4PBDA

Crystal structure of the n-terminal cs domain of human shq1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
102
Chain Sequence
AHHHHHHKMLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein SHQ1 homolog
publication title Structure and Interactions of the CS Domain of Human H/ACA RNP Assembly Protein Shq1.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2014-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pbdA00
3J07A 3Q9PA 4RZKA 3AABA 3Q9QA 3GLAA 1WFIA 2XCMC 2Y22A 2CR0A 4YDZA 3QORA 3VQLA 4YL9A 2JKIS 2CG9X 3QORB 5DS1A 1WGVA 2MNWA 4YLCA 1WH0A 4PBDA 4I88A 2KLRA 3N3EA 4JUSA 4M5TA 3IGFA 4YE0A 1X5MA 5LUMA 2RH0A 4YLBA 3QORC 2Y1ZA 1GMEA 3VQMA 4ELDA 1RL1A 2WJ5A 3GT6A 4FEIA 3L1GA 3AACA 2K8QA 5DS2A 3L1EA 1EJFA 4PCKA 4M5SA 2N0KA 1SHSA 2O30A 2WJ7A 2Y1YA 2BOLA 3QORD 4JUTA 4MJHA 3EUDA 3GUFA 3L1FA 2N3JA 3W1ZA 4ZJ9A 2KMWA
chains in the Genus database with same CATH superfamily
2YPVH 4NZDA 1D7FA 4QF1A 2CUIA 5K39B 1S46A 4OD2B 4G42A 4LDEB 3IAQA 3L3HA 5I1HL 4MVBC 1P5VB 2LQRA 5J6SA 3KLSA 4F7CA 3BAEL 2BWQA 1WS7A 1WD8A 4R8WH 4E9XA 1X9LA 2H4EA 1GJWA 4X7EC 1DLFH 1QBLH 1HL4A 3WUWB 2MOQA 3FTWA 3RLSA 5LGKA 5A2KH 5DMKA 2BSTB 4NWTL 2ADIA 3O6LH 3X13B 2K8QA 3JWDL 2TSAA 3QISA 4LCIH 1TCRA 1Q0XH 4X0KB 1KTDB 5FK9B 1H6UA 3IDYB 4KVNH 2AQ3A 3H3KA 3EG9B 2XQYG 4ODHH 1KG0B 4Z3FA 3Q6FA 4GP4B 3HLAA 4AQEB 3FTXA 4XPGH 4M1DH 3NG5A 3X11A 1WFUA 3IB4A 3QO1A 5ITFB 4KMLB 3WE1A 7PAZA 3LEYL 4CBZA 1FCCA 3BUYA 3PJLA 3U9PL 4C4BA 2R0WH 1J5OH 3UBGA 1CFSA 1INEH 5HJDA 4J5VA 4K8RH 2GJPA 2X53A 1A1NA 1TKWA 3IXAA 2LLNA 2BNRB 5B39G 1T22A 2EZ0C 4L3EE 4DGUA 1DJXA 4HIHB 1WISA 4JANB 4I0KA 4QYAA 1J10A 1FFTB 1OSYA 2Y2WA 3RGVA 1CT8B 1GKEA 4I5BA 1L0QA 2R8SH 1PIGA 4XNUH 4DZ8B 1PZ2A 4OLYL 4XVTL 3U1PA 4F5CE 3N0PB 4R3SB 2HTKD 4DP1X 5D6DC 2EDRA 2DMHA 4QGYA 4XN5A 2APWA 2K45A 2WLLB 3CFUA 1J12A 3I50H 3D2UA 4AQ8C 4TSAH 1UZGA 5JPNB 3RY6C 3IGUA 4L3EA 5B3JF 4PJ9D 2A2QT 4HUUB 3U2SA 2PP8A 5JOPD 4UMSA 5K1JA 4DKEH 1YMMB 4IBLT 3SD2A 3FO0H 3LRSA 3VDBA 4PJCE 2ICEB 4XN2A 3N1PC 1E5AA 4NPYB 5GSVB 1MKFA 5CO1A 5H4ZA 4POZD 3C12A 2I69A 4XCYA 4WJKB 4LEXL 3NIDB 2Y06L 5ALBL 4M6MH 1T04A 3GTVA 4GSDH 5SWZA 2CLZB 5DLMH 1BAGA 2IAMA 3W0WD 3MVSA 1U8QA 2WBKA 2XV6B 2ROYA 3LXUX 4O9HL 1Q9OB 3IJSA 3ZE2F 2RAMA 1MI5B 3N91A 3V4VA 3AVEA 1QLFA 4XB7A 4HUXB 1IZJA 2WBJD 1I7TA 