXHH 4OCRH 3GMPA 5J06A 2J8UA 4OZ4B 2NR6D 1SJHA 5DK0A 4LLDB 2R56L 3H9HA 5HHPA 1GAFL 3F7YA 4LCYA 5ICXA 4X6DA 5FGCB 2YEZB 2DTML 1FPTH 3HE6B 3VXSE 4DVBA 2Y06L 2P8MB 3EOTL 1UM6H 1X5LA 1BWMA 2VL4A 1EBAA 5HY9B 5FHAL 4JFPB 2IH3A 3BKYH 4GXVH 1OP5H 3VFMA 4HK3J 1HDMB 1R3LB 2IEPA 4Y4HD 2X89D 3BPNB 3T0EA 2DM7A 2W60A 4PJGA 3C87A 1NFDA 1G9ML 3BPCA 1J05B 3FQXB 2A6IB 3FT3A 5FYKH 1KEMH 1WTLA 3HAEB 5D7LA 4X6CF 3G6DH 4N1HB 4XP1H 5ECJE 3UJJH 1H3GA 3PWUB 1MQ8A 1N26A 3NCMA 3ARZA 1RUQH 5E95B 1V3MA 2VLKB 3TNMA 2X1QA 5GHWH 2WP3T 5IUSA 1T89A 3QQNA 1W0VB 1M6OB 3VXNA 4HFUL 4K8RH 1T3FB 2EDOA 5DJZB 2SEBA 5DUBB 4JFEB 4I3SH 1K4CA 5B8CB 2P42B 1DBJH 3ES6A 1JPFA 5EOCL 5C08E 1RJCA 3K81A 1JI2A 2JJVA 4CVUA 3TVMD 3O8XB 1NC2B 4XBEL 5EZOL 3FN0L 1PEZA 1UC6A 1EVTC 3RVVD 4JRXB 5IVOA 2ERJC 3MRBA 5D4QA 4ZSOE 4M8QA 4YZFF 1X6NA 4PJHA 2P24B 4R4BA 5T1KB 4NQCA 3QEHA 1J0HA 2NPLX 4ZPTA 4LVOC 3P4OA 2CIKA 4IRJD 2HKFL 3QFDB 1PX4A 2JB5L 3BZFB 1VHPA 1IAIM 4L8SB 1D9KA 5FXCH 3WXVH 1J0JA 3G08A 1X44A 4JN1L 4ZQKA 2Z8VC 5FYJD 5C8JA 3H9SA 4U7KA 4QRRB 1MRCL 5A3IC 4IRJC 5F21B 3HG1D 1H8NA 1MFNA 5EORL 2VDLH 3N0PB 3KYKL 3MLRL 3SDAA 5HHNA 2BY0A 5M95B 3SO5A 2JIXD 4ZO6A 4FTVB 2D7OA 4ZUTA 3WJLA 1IT9L 2A73A 2MQCA 3AFLA 3LV3A 2QLVB 3GMOA 3RWIB 3B5GA 3KPSE 4KROD 4K3DL 5F88A 1NSNH 4KROC 4J6RH 1RULL 3GJEA 5HGGS 1I1AB 1QVOB 1XGQB 4K07A 1QRNA 2BSTA 4NT6B 2MNUA 4NQUA 4CNIA 4P23C 1JV5B 2P5WE 4P5TA 1KXVC 4ZXBD 1RZIB 2W65B 4N90E 2DQJH 3KDMB 4JFYA 3ULUD 4YHZL 4FQHB 3WIFA 4OQTA 1I3RB 4J4PD 1I7RB 1J0KA 3ZYOA 1N5YH 1B6DA 1NDMB 3TJEH 2FZ3A 2YC1A 3PQYD 4X80L 1YNTB 1DSFH 2GHWB 5H35A 4E41E 4HKXB 1I85A 2IGFL 3P0VH 2EYRA 2ARJA 4FQ2H 2BNQE 3RWCA 5A2LH 3U0WL 4JY6B 4U1LB 3ROOB 1G7MA 4G7YH 3OG6B 4P5MA 4NN6C 5F7MC 5E2UH 2H2PC 2IMMA 3N9GH 4NHUA 3SDYH 4JPWH 4HWBL 5DFTA 4MDJB 4GMSH 3S35L 2ESVE 3B6SA 7CGTA 2CUMA 3QUZA 1PYWA 3I02B 1YEIH 4HH9A 4GKNA 1T1WA 4LCWE 5CP7A 5JHLL 5AD0B 3CX2A 4WY7L 4NM8L 3RUGA 2BVPA 3WIHL 3HNTL 4NHUB 1EHLH 1OCWL 4L4TD 1SY6A 5H94B 3GI8L 2EZ0D 2RBLA 1VERA 3WL9A 4PREB 1OSPH 2OZ4A 1DBAH 1CLCA 5I8KL 1CFTA 3NIGE 4JPVH 2XKNA 3T77B 3GNMH 3LHPL 2XG4A 5GPRA 4PGCA 4GAJL 2HN7A 1U9KA 4JJHA 2DTMH 4NKOB 1GGCL 3BP7B 2YWZA 3UDWA 2E6PA 2VB5A 1WZ1L 4E42A 2NY5C 4DZBA 4MQXD 3SHSA 4FRWA 1FDLH 1RUMH 4AEFA 3RAJL 3QQ9D 2DIBA 3U9UA 1ZGLP 3Q6GH 4YNYA 1I1AC 3SDDB 4U31A 3CC5B 3RKPA 1TITA 3KLDA 4KPHH 2OTUA 3RGVD 2AJUL 1MLBA 4Y19A 3T0EC 3MA7B 1I1AA 3VD3A 1RZJC 2EO9A 1YPZF 4LQFL 3RZCB 3TT1H 5CEZH 4QXWA 1TQCC 3GSXA 2ZCHH 1IVLA 2BX5A 3MRCB 2B1HL 4U1SB 3O9WA 3TEUA 3KYNA 1U3JA 2OZ4L 2NXZD 4KFZC 4W81A 1OM3L 3FO2B 3BYYA 2EICA 2JE8A 2CRZA 1F6AA 4G80B 1PZ5B 5E8PB 1NGQH 1ES0A 3ARTA 5E03A 3QT2A 4JFFB 1JWMB 4OCRL 1DE4B 3CDYA 5JORA 3FQRA 2Q86B 3VGBA 4K8RC 1TFHA 3K80A 2Z4QA 4Y1AA 5BV7B 3KYOB 3MNWB 2A0LD 5TDNA 1N7MH 5T3XE 5HVHC 5D7IA 3S88H 4XBGA 2OI9B 4MWFB 3L6FB 3QQ4A 2IBBA 4UT9H 1NMCB 5I76A 4D9QE 2HWZL 4OD1L 1J7VR 2EDLA 1MJ7L 2GJ6D 4RIRB 1FL3B 2A9NL 4Y5XA 4ZTOH 3F65A 1RFDL 5T1KA 1AXIB 4M8QB 5CS7A 1F4AA 1BVLB 5T33L 2Z0BA 1WICA 1NC2A 1N4XL 1FLRL 1U8LA 1KPRA 5KTEL 1L9NA 4Y5XC 4H20H 4MSWA 3NFPA 2NYYD 5MEQA 1KEML 4UMGA 3U1SH 2OL3A 2CH8A 5EB9A 3RFZC 3S3SA 5L2KD 3KYKH 1A3RL 2IMNA 5DVOA 3CFDB 3NIFF 3NH7H 4QHKI 3FFDA 3DETD 4YFLI 2DAVA 3TCLA 1SJVA 1CDBA 2X7LB 1YMHA 4P46C 5C2UB 1H15B 1TCRA 3CSYA 1IT9H 3D25A 3O6LL 1BD2D 4GAYA 4OZFB 5IFJB 4O4YH 5E0QA 5ESVB 3QDAA 5DK2A 4YX2L 3AREC 3QAZB 4LLWB 4X4ZA 1FGVH 5EUOB 3X12A 1JUFA 1GVIA 3GHEL 3OKOA 4C59B 5I71C 4M43L 2APTA 3MYJA 4ETQB 5DJCB 2OR7A 5MENE 5IFHL 1MQKH 2F54B 3INUH 4AIZB 1UZ8A 2Z91B 1F4XH 1YQVL 2DJSA 3OJ2C 3NPSB 2XPGB 2IAND 1R3LA 1RV6X 3JWOH 3T1FB 3DETC 3PQYB 3DJ9A 4DFIA 4ORGB 3PQYE 2Y36H 2NY0C 2EE2A 4HIHA 1OARL 1BF8A 1G7QB 3PP4H 2CLVB 1Q0XH 1AGDA 2JK5B 2COQA 3T0ED 1YJDL 2EYSA 5T1LD 1U3HB 4PJ5E 3WXVL 2A83B 4IIQA 4G6AC 3VXQA 4GRWE 1JZ3A 4N1CA 3FHQA 5E2TL 3ULUE 6FABL 1JPSL 1XIWA 1PY4A 4JGJA 3D85D 4FG6D 4XCYA 1AGEA 4YWGH 1ZLWH 1MEXH 3FB5B 5AUMA 5IEKA 3H3BC 5K93A 5BRZA 2ILLA 3R1GL 1K4DA 2ITCB 3GSVA 1UEYA 5IBTH 3HI6L 4RMRA 1IAIH 2BVTA 1C16B 2QTEA 1N6QL 1F45A 1Q38A 4EOWH 5GS0D 5I15H 5I71B 4JG0L 5D1QB 4KGJA 1J1XH 4I2XA 1MREL 2W0KA 1MFEH 2BVQB 3IU4H 4XVJH 5CEXB 1NEZG 2YKLH 1MOEA 3IDJB 1S7WB 2XY1A 4AMKL 4BZ1H 1JNNL 4M7KH 4U4BA 4LHUA 2A6KA 5I8EB 4JPVL 2EDRA 4WCYL 3MQIA 4NQCD 4MNQD 1T1ZA 2IPTL 3QNZA 4WUUE 5J6HB 1KEGH 4J3SA 2FSEB 1KJ2L 1HHHA 1VACB 1JN6A 3UJTH 4YGAB 3UC0L 1FSKC 1ERNA 4JM2D 5IESH 5ID0B 3D39A 3PV7A 5CBAA 2PW1B 5FGCE 3HS0B 2JCCA 3FRPA 3G5YA 1S78C 5JIHA 3Q2CA 5F1SA 4Z77A 3ARWA 3DGGB 3GSNH 3KPOA 3WV0A 4WEUD 1S7SB 5TE4L 2HRPL 1SYVB 3HG1A 3VI3E 3C5ZA 3BHBA 2AGJH 4YDIL 3D87B 3MRGA 1YECL 3QWOA 2Q7YB 4LEOB 4QGTA 2VKXA 4TUJB 2X4NB 3O3EA 1H3PL 3VFRB 3NZHH 3H8NA 5FOJA 1EJOH 2E9WA 2FL5A 3IVKB 2VYRE 5FOBA 5GGSY 4JRXD 3GSQA 1ADQL 4QOKA 1KJ2B 2F9BT 2J5LB 3QDJB 3S37H 5C0DA 1OHQA 2NW3A 2PW2A 2EDBA 3C5SA 3AAZB 3CUPB 1AQKL 5IK3B 3FONB 5FM5M 3ARBC 1OM3H 3NACH 1YEIL 3GIVB 4BJLA 2X4QA 3CDCA 3F7VB 1WK0A 4L4VA 3ARYA 4UT6L 5IR1B 2ESVA 3SDCB 5E56A 2VLKD 3AXLA 5D1ZA 