4PBDA

Crystal structure of the n-terminal cs domain of human shq1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
102
Chain Sequence
AHHHHHHKMLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SHQ1 homolog
publication title Structure and Interactions of the CS Domain of Human H/ACA RNP Assembly Protein Shq1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2014-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pbdA00
2N0KA 3Q9QA 4YDZA 4I88A 3GUFA 5DS2A 2WJ5A 3L1EA 3W1ZA 4YLCA 2Y1YA 2KMWA 2KLRA 3GLAA 1EJFA 3AABA 3L1FA 4JUSA 5LUMA 2RH0A 4JUTA 3Q9PA 2O30A 2Y1ZA 2BOLA 4PBDA 4ZJ9A 2CR0A 3IGFA 4PCKA 4FEIA 3VQLA 3L1GA 4YLBA 5DS1A 4RZKA 3N3EA 1GMEA 3GT6A 4MJHA 4YE0A 1SHSA 2XCMC 1WFIA 3J07A 3QORC 3QORD 3VQMA 4ELDA 1WH0A 1X5MA 3AACA 4M5TA 3EUDA 2K8QA 2Y22A 3QORB 2CG9X 3QORA 4YL9A 2N3JA 1WGVA 2WJ7A 2MNWA 2JKIS 4M5SA 1RL1A
chains in the Genus database with same CATH superfamily
4N2GA 3ELAT 3JVGC 1MPAL 3QO0B 1DFBL 4Z7WE 5INCB 1EAPB 3F6JA 4JO2H 3DXAA 1T20A 5JORA 2AI0H 1NUDA 4I13B 1DBBL 1HL8A 1VPOL 2QQKH 3GBNH 3CSYB 1L3NA 2Z91B 1H3PH 3KPSD 3WDJA 1N3NB 2Y69B 2KT6A 1YNTF 3O2DH 4OLWH 5EBGA 1Z9PA 1HOCA 2Z31B 3P30H 1TLMA 2A6DB 2BS71 2IXQB 3SJVD 4Y4KC 2EILB 2WVVA 2R4SH 1W72H 1DDHB 1YPZB 4EIZC 2IADA 1UFGA 3ARPA 4IBSA 4PTUB 2DQCH 3FF7A 4IDLA 1RZQA 4DQAA 2EDNA 1SJEA 3Q43A 5CGYD 4X99B 4Y7MA 1JJUA 3BLKA 4YVNA 4GAFB 3E8UL 1E9OB 1ICTA 3IMUA 3BZ4B 5A6LA 5KTEH 3SGDH 1XXFC 4IKKA 3QRFM 1FO0L 4GNKB 1R24A 2AVGA 5FHAL 2LTQB 1CGSL 2B9BA 1PIGA 2BNRE 3R1GH 1P5UA 2ZUTA 5L2KA 2ZXAA 3T04D 3EH3B 4LVEA 5JHBA 2GG1A 4LDLB 4ETQA 1L9TA 4ANVA 5IF0A 2YAFA 1NLBH 4PH8A 3QDJA 2AEQH 2JCCB 3RY4A 1HT6A 2YA1A 3WD5H 2OQJB 5J4MA 4JRXD 3MDJA 1HSBA 2XVBA 4LU5L 1UD8A 1J1PH 4HKJA 4QKXB 2BVPA 4C83B 1EXHA 5HJDA 1HNGA 3ARGA 5BXFA 1N59A 3ULVF 3GIVA 3RDJA 1IC7L 2LU7A 4RSYA 4E9WA 2AXFB 5DUML 4LCWE 1ZKAA 2YO3A 3PGDB 3LKOB 4IK7A 3HG1B 1XWVA 2JJSC 4B7LA 1CFBA 4JVUA 2YRZA 5BZDB 4HUWB 3DIFA 4KK9D 4ZFOB 4A6YA 1DSWA 3BP7A 4JFVA 3U30C 3G6JB 4M3JA 4ZFZA 5C09E 4A39A 4BD4A 2W9EL 3EADA 3MJ7A 3SD2A 4JG5A 1U8LA 4OIIH 4ZS6C 3M7OA 1OPGL 4WTZG 1AXIB 1XDTT 1C5CH 4O2FA 4UQIM 1PY4A 3FQTB 1KCSL 1LILA 1M7DB 4QEGA 3KPRD 3FN9A 2VW7A 1IFHH 4JDEA 4YEFA 3ESMA 4DP7X 4ODTH 3SDXA 4IRZA 3TC9A 2XIDA 3Q9PA 3PF2A 4Y5YB 1JK8B 5EIQA 4MB1A 2GFBB 5AVUB 5KVFH 1ET8A 1E9PA 3M1BA 4N24A 3UZEC 1RLWA 2BINA 1IVLA 1J05A 4HGWB 1JXJA 4MNGE 5C0BD 3LY6A 3ETBJ 4DP9X 4M4PA 2DLFH 4BHUA 2XNAB 3B9DA 3PCYA 4ZUSB 4ELDA 3K6DA 3P4NB 5EF2A 4JZJB 3V6ZA 3FNKA 4GRMA 1HKLL 1TZIB 3NCBB 4BINA 4NO3A 4TSBL 2NCEA 4X6CF 3WS3B 4F8OA 2EE9A 3CN2A 3X13A 1AGEA 2LU4A 4AYSA 4O4YH 4NAJA 3KGUA 2IAAC 2EC9T 3N1GC 3H53A 1GR7A 3PABA 2Z8SA 5I15L 3LB6C 3LB6D 4NQXB 1AHKA 4FI6A 2P4AB 3X11A 1KXVA 4OB5L 1IL1A 4F33A 1FNGB 1T21B 2QV2A 4UQAA 2Q8BL 3S5LB 3HE7C 1CFNA 3G7TA 1B9ZA 5FGBA 3QORB 4OUUB 3KLSA 4DKDC 2R2HB 4AQOA 2WC7A 3NH7L 2FIKB 5HBBA 4HEPA 3NACH 5IGXL 1PVHA 2WOYA 4OLUL 2RBLA 4KK8C 2BMKB 3DOIA 4KK8D 4HLJA 1HQ4B 1CIUA 1A9BA 2EYSA 4AENA 1OP3K 5SWSD 5CJQL 5IHUH 3L7FB 4GOSA 4YXLH 2H9GB 4EEEA 4JHUA 3FB6A 2EE3A 3GUTA 4JPWL 1WIOA 4LDEB 5FYJD 3SDAC 3SDAD 4QOKA 3SPVB 5EPMA 4Y1AD 1P7QD 5FB8B 2IAMA 2DIAA 5IK3B 4M1GL 1UVQA 1X7SA 3BW9A 4OFPA 2BS9A 2G2RB 2DQDH 5LG1A 4ZAKA 5I8KL 2M8XA 3OC5A 2FQGA 3MODH 3AGVA 2V2XA 2NSQA 2HFTA 4X5PA 4TM9A 3J27A 5FGCE 3UP6A 1C1EL 1RQ5A 1RULH 2C7UA 3T65A 2B2XH 4ABUA 4XODA 1G4MA 4M93B 4XP9L 1PZ5B 4NRXB 2I9TA 2MCG1 1UD2A 2VLRE 3EJSA 1N8ZA 4OF5A 4YBQC 4YBQD 2R51A 5C3LD 3NTCH 1J0ZA 1TVDA 3MRMA 4QYAA 5JIDA 5L4IA 2CBOA 2WN3A 4QHUB 5IQ9A 1MWAB 4YGAB 1S9YB 3ROOA 3IYLW 4QXGH 3CIAA 3GXTA 4PJEE 1NGXA 5GGRY 1M6OA 3J7HA 4OLVH 3T0BA 4FKHA 4LIQE 1MLBA 3CHOA 2HVKA 1XT5A 4NZDA 4YSAA 3IRCA 2X9YA 4I77H 1MDAA 1MXDA 2YGOA 3DYOA 3LS4L 1VCBC 1UJ3B 1OSZA 3R8BB 2VDOB 4PG2C 4PJDB 3TPKA 5FS5A 3UL4A 2AAAA 4AYBA 2EIKB 5B3SB 3MRBA 4ZTOH 3UAJC 1AHWC 4ICWA 2BC4A 2QGEA 5FKAA 5C0GA 2YQ2A 3G08B 4Y9CA 1RVFL 1OO2A 1UKTA 5G5DB 1RZ7L 2WV3A 3I02A 3T0EE 5DR5L 5GPRA 4Z7VB 1PJWA 2D31B 2YXVA 4GSDH 3WTUA 4LF3A 1ZLVK 1T5WA 4MQXC 4J4PA 4FNPA 4KK5D 1QWUA 3C5JB 4W68A 4MXWH 4A7TA 4QT5B 3L81A 2MIZA 4ODSH 4P2QB 4WENB 4C54A 5IHHA 3UYOD 2XYBA 1B0WA 3NJNA 1Z9NA 5HYJB 4O9HL 4GW5A 1HQRB 1E6JH 2WGNB 1XGQA 4DPAX 1PZCA 4M62L 3EYSL 2HH0L 3VFUA 3JWDH 3EO9H 3ARSA 4BFIB 3LDBC 4HKBA 2BFGA 2VR7A 1IBBA 1MKFA 1XQ4A 5D1QA 5DQ9B 4JQXC 2VOTA 4YHPB 4RFNC 1DEEA 4XNUL 3RJDA 4U2YA 3QUYB 4P9HH 3CC1A 4HCGA 4J8RA 4YHNB 5C0EB 3BKCL 2A5UA 3HPJA 3MMEA 5GRYA 2PR4H 1JGLH 3VSTA 1IAOB 3QHFL 5CEYB 4U4IA 5MP6L 3CDGB 4ZS7H 4HJ1A 2H2SD 4U1NB 1HCYA 1NAMH 5ERWA 2YHGA 4FFZL 1CN4A 2H3XC 1QTPA 2VJ8A 1IO4C 1GJWA 2XC8A 1UUNA 3F3HA 4AQZA 3UPAA 3PDOA 1HEZB 4FKEA 1RJLA 2CK2A 4OJDH 1OCWH 4QAMB 1ZHLA 5DJDB 2C9SA 3AS0A 3RY6A 1F58L 3PJSA 4H5SB 4OFKA 1NCAL 1GKOA 4G8IB 1TEFA 3FU7B 3QUML 4AEIL 2GBUA 2CJUH 3SE6A 4EZLA 5BS0E 1EJOH 1FFQA 1YC7A 1BEYL 1KXTB 2YSSA 4OU3A 3V2AR 3PFUA 4BV1A 2NNFA 4KJWD 4D3CL 1GMIA 1AO7D 2EYTA 1AMXA 2Y36L 4JFHD 5FYKU 3AUVA 2WANA 5EIIB 4ZMOA 5I1GL 3BD5A 4KROD 3NPZB 1JXGA 2P5EA 4LLWB 3V4VH 4WK0B 3DIDA 3SHSA 1NCIA 4R96A 4JQIL 