4L4VE 2C7UA 1U0QA 1SJHA 4EN3D 3ATFA 4MA1C 1UT2A 2W60B 4HGMA 1I1RA 3K8MA 2IH3A 4F2ME 3HRZA 1EO8L 1ZLUK 1NEZA 1FZMA 2BHFA 4S1SL 4JZNA 2K8MA 4BWWA 3VDAA 4A7GF 1UB5A 1YJDC 3CVIL 2ZOUA 1RUQH 3V5KA 2X4NA 1P7BA 4KFZC 4YXHL 1BDYA 2GBAA 4X7TA 2LGNA 3BGFB 1NKOA 3Q7JA 3BP7A 3KYNA 4MYPA 5ERWB 1EGJH 4WFHD 4OZIF 3EOYG 3KPSB 4H8WL 5EU4B 5KVGH 2YQ2A 4NUJA 1JPGA 2XG4B 5HBBA 3HC3L 2VL5B 4F2MA 1KBPA 1ZSHA 3V0EA 4A67A 2DTMH 4WI0B 4ENED 3OWRA 3UPRA 3CVHH 3FQTA 4IU2A 3ILPA 5E9DD 4RAUA 2VLKE 3NH7H 3REVA 3UEQA 5KN5A 4EUPG 5HI5D 1WZKA 3SYAA 4AVIA 5FYJL 1FN4A 1KNOA 5A6MA 4CU8A 3H3BC 4FULA 4K9EH 5FYJD 4GQ9L 3S36X 4AT6B 4CSSA 5I6OA 2K9UA 5T3XD 1RZJL 4DN3L 4L0YA 4MMXB 1G4RA 1HHIA 1NSNH 4FQJH 5MEQA 1WSST 2AQPA 1TU2B 4IHOA 4MMYA 5GJSH 1ZGLA 1F18A 1MRFL 4LEBA 1XWVA 1GIGH 1WWBX 2YRLA 1JPST 3ZL2A 3ME0B 1HK6A 3O2DL 4MWFA 2WKOF 5F89A 2VLKA 2Y24A 5EUOE 4L29B 4NCDA 3KCPB 5F1NB 3SD5A 1C5CH 2AEIT 1RI8A 3QQDB 3TBWA 2F58L 1E2WA 3T1FB 2EIMB 2VRQA 3LEXB 4KXBA 4ABVA 4LOUC 4P2OB 5JXAH 1NPUA 5E1GA 3DBXA 3PUCA 2D8KA 3CC5B 1FIGH 4OV5B 3L3OB 1J1XH 3S35L 3BZFA 3L3JB 5AVQB 1PU0A 1OARH 2NDGA 4P2YA 1INDL 2PP7A 4FXKB 1D6VL 2HVKA 5DYFA 2CJTA 5F1IB 1GGIL 1EWHA 2BDNH 4AUUA 1Q9LA 2F5BL 4ZSOB 4RGOH 4OGAD 2AVFA 1AFVL 1VGKA 4UNTA 2WUCH 1EA9C 2MNUA 5T1KA 2DKMA 1Z5LB 4AENA 1DN0B 2DQEL 4B0MM 3MRCB 1XGQB 3FQYA 2WQ8A 5CJOL 4XMWA 4OJAA 3BWZA 3QDMA 3GXFA 3NQIA 3TA3A 1WICA 2J4WL 1LTXA 5IQNA 5IGXL 1NA8A 4GMTL 1FVDA 3FCTA 1KCSH 5HYSA 4P4KB 5BZZA 4JX0A 3P9MB 5LQBH 2PR4H 3LHPH 2W07A 3DTUB 1RMFL 2CWRA 2BZ7A 1G5GA 4P9MH 2F74B 1ES0A 4AQOA 4WWNA 2BFGA 3DIVA 1AQMA 2NUTB 4XOEA 3MTXA 4JHAL 3D2TA 3H3PL 2O26U 2CR3A 3RKDD 4AY0A 4F9LC 4PW4A 4Z7NE 1WGOA 4JZOB 1H3TA 1EZVX 2P46B 2CRZA 4G8GD 1H3GA 4XBGA 3IJHB 1S9WB 2R69A 4ZUWB 5SWSB 2EUZA 3CC1A 3LH2L 3R18A 3RWJA 1LJMA 4JRFA 5EFIA 2V9QA 3J7HA 1NIBA 2JFCA 3UYRL 5J13C 3IE9A 4PRNB 2BM3A 4KJYB 4XH2B 4P23B 5E7BA 5AYTA 1S7WA 3TT1L 2VZ3A 1PEZA 3U0WH 2ADFH 3ZX1A 1MLCA 1CBJA 1I7RA 3EYVA 5D8JH 43C9A 4PRHD 2V2WA 4F8OA 3OLEA 2V2TB 4ZMOA 2NYYC 4DEWA 5JHBA 1FV1A 4XVSL 4KK5D 1FL5B 2XXCB 5CLYA 1VFAA 5IB5B 5AL8A 5K9QG 4CILA 4O2CA 3QEHB 2BVYA 3P0YH 1J5HA 4KX7A 3EJQA 4JFDD 4YR6B 1QKZH 2YAPA 3U48A 1SQ2N 1OOAA 2V3FA 4I77H 5I8OH 3FT4A 1CLZH 3V0VB 2OBGA 4RAHA 2WOYA 3BPNC 5F6HI 4F37K 1N0XL 5KYXA 2EDDA 1XT5A 4KI5F 3QJFA 1KIPB 3FN0L 1CZ8H 1F6FB 