2PR4H 3VXSB 1S7VB 5DGQA 5I8KH 1SYSB 3OPZL 5E6IA 1MAKA 1T4KA 4TUKL 4NP4L 5IB4B 1UM5L 4ZFOB 1JGDA 5DDHB 1A6TA 5CEZE 1N7ML 4PGZA 5MEPA 5J6GB 1OP3K 1Z9MA 5FGRA 2OMNA 5F7EH 3NN8B 4NYLA 3QUML 4XCFH 5HPMB 3ZTJH 1T2JA 5GGTA 1HXYB 4J3UA 4CGTA 4MDIB 2N4IA 4WU5B 3CDGB 3B9VA 1MJ7H 4Q6IB 2DWEA 3CVHA 1DUYB 4YHOL 3PF2A 1YEDB 3FB6B 4HS3A 4QHLA 4LF3A 4Q9QL 1T22B 1LP9F 2ZSWA 4NN7B 5T33H 2VXUH 2NMSA 3VH8B 5EUOF 2AV7B 3ULVL 3QIWC 1FLRH 4FTVE 5F6IB 3QUKB 5CIPA 2F15A 3K1KC 3SKOA 3JUZA 4PRPA 3GGWB 4PGEB 5A16A 2PYEB 3NAAL 3QO0B 1OQOA 4WTZG 3DROB 5D2LE 4RFEA 1KCSL 3DUSB 4PV8B 4NQDD 3MCKB 3EHBC 3MV9D 1QEWA 4UV7H 4L29B 5DD3H 1ACYL 2HT4C 1LO2L 4KGLA 2AJ3B 3MLVH 4JHWL 1S7QB 3L7EB 4JN2A 5D96B 3ZHKA 1LP9E 5FYJU 4HIEA 2P5EA 1A7BA 2Y07L 1MQKL 5MP6L 1H3TA 1H3VA 4C56D 4XNZC 2RFXB 3OB0K 4F15B 3CLEH 4JCLA 2XWBA 3TO2B 1Y6MR 2XKUA 2EDYA 3SGDI 3QRGL 4UILL 4PYGA 1XFPA 1YN7B 2X4UA 4AYFA 5FYJE 1U8IA 2NXYC 1CE1L 5IROA 1H3UA 1NCCH 1Q0XL 1RFDH 5LGJB 2DYPB 3DO7B 4ZO8A 3PWNA 5DHVA 1HHIA 3CU1A 2R69H 2BERA 1IQDB 4XTRC 2WINA 3FO1B 1KCVL 4ZSOA 1DVFD 2MKLC 5CSBA 5J8OA 3QIBA 4JFOA 3C60A 4YHYB 4UTAH 4HWEL 3VXMA 4YPGB 5JMRA 1ZLSL 2BSRA 4QHUB 4RWYL 1DLHB 4Q74A 2E9IA 3GBNL 2EXYD 2NR6C 3MLSL 1B88A 2D7PA 1GIGH 1LEIB 4YX2H 3I6KB 1G7JA 1YY9C 3QIWD 4KHTH 4U6YB 1KIQA 2FD6H 4ZFGL 4PJ9C 3V4PH 4M1DH 3GI9H 1JL8A 5FM4A 4M93B 3SDXB 1QSVA 4KZEH 4JQXC 4X7SL 2QBWA 5D5MA 4BZYA 3S3PA 5CGMA 5E5MB 3ZYZA 4XPBH 1E4WH 5GGUB 4Y2DB 3EYQC 4JFED 3BP6B 4GFTB 1U93A 1QFWH 2BHYA 3VXTA 2YR3A 3QJHA 1QFPA 2RIKA 3AY4A 4R2GD 5C9KA 3B5TA 4E41B 4ZOCA 1A3LL 3CCHA 5IJVA 1NCTA 3W0WA 4CADA 4NRXB 3TBWB 3DMMB 5CJQH 1J87A 2ADFH 5DI8A 5CFHA 5L2KA 3STLB 5DEZA 3ARBD 4RGND 2DL9A 4KQ4L 2GQHA 4C56E 3BXNA 3UTQB 3VXRB 1J0ZA 2BRQA 4AENA 2B39A 1A47A 3FTGB 3LPWA 4W70A 4LRNH 3KAAA 5GGSB 4OFDA 5DQDL 2XRAH 2DLFL 4JZNB 2BSED 3QEGH 4TTDD 4JG0H 4LK4A 4XNMB 4C83A 4Z95H 4NM4H 5K59F 3C2AH 1A8JH 4YUEH 3ZTJG 2ZSVA 3ARFB 1S9WA 2OR9H 4UT6H 5L8JB 5IB3B 4Q7DA 3TN0A 4YHMH 1LEGB 1T0MB 4P2QD 2PR4L 4G8GE 3C6LB 2HYMA 2NYYC 3GMLA 1GOHA 3EUUA 5AWNH 4PJ7A 2IANA 4UAOB 5DRXA 2NZ9C 3M17A 4O2CB 3U4BL 4PBVC 4KZDH 4JM2C 1KEGL 1S7TB 5CD5C 1XF3B 3VDCA 3QUMH 3P30H 3CFBB 1MCLA 3LPFA 3MLUH 1Q72L 4WENB 5F6HI 3ILPA 1KCUH 4P3WA 1L0XA 1HSBA 3PNWB 1HINH 2A6DB 1NGPL 4OFIA 1MCEA 4PTUB 3ARBB 4IBLT 3PGDA 3L3DA 4MA7L 4MAYD 5EN2A 3C8KA 4OJFH 3VXSD 5I18L 4LCCB 1DQTA 2D9QB 1LEKB 1NFKA 1JMZA 2F53E 4O51A 4ODUA 5T1DL 1DJSA 5IHZA 4LHUG 4JFZL 2AEQH 4Z9KB 3FL7A 4OTXL 4GJTB 4NGHH 3EFFB 1BAFL 3BWUC 4YXKH 1P84K 1YPZB 4ZUSB 5DJAA 4I2XE 4HIJA 3QDJD 3S5LA 5JDJA 3MO1B 3NACL 3LS4L 1UWGH 2LTQB 3A6BL 1UB6B 4XNYH 4GLRH 4POZC 2RB8A 3EGSB 1LO0H 2B5IC 1ZXQA 4Y2DD 3LEXB 4ODWA 4PFEA 3NGBC 2RJMA 4LOUD 4PJFA 1QA9A 3UYRH 4KK6C 1ZLVK 1TJGH 3LN5A 4Z18A 1AXSA 1ZT7A 4R96B 3VFGH 3RVWD 1S9VB 2ZOLB 5D1XC 3Q3GA 3SO3C 1G0XA 4OZHF 1EFXD 4HUUB 1QR1B 3WBDA 1NBZB 2F54D 4OF6A 4U1MB 3D39D 3LQMA 3R06A 5DS8B 4PBXA 4R0LA 1NBZA 1NLBH 1IZKA 3K4ZA 5C0BB 4MQXC 3B8YA 3MOAL 4OI9A 5KVMC 2DD8H 3HR5B 5CLTA 4YBQC 2R1XB 2ZJSH 2FX7L 4LLYA 3C5ZD 3RWDB 4U6HA 2NLJA 3NCYS 4PJEB 1L4IA 2CO6B 3O3AB 4Y8DC 2HH0L 3MROB 4RQQB 1CQYA 4KK5C 2QJDA 4JFXA 5JW4Q 2N1KA 1XCQA 2O5YH 4LGPB 5I1HL 4ZO7A 3ZDYF 1OPGL 1CR9L 2VN7A 2XICA 1ZLUH 3NGBB 5AG9A 3VXOB 1JNHA 1KN4L 2NW2B 4OZIA 3UTPD 1UKQA 4D0DB 4Y16A 4LEXL 4PJAF 1KTDA 3MRLB 3O6FC 4N9OB 1R24B 1C1EL 4PJXF 5CSGA 4WFFD 2WIIA 4R8WH 3DBXB 1J11A 2ZCLL 3GBNH 1CGWA 4UZGA 4L4VD 1ZE3C 4L4TA 3RX8A 5HI5D 1V3LA 3LKNA 1I7TA 1WIPA 5GRVL 3G6AA 5DD3L 5BQ7A 3S96B 1MFAH 4JHWH 3BP4A 3GI9L 1BIIB 2J8OA 4QO1A 5AZEL 3VG0L 1G7PA 1DVFB 1WCBA 4B7LA 5IBUG 2Y07H 3TLRA 3LS5L 4NZJA 5C0CB 3E1F1 3WUZA 3CLEL 4JQXA 4XGZB 2F5BL 5I73C 4S1DC 4ACPA 4A2LA 5I1DA 4CAGA 1G6VK 1ZANL 3BN9C 2D7TH 4HJ0D 2J2ZA 5DO2D 1S7TA 1CF8L 1A7QL 2GIYA 2X5PA 1ULVA 1IGYB 3P4LA 1B4JL 1NFDE 1OTUC 2W38A 5C0CD 4PLKD 2IANB 4XP6L 1EMTH 4P2RD 4F9LA 4AG4H 5LQBH 3C6LA 1G7LB 2CKBB 3CVIH 4Z8FL 2R15A 3IDNB 1MWAL 3KNBA 4I4WB 4OV5A 1A6UL 4PV9B 1T5WB 2YS4A 3EAKA 5K9QI 3U30B 3ARFA 1PSKH 2DQTH 1KCVH 4RGMB 4PRNB 3O6ML 5F89B 1SQ2N 1OP3H 1I8LA 3MBXL 5I1AA 1WWAX 4JREB 4NC0B 3MBED 4U3CA 4NDMA 3KJ6H 3SY0B 4CBPA 4FQXB 2ADGA 2QADD 3VJ6B 4RRPA 1ND0B 4K9EC 3RPKA 4MJIB 1TVBA 2B4CL 1OP5K 4LVHC 4XCEB 4HJGB 3MLSH 5DJ0B 4X6CE 5TQ0H 1PG7X 3RX5A 3NCFB 3TESA 4JGMA 3TPKA 1KJ3L 2R0LL 4PJBB 2YA0A 2YA1A 2Y72A 3EDFA 3W82A 5IJVB 5KS9B 5ANME 4KZEL 5CBEA 5TGBA 4M7JH 4MA3A 1JWSA 1ZSDB 3MRHA 4XVTH 1I9IL 4R4FL 1EAPB 1QSZA 4I13B 4ZTPL 3SKJH 1L0QA 4WV1C 1OAZL 3QISA 3CSPA 4N8VA 3QDGB 5J4MA 5CJOH 5KANG 4GW4A 2HFTA 4NWTH 1NDGA 5FIEA 4RMVA 2H6PB 3IFNL 1AXTL 5CGYD 4N0CC 2PTVA 1RJYB 4JKPH 3TO4D 5T1KD 3ZT7A 3MV7A 3KS0J 3TBVB 1XF5B 3N06B 2Y5TA 1SY6H 1HINL 5BS0B 3MRMA 2NY3D 1QSFD 4O02H 4ODVH 3ZT6A 1A3LH 2XQYG 1OWRM 2EZ0C 5EIIB 2DIAA 4Z7NF 2R23A 2GEEA 3H9ZA 3WUWA 1FL6B 4U7MA 1E6JH 1PQZB 1HXMA 5KSVB 3PHOB 1NMAH 5KG9B 5JXEA 2IBZX 3RVTC 2ED7A 5ACZA 4OAWB 4JFZH 2AQ3A 2VISA 1DLHA 3WEXB 4FP8H 3OR6A 1NMBL 1FV1A 4OM0L 1I3VA 4ZAKA 3NIFE 1LILA 3G5XA 2VTFA 1TZIA 