4PBDA

Crystal structure of the n-terminal cs domain of human shq1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
102
Chain Sequence
b'AHHHHHHKMLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SHQ1 homolog
publication title Structure and Interactions of the CS Domain of Human H/ACA RNP Assembly Protein Shq1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2014-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pbdA00
4M5TA 4M5SA 3Q9QA 4YDZA 2XCMC 1SHSA 3QORC 2Y1ZA 3GLAA 3QORD 4I88A 4JUTA 3GT6A 2JKIS 2KMWA 4JUSA 4MJHA 4PBDA 3Q9PA 3VQLA 1WFIA 2WJ5A 3L1GA 3EUDA 4YE0A 2RH0A 2BOLA 3VQMA 2O30A 4YL9A 3QORB 4ELDA 3AACA 2WJ7A 3QORA 4YLBA 4YLCA 1RL1A 2N3JA 3L1EA 3AABA 1X5MA 2Y22A 5LUMA 3W1ZA 3J07A 2KLRA 2MNWA 3IGFA 3N3EA 2N0KA 4RZKA 2Y1YA 5DS2A 4ZJ9A 2CG9X 2CR0A 3GUFA 1WGVA 3L1FA 4PCKA 1GMEA 2K8QA 4FEIA 1WH0A 5DS1A 1EJFA
chains in the Genus database with same CATH superfamily
4YK4C 3HZ3A 3S96B 1QLEL 5AAPA 2Z92A 2X2IA 4KKBD 1T0PB 5DR5L 5C07E 1WFTA 4JN2A 3RIKA 5EO0B 1Z9OA 5B21A 2AJZA 2FQEA 3BC9A 4Y19B 1QTSA 2CKBA 2OPCA 3PUCA 1W16A 4NHCH 1CJYA 3VXME 1ZS8B 2DJ4A 2IPUG 2QR0A 2OMXB 1PW3A 3LKOB 3NOIA 2VZTA 3ARUA 4WSKA 3V6OE 4HS8H 4ES8A 4OIAA 1PEZA 3RY4A 4Q4EA 5DHEA 2V7HA 4YX2L 1ERNA 2Z7WA 5AYQA 3BN3B 4PJ9D 1HQRB 1JZ2A 4XCCL 4RGNB 8PAZA 4D0DB 2CDEB 4XB7A 4K3JH 1S7WB 4PW3A 1JZDC 2J6EA 4L8BB 3QJXA 3U0WH 1E4XI 4OLWL 3BRFA 3LOWA 1R6VA 5BS0B 1S7XA 1SHXA 1TYJA 2BNUA 1JP5A 1S3KL 1T0MA 3KLLA 5J6GB 7CGTA 4LQ1A 1KEML 1OKEA 3BP6B 4PG2A 4ELKB 4Y5VC 1A4KA 3RVTC 5HYJE 5ESVA 4OD2A 5GJTH 3WFEH 3EFDL 1P5UA 4G11A 5IMMA 4UIKL 5LO7A 3MUGB 3O6LH 4NBZB 3OB0H 1CQKA 2OJEA 3PAVA 3KR3H 2VLJB 4J23A 2IFGA 3C60D 3BFQG 5DDHB 3N41F 4NFCA 3C6LD 4KZ0A 4GW5B 4OGXH 3JYCA 1PZSA 3DHMA 5JHDB 3NG5A 2Z31B 1BP3B 2WO3B 3DBXB 2OMYA 4LF3B 4LLQB 4KKCD 3BPLB 1EK3A 1M9WA 3D1MC 5ACZB 3IMUA 2BFGA 1ZV5A 2PABA 5LGHL 5JORA 1DLHB 5IB5B 4YGVB 4O02B 2V5MA 4BCXA 4JE4B 4E2OA 5I19L 2YD3A 4ODVH 1KJ2L 1ZLVH 3L5WB 3MRQB 4GAYB 3MLRH 3QUKB 5KVEL 2YA1A 3R0NA 2Y7MA 3ARGA 3H9HA 5DQ9A 1FH2A 4PRHE 4ZUWB 3ZSTA 5CEZH 2APSA 4Q58C 1U91A 3CFCH 4WI5A 2XKNA 5EBMB 1QLFA 4I0KA 4JKLA 3F7QA 4XWOD 5GRUH 4ZMXA 2XFGB 1ZGLM 3ZW3A 4X9GA 4AJ0A 4FQXD 3BWUC 3ARPA 5L2KD 1A6UL 1IIIA 3TN0C 4BDVA 1PG7W 2QVTA 3Q48A 3VI3F 4N0UA 5IK3A 5JHMA 3MRDA 4BUHA 1RURH 1CR9H 2GBUA 4OAWB 4X6FA 4LCCB 2FB4L 3ZR5A 2ZE0A 1QWNA 2AXGB 4AV5A 5L8KB 1NICA 1BF2A 5FYJE 5KANG 2RACA 4FLOA 2JJSA 5HYSB 3FO1B 1MFUA 1YQVL 5JXEA 2GY5A 4NQQA 4O4YH 4E9LA 1HX0A 4P05A 3V4LA 2YMOA 2CO1A 4LAJH 1U36A 3IXTA 4JREB 2C9VA 1NCNA 3MLYL 3QCUL 1EHLH 3MRNA 3NAAL 4J28A 3RTQD 2HT4C 1DN0B 2NW2A 4KTDL 1YJDC 2X4OB 5GIRB 1JNHB 4UZUA 4JZJC 1JG9A 2VR7A 4IM8A 3IT8D 3TYGL 4M5ZH 3QJFA 3GBMH 4AYGA 5L2JB 5IMLA 4CNIB 2F54A 4ZS7L 3BSZA 2VXUL 1JCKA 4CVZA 4WFHE 2R83A 1UA6L 2WXIA 2BXZA 4XNDA 5K59F 5LAXA 4FD0A 1J12A 5AW0B 1NCJA 3DNKA 2YD1A 4BSWA 3B2MA 1I8KB 2AEIT 1MRFL 2W0PA 1A6TA 4JN1H 4TQIA 2KKQA 5FUOL 3VXQB 1A1MB 5E95B 1PG7X 3WTUA 4NFBA 1NBVL 3TJHD 2KZWA 4V1DA 4KZDH 1DSFL 2IPUK 1IGCH 2ZUQC 4I77L 3Q2WA 4XWGL 4BIKA 1BIIB 2GUYA 5JQHC 1E5ZA 5F9JA 2K78A 3M86A 4KRNA 5ISZB 1WE5A 1XD1A 3HAEG 5I1DB 5I2IA 4OLYL 1MREL 1LO2L 4UM8B 1IC5L 3GMLA 2C26A 3LH2H 3POCA 5LBSH 5C2BH 3SQBA 3QSKB 5EC2B 3H9SD 3HUJA 2JI3A 2UYLA 4TNWF 1IBGH 2OK0L 1ZT4B 3O3BA 5IP4A 5CGYC 1KBGH 4KTEL 5DEJA 3MAWA 4WKZA 4NO5B 4NZUH 1D6VL 5D1XD 3CDYA 3MJ9A 2DYPD 1J0IA 4ZQKB 2RALA 2ROXA 1I1AA 3PV6B 3HE7A 4P07A 2B1AH 4QXUL 4TRPH 2BOBA 4WWKD 4HF5H 4DPBX 3DRQA 2DEXX 2P5WA 4F33A 4WTZA 3QIBC 5ETUA 2NY2B 2ZUVA 3KBFA 4NC0B 4OJCA 3ZL1A 4JHBA 1OCWH 3D4YA 3QFDB 4GAJL 3VXOB 1K4CA 4Z5RA 2FATH 5DD3H 1A6WL 3VI4E 5KG9A 4K8RC 1RZGA 3P2DA 1XGYH 3RDTD 1HSBA 4PHXA 3L54A 2LW3A 3KPLA 1NOAA 1RH8A 4KI5E 5LNGA 3SGJC 2PTTA 3VXRD 2W0LA 4Q9QL 4P5TB 4P2OC 4QOKE 2HMIC 5C0BB 3MPCA 4M61B 1KTDA 2JCCF 5LCVH 2HPOA 1I7UA 3LD8C 1KPUA 4FQPA 4CUCA 5EZOL 2UZIL 4W9GC 5DZOA 3DPBA 1MCDA 4X9HA 2XV2A 1R3HB 4QKTA 5GGSB 1CDHA 3GM0A 3FRPB 3QR1A 1W8NA 2BVEA 2FGWL 2OZNA 4OJEH 4RAUB 5KS9E 1IGJB 4LHUD 1U8OB 1C08B 4H26A 2XRAH 1AHMA 2IGTA 5CLZA 1YC8A 4OZFA 5E7FA 2ZJSH 2X4NA 3QIUA 3TO4B 2DWEA 3ZE2F 3US9A 4IOSA 3WLWC 2CO7B 2IBGA 4DEWA 4MHHI 3W5MA 4ZO7A 4XVJH 4B6ZA 2GBVA 2EIEA 4LO9A 1NPJA 4MAYD 2PXYD 2HUEA 4G7YL 1QRND 2H45A 1V7MH 1FAIL 4LSVL 3S5LA 1GOHA 3AMLA 3RAJL 1GGIH 4PJAA 2BK8A 4QHUA 2D4FA 5CIPH 5DC4B 5HPOA 5EPMA 4BZ2H 2JH2A 2GJRA 1ODUA 5DHVB 1E4XL 3L7FA 4ADGA 2AQ2A 1MCSA 1TVBB 4U7SA 1C9SA 5HJBA 3IFOB 2IC2A 2VSDA 1KCVH 3GEWB 3BUDA 4JPSA 3FBKA 3BP5B 2EIMB 3VGGA 5IBTL 2XTSA 2BY0A 3STBA 3V5DA 5I66A 1YYLL 1XSJA 2WQAA 3BPOC 1FUNA 4QO1B 4QPEA 2F08A 1B88A 3QNYB 2V2TB 1A9EA 1KG0A 4Y16D 4C83A 3VI3A 1LE9B 2AV1B 4NKMA 4GO9A 4JY4B 1HNYA 5IB3A 4JO4H 1I1YA 1JPTH 3PY9A 4X80H 1DLFL 3U9WA 4ZMLA 4R7NB 2L04A 5CJOL 4OFYD 3PPSA 4XP6H 2IQ9L 5EZJA 3PXLA 4IRJD 1UB5A 2O1AA 2XV0A 3MLSH 5GPRA 4JKKA 1VADB 3CTTA 2RA1A 3NJVA 1L0XA 1OPOA 2XYCA 3QJHB 1NANH 3MO1A 3HS9A 5EUOB 3SBPA 5MP6L 3F12B 2E9IA 4YSUA 1S9VA 1PSKL 2R29L 1RU9H 1VFOA 1ADQH 1QZNA 2H32B 1RIUL 4JE0A 1XEDA 5BO1L 4KKAD 4O58L 5LG1A 2QADB 5KUMA 4DETA 