5DHMC 5J1TC 1XCQA 2ZNXA 4WTZG 4JM4L 2C26A 4XN8A 2CR6A 4OV6F 1DZBA 3GEFA 4KTGA 5EU7E 3O4LD 4I13B 2PTTB 2OJ1A 3FRPA 5KYYB 5BW7A 3IMBA 2OMTB 3ARGD 4YFDB 4RGNC 3VFMA 1LE5A 2A83B 4ODSH 4LSQL 3APNA 4DOHE 5DO2C 4BEIA 1I82A 5FKAB 1JGEB 4OIBA 1D7BA 4P9HH 1QVOA 1F56A 2ZWZA 3PAVA 3BP5B 5TGBA 4M3JA 1U8OA 3MOBH 2LU4A 3QK0A 2DQ6A 3GLEA 1YO4A 3MCYA 1ZHNB 4ZUTA 5FECA 3T0VA 4MAYB 1YPZB 2Y3NA 4OCMC 1A1OA 5EN3A 4TQEL 1ZK9A 3K6FA 3UBXA 1JN6B 2BVPA 4GSQA 3E9TA 5A6LA 3B83A 5EC1B 4FQHB 1JRHI 2VWEC 2JKXA 4N2AA 5DRZB 2NW3A 4LEOA 1EHKB 1C7TA 5E00A 4ZS6C 3WLWD 1S78C 4EUPH 4X6FA 1JK8A 1SF5A 2J25A 1W0WA 3DBSA 5IM7B 1Z32X 2VQTA 4BYHA 4JL1A 3MUGA 3EGSB 3UGXA 3ZE2E 3HPJA 1OD9A 5GGRY 2FO4A 4YBLB 1FNEA 4Y1TA 5TE4H 3GNML 3OKMB 5AG8A 5CN2A 1X5GA 4TUKL 5GRYA 4CVZA 5EF1A 2X3AA 3ARFC 3P4NA 4FDWA 1R34A 4OM0H 2AJVH 1WJ3A 4UOJA 3TV3H 3LSOB 4OZGB 2BNRD 4NO5A 2WINB 4PR5B 1AR1B 4UYPA 5IY5B 3UZQA 2WN3A 5EDSA 3ALPA 4Y2NA 4LL4A 5I0YA 5KVDL 2DIEA 4WW2C 1AP2B 2J8UB 2XN9E 4K3DL 3ASWA 3B8SA 3OAZH 1I8UA 3ZSSA 1RZ7L 4V1DB 4YHKH 3RX8A 3IGAB 1NGZB 3GB7A 4GKZB 2H32H 1Z6JT 1DBML 2B4CH 5DJYA 4NQXA 5FYKH 1QPXA 3ZK0A 3FW6A 2CKBH 2E7CA 3VW3H 3SE4C 1XF5B 2DMGA 1DLHB 3SCMA 1BFVL 4A7GA 5DXWA 3HNTH 2HLAA 1XGZA 4GRMA 4GW5A 3D06A 3LZFH 1U8IA 4KJPC 1KBVA 3FFCE 1A02N 1YMMD 1N2RA 3UDWC 1CGUA 4C56A 3SO3B 1A4JA 2XN9A 1OAYL 2V5MA 2GVYA 4CVWA 3ARZA 1UKSA 1RUPH 4K5NA 3ZDWA 3IVKA 4GS7B 4ZTOL 4Y2OB 2WLMA 3WOVA 4OZIA 4W6XB 4PLJC 1A5FL 1D5XB 3D0VB 1NGWA 1MG2C 4ZW5A 2FX9L 1MIML 4RQQB 4GXVH 3EBIA 1ZKAA 3SHSA 4NO3B 4ELKA 2K6ZA 1YCSA 2P7TB 4I18C 1HHJA 1JXDA 4U1SB 4OD3L 4ES9A 5HDQL 4C47A 1T83C 5C0CA 1MI5D 4TLUA 1XB3A 3SE9L 1B4TA 1QWHA 1RSYA 4LSTL 5E6UB 4B9YA 4AEEA 4M3KB 4J3SA 1TFHA 4ZNCD 3K74B 3ZKXB 4ZOBA 3Q8BA 4J8QA 1ZRUA 4LLQB 3TBSA 1V05A 3BUQA 2D7QA 4PHXA 3VD3A 4BFIA 1KT2B 4LXFA 1KGXA 1Z2KA 4XODA 5DFVC 1FGVH 4K3GA 1DFBH 3VWJC 1PZ5B 2NY6B 3DV4B 3KNBB 4M1GH 3H9HA 5F44A 2WKOA 5JQ6L 1KJ2A 2QVTA 2P8LA 1CLOL 1PEWA 1NGXB 3BAJA 1CDIA 3DX7B 5FOBA 4UT9A 3UXFA 1KBKA 4UT6L 4WWKB 4HS6A 4XVJL 5CN1A 3OMAB 4G9FA 5DHXB 4CSTA 4N8VB 2ZPKL 4U1HA 3KPSD 4PCSA 3GBEA 4NX0A 4JG0L 4OUOA 1A22B 3KWTA 4KPHL 2HUHA 2OFQA 1QEXA 3K0YA 5GSRA 3V0AC 4FTVB 1PFOA 1QA9A 1GGTA 1WAEA 3ARYA 3PGFL 2FD6L 1PKOA 2ED9A 4BFEA 1F86A 3DJRA 2X3BA 4NP4H 2YPVA 2YS4A 3C8HA 2E46A 3CCHA 3MLSL 4LLDB 2ZX9A 4AIEA 3GXIA 