4JANB 3QIBB 1H8OA 1S3KL 5TFSH 2EEAA 2BVYA 4IS6B 4I0CC 4ZFZA 5DURB 2V5SA 3LD8B 3P0YL 5FEBA 3UO1H 3BGMB 5CCKL 2OR9L 1S5HB 1QYGH 5DVNA 1K2DA 5DMJB 4M1GH 4YHML 4MCZA 3FQTB 3B83A 4OLZH 2I5YH 5C08B 5LVEA 4OLXH 1ZGLA 5KAQG 3OBAA 3DURB 4KAQL 4P3CH 4KTDL 5TJWK 4EUPB 3NCEB 3VRJA 4OBRA 3V6ZA 3WNNA 3ECBB 2VXSL 3U30C 2LV4A 3LB6C 3ZKSD 2F19L 4YHLL 3TYGH 3F8UB 4KV5F 5JHDD 2W0FB 1A7PH 3LQZB 3GJFA 4HF5H 1I75A 4Y4KB 2VDML 3SKMB 1X5ZA 2Z8WC 3ABZA 4KDVA 5LXGH 2IH1A 4O00A 2RR3A 4L29A 2HTLC 4HXBH 3PWPB 3MV7E 1KULA 1MH5A 2CK0L 4GMTH 4NSKB 4PRBB 5I1HH 3W5MA 3S36L 2J6EL 3D48R 2AEQL 5D9SA 3EHBD 1NUFA 4JRYA 2DBLL 1EDQA 5ENWA 4JO1H 5DJ8A 2PETA 1W8NA 1C1EH 2PYFB 1E28A 1MVUB 3ARQA 1ODAA 1ED3B 1FZOB 4EUPA 4ZAKB 2BVOA 2GTZB 4IHOB 4CU7A 1KPUA 3QWQB 3CMGA 3BGFC 2EE9A 2ZUWA 4MQTB 4XNYL 5CIPB 2VISB 4DCQB 5D93C 5C6TL 5A2KH 3WJJA 4KWUA 3FOMA 1H5BA 3G5ZA 2CK2A 1A3QA 1OW0A 5J9PA 2DF3A 4XX1G 3SJVA 3PP3H 4FQJL 4RGOL 1DEEB 4IRSA 1DQQA 1ZWIB 4ZFZB 1DN2A 1G7IA 4MJ6B 4DKFL 1HQ4A 3JWDL 3KVQA 3CX5J 4XI5D 3TBVA 5J6GA 1RI8A 2VQ1A 2Z93A 3F5WB 2DM4A 5CUSL 4HZLB 1FH5H 5I8OL 1PX3A 3BMVA 1T4KB 2NY4C 1KLUA 1ZHNB 1KLFA 3P0GB 1VADB 3KLHC 2UY7A 1NKOA 1PQZA 5E00B 3VXSA 4ELMB 5IQ7L 4NQXB 4M7LT 3VD7A 5HGAA 1NCBH 4M6MH 3VMOA 5EIIA 1L0YA 2C3WA 5AYQA 3T65B 5FHAH 1CR9H 4IMKA 4NJ9H 5JZ7C 2Q1EA 4LFHD 3OMZA 1YC8A 5C0BD 4P4KC 2FJHA 5ALBL 4GG8B 4KK8C 3QDJA 3MRKA 3AU1A 2NY1B 1OD9A 4JJ5A 4MS8C 3QDGA 4TRPL 2XWTB 5CZVL 1WFUA 2FL5B 2IAMB 1YPZE 3RTQD 4FNLL 5FF6B 4D0BA 3ZO0A 3MRHB 4G8FB 4ZNEA 5F3BB 1RU9H 4Y88A 4E5XB 1I1YB 4LLMB 3IXAB 5E6ID 1MFAL 3O6FD 4PJBA 4PRNA 4LSTH 3LSOB 3C08L 3BP5A 5EU6D 4PV9A 5F96H 1LP9A 2IALA 4ISVA 5IMOB 1VDGA 2WUBL 4MNGB 1IKNC 4W6XB 3DRTA 3RVXD 4UTBL 4AQ1B 1ND0A 3DHJA 4OCWH 2PO6C 5B3JF 2NY1C 1HEZA 4NDMB 4MD4A 3SY0A 1GJIA 2QSQA 5FECB 4F33A 2EIEA 2D7NA 5F89A 4XBEH 1FORH 4MJ4A 3O2VL 4NNPH 4O02L 4JG1H 4ODVL 3WLBA 2X9XA 3EO9H 5I1DB 1S7WA 3NA4A 1XAUA 5GSRB 1QUNA 2H3NA 5EBLA 2BVQA 4XBPA 2HKFH 3PGFH 3MLZH 8FABB 3P11L 2PTTB 3O6MH 4TUOB 3D69B 4PRIB 3MRPB 1XCTA 3V2AR 3QI9C 2Z9TA 1ZTXL 1IAOB 4FP8L 4MHHI 5HTSA 1OSZA 3OKEA 1CYGA 5BRZB 1XGUB 1KTDB 4NOFA 2AABH 5HYQB 2PXYA 2BNRE 4XCYB 4X5XA 1BIIA 3D2UD 3B2UD 5IHUH 4WFEE 2EKSB 3BKYL 4GXVL 3GSUA 2ZPKH 3M8OL 1J8HD 1PLGH 4A6YH 5IW6B 1CFSB 1BGXL 1H0DA 4HMDA 1JNLL 4M7LH 2CLVA 1T7YA 4R7DA 3JV6B 2GYSA 4XNUL 5F7YC 3V0VB 1MHPL 3IDXH 1CL7H 2GJJA 3WS6C 4NWTL 5IT2L 5EUKB 3PL6B 3TYGL 5IFAL 1P4LB 3BD4A 4PJIA 4RMQA 3PE9A 3PWLA 5DJ6B 3S35X 2P43B 2HJKB 4PJ5B 2VAAA 5D6DA 1MCIA 2Q76A 4Q9RH 2P7TB 4H1LG 4W4OA 3BRFA 1RUQL 1MHHA 3IKKA 5DJCA 3AB0C 5DC4B 2F53B 7FABL 4P5KB 5C7XL 4AM0B 4OZGB 3OKOB 3UMTA 1SM3H 4RWHA 2NLJB 5J12B 1BQLL 2Q6WB 1DBKL 2NY2C 1UXWB 1JGLL 3P9MA 3X14B 2N7BA 4X80H 1QZ1A 3MRIB 3SOBH 1X5IA 2X7LA 1TTFA 4WI7A 4JO1L 4J12A 1ZVYA 1FO0A 4WW2F 1JK8A 2APWA 2B5IB 1CDUA 3ARPA 4YC2B 2GSGB 5KVDL 4ZUSA 4DUWA 1D6EA 3BPOC 1FN4A 2DL2A 3WO3B 3E0GA 4XAWL 4PG2C 3HZYA 1MJUL 1Q1JH 1ZEAL 4EI5C 1TTGA 3KPLB 4O51B 3OTTA 4M1GL 1JMXA 2YUXA 4K3JH 2BY1A 3RTQC 3L5XL 4OLXL 2V9RA 4PJDB 1BM3L 1FL3A 4Y5XB 4B5EA 2NY2D 4N90D 3BIAX 1N2RA 4LU5L 1MRCH 4WO4A 2DS4A 5DHYA 1T21A 5MI0B 4UOW1 5TDPB 4JB9H 1QSEE 1IEAB 1FBIH 4YDLC 1GC1H 4FQLL 3L5WA 2CDFB 1A02N 1U8NB 3OKLB 3MLRH 3RBGA 5T5FH 4QNPE 3KYOA 2PCPA 3CU7A 1JYVA 1FH5L 3O4LD 2FHFA 4XHJC 4KTYA 5DGRA 1P5UA 1M4KA 1S5IL 2X05A 3DV6A 3K7UA 1WZMA 1KB5A 4GG6A 3MUY1 3OJDA 4QY8B 1Z0NA 4PJCF 1JJUA 1GGCH 3ARBA 4K3DH 2PYED 4BQ9A 3DSFL 4JFDD 5CD5D 1XGTB 5C0GB 4F15C 2VOTA 4OGXL 5EBLB 3S9DB 1RSFA 1HSBB 2G2RB 3SBWA 2KZ1B 4CKVX 5C0JB 3ARDA 1P4IL 4MXQC 5JQHC 5ICZB 5EBWA 5HYSG 5DXWA 1BFVH 1IGCH 3GMRA 4X7TA 4F33B 4PD4J 4F37K 4EZMA 5J13B 1VGEH 2DQJL 3IGAA 2RAMA 3AS1A 4XAKE 3HLAB 4Z7QF 5B3NA 1P1ZA 3EYVB 1V8HA 4L4JA 5I2IB 3D69A 4PRIA 3GUTA 4TTDC 3N9GL 3SDYL 3GMLB 4XBPB 4TSAH 2ZUQC 1T7ZA 3CC5A 4WHCA 2UZIH 3ROLB 4X5WB 2W9DH 4XP4H 3S8WA 3EYSL 3CSBA 4KJWC 4WWID 3S5LG 3CD4A 3MFFB 5IM7B 4DZBB 4JGUA 5HHOE 4LCWD 3ULVF 5GGSA 1DN0A 3HNTH 4K23H 1OCWH 5FDYA 2HN7B 1AD9A 3OAUH 3UTQA 3VXRA 5BV7H 3ARGD 1E6OH 3A0OA 4P5TD 2XKNB 4GLRI 4MNGA 3AU1B 3FRUB 3BH8A 4ISVB 4PRAA 3BEWA 2CRIA 3EO9L 3WL9B 3OGCB 2JKXA 4RGMC 3S88L 5H94A 2EDTA 1S9XB 1FVDA 1CFVL 3JTSA 4NRXA 2V6HA 4PG9A 3T65A 5F3BA 1T1WB 5B8CC 4KDWA 4E41A 5FA3A 1JBJA 4JRYD 1P7QA 2JJTC 1YEJH 4V1DB 5E8NB 3MOBL 5E00A 1MIEH 2KPNA 4NRZA 4TPRH 1RK0A 1CCZA 5F3HB 2EIZB 4HCRH 1MLCB 3VWJC 1CG9A 4YHKH 5ALBH 5L2KE 1TQCB 3VXTB 1HHJA 3GMQA 3LHPH 4PTTA 2OJZH 4OSUH 1D5ZB 4ERSH 1LE9A 5CILL 2Z93B 4NFDA 1YYLL 5DF0A 3MR9A 1HSAB 4QCIA 1TIUA 3I50H 2FECL 2BY2A 3RWCB 4MJ6A 4KRPB 5GS2H 1T03L 3QUYB 4P4KD 1LO5A 4IRSD 1RZFH 4KY1L 5H2BA 2V5TA 3VFWA 3DSNA 2VH5L 3C08H 3Q6GL 1IQDA 2OZ4H 4YXLL 2G5RA 1JNLH 4Y16C 1TZGL 5FUZH 3HN3A 3G5ZB 5JIIA 4NZUH 1DFBH 1U0QA 1EX0A 1H3WM 1LDSA 3QZWB 1RUKL 4WEBH 3F5WA 3WIFB 4FQHA 2UY6A 1EBPA 4P9ML 4X6CA 1BZQK 2V17L 4IM8A 1VKXA 2VDPL 1RQ5A 1N3NB 3VRLE 4MCYB 4J4PC 3INUL 1XGPA 4MB5A 2P45B 4JRYB 1GHFL 2J1KA 1WJ3A 3JWOL 5JOEA 3QHTC 3HI1A 1QSFB 1VFBB 1H5BB 4K71B 1TJHH 5IQ9A 