3SDAA 5TE4L 3MOBL 3GMRB 1G7PB 1VRSA 2WK2A 3GSNB 4GIPD 3TYFA 1PAZA 3I50L 2FL5A 5D96B 4N86A 5AKTA 1GL4B 4A1RA 1UM4L 1NJ9A 2QQKL 3FCSA 2O5XH 2CGRH 2JQZA 1AO7A 3FU7A 1NFDF 3DOSB 3QCTL 3TIDA 3WTWA 2CO2A 4B97A 3ETBF 4XBEL 4AMKL 4JM2A 3WNOA 4M3JA 3DPDA 4DN4H 5JIDA 3WMQA 5DZNA 4IOFC 5FB8A 2OP4L 2XXGA 4QRPD 4P23A 5IKCB 2CU9A 1S9YB 1KCKA 4GYBA 5HYIA 2D3VA 2W65A 2PWGA 3CXHJ 3ES6B 4JY5H 2LU3A 4PJFB 3MU3A 4MXVF 4AGLA 3QEUA 4OQTL 5C8JB 3ILQD 2L7JA 1N6QH 1PX3A 2J8UB 1P9MC 2FECI 4JLRB 3LPOA 1OCCB 3BVWA 4Y0GA 3LNHA 1E5BA 4PLJD 2DPKA 3EJCA 3FC8A 3HC4H 2VDRB 3UBFA 5AUMA 3WS6C 1WBXB 2I24N 1E42A 2OL3A 4HJIA 1I1CA 3V8OA 4AKPA 5FHBL 1CGSL 1KJVA 1ZLSH 2DLIA 3HHSB 3W0WB 5KN5A 4P49A 2DLHA 1I3GL 5AW5B 3ZSSA 1JZ3A 3KXFD 1UM6H 2WVTA 3IDXL 4FXKC 4CILA 3SB3A 4Y1AA 3KH4A 4QXGL 3UZEC 2EH7L 3MLWL 3CPLB 1W8EA 3EYUH 4HGKC 2UWEB 4AQEA 1LP9A 4JO5A 2Z7YA 3QXUA 2B7DT 4N6RA 4PJXB 4UT7L 4PG9A 2HWZH 2QVKA 1AE6H 3QAZB 1JPGA 1J0ZA 2ITDA 4XCFH 1MHEA 5GS1B 1JZHA 1C5DB 4R7VA 1E3XA 3UBXI 1D5IL 4HJSA 4P3CH 1QSEE 1ET8A 2YUVA 1HESA 1D5XB 4L9LB 1EZVY 4FAAB 5F0PB 3IETA 5I73C 1KTLA 2JCCA 5F1SA 1CXEA 1BFTA 5DZ9A 4JFPB 5ECGA 3TO2A 3DK2A 2VDNL 4PRBA 1B2WH 1AD0A 5C0FB 1GAFL 3IMVA 3NK4A 5I1KL 2X12A 3VXNB 1AD9A 5CZKA 3GPEA 2R1XB 4R0LC 3RVTD 2VQ4A 3FUHA 4PUBH 4YSTA 4YIQB 4MD5B 1XAUA 2CUIA 4DJMA 3TPKA 3FOMA 4F9PC 1L9SA 4PGEA 4RFNC 3WHE1 1LO3L 3ERXA 4AYDC 1J88A 1XIWB 2WWOA 4GS7B 1ZLWK 5JLZA 3OLIA 1QAWA 5E1AB 4P9MH 3RY6A 3K8KA 1KCWA 3LRLA 3KPRD 4YJZL 4X4YA 3FB5B 1UD5A 5J9PB 2VDKH 4D3CL 3QXAA 2VO8A 2ZXWB 3A21A 3KYOB 3V0IA 5HVHB 3RWDB 3NIGE 2HKFH 2QHLA 5HGDB 1TCRB 3RUGE 3BOVA 4W4OA 2APWA 3EH2A 3MMEA 1GZHC 1KEGL 1F4AA 4XZUB 2YBRA 5CZXC 5GSRB 3LQZB 1JRHL 1BOYA 4JHUA 4P9HC 3RPKA 5I75B 2Q8BL 2GFBA 4M43L 5IHLB 2C9PA 3MXWL 3VXUB 1CFVH 1LMIA 3AXLA 3FYEB 1IBBA 3BAXA 3RDJA 4F27A 4KVPA 5C0GA 3HLAA 3LEVH 5INCB 1PG7L 2P5PA 5TQ2L 2V0AA 3H7LA 4GG6B 3K74B 1T5XA 4KKLC 5GRJH 4L3CA 2HRPH 3KPSA 1ZPLA 4MXQD 2AABL 4S1QH 1V10A 3GSQA 3D33A 4NQEA 2VSCA 3BYTA 3LKQB 3TN0D 4HGWB 1E28A 4ONGL 5I1GH 3N42B 3ZL4H 1Q1JL 1YJDL 4C56E 3LXCA 4V1DE 5MERB 3MZGB 4MYWB 1N0XL 3FUDA 2YAOA 4LAQL 3F7VB 2NYKA 3ULUC 1HVXA 3VM5A 1Y6MR 1UZGA 2BSTB 2I25N 5JYLA 4EI6A 2VMEA 3HZKA 1VFMA 1D2OA 3K0YA 2WJ7A 2OMWA 3P4NB 4X5XA 1CFNB 1W72H 4WEUD 3AWEA 3K4AA 1KENH 1FO0B 5I0YA 3NJNA 5IW1B 1AANA 1P69B 3TEXA 4WHYG 2UY7B 3BT2L 4KX7A 1DL7L 2R1WB 2HVJB 4FJ6A 1JGIA 4GKNB 5DJXA 3TIEB 2VZ1A 3MNWB 1TF4A 4URTB 3T77B 4AKOA 1RZKH 4WNQB 5IM7B 4YDIH 3O81A 3TBYA 4MA8L 3VA6A 2XTJB 3IS0X 3D25A 1QSFA 2OSLA 1CFMA 2Y2YA 4M6OH 4PJHF 3WFCL 5CILH 4N8CL 4NJAL 2PW2A 3CSPA 1JGUL 3DI2B 5MEPB 3R8BB 3OJDA 3WYRA 4R2GB 4HU2A 1FFQA 4TNEA 4XH2A 3FFCB 3NGBC 4IJ3C 2VLMD 2NY6D 3BZFB 1KTBA 1WA1X 3CZGA 3DXAD 5IMKA 2Q20A 3ARDA 5CBAB 2ADGA 4YL4A 3MHZA 4KO5A 2OI9C 4X6CE 5FGCB 4ZPTA 5JIPA 3WJJA 4EUPA 3O2WH 5E94B 2QV4A 3V4VL 1WFIA 3UH8A 1LEKA 1WFNA 2DQCL 2W60A 3EGXA 1VB9A 4XP9L 4AWJC 2GSGA 2A6JB 3S2CA 1NGPH 4YZWA 8CGTA 3MRHA 4HFWA 1T0NB 4AXWB 4IRSA 4CAGA 5J6HB 5SWQB 3WIIH 3MOAH 5CGYD 5JTWA 4K8RL 1T5WA 1FC2D 4MVBC 2OW6A 4ZYKA 3DURB 4GRMA 5J6SA 3GDCA 4KK5C 4GSRA 1PZ5A 3CQPA 1KGIA 3RKDC 4XC1L 1WD8A 2ATPB 2JB5H 5L4JA 1J5HA 4J7RA 1U8CB 4RQQA 3S3SA 1ZVYA 4ZO6A 4MNGB 4I1PA 2XN9A 4JFQB 1WT5A 2AXWA 3QIBD 3QZWA 2PR4L 4ICXA 4KY1H 1LO0H 4ATTA 4ELDA 1XD0A 1BVOA 1LNUA 4OT1H 3DVGA 4HXAL 5FKPB 1LYQA 5DTFB 3SJVB 1T1WA 3I9IA 4K8RD 5HYSG 4OI8A 1IX2A 1B3JA 2QSVA 5B3JF 4AIEA 4B60A 3GSRB 1U4FA 2Y06H 2ZX8A 4HZLA 2DIEA 2Q5BA 2P45B 3AQDA 2F7IA 2YBGA 4B7IA 1G7IA 1MCPL 4GSUA 2G9KA 2W95A 4FJYA 3VX1A 4MA3A 3I75B 3GMQB 4HH9B 2ZOLA 3TBVB 1A7OH 4KC3B 4P2OD 3ESVF 2HMID 3TBBA 3KM1A 3H0TA 4WNJA 4MMYB 2AEOA 3NYKA 3IKKA 3WNJA 4JFYA 1I1FB 2I26N 4L29B 5MI0C 3EBAA 1KJ3L 3DIFB 1EVUA 3HNVL 4AGPA 3O2DA 1ZA3A 2BIHA 4L8SC 2EECA 5LQBL 3VW3L 1WISA 4LLMA 4WFGD 1ZHBB 1S78C 1EIBA 1LE5A 2PO6B 4OGYH 3WFZA 2YWZA 4X98B 4Z18A 4FQLL 1DVQA 1FLRH 3VI3E 5KSBB 3F04A 3N44B 1HHJA 1XBRA 3MZTA 3GGWA 3R8QA 1QATA 4HFUH 4KNTA 5EMYA 4BA0A 2MPAH 4M5SA 4YSCA 5I0VA 1BVNP 4PJ6A 4FKHA 4HEME 1RJLB 5BV7H 4LHQB 3RWCA 3E2HB 4YFLF 5CAYB 2VLRA 1NMAL 3HC0A 3WLWD 3G6JF 4EBQH 2B1HL 3L9RA 1UEMA 4KJWC 4QHLB 5KOVC 3MA9L 4Z7OF 1AOHA 1K85A 3QUYC 1TENA 4DUWA 4HUVA 1BIHA 3IFLH 2HVKB 3F6LA 3PGCB 4JFXA 4DT2A 3AXIA 5ICYB 3VRLF 3UYPB 4N0FA 4ZW8A 5G4MA 5AVWB 2ADJB 3MYJA 5I8OL 4N5EC 4XPTH 2I85A 4J3TA 1R0AL 1SEBB 2VDQL 1A25A 1V27A 3ESUF 4QHPA 5DJZB 4W9FC 2FJGB 3ASWA 7PCYA 1E90A 4H1LB 4XNQB 5CEXA 5K59E 1XCXA 3O0RL 3TX4A 1H3PH 2SEBB 4PJGA 2VXQH 1UJTA 3GNMH 1RHFA 3MRRB 2IFFL 1EHXA 4YBHA 5GGUA 2OYMA 5FDYA 2OZ4H 1MWAA 4K2UL 1RUQL 4R7DA 4OCXH 2GTWA 4NNYA 2W5PA 2YPKA 2BZCA 3U7YL 1U3YA 3PLYA 1ZJBA 3IDIA 1YEIH 3O45A 3UC0H 4AUJA 4FQHA 3QDGE 1FL3B 2DMHA 4ZRGA 4A7QA 2VSMB 4YVUA 1Q9KB 2Z65C 2ZCHL 1KCRH 1T66C 5HPMB 5KYXB 1YN7A 1HIMH 4PGBA 1NFKA 2BP3A 5E00A 3M8OH 1T7VA 1KGJA 4WTZG 5F70A 3ZYZA 3ARFB 2WB1A 1CGVA 3D18A 1R9FA 4M7KL 1E9OB 1AP2A 4HIIA 4OZGF 4RVBA 2WYZA 4YDLB 3ECBA 1AYRA 1UD2A 1K8DB 3LZNA 5ADPH 2H3NA 2DQJL 4PJ5A 4G8GA 1SMOA 2HXAA 4OH2A 5ESQB 4C4KT 8FABB 4U1SA 3FRPG 1JHTB 4XN9A 3D05A 1ML0A 