2VITA 1JI2A 1YMHB 5HHPA 2PW2A 2ZSWA 3CHSA 3HC2A 5I28A 4Y2DC 1S7RA 4LPWA 4Y2DD 4PJXE 2HT2C 2HT2D 2J44A 3LPOA 3UTPE 5EZLA 5D5MA 3VRLF 2BH0A 3TFKC 4B9IA 3LMJL 1G7QB 4NM4L 3TFKD 2CRZA 4FQJH 43CAA 4XP5H 4GT7A 2WP3O 2H0FA 2XT1B 3L4YA 4P2OB 4PJBF 1GOFA 3B5GA 2AITA 4N8CL 2YD5A 2VM4A 4S2SA 1UZ6E 1UD4A 2XFXA 3L3KB 4N2BA 1XGRB 5LBVA 2OW7A 3CN0A 3JT2A 4OSUL 4CW1B 5GQBA 4A66A 4N90D 5BRZA 3QT2A 3TV8A 1T89A 3FQYA 4YVUA 4KGJA 2ADJB 4KTEL 1LLAA 4C4KO 3IDIB 4HXBH 3FHAA 4OZHA 1JGIA 3D4ZA 4XVUD 4QWWC 1FVEB 3QCTH 3Q2WA 5CD3A 3GDBA 2C4XA 3NFPB 2EJ1A 3FB8B 4PWGA 1BXXA 5CMAB 4UM9B 1E8YA 3KXFB 4N8PA 5EU7C 4KKPA 4R5VA 2EEFA 1NCTA 4RWHA 2AJSL 2AMUA 3QR0A 1JCVA 2DH2A 3ME0B 4AQEA 1N19A 3RI5K 4ZQKA 1JHTB 5HYSA 2BOBB 3O3EB 1BYNA 1OKEA 2N01B 2PTVA 5I0YA 4WFHE 4ZMPA 4OV5B 4TRPH 5B38A 4FFZA 4AGMA 5CIPB 4YXHH 2HRHA 3UBXA 3T1FA 1U8IA 1FGVL 1EDHA 3ET9F 2WLZA 3QG6A 2DWDB 4Y4FC 4DCQB 2IBZX 2OL3B 3ECVA 2ZG1A 3L4XA 4LVNB 1U8CB 5AW4B 1IIKA 4DVRH 5EU3B 1RZGA 3EBAA 4U7SA 2R1XB 2YXMA 2WSDA 4FXKC 4OF3A 2Z31D 4O2CA 1XBDA 3RWDA 2BFVH 1KEGH 3CU7A 2Q7YA 4N2FA 1II4E 3PWJA 4G8GE 4ERSH 4OD2B 1INDH 3B9KC 3B9KD 1QZ1A 1OVZA 4YR6A 2XG4A 2L0DA 3U7YL 2WXKA 3RPBA 4UB0L 2X70B 4XC3H 2VXSH 2EDHA 4L4VB 43C9B 3WEAA 4UT6H 3B56A 4PJCA 3GLAA 5CHNB 1IBYA 1UOLA 5CZKA 3ULSB 1QR1A 4JQIA 2HKAA 3NIDF 3DX3A 4HXAH 1RJCA 1JUFA 3A5VA 4PG9B 1T0PB 3KLAB 4MMZB 4PJ8C 4PJ8D 3OAYH 4K7PL 2QZ5A 1YMME 2ZCLH 3MROA 3D9AH 4W4OC 4TOYL 1JFQH 1QBML 1I82A 1KBGH 2ZPKL 5I8OH 3RTQB 5I16B 3OKMA 3QQ3A 4OGYL 1OARH 1NBZB 1Z9SA 4RQQA 1OE1A 3NJGA 4NYLB 3TYFA 2RR3A 1X7QB 3OF6D 5C0JA 1EAOA 3DX0A 2DRUA 5DUPL 2FX8L 1QVOA 4LLDB 4ENEC 4ONGL 4HUVA 1L5GA 3RGVB 5GXBB 1C5BH 5A40E 4MJ6A 1MH5A 2WINB 5I9QC 5IMKB 3ULUD 4XMPH 2VL5B 5MERB 1AJ7L 1R4XA 3CBRA 3RZWA 1A4JA 5A2AA 4C56A 2B3IA 4LGRB 3U0PA 1LEGB 4OZGF 3O8XB 3TPUB 4FQ1H 1RZ8B 1VB9A 1FFNB 2ZCKH 4OZFA 4ZOEA 5SX5K 4DZBB 3EXJA 2O4EA 4GKZA 3STBA 3QRLA 3VXOB 2CKBL 1UJTA 2EDMA 1O6SB 3HMWL 3QZLA 1I1FA 1VF5C 3L1FA 4PRAB 2PO6A 2EIDA 2QQLL 3R4RA 5LCVA 2NX5E 1L3WA 1RZKL 3D06A 1E2ZA 3J2PA 3QQ4A 4U3SA 4DHLA 4FERA 4TQ8A 1EFXB 5JW5B 5H37A 3ZE2B 4RDQF 3WJJC 4AKQA 3E38A 3V5DB 3VXTA 1NM4A 3CG8A 1GSMA 4P4KA 4XBPB 3H6AA 3SKMB 2ZD0A 4GMSL 2BHYA 3VFRA 3MCKA 2OR9L 4NZTH 4F9PC 1QI3A 1DBAL 1BWMA 2HAZA 2J5LC 4JL1A 2V9UA 5D70H 5F3FA 4OCWL 4YO0B 3FN0H 1XF3A 4LSUH 4AEEA 4NQCB 1W2KT 3KCPB 3LEVL 4N85A 3T3PB 4XI5C 5IG7A 4QJ5B 3GSNH 3TONA 4UILH 1QSFB 2ZKWA 2ZSVB 3QFJB 2V17H 4WGVB 5ESAB 5BMFH 3OSKA 3CHRA 2DH3A 3D05A 1U8OA 1A7QL 1V54B 4GH7B 1CICC 1XL4A 4F8PA 2DLHA 4JHAL 1KB5L 3AVEA 5DS2A 4QO1B 5D96B 4GAYB 3ESOA 2RIKA 1TJIH 3VXRE 2DY2A 1CD1A 4HJSA 1VEPA 2VDKL 4W9FC 3A6BH 1IGML 3C5ZC 3C5ZD 4DW2L 1ZGLA 5K39B 3QEUB 3N42B 4PY8J 1S5IL 4DFHA 1O5DT 4RGNC 3CFCL 4X5QA 3M8OL 3F6IA 3C5XA 3OAUH 4ZUTB 3CZLA 4PJ9B 4X5WB 5IROC 5IROD 3MBXH 4PB9L 1E3FA 3ARQA 1OB1B 3GSVA 4PRBA 2XV2A 3SKOA 1FYTE 4LSVH 1WA1X 3TO4C 3TO4D 2XKNA 1WE5A 4HS6B 4JKMA 4P46B 2BIIA 4DAGH 3G5WA 3CBKB 4ZMLA 1EXUB 3L5XL 4P2CG 4UNUA 3MLZH 4XPAL 2NY2C 2NY2D 4MNQA 1IT9L 5J3HD 2E9GA 3I3BA 3JV6B 4FP8H 4NJAH 1B3IA 1UCTA 3QYNA 1LE5A 2ILLA 2CIIB 2CR3A 1U4EA 1FN4B 4KMTL 3WIIH 5A2LH 3JV5A 5IBTL 1CDIA 2QGBA 2Y25A 5E8DL 1P7KA 3QDGD 4UTAH 1KJ2B 4XNQB 5AZ2L 3QWRD 5CCKL 2M26A 1ZY9A 4OCRL 4PJIE 2NW3A 1NMBL 2AK4A 3CQPA 3OB0K 4HCIA 3AREA 5TGBB 3HAEB 4EVNB 4RMWA 2J2ZA 2Y1YA 4YHKH 3NJJA 1WTGT 5C0CE 4L8BA 5PAZA 4ZXBC 2HX8A 2DQTH 3EHBC 3EHBD 1A7NL 3TJHC 2PYFA 4Y1TA 3ZDZB 1A5FH 4R9HA 4HK3J 1H5BB 4LL4A 2JB6B 4TNWF 1EMTL 3HMXL 1FVDB 5CGTA 3PG2A 4IMLA 3MGAA 1H9DA 3NA9L 3UTTA 3V7AE 4A1RA 5E6RB 3NVQA 4ODUB 3DETC 3DETD 3UGEA 1N2RB 4HT1H 1ORSB 2C3XA 4M8UA 5JIHA 1WSST 2D7NA 3O3BA 1U8KB 2P8LA 3TEZA 4KI5D 2JKXA 4RSVA 4UQ3A 2EVIA 3FQUA 1KMGA 3IXTB 3LKPB 4D94A 2WB1A 4PV1C 3VSUA 5ACMA 5KVEH 4B50A 1E67A 2ZAIA 1QQDA 5D7EA 1W72B 4R6UA 3SE9H 1JAEA 2DMKA 4HZAA 2X6CA 5CEXA 2VN7A 3KWVA 1DQDH 2O6DA 1CQYA 2BSED 5DHEA 2ZJSH 5CO1A 2RD0A 4JDZB 5AOIA 1MNNA 3QIWA 4K7FB 1PU0A 2YMOA 3L3DB 3QHTC 1KB5A 4WJKB 1FFOA 2NSXA 3NSXA 2EC8A 3ZDYB 1MRCH 4MAUL 1F1AA 2G4EA 1P1ZA 4FGMA 1IVTA 1R19A 1JF1B 5F44A 5FXCH 1RK7A 1PLGH 3GGWA 2B1HH 4F1SA 5DK0B 1QW9A 4HS3B 2EVHA 4R7VA 2A0LD 5AD0A 5E08L 4P2QD 1I31A 3DSNB 4KHXL 3GXUB 1SMOA 2DYSB 3CLFL 2NY5C 2VLKB 5HYJD 1CGXA 4PRHA 4Z7UF 5DHYB 1QSEA 3MJWA 2OULB 5F7WC 3O6FA 3SO5A 1SYSB 2TSBA 2A6IB 4KOCA 3TIEB 4F7TB 3KYOA 4JREC 4XWGH 3C08H 3RBGA 4EUPA 4BH8B 1NBYA 4J2XA 4P4RA 1KNOB 2X41A 5ESVB 2KBGA 4XC1H 4EIUA 4OR1A 3CE1A 4D0BB 4OFYA 1N6UA 3QUYD 3ZW3A 3AT8A 2NLJA 3VCLA 1X5JA 2PCFA 3DTXB 3MLVH 5ICZA 5KSBE 3IDGB 4PJAB 3B5TA 2J20A 3B3IB 1MHCB 3PWPA 3ZY7A 2GTQA 2W80C 4ZPTB 1R3LA 1A6UH 3LN5B 3HOGA 1TETH 5MHSE 5E2VH 4KV5E 4FHBD 4M8RA 1B0GA 5HY9A 4XXWA 2P47B 2UY7A 3PNRB 4D7BA 2GB2A 2LVCA 2DEYX 3DX8A 4UU9B 3EYOB 4WAFA 5ELIA 3HMXA 3E0GA 4I3GA 3GIZH 4U6TA 4WWID 4CGUB 5JHAA 3HNTH 5IEHA 1SN0A 1G9NH 3QUZB 5C9JB 2BNQB 1Z66A 1F4YL 2D3NA 2OYPA 1BPVA 1Y6NR 2I07B 2QVKA 2PXYC 2ATAA 2VE6B 1GPOL 1FNAA 1YJDL 1I1AB 1EBPA 2DQMA 2ZIDA 3LEYH 1N5AA 3KVDD 4MAYA 1CFSA 4J3BA 2CO2A 3MUY1 4NIKB 5F9WB 1XF2A 4QRUB 1QBBA 3GLDA 3OKNB 