4R9HA 3JTTB 4OUUB 4MMXC 3DO7A 2I27N 2CR6A 1JGLH 2A9NH 4MNQB 4IHOA 4IMLB 3WHXB 1DQDH 3L7FB 1C8PA 1E28B 1MVUA 1PW3A 3EO0A 5CSZA 2C1OB 5F1IA 5HHNB 5HHQA 1R3JB 2VERN 4BZ2H 5IMLA 3U1SL 3NA9H 3VI4E 5GS0L 4TNVF 4U1KA 4NSKA 3L3JA 3WHXA 3BZEA 3MJGX 1F90H 1NAMB 4JPKL 1JZ7A 2EDFA 1IC4H 2R1YB 4EOWL 1DBML 3FRPG 1Q9WA 3OR7A 4WHYG 1UKTA 3L5XH 3WXWL 5FO7B 4MCZB 1FZMB 2C1PB 2UYLA 1IC7L 4LLVB 4RMSA 5JW4N 4Z7WE 5DMKB 4JM2F 1U8MA 1XR8B 5I9QB 5DC0A 5ITFA 3RVTD 4KI5E 3GEWB 2GK0B 4QTIH 1NBYB 3ULVD 1REIA 4MD0B 1LD9A 1TVDA 4RFNB 2XQBL 4JFQB 2HLFD 4IMLA 5B38B 3GMNB 4Q9RL 1UJTA 3O8XA 3RVUD 4OLUH 1YQVH 1UM4H 3ARFD 3QUKA 2IPTH 4XVSH 2BDNH 3QZWA 4I9WE 5LBSH 3VI4F 4C58B 1NGWB 2AKRB 4XI5C 5E4IA 4XXDA 2DQDH 2OQJA 3GHEH 4JLRB 3WUWB 2BHZA 1DBKH 2HFGH 1VESA 1LO5B 2DKMA 1XIWC 4G8IB 1EIBA 4NQEA 3BT2L 2OI9C 2D7MA 3TV3H 3SOBL 2VXVH 5E8OA 2XN9E 4ZPVB 1C5CL 2CSPA 1FV1B 4AQOA 5JPNB 4YDIH 1JGDB 3FAWA 5DDHA 2WSKA 3VGAC 2R8SL 4FFZH 5KG9A 4GQ9H 4DOHB 1C08B 3E3QE 1RK0B 4HBCH 5F3HA 1IKFL 2D0GA 2W60B 1C5BL 3NZ8B 1Z6JT 1QLRA 3MA9L 1B0GB 3QUYA 5FA3B 2ESVB 3QWOB 1IQWH 2J4WH 1JYXA 5KS9A 4XXCA 4XVUC 4WUUD 1N0XL 3W39B 2Z31D 4PRDB 3FFCD 4LU5H 2XZAL 1P2CB 5KOMC 4LVOB 2HT3D 3T2PA 1GC1L 3RZCC 1J10A 3WCYA 2GCYB 1CG9B 3WFBH 1MLCA 3WNKA 3HNSH 2X4NA 2XZQL 3O3EB 4ONHA 2CLRA 2VC2L 4FFYH 2D3VA 4X6BA 1N59A 4LSVL 1FSKB 1S7SA 1QNZL 1MREH 3CAFA 2YUVA 1M71B 1E4JA 3HMXH 3QPXH 3PDDA 4L3EA 1P69B 2YKLL 1KNOA 3BEWB 3IDNA 4I4WA 3V4VH 4XCEA 1MIEL 4P4RA 2DMKA 4TPRL 1CXHA 1JN6B 3BKJH 3VJ6A 1BFVL 1IGCL 2CKBH 3VMPA 4QRQB 3ILQC 3HG1E 5CILH 5KBNC 1VFUA 4PUBH 4F7TB 1S8DB 4HXAL 1IGMH 3H3PL 4JM4L 4ODHL 3RWFA 2G75B 3UAJD 4RSVA 3S37L 5DT1H 1T03H 1NC4D 2A9MH 3X13B 2VH5H 2V5RA 5HGHA 4AH2B 1XIWB 2YD9A 3F7PC 1KTKE 2P5WB 3UPCA 3ZE2F 5D1ZC 4L8DB 4NIKB 1X4XA 2EYTA 4GG6B 4UU9B 1KXTB 5EZJB 5DA0B 1V5JA 2OXHA 1CBVL 3CFCH 5EBWB 1XR9B 3UPAA 2VDPH 1F4WL 4XGZA 2ZUUA 4M6NL 3FB5A 5AUMB 5IEKB 4LCUA 4MNGE 4J4PA 5IJKC 1AQKH 3F62A 5T3ZL 1EGJH 4AIZA 1FQ9C 3QBTB 3T3ME 4FFWC 1FNEA 3G6AB 5C0ND 4DK6A 4P23A 4ZUWA 2WLYA 3H3KA 2IJ0C 1HQRA 3E6FA 3WLWD 3WS3A 1CLZH 3VFVB 3H7BB 3IFOB 4UOW0 4X98A 1I9JH 3FOLB 5IHLB 4BKLA 1KTLB 3DNKA 3B9EA 2WIIB 3OPZH 4YHKL 1W8OA 3E3QC 1BJ1H 1R24A 4KJWD 3L5WB 2GSGA 1NCAL 2ZUTA 3OXSB 1H15A 3TBYA 4YFEA 3NABH 1JNHB 4OZIB 4L3EE 3FFDB 3SE9L 3AREB 4PJAE 4G5ZL 3BD3A 4PJXE 3OF6A 2EH8L 1X5HA 4OCXL 5F7KC 3U4EB 4G43A 4KY1H 4LSQL 1UADC 2AJYH 5EUOA 4L1HA 1KB9K 1OAQH 5EULV 4PJCB 4G43B 4DJMA 1LHZA 3CSYB 2YD3A 1IGFL 2EDWA 4HUVA 3ARGA 4OZFH 2Q76B 4QEGA 2VAAB 3QUZC 2EEBA 3SQOL 4H5SB 1P4LA 4PJIB 3FMGH 5FK9A 4G9FE 1BQHB 3I6GB 5DJXB 2EH7H 2FRGP 1TETL 3BE1L 1FVEB 4ODWB 3AMLA 1N5AB 4P5KA 4PJHF 4UILH 2FATL 4JFFA 2A6JB 5IW6A 3PWJA 3BIKB 4RDQF 4P23B 1EZVX 3QFJE 3QXAB 1EO5A 2VLRA 1FNEB 3IRZA 1YNLL 5EN2B 2HFGL 3T2QA 2Y25A 1NCCL 3BT2H 4QRPA 1IBGL 2NTSP 3QCTL 1TQBC 3DVIA 4I48A 1OD7A 5DRWA 5TH2B 3TV3L 4MJIE 5E4EC 3BKCH 3V5KB 1MI5D 4LOUC 3VA6A 1YMME 5CJQL 1II4E 2DKSA 2F8OA 2GFBA 4U1JA 3ZKMD 3EFFA 3QIBC 1UFUA 1XF4B 3VXUE 2IBGA 5ISZD 3DTXB 2B8OT 1F11A 2ZUQB 1JWMA 4QXUH 3F7QA 4UTAL 1C5BH 4EQ3A 4DEPC 5DRXB 3WFHB 4PJ7B 1MLBB 4Y19B 2PTTA 4XH2B 2XA3A 2OTUB 4HMEA 3U46B 3LN4A 1JPTL 2AEPH 1NPUA 3X13A 3M07A 4NM4L 5SX5H 2ZSVB 4LSRH 4F9PA 1BLNB 5GRUH 5IMKA 4FOMA 3WLBB 3DVNA 4M1DL 5HD8D 4Z0XB 1J8HE 4W4NA 4X7SH 3VFTB 4Y5YC 5DURD 4RWYH 4PY8I 5DFWH 1F3DJ 3LKRB 1BJ8A 2MPAH 1WQVT 3TA3A 2BXZA 5DYOB 5ABDE 3QNXB 1CXEA 3BPLC 4LPCA 4DN3L 2H3NB 1QNZH 2DQDL 2NZ9D 3RVWC 4LLMA 3RUGB 4L9LC 5ISZB 3W0WB 5SWQA 2P8LB 1T83C 4X9GA 4ENEC 1Q8MA 3EYQD 2EEDA 3QUZB 5D6DC 1E4WL 3MV8D 1JRHL 4ZS6C 5I18H 4PRHA 1INQB 2NNAB 5GJSL 2GCYA 3C60D 1YEEL 4M5YH 4PJDF 1ORQB 1NC2D 2O5XL 4NZTL 2Z31C 4GQ9L 4QHNB 4OCMC 3BP5B 4Z7QE 5I6XB 2YK1L 1P2CA 3GJFH 1YZZA 5FKPB 1BD2A 5CMAA 4F57L 3NFNA 5DQDH 3DUHA 3KPPA 4M6AA 5D71L 4OCLC 4G8FA 3HKFA 1D5XB 1NAKL 4HKXA 3BWAB 2ID5A 4QT5A 2XWTA 2YC1B 3E8UH 4JJ5B 5E1AA 1ZLWK 3EJYC 3ULVE 2NY2B 1S7UB 1A9BB 1FFQA 4HZLA 1BQSA 1JGUL 5GGUA 4FQIL 2XZQH 3U4BH 4JY6A 4GG6F 2XRAL 2C4FT 4FFYL 1QOKA 3D9AL 1EEUA 1ZWIA 5JW3H 3FO1A 2R0ZH 1YY8A 4KDTC 5J9PB 1W72H 1VADA 4QRSB 4M61A 3U4AA 4HUMB 1NEUA 2AKRA 3D85A 4Z7UE 1Z9SA 1HHGA 1OVZA 4QHUA 4KJYA 1U8IB 3OXRA 5I9QC 4MA7H 2GTZA 3RIAF 4O2EB 1ED3A 3TZVA 4E9LA 4Z7VA 5FHBH 2V2XA 3MLUL 3MLXL 5ENWB 4POYA 1HOCA 2YPLB 3MACL 4NRYA 5DMKA 4OTXH 4LLQB 2X4TA 2HA1A 5J1TC 5DT1L 4EXKA 1OT1A 3GJEB 4U1IB 1NGPH 2DICA 1ZKAA 1C7TA 5C8JB 4LSDA 2HJFA 3K2MC 3ZKND 4ZOAA 5ALCH 5LAXB 3CPLB 4PJ8C 5DQJA 1I85C 2WWMD 3WKMH 5ADPH 4L8SA 1ZA6A 3A6CH 3TT3L 4F3FA 4P46B 1CXFA 1AKJD 3QI9B 4HPOH 1HH6A 4G42B 4GRWF 1E27B 1R3IL 3CFCL 3PABB 4TSCL 5DJ8B 5INDA 4OD3L 3G6JF 3U48A 1FIEA 4JE4B 4ODSL 2NXYD 4L8SC 1QD0A 3FMGL 3VRLF 4U1GB 4HJJL 1RAMA 3HMWH 2PYEA 2MMXA 3VFOB 2P5EB 4LARL 5T3ZH 2EE3A 1VFAB 2D7TL 2IFGA 2XTLA 4KMTL 4QRRA 1EERB 3BE1H 4MNQA 4HQQH 1GOFA 3ES6B 4LMQI 4NKQB 3ETBF 1D9KB 3MPCA 4RFOL 5GSVB 5IB1B 4UB0L 3UYRL 2CDGB 3OZ9H 1B3JA 3BGMA 5CJ8A 3FB6A 3C6SB 3CVIL 4Z8FH 2HH0H 4GBXD 4GRLD 5HYEA 1KB5L 2X6MA 1NCAH 