3MV7A 4U1NB 4WUKL 3LS4L 3DGGA 1UM5H 1H6TA 2EEDA 3O3EB 4XP4H 3F65A 4BK8A 5EU7E 2O6EA 4Y1AE 5AVSB 4UANA 5AW1B 3RG1C 5ERWA 5GGTL 3IE4A 1NIEA 4KUCF 1PKQA 3CVIH 3HG1A 3O11B 5T3ZH 2J5LB 5JPMA 4U1JA 1IQDA 1Z5YD 4K07A 1YEEL 3B3IB 1BYOA 3GSUA 4MZRA 4BHUA 1TITA 5D7IB 5DC0A 4OM0H 1RUKH 2OMNA 3V5HA 1LDPH 4IOFD 5C0CB 4WGWB 4CMMB 2P80A 1N12A 2EO1A 3FHQA 5AOJA 2J71A 2JKIS 3NJGA 3MRFB 3E6FA 4ZFOA 3C08H 4BQCA 3A3YB 1RP8A 4P2QE 1P2CA 1I3VA 4L0YA 5I71B 2AXFA 1CU4L 2P47B 3VWJA 3FO0L 1CFQB 4OZIA 4KAQL 2B5IB 1FNEB 4LQFH 4TKWA 3S5LG 4PQXA 3SDDD 1R3JB 2AFNA 2P52A 3GS0A 2ZWYA 2NDGA 1WA0X 2AGJL 1KPRB 1BSIA 3AS1A 5SWSA 3ZE2E 3GK8H 3CLEL 5D7LD 2APFA 2AMGA 1HHIB 5IEHB 5LGYA 5D7JC 3Q5YA 5F3HB 3D39A 4WDIA 2I9TB 2ENJA 5B38A 4HLJA 5IW6B 5JW4Q 1D7CA 2EXYC 4O02H 2VM3A 3ENEA 4CU6A 1KLUA 1DFXA 3BMVA 4L3EB 2ED9A 3LNFA 5EU3A 1ZVSB 2V2WB 3L3KA 3BE1H 1NLDL 4WEBL 1CL7H 3JWNG 1MI5D 2QBWA 3O6FC 3OKKB 5MENB 4HPHA 1F3RB 2VN6A 1F3JA 4LPXA 2F74B 1PGRB 2ESVB 1GVIA 3ETBJ 1BQKA 2VKXA 3IF1A 3JQOB 3CN2A 3NCMA 5D55A 3KJ6L 2HN7A 4XX5A 2AJYH 4JRXE 3CFNA 5FYKU 3LPGA 3VXSE 2NNCA 4P4KC 3VO0A 1QBBA 4Z7VA 4Z3EA 3VH8A 2AEPL 3MCKB 3PABB 1GMEA 1BAFL 4D7PA 5DMIL 3FF7A 2WLLB 3C2AH 1I82A 3GIVA 4HJUA 3DVNB 4LNRB 4OIIL 3QUXA 1FSKB 4P9HL 2VR6A 4AENB 3M1CA 2QSCL 3UG4A 1JPST 2H4EA 4HV8A 4HULB 3MV9B 4LVHC 4FLQA 1IGFL 1HYRC 1E30A 4JR9H 4X7TA 2QKIC 1WDAA 2W07B 3LNEA 1Y1DA 3UBGA 4XCNA 1IC4H 1OF2B 3B9KA 1OAKH 1MAMH 1QBAA 3HRZB 1HL8A 1M9SA 1J0HA 4XPFH 5E4EB 1TJIL 1I8AA 3HI1B 4HAFA 1U33A 2F19L 3MX0A 2R4SL 3IEAA 1XCTB 2ZUTA 2HJLA 5C07B 3OXRB 3H42L 2EC8A 2E9BA 4L8DA 5D5MF 1U8HB 3W9DA 4BFRA 4OV6F 1MEXH 3GI8L 3QRFM 1ASPA 3VXMB 3K2KA 1Q38A 1RD6A 4J12A 3VMPA 3R06A 1HKLH 3T1FA 4KKLD 2GSIB 1NFDE 3NA4A 4BRVA 5K9OB 2F5AL 1Z5LA 4EMZA 4L5FH 4P3DA 4NQXA 1E2WA 1UXWB 1UXMA 3K81A 3CBRA 4OFIA 2GHZA 1OSZA 3U1PA 5IFJA 1P0SE 3IMTA 2XBZA 2Z34A 5D93C 2DQGL 3UTQA 1T03L 4JRYE 4L3AA 3HE6C 2WGNB 4M7JL 4MJIE 3ZHDA 2Y5QA 1CXLA 4B7LA 2R2EA 3CMGA 2DRUA 4MXVE 2ARJA 3NP4A 2YSSA 2HFFA 4E9QA 1ZK9A 2AP2A 4NAQA 3IDUA 3I3EA 1U41A 4FFVC 4OZGA 3MJ8A 2GIMA 4KDTA 4WI7A 3SOBH 3RZCC 5HYJB 2QFPA 4TOYH 4MGXA 2FQDA 4HIHB 4RGOL 32C2A 3BO8B 4JQXC 3P9LA 4FQ1H 1CD9B 5IVNA 1FDLH 1J05B 1X7TA 4FL4B 3TCTA 4HLZH 3BN9C 5C71A 4HIXL 4QRAA 4EIBA 5A2JH 2OX5B 5KW9L 1OTUD 2OSXA 5E99H 5DLLA 4X7CC 3FKUS 2PWHA 1J5OH 1UWYA 5ID0A 4M4PA 4LIQE 4Y2DB 3U0PA 4GQQA 2R15A 3D8MA 3DETC 3KYKH 4YAQB 1TZOA 1FNSH 2NX5A 3GHEH 2R0KH 1T2XA 2FLRT 4Y5YC 5FA3B 3BIKB 4PI2A 4UB0L 3VTAA 1HHHB 5GJTL 2VJ0A 1HAUA 5GHWH 2FDBP 2J1YA 3TZVA 5FWQA 4PFEA 4Z1PA 2A6IA 4WSJA 3T0BA 1AXTL 3UO1H 2XVKA 2JIXD 1HT6A 4HU8A 4URKA 1D5ZA 2R2HB 4PRHB 4XB3A 1S9KC 2EILB 3ME0A 3T71A 2NZ9C 2P5ED 4FFYH 4GAGH 3VFPA 1JFHA 2XV6B 4EI0A 3I2CL 2DEYX 3L3DB 2Q2EB 2A0LC 4XVSL 5HDLA 3UADA 1TR7A 3REVA 4HPOL 4OCSH 2XWRA 3S8WA 1VCBC 3AJ7A 1NANI 1QA9A 4JFDD 4LDCA 1EJOL 3BAKA 3LZRA 4MVBD 2BRQA 3FSVA 2IANE 2I07B 3LKSA 5MEOB 3WTVA 3RKDD 4HKXA 2QVFB 4JFED 3NA9L 1Z7JA 3MLRL 4Y4KC 3D08A 1KGUA 3GLAA 3ZTJH 5ID1B 5C0AA 3EJSA 4FFTA 4PGZA 4C58B 3N5AA 1G4MA 4J4PA 5IVXF 3VDCA 4AW7A 4W9IC 1JZ5A 3G5WA 1YDPB 1WA2X 4JGUA 2ZNWA 3KVPA 2YA2A 4HWZA 4JKPH 3WN5A 3KWXA 2XUWA 2WIMA 5EU5B 4JS7A 4IRZA 3S8FB 1F6AB 3HI6L 5I17A 5KANI 1QPPA 1U93A 3TCXA 1E8WA 2RHEA 1N5YH 1C5CH 2V5SA 3PIQB 4D0CB 1Y1UA 4JO3H 5E6IA 3SOTA 1UXLA 1DEEB 2FBRA 3U4BH 5KSAA 4WWOA 3MKGA 2QDWA 4U4BA 2MWCA 2ZSWA 3MCG1 3LSOA 3IGUA 4P5MB 4PWIA 4RDQF 5AFAA 1KIPB 2NY4B 4XO8A 2NW3A 2ZCZA 1EHLL 5DRNA 1S78D 1UURA 2G60H 1HHKB 2Q7YB 2XSKA 4LBEA 4O51B 5DJDA 4HWBH 4NERA 2YS4A 4P04A 5CP7A 4NYLA 7FABH 1F18A 1KIUA 4ZOAA 3L95B 5FW8A 2BMKB 3AY4C 4PH8A 3TT1H 3S88H 4QRUB 1FFPA 2CALA 1IKOP 2GSMB 3V52H 5HVFB 4TNWK 2JFCA 4FYSA 3Q01A 4MMXA 2GAZA 1EAOA 1NEZB 5EC1A 4A2HA 5FW6A 1MUJB 5SWZD 1DUYA 3MODH 3QUYD 4PREB 2PWDA 5IFHH 4ZOBA 4DH2A 3JWNH 4JKNA 1IBFA 1L7IH 4JANA 3LZOA 3WENA 1N0LA 5EIIA 4IKIA 2EH8H 1XT5A 1SDAB 1E4HA 1WGVA 4PJ5E 4AG4H 2FO8A 3STZB 3UTSE 2H6PA 4A39A 4N5ED 4TL5A 4QR7A 4IDJL 4FC3E 4MQTB 1CDIA 3PL6B 4FTDA 2E6JA 4NJ9H 1A0QH 5CD3B 2JWYA 3VCLB 5D5MA 3KPQB 4MCNA 5AB0A 4PJHE 4H44C 1J8HD 5EBWA 4HCRA 1DBKH 1PKQE 3HG1E 2H6UA 4JHAH 5SX5K 3VI4B 1I7RA 3QXDA 1T22B 5E2UL 2MPVA 3DV4A 4M62L 4M8QA 3WXVL 3WIAA 2VLKD 1JNLH 4MNHB 6PCYA 4YHLL 4NZUL 4FQCL 1AHWB 5FYKE 3UTTE 1HILA 2BVPB 1HINL 2H1PH 1T20A 2H0PA 2K9FB 4IOIA 1AMXA 4HF5L 4NCDA 1T66D 3AGWA 2JJTC 4PV9A 4UV7H 1RULL 4QOKB 3QNXA 5GJSH 3KMDA 1CYXA 1U8MA 2HT3C 2NYYC 2BOLA 3ABZA 2P49B 3LIZL 5GGRB 4I3RH 4OVUA 4X7EC 3JVGA 4TVPH 3TOPA 4AVIA 2VDRH 2Z3FA 1IO4C 2MKLC 2W91A 2X4RB 3QT2A 4PJ8B 3HB3C 3UBHA 3L8QA 3B2PA 3BPNC 4XTRC 4AQ8C 2XU9A 4X6DF 3DHPA 5GSVB 1COBA 5KS9B 5C0NC 3NCJL 4ZAKD 2R4RL 1I85A 1NGXB 2D9CA 4K7FA 4R3SA 4QRRA 4ZUSA 2KBGA 3MNZA 4GT7A 4HC1A 5DVLA 2BINA 3ZN6A 3FCBA 3Q13A 4GXVH 4LMQE 4Y4HB 1TTRA 1MLBB 5GZOD 2FO4A 3T3MF 2OR8A 2DD8H 4HKZB 5J12C 4ODSL 1K2DB 1MCHA 1UFUA 1XH2A 1N7ML 4NQCE 1BD2A 2DI9A 4ONHA 2J57A 2HLFC 2UX6A 1B0GB 2N0KA 3VWKC 3FU0A 3MN8A 3QG7H 3NCCB 5E8PB 4GLRH 1XGUB 4RMVA 2IJ0C 4HJJH 2WBJC 5D6CB 1CXFA 1DTUA 3VB8A 2QDVA 3JWOH 3ZT6A 2AEWA 3HN8A 