5FW8A 3MGTA 4GUQA 3ZZLA 1TQWA 3HS0B 2WSPA 4KI1A 4Z8FH 4PLOB 3TNMA 2AEIT 3AG1B 4FJZA 5CSZB 5DEJA 3HR6A 1XBRA 3DXAE 4IIQB 5E6SB 2OYMA 3BWAA 2CU9A 4XO4A 2V7HB 5TQ0H 4JG9A 1HXMA 2ZF8A 3RVXC 3RVXD 1MAMH 4BK8A 2ZT9C 1JGVH 4NPJA 1WAPA 3KPSA 1TTBA 5FHBL 4P2OD 1SZNA 1T4KA 4XN4A 3CX5K 3L3IA 1CD9B 3WS6A 2P8PA 1C16A 4RMTA 3BIAX 1C8QA 4J3OH 4Z7AA 1TZAA 1X9LA 4FQHA 2F53B 1W15A 3FU8A 5EU6D 4NFBA 3OHXB 2ADIA 5E9DB 3MCLL 1TO4A 2YPLB 4JY6A 3ZTEA 5IT2L 1W6WA 2OZNA 4OLEA 4OD1H 3TWCH 5BNXD 4OJFL 2FLMA 4OBSA 3EOAA 4WJ5A 3U82B 1DO6A 1RUKL 4PJEF 2A83B 3KJ4B 1CYXA 2JIXB 4TNFA 4HOWA 5AEAA 2ZUUA 4YNYB 1DVZA 5EH1A 4I1NB 3H7BB 1IGCL 2C7FA 3CFUA 4DGVH 4KZDH 2MPAH 5EC1A 3V95A 1SXZA 5FUOH 1I9JH 4UM9D 4JZNB 3KXFD 2XZCL 3MJ9A 1DO5A 5HDBF 1HIMH 5L2KE 5FUCC 4IU2B 1Z32X 2DI8A 4ORZC 1S7SB 2FECL 5B8CC 2BJML 5KSUA 2DQUL 2DBLH 3PNWB 3QCVH 2FZ3A 4HPOL 5EHFA 3BH9B 3QJTB 4LGPB 1N0LA 1WFIA 2F8OA 3GI9L 4XOCA 3MO1B 4TQEL 3SOBL 1P5VA 2Y3NA 4XCYA 5CJBA 4N2IA 4JRXA 3GMRA 35C8L 3MNVB 4RETB 4X6EA 5FA3A 2BIOA 4BH7B 4CSPA 3BP4B 3BSZL 3OMZA 4I3RL 4MDIA 2B1AL 3QA3B 4MA7H 4KVCL 4QF1A 3ZMRA 2AKRB 1FVCA 2VRKA 4MBRA 2QTEA 5FUZL 5LN4A 4M1DH 1IGTB 3RWIB 3FU9A 2BIMA 1ZHNA 3S8FB 5B39A 3ALWA 2ZP8A 4GFTB 3WFEH 4JPVL 1H0DA 1TF4A 4ZNEA 3BKML 2ROYA 1UB5A 5AB1A 3FMGH 3L4ZA 3PAYA 1I85A 4F7CA 1K3ZA 1FH2A 1F0LA 3F7YA 3VE0A 3QJHA 4NNYA 1D2PA 4MMXB 3U7WL 4QTIH 1VFBA 2O6CA 1OCOB 2V2WA 1KWKA 2Z93B 5DSCA 3EZ8A 2V3EA 3KGTA 4TSCH 5DEGB 4NQEB 4N22A 2E74C 2V2TB 2WN2A 4X98A 3KPRA 1CT8B 1KDIA 1NGPL 2OV0A 2OTWB 3BUDA 2Z0UA 4LAQH 3X14B 5HHQA 4AT6A 1KTRL 4J3UA 5IB1B 4LCCA 4Z95L 3SDXE 5GGSB 2I5YH 4MJID 4NZJA 2VABB 1YLBB 1CDJA 2XIBA 3MRJA 1AQKL 4EI6A 4ZTPH 3ZZ1A 3N04A 4AIZA 3BD3A 4HAKA 1I1YA 5HHVH 4DWHA 1M1SA 1C5DB 2CIKA 2GJZA 3VQ2C 1NDGA 2CLVB 5DVNA 5CN3A 1T66C 1T66D 1GC1L 4IRJC 1DVTA 1ZANL 4PJ7A 1HEHC 2YD3A 3LQAH 1U3JA 2NXYC 3MLXH 3G5YA 1WISA 4UDUA 4WW1A 3TBVB 3L3JA 1BVKA 3PJLA 3A24A 1S7TB 2O5YL 4LCUB 3H3BC 5H94A 1ROWA 4H8WL 5F96H 3O8XD 3D39E 1JD9A 4I7ZC 1QYGH 1PSKH 4IRSB 2A1WL 4AJVA 5HHMB 1Q0XH 4PS8A 1WFUA 5I1IH 1MQKH 2ZOOA 4KO7A 2HFFA 4ELKA 5D7IE 4KX7A 3ZKXB 4RGOL 1A4KA 2UXVA 3FSOA 4GBXB 4AV4A 4F7EA 4PJGB 1HYRC 2IOOA 4IEFA 1YUHB 1HHGB 1K4DA 5E99H 4OBRA 5DMYA 1BD2B 2UWEB 4RNRB 1F4WL 3IDXL 3F05A 3K6NA 3ZZQA 2NY3B 1CVSC 1NGYB 1NAMB 5KYXB 1F18A 1KXQE 1IEBB 1TQBB 4PGCB 1S4IA 2CCLA 4R2GB 5SWSA 2MH4A 2R59A 3BAEL 3BI9X 5BVJB 1KYOK 3BPCB 5HDWA 5C0DA 4N0CC 1YN7A 3QE5A 2EIZB 4N0CD 4K3JH 4QRBA 4PGJA 3K71A 1EHLH 2VXVL 3BSZA 5BZZA 3ALXA 4QOKE 1ZVSB 4ZW7A 1S9XB 3LZQA 4X7TB 4B9CA 4YQXL 4XR8C 4X8CA 1V7MH 1H9VA 1BJ1J 4NQCD 1AYOA 2RB8A 1M2OA 4ZMNA 2F5BL 5EUOA 4HFWA 1NEZA 3MSPA 4JAMA 3SDCC 4KKZA 3MOAH 1A22B 25C8H 3CBJB 1QSFD 3ZR6A 2BRQA 3ZO9A 4PY8I 2VSMB 4MJHA 2K3HA 5J06A 3SODB 2QHRH 1FRGH 5DT1L 3FPYA 5J89A 3V4VB 5L6YH 4WNQA 2CO7B 2XXFA 3UZQA 4RZCB 4C57C 4ZFGL 1KFAH 1TFHA 3K4DA 3AU1B 1G7HA 5DHMC 1FH5H 1J9SA 3A4DA 2WAQA 3U9PL 1G0DA 2FH6A 4K07A 3MLTB 4UI2A 1DFXA 3O11B 1V3KA 3A0OA 3F65A 4AIOA 1VFMA 3QAZC 1OSEA 2KZ1B 1X5AA 3VFWB 1SBBA 1PX8A 1G6RL 1YZZA 3MRCA 3H9SB 4P5TA 1K8IB 1TT6A 2IV9A 2FX9H 3ARFB 4KITB 5JW3L 2JFCA 5EDXA 2CCWA 4X5XB 3TLRA 3WEXA 2WLIB 4P46C 4P46D 3MXWH 5DJZA 4YHYC 3NZSA 4GKSA 4DF9A 2A9CA 1M2VB 1U91A 4DP6X 2A4CA 2IG2L 5KANI 4Q52A 1DTUA 1ADWA 4EBQL 1UXWB 4IBUA 3IDYC 3FRPA 3QS3A 2AABH 5GGTL 3TBSB 4WI9A 5I1EL 4X5RA 1KBVA 5FDWB 4ACPA 4LL1A 2Q5BA 4OAWB 1A64A 5DYOA 3IKKA 2Q3AA 1H6EA 5GSVB 5GGUB 1QD0A 4KKBD 3POCA 4KKBC 4NBYB 2ZOLB 1LO0H 3LHPH 4JPKH 5AW0B 2C9UA 5MI0C 3KL3A 4ADGA 3FONB 3LZRA 1F90L 3IDMB 1F3JA 2I32A 3W0WB 4IBLT 3GK8H 5LWYL 4BE6A 4ZDHA 1ITBB 2VAAB 4JB9L 2NY7H 2H1PL 2YOCA 1RI8A 2GSGB 4NM8L 5JXEA 3C5SB 2VC2L 5GHWL 1T0NB 1CXKA 4Z78B 1IE5A 5HVFB 3U4BL 3CVHH 4P3CH 4YHMH 4M9OA 4AEHL 1S7QB 1CDHA 3P11H 3L2MA 1NGZB 3NFNB 4G1EB 4UNIA 1XR9B 4LKXB 5DGQA 3NP4A 1E2VA 3SPIA 5D1QE 5DJ8A 3UO1H 4PGDB 3ZJAA 2E9BA 3D3VA 5KSVB 3BAKA 3BCFA 2B8OT 2CXGA 4IGBA 4P23B 4CUCA 1IGFH 2ICWB 2CHWA 2FSEA 4JHWL 3T77B 3MUGB 1J86A 4FRWA 3FULA 1JZ7A 1NBVL 3FTSA 1I8KB 1ADQH 1KJMB 3LQZB 2YZ1A 2JF1A 3D09A 3JUZA 5AAMC 1U8PB 3ZTCC 1FGNL 4C4UA 1F1GA 1A6WH 4HIIA 4TL4A 1UFUA 3VWJA 1EEYB 4BKLA 5L0QC 5DCCA 5B38G 5CM1A 1LNUA 1LTXA 4FG0A 4G2AA 4U0RB 3D85A 5D6DA 3GHEH 3N6YA 2AJZB 5DC9B 4L8CB 2FGZA 3SY6A 1Z5LB 1RH8A 3QNFA 4WEMB 3RKPA 2IPTH 2J25A 2C8NA 3NAAH 3DSFH 1AO7A 4JPSA 1G6RA 3FQNA 4W6WB 4GKOA 2VLKD 3RZCB 2J1WA 2OMTB 2Z7ZA 3FSAA 5JDSA 4CU6A 1SF3A 1NLDL 1J9RA 1WAAA 3IMSA 4BSJA 4URKA 5EOCL 3BPOB 4MA8H 4AEFA 4GI9A 2XVGA 3BAXA 1IIIA 1VGKA 1X5MA 4UYPA 5C08A 3SE4C 1J9CT 4WW2A 2VERN 1CG9A 3ULVH 4L5FH 3T6XA 4DK5A 1HH9A 2CUMA 4GP4B 4Q89A 2OXHA 5GGTA 1AC0A 5D5ME 4I18C 3PY9A 2EKSB 4HIHA 4XO8A 5DWUH 5F88B 4K8RH 4L3CB 5AFAA 2GC4C 1DUYA 3OPUA 1G84A 1K4CA 4BFKA 1BQLL 2WUBH 5FIEA 5DEFB 3IRPX 3PAUA 3L9YA 4MHHI 3IGLA 1GYAA 1UWEH 3DBXB 5CLXA 1YRKA 3WDHA 3ULUL 1JMZA 1RHHB 3B5HA 2FO4B 4GQPH 5BRZE 5CFHA 5I18H 3VGFA 1JPTH 1BXUA 4D9LL 1D5IH 5EFIA 1DLHB 3BLBA 3HI6L 1SDDB 3TBYA 3HZKA 5I5IA 3EGDB 3MLSH 4QI3A 1J8HA 3DV6A 3A21A 4LHUB 3WNKA 5DDHA 4OZHE 2APBA 3AW5A 4WI6A 2X40A 3M17B 