4MMZA 3ECVA 1C8PA 3EOTH 5FLUA 4HISA 1FNLA 1U3HC 3HBZA 2NMSA 4BSJA 3GBDA 4FQ2H 4W6WB 2YPKB 4M43H 2G3NA 1I9RL 2Z1PA 4MXQC 3CHOA 2ZX8A 2P9RA 4WNSA 1YECH 3BPLC 4KNQA 5J3HD 3W2DH 1RK1B 2VR8A 2SEBB 1NIFA 4HEPG 3BZEA 2BSEA 2P5WB 1IRAY 1XR9B 3QJQB 2Q6WB 1YY8B 2FAUA 5PAZA 5FHAL 2FVNA 4G72B 4BSWB 4IBYA 1XZWA 2Y3AA 1B0GA 2K6YA 2TRYA 3NEEA 1MFCL 4Y2DB 5AFAA 4D0DB 4P2OD 3BLPX 4ZFOA 4L8BB 3FQNB 3ZYIA 1AH1A 4KY2A 1P9MC 3OAUH 5DTFA 25C8L 5GRUH 1CBVL 1A25A 2TAAA 4QRPE 2H26B 1A2YB 2QGEA 2FBJH 2P1YA 5A2AA 1CE1H 1RURL 4F57L 5CP3H 3SBWC 5JMOC 2YD0A 3VMPA 5D1ZC 4Q97A 1FYTE 3QCUL 4Y5XB 1JK9A 2K9FB 3B9AA 5EPMA 3CLFH 1HU8A 4LGRB 3CH8A 1IAIH 4FQXB 3N5AA 3T09A 1C1EL 2XT1B 2ICCA 2VDPH 1AGDA 4X5PA 2N56A 1I8KB 3GMRA 3MFFB 1MCHA 4KI5E 4PJDB 1MHCB 2VXVL 3K6OA 3QXAA 1DQJA 1A47A 3KH4A 3VE0B 2BSCA 5HHNA 4P4KD 3O11B 4JRXE 4G80B 4OB5L 5F9AC 2YD9A 1FYTA 2OMVB 4L48A 4N1CA 1R6VA 4IRSB 4LKXB 3BD4A 1JCVA 4MFHA 1JUFB 4ZMNA 3U30C 2IALB 3BT2L 2L7UA 3NJXA 2R1XA 1S7QB 3KAAA 1QFWM 3WNNA 1PSKH 3PHQA 1HEHC 3L4WA 3HKFA 5LN8A 2X89D 5F7NC 4YMPA 2Z31B 4C58B 2FZ3A 5I1KH 1SLUA 1TPXC 2IOOA 4LLAA 5I5JA 1KBWA 4AL8C 3CDFA 5SWSD 4JRXA 5KG9A 2EQDA 3E3QE 2R39A 1PY4A 3QO0B 3APMA 3RUGE 5MEPA 5C0AE 3KEHA 5KVGE 3H2PA 1R3KB 1HX0A 2OZ4H 2OJEB 1MCWM 2AJZA 1N6VA 1T2JA 2AXFA 2V8MA 3KDMB 1RERA 3GHEL 3TNNB 1SBSL 3CQQA 3QZBA 1FFPB 2A6DB 1GZPA 3O3UN 3WNKA 4PMEA 1JG9A 3QNYA 5D5MF 2XZQL 3U4EA 4Q9QH 2OTPA 1O0VA 2Y4SA 1NAMB 4Z3EA 1AQDA 3DETC 3MYJA 2IPTH 4AXWA 2WK2A 1EGJA 4AM0Q 1C16B 3TYGL 5GRZA 4HJTA 4DEPC 2BVQA 3AXIA 1K5NA 4A2LA 4HWBL 4WEBH 4H1LH 3O8XA 3R8BB 3WO4B 3JTTA 4TVPE 3C08L 1CFTA 3CVHA 5DEZA 3AT8A 5L4IA 1YEIL 3PWPB 2FBRA 3LEVH 1C5BL 2B1AH 2BNQA 1T66C 2OYMA 3GM0A 2IH9A 1JIBA 2WC7A 6PAZA 3RIAF 2BFVH 2VO8A 3FFOA 2HXAA 5GGUA 5HI3C 2P5EE 4KC3B 2Y2YA 3WXVH 2AAVA 2ZP9A 5A2CA 4I3SH 3LKRA 2QTVA 4HDIA 3DX2A 3LEYH 4ODXA 4GNKB 1FGNL 5KSBF 5TDNA 5D72H 1U8KB 1YQVL 3AQXA 4R0LA 3F04A 3GKWL 4MAYD 3Q5TA 1MQKL 3F7VB 3SDDA 1IAOB 2X4PB 5C6TL 1XSOA 3KVPA 3U7YH 5TQ0H 4BCYA 3WN5A 1XSIA 4PAZA 4D9LL 4OZHB 4ANXA 1A9BB 4H26B 1G9ML 2PPAA 4NFBA 4WSKA 4XNXH 1CL7L 4APXB 3DMMA 2XXGA 1MF2L 3PFUA 1AZBA 4G7QB 1LE9B 3T4AC 2VDMH 2VKWA 3LN4A 1OAQL 4HYTB 4XMXA 4YZFF 2BVOB 4QLWA 3OB8A 2DQMA 4YDZA 4OT1L 2HAZA 1FC1A 4NQCB 3P54A 1Q9KA 4YHZH 4K55A 3NPZB 1EK3A 5LUMA 2IPUG 2NNAB 3U9UA 2W0FA 3U6RA 