5TE7L 2BS71 4JAMB 4QXTA 3HMXH 5EZLA 4DHLA 1IEHA 2NOYA 1AQDA 1G7HB 1P1VA 1XGPA 3OKOB 4NO0B 2YD9A 5DVOA 3WY3A 5T1JA 1THCA 5HHQA 2ENPA 4H1LG 4PRAA 3CK0H 1I75A 5EWIH 3V5KA 3CFMA 1VACA 15C8H 4GRLA 4N9GA 5DYOB 4RMUA 3QWQB 4TLSA 5CN2A 1EDQA 5TD4A 3RPIA 4EOWH 4ETQB 1Y18A 2X6MA 3OKNA 3ZMEA 1GCYA 1PZUB 3WOVA 4UT9H 3O6KH 1JL8A 5BV7C 2H3XC 1MCLA 3D07A 3EOTH 2Y25A 3CDGB 4A2MA 3G6JE 2CIKB 3HBGA 3L3OB 1HSAA 4DEPC 2BWIA 3B1UA 2DWDA 3FU3A 4Z7OE 5IVXA 3TEWA 4IW4C 1K5NB 2F58L 5D7JD 3DMMC 5A2AA 2B3RA 5EEYA 2ICWI 3ATBA 3QISA 1NCCH 2PWEA 1XF5A 3QWRA 4RZKA 3VRLE 1JIBA 2EXYD 3QI9B 1S7VA 4Z7QF 3G04B 2F61A 5ANME 4MQXD 5D72L 1A9BB 1KV3A 4TQEH 4OLZL 4WW2B 2WAQA 3AMKA 4Z0BH 3M7FB 3O41B 1LDSA 1RLBA 5DD1H 3LMJL 3O6FD 4GRWF 3ZE1E 4OSUL 4KMTL 2HFEA 5EU6A 4FX5A 2MJWA 4HHAB 3K71A 4G7VL 1X4XA 2CKBB 4YQXL 2QKSA 5KUKA 1JTOA 1RK0A 1XFPA 2Z6FA 1KXVA 4YHMH 5FOJA 4XPGL 3K72B 2HJFB 1Z9LA 5CO1A 1SXBA 2GPZA 1VKXA 4P4KD 1HE8A 4LP5A 5K39B 5ENWB 2XXFA 4XXCA 1LWJA 1RU9L 3EHBB 3T2PA 3CZKA 2X42A 1OGAD 4I18C 4APQA 2OCFD 2OULB 4LVNB 3U1SL 1Z9SA 4G5AA 1X5GA 1OAZL 5E9NA 1WZ1L 2XG4B 4OGZA 4AGNA 1V7NH 1YEKH 2G0LA 5G5DA 4EE2A 2NXYB 1QNIA 2NXZC 1A64A 2DQHL 2OTUA 3L1GA 3CSYB 3ARBC 4YE4H 4A7GF 3TA3C 2ENQA 3DTUB 1M7DB 1FO0H 5FFGA 1KGCD 2CGRL 3IRPX 1FZKA 2QVMA 5G4NA 4M6MH 2EYRB 4A7VA 2MOGA 4WZ9A 4ZSOA 4YDMA 3QHZH 1TTUA 1P5UB 5E08H 2OXHA 3QEGL 2DQDL 4D7BA 3LV3B 1IAKA 5EOCL 1K8IA 5KSUB 1V8HA 3KPPB 1YUHB 2YIHA 4I0PA 3F58H 4P5RA 3WIFA 4H8VA 4DCQA 3M88A 3TPUB 4PGDA 2AI0H 4U4IA 3ZHKA 3CAFA 3OSKA 1CLYH 1NAMB 4ODHH 3A4AA 2X0WA 4I89A 4PJDE 4RGNC 1IIKA 3HC4L 1IC7L 4P48A 3ALWA 4X5LA 5DEFA 4NT6B 5JORB 5C1MB 2WNXA 4OJYA 1F4YH 3BUYB 5E24E 3MUUA 1MH5A 4MD4B 5LXVA 5DZJA 3HE6D 1QSEB 3IYLW 2SODB 2ZG3A 2J21A 3RVVC 3ESNA 3E6HA 1JN6A 5DU7A 4OJFH 1U91B 2GB2A 3UTPE 4EF3A 2VXTL 2XLLA 3OLGA 5IIEB 3FB7B 1MW3A 2KL6A 4FFVD 3QIWA 4GFXA 2HRGA 3AREB 4PRIA 2CXGA 2QGBA 2QT6A 2J88L 3J07A 3RZCD 1CICA 3RP1A 1BVNT 1CDUA 4BDVB 5F9AC 5GISL 5B38G 5D8JH 1W0VA 4J3XA 3BN9D 2DJMA 3HBPA 5IJBC 1HDMB 2Z31C 3M17B 4JVUA 5IQ9A 3R19A 5EN3A 4EI5A 1A6ZA 1QBMH 2D73A 1DQVA 1PVHA 2DLFH 2J8HA 3WHE0 3IVKB 2AF2A 4P57B 4XPAH 3FQNA 1B2WL 4Z76A 2C7UA 4JZOA 1HI6A 4KVNH 1QEWB 1FNLA 2R39A 3NIGB 4DQOH 2N7SA 1M05B 2UXFA 4KRPB 5KBLA 3BEWB 4P46B 4LBAA 5TH2B 5CKAA 3RUGB 4PU2A 1U0QA 4NM4L 4UUJA 4AVHA 4N3UA 1NA8A 3Q05A 1KBWA 4PJ9A 3TEZA 4DSYA 1FNGA 4FTVE 1A9VA 4DGWC 5IB1B 1KJMA 3NRFA 2NZ9D 1DQMH 2CK0L 3SE4C 4ZX5A 2RIKA 5ES4B 2J56A 3FUMA 4D0BB 2A0LD 1TNNA 4K9EC 3TH4T 3FU8A 4NIKB 1EZUA 1A6TB 4CN6A 1N2RB 1EUUA 3NZSA 5LGKA 3N40F 4UOW1 1KCSL 2P8MB 2OXGB 5AVUB 4AITA 1WK0A 1WWAX 3KPMB 4LCCC 2IDSA 1TO5A 2VWEC 3FQ4A 2BNRE 1ZJAA 4X7SH 4C56B 3SKMA 5JIIA 5K5YA 4V1DB 1MCOH 1C5BL 1HU8A 3V4PB 5C0RH 4Y4KD 3BVNA 3JZ7A 1V3JA 4G9DB 4IMKC 3SY6A 1JGEB 3EH1A 4CMHB 4F7PB 5EOQH 5JR1L 5AZ2H 5CJ5A 3GWJA 3C60A 2PMZA 2A6DA 2Y69B 3QORB 3MRBA 1H5BA 1JE6A 1BWWA 1MDTA 2K70A 2YRLA 1FF5A 4JHWL 4Z77B 4NQDE 5T33L 4J1UB 1X7QB 2W9LA 1Q0EA 1G6RL 1S7SA 4UILL 3KVDD 2J1WA 2HH0L 4CU7A 2BC4A 4MX7B 3HI5L 5K9JH 2BSSA 1CXKA 3TNNB 1IFHH 1ESOA 1P7HL 4RISL 4KNQA 1N9PA 4LLUB 4TUJB 1W72L 2WZAA 5F93C 3JTTA 4X2UA 2C9AA 1KV7A 2B39A 1NCWL 3MJ7A 5FOBA 2DAVA 1JZ6A 2FR4B 4WJKB 2FEEI 3EDDA 2X1QA 2XWBB 3KPLB 1T2QL 1NSNH 2C9UA 3VMOA 4GFTB 5C92A 2WWKT 5L2KA 2Y9RT 2PTTB 4X6CB 4XNXL 3WEXB 4N2EA 3VFMB 4RSVA 1KJ2A 3SEPA 2X40A 5F7UA 2D3LA 2E59A 5EV7A 4XGZA 2E86A 4Z7UA 4WU5A 3RHWK 5E1HB 4NWTH 2CLVA 4BK4A 1T7YA 4GW4B 3X3GL 1QFUH 4MMZA 4PM1A 5H2BB 1INEL 3UC2A 3CZFA 5KYUB 4DUVA 2VJ8A 4GMSH 2X44D 1IGYB 4DP0X 2WVUA 4B41A 3S3BB 1KB5B 3N41B 1MHHB 2NY2C 2JKXA 4NKOA 4XVUD 1O6SA 2D7PA 2FJHA 4HUNB 5IQ7H 1OSPL 4CDGC 1LK2A 3BVXA 3CFIC 1FCCA 1TJMA 2ZONA 3G5VA 3WAKA 4KO7A 1G1YA 2FBJL 2IGFL 3AU1A 4Q2ZA 2Y1AA 2VW4A 4TUKH 4HBQA 5EO1B 1JI2A 2OTWA 5FV2A 2BW5A 3PWPD 2ZKXA 1MVUB 1KB3A 1ND0B 3MOAL 2IVFC 2F1EA 3BH9B 5D4HA 2KZKA 1MHCA 2CLZB 4P5TC 5F7NC 3QPXH 3HMWL 2GY7B 2NR6A 3CLFL 3BAJA 3WKMH 1W8OA 5I1JL 2V37A 3GLZA 4HX1A 1EAPA 3CIAA 2GVYA 5BZDA 5D71H 5TF0A 3T3PF 2LQRA 3WEBA 3EYOB 2HT3D 2FYVA 5BW7C 5CEZE 2NYYD 3SDCB 1XGQA 4KVCL 1IZJA 3RURA 3QFJB 1CE1L 4Y5XA 5DCCA 5GGQH 1ZT7B 3N1FC 4NKIH 3HB3D 3VQ1C 4WHTB 1G43A 2EIDA 1NCGA 2PCPA 2LU4A 1WRFA 3VI3B 3NFSL 2BFVH 2Y06L 3H9SA 1RZ7L 3RKPA 5C0ND 2EIJB 1BQHG 4IU3B 3TO4C 1GC1H 3ZY7A 4H5SB 3W57A 1S3RA 3O4LD 5D1XA 3UZQA 2YAPA 5HHMD 3ZOAA 4LCYA 2DYPA 4CSZA 1F58H 3BQVA 5IVXE 3RX9A 1Z3GL 5C09D 5DS8A 1RLWA 1ZVNA 1SOKA 3C9NB 5D2NA 4AL8H 4HIEA 3FN3A 4PW4A 1NEZG 2X4SA 3K6OA 2HLFD 3LN5B 4OGYL 3VWKD 5B7MA 4X8GA 1S9WA 3QIUC 1LEIB 5F1NA 3RWIA 3FB6A 1KLFB 2Q87A 1BOGA 2WBJD 5ITFB 3RDTA 1E8YA 3EYVA 2MPAL 2XG5B 1BPVA 1D2PA 1FVEB 2JTYA 3SDAB 4KDVA 2OJZL 5BV7L 2AK1H 5L8JB 4H4NA 1OP3K 3CE1A 5CINL 2ED8A 1SEQL 1SOSA 3KCPA 3VXRA 3MSPA 3QJRB 4AC2A 1E6OH 4JDZB 1Z9MA 3NJHA 1FL5A 1CN4A 4GI6A 3OKMA 1NINA 4AT6A 1EMTL 1UT2A 2XPYA 2VGLM 5AKVA 1JXDA 3SYAA 3P3SA 5KBKA 1QBLH 3ULVC 3LN4A 5FK9B 1IBZA 2CUAA 1ADWA 1BFVL 1D5RA 1T04A 4U6YB 2QZ5A 1HK6A 1UEYA 5IJVB 4ZO8A 5ESAA 3DDGA 3CCHA 4S2SB 4HS3B 2EVFA 1UZ8A 3QDGB 1BZEA 1V3KA 3CUPB 1ORSA 1X6LA 