2R69A 3QUZD 2DWTA 4GUCA 4DN3H 1KULA 1IAKA 1TMQA 4PRIA 4ZFOL 4UTBH 1NANH 3QUXB 2AV1B 3MA7B 4U05A 7PAZA 5MEQB 1RURH 2EECA 4W93A 2G75B 4E42A 4OZFG 5I0ZA 1AXSB 4BM7A 3MV8B 4TLTA 2RCSL 3RKDC 2XRAL 5EOTA 2AERT 1MJ8L 3ALPA 3GSNB 1EVTC 4M7JH 5DURB 1CK0L 1SQMA 1D5MA 3NCJL 5INCA 1IAIL 4NN6B 1BF8A 1EAPA 3B7RL 4F7PB 5H37G 4NPYB 2F54D 4F58H 3BAIA 5TDPB 2APSA 4H1LB 1HXKA 3UJIH 1UOVA 2ZONA 4L8SC 3CSYA 1B4JH 4JPQA 4LP4A 1DQJB 2Z91A 3WXWL 4NJ9H 3CVIH 5EBLB 5CZVH 1FPTH 4HJ0C 1N3NA 1MG2C 3V6OA 1CLZL 2FWLB 1LJMA 1V7NL 2W07B 3HS9A 2Z31A 4ZD3L 2A6DA 2IXQA 4JFSA 2CPCA 2O26U 3N2JA 1ND0B 4G7VH 3BUBA 1DDHA 1YPZA 4BFNA 5GS0C 2F53D 3NPSC 3OB8A 3AFLA 4DKFH 2J3SA 3GMMA 5DC4B 3QQNA 4PTUA 1U3ZA 3JWNH 3WIHH 3IMVA 2D7TH 4FZEH 4X99A 4TUUA 2BO0A 2JIXD 1E9OA 4DKEH 3T8MA 3H56A 3DO7B 2ZWSA 1WFJA 1GYUA 4W9CC 3RE0A 1YN6B 3ECUA 5HYFA 3G6AB 4CL7A 2LU3A 5CNHA 1R1CA 4JRWA 4X9GA 1L7IL 2I60H 2PP9A 4YHLL 1IBDA 4G71B 4TVPD 4W70A 3U1QA 2NY6C 5J13C 2Y7SA 4PRPD 4KKAC 4KKAD 2H41A 2J43A 3GXPA 5AVZB 4FQXB 2RH0A 2PN5A 3OF6A 4Y16D 2JCCA 4Y16C 4PBDA 5EZIH 3CN1A 3TA3C 2YFOA 2V9QA 2OQJA 2IOIA 3BEVB 2IWGA 3HUJB 3LZPA 1TYRA 2NY0B 4JFFE 4KKQA 5FCSH 1T03L 1M42A 3LPPA 1DCEA 1BQRA 4C83A 1E8XA 5IMOA 1BBDL 1GGUA 4ONOA 2PUQT 1R0AH 2AQPA 2AXFA 5E00B 3PGDA 3LKOA 3HG1A 4OT1H 2VR3A 4QRTB 5EIVA 5C0AB 5BZDA 4HUWA 4PEEA 2QVTA 4ZFOA 3WUWG 1VHPA 4DGYL 1FIGH 2DQFB 3F83A 3ZYOA 3TH4T 5HDQL 2X42A 5J56B 3G6JA 5I74C 3EFDL 3KJ6L 1MW3A 4HAGA 1AI1L 1CTNA 3I75B 3VD2A 4NFCA 4FE9A 3GHPA 1EZUA 3N40F 5TE6L 2OR7A 3OPZL 4NQED 3FQRB 2ZCHL 4HF5L 2J1ZA 3FQTA 2WXOA 1M7DA 1JHKH 1ZLUH 5IOKA 1INEH 4RRPA 4KZCA 3QDHA 1BM3L 3LEXB 4UINL 3V4LA 1AOZA 4Y5YA 2GUYA 2A7BA 2GFBA 5KYWB 5DD6A 3CJJA 3NCYS 1G9MH 4KV5F 3HBZA 4HGWA 2HG5A 3T8XB 1K2DB 2AZAA 2XNAA 4FD0A 3LZOA 2V0AA 2P24B 4ZUSA 4PI2A 5ENWB 5FO9B 3P4NA 3AB0C 4JZJA 3FCSB 1GZQA 2A9DA 2Y5QA 3BT2L 1TZIA 1Y18B 2VDOL 1DCLA 3WS3A 1GY2A 1O9WA 4LSDA 4V1DD 5AW1B 5KOMC 3HIZA 1O9VA 4YDIH 2YEQA 4XVSL 5D72L 4GG6A 1A3RL 3AUWB 3DX1A 1AXTL 4HZ1A 2HYMA 5HHMD 4NQXA 3EOBB 2VDRB 4M48L 4WCYL 4ZUVB 4HLZH 1I9IH 4XPTH 5GGRB 1FNGA 1EHNA 1OSPL 1T21A 3UZVB 5KSAB 3V0WL 2ZOTA 3S5LA 1E40A 4OF7A 5DJXB 5FLUA 4GBXD 3QORA 4OUUA 1HZKA 5IB5B 2R2HA 2NYYC 5I1CL 1R3HB 4CVZB 2R4RL 3ZL4H 5F1KC 3C09B 1PS3A 1BD2D 1X7TA 4GXUN 5IVNA 3JUYA 2BMKA 4R90L 1MN4A 4CN6A 1HQ4A 1LO4L 3DK2A 5DUBA 2NY3D 1Z3RA 4H2AA 5CJ5A 1TQBC 4Z7QF 4XH2B 4D0DB 2IBZY 1W91A 4N28A 3H54A 3PE9A 4PCTA 2O72A 3L7FA 3DECA 2H9GA 4PD4J 3QO1B 2VM3A 4MNQE 4RFEB 4ZOCA 2COQA 2K3TA 4MCNA 3LPGA 2P5WB 4G80B 3SPVA 3ZDXB 1LK3L 5FB8A 4EUPG 4RH4A 5IK3A 1A9EA 1VFAA 4R7NB 1RMFL 5T3ZH 1YC8A 4ESKA 1S7WB 2G2RA 1LDPH 2XWTB 3TZVB 2R2BA 4WO4C 1J5IA 5CS7A 3APFA 3B6SB 4I2XB 2AK4E 2IEPA 4GB9A 5I66B 3KS0J 4XCCH 4XMLH 2X38A 1NAKH 1KGUA 5D2LF 1P4UA 4KRNA 1I7UB 4XOEA 1V55B 2R15A 2B59B 2VWEE 3F5WB 2IDFA 1PZ5A 3KYNB 1KLGB 4G7YH 1IBZA 1OM3L 3CFTA 3UTTE 1M4KA 4Y4HC 4JQVC 4Y4HD 4HEMA 5DQDH 3ASWA 2LR4A 2IBBA 4QHUA 1FNEB 3CHPA 3RVTC 3RVTD 3OD3A 1SEBB 2FWSA 3WLBB 1DE4B 3IVKB 4HKXB 4HC1H 3H9SD 3SD5A 4PJXB 3ARFD 5J11B 3LD8C 1WD8A 2CR6A 5I17B 4QTHB 1I3GL 1JRHI 2C4FU 2ZNWA 3WHXA 2WO3B 3KLHD 2PCYA 3JYBA 2A9NL 1I8MB 3O6MH 3SYAA 4RVBA 1OW0C 1U4FA 2H0PA 1RPKA 2MTPA 1CC3A 1UJ3A 1MF2H 2NNXA 4JHBA 4PJDA 3L7EB 2DD8L 1BQKA 2YBGA 1YA5A 4DEWA 4JJOA 5J9PB 2FEEL 5G5DA 1MCKA 3G08A 3VWKB 4UWQB 1H3XA 3C2SA 3IRZA 4Z7VA 2D31A 5C3IA 3WOVA 3VFSB 2Q3ZA 4F2EA 1YNKL 3JZ7A 3O3DA 3SZ6A 3TTSA 4D9QE 5LNDA 3C5JA 4LLAA 4ZODA 4M6ML 4QT5A 4P2QA 2FJHB 3BP5B 3IDUA 1BX2B 3B2VH 3AITA 3VD1A 5D1XB 2ZX7A 3L1OH 3VNYA 3S8GB 3OQRA 5HYJA 1UA7A 5DFWH 2C1PA 4Y2OA 1HQRA 4Q0XL 4PRHE 4A7VA 4CVUA 3DTDA 4JN2B 3T0AA 4AMWA 4A2GA 2L04A 2Y1VA 4O02H 2GUOA 4KK6C 4AGOA 1A4AA 4WKZA 4D8PB 5T1LD 1WFOA 1LE9B 2MSPA 5EZOH 4BFIA 3RVWC 4IM8A 4OQTL 1FQ9C 5CLTA 5DQ9A 3NIGE 2B14A 3I9GL 4OCYH 4YHPA 2IPUK 3QRGL 1F02I 2DQ6A 1K3IA 5FO8B 3QUYA 3TTYA 3UGXA 3WY2A 3BWUC 4YHNA 5C0EA 2FT8A 3Q1EA 4J3WA 3HBPA 3KVQA 4FHJA 1R3IH 4UV4H 1S2EA 1IAOA 1UWXH 2PP8A 4M7ZB 5CEYA 4A7UA 5IY5B 1AFVH 3CDGA 4ZT1A 4EN2A 4L9DA 1RZJH 1GS8A 4U1NA 5D7SL 1XIWC 1T5KA 3IS1X 2IDCA 4PP2A 3PWPE 1MCSA 2X9ZA 1UM6H 4KU1A 1ZTXH 4EDWL 1FUNA 1NFDF 3S4SB 4AH2A 5GJSL 2P49B 3F58L 3LZFH 2AXJA 1HEZA 3V10A 1N5YL 4HIJA 5DJDA 3ZQ9A 4DK3A 2OL3L 4H5SA 2N7AA 4G8IA 4AYEC 4FL4C 2XTJC 2KZKA 1XO8A 2NZ9D 1KXTA 3NABH 1XEUA 5B1KA 3Q8EA 2XWEA 3QPQC 4JL2A 1BVOA 1QFWH 2PW1B 3NRQA 5EIIA 1GVIA 1F00I 1MCPL 5B39G 3RZCD 2Z9TA 1NWOA 1CDBA 4LLWA 5ISZB 3ECQA 4HBQA 5CJOL 1J5OH 3IXAB 3SCMA 3LKQB 3NZUA 4POZD 1YMHA 3ZE1B 4GAGH 1W6LA 4GO9A 2BHFA 4AQ1B 3BKYL 4K5LA 3V0JA 5C8JA 1PNDA 1MW2A 4KQ4H 1RV6X 2HTLC 2BW4A 2A77L 2AW2A 3MPCA 4GINA 2WLYA 3IU3B 3C2AH 3IBEA 1KY7A 3Q3GB 2WK2A 4P2OA 5I1KH 3KPSE 3V52H 4K7PX 1RK1B 2X4RB 4JN1H 1BF5A 2ZTBA 1CU4L 4HD9A 2QADB 3L3KA 5CSGA 2Y06L 5LBSL 1FHNA 3SJVE 4JM0A 3IKCB 4CW1A 4N20A 2P46B 4KNUA 2XG5B 1OAKL 1NIDA 4JY4B 4G9DB 4G6FB 5GISL 4KKRA 5DVOA 3II2A 1UGNA 1AQ8A 3UXFA 3IDIA 2HVBA 4X42A 5HGBB 3DROB 1Y6MR 1EHAA 2X4OB 3GSRB 5IHBA 1RK0A 4LHUD 1ONQB 2YQBA 2AJ3B 2OI9C 1BVNP 1FVEA 4TQPA 1HHHB 2X4QB 3NFPA 4J12A 