1T89A 4J3TA 2FJHB 1AR1D 1Q94A 2XTLA 3OMNB 2AVGA 3LS5L 2EEBA 4LLUA 4ADJA 5C7ZA 2ADYA 5GZOD 3GQFA 1ZT7A 4JO3H 1R5IA 2P80A 3UTQA 2GBUA 2JVUA 3QH3A 3O6ML 4XX5A 2FECI 3CVDA 2XJLA 2R2BB 4V1DD 1O75A 4PRPB 5J57B 4YLQT 1JZ3A 1JV2A 3ETTA 2WZPA 3SYCA 1VFBA 1DEDA 4PP1D 4M8QA 3TM6A 4QHKI 5B39A 3LDBC 4XP9L 2DQFA 2FCBA 4HWEH 2C9UA 1NFDB 5E4IA 3TIEA 3D6GA 2BP0A 3FF7A 4E9RA 4TLTA 3EO9L 4BHUI 1S9YA 3MR9B 4P2QB 5H2BB 1B9ZA 4XBPA 1MY5A 4MD5B 2XPYA 4MRBA 3T0BA 1S9VA 1NBVH 4MX7B 2JF1A 2ZWLT 5I19H 3EO0B 2WVSA 4LQ1A 2OI9C 2RR3A 2VDKB 3V6ZB 3CVIH 3P9LA 1A6WL 5DK0A 2H1PL 12E8L 3EO1B 3T65A 3FU3A 4PPTA 2HJKB 2CO2A 2MKLC 5H37G 1YNTB 3MLWL 3WUWG 4HIPA 4DSYA 4LFHD 1KBBA 1YHPA 1ZLEA 3O2VL 3JYCA 5KJRL 2FUQA 4PB0L 1ZIAA 4GRWB 4M5SA 5LG1A 2CD0A 3DTXA 2KLTA 3FL7A 1OLLA 1OK0A 1VFOA 1K4DB 3AAZA 3FJTA 3FOMB 2DMCA 5DC9B 5FYJH 4MNQE 3P11L 5T3XH 2FL5B 4LPTA 2WVVA 3CFNA 3GS4A 4N9OB 3VWKC 2J2ZB 4MD0A 1WIPA 4IMKA 1PDKB 1Q0YL 4KZEH 3WKML 1RU9L 2LOEA 5ELIA 1E4XH 2NY6D 3NUKA 1IEBA 4E9VA 3RILA 5E6IA 1ZMYA 5EWIH 3TCTA 3ULUH 5ICZB 2V7HB 2EDLA 2VC2L 2W65A 5EZPA 3ZSTA 4G70B 4WWKD 1OP5K 5I6KA 3QXWA 4JJHA 1XSKA 5F7AA 1WT5A 4N2HA 4U1JA 3LKPA 2Q7YB 2P43B 5E95B 4BZ1L 4M8VA 2C9AA 2YPLB 1SEQH 4FTVD 3UP6A 4NYLB 2VABB 3KLHC 1Z0NA 2PPCA 4LOFA 4AMKH 2EUVA 2XN1A 3V52L 1TFPA 3M1CA 4MQ7A 4PBDA 2HP4A 3IMVA 3MJ8A 3ZLQC 2KI6A 3DSNB 3LPOA 4MHHG 1OT4A 5ECGA 5B8CA 3S35H 4NP9A 2VW6A 4OIIL 1NKRA 2Y1AA 1P5UB 3T3MF 1KB9J 4QXUH 3VFWB 3X3GL 2VQ1A 5KYNA 1CD9B 4YHOH 3SKMB 2YXWA 2WAHA 4Z7WE 2F5BH 3VJ6A 1FJ1B 1FG9C 2JCCF 2PCPA 5KOMC 1AFVH 3VXUB 1UFUA 3ZE1F 3U0PB 2O5ZH 2ZUVA 5JZ7D 2JB6B 1KXTA 1QWNA 4NKDB 1XEDA 4PI2A 4ZAKC 3TS8A 2D0FA 2WZ0A 5DRNB 5IHUH 2UY6A 2Z8WC 3DIFB 5E8DL 2P5WD 4F27A 3JWNC 1W6WA 5IW6A 3G7TA 2R51A 3CSTA 4CSZA 3TEUA 5KVMC 5HHXH 3EBHA 5DT1L 5K9JH 1OF2A 3VI3A 4Y2DD 4JREB 2B14A 2F54E 4N2FA 3BXNB 4OCRL 4XZUA 3GXPA 1NBQA 1Z7JA 3C5JB 4YN3A 5B1JC 1KPVB 2CJ3A 5ES4B 2PW1A 1KEGH 4F7KA 5IFHH 1AGBB 3NK3A 4NRXB 4GG6F 5D5ME 1P7KA 2IWGA 2VDRB 4L2LA 3WFCH 4DVBA 3GJEA 2M1KA 4XPAH 4H20L 3D3VB 1KXQE 3DSFL 3TEXA 5BMFH 1B6UA 2DQGH 2X4QB 2L8AA 1FL6A 3AITA 2Z91A 4JFPA 1E5ZA 1VACB 3FO1B 1M71A 2CKBA 4XCNA 2XNAB 3S2CA 1DBBH 4F92B 5FO8A 3ZZQA 3FO9A 4PS4H 1Q38A 4X5XB 2W0PA 2MTAA 3RX7A 1G7QA 2QPDB 1PKQE 5ACLA 3RVWC 4IYKA 1QBAA 4I4WA 1VLXA 1HEZA 1CD8A 1UZ6F 4QTIL 4R7XA 