2IPTL 3PWUB 2QQQA 4PRPE 4D94A 4N5UA 5B39A 3MRGA 4ZXBB 3FOLA 3REWA 2ZOKB 1IT9H 2DQIH 2R0ZH 3QEUB 4A7UA 5DRWB 4K94H 2HP4A 2WUCL 3CSGA 1T3FB 3PNWB 5FGSA 3JWNC 1QR4A 5T5FA 3I9PA 4HMCA 3FK3A 3C5SA 5BUPA 4FQ2H 4MAYA 1O5PA 2PXYA 3F00A 1PL3A 1WEJL 2QADC 3LHPH 1QRNA 1YEDA 3VVWA 1KJVB 4ZNCD 1RFDH 2AZAA 4G7SB 1HOCA 2APTA 1I8MB 3BVDB 3VFGL 5D96C 2EO9A 3RA7L 2WBXA 1HIML 4N2CA 3ZUCA 4GUQA 2B2XH 3R1GL 5JO5A 4U6HB 3ASNB 4Y1AB 4KBPA 3M8OL 3UCQA 4GP5B 1WLHA 4KQ4H 4KXBA 4J3OH 3VD7A 1CS6A 2HG5B 3M45A 1QTYT 4RFEB 5J0BA 4M5YL 2F18A 4FDWA 5FLUA 4PJEF 5I1AA 4GQRA 2JKJA 2AS5M 2YXVA 4TNVF 4OZHA 4AE0A 4NUMA 5JDSB 1TQSA 1KXTB 1VHPA 2ITDB 1KNOA 2ICES 3APCA 3BWUF 1KFAH 2AXHA 2O61A 2DYRB 1GY2A 4M9OA 5F88A 1YEJH 3PGDB 4YDNA 2VYRE 1X9QA 2W88A 4JDVB 1UM5L 1YNKH 1GTFA 1D7BA 2PYFB 3ARBD 2VZ3A 3BKYL 1JYXA 1ZT1B 2ZAIA 4D8PB 1P5VA 4P2QB 4F57L 3H8NA 5IQMA 4OFYA 4MNQE 3LZFH 4Y9FA 4NO3B 5I9QB 5C0IA 4IRJA 1ET7A 1IEBA 4BH8A 3EYQC 4X6DE 4UQCA 3QQ9C 1DVYA 4XBPB 4JZNB 1A5FH 4WGVB 2YPVA 2Z4QB 3DO3A 4YDKH 4OLVL 1I9JL 1LWHA 3D85A 4IBVA 2ALWA 3SY0B 1H6FA 3H55A 1KYUA 3AUWB 2FQGA 2R2BB 4XMUA 3ZE2B 4MQ7A 5T3XL 3T3ME 1EGJL 3BWSA 4ABUA 3C08L 1HNFA 5EU4A 5IHUL 3Q2NA 3QAZC 3OAYH 3UROR 4AV0A 4HKJA 2FEEL 5D70L 2KDYA 1YN6B 1R34A 4L9LC 3CHSA 1SY6A 1K3ZA 2WXOA 2WB7A 1RIHH 2RGSA 2ZSVA 4GNKB 4N2GA 4YHYB 5KYYB 2R29A 2E8ZA 2YN5A 3JWOC 5BS0D 4HUWB 1A3RL 2WXGA 4QD2E 1B6UA 1R3KA 5T3XD 3RVVD 3MCLH 4R26H 4K9JA 1MFBH 1YY9C 4MCMA 2R7EB 3ALXA 2IDTA 3QRBA 5BJTB 5LNDA 2YC1A 3K5RA 4UQ9A 4QRPA 3HLAB 4QRQA 3CVHB 2XIBA 2BY1A 1T5XB 4JRXB 3SE6A 1MFDL 2O5ZH 2C5DC 3VXSB 5BOZG 2NUPA 4TLTA 2Q86A 1F4WH 2VLJD 3G5YA 1WS7A 3TS8A 4H88L 4AEIH 3ROLA 1XIWC 2BSDA 4GS7C 4JG5A 1YHPA 5DRZB 2Z31D 2W8CA 5FYJH 1OAXH 3U4EA 2DS4A 5DJ0B 1R24A 2B59A 2CBOA 3EUDA 4BXVA 5HVHC 1ZXQA 1ZLWH 4JKMA 4JPIA 1F8TL 2AJ3B 2E0PA 4XODA 1LHZA 2XFXA 4K9EL 5MHSE 3OKEA 5EIQA 2KERA 4Z7QE 2BCKA 1CVRA 1HEZA 5CP3H 1XH1A 5FO2A 5I75C 3QQDA 1F4XL 2YSTA 1T80A 3KEDA 1S5IH 1JK9B 1U2HA 4LOUC 4NP4H 1NCHA 1UT9A 4GRWE 3FNKA 1S9XA 4H0IA 2RB8A 2DQFA 2A9BA 1IFRA 4QJ5B 2FX9H 3C8KB 2XVGA 1A3LL 2Y2TA 1DZBA 3SZ6A 1GOGA 3V6ZB 1XQ4A 1AZNA 3GEFA 2UXVA 4JFOA 2PF6A 3FXIC 3WGUB 3B5HA 3CQQA 4R4FH 5E7BA 1CPUA 1ZTXH 5FEBA 5J13C 1NFDB 2EIBA 2O6FA 3ECWA 2YQ2A 4Z8FL 1MAML 4XP1H 2Y07L 3P4OB 2FX8H 3ARGD 4XPFL 3UXFA 43C9A 5IMKB 3SQOL 1GSMA 5F7DB 4TS6A 4Y5VA 2A5UA 2ADGB 1QFPA 1VCAA 4JRYB 4LLAA 2C3HA 3WNLA 1BMZA 2A9NH 4MJIB 5D1ZB 3F5WA 5DVMA 2XZAL 4GKZB 4NGHH 5ILTL 4AW4A 4EUPB 1KDIA 2DBLH 2VLLB 2WNGA 4O2EA 3WJMA 4LSPH 2L7UA 1DUZB 5KVEE 1HWGB 1MEXL 4YNYB 5KSVA 1MW1A 3KEHA 1SJXA 4XXDB 1I8UA 4PY8J 1AXSB 3WXWL 1KC5H 4IHBA 3NJMA 3B4NA 4J8RB 2HRLA 4U6VH 5DVPA 1KT2B 1O9WA 4UTAA 2XZQL 2Z93A 4H8WC 1QR1B 1PNCA 1TZHA 2O6CA 1ID2A 2ZCKL 4RAVA 3KPRA 3CVCA 1SLWA 3OGCB 5CZVL 5HHXL 5AW6B 5I30L 2XWTA 3OPUA 2GC4C 5D2LF 3DX8B 3ILEA 1XCWA 3KD4A 4M7LL 3B7YA 3OR6A 1AFVL 5I24A 1YMMA 4X5WA 3FTZA 5LWYH 1YEFH 4ZUVA 4KZCA 1CLZL 1GMIA 1YY8A 4R2GC 1M6OA 2X7LA 1CZ8L 1N64H 2OCJA 5HHPB 1P53A 1NGYB 3OKDA 1LNUB 4LZKA 4LOFA 3VXPA 1U8QA 2VM4A 3MA7B 3NZHL 3SOBL 4G5ZH 2UZXB 2F54D 3FCTA 1TMQA 1H6UA 1IAIM 5BXFA 1ROCA 3GKWH 3Q2CA 4LASH 4R97B 4Y7MA 4XBMA 4OGAC 5B8CB 3P0YL 3ZJAA 3W5NA 5ISZD 4FXLA 1VERA 3TN0A 3VFVA 4FFZH 4POYA 4YGAB 1MJ8H 4K71C 3WDIA 3SBQA 4WEMB 3L7EB 4NPYA 4PVNA 2FSEA 3CX2A 2CO3A 5CJXC 1S6NA 1PLAA 1UT1A 1TTFA 4LKCA 2WIIB 2Y22A 4I85A 4PCTA 3VFSA 1O7DC 3GHEL 3RLSA 3MJ9L 5E1GA 5IEKB 4WRLA 4HETA 1TFHA 4MJ6A 3N0PB 3H9SE 2IANB 4U1IA 3GGWB 3D9AL 3NJFA 3WFHB 4N26A 1LO5A 2XPGA 2NY2D 1A7PH 1UOLA 2E7CA 5D1XE 4XZ4A 1OXYA 2XWCA 2WOBA 4JCMA 4LLVB 2R56L 3HC0B 3AXHA 4ZT1A 4M00A 3O6ML 3UAEA 3HG5A 1RJZA 25C8L 2H0JA 3TVMA 5DJAB 2ZUWA 3X14A 3PHOA 1N8ZB 1CG9A 4QIRA 2WP3O 4Q52A 4X9FA 2O5NA 1U21A 1J9SA 1DZ0A 1VFUA 4P5TD 4HA1A 2J20A 1UH4A 3WG7B 3QPQC 5C0BD 5IFAH 2D7TH 1M4KA 1SXNA 3BUQA 3DXAA 3D30A 5BQ7A 1R5VB 1S8DA 2EACA 2KMWA 2A1WL 2FJUB 1DANT 1IAOB 4DP4X 2GEQA 5E8EB 3GRWH 3SE9L 2R8SL 2PO6C 3EBHA 3L6FA 2QMJA 5LVEA 3O8XB 3I6LE 5DHXB 1ZHNA 4HJGB 4FZ8L 3K6DA 4R7DB 4POUB 5I82A 3SPVA 7PAZA 3MUY1 1GJUA 2VXSL 3JTSB 4IBSA 3MNVA 3QA3A 5DSCA 2MCPL 4JDEB 3E2HC 4YXLH 3BZDA 5BRZE 2VDML 3TO4D 1WWBX 1SVBA 3GXNA 1R5WA 5DI8A 3WLBA 5F6IB 2BSCA 3BDXA 3P0VL 3TESA 2BLFA 3FMGL 1EUTA 3S36H 1X5YA 3CFEB 1IM9D 1KBPA 3DROB 2Y3NA 2BS8A 4XXWC 2GJ6A 4MWFA 1R1CA 4OJAA 4LCWA 2I7OA 3V4VA 4KJYA 4GEIA 3D18B 4LRIA 2D3JA 5L88L 3QIBA 3VD5A 4AM0Q 4NQUA 5GRYA 2H3NB 3P3UA 4MLIA 4AE1A 3ULVL 4YXKH 1IU1A 1CGXA 1U2CA 3QIUD 4Z3TA 1QRNE 3IGLA 3A6CH 4IOSD 3UTSB 1T1XA 2XQYA 1U3HA 3MBEB 3KBEA 1IGIL 4Y2LA 3OC5A 4YZFF 4ISVA 5IUCA 4UQ2B 5I6XB 2KUTA 4B9KC 2CKBH 3S88L 1MPAH 1UUNA 1WP6A 4U1MB 3FTXA 2Y5TA 3ABLB 2HX8A 1F5WA 4PJHB 5K9KB 3SGJA 1RUML 3JSSA 2NLJA 1S2EA 2QLVB 4P2OA 3SBWC 2FX7L 1RY7B 5HJDA 4O5LL 3LN9A 3W1ZA 3IPEA 3ULVD 4Q89A 3PP4L 4XNBA 2J6EH 3UTTB 4AG4L 3ZTNH 1NEUA 2BSBA 1LEGB 2LLNA 1EO5A 3QG6A 4ZDHB 4NUGL 1HL5A 2ED7A 5DQJA 1TZGH 3GSNL 1BZ9B 2YFNA 4OF6A 3ARFC 1ZSDA 4LKXA 3ZQXA 2XKSA 2ZPKL 1DVUA 4FMVA 3QO0B 4M1DL 4H8QA 4YDLC 3U36A 4C8XA 4F58H 3P4MA 2QGDA 2IALA 2K4AA 1RZ8B 4M1CC 