3FB8A 3N1PC 4OQTA 4UM9A 5CMAA 1O7DE 3KXFA 2J8UE 3QUXC 3QUXD 5F9OH 3DHPA 4XPGL 2VQ4A 3ZE0E 5DMKB 3BUTA 4Z3TA 4KKCC 2HKHH 4KKCD 1TJGL 5IFAH 3S37X 3MV8D 4ZO7A 1G4RA 2DYPB 1E5CA 1K8DB 4EZJA 1KDJA 3ME0A 4IBVA 4AE1A 1DYZA 3BZFA 1JHTA 3HLAB 2BOBA 2XVLA 3NCMA 1KTBA 5LNEA 2WKOA 4TS6A 5DURD 3M45A 3NCCB 1ZV9A 2DQHH 4OV5A 2HKFL 3EDFA 3SZKC 1K5NB 5CIPA 4JRXE 2QSCL 4HIQA 1QI5A 4MZIA 3Q1SH 1L0QA 1AGDB 4PRDB 3S96B 5IESL 1HHKB 1JK9B 5AW6B 3Q2VA 1UA6L 2F1AA 1JNNH 4CVXB 1CE1H 2DWDA 3W11C 4DCQA 2E7LA 1U0QA 2J1KA 2Y1ZA 2OL3A 3GPEA 1T2QH 1BLNB 1Z6JT 1U8CA 5A1AA 5EU3A 3TIDB 2R1XA 3DVIA 1L9MA 3G6DH 3ZN6A 2UYLA 1BG1A 4MNHB 3W5MA 4ZNEE 5I1HH 1CFQB 4YDKL 1BMWA 4OLYH 1A1NB 3I6SA 4W9ZA 2X70A 3VRJB 1MNUL 2IDUA 4L4VA 1NEZG 2VH5H 4RMUA 4XP6H 3AAZB 5D2NB 4B9PA 3VD0A 5CHNA 3CAFA 2OJZL 4LB8A 2LLGA 1UWGL 2K1MA 4TSAH 1ORQB 3DMMB 4FNLL 4MD0B 4PG9A 5L88L 4ISVB 3KLAA 4MMZA 5AZEH 1QRNB 3VTAA 4BKTC 1SQ2N 4K9EH 1BFOB 2KL6A 3KPRE 3GEFA 5I24A 1WFTA 2BIPA 2ZX8A 1XMWA 4HH9B 2QLYA 5J6HB 4F57H 1EO7A 3RTQA 5I16A 3CZGA 4KXZI 2ZWNA 3EO1A 3HHRB 3KL0A 1NBZA 4RISH 4NYLA 2DJUA 2GVYA 3LJ3A 5CP3A 3W37A 1X7QA 4XVJL 3Q05A 3F7QA 1LO2L 1V10A 1W8NA 2WCGA 5LBSA 4LLDA 2A74C 2NY0C 2NY0D 1HWGB 3CN4A 5TE7L 3RGVA 3RNQB 3HNSL 4WUUB 3UBHA 1VCAA 2WINA 3PUCA 4O51B 4OCMC 5IMKA 4NQUA 4PJ7E 5TPWH 2EE0A 4KJQD 1WZ1L 2JI3A 2VL5A 1KYDA 5MERA 4LDCA 4KZEL 4J6RH 4F9LC 4JFQA 1TZGL 3QISA 3I6KB 4GS7B 3OJ2C 3WELA 1LEGA 3CVHB 3O8XA 3TPUA 1CMOA 3WKNA 3RDTB 2ITDB 3B9VA 4DZBA 2VRAA 3T2NL 2DN7A 1KJ2L 4YDJB 5IQOA 4OQ1A 1PZDA 3CTTA 4KXDA 4JFDB 1YNTB 3FRPG 4TUOB 4FQ2L 1O6SA 4LPVA 4YH6A 4PRAA 1T80A 3VXQB 2UY6A 3BC9A 2W8CA 2V8MA 3GSQB 1XH3B 5JW5A 1AD9A 1L9QA 3GBDA 1EFXA 1DQML 4OM1L 3W9EA 4AE0A 3V5DA 4YSOA 4LFHD 3N9GH 4IOSD 3K2IA 4XBPA 4JO2L 1NKOA 4Y2NA 2H2PC 3OAWA 2AI0L 5SWSE 1LD9B 3OQ3B 2QQKL 3GBNL 3F12B 4B0MM 4POYA 1H3PL 3GLZA 4QRAA 4LEXH 1AGFB 3OJDB 4BFJA 2I24N 4IS6B 4YO0A 3O2DL 3VGGA 4OLWL 2DL9A 1U33A 3P30L 3FK3A 4NQCA 3KCPA 2VDMB 2J57A 2MMXA 2R4SL 1W72L 3Q5TA 3IM1A 5EUOE 3CGTA 4DNLA 3RUGE 3V8OA 4OZHF 1SY6H 5GJTH 3VFTB 3S3BB 2ZSVA 2DQCL 3QFJA 3QYCA 4M56A 4N0UA 5D9SB 5LGHH 4H8VA 1DBJH 1MFVA 2PKDA 5I6NA 5C6TH 3BLPX 2OYKA 5J1SC 3DGCR 1DL7H 4QO1A 4GAYA 5KTEL 4ZW6A 4AGPA 2F5AH 4NKOB 4X7FC 5F3BB 3AGWA 1IC4H 1JVLA 3IFNH 5FYKH 3R1GL 2X2JA 1L9NA 5KSAD 3BUYB 1E9QB 2AXGB 5K39A 3QEUA 4Z7OF 4H8QA 5KWYC 5DWPA 3G9AB 1F42A 3WKYA 4EI5C 5C0NC 3TV3H 1NLBL 4PJFB 5B3NA 1U42A 2CHNA 4ZUTA 4U3HA 4NBZB 1PKOA 4PJ9A 4G43B 4X5WA 2W9LA 1ZLWH 2AEQL 2OZ4H 4UV7H 3WD5L 3GF8A 4HS6A 1ACCA 1BFSA 4E9RA 4L1HA 5EEZA 3JWOC 1EXUA 3L2LA 5JOPD 3UX9B 4I9WD 1J1PL 2VXQH 3PYCA 4PW9A 5IKCB 2IMMA 3BPLC 4XMXA 1DJHA 3ARDB 1P9MA 2ZUQB 4RA3A 1KLFB 4W9DC 1NINA 3JV6A 4AK1A 2Z35B 2FNBA 2P5WD 3NOIA 4OKVB 1RZFH 1FN4A 2FNWA 3GJFH 3VGDA 2QQQA 3NJLA 1UD3A 2LQRA 2D7MA 1KJ2A 5DS8B 4PWKA 4DN4H 5LXGH 4XNQA 3UABA 1G1KA 4PJCF 3VGEA 3ESUF 1F56A 2XWJB 3E8VA 5DRWB 1JPEA 4WKXA 5TGBA 2VR8A 3HAEA 4EVNA 4PLNC 1Q90A 4KNSA 2BIHA 3NJIA 3GRGA 1CL7I 2A6JB 3ARBC 1CI5A 4E41B 5J1TC 2O6EA 4WF7A 1NCHA 2P42B 4UDTB 5F7EH 3RVVD 1JV5B 4OIIL 1H5BA 1T6BX 2JB6A 1PNCA 3D48R 4M5YH 1FVDA 1C5CL 3UDWC 5IOPB 4U1HB 1IFHL 4MFHA 6FABH 4ODUA 2NNRA 4MJ5B 1CB4A 1C7SA 4ODTL 2AJXH 3VXNB 1N2RA 1YYLH 4LASH 1UYWH 1ORSA 4H44C 1U8KA 3BAJA 5KVFL 2EQDA 4R84A 5SV4A 5KVDH 5IJVB 2BRRH 4R4NC 1JZGA 2DLFL 3IXTA 1O0VA 3LKPA 3KPMB 1A6AB 3D3VE 3O2DA 4FG4A 5AYTA 4F3FB 4G7RB 1ZLSH 5IWLC 4J3OC 4J3OD 5LDSA 3GWJA 1W72A 2FBOJ 2OS7A 1MLCB 3DO4A 3WBDA 5F1IB 4F5CA 3OKKB 4DP1X 2NTFA 4EZMA 5KUMA 1C8PA 1RERA 3D07A 3GC3A 1NPJA 3VXSD 3M1CA 3PDDA 2GSIB 4JDZA 4O4YL 4K7FA 5BV7H 5FGRA 5EDSA 3L3DA 2ZNXA 5C3TA 2WYZA 3PV6B 4NWTH 4K71C 4I85A 1JF1A 2R1YB 4NOFA 1EX0A 1W0VB 3WEBA 5DK0A 2WLMA 1DN0B 2KDYA 5AAWC 5CJ8A 4HGKC 4ZO6A 3DSNA 4B7IA 3NACL 5A16B 2PWHA 3GSOB 5D1XD 4B0MB 1AO7E 4QRPD 1BZ8A 2VCOA 2VLKA 4XXCA 5DHYA 1XB6A 2VZUA 2G0LA 2NZIA 1SYSA 2A6IA 3TIEA 1WAAE 4F7TA 3BQUB 5IHUL 4YXLL 3GBEA 3F62A 3WXVH 5C08E 5DRXB 4BH8A 4HWZB 3GI8H 1KNOA 3DJRA 4UIKH 3V5HB 1R9FA 5ESVA 1EK3A 3SKNB 4D0BA 4YDLC 1C7TA 1X5IA 2DQDL 4EOWH 4PI0A 3WKMH 3DTXA 2ATKA 2WXMA 3ABGA 4V2BA 4U3CA 2R2EB 1WWAX 3IDGA 1KGWA 4G6KH 4PJAA 3VD5A 3MODL 3B3IA 4XO3A 5C6WH 4JKWA 4ZPTA 4UM8B 3BGFB 3LN5A 4OF8A 2NY4C 1M3IA 4LMQE 4G83A 1DZBA 1NC4B 1MW1A 1JPSH 1RULL 3FTVA 4TNGA 5F9AC 4B9ZA 3KPOB 5FFOA 2B2XL 1FORH 3K5RA 4UU9A 5K1JA 4D8OA 4BDVB 1OT2A 1AZBA 1FL3B 3ZT5A 4G8EB 9CGTA 2X4UB 2JE8A 1J8HE 2IGFH 3QUZA 4N3UA 3T0VA 4QRRD 1IU1A 3NTCL 2G9HB 2BNQA 4P3WA 5C9JA 4LOEA 3CU1A 4PIBA 3K2MC 4H40A 2I07A 1HHJB 4QXGL 2VE6A 1I1AA 4KH2A 1A47A 5DF0A 3C60B 4OLVL 5JZ7C 1X4YA 5JZ7D 1U8MB 4IW4C 3DDGA 4QRUA 4DGUA 3FH7A 5ISZD 3OKNA 3VX0A 4I77L 4HW6A 4F7KA 1CTOA 3HS0A 4K5PA 2C34A 4L37B 2VIRB 3QUKB 4KVPA 4ZTOL 5DD3H 3BDXA 5CSZA 3FFCB 2IWKA 4IIQA 1LO3H 2EXYC 2EXYD 5DZ9A 2V7HA 3TH2T 1XGYH 4GSDL 3ML9A 3RX5A 4LSQH 5D71H 1GGBH 4RRPG 3V6OE 2XQBH 1MAJA 1G94A 5IUSA 1FDLH 4MXWL 2ENYA 2QADD 4H88H 5FLVA 4ODSL 4Y9FA 4UQ2B 5AALA 4H25B 2O5XH 2E8ZA 2F53A 2H8PB 1YPZE 5I6XC 3OHXA 4ZJ9A 3FSVA 2W95A 1E6JL 5E9DA 2YPLA 1EDYA 4FXGC 4G6FD 4N6RB 5D7IB 