4HUXB 3EKCA 2DQEH 2O5YL 1FE8L 2JJWA 1FYTB 5E99H 2HJLA 1NC4A 2HKHL 1CICC 3IU3B 1BREA 3MBXH 1KN4H 2G5BB 3JWNC 3FCTB 1G0YR 5C08A 3IF1A 4S1QL 1K4CB 4KKLC 4TNWF 1YEFH 2ZZUT 4P2QE 3CXDL 3QCUH 1T3FA 1K2DB 1PVHA 3FAXA 4DAGL 1CGTA 2ZKHH 2E7HA 3EO1B 1YEDA 1PAMA 2AEPL 2K7QA 5I74C 2OR8A 4IDLA 3QXWA 4XPAH 2VLKA 1KOAA 2OS7A 1Z0MA 3QXDB 1HXYA 2X4QB 1IGFH 3DX8B 4X8JB 3P4MA 4ESKA 4P57A 2DQUH 1TZIB 3O2DL 5ADOH 2Y5TB 35C8L 3I9GH 3MR9B 3MRFA 3TIDB 2NCMA 5FUOL 1A6TB 4LP4A 2EKJA 4OAWA 3DWTA 2WAHA 2VABA 4YAQB 2FJFA 5E6IB 2F5BH 3TBSA 4LCYB 2HG5A 4PJGB 1SJHB 5I1LB 1D5IL 1U3HD 3GK8L 4L3CA 5CKGA 1X5XA 3T2NL 2ENSA 4MNHB 3K4AA 1CF8H 3GMPB 5IWLC 3SGJC 1HDMA 4OT1H 1JZ5A 3QIUD 3F7VA 5CLWA 3ZLQC 1YNLH 3RUGF 2AK4A 4XP6H 4S2SA 5HY9A 3LB6D 1XF5A 2PYEE 4KVNL 5IK3A 1CN4A 3CUPA 1JPST 2R29H 2YEZA 1OGTA 3IKCB 4DKAA 3BMWA 4PRAB 4K7PH 2X09A 3BQUB 2PW1A 5I1EH 5GRVK 4ZG1A 5ID0A 4HK3N 5KJRH 1CU4H 1RY7B 1I8MA 2VQTA 5GJSH 4J1UA 1B0RA 4X99A 1A7QH 4FQXA 4LBEB 3MV01 1UZ6F 1XH3B 4PR5B 4HLJA 5T3ZD 43CAA 4PRPD 1SYVA 3HG1B 4QRUB 2P44B 4D9LL 1IARB 2A1WH 5TFSL 3O45A 4Z77B 5L2JB 1FPTL 4DKDC 2WP3O 3O3DA 5F97E 3MV9E 2AEIT 1MHEA 3KNBB 3PUCA 3P0YH 5GRUL 5DD0L 3ZDZE 4DW2H 2OK0H 1V3JA 4WEMB 4C56A 2OTWA 4X6EA 1P1ZB 3EYVA 4EXPX 1HCVA 2AXGB 2P4AB 3OKDB 5EC1A 5HI3D 4KAQH 1I9IH 4R4FH 2CUHA 1XGRA 2V7NA 2A6KB 1A6WH 1VCAA 3UZEA 5JUEH 4YDVB 5CJOL 4CN4A 5IV2A 4ZYKB 3GRWA 5C0CA 3TVMB 1NBQA 1T2XA 2YD1A 4M93C 1RJLA 1AR1C 4JKPL 2R2CA 2E9JA 3RL1B 1A6AB 5EOTB 1SY6L 1FAIL 4M48H 3V79C 2LVEA 1EEYB 4QY8A 2E5EA 1T66D 4NPYB 5AAWA 4TVPL 3LKNB 5LXGL 1RVFL 2A0LC 4GRMA 2FH6A 4HXBL 3O41B 4KKAC 4LSUH 3DYOA 3T0VA 4OCYL 4DUXA 2J7LA 2JELL 4Y16B 2YK1H 4L5FL 4OM0H 4UIMB 3U6RB 3NPZB 3QR2A 1KSRA 5FYLE 2GUOB 5TQ2H 5D71H 5JOPE 5SWZD 5JLZB 3C60C 5HHOD 4I77H 1E6JL 2NTFA 5FYJH 1NMAL 4ORGA 2JB5H 1FN4B 5D8JL 2DMCA 4TSCH 5F1NB 2OSLA 2IAMD 1SMAA 1NMBH 1CLYH 2Z8SA 2IFFL 5BW7A 5E5UB 3MNZA 4R0LB 3V7AG 3R06B 2FBJL 4DKFH 4OIBA 1CVRA 3H42L 4HWZB 4OB5L 2GITA 1LNUA 2ZOLA 1QBLL 3MYJB 5MEQB 3DMMD 2YPVH 4CN6A 5K9KB 2X4PB 4XB8A 5IB2A 4KXZH 2LU7A 4WW1B 1ZS8B 4MXWH 2FJGB 5EZLB 3RWEB 2MWCA 3T04D 3ARUA 3E6HB 2VIRB 5GS2D 4PRHD 4WV1B 3KHOA 2BNUB 1R5VB 1L7TL 1NSNL 3Q5OA 1NCBL 4M6ML 1JPGA 2E7CA 2HJKA 3CFDA 4K7PY 3WIIH 5DJ6A 2YD6A 2A2QT 2ERJB 4FN0A 3O81A 1ZLVH 3LKQA 4KJQC 4LPUA 2IQAB 4RGNE 4Y4FC 4MSWB 5HI5C 2APFA 3LKSB 3TIEA 4PJBF 4NKIL 4R7DB 3FB8B 4I0PA 1YN6A 4KJPD 1NKRA 2Y7QA 1KT2B 3KLSA 4DAGH 3TO4B 1G6RB 1EJ6A 1ES0B 1QR4A 4RIRA 4PJIE 5TE6H 2P8PB 3MO1A 1IILE 2UVFA 3LH2L 4HULB 4LLUB 1AO7E 3KPSA 4LCCC 4LPTA 5SX4H 2VDKL 1XGUA 2IAMC 3DVGA 2V7HA 5IHZB 1EFQA 5JORB 1I8KB 3FT4B 4LCCA 1LE5A 4EVNB 2VLJD 4TUOA 3BPNC 1CT8A 3MRJB 5HHMB 1TZHA 4JPWL 4QXGL 3NIDE 4J3VA 4MJID 1MCWW 4JM2A 8CGTA 1KFAL 4UB0H 3SGJA 3T0EE 3TN0B 3OZ9L 1HKFA 1UXSA 2VITA 5K59E 3JVGC 3S98A 3ISWA 4OI7A 5EU3B 4I9WD 3CFBA 3OV6A 3C9NA 1KACB 3DIFB 4MYWB 3UBXI 4B53A 1VEMA 1FE8H 3PGFL 3RGHA 5I17A 1SMOA 4Z78B 2F8VA 4EUPH 1OWWA 1OF2B 2DKUA 1T66C 3DRTB 5BJTB 2VDOL 4YHPB 2IALB 5IMOA 5EFIA 5I16A 5L2KB 2FNBA 1NGZA 3R0NA 3VW3H 1BBDL 1MRDH 1LDPL 4JFDE 3GB7A 1D5BB 1T1XB 2AABL 4H88H 4XNMA 4CADB 4Y4FB 1I1YA 3ZE2E 5TDOA 2W1NA 2K7PA 4GKNB 5CP7B 3QG6B 2QL1A 5DD0H 2OK0L 3MODH 5ESQB 5IHUL 3A67L 5GGQL 5C0RH 4U2ZA 4JAMA 5GZNC 3LDBC 3MRKB 1A6WL 4GW1B 2FJHB 1N8ZA 3DOSA 3OAYK 2XV6B 4XC1L 2Y9RT 2FH8A 1AE6L 4LQFH 4FXGB 1N8ZB 2V5YA 5I75B 4YBLB 1FNGA 5AD0A 2E27H 2EYRB 2NY4B 2B1AL 3RNKB 3CLFH 1A6ZB 3D0VB 1WWWX 3QHFL 4KVNH 4M4RA 1NJ9B 4ZXBC 3OHXB 5C7XH 1NDMA 1ZHNA 2OL3L 1U93B 3UTTD 1NGQL 1BQLH 4R97C 4EI6A 5BVPH 3B8SA 3VXMB 3P9LB 2R9HD 1YUHB 2NQCA 3UTSA 1E4XL 3CVHH 3QDGD 1JV5A 3PJSB 3T0XA 2C5DC 1C5DA 1QVOA 1YEGH 2WBJC 1DEEA 5B21A 1F13A 3BGFB 1YNTA 4JY5H 5KVDH 1G7JB 5I17B 1TXKA 3SE4A 5MERA 1U3HC 5EDXA 3O6FA 1FJ1B 2KL6A 2XN9D 4NQDA 1BMGA 3TYFA 2DYPA 1X9QA 4MQSB 4NBXB 5IEHA 3GMOB 3RWIA 1KPUB 5EU6A 4YR6A 5K9JL 5EWIH 1I7ZB 1PLGL 1YEHL 4PJ9A 4HD9A 4DGVL 2XY2A 2PYFA 1T20A 5C86A 5BO1H 4X7CC 5ANMA 1CT8B 5DTFB 4JFFD 4JB9L 3SDAB 3GM8A 5IT2H 5C0EB 3UP1A 1LE5B 2MTPA 3FT2B 2QKIA 4CJ1A 5C0AA 2P5WD 1IC5H 1ZT4A 3CH1A 4PRBA 5D6CB 5SX5K 1MVFA 4G6FD 4HIEB 1BF2A 2LU3A 3WFDH 3L3KB 3PV6B 3SKUD 4TQEL 2ZPKL 4YFLF 2VZOA 2ED9A 4HS8H 2FR4A 2B20A 3KPSB 3SKMA 4ELMF 4Y4KA 5IVXB 5D2NB 1SM3L 2VR9A 2C7UA 3MJ8B 4PJFF 4HIXL 3C6LC 3V6OE 3OAYH 4EIZC 4NQVB 4OCYH 2BOBB 1JTPA 3WKNA 3KJ4C 2QHLA 1YY9D 2Z31B 4BQBA 5E8EB 5IFHH 1P4IH 5F8QC 3GSWA 3SKOB 5KSUA 4KUCF 4N0YH 5IOPA 4L9LA 3DURA 3IJYB 5I19H 3WHE0 3NOIA 4G7VH 3QYCA 1QEWB 4Z7NE 3LKOA 2JJSA 1JPGB 3I3BA 1GGIL 4CW1A 2B2XL 4RFEB 1KYOK 1D5MA 4UIKH 1MWAB 5L9DL 2B7DT 1M05B 2C3VB 5BMFL 2AK1L 3O0RH 4ZODA 4D3CH 1YJDH 2AQ2A 3CK0L 1KIUA 1SBSL 2CKNA 1RZ8B 4KUCD 1AIFB 2FJGA 5EZLA 4U2YA 1A5FL 4RZCB 3LKPA 2ADJB 3NN8A 4NYLB 4OFKA 2I26N 3O3BA 4PGDA 5DUML 4XPHH 5D7LB 4UINL 3RWHA 3LQAL 4NQDE 4S1RL 5D7SL 4BYHA 4D8PA 4N8VG 2EC8A 3ESUF 4K23L 4NWUH 1AHWC 1MFDL 5MEND 1Q9KA 4KC3B 2YPVL 3PHOA 5EBMB 1A1NA 1UQSA 5KSAC 4E0RA 3MNZB 1YNKL 1QSED 4X4XB 1KFAH 5ELIA 2DWEB 5T3XH 2R4SL 