5ESVA 1AKJB 2ODIA 2YRPA 4IRSD 3TYFB 1TZGL 2IPKB 2LHAA 4IOIA 5DZOA 1W72H 5D7EA 5FEBA 1OTSC 3D30A 5L8JB 4JJ5B 1ECYA 1A3LH 5I5RA 1RAMA 5J6GA 1WEJH 4NRZB 2BY3A 3KPOB 4IU3A 3TX4A 5FGBC 4IRJC 2GHZA 5DUBA 5ABAA 5KSBE 5LWYH 3DV6B 4NQDE 3IU4H 2Z31D 1OIOA 1WCBA 1BVKB 2A99A 3PWNB 4LLYB 1I9JH 1VZHA 1WFIA 2NLJA 4X6CF 3KYAA 1XXDC 4M6NL 4B9PA 1JGIA 2NZ9C 4OTXH 1PCSA 2EE9A 4KJQC 5F3BB 1L0PA 2FJFB 3ALXA 3CX5J 3DXAE 4NENB 2XPZA 5A16A 3SE3A 2GIXA 2J1WA 3CDGB 4K71B 2QZ5A 1KCVH 5I1IL 4TNGA 1JV5B 4QHLA 1E4WH 1MLBA 4LU5H 1NBZA 5E8NB 3HA0A 1M1XA 3QDJE 5KSBA 7FABH 4PJEF 4IKKA 4YZFE 1NAML 1WYJA 2QQQA 5GZNA 3S88H 2FEJA 4J8RA 2IVFC 4AKOA 4DP0X 5D7HA 2WYZA 4AQAA 3OKLA 4Z76A 1KCKA 3GSVB 5AWNL 1FC2D 3G5XB 1LQSR 4JPQA 5DDHB 1MCCA 5E5RB 5H37H 2X42A 2JELH 3OHXC 3OX8B 4LDOB 3NCEB 1DQDL 5ANMA 1MVUB 4FFYH 1NBYB 2HJLA 2L7JA 4BD4A 4JN1H 4BJLA 3E8UL 4XXCA 5GS1B 3PWPD 1GS8A 2EUXA 3AREB 4J27A 4ZK8A 1TIUA 5DQJA 3B2PA 5B38A 2YAHA 3QNZA 4CJ1A 3VYNA 2WD0A 2Z8VC 1F58L 4TF4A 2DD8L 3FB6A 2YEQA 4R4BA 3JVGC 3QC5X 1KJMA 1M9WA 5GGVY 4ISVB 4GAJL 1JFHA 4DGIL 1N19A 5KEZA 4MJ4A 4LSVH 3TZVB 1T1YB 4UQCA 1SF3A 2AJXH 3B2VL 3MXVH 3N43B 2FGWL 2N0KA 1DJGA 3UC0H 3ULUF 3OL2A 3LQAC 5K9QI 4M3HA 4IDJH 5ALCL 1QFOA 3VVVA 5KSAC 2RCSL 2XZCL 5LXVA 1PTZA 5B4MC 3SPJA 2UXVA 1UYWH 2EKSB 4YSOA 5I8KH 3CX5K 1XF2B 2QSCH 1F8TH 4AJWA 1PF3A 1LO5A 2WXHA 1E6JL 2IMMA 2KT6A 1UQSB 4GW1A 2VB5A 4OGZA 3UGUA 1CFBA 1JYWA 2LV4A 1I7UB 5IBLD 5CP3A 4ZMTA 32C2A 1JFQL 5D9SA 5GGSB 1QR1A 4JKMA 3JQOB 4IEFB 4PGCB 2IDUA 2D3LA 4UTCA 3WXWH 4NQCD 1UT9A 2XBTA 5DHYA 1F97A 2OX5A 4WHTB 2YRZA 1KIRA 3EDEA 3O6FA 1MCQA 3C6SA 1NFAA 5J1AB 4XXDA 4GW4A 1BREA 3RVXD 2WOBA 5IB3B 5E2VH 3IJYA 4A68A 4F7TA 1X5ZA 1BBDL 5F9JB 5I16B 2MNWA 5FW7A 1QD0A 3PAYA 4P5MA 1TZAA 1QTPA 1H19A 3NN8A 1NGYA 4NN7B 1RULH 4K9JA 2R4RH 5IR1A 5L4FA 4PRPD 2VDOH 4WUKH 3TWYA 4OFIA 3UABA 1GC1C 1W0VA 3KWWB 4KO5A 1M7DB 5HDQH 4JPVL 4BCXA 1JF5A 3FBQA 2RJMA 1CVSC 3VGGA 4XB8A 2A9MH 2O72A 5FM5M 1CXKA 3O4OB 4LARH 2BSSB 4A6YH 5JOFB 2AHIA 2XXMB 1O7DC 3A67L 1K8IA 3NCMA 4PSPA 5EEZA 4P2QD 3ZIMA 3FQWA 1ZSDB 3HR5B 2AJSH 1EANA 3FO2A 1MJ8L 3ECBA 4EIUA 1RZ8B 4NBXB 4ZD3H 2VDKL 2OS7A 3S37L 1GHFH 4S1QH 8FABB 3M7FB 2A3TA 3EF7A 5GGTL 3DGGA 3X1BA 2EYSA 2MQGA 3B9DA 3ZHNA 4UILH 5DZVA 2ADGB 1CXEA 3T1WA 6PCYA 4DETA 5DGRA 3L4XA 4NERA 5CGBA 3WL9B 5JQ6H 4JQXC 3SDAC 