4HJTA 2IO5A 4OLZH 1OB0A 4FA6A 1PZAA 1XH0A 2K8MA 2XN0A 1ZXQA 4K3DH 2CHZA 3ZMEA 3JWDL 2EO7A 3JTTA 3EO9L 3L17A 5GS1C 1EANA 5DD0H 3SB3A 2A83A 2JIXA 4JM4H 4U7MA 4WU5B 4G7QB 4A67A 2G5RA 4YNYA 1MZZA 1QFWM 3H7BA 5BQ7B 1PZBA 5JO5A 4MKMA 5B21A 3TN0B 4JZNA 2XN9B 1E4KC 4P9HL 2PTUA 4IU2A 2CWRA 2E6PA 5JYMA 1CGVA 5IMLB 2PR4L 1JGLL 1S7SA 3OAYK 4LEBA 2H3NA 4UIMB 4ZS7L 3PNWA 1IAMA 3S5LG 5I6LA 1L9SA 1NAML 4RBPK 2JCCE 2C3HA 5CSBA 3MO1A 4LLUB 1M1XB 1PPIA 1BZ7B 5AVYB 1RSFA 3BRFA 3U6XS 4EN3B 3MNVA 2MNWA 3RI5F 3ULUE 4HFUH 1OCWL 3QXWA 4BH7A 3BP4A 3QA3A 4KNQA 2AKRA 5J8OA 1DVQA 2ATPB 1IGTA 3S98A 2CJUL 3ZTJG 1EJOL 2MPVA 3UG3A 4IBWA 4PJBB 3HG1E 3MBEB 1KCVH 1UT1A 3AM8C 1EHXA 3FFOA 5CJXC 4U1GB 2YC1B 1NCOA 4LHQB 3H9ZA 3V4VL 1J0HA 3NIGF 2G9KA 4N9OB 1KPVB 4MMXA 2Z93A 3EOTH 4KRPC 4QXWA 2KMWA 1AACA 4W4NA 5DEGA 3DMMD 3RNKB 3P0GB 4EN3D 4EN3C 4NQEA 2V2TA 1WHPA 1QRND 1CT8A 2OTWA 4AWJC 3X14A 4FQJL 3ORJA 5JNYB 4XP5L 3SSGA 5IB1A 4N8VG 3QZPA 1GTFA 5GGSA 4BK5A 2ESVB 4GG8B 2VABA 4LXFA 3WNPA 3CLEH 1Q72H 4GKNB 2OMXB 4PSRA 4PRNA 3OWEA 1C5DA 1TVBB 2CLVA 2AQQA 4ZSOB 3MV7A 3ZUNC 3LSOA 2D0FA 3R06B 2B5IB 4ES9A 1OE3A 1I7RB 4WUUD 2OMZB 3RY5A 3NMEA 2PTTB 5IJKC 1VGEH 3TBVA 4HXBL 4E9TA 3ZHLA 1S7TA 4O02B 4LCUA 2WYTA 1B88A 3PHQB 3MFFB 3QCTL 4IRSA 4AUJA 1MREH 3UTOA 3GXIA 5EBMB 3ROLB 2F2HA 3O45B 3NJMA 5SWZB 1WBXB 4JFDD 3HB3B 4N87A 1VKXB 4BXVA 5HHOB 1SBSH 1MHHB 4FNUA 4TN9A 1JXFA 4GBXA 4PJGA 5JTWA 1BIIB 4Q6IC 1QO3B 3LXUX 4DPRA 3BN9C 1HHGA 3BN9D 5L4MA 4Z1PA 1A8JH 3P9MB 1BD2A 3RRQA 2UWEA 3PP3H 4RNRA 4QRSB 4QTFA 4CN4A 1ET7A 2DQJH 5BZWB 3QIUC 3PQYB 3WU1A 1NGYA 3KPNB 1NAMA 5KYXA 4DQOH 4TRPL 1IEBA 4PGCA 1B6UA 4YXHL 5BVJA 3NIDB 3BPCA 1U3YA 2EIZA 1B6DA 2KI6A 1DDTA 2WKGA 1JPST 4GKLA 5K1VA 5BW7A 4QHKJ 1ZVSA 4DVRL 1CZ8H 1S9XA 4RAUB 4R4BB 2YMTA 1KYUA 1NZRA 1E4XH 4JX0A 3V4UH 2XWDA 1ZLEA 2BFVL 1KEGL 1V27A 4Y5VB 4ERSL 3PL6B 1INDL 4OIFA 1CO1A 4E5XA 4L4TB 5FYJH 4UOJA 3P2TA 1TTUA 4XC3L 2VXSL 4UT6L 3QJRB 2H7WA 2YFNA 1NEUA 1HCZA 3NCYP 4K5MA 3T0XA 3V4VA 2CO7A 3B2UD 3B2UC 4G59C 3ZE0F 4RZCA 4TF4A 4HXAL 3ULVD 4HCRH 2GIYA 3AU1A 2OX5B 5FF6B 1F5WA 2ZCLL 2F0CA 3D9AL 1JFQL 1KBGL 1QNZH 2IC2A 5I8OL 3MLTA 1MHEB 3O11A 2BWIA 4HEME 3D5OF 3VFWA 1O6TA 4R5XA 1OARL 4KI5E 4D0CB 1NKRA 4MDJA 3ARFA 2CD0A 3J07A 3CZNA 2OTPA 1X4ZA 2QPEB 4X5XA 4Y88A 2KC0A 2WLIA 5HTSA 4BIKA 3B2DC 3U0WH 1C5BL 2VLMD 3OZKA 1M2VA 2PPDA 4X4KA 1QPPA 4XMPL 4R0LB 5EIIG 5I6OA 5SWQB 2YGVA 4L3AA 1GOHA 5DJAB 3ARDD 5JQ6H 5K69A 1A14H 3OR6B 1UXWA 2D4FA 4PJDE 3TBSA 3PXJA 2QFRA 5JW4N 4FQ1L 4LPCA 2QVFB 1QX1A 3PGCB 4KUCF 2AQ3A 2ZCKL 5FDWA 1KTKE 1MY5A 4MA3B 4B53A 4OAWA 4M8QA 4QNPE 1V5JA 1XX9C 5LQBH 4Z7VE 4XB7A 5FM5O 4ENZA 4A2FA 2YD2A 5GSVA 5GGUA 3RWGB 1H3VA 4YBHA 3DHMA 1B4RA 4WSKA 3FONA 5JPNB 2XBDA 3IDMA 2ZKHH 3W0WA 4XBGB 4P2QE 1EVUA 3MRLB 4AZ8B 4E41D 2VAAA 4YLCA 4XMUA 1D6VH 5J12B 5HYJE 1TJMA 4AQ8C 4D2NA 2EDXA 4LBEB 4U1LB 5FEBA 5D93B 1CD8A 2GSGA 1OP9A 3C5SA 1UUSA 3MU3A 4NZTL 4Z78A 4TPRH 2EDEA 2EUZA 2DMHA 5IVXF 3MR9B 3Q44A 1P4IH 3EDKA 4P49A 4PWHA 1OHZA 3MUHL 1S7QA 5J1AB 3BX7C 3E7JA 3NFNA 4GAJH 1UM5H 4G1EA 2YD4A 2XZQH 4PVMA 5D70L 4K15A 5FV2A 1XR9A 4LKXA 3WJLA 1EJ6A 3ZT6A 4PGDA 3FN0L 3AWEA 2CMRH 4LSUL 4N2AA 1QHOA 5GGQH 3RWJB 3UCQA 5KSVA 4P23A 3QZWB 2ICWA 3JV4B 2XKUA 3GSNL 4UILL 32C2B 3T77A 3INOA 3MUGA 5T5FA 1WP6A 1T5XA 2V17L 3G04B 1X5KA 5BMFL 1I8KA 4JM2B 1KJMA 3LQZA 4E9LA 4UT6A 2BHZA 3VXMB 2G60H 1U8PA 2VLJB 5T3XH 4GLRI 3B37A 1ZHKB 3O6KH 2CGRH 3TBWB 1EEYA 2QV4A 1TJIL 2VO5A 4HCFA 4RAVA 3FT2B 4LE8A 1EA9C 5JPMB 3A6BL 4NRYB 2EDLA 2WHVA 3MRQB 1Q0EA 2YSTA 4NCC2 4WEUD 2AJZA 5EWIH 4JFPB 1MJJB 4LVHC 5FWRA 1Z5LA 3FAWA 4APQC 4APQD 5I75C 4QR7A 3OAUL 4BELD 1PCSA 2NOYA 3MBXL 4YDNA 3TT1H 1CD0A 5KVGH 5IB2B 2NQ3A 3D12B 4GW4B 4ZUUB 3D69B 4LSVL 3RZCA 2OMTA 1JYNA 1BVZA 4DAGL 2Q2LA 3HA0A 1CWVA 4I87A 2HRPH 4XO5A 3BQUC 2NMSA 3BQUD 3MLZL 1JZ4A 3AACA 1QR4A 4GQRA 4NKMB 5KYNA 3NRPA 3CZJA 1ZT4B 1AS7A 4PW3A 4FP8L 4NJAL 5GSRA 3OAZK 5D6CB 3JSSA 2GBAA 5HHXH 1Z0MA 4JRYB 1MY7A 3WIIL 4F37K 3MLWH 3VSQA 2D73A 3LCYA 2EKSA 4UTAL 1YEKH 4KDTA 5F88A 4L3CA 1X5FA 5IFHH 2Q6WB 3ZK0A 3M7FB 2V33A 1KJVB 4Z3IA 5IR1B 5DI8A 5DEFA 2GBTA 4JJ5B 1EZVX 4S10A 1ZV5A 4YHKL 2JK5B 1KBBA 4NP4H 1KYFA 3BGFC 5AZUA 2DQTL 1CLVA 1RHHA 1G6VK 2FO4A 1FWXA 1AKPA 2ORBH 2XICA 1NC4D 5C2BH 1A5FL 3SE3C 3QUHA 1E2WA 1SDDA 3WE6B 1XCTB 3S35X 3EGDA 1WT5C 2MQGA 3WEMA 3CH8A 3M17A 2YRLA 4HT1L 1RUAH 4QYOA 4E9SA 3L6FA 1R6VA 1JPFB 3ZHKA 5BOZG 2OSWA 1XGUB 1XCQA 1GY1A 1MJUH 3A6OA 3FC8A 1RUPH 4G9FB 2AV1A 3MA7A 3KXFE 5MEQA 2G75A 1AXSA 4Y7OC 2NUTB 3C60D 3C60C 4LDOB 4TL5A 4Z3EA 5ILTH 5KVEL 3MV8A 2H6PB 3BSHA 3OJMB 2CG9X 2EVGA 2X1WL 1PG7W 3SE9L 4LBAA 4WWKB 4Z7UB 5BO1H 5F7FA 3GSNA 4ZO8A 3X1FA 1DQDL 3GSXB 1NFAA 3IE4A 2ZJSL 4ODVH 1IFRA 3MREB 4F7PA 3CWGA 4NPYA 4XHJC 4XHJD 5C92A 1GGIH 5TDPA 1MRCL 2FYYB 2X4NB 1DQJA 5EBLA 1PLGL 1NMCC 2Y2YA 2B1HL 1BVLB 1HILA 3SGEH 2W07A 4LT7A 4Y89A 5E0FA 3GXNA 4BHUI 1OF2B 1G7MB 1ND0A 3V55A 3UYPB 3TYGH 4IKJA 3KE0A 2XLLA 4I5BB 3KEDA 2AQSA 3FQXB 3UTZB 1SOSA 4L4VE 3MRKB 4XWGL 3L5HA 5EA0H 1GGYA 3C08L 1I8LC 1AIZA 3RFZC 1EV2E 2EDBA 3BWUF 1NCDH 2B08A 