5F1NA 4WU5A 4FQ1H 4JQVA 5HPMA 4NO0D 1NLDH 4ZO9A 3FONA 3MV7B 1OQXA 5D7IF 5IG7A 4ZFOA 5JLZA 1B2WH 1I3UA 5C09E 4ZAKD 1IJ9A 4LIQE 1NDGB 4ENED 5FOBB 2AW2A 1WC7A 3GKWH 2DQCH 2J8UB 4F58L 3PL6D 1X6LA 4TUJA 4HKJA 2VSCA 4LEOA 4GKZB 5DZLA 3WUWG 5E4EB 1A21A 5L7XL 3MLWL 3I50L 5IIEB 3FFCE 1U41A 4PS4L 1QRKA 5B39B 5C07A 5CAYB 1A9EA 4MB3A 3ARVA 3TZVC 1VEOA 32C2B 5KVGL 5EU7E 4GW5B 2PW2B 4NPYA 4X6DB 4KRMB 2CDEA 3GSNL 5JDSB 4MLSA 3MGOA 1TVBB 4YXLH 2R2BA 1VACA 5FGSA 4OZ4A 2ICWJ 4HKZB 5HDBF 2ADGB 1YECH 3VFRA 4WEBL 5I1AB 1JGVL 2QR0A 5JNYB 1W2KT 1S7RB 5BV7L 1U91A 5CD3B 1M1SA 2DRUA 1CXKA 3LIZH 4JR9H 4N0UB 1T0NA 3MJ7B 3G5YB 3TVMC 3WNMA 2W9DL 2H45A 4XP4L 5JHDA 1QRND 3PP3K 4G6JH 4I2XB 5EPMA 3U7AA 1HHHB 5DEGA 5ESAB 1I8LC 1I1RA 4ZXBA 1KXQE 1KELL 1I3GH 3K1DA 5J6HA 1YEKL 3O3DB 2P49B 4CVWA 1YEJL 1U6AH 3LRGA 2L7UA 4CJ0A 4HCRL 1RZKL 3CH8A 1EO7A 3EOBB 3SO3B 4TUKH 4BH7A 4YHYC 2H9GB 3BVNA 1E0OB 2DQFB 4QHKJ 1GAFH 5FM5O 2AJZA 3K74B 4FHBD 4XPGL 2WQ8A 1A4JA 2IF7A 2AEWA 2VR5A 3S96A 1K8DA 3KPSD 4WFHD 3TPUA 5F9DC 3C2SA 1AGDB 1NCDL 4KHXL 5EWIL 1F42A 4Q97A 4FG6C 2FO4B 3TWCH 2KDGA 2VXUL 3MSPA 5CP3A 4G6AD 5DVKA 4UUJB 1MAML 1ZA3A 3LAFA 2DJ4A 3VXRD 1BQUA 4X9HA 1U3ZA 3V9FA 5E9DA 4QTIL 2F54A 2VZ1A 4RISH 2YSSA 1Q9KB 1NL0H 2QQKL 3UJJL 1A1MB 1RZFL 3CLFL 4TVSa 4D8PB 12E8L 1AP2B 4NUGH 4RQQA 1PDKA 3O3AA 1BZ9B 1MCKA 3HRZA 1MF2L 4MB4A 4LLWA 4F9LC 3E2HC 1WBZB 1WT5C 4NZUL 2HLAB 4RMWA 4E41D 5JXEC 3VD5A 1RZ8A 4GAYB 3VMNA 2CLZB 1TCRB 3UPRA 3WSQL 1ACYH 2JJUA 3BYTA 4KJQD 2Q3ZA 5C0BA 5L8LB 5BVPL 1KN2H 3ULSA 1DBJL 4UT7L 4PJAB 4YXHL 1UZ8B 4P99A 3F12A 4KU1A 4G6ML 4HUUA 3UBXB 1X5YA 2QV2A 4OLVL 3H9SE 4M9OA 4PJ7E 5C3LD 1C5CH 3RWHB 1GHFH 1UCBL 4J7RA 5FO8A 2CO7B 1TCMA 1FYTA 4WFGD 4D0CB 3K8KA 3STZA 1AIFA 3EOTH 4OIAA 4P4KA 1IAKB 1RJZA 4PJCE 2B2XH 1BBJA 1UENA 5SWZB 1IC4L 5BOZG 1T5XA 2ZOKA 3CK0H 3RRQA 1YEHH 5I76B 1F6FB 5IVXA 2IQ9L 2BOCA 3SKNB 5CJ5A 3JV4B 2H32H 1IC7H 4XBGB 3HC3H 5D7JC 2K3TA 2IBZY 4L9LB 1BIHA 5C2BL 5FYKL 4H0IA 2HTKC 5GS0H 3BSZH 1KIPA 5E8EA 1J88A 3TN0C 2XQBH 1W0YT 2BFVH 4NQVA 3G9AB 4XHJD 5ACLA 3SCMC 3L3DB 1CFQB 1JHKH 1M7IB 5T3XL 3W81A 3W0WE 4HKBB 3WXWH 5IW1B 4JY4A 1HKLL 2NY7L 3FQNB 1GIGL 4Y1AD 1OOAA 1T0PB 4Q58C 3VCLB 4BELD 3E2HB 4FQXD 2ZUVA 4YR6B 4BSVB 3BAEL 3ILPB 3V52L 3WFCH 2WQRA 1QLFB 1K5NB 3WN5C 3PV6A 4HIXH 5IEHB 2WV3A 2HJFB 3WO4B 1JTTA 1F2XK 4JO4H 3CH1B 5D6CA 2VXVL 5C0AB 3T8XB 1K3ZA 4LNRA 3QIUB 4OLUL 4PB0H 4EDWL 2YXFA 1QFWM 2CKBL 1I1CA 2B0SL 2BDNL 5LBSL 1QSEB 2BMKB 1CD1A 1JWUA 5AEAA 3IDMA 3O4OB 1T20B 2VXQH 3D2UA 3X3GH 4HGKC 2X41A 1RK1B 3FO2A 4H0GA 4QWWD 5DJ2B 4N8CH 3QXVA 1I7ZA 5EU6B 5ITBH 1K8IB 5KVGH 1Y0LA 3D85B 5I66B 4NFBA 1FC1A 1IQWL 2J4WL 2ZUSA 2ICWB 3UCRA 4R3SA 1CK0H 1HYRC 2X1WL 5GRYA 5D93B 5C6PB 3BP7A 2FDBP 4AENB 1FRGL 4PLNC 4YDJB 2R8SH 4PGCB 4S1RH 5D7SH 3W5NA 3CZFA 3I75B 5TPWH 1HH9A 2VDLL 3MMEA 3SPVA 2X70A 5D1QD 1BVKB 3LVEA 3DO3A 4LFHG 3WFBL 2YBRB 3U9UB 2O61B 1Z9OA 3UTSE 3DARA 4ZD3L 4ONOA 4EEEA 4I18C 3HR6A 3MV7D 2VC2H 3P9WB 2DLFH 1KGCD 3LRHA 3FQUB 4Y8AA 4BUGA 4PRPE 2DI8A 1I3GL 2ZCKL 4X6DF 1RULH 3D18B 1EEZA 1RUPH 1A64A 1JF1B 1G6RH 5F70A 1OLZA 3QNYA 3N50A 5JXED 5MENB 4PREA 1NBVH 2K1MA 2DQCL 1D9KD 1NGZB 1G7MB 3V7MA 1AR1D 1FCCA 3MUZ1 2BVPB 1BVKA 5HI4C 5BCAA 2E8ZA 5SWSA 4WI2A 2VDNL 4GH7B 3LRSB 4PY8J 4PLJD 4XPGH 3QDGE 5CZXC 3SE9H 2QSCH 1WIOA 1OTSC 4HH9B 1GL4B 5IMMA 1PYWB 3I02A 1WZ1H 1N5YL 3HMXL 3QPXL 2VLKE 4OCXH 4LPXA 2HLFC 2FIKA 1RUML 2JIXA 2ZP0T 3FFCA 1UEMA 1AKJB 3QI9D 4L4TE 1ITCA 4Y7MA 4U0RC 4TNVK 4F7PA 4S10A 1OTTC 1SHMA 5DJ2A 3IFLL 1RZIA 2W65A 1RK1A 2IANE 4YJZL 2VL5B 3O4LA 2OX5A 4N0FB 4G9DA 4HXAH 3MMEB 1X5GA 3H3PH 4ZFOL 1CBVH 2AAVA 2FGWL 1QSEA 2DJUA 1QRNB 2BSTB 3I75A 4NT6A 3T3PF 4PJ7F 4ZSOB 4EVNA 1PGRB 1RIHL 1BAFH 4YXKL 1ZHLA 1E4KA 4OZFG 4GMSL 1FHGA 2A9ML 5M7QA 2FZ3B 4BA8A 3FT4A 1F00I 4HLZG 5DHVB 4XT1C 4CN1A 1I7RA 5F88B 1ZHBA 5IMKB 4DVRL 1MIML 5DFVD 4F7MB 4WY7H 2A73B 4Z0BH 1UWEH 3VCLA 1FNSL 1LO3L 4KKAD 4I3RL 4ZUTB 4OCSL 3KPQB 2VZ3A 5FKAB 3VXPB 4QRPE 3DX9B 3GRWH 1GZPA 3BW9B 1U6AL 4UT7H 1OSPL 4KKBD 1F4WH 1IBGH 4HKBA 4J23A 4G6MH 4MQ7B 5DRNA 3RWGB 3RDTA 5E6IC 1G6RA 1OAXL 3QWRA 4I0PB 4PJBE 3MRDA 4EN3D 4WI4A 3QEUB 4OF0A 2Q87A 4UT9L 3FO0L 3RDTC 4UQ3A 2HWZH 4WI5A 1V05A 5JR1H 2WM0A 3MLYH 3ZYJA 4JZOA 2FX7H 3DUSA 4PV8A 3VGGA 4IRZL 4LSQH 1J1PL 3JWOC 4XMPL 5I74B 3RA7L 5IW1A 2N7AA 2ZOKB 5BXFA 3TWCL 3WFEL 1JPTH 1EO8H 2Y5EA 3BIKA 4UV4L 5E8DH 3HE7A 2YPLD 1BBJB 4OUOA 2XIDA 1RJZB 3NABL 3PIQA 1OGAA 3FB8A 4APQD 3KLAA 4K2UH 5L6YL 4D0CA 3UTZA 4YH6A 3TFKD 3VWKD 3O6KL 3MX0A 1NL0L 1EUTA 3UTTB 3JWDC 4HK0A 2NY6C 2AJYL 2VRAA 1WBXA 2JCCF 3DECA 1OAQL 3RKDD 3VXNB 4J2XA 4P23D 1HKLH 4FABL 4WV1A 4OF5A 1WTGT 4MD5B 3AS2A 3CVHB 5KZCB 1QSFE 1RZKC 1FGVL 4ELME 1WLHA 3QEQA 4XRCA 5ERWB 1KCRH 2XNAA 3T4YB 3DLQR 3Q5YA 1KYOJ 3ULUF 3GSRB 1R3KB 1MJJA 4JO4L 5K9KA 1BEYH 3N85L 5MEPB 1PKQA 3BKCL 1JPFB 1F4XL 2MKWA 4M7ZC 4PJXA 2JJTA 1P4BH 4U6VL 4PJAA 4P2OB 2Y6SD 3AXLB 4DGIL 1VB9A 3C5JA 3RTQA 3G9VA 2E6QA 4QXUL 4ONFH 3MRQA 4NN6B 3IDGA 3O41A 1D3CA 3BKMH 4RBPH 4OLEA 