3S3BB 1SDAB 2JCCE 4YHLL 2NR6A 4HGWB 5EV7A 1OB0A 1I1AB 1WC7A 4FFZH 3RWDA 2OZ4A 2ZD0A 2VXSL 2X9WA 1Y0LB 2VT0A 3AC0A 5HJ3A 4DQOH 3BVTA 4NAMA 1A64A 3MKKA 4U6VH 1KACB 2VLRB 1M57B 3APFA 3HMWH 4M7LL 4XNBA 5ISZA 2VQUA 5SX4H 4IBWA 4KKBD 1OCWL 1MHHA 3KPLB 1R5VB 4YOKA 4BUHA 3EFFA 5L88H 2IDTA 3VB9A 1P84K 2AV1B 2DM2A 1OK8A 2Y1YA 2P49B 4KNSA 2JCCA 1E5YA 4FNUA 4GG6E 5E94B 5T1MA 3GMNB 2WHVA 1UHVA 5D7KD 1ZS2A 2EDTA 1WPCA 2V2XB 1DCEA 4H1LA 4H5SA 1BZEA 3VXPB 4JPWL 4YVNA 3IBOA 2XXFA 3CVCA 5DU7A 1K6QL 3JBG7 4WFFD 2OSXA 2YBGA 3D85B 4PP2B 4GSRA 4YSUA 3KYKH 4OJFL 1QUNB 2XFXA 2YPLD 1UASA 2B5IC 3HS8A 4JMXA 4G9DA 4ZPTB 5EOTA 2PNDA 5HGHB 5L4MA 3P77A 4GG6A 3OZ9L 3KLKA 4X9HA 2WQUA 4YSSA 3GXDA 1XV8A 25C8H 2ZTBA 3RTQC 5JOPE 1CBVH 2XN2A 4JGMA 4TNVF 4PWHA 5C3TA 4C83A 3QCUH 5DGQA 1Z9SB 3CLEH 2XZAL 3KYMB 2G2RB 1K9TA 2YGQA 3LKOB 1H9DA 3GSNB 1T5XA 3X3FL 3ZKND 3VXUD 1FFNA 3T71A 3ROOB 1H8OA 1GYUA 3H9ZA 4B60A 6CGTA 3MHZA 2HRLA 5HVHC 4X6CE 5I1GH 1ZLVK 4B6ZA 4N8UA 1A7QL 2AJUL 2BNUA 3EDJA 3D48R 4PJ9A 5C0EB 2I9TB 4M7LT 4XNQA 2X6MA 3US1A 1U2YA 1XTLA 3F12A 5HDBE 3PREA 3F83A 4JG1H 1QFUH 1IGFL 2F8XC 4J39A 1UUNA 1XH2A 2VDRL 2D31A 2YKLL 4UB0H 5GRJL 3J27A 1G1OA 4NUGL 3TF4A 2NY5H 3LPGA 5FWRA 3P3YA 3AU0A 2X09A 2KYIA 3D18B 4GEIA 4ZYKA 1LNUB 3D3VD 4IQHA 4X6CA 4HV8B 4U0QB 2VE6A 4WFGD 3W0WA 2HT2D 5DZPA 5EU3A 3RGHA 1XCXA 5D2NB 5SV3A 3IGKA 4HCIA 2VXUL 4Q6IB 2WCPA 2N1KA 15C8L 3H55A 2NUPB 4BIKA 5I1JL 4WFHE 3EZ8A 4GMSL 2X4RB 2Q76B 4N8VG 3HG4A 3NJJA 3X12A 4W9LC 4ZXBA 2VOTA 2Y7OA 3QIWC 4PJEA 4FG6C 2ZX7A 4GI8A 5E9DE 4M9PA 4NWUH 1AKJD 1L9TA 1XSJA 1MW1A 3JWOH 1SBSH 2G75A 2GCYB 2KZWA 3MI6A 4BQ6A 2JLPA 3H53A 1OE3A 2AW2A 2GEQA 1BVLA 1MFVA 3N2JA 1QYGH 2F1EA 5FYJE 3REWA 2J5LC 4FAAB 5T3XE 4A66A 4ZMPA 3NSXA 2ALWA 3V5HB 4OAWA 1TVHA 4PJAE 4WO4B 4AGOA 4Q58C 4S0HA 2PXYA 4N5UA 4UQ2A 4ADGA 3GTNA 4LLVA 3NIDF 4YSPA 1VB9A 1EJ6A 4J6RH 1T0MB 2Y6SC 3H54A 1MQ8A 3NJFA 4IRZH 4HWBH 4OY9A 1MDTA 1WLHA 4UV4H 4ZNEE 4JFZL 3V5DB 3TN0C 1YNLH 4W9FC 4RBPK 4PJ8B 4QO1A 4KHTL 4KROB 2CPUA 2QKSA 1KELL 1DO6A 5E6ZA 1J0YA 1D9KC 2MRYA 2Y36H 2R1YB 1R3JA 3EYUL 4GAFB 2CHXA 3RVVD 2PR9A 3QCVL 3TVMB 5MEOB 2AABL 2EDKA 4PJ5B 4Q14A 4RA0C 3DK0A 2VMEA 3BP6A 4RIRA 3KM2A 2ODHA 2BPBA 2GFBB 1RZKC 2YGNA 5T1JA 2DYPB 1TETL 3K46A 4RMVA 1OGAB 1OAUH 1P1ZA 3EIFA 1U2HA 4IK6A 1BFSA 2AS5M 4HS8L 4Z0BL 3DUSA 5JUEH 