4F9LC 5H4YA 1MJUH 5TPWH 5AAWC 2Q8AH 1MCFA 4NZTL 2QADD 2GJZB 2JF1A 4FHJA 3CC5B 3OKLB 3PP3H 5D2LA 3W81A 4IGBB 1DBBH 4DKEL 5ICZA 3EGDB 2EDNA 3O9WB 3UPAA 3EJZC 1WS8A 1GGCH 4UMSA 5GGVH 5CLXA 4YEFA 4TVUA 2KQMA 2QSTA 4UV7L 1HHGB 3D0LA 3ZIYA 3FJTA 3LZPA 2E9WA 5CHNB 3DARA 3HRPA 1NAMH 3FQWB 2J5LC 4WAFA 1UWXH 3ESOA 4E0RB 2Y7QA 3RL1A 1E9QA 3I3DA 3V0EA 2VDRL 3NN8A 4NQCB 1FG2A 4WV1A 1XTMA 4R90L 2I60L 1VPOH 3E8UL 5A7BA 4I3SL 3BKJH 2NY3B 4U1HA 3L3GA 4ZI8A 1BXUA 1RK1A 1QUPA 5JDJA 4NENB 2CDFB 4HIJA 5HYQB 2X2JA 3NCYP 3UBXA 1IBYA 1FYTA 1JXFA 2W38A 2DL9A 5I71C 4GXVL 1AO7D 1JOIA 2DD8L 1KB9J 1JWSA 1M53A 1LD9B 3FTWA 3ECQA 3IF1B 4KPHL 3UEZA 5F89B 2GHWB 4JM2D 2B5IC 1AH1A 4XNZB 1BXXA 3SO5A 1MN4A 3DUSA 2ZOOA 3ILPA 5FM5O 4F93B 5T1KB 1PYWB 1DBML 1UYWH 2IH8A 2F1AA 1WYJA 2W94A 1ZIBA 3EYQD 4JQIH 4YPGA 3SBRA 3MRKB 3QQ9D 1WAAA 1KN2L 1QLRA 5KAQF 1J1OL 5C0JB 3RI5K 1I4FA 1PBYA 4ENED 1ET5A 2ED6A 1REIA 5E9DA 2AQPA 5LBGA 3G6JB 3B2UC 1QKZL 3QZNA 1HH9A 3EGSB 3UACA 4F92B 2XA8H 2EVHA 4KK9C 3CH8A 4Z7OB 1K4DA 4Y1TA 4K3EL 1S46A 3KXFE 1KBVA 4P4RA 2C1OA 1UJ3C 5FUCC 2EDWA 4FJZA 3VD4A 2MOQA 5AQ0A 4ELMA 5ANMB 5F1OB 5FUZL 3UJIH 2ZQKA 5F96L 4ODXA 1IM3B 1FE8L 3BSZH 3FQTB 4DGVL 5IOPB 5B22A 4TSBH 4ZPVB 4UT9L 4CW1B 5ANHA 1DDHB 1KACB 3TBSB 2X4TA 1PX4A 1BM3H 1RZJC 1JF6A 4XR8C 1JDDA 2XWJB 2NUTB 4AYEC 5AD0B 3ZE1B 1BHGA 5HI4C 4G1EA 3T08A 2B15A 3VRJA 4I87A 2NY1D 2MH4A 1YNLH 3DUHA 3K3QA 3BWAA 5IB4B 5TFSL 3S35X 3NUKA 2BSRA 3KE0A 2DL2A 1AIZA 3QWOB 1QI5A 3SDXF 5GGTA 1LXMA 4P3DB 5KVGL 3ABKB 3IBEA 1P9MA 1FSKC 5E1QA 4BGLA 4DFHA 2MEJB 3V4PH 3NSJA 4Z0BL 3WS6A 1XIWD 3DX7B 3HLKA 4KK8C 4K5NA 4WW1A 4YUEL 1WV7T 2ARJB 2P7TA 4LEXH 5CGBA 3NCXA 1Q9LB 1W6LA 5AZUA 3PAYA 3NCBB 1A3QA 3D69B 4HOZA 1AI1L 3LEYH 3HRZC 1TG8A 3O3DA 4B50A 4JPVL 4YHML 4AEHL 3SKJL 4FXKA 4LRNL 5E4EC 2PP8A 2CLRA 1XH0A 3I6KA 1Z1WA 5D7KE 3EZJB 1WFMA 1A7NH 1RUPH 3NIDF 3P77A 4JO1L 4NDMB 1ECYA 3UZEA 4Z7IA 1YEGH 3AT8A 3NTCH 5C9KA 4X42A 2BP5M 3NCYS 4DN3L 4WVRA 3VXUD 5A40E 5JIMA 1MCEA 5H37A 4XNMB 3DBSA 1MCIA 2MQGA 5HGAA 1FN4B 1NGWB 2IXQA 4G43B 3B9KC 3WTXA 1GA2A 4XMXA 3V6OC 1MI5A 3QC5X 3BFWA 3BVTA 4L3FA 3BGMB 1XF3B 2C1PA 1HKFA 2AEQH 1YNTF 4FZEH 3V6FB 3DECA 3A6OA 4GXUM 4D9RD 4PJEE 2NTSP 4PJDB 5IQLA 2D0FA 3HBQA 3W82A 5T3ZE 4BZ1H 3Q8AA 4Z3HA 4H8WL 4G8IA 3OZLA 2AK4E 4G1MB 6FABH 4NLHA 2CA4A 4R0LA 2WINA 4X8JA 4BRJA 3NSXA 3ZKSD 4YHPB 1L5GB 1L6ZA 1UFGA 2E7HA 4F9PA 5A16A 1JS4A 1CUOA 1G5GA 2X89D 4Q0XH 2ZF9A 3HFMH 2EE0A 3PQYA 4L2YA 3VSVA 5FDWA 1BQLH 2Z8SA 4OB5L 3P73B 4MAUH 5FWRA 1GGUA 2WQRA 3EJRA 1JV2A 3O3AB 1EZVX 3T4AB 1XSIA 4U2YA 3BDYH 4BSVB 3VD0A 1XL6A 3DDFA 3HS0B 4U33A 1QNZH 3GMMA 1F45A 4OZFH 5CMAA 1U8LB 3C5JA 5C2UB 4Y2DC 1ACYH 5KVDE 5H35B 1Z0NA 2ZYHA 1GZHA 2OR9H 3ABGA 4L1LA 3ZHNA 4R2GD 1QSZA 2WXKA 5I0ZA 3IJEA 4NXKA 1BJ1J 1VZHA 5EFIB 5CFHA 1BVZA 1MFNA 1S7TA 1YPZA 2VDPB 2H2SC 4GP8B 4HAGA 4L05A 4B3EA 1NBZA 2CRYA 1P4LA 4JGMA 1JHKH 1XGRB 1IAIH 3FSOA 3T2NL 1FJ1A 1BQ5A 3Q6GL 4RWYH 3D3VE 4Z6AT 2YRPA 4KI1A 2BVYA 4GBXB 3VFUB 5FO7B 4OGAD 5I8EB 3QQ3A 4GO8A 5EBLA 4M48L 4F7TA 2A9DA 3P1VA 4AIZB 3C5XA 4FTVB 3IKCA 2WTRB 2H1LM 1NDTA 2DM3A 4R5TA 2A99A 3WL9B 1RAMA 5TDOB 3HPJA 3PWNA 3CPUA 1R3LA 3QR2A 3E3QE 4A37A 5DRNB 3A67H 4C59B 3JWDC 1B2YA 2YPLE 4ORGB 1OAYH 3EG9B 4LBEB 2BP0A 1UB6B 4M7ZB 5KBDA 1TSRA 4HWNA 4IKKA 2BNRB 1ICTA 1FZJB 1EWHA 2ADFH 4UOW0 1VGKB 3GXPA 1HZHH 2FCBA 3PWVA 4K3HA 4QYOB 1F11B 1P84K 2VQ1A 5TE6L 3VYPA 1MY7A 1YLBB 3IDNB 2XN1A 4JB9L 2WWMC 2F5BL 2ZYIA 3SJVD 3A22A 2ZYSA 4BH7A 3IU3A 5CCKL 5L8LB 3T4YB 4OVVA 2EYSA 1U8JB 4M3HA 2X2YA 1W15A 3IWUA 4HKBB 3VB9A 2ZIDA 2P9RA 2XWEA 3KPTA 1DSWA 1FORL 2QGCA 3GPSA 4NQDB 3L3JA 3V0AC 3VXTA 1ECZA 4M29A 3UZVA 4FP8L 4J3UA 5HHNA 3QPQD 1MIMH 2XCMC 4ZW7A 1JGLL 4P59H 4DQAA 2BHYA 2FT8A 1RP9A 2WLYA 3QH3A 1E50A 3K7UA 4PW9A 1PD0A 5IQNA 3EFFB 4ZUTB 2JI2A 5CS7A 1RZFL 2XZCH 1WJ3A 4UQDA 5EOQL 2JIXA 3OWEA 1MIEL 1U95B 2JKLA 2PO6D 2RR3A 4XAWL 5DFWH 4JGNA 3QP3A 2JXMB 4YSOA 4LSSL 3SDXA 2HTLC 3DX6B 1AQKL 5HGBB 1Y0LB 3MGOB 4L5FE 4MZ2A 5E2WL 4UM9A 4YBLB 5E6IC 3VAEA 4Z7WE 4UQ3A 1GGBL 2FJFA 3B9EA 3CZEA 4JFDA 5BZWB 2EVIA 1EERB 1TKWB 1AZCA 1TQBB 4G71B 4OV5B 2X70A 4ZD3L 1PQZB 4F7EA 1KGXA 2I5YH 4JFEA 2BNQA 1NCBH 4P06A 5KBNC 1A2YB 4PI0A 3VFOB 1CDBA 1N67A 1SFHA 3IMSA 4L0PB 2OL3H 1SVZA 4OZ4A 3F7YB 3H56A 4GAAA 1NCDH 3PL6C 5I18L 1GW0A 4O00A 2Y7SA 1CIUA 3J2PA 4OLXH 1QG3A 4UDUB 2FHBA 2VLRD 2GT9A 5D2LE 5IG7A 1AGCB 1H15B 4R3SB 1SFDA 4GI9A 4XMLL 1QVOA 4N22A 4U2ZA 5F0MB 5FX3A 1OTTD 2BHZA 1OAUH 1P6WA 1OSEA 1VENA 1BV8A 2AJXH 4XX1G 2XJKA 4RRPG 1ORQB 4RZCB 1AHWC 1BGXL 5SX5H 3CC1A 1AKJB 4PJCA 1JXKA 1RJCA 2VO5A 3GBNH 4KI5C 5EF3A 1KXQE 1BEYL 1TLKA 3EOAA 1JSYA 2G75A 4YDJA 4YS4A 2ZOUA 3KG5A 1OB1A 4N2NA 3EYSH 3INUH 4L8SA 4M4RB 4ACPA 4NSKA 5FO9A 2RD0A 3QR0A 1WF5A 2D4DA 4LVOB 4OQ1A 3DSNB 3OAZH 3QJSB 3QEQA 3O2VL 1ACXA 1PZ3A 3Q6FA 5IROC 3OF6A 4F2FA 3OWRA 3UAFA 1XSKA 2ZX9A 1MCWW 3ARFD 5DC2A 5IQ7L 3ZZ1A 3FT9A 2FJSA 1BYNA 3FQXB 1XGPB 2IOOA 4PJ8C 3U9PL 3DSFH 3F7RA 4HCFA 4RFOL 5BO0D 3CWGA 2VMDA 1ETB1 4QT5B 4DKDC 3I84A 1CC3A 2HJKA 1SJEA 3V5KB 4M1CD 5PAZA 4QF1A 5JOFA 1YG9A 5J56B 3G6DH 