4QOKE 1PSKL 4WWKB 5EOQL 4CMHB 1FNAA 4QOKB 1J1OL 3QG7H 4YO0B 3MBEC 1MEXL 1U42A 3F7YB 4Y5YA 2R0WL 2FIRT 5DSCA 5IB5A 2X9YA 3ZSSA 1TMCB 3H7LA 4RBPK 4EQ2A 3DV4A 3IDIA 1XGYH 3WMSA 3OKMA 1MY7A 1IAIL 2WWKT 2VR4A 2ICEA 2ARJQ 1R5IB 2OLDA 1GH7A 1QACA 1SEBB 1MJ8H 1JHTB 1I7UB 4LSRL 2JCCB 2R2EA 3CFJA 1UCTA 2OTWB 2ZCKH 1MFEL 3IU4L 3UTSD 3V0AC 4C56B 1SEQH 5HHPB 1EFXB 4HUKB 1XZ0B 4Z7WF 5FCSH 1HI6B 1ADQA 1YMMA 2D31B 4KROB 5FV2A 3AC0A 2DQFA 4YBLC 3MJ7A 5I75C 4URTB 2IC2A 4K3EH 2V9TA 4XPTL 4QYOB 1FYTD 4UQ2A 3ZHDA 4EDWH 5L2JA 1CFNB 2XN9B 4ZYKA 3MV8E 3SDXE 4PJ8B 2VLME 3QDHA 5HHVH 1S7RA 5I1IH 4G6KL 1IGTA 2HMIC 3ARSA 2XN9A 1I1FA 3KR3H 1XGRB 5IW3A 43CAB 5I1GL 1CZ8L 4XPFL 5CGTA 3UC0H 3IFNH 5AG8A 3KPNA 3QH3A 4XNQA 2YZ1A 3MLXH 6CGTA 4R6UA 1J9CT 3CXHJ 3T3MF 2EC9T 1AO7A 1U8PB 3AVEA 3U2SA 2R2BB 4JKWA 2WANA 1WCQA 5GJTH 1I8MB 3BQUA 2P47B 2GT9B 4IRJB 1I7UA 3VXMD 2A74A 5JHDB 1KNOB 2HRPH 3QUXD 1T0NB 3F58L 1J8HA 3O45B 2Z92A 3BZ4B 3E8UL 1EJOL 2HFFB 2FGWH 4X0KB 1D6VH 3N1MC 3JUYA 1JGUH 1B0RB 4X99B 3VXRE 4GAGH 4L3CB 4KV5E 2ARWA 4HJJH 1GC1C 1AR2A 1E4KC 4LARH 2FJFB 3CFJB 5HBBA 1NAML 2R2HA 3O8XD 4HBQA 1P7KA 5FDWB 4ZDHA 3IJSB 5HYJA 4NUJB 5KAQF 4P5TC 3MREB 3NPSC 3RU8H 4I3RH 5EO1A 5GXBB 4OCSH 1KG0B 4P57B 3QP3A 1F8TH 1UH4A 3OAZK 4AMKH 2DLTA 3JV0A 3AROA 3QHZH 5LWYH 1NBVL 4FFVC 3ARDC 4WCYH 1WC7B 2LFGA 4B0MM 1AGCB 1QG3A 3QULB 3TGXA 3V5HB 2WZPD 2EDJA 1C08A 2DQEL 3TBSB 4YO0A 4PJXB 3D3VE 4YAQA 1NH6A 4PJ5D 4XCFL 3UJTL 4QXTA 2H2SD 3OB8A 5DJYB 1JYNA 3MRFB 1JUFB 3OX8A 2HJLB 4OI8A 2ADJA 3ZTNL 1TPXB 1QKZH 3IETA 5I1JL 3HA0A 5DK2B 3DX8A 4X8JA 1HILA 1WWBX 2DDQH 5ESVA 4HPYL 3T0DA 1JIBA 3HPLA 3IJHA 1DANT 2YD4A 3WFEH 2I07B 4V1DD 1RZJL 4KH2A 3TCLB 4KMQA 3ZDZF 4XPAL 1UQSB 3QSKB 2I9TA 5ADPL 2ICWI 4YDKH 2LQRA 4MA8L 4AJ0A 5C9JA 4EIGB 4K94H 5EO0B 5JOFB 3ALWA 4NO3B 1X4YA 3LKPB 1BOGB 2VLMD 3Q5TA 4NO0A 1OGAB 3VGEA 5FYLH 1MIMH 2ICES 3C6SA 2DLIA 3ESVF 1MWAA 3HAEG 5HHXL 3WKML 5IF0B 4LLVA 2C1PA 2UYLB 2BK8A 4JZOB 5IB1A 4F3FB 4NBZB 1QFUH 3L6FA 2FR4B 5D7IE 1IGIL 2DN7A 5D7IB 2G60L 2FYYA 5GGRY 3ARDD 4NKDB 5KN5B 1KB5H 3KLAB 2Q86A 3FQRB 3QO1A 1PG7H 4GSDL 1QBAA 2F5AL 4IJ3C 4N5UA 2QKIB 5F7EL 43C9B 4KMTH 3GSOB 1IE5A 4BSWA 2BOBA 3SQBA 2D0HA 1HOCB 1U3YA 1KB9J 2JB6A 3OJVC 5I8OH 4S1QH 1MPAH 3QI9A 3X3FL 5JR1L 4X4MA 3CXDH 3QCUL 4QOKD 1LWRA 4HW6A 3QDMA 3CPLA 4P2YA 3O9WB 1VSCA 3JSSA 3L3KA 1G1YA 2E8YA 3TYFB 1FJ1A 4LSSH 4X9IA 2UWEE 4U1HB 4P2RB 4OCNC 2PXYC 2R0WH 4K2UL 1NUGA 4JZJA 4LCWA 5ADOL 2X4TB 1A14H 1PKOA 5E08H 5IROC 2UZXB 3NFSL 4GUPB 2VUOA 1BOYA 1C5DB 1XGYL 4KQ3L 2EO1A 2MOVA 1FFNB 2QQLH 3UTSB 5D7KE 3THMH 3LEVL 3L95A 3OXRB 4F7MA 4HS6B 4FABH 3T2NH 5HVFB 2XFXB 2ZG3A 3MOQA 2YD5A 4OM1L 4UV7L 4HIIA 2FIKB 4QRSA 1Y6NR 2D0FA 2W59A 3V4PL 5C0FB 5CKAA 2Y6SC 4H8WH 4GBXA 5DRZA 5MI0C 4U7SA 5FUOH 4M1CD 1P7QD 3CZJA 1UJ3C 2R29L 3I3EA 3T77A 2NY5H 4U6TA 4KI5F 3KPPB 1RMFH 3GJFK 5EU6E 4FXGA 3QDJE 2ZG2A 4OCWL 1BWWA 1QTYT 3GIZL 5C08D 1WBYA 4XPFH 4DGIH 1BFTA 3D3VA 4UDTB 5CHNA 4ALAL 1VEPA 3BPOB 1JRHI 5T3ZE 5D96C 2N56A 1Q94B 3VG9B 4HCRA 5DJDB 1UKSA 5KS9E 2A1WL 4QT5B 3TJHD 1HNFA 4TVPE 4C55A 1A6ZA 3DPBA 1Q94A 4APQA 2ADFL 2H26A 2P8LA 5E9DD 2JTDA 1CQKA 4RAVB 3VWKA 5I30H 1T1XA 1FVDB 2Z8RA 2XKSA 5FKPA 5I16B 4APQC 4QHMB 3T2OA 1J18A 4DZ8A 4PLOB 4OLWL 1V7MH 1XF2B 1JF1A 3SGEH 5BZWB 2OJEB 1NCWH 2CXGA 4HDIB 2IADB 3H42H 3QEGL 2X40A 4JDTH 4Z78A 5ESQA 4YUEL 5C0FA 3ULUC 3FQWB 4CMHC 5CZKA 1QQDA 1M7XA 1G9MC 1MAJA 1B0WA 1D5BA 5EU3A 1I3RA 1BLNA 3DX7B 4J3XA 2IG2H 1KV3A 4DGYH 5J7CC 2HVJB 1RVFH 4Y19E 4AEHL 3D2UB 4K3EL 4V2BA 3U46A 3C6LD 5HDOA 4U0QB 1MHPH 3IDXL 1TZHB 4KZDL 5HHVL 3LKRA 3IGAB 4O2FA 1FFOB 3N1FC 4HSQA 3ZTNH 3SBWC 4FQCH 5C07E 4NKIH 1BZ7A 4G3YL 1XF4A 4LASL 4F8QA 2IPKA 1KTRL 4MS8D 5KSAD 1MCNA 1UXSB 2F58L 3HUJE 1MNUL 3P4NB 2C3HA 4I77L 5TE6L 2YXMA 2QADB 1CGXA 1CFQA 3WFHA 5JOPD 4XVUD 5KSAB 2BRRH 3GSOA 5T1DH 4R4NC 1YN6B 4KRLB 3L3IA 1KIPB 4GAGL 5HPOA 3V95A 3LKSA 3TIEB 2UV3A 3ZE1F 4U3XA 2HP4A 2V7HB 1IGJB 2BXYA 4FS0A 4ZQKB 5TQ2L 4BSVA 1HHKA 2J6EA 5DD1L 3LS4H 3C2AL 3KPRD 2ZUXA 2YRZA 1JF6A 1QBLH 3PWPE 3V5KA 1ACZA 4S0SD 3KPMB 4XAWH 1A0QL 1N2RB 2I60H 1Y6KR 3Q1SL 2P8PA 4LAQH 3UYPA 1B4RA 1QFUL 2VLRB 4ZPTB 1C12A 1F8TL 3TO4A 3E6HA 3MV8A 1KT2A 5T1MA 1VFMA 2VZSA 2J8HA 1CLYL 1BM3H 2G60H 4OZHB 2C3XA 5I1CH 2VXTH 1UB5B 3AS0A 3HZYB 4NO3A 1BQHA 1JI1A 4GKSB 2ATKB 4H0HB 1FBIL 5FK9B 4K3GA 4KKBC 5EO0A 3P30L 2XYCA 5K33A 3DXAB 4YHIA 2EIBA 4LCIL 4U1GC 5T5FL 4JDVB 1T1YB 2XOTA 2BNUA 4XCCH 2ENYA 3UX9B 5SWZA 1XF1A 2Q8BH 2DDQL 2OSLB 4DTGH 4NNYA 4PB9L 1IAKA 1CTOA 1BBDH 1MRDL 3QUYD 4P4KB 1CDIA 3STZB 4KTEL 2X1XR 3CJJA 5FO8B 4X98B 1NANH 2ZUYA 3ET9F 2RHEA 3H7BA 4LGSB 1LNUB 5MHSD 4QXTB 1FAKT 1X5KA 4XMLL 2VDKH 4ZUVA 3W9DA 1CTNA 4Z7UB 3RY6C 4NGHL 1H9VA 4JZJC 5C0RL 4P2QA 5F1OB 5IGXL 3DGCR 1UZ6E 3EYFB 1U36A 4U1NA 3GDBA 2C26A 3TBYB 5HDQL 4L8BA 1WISA 4KKLD 3P73B 5BZDB 4H25A 4JO2L 1CLOH 1BZ9A 3HRZB 4LDOB 4U0RB 4NUJA 3V5DB 4GRMB 5CZXD 1UT9A 1CFSA 2VLRE 3EJJX 4ZUWB 3TPUB 5C09B 2EKSA 5E2VH 4GBXC 5SWSD 2NY0B 4Q2ZA 4DWHA 1A6AA 5EOTA 3G6JE 3RIFK 