2AMGA 3HN5A 4ODHH 3DO7A 3ZRCC 4XC1L 3I9AA 1YN6A 2B1OA 2CNYA 2IPUG 2PNDA 3TN0D 4S0SD 3TN0C 1AR2A 4AX3A 3G6AA 3GJFB 3LNEA 4GRLB 2BZ7A 3LOWA 3RX9A 4UTAA 5GZNC 1HESA 5GZND 4F92B 3MLVL 2JMRA 1UT9A 4K9JA 4FQXA 1ASPA 4LCIH 4R5TA 1NBQA 4PJHF 1RZPA 1A6UL 3BEVA 1BHGA 1TETL 2HLAB 4X80H 5E2VL 5D7JB 4IQHA 3ZMNA 2D2CC 4WV1B 3L08A 2GABA 4FQIH 3GIZL 4YBLC 5AOLA 4ZYKA 3HNTL 3S2AA 1G9NL 1CFVH 3HR5B 1TJHH 5E00A 5K9QI 3BWZA 4QRTA 5C0AA 3SPHA 4ZW3A 3MBED 1L9PA 1WAAF 4OJYA 4AVIA 2YPKB 4MS8C 3LEYL 2DQFA 1NIEA 2LV4A 3WNNA 4WW2F 3FCTB 4HOMA 3KPQB 5IW6B 5B7FA 3TASA 4KMLB 2NTSP 3ZE2E 3HAEG 3I75A 4HQQH 4KXBA 3P9WB 4IOSA 4Z8FL 2CDGB 2ICEC 3FQRA 1FZJB 2FHBA 2EADA 3DX6B 1K72A 5BV7B 1Y1UA 5TQ0L 4DKTA 1WS8A 2WBJC 1QRKA 3N0PB 4X9FA 1MAML 4P9MH 1WEJH 1JGVL 1ETZB 3LEXA 1CIDA 1USZA 3QIBC 3M07A 3QIBD 5ANMB 4ABWA 3OGOE 3WN5C 5HDBB 4JGMA 5KYWA 5C2UB 3RVUC 3RVUD 1T4WA 1PL3A 3T8XA 1K2DA 3EH5B 3L4VA 2L7JA 2EDDA 4NQCE 2P24A 5C9KA 5I1LB 5ENWA 2X1PA 1PTZA 5FO9A 2DICA 1QBLH 3FCSA 4XHQA 3T3PE 3ZOAA 2IANB 3IPBA 4IRZH 3N3EA 3WFBH 5FR3A 1TVHB 1ZSDB 1QSFE 3QEQD 3QFJE 1Y18A 1A25A 5C6PB 1JDDA 4OD1L 3D4GA 3TWCL 2EINB 2DWEB 3KYKH 2DM3A 4YMPA 2ERJB 4PJ6A 4CC0A 5BCAA 1BEXA 4RX4D 3DC0A 3BUIA 2OCCB 2QEJA 4R3SB 3KW7A 4JO5A 4PQXA 4KZDL 4DGVL 4J3TA 2MPAL 3EOBA 3Q2LA 2HP4A 4ZUVA 5FUOL 1I9JL 3JTSB 5SWZD 5GGRA 3HB3C 3HB3D 3I6GB 3UZVA 5HHOD 5KSAA 1HIML 2WLKA 4F91B 2EXWC 5DJXA 4A7SA 4CC4A 5AB0A 1J1XH 2CK0H 5IB5A 1BM7A 1NCJA 1YEIH 4YSQA 4NAQA 2DBLL 1JCKA 3QCVL 4QHKI 2CO3A 5KBMA 3IJYB 2D03H 3CDFA 1TYJA 2PYEB 3SKUD 2GHWB 4N25A 4ALAC 3V9CA 4XH2A 4D0DA 2E3VA 1NKGA 5FM4A 4I3SH 3MNMA 3QDAA 2R0KH 1BA9A 3ISYA 5GIRA 1ZAGA 3DRQB 4MA7L 1OGTB 4PWIA 2QFPA 4RGMB 4NN7B 4WK4B 3U2IA 4AMXA 4F24A 2P5WA 4G80A 1A6TB 4M1DL 5F1OB 3L4WA 4YL9A 1KYAA 3V7MA 1M71B 5TK4A 5KBNC 4GT0A 4ONFH 1ED3B 4R7NA 2Z7YA 3WFEL 4Y5VC 1JWMB 1S7WA 2XWTA 3T09A 3U4EA 3TZVA 3UEQA 5JR1H 3FMGL 4L4TD 1M56B 3B6SA 1I8UA 4WRLA 3VD4A 2YD7A 4X9BA 1P2CB 4AUYA 5B1JC 4HUUB 5E6IB 4LGSB 3IJSB 4QTIL 1IKNA 4LOUC 4LOUD 4TSCL 1R34A 3ZDZE 1I7UA 2W1NA 3ECWA 5DHVH 5LAXB 2XV6B 4NQQA 2B59A 3F5WA 4FTVB 3BD4A 3KYNA 4LAQL 1KLGA 4XVTH 4KFZC 2YAMA 3S3JA 3TL5A 5GZOD 3HKZA 2OCJA 2JCCF 4NO0D 2I5YL 5CEZD 4BUGA 1FNEA 1PBYA 4OGAC 4OGAD 1ITCA 1DJGA 1SEBA 5I8EB 3WLBA 4ZTPL 1ZGLP 3TBCA 5HHVL 3NSJA 4PJXA 3PHSA 4NRZB 1OAQH 2CZNA 5I17A 4QTHA 1AZVA 3IMTA 4GFXA 1I8MA 1T83A 3WAJA 3WMSA 3LQAL 1MWAH 4F5CE 3MLXL 1X5LA 1KELH 3K81A 3QK0A 5F6IC 1QA9B 2QPDB 3BMVA 3L7EA 1RHFA 1R47A 4FLSA 2WZAA 5AYUL 5F96L 5E2WH 2WXLA 2NT1A 4Y4KB 5J9PA 1QYGL 1PSKL 4FDWA 4PHZA 3VWKA 4ODXB 5CBEB 1Q0XL 4L9LB 5FA4A 1ZE3C 3ZDYE 2VDQH 1MQKL 4PR5B 5G2NA 5I1IL 1NBCA 1IBFA 3G6JF 3QG7H 3VFSA 4EZKA 1U93B 3N41F 4MGXA 3K4ZA 1NH6A 1KTLB 3UJTH 1ETB1 2FJHA 3BP5A 4HSCX 2Q9OA 1FLRH 1BX2A 5E99L 1JHLH 5LNGA 5D1XA 3RL1A 2CO1A 2J73A 5IHWA 2VLKE 1HOEA 3MUUA 4JN2A 5D93C 5EF1A 2JJTA 2ZXQA 1NDMB 2QKSA 1GIGH 1KTDA 2R23B 4D8PA 2Y0SA 3BIKB 3L54A 4K3JL 1LE9A 1Z9OA 1EHLL 2BOLA 2NY5H 4Z9KB 3L5WB 4BRJA 4R7LA 2K6ZA 3BVXA 3VI3B 4Y19B 3KPLB 1V7ML 2BOCB 2UZIH 5FO8A 1UOKA 1PW3A 3L9BA 3KPPB 1U58B 3U25A 3GYRA 3BDYH 4G11A 2A38A 3SIKA 5JIQA 1E6OH 3MOAL 25C8L 2ADFH 2FH8A 3IETB 4NN5C 2H0EA 4GG6F 3OM3B 3BUQA 4XCEB 3P2BA 4NO2B 1Z5YD 1T3FB 4PJAE 2E7DA 2QHRL 4NHCH 1FRGL 3ETTA 2JTYA 5HYQB 5L6YL 4HS8H 3VXMD 3S4SA 2VSDA 1JWSB 1OAXH 3UBXI 1KFAL 1FH5L 1G1YA 4B95C 5JPMC 3SYOA 3TNNB 3IPEA 3U30B 4WJG3 1NCWH 5I73C 3PWLB 2N3JA 2BNQE 3A67H 3P54A 4Y0GA 3N06B 3WENA 4Z7NF 3EBHA 1I3VA 1OGPA 2H45A 5KVFE 4EKJA 2PW1A 2FX9L 3MKKA 1I3RB 2F9BT 3A6CH 4JUSA 5F97E 3MXWL 2IQAB 2YEZB 5ISZA 2IVFC 2NY1C 4PLJC 4PLJD 3VO0A 2HX9A 1Q4NX 4Z0XB 1RD6A 3IXAA 3AS2A 3LKQA 3P3UA 2YQ3A 3PWUB 4I0KA 4JBSA 5C0BB 2I25N 3TH3T 2AABL 4AQ1A 4CVWA 2WNWA 1BQSA 5K9JH 4HUMB 4JRYD 4XAWH 3RWEA 4LLYB 3RYMA 2GJPA 3AXIA 3C8HA 3GRBA 1A0QH 3IU3A 4LPTA 3ERXA 1Q0YH 3Q3GA 4JKNA 1JSYA 3H7LA 4LL9A 1RK1A 1LO0L 3LHPL 4JPKL 1EFQA 3OXSB 1OWWA 2MOGA 3IKCA 1VFOA 1RUMH 3GM0A 3GK8L 3TESA 4HX1B 1HE7A 1UHVA 2WCPA 2XG5A 2E8YA 3HCVB 4KO5A 4NZRH 5C71A 4IK6A 2F53E 4JY4A 1DHKA 4UT9H 1ECZA 3WIFB 5ETUB 2NY7L 5E9DE 1OAYH 2YPLE 2HZHA 2E47A 4HHAB 3QZBA 2P44B 3HE7B 2BZDA 2IDSA 5HGBA 3CVHL 4P3CL 5LBGA 4YHML 2X4OA 3GSRA 4AV5A 3HE6B 3O4LB 5KJ4A 3ZKND 2AJ3A 1OT4A 1E5YA 2E9JA 3DVFA 3E3QE 3NSDA 3P11L 4U2ZA 3WN6A 2X4QA 5EUKB 1X3DA 3OL2A 3UO1L 1FG2B 2VDPH 5IQNA 5DMKA 4G9FD 2KYIA 3V0AC 4BQ8A 3NK4A 4LQ1A 3GS7A 1IGFL 2DYPA 2FWOB 4J27A 2HFEB 3MGOB 4WWKD 1RIVH 4MWFB 3HLAA 3SDAB 2EDKA 2AQNA 2H1LM 2LE9A 3NUKA 4Y8AA 3S48A 4Y1AB 5EO0B 2E0PA 4IKIA 1ADQL 1F4XH 4OI9A 2W9DH 1T7XA 2N59A 3JBG7 3NESA 2Y07H 3O0RH 1A6ZB 4OCLC 1A6WL 1K5NA 2ZYRA 3SQOH 3S96A 1AGDA 1HHKA 3WFDH 1JK9A 2N7SA 4CVXA 5IIEB 3P0YH 3BH8A 4NO5B 3PRZA 1T1YB 2ID5A 1M57B 3GHEL 4L1SA 3TEYA 1BLNA 5FYKD 2TAAA 3IJEB 4RESB 4D7PA 3LXBA 2ITFA 2Z7UA 3TIDA 1GTNA 3BGAA 4HHWA 2IPTL 3O41B 1UT2A 2DOCA 2YD0A 3BOVA 3HRZC 3DSFL 3NAAL 2HUHA 4MNHA 4KJYB 3WSQH 1CFQA 3IAGC 4UAOC 1UURA 1NGWB 3DJTA 1A1NA 1G9HA 1KACB 1FV1B 2YKLH 3VRJA 4B9JA 1R3KB 2DQGH 2DWXA 1QAWA 5SX4H 3TBBA 4AVJA 4MA8L 3AAZA 4UMSA 5D2NA 1N6VA 4E5XG 