3OQRA 4I4WB 1JD7A 1G7LB 3QUYA 2HB0A 4YHIA 2ADIB 3KWVA 3L1OL 2XXMB 4Y4HC 4A6YB 1QUNB 3ARQA 3H7BA 1BJ8A 3LJ3A 4D9QD 3F01A 3EJZD 4OFPA 4OFVA 4E9RA 1P7KA 4U1KA 5D71L 3W2DH 5CUSL 2WVVA 4WTQA 2CRMA 4HUUA 2B0SL 1KY7A 4DIXA 5GS2D 3T04D 4PJIA 1KYOJ 5ALBL 5AW4B 3A6BL 3IGKA 2CBPA 4AYFB 5HHVL 1SF5A 2DICA 1WQVT 1EEZB 4W4NA 3B37A 1J8HA 1A8ZA 4HT1L 5KBMA 3WSQH 1F97A 2JKTM 4G6JL 1H9VA 2DTML 1NL0L 1BM7A 1A1NB 1Q4NX 1H8LA 2EP6A 5I1CL 4XC3H 2VLKA 1HL4A 1FFTB 3S35L 1B0RA 2WQXA 4NKDB 4ODTH 3TBCA 2X0VA 3THML 2CBMA 3KGRA 3K6SB 2RAMA 4RETB 2VL5B 4GQZA 4ZQTA 2DWYA 2XI9A 2PYEE 3K71B 2MTAA 3GINA 1QOKA 1B6DA 3GLDA 4H8UA 3TNMA 5IY5B 1XR8B 4OFQA 3NABL 4U0RB 3OPZL 5D7SL 1NC4A 5DD6A 4OCRL 4TSCL 4AJWA 2WXRA 3PDOB 2Y7NA 5LBSA 4UYPA 2HSIA 3OMNB 2CJ3A 5DJ6B 3GZQA 5I0DA 4UU9B 2UVFA 3L3OC 1GYAA 4D9LH 5AKRA 1JYVA 4HSAC 4PRPB 2R59A 2X6VA 4OF7A 2RMNA 5IBUB 3KWTA 4WEEA 1RZJL 2CGZA 1MRCL 2EKJA 3FSZA 3RVXC 12E8H 3RU8H 4KK9D 1IEAA 3NFNB 5F3FA 3LRSB 3QI9C 1WZKA 4Z23A 2K45A 3H3PH 3QJUB 5D7LE 4HXBH 4PJBA 3UAAA 3NRQA 4WW2C 3S4SA 1QBLL 5JHLH 3MRJB 2CM5A 3DTXA 3FUIA 4X6EA 5SWSD 4OD1H 1DQJA 1J1PH 2DQEH 3MNMA 4UTBH 3L16A 2YEZA 2IH1B 3BDBA 4YZFE 5AW3B 5E4AA 4MBRA 1HQ4A 2IV9A 4QCIA 3V7AE 1H8SA 2X2UA 1D5BA 3MFGB 2X87A 4H20L 4QEGA 4PS4H 5HI4D 4I0PB 3OX8A 3S5ZA 5L9DL 4G8AC 4GW1B 2DQIL 2X28A 2VXVL 5FPIA 1E9PA 1U8NA 2ZX6A 2ZKMX 3GLEA 3ZGIA 3G5ZA 4RLDA 3EHBC 1N26A 5LCVA 3UGXA 4TQ8A 3TXAA 1JXGA 4N90D 3K6NA 1EAJA 4UBDC 4CA4A 4BFIB 1TSHA 1AS7A 4UWQB 1UWFA 1QQDB 3VRIA 2PCFB 3FTUA 2NXYC 4WQOA 2Z35B 4U1LA 1MQKL 4G3YL 5AYUH 3S37X 5EF1A 1ZV9A 4UYQA 4EUPH 3HZVA 1FVDA 4KUZH 3MBWA 5JW3H 4KK8D 2N0MA 3MV9D 4EN2A 2QFRA 1GR7A 3ULSA 3E6HB 4CADA 3I9GL 1TVHB 3NACH 5J1AB 2CDGA 4ZZFA 2KHAA 2DOCA 1DANU 3TONA 4IHOA 5C7XL 4JG1H 3GBLA 4OIBA 4MNQB 2OQJB 1FFOB 3L9EA 3MFFA 4NI6A 2G5BA 3CFBB 5L4FA 1BVKB 1ZEAH 4IMLA 3V4UH 5G55A 3WD5L 2D3NA 3QUXD 1FH5H 4X6DB 2Y1YA 5KBPA 1DQDH 3GXUB 2XWZA 2D31A 4C47A 1NBYA 4NHUB 2IDFA 2VITB 2O72A 4YHKH 2OMVA 2I7SA 4NUJA 1YEJL 3VXMD 4MJ5B 3DUUA 4F7CB 3T3MB 2XKUA 4LIQH 1BX2B 3B9KD 1CBVL 2IWFA 4L23A 3F3HA 5F1KC 4DTGL 3O6FA 4Q9RH 4UV4L 2CUMA 3WDJA 3OHXB 2E7BA 4JPWH 4JZOB 1GKOA 1JMXA 4J6RH 5E2VL 3MYZA 1G9NH 4UDTA 2EKSB 1CLCA 2OR7A 3B5GA 1MLCB 5CIPB 4AV4A 4P4KA 3PV7A 4WU7A 4XP5H 5SX4H 5FC9A 3DRTA 1ZLUK 3WJLC 4CBPA 1OGAA 4KO6A 2GITA 1T1ZB 4S1RL 4OGQC 2PLTA 3GMPA 1SYVB 1F86A 2C3WA 2ORBH 3AREC 2OYLA 3ZK0A 4POZC 3O2DH 1JGDB 1WFUA 3R4RA 5HYJD 5M95B 4R4NC 4UOJA 4OUOA 3KNBB 2H8PB 1R17A 4PP2A 2KLRA 5IHZA 3VFNB 4KDWA 3VG0H 3CBJB 4OCWL 1UWGH 3IJSB 5C08B 5IR1A 5DD5H 4FLRA 1HCFX 1URLA 2MMXA 1CFSB 4RCAA 4Y2DD 2KZBA 3MCLL 4F37K 2QQNL 2PW1A 1ZLDA 2XHNA 4JFHD 1EHAA 5F44A 3MDJA 2ZWKA 1XMWA 3PF2A 4KRPC 3FRUB 3DKHA 3EYFA 4P46C 3C6LB 1N6UA 2H2SD 2O5ZL 3ALPA 4QJ3B 4Z7QB 4F1SA 2XQYK 4F7MB 1W0WB 3N85H 3P9MA 4FA8A 3JWDL 1BXAA 5HDQH 1Y6KR 2NQDA 4ANVA 3WKQA 4MD0A 4FNLH 4YR6B 1BFOB 4WI6A 3CXFA 4GRWB 4ENZA 4W9ZA 4NM8H 1P4BL 1MKFA 1ZWIB 3GUTB 1OL0A 5CGTA 2Z8RA 2YD2A 4JQVA 3IDYB 2E75C 2QTEA 3FT2A 3HE6A 4YC2B 1HEJC 4K7PL 2KYIA 1MWAH 3NVQA 2I9LB 5F7YC 1EBPA 1QTPA 2FYYA 2P5EE 3SDXE 4HK0B 1PTZA 2GI7A 3Q5OA 3N6YA 4DZBA 4PJ7A 3X3FH 1FAKT 4AI7A 5E8DH 2VUKA 1MCWM 5FECB 4FQXB 4DERA 4HBCH 4CMHC 3RZCA 4R4BA 3FTGA 4IBUA 1OP9A 1E6JL 2AJSH 4EVNB 2L7EA 4JQXA 1WIPA 3N55A 4G42B 5H37G 5LB1A 1KBBA 1BG1A 3VDAA 2FWOB 3B7RL 3A47A 1VZIA 3UTZB 4CDHA 2GG1A 4UIMB 4L1BA 1HJCA 1RIVH 5KYWA 4YL9A 4BA8A 4PS7A 2V8MA 5EZIH 1GXEA 3ZDYE 3QDJE 4WCYH 3LAFA 3X13B 1WCBA 3NIDE 2F6AA 5B4MC 4R6UA 3N1QC 1XR9B 1FL6B 2Q10A 1A7QL 4WFHD 1YCSA 3RTQB 1PY9A 1NIFA 2X6BA 2LTQB 4Y5YA 5A2BA 3CSFA 4YWGL 3GHPA 4IU2B 2X4QB 4XCEA 3RNQA 3BH8A 4P3WA 5DT1H 3A0OA 1QFWM 4O9HH 3IDGA 1IQWH 5DMKA 4IS6B 5I1LA 3VGBA 3BP4A 3GSOA 1AGBB 2YEQA 1M42A 1OTSC 2HTLD 3X1EA 5FW7A 4IDLA 5FYKH 2YRZA 1L3WA 5E8OB 3V9FA 43CAA 5CM1A 1JV5B 4KH2A 5E6ID 4F5CA 1FVCA 3EO0A 5KSAD 2DMKA 4AEFA 2YKLL 3BFOA 3C09B 4JO2H 1EAPB 5EO9A 3T0EE 4Q4IA 4G9FE 4GXUN 5LWYL 3L2MA 4QUOA 3UJTL 1RZIB 4N0YH 1HZLA 3L5JA 1CD0A 1NGQH 3QJZA 4BCZA 4CRPA 3MLPA 4Y4KA 2WYTA 5E6ZA 3U6RB 3KM2A 2CCLA 5CSZB 5FCUL 3PGFH 2DYSB 3OJ2C 4Q6IB 3OZ9H 5DQDL 4JJ5B 2P8PA 1UVQA 3EH3B 1V3MA 5SWZE 3PL6D 4NNPL 4X5RA 2UUDK 3QCVL 3H9SB 4HWEL 4W1TA 1E67A 5TGBA 3MLZL 4ODWA 1NAKH 1ODAA 2ATKB 2NT0A 3STLA 3JV4A 1TEGA 4NRXB 4O2FB 4YO0A 2PETA 5D1XB 3FB8B 4G8FA 1SDDA 1KLGA 4N8VB 3VJ6A 3NJKA 2IH3A 3QRGH 4WWKB 1G7MA 4FABH 2XQ0A 3MACL 3S3PA 3S8GB 1CFTA 1QYGL 1UQSB 1AGDA 4G80A 1UENA 5LGJA 4R96B 2C4XA 4FLSA 2MCG1 2VDKB 4KI5D 3ATFA 2BY3A 1QO3B 4KH9A 2K9UA 3MROB 3CD4A 4G7RB 5I5MA 3QNZB 4DW2H 1BOGB 2WXMA 4KXZH 3RGVC 2Q2LA 1HXYA 1AGEB 1TMCB 1UKQA 4ONOA 1XF4B 3CN0A 3SDCC 5IROD 1DO6A 1DVSA 5HY9A 2J73A 1T89C 3BAWA 1EA9C 4ZFQA 4IYKA 2EIZA 2VABA 1EEYA 4PJ8D 5GRZA 4RGMB 4L37A 2BVOB 3AY4A 3PCYA 5CU5A 1EZSA 3BPCA 3B7UX 3WKPA 1T83C 5F2FA 2NR6C 5IF0B 1ZGLB 3EW3B 1W72A 1HCVA 2MNJB 3HNSH 1WITA 2DQUH 2JKSA 4HC1L 2N01B 3GXTA 4Y4HD 4X6BB 5E5UB 1Q0YL 5BRZB 4I1RA 3A5VA 1XZWA 4EN3B 2ZCLH 4GG8A 1FPTH 4Y2OB 1MFCH 3FT3A 3MRGB 4LHUB 4UINH 2YLHA 1G7QA 3L3IB 5GGSY 2H7WA 5JHAA 5DUBB 2O26U 4N68A 