3B9AA 1TNNA 2F5AH 1F3RB 2OL3H 4JVPA 2ED8A 4WJ5B 4MAYA 1W72A 3RWFB 3PDOA 1FYTE 3QA3A 3D0LA 3MOAH 2Z92B 3BZ4A 2NY6D 4I0PD 3EIFA 1MPAL 1FGNH 1U8JB 5EZJA 3OL2A 1AI1L 2AI0H 3OKDA 1TTUA 3V4UH 4LAJH 5JO5A 3EDDA 1J86A 2VE6A 4NQSA 3VW3L 1K8DB 5ESAA 1A6UH 2AJVH 5F93C 3L3OA 4H88L 1DUZB 2DQTL 1F5WA 4X4ME 5I30L 3KPNB 3TVMA 1M71A 1T89C 4RX4D 3EOBA 3HC4H 3NFSH 4YDVA 1MUJB 4LIQH 1HZHH 3ZKNC 1P53A 5DMGD 2E7BA 4X6BB 5KSBB 3WHE1 5J11C 4XZUB 3TJHC 5EC1B 5KANI 1HEZB 2HFEA 1J5OH 3LEVH 4HKZA 5HJ3A 1H3XA 4OGYH 1EFXA 1S9YA 3EJZC 4EN3C 4N68A 2X4SB 1UACH 4NHCL 3SDDD 5JDSA 3BEVA 5HGBB 1LK2A 2BCKA 2B1AH 1QO3B 5HXMA 5CEYB 4OLYH 4LKXB 5AZEH 1FNHA 3QHFH 3VG0H 1NANI 3MV9B 4EN3A 1TZGH 5FUZL 4MX7A 4XVTL 2AK4B 3LS5H 1HIMH 4ZTPH 3SKJL 2QR0B 5BVJA 4MXQD 1FNFA 2UZYB 1XH3A 4PR5A 3WIHA 1FC2D 4LBEA 3R8QA 3OSKA 2G9HB 3MRNB 1A4KA 1AXTH 4Y5YB 1NFIA 3VH8G 2MFNA 2YPKA 4FZEL 3S3JA 1OGTB 4FQCL 1KJMB 2VZVA 3D1MC 3SN6N 1BP3B 4LHQB 2L4OA 2D9CA 1AD0B 2MJWA 1KLGA 3TH2T 1MWAH 3QJFA 4S2SB 4H26A 2NY3B 1U58B 1YYMH 1WSST 3EOAA 5DR5L 5GGVH 4GKZA 1CIUA 1UH2A 2DLGA 5L9DH 5IKCB 2ICCA 4PD4K 1QLRB 3NZ8A 3RGVB 2AK1H 5LG1A 1RHHB 5DWUL 3MJ9A 1DQDL 4P2RE 5FGBA 3BI9X 5KVEL 1V7ML 3IF1B 2FEEI 3FCTA 4ORZC 4POUB 5C6WH 1S3KH 5DD1H 1DANU 4KDTA 2JCCE 1IFHL 3GSRA 3TA3C 3NA9L 1KPVA 4PLKC 2XNAB 3T4YA 4UBDC 1A7OH 2AK4D 5D7JB 5E8OB 3GMMB 2R0LH 3IXTB 4PJEE 4UBDD 4LAQL 1DQQB 4NQEE 2C3VA 3ALPA 4P0DA 3BJ91 3PGCA 2I5YL 1WF5A 2W0PA 3K8MA 4Y4FD 3JXAA 4OFYD 1ZVSA 3C09B 5DHVH 3QCVH 1WZLA 3UTTA 4M1CC 4HFUH 4LVEA 4NC1E 1B90A 1MI5A 2VXSH 3Q48A 1T6WA 4AZ8A 5IOPB 4YHLH 3UYOD 2BVOB 1IM9A 1B2WL 1WVZA 3MNVA 5HYSA 3KYMA 3VFSB 3ARXA 3KYAA 1BPVA 4U1KB 4NO5B 4Z76B 4R90H 1NBYA 3J8F7 2Y4SA 2CJUH 3GKWL 1AY1L 2VQUA 2NX5E 1Z9LA 4LKCA 1M05A 3MV11 3EYOA 3CGTA 1W0WA 3U0PB 5CSZB 3LKOB 5L7XH 3EO0B 3T08A 3TBTB 4AT6B 2FB4L 5DQJB 2R1YA 2VZUA 3IJYA 3LPGA 2BNRA 3SCMA 5BMFH 3QEUA 1VFAA 3EFDH 5D70H 1ZT4B 1S9KC 4DK3A 5EH1A 4P3DA 5FAAA 4QWWC 5HHQB 4FQ2L 1GPOH 3MJ8A 5I19L 4Y2DC 4XPHL 2MQ0A 1NEZB 3PABA 3BUYA 3B2UC 3VXUB 2CQVA 1CE6B 4YZFE 1N3NA 2D2OA 5DD6B 5B4MD 3RIFF 4O2EA 5C09D 1YMMD 3ARRA 5FO9B 4ZOBA 5EC2B 3O0RL 4D3CL 2I25N 5L0QC 1ZGLB 4RA0C 1JHLL 3S37X 3G5VB 1N6VA 4G6JL 3AB0B 4BH8A 5MERB 1QSFA 2BY3A 4U1IA 1A5FH 5I1CL 1DBBH 1S5HA 2AVGA 1CICA 4HC1H 3VFWB 3EYUL 1FG2B 4MLIA 3RPIA 1YEKH 4L4VE 3L5JA 4NWUL 4ZAKC 2EDNA 3PJSA 5FUCC 5JTWA 4WWKD 1FGNL 3C8DA 4WI6A 4O58L 5L8KB 4Y5VC 2I9LA 4PB9H 1S7UA 5SWZE 3O6FB 3KXFA 5IQ7H 4WU7B 4YC2C 5E1AB 4KTEH 1KJVA 1Z3GH 1NJ9A 2K9UA 5GGVY 3O9WC 1INEL 2ZWLT 3WFZA 4GMTL 4Y5VA 4ZNEE 1P7QB 3NBNA 1GGTA 3BWAA 2O5ZL 3BO8B 2QSVA 4NJ9L 1GZQB 4P2OD 5BS0A 4YQXH 4OIIL 3U36B 5IGXH 1ZMYA 4EDXB 5ID1A 3NCBB 4F58H 4NZDA 3B9KD 5MENA 4NC2B 1NCUA 5FCUL 4FNLH 4GW1A 4IJ3B 5SV3A 4JAMB 2GSIB 1CD8A 2NNAA 1EEZB 2FGZA 3UAJC 1INQA 1CLOL 3U7WL 4Y4HA 3D0VA 1CGUA 4K8RD 3QXUA 4MA3B 4JR9L 2ZCHL 5TGBB 1GGUA 1AHWB 1D5XA 2YWYA 3PHQA 4LSTL 1FNGB 5C0CE 3PL6C 3T4AA 2FEDD 4NKMA 2XTJD 4KK8D 4NN5C 2MHAB 4NNXA 3OGCA 5JHLH 3JWDH 3GBMH 5C0BE 2YBRA 5D72L 5LCVH 1WAAE 3VXME 3BH8B 5BJTA 1HH9B 5CUSH 3CZFB 4PRHB 4LLAA 3GUTB 2OCFD 1OF2A 2OYPA 3HLAA 3MJ6A 3VFTA 1NFDF 1Q9OA 4JG1L 3UROR 3V4UL 5TDOB 1IKNA 3QQ3B 2X44D 1MCPL 1EGJL 4JO3L 5HSFA 5I66A 3O3UN 2AS5M 1U95A 3GB7B 1KELH 3RUGE 3HTLX 3MLZL 1T5WA 1CLZL 4YEEA 4YHPA 1I9JL 1D7FA 1XGTA 3CNKA 5C0GA 2ATPB 1R3HB 3MJ9H 3RAJH 5DYOA 3X11A 1DDHB 3TA3B 5C70A 3REWB 3G04B 5KVEH 4LNRB 1N4XH 5KTEH 5DMIL 3T8XA 2CXKA 3EJZD 1YC7A 5ICYA 3DIFA 2M2DA 1IFHH 4UDUA 1PKQE 1MRFL 3DVNB 1CXIA 2EXYC 3BSZL 3QUXB 3TT1L 1ORSB 4G5ZH 3UTOA 5C0JA 4LPYA 5DMGC 4V2CB 4OLYL 4JM2B 2HMID 1T21B 1J12A 4CMMB 3DHMA 1BGXH 4F7EB 2XZZA 4PJDA 5FYKU 1R5WA 2H1PL 4AEIL 3OJDB 4OKVA 5F44A 2A6JA 3HC0A 3RWJA 3V0WH 4UTBH 3RHWK 4IIQC 1I8KA 2J5LC 1HN1A 5IFAH 4OGAD 4JFHE 2XA8L 4XNXH 3C8HA 5KW9L 3S36X 3DVGB 5GRXG 3KLHD 2CJUL 2HTLD 2ZNWA 4RDQG 12E8H 3V7AE 5TDPA 1FO0B 5DHYB 1TENA 4I48B 4OF8A 1T5XB 4PGBB 1F58L 5GISL 3HUJF 3PWJB 1FFPB 1FNLA 3MGTA 4JFXB 5E5RB 3RVXC 3O11B 3WSQH 4N8CL 3P11H 1MY5A 4DN4H 2Q6WA 3QCTH 3I6GA 2X4PA 5E6ZA 4XTRD 4Z7OF 3OKNB 4OLVH 2IQAA 4OZGA 1KCKA 4MNQE 4H5SA 1MCWM 4OD2B 2HT4D 2LVCA 4YWGL 3SEPA 2YOCA 3FHAA 4U1MA 3JV5A 1A7OL 2O26U 4X8XA 4X4YB 3UPRB 1S9VA 5EUKA 2XTJB 4A6YL 1KTLA 1Z5LA 2P46B 4WHYH 4BKLB 2NTFB 4O4YL 4AM0A 1JZ2A 1J1XL 2GTWA 3VRIB 1U92B 3D3VD 3LZFH 2GUOA 3BZDA 5D2NE 4KUZH 4X6FA 3S7GA 1NGYB 4XVJL 4BFEA 4XHQA 3OXSA 4LCUB 1G7HB 3T0AA 1ZHKB 4WO4C 3VGFA 5IP4A 7FABH 3ME0A 2VDNH 2DYPD 4PJGE 4PLJC 5IESL 1INEH 1AC0A 1F4YH 5JMOC 4JRWA 1GCFA 2O5ZH 3EFDL 3NVQA 1LMKA 2XXMB 2LU4A 4FMFA 1RJLB 4WNQB 3I2CH 1CK0L 4NCDA 4OIIH 3DI3B 3OG4B 5C0AD 1VGEL 3QPQD 4IMKC 3ZZ1A 2X10A 3W11C 5TPWL 2VXQL 4M7ZB 5ICYB 2MCPL 4AEEA 5FECA 3KPTA 1VPOH 4ETYA 3R1GH 4UU9A 1UYWL 3VWJB 1ADQH 1K6QL 5ITBL 1XCTB 1EEYA 3G04A 3SE3C 1ETZA 2P5WA 2UZIL 4K3JL 4N1EA 1FZJA 1JCKA 5I15L 1DR9A 1GGBL 2AJSH 1AGFB 5IB3A 4L3EB 1DBBL 4DVRH 4MZ2A 1IM9D 1FRGH 4HC1L 5T5NF 2KQNA 1N6UA 3EYUH 3BDYH 1UWEL 1FNSH 1LO3H 1U91B 3ZKMC 3IB4A 5LKNA 5F9WB <