4PWFA 4LK4A 2PWDA 5LHDA 1IBHA 3STLB 1A9VA 1DVFC 5DMIH 5DFAA 3ULVL 1ORQA 3C6LC 4L5FL 3DMMA 3ZGHA 1Q9LB 3FTUA 4MD0A 2FHCA 4ISVA 5BPPA 4NQEE 3L13A 3ZYIA 2RALA 1OP3H 4JO3H 2ITCB 1QRNA 3JV0A 5TQ2H 2E7MA 1BFOA 3CIQA 2DBJA 1U3HC 1U3HD 3LRGA 4Q14A 4HH9A 2H0JA 5J6HA 5DWUL 3W9DB 4K8RL 4GRLD 4LLVA 1RP8A 1ILUA 2WUBL 4G8FB 3QJVB 5BUPA 2VJ0A 1UWEL 1MCQA 1AHWB 1XGTB 4CSZA 2WYIA 2Y72A 1F4AA 2BNUB 5I18L 3RNQA 4HIXH 1OTTC 1OTTD 4HYTB 1JPTL 1WWCA 3N5AA 4O51A 4WUUA 4LRIC 1KTJA 2ODIA 1D5IL 5IJKA 2EZ0C 2EZ0D 3FO9B 2DS4A 4ZUWB 3MLSL 4DOHB 5ACZB 5DD1H 3HC0B 3GKZA 4LZKA 1WBYB 4DN3L 3RDTA 2ITDA 1CGYA 5BRQA 4PGZA 1WIPA 4YHZH 2OK0H 3HZYB 4YDJA 5IM7B 1RL1A 5HHME 4TUOA 1VEOA 4FS0A 4JFDA 1YNTA 3FT3B 4UTBL 3S5YA 1EEUA 3RGBA 4YXKH 1RURL 3SDDC 3SDDD 3VXQA 4N9GB 4PJGE 3GSQA 1JIBA 3LDBB 1BD2E 2K9UA 3NA4A 2UWEE 1IKFH 2J71A 1IGIH 4M7JL 5DTFB 5HGDB 4L0ZA 4ABQA 3UEZA 4RFNB 4J5VA 1F3DH 3MKGA 3QI9C 1ADQA 2B9AA 3N1FC 2XSKA 4F58L 1XB3A 4UOZA 1LD9A 5LCVH 1RCYA 1QEWB 2J88H 3F12A 4H0HB 3UJIL 4EKXA 3TCLB 4NLAA 4AXWB 1B4JL 2A99A 2P80D 3WTSA 4NJ9L 3CVIL 4YFDB 4G6JH 5CZVL 1FPTL 3PWVB 4GQ9H 1AGFA 3OJDA 2O1AA 4IS6A 1IC5H 1GCFA 2FQFA 5IMMB 3S3SA 5EU5A 3HI5H 2W92A 1S9WB 3MRGB 4G7VL 4WFFD 5AKSA 1ZLVH 5A2FA 1T1XB 3T0EC 3VQMA 4DKFL 1HH6A 3VFTA 3CX5J 2HWZH 2KKQA 5D9SA 4Z3HA 2F74B 4JFXB 3KD4A 3UTSB 3WIHL 5JLZB 2D7TL 2VZTA 3NJXA 4FZEL 4I9XA 1DZ0A 5E95B 1SUHA 2YGNA 2IDQA 4H0GA 3EXLA 3F04A 4DKEL 7FABH 3HRPA 4OV6F 3L4UA 2VISB 4NKOA 5F3BA 3H42H 4FG6C 4FG6D 5ESQB 1JFHA 3FO0H 2PABA 1MFDH 5DLMH 3BUYA 1E9QA 1Z2KA 2AXGA 2LU5A 2I60L 4WI3A 3II3A 2QR0B 3IFLH 2WKOF 2BCKB 3LPFA 5I2IB 1WH0A 5ALCH 4PJFA 1R3JB 1HU8A 2HT4D 4G43A 5FO2A 3CX2A 2VZOA 3FRUB 4OCSL 2EVJA 3H9SE 4FMVA 4Y2DB 5EZIL 3LKNB 1FG9C 3ENEA 2WQSA 3D08A 2JKIS 3NIFF 1TDQA 5MEPB 2JB5H 2I9LA 2PYED 4AIEA 2FR4B 4BCZA 4Q2ZB 1LP9F 1XSIA 1E5ZA 1ZD6A 3FTGB 1BXVA 4IKLA 5A3IC 5A3ID 1ZLDA 3UJJH 5IKCA 1HEJC 4A7QA 3TS8A 5KSBA 3ARDA 3AQZA 3JYCA 1KLFA 2Z35A 2AQTA 3H0TB 1R0AL 1XFPA 2NNAB 2J12B 4M9PA 5ICYB 5ID0B 2Y23A 4OT1L 1G7IB 4MB4A 2MQCA 2CKNA 2ZOKB 2G3ZA 5JW4Q 5DS8A 4Q6KA 4NX0A 1FIGL 2XWJA 1KJ3H 2BSRB 2OCFD 1IV8A 3B34A 2VZ1A 1EZLA 3L95B 2MCAA 2A6JA 2GHZA 2IDTA 2XWCA 3QRBA 3W0WE 3ZT7A 2IF7A 4MJ4A 4S11A 5BS0D 4KDWA 4Z5RA 1PYWA 4PCYA 2O5NA 4UDTA 1HI6A 4WDIB 3S37H 1NC2D 1JV5A 3CFNA 4X8XA 2IQ9H 4YPGB 4A38A 3DGGB 3L3HB 2ZWYA 2WXQA 5IOPA 1SVBA 4JLRB 2K6WA 1JHKL 1JZDC 3DA0A 4FTVD 4A04A 1INEL 3EFOB 3ATFA 3VXNA 4MJ5A 3OZ9H 5ABDE 1IMHC 3UMTA 3UH8A 1SXSA 4PS4H 2N7BA 3CLWA 1OAUH 2YXWA 1G9ML 4I88A 4JKPH 1L6PA 1HFUA 1NIAA 4XMWA 1JL8A 2DEXX 1RPUA 1H3UA 1A6AA 3KPMA 4JO4H 4N86A 4F3FA 2EEDA 3N50A 1U8NA 2A9MH 1ROCA 4N1CA 2WIMA 3P1VA 1MLCA 3KLLA 4Y4FB 5F1IA 2R9HC 2R9HD 3OKKA 3DK0A 5E0QA 4J23A 1GAFH 3Q8AA 1QG3A 3DVGB 4YDVB 4Z7QB 3B3BA 3T1WA 3HZ3A 2HA1A 4P5KB 4QHNB 3UIYA 4PM1A 1VRSA 3WIHA 2JVUA 4AMKH 4YDIL 2OSXA 4FXKB 1UWXK 2GSIA 4RMBA 5AOMA 3MCG1 4Y4KD 5EC2B 4U1SB 4TTDC 1XF5A 3P9LB 4TTDD 2BWQA 3WGVB 3LXAA 2WVVB 3B9KB 3QQ9C 1BBJB 3QQ9D 1KB9K 4L9LC 1TZHA 1I9IL 4ICXA 4XPTL 4AGNA 3PV6A 1CXFA 4K94C 4OF6A 1CURA 3GRWH 3WJMB 2R1YA 1G87A 2WMPB 3ZRFC 1W0VA 4UBDC 1CVRA 1DN0A 1SJEB 2Z92B 5ID1B 5K9OB 1K85A 3EJZC 3EJZD 1H3GA 3VXUB 2C4FT 3ZL4L 4CA4A 5A16A 2GEQA 3GSOA 1AIFB 2AJVH 4PJ8B 3CD4A 3VG0H 1OT1A 3EJQA 3AS1A 2BIQA 1GZHA 5D2LB 5BOPA 2H5UA 1U8QB 1IC0A 1XGPA 2G0KA 5DRXA 1KPUB 4IMKA 4HWZA 4QY8B 4H8PA 4WNJA 1A7RH 4Z3JA 3VYPA 3DVNB 5B22A 4BRVA 2FO1A 4CNIB 4Y19D 3SKNA 3FTWA 4UQ9A 1OHQA 3ULAB 1KYOJ 4QRQB 3ARUA 5T3ZL 2AXWA 2JQZA 3H2QA 5I9QB 1LDPL 4EAEA 2R2EA 4LEOA 2B4CC 1HVXA 3INUH 3CQFA 3CQQA 1YYMH 3A4FA 2E7CA 3ISRA 2AGJH 3FBKA 4XCCL 4XMLL 1HC1A 4UM8A 3GIVB 3Q9QA 1NAKL 2JELH 2EEBA 5E8EB 1BG9A 1UWFA 5AVQB 3CFJB 3T3MF 3CMGA 3UPCA 5DO2C 5DO2D 3WFCH 3MOQA 4G8GD 4X7EC 4BDVA 3T4AC 2WLLB 1FL3A 2V8LA 1LQSR 1MCHA 3DRTB 4G7YL 1YHPA 2X4UA 2X0WA 1OP5H 3NJVA 3BP7B 3AG3B 5DQDL 2G9HA 5I0XA 1AS8A 2Z8VC 3GBMH 3EG9B 2JQAA 1HHJA 2ZKXA 5KN5B 1AP2B 3K7UA 3VM5A 4ZS6D 2PF6A 4HC1L 3I2CH 1U8LB 3SBWA 4NP9A 2FBJH 2X6UA 1U95B 3MV8E 1U8MA 1WUZA 1YMMD 2QSTA 3O6ML 1MUJB 1XL6A 2J5LB 2WCSA 3X17A 1E4WH 4M1CC 4LCVA 3O3UN 1P7HL 3GMPB 1LMKA 1MF2L 5AKRA 1MVUB 2TSAA 4K2UH 3IGFA 3QFGA 4AYFB 1W16A 4WZ9A 2YA0A 4L37A 3QUKA 4P0DA 3FFCA 4RIRB 2R1WB 3FUEA 1HKFA 2FB4H 2XWRA 1ZCRA 2YAHA 3FQWB 2BY3A 1OEZW 1Y1DA 1OIOA 1JYXA 4C4BA 1WYJA 2NR6C 2NR6D 5EMYA 1FE8H 5SX5H 1XD1A 1CICB 3L5IA 1HCVA 1LL1A 1M05B 3AABA 3D39A 4JG0H 4H25A 1AGEB 1IM3D 1BMGA 2BP0B 3B2VL 4GYBA 3GD1C 4QXTB 1H6TA 2WVTA 3L1OL 2H8PA 4K55A 3OKLA 2X4PB 4N6RA 5D7IA 2WUCH 3P3YA 3C5ZB 1FO0A 1O75A 1IL1B 1NFDB 4LNRB 1AGCB 2EDFA 4YK4C 2N56A 4O02L 4X8JB 4H20H 3HE7D 4RGNB 1E50A 3DGDA 3HE6C 3HE6D 4PBWD 3O4LD 5EZOL 2NX5D 2L7UA 4WU5A 2E86A 5GS0H 2VZSA 4LO9A 1RZIB 5BQ7A 3HFMH 3WCYA 5JYLA 4OCYL 5CINH 1U36A 3QJOA 4HSAC 5IB4B 3TO4B 1KXQA 3CFIC 4ZO9A 2XN9A 2FGWH 5D1ZA 1A9BB 4AENB 5IMLA 3ZGIA 1R3IL 4UV4L 2AEWA 2BVEA 2NY2B 2OSLB 1AFVL 4UIMA 2V4LA 4ZW5A 1RZJL 4YHIB 3FB6B 3FSWA 2FECI 3WKQA 3ISWA 4AVKA 4MRBA 2WXGA 1UM6L 4LLUA 1ZTXL 2QPUA 1M1XA 1ANUA 2BXZA 2H6UA 3HUJE 4I0PC 3MJ9H 5CXPA 5JIMA 1VENA