1M7IA 3BGAA 4JW3A 5GRXG 1X5LA 2FK9A 4EIZC 1FFNB 1OHQA 1ZHKA 4BKTC 3EADA 1HC1A 4PS3A 5E6SB 2K6ZA 3VGHA 4BM7A 2ICWA 4IIQB 3W38A 2AJVL 2A6KA 2PPFA 4WJ5A 3RIAK 3CFJA 4HJ0C 1I9RL 2CQVA 5T1DH 5L4MA 4XVTL 1UATA 3PWPA 3V79C 1Q72L 4KRMB 4KMLB 1CD1B 5BZDB 4ZFGH 1ZA6B 3FO9B 2EUZA 4MCYB 3FONB 2C3VA 1NGZA 4HIQA 3RWJA 3S36L 5LDUA 1ZANH 1H0DA 1WAPA 2OMBA 3Q1SL 4LU5L 1OP3H 5DJ2B 3KYMB 1DBJH 4FQJH 4BFFA 4BKLB 1KMGA 2JJTA 3QUML 5TQ0L 4FXTA 5KJRH 1FGVL 3IDJA 3HG3A 2DMBA 1QABA 4XNUH 1CK0L 1B4JH 1IGTA 5HHOE 3K4DA 5HP5A 1KNOB 3A6CL 4ZXBC 2H9GA 4HK3J 4N0CC 2VDOL 1AQMA 3MRIA 5JW4N 4L1HA 4AQ8A 4IKJA 2ZP9A 3VGEA 1WBZA 1KPVA 4Y16B 5F88B 4GSDL 5IB2B 1MPAL 3TLRA 1WC7B 3OC8A 5EDXA 1R3IH 1NFIB 1P5VB 1A4JB 4L4VE 3JV5A 4AH2A 2FZ3A 2WLMA 3ZZSA 4PR5B 3GMOA 1MFEL 1WWCA 2GK0A 5C09A 1CQYA 4KY2A 4JDTH 1EAQA 2HKHL 4AQ1B 1UD3A 2WZ6A 3B6SA 3X11B 1ZHLA 5SV3A 4M6NH 3VWKA 3LKNB 5EU7C 1M2VB 4ZFZA 2MQ3A 5E2TL 4MQ7B 2LU5A 1L9TA 2WBJA 2JB6A 4QTHA 4AGOA 3Q8BA 3BIBX 3C5ZA 3VGDA 2DZEA 2J25A 4AQAA 3EHBD 4XMKL 2G9HA 4PV8A 4Y8AA 1UWEH 1A1OB 4KU1A 4UBDD 2FTAA 2HLAA 3LY6A 1PLGL 4E9VA 2NXYD 3KGUA 5DD0H 2NY5H 5ACLA 1CDGA 5EOCJ 3D0VB 2IBZY 1TETH 5INDA 5TDNB 4DGYH 1EHKB 3BEVA 2N7BA 3KHQA 5IJKC 2ZWLT 1JVLA 1WAEA 3GSWB 1OGAE 4R8WH 1VFBA 5JUEL 4Z78A 1EJ8A 1DJSA 3RBGA 5BCAA 3OJMB 4FEMA 4LLDB 2WLIB 5DLML 5I9QC 1VEPA 2NQCA 3BLKA 1RJYA 1N70A 2FQFA 5BPPA 3PS6A 4YSSA 1JF1A 5D1QE 4R7LA 1A14L 1TYEB 1J9CT 3DMMA 4PY7A 2J1ZA 4HCIA 2HVBA 2YUWA 2WO4A 1N6VA 3HC3H 5JXAH 4OUUA 3LKRB 1GPOL 3LB6C 3OR7B 3G08B 4OIFA 3F7PC 3FO2A 4M8RA 1TTAA 3B34A 2NCMA 5DEGA 4MS8C 4YHOH 4YSPA 4X99A 4YK4B 4ZW6A 1UCBL 4DO6A 4N28A 4XMPL 2VDPH 2YGNA 1JFQH 1MCQA 1ANUA 1USQA 4HQQL 3GMNA 4M9PA 3KXFB 2DM4A 4W81A 1EXGA 1MCJA 1SBBA 2IQAB 4IRZH 3KGTA 4YHYC 4XMWA 5JW5B 2ZF8A 4IEFB 3AAZA 2WWNA 2VR5A 1QSED 5DHYB 2OZ4A 5BVJA 4JG0H 5EDSA 1BLIA 3TEUA 1SN2A 2QL1A 3BKCH 2EQDA 2DIBA 3BKMH 1MFVA 1MRDL 2A77H 1I3RB 1JZ7A 3U2SA 4ODUA 1BLNB 5EOTA 1KF9B 2G5UA 2NZIA 3AB0B 3MRCA 4GB9A 5EG6C 3TBWB 2IPKB 3CVBA 4GUPB 4BFNA 4ZMOA 1JWUB 1RVFL 3GI9L 4HUXA 4I18A 4E42B 2VW6A 1CB4A 5LXGL 3X12B 3ARED 4AK2A 4M93B 5KZCD 4POZD 3SKOA 1EFXA 1AC0A 5F7EL 4R4ND 3ROOB 2WMPA 3ZYJA 3EFOA 2PCYA 3RWHA 3ARBA 1KOAA 3TA3A 1HXMA 3PJLA 3HR6A 1KZYA 2B4CC 1KIRB 2IADA 2GUOB 3SGKA 3V0GA 2V17L 3CH1A 2J6WA 1E5UI 3PAUA 3SE3C 3KH3A 2EXSA 3U46B 4YFEA 1CF1A 4JFFE 1BZ7B 4Z95H 1J0KA 2R1YA 3OB0K 2W9EH 3EO1A 3FUKA 3FQUB 3S96A 4MZ3A 1BMWA 1ZCRA 4KKPA 3K4ZA 1OW0A 3QIWD 1U92B 2QHRL 3RWFB 5EO0A 2CRIA 2V9TA 1NDGB 3BMWA 1CICD 1T4KB 4IBZA 4Y19A 4ZOEA 2AQTA 1ZS8A 3E9UA 4KRPD 2OMXA 3LKOA 4P46D 3NH7L 1A4BA 5DVNA 3HUJF 4APXB 2X9YA 2A9ML 2VDNB 1FRGL 2WKGA 4RAVB 5BVPL 4GQ9H 4NKQB 1E7VA 3B2VH 1QASA 4PEEA 1HQRA 3RTLA 2JMRA 2G2PA 4K15A 1PIGA 3G7TA 4D0DA 2CDEA 4ZS6C 1S7WA 2HZHA 1GJWA 4L8BA 4NPJA 3MTXA 3Q2VA 4HOWA 4OCYL 4ZUVB 3X17A 1I3UA 4HCRH 1FGNL 2YD5A 1DVFB 5BS0A 1OSYA 4YDVB 2BRRH 3AQZA 1MJJB 1YYMH 1EGJA 2BDNH 5B1KA 5J6GA 5CF3A 5HJGA 3VXPB 3WUWB 4ELKA 3BP6A 4G59C 4PJEB 4C56D 2VERN 3C8DA 5A43C 4P99A 5C0DB 5E8NB 5D1ZC 4GKSB 1YAZA 2AK4B 3ZRSA 2JELL 4LGPB 3D5OF 3WMSA 3HHMA 3K5SA 2E76C 3MUGA 3IMRA 1X5JA 2VLJA 4TULL 5DDHA 2X4UA 2YWYA 5CN1A 2UY6B 1DQLH 4OLUL 5J3HC 3KAAA 4GW5A 3QHFH 3N9GH 4L1SA 2R69H 3AS3A 5JHDA 2Z31A 4Y9EA 3DBXA 3MOQA 3VM7A 3IFPB 5AG9A 2AEQL 2AQQA 2MQ0A 1NCAH 4LF3A 1RSYA 4LLQA 2WQVA 4LKCB 5FF6B 1F02I 1RV6X 3T8XB 3HHRB 3E9TA 5ACZA 2TAAA 5B4MD 3OAUH 5E70A 4AGQA 2CHXA 1DLHA 1WH0A 5AW8B 2AW2A 4PTTB 2VISB 4LSUH 3MLTB 4YGVA 1LM8V 4O02A 5IB5A 2W9DL 2YR3A 5E23A 3L5WA 3MRQA 4GAYA 5CWSB 4Z7NF 4JZJB 1K6QH 3QUKA 3WE6B 4DKAA 4ZUWA 2VC2B 1E4KC 1LGVA 4I5BB 4XOBA 3FN0H 3TWCL 3HFFA 1OGTB 2CO4A 5TF1L 1QFWH 2EDKA 5EBMA 1MG2C 4PB9H 2VRQA 3IFNH 1RJZB 2J1XA 4HPYH 4AM0B 1BQLL 1OTSD 3SE4A 4R97C 5B8CC 4PJAF 1QFOA 4GSQA 1M1XB 3D3VB 1O6VA 2XQBL 1AMYA 1KB5L 2YZ1A 5EZPA 2NY6B 4XRCB 5I5IA 3GRBA 4OAWA 4WUUE 3RB5A 4LCCA 3QYNA 1NUFA 3DIVA 2IG2H 1O75A 2AXGA 4TMPA 4WHCA 4PIRF 1DVZA 5BUGA 1SRDA 3TV3L 4U3CA 5I76B 4ODBD 3LVTA 1VEMA 3FO1A 4IMKA 5HYSA 4E41D 4JG9A 2V3FA 4L8CB 5EA0L 1EO8L 1Q9WA 1RUAH 1SYSB 3KYAA 1H3TA 4EAEA 1JHKL 2YPLB 4A6YH 1DN0A 4MA7L 4RWYL 2X4OA 5FA4B 1SOQA 1JNHA 2D0HA 5GIRA 3BT0A 2HTKC 5A2FA 2ZWNA 1OE2A 5L2JA 1BVLB 4FXGB 4CNIA 2HCZX 3K91A 3LX9A 1U9KA 5I23A 4EDXB 2LAAA 3EJJX 5F9OH 2C9XA 4PP1C 2Q7NA 4JEGB 4PB0L 3U9UB 2Z1PA 3OHMB 1J86A 4TL4A 1F6FB 1I8KA 2E7LA 1TQUA 4QRSB 2Y7OA 3A67L 1A1MA 4FHKA 2QQLL 2GKIA 4TF4A 4AIOA 2CCWA 4WY7H 2X3CA 3LS5L 4FQIH 4A55A 5KVFH 3SE8H 3RGVD 1EANA 4ZW3A 2BHUA 2V7NB 3SN6N 4XE5B 5D1ZI 1GIGH 5EN2B 3TVMC 4LE8A 1U58B 1NLBL 4Q6KA 1BIIA 5FHAH 35C8L 1XF2B 2R23B 1XGTB 1Q94B 3QFJD 3O8XC 4FADA 5ISZA 1X5KA 4LESA 5I1DA 3Q8EA 5CU9A 2NLJB 5IT2L 4UM8A 4JFVA 3M1BA 3K46A 1ZTXE 2NR6D 5EC2A 3LD8B 3PAZA 1ZT4A 3WHXB 4JM2F 3MGTB 1EXUB 4NO5A 1NC2B 4Z7WB 4A2LA 2M26A 2WXPA 2GCYB 4XPBH 4KJQD 1QX1A 4ZQKA 1MCNA 1S7QB 3PV6A 3MLVH 2A4CA 4FNTA 4N1CA 3VFTB 3N1PC 1MF2L 2CJUH 3WIHH 3FQ2A 2EDLA 3KS0J 4ALAH 3O4LE 3VE0B 3PWLB 1BQSA 3VXOA 3QEHB 4PRNB 2UWEF 4M1GL 2DMGA 2EDBA 3MBEC 3QDHA 4BE5A 4RMQA 1N4XL 4HJ0D 5I6XC 2GK2A 4IK7A