3IKCB 2P4AB 2WSPA 3GBLA 1CR9L 3LHAA 1BIIB 3ARED 2EDXA 5T5FA 4HMCA 2X2HA 2VDLH 4HBCH 3NT0A 4PTTA 3QYNA 4P3DB 1NC4B 4UIMB 5SX5K 5LGJB 1UXWB 1OB1B 2HFFB 2A73A 2I26N 2QV2A 3QPXL 4N2IA 4BSVA 1H15A 1UEYA 3LRKA 1ZTMA 1UCTA 5FB8B 1PIFA 2X2IA 1WZLA 2CUAA 3MACH 1ND0A 5D93B 1FVCA 5BQ7A 5E2UL 4KOBA 1SN0A 1IO4C 3TZVD 3MLTB 3CFDA 2OR8A 4Q8BA 1JHLH 2FYYB 3WD5L 1TJIH 3HNSL 1VJSA 1YEEL 1AE6L 2XPGA 5BVPL 3E1ZA 3K4AA 2PUQT 3KHOA 4G8GE 3RU8H 3WELA 1WWWX 4NKOB 5I1CL 3LKQA 3BWAB 3ABZA 2IQ9H 2B8OT 3DKHA 3SGEI 4MAUH 1KPUA 4MYWB 2K3HA 2W9DL 4ANKA 3GDCA 5IKCB 3BKML 3BKYL 1IKFH 3MLUL 1XD1A 3OQ3B 1U92A 1YAIA 1M6UA 4PRHE 3AG3B 1T6WA 2EEDA 1H6TA 1VPOL 1LEGA 4GUPA 5MENA 43CAB 5EU5A 4ZG1A 2OLDA 2P8PA 4DTGL 3R4RA 2W9EL 3WHE1 4Y5YB 1CDYA 3FU6A 3H85A 3KPMB 2DMBA 5I5MA 1A6VH 2UX6A 1A7PH 2VH5H 1GZQB 3QNXA 4NPJA 3RNQA 5LVEA 3EGDB 4KZDL 4RWYH 3N0AA 1EHXA 2NSQA 3A24A 3ZRSA 2V5TA 4TL4A 1IGYA 4RGNB 12E8H 3GF8A 1FIEA 3U36B 2ID5A 1JGUL 3Q05A 5I8CB 5KVEH 4PJIB 1S7RA 1CU4H 3ZMEA 5DMGC 4Z78A 3MNVA 2UZYA 3CVBA 2YAFA 4O00A 2OMUB 2AXGA 3O4LE 2CCVA 2V0AA 4M6OL 4JUSA 4UIKH 4MNHA 1W72A 1DP0A 1YYML 1MG3C 3UP1A 1A4CA 4PJFB 4DGYH 1E42A 5I8EB 1L7IH 4JFDA 3C6EA 1TTCA 1YZZA 2VLJB 4XX1G 1A8JH 4JGJA 4OCWL 1ANUA 2LVCA 1YEDB 3HCVA 4LVHC 2EDOA 4F20A 3GMPB 3L3DB 2YEZA 4ETQB 2KPNA 4LOVA 1MPAH 4AVKA 1DQQA 2DWYA 1U8JA 4X5LA 1E8YA 1J1PL 4R7DA 3O4LA 3WJMA 3UX9B 2EDWA 3EH1A 3ARGA 3L3KB 1I1AD 2IDQA 2N7AA 1X5FA 3QUKB 1JZJA 5IF0A 4QOKA 1MRDH 2XTJC 3RVUD 4XBMA 1VZGA 2UZIH 4A04A 4IOSD 3ARFB 3W9EB 3F6IA 4FP8L 4G1EB 1QBML 2VLRD 1FL3B 2ZKHL 3VX1A 4AQ1B 4L8SA 2HN7B 1YYLL 1L5GB 3SPHA 4L1HA 2PWFA 4OD2A 5DQDH 4JM2C 5K59E 1HN1A 2QADC 4C8XA 3NAAL 2ICWI 1BMGA 3VO0A 3VM5A 4Q7DA 5H37A 2Z4QA 3WUWA 4BFFA 2X28A 4FFYA 2BSTA 2BNRE 4Q52A 3LPFA 3TFKC 2QT6A 4APQC 2ARWA 4X0KA 5FK9A 2QLYA 4B9ZA 3JUZA 3WHE0 3B5HA 3DHMA 3DO4A 2NOYA 4JKPH 2R2HB 4NZRH 3QUZC 3FCSB 3D85D 3SKOA 4EO5A 1NDMB 1PY0A 3JV5A 3NIFB 2R0LH 1N64L 3QWNA 1KEMH 4GRLC 5JQIB 4Z8FH 2OKMA 3V6OE 5F7EL 5FAAA 3TIDB 4N2EA 5JR1L 4OCRH 4HAFA 1EBAA 3FQ1A 4JDEA 2BNRA 3E6FB 5LO7A 4KDTA 4HIHA 4JANA 4WGKA 4L8CA 4XVUC 3T8MA 3VXMB 1XCWA 3CZFB 1YMME 4Y5VC 3WS3B 2QQKH 1CT8A 4DGVH 5JW4Q 2EE0A 2XWBB 1YPZF 2NXZB 4DUVA 5MP6L 1JZ2A 4HULB 1TVBB 2WSDA 2KQNA 2QR0B 4R3SA 3V6OA 4M62L 4X2UA 5J4MA 2AI0H 3WEBA 3BLKA 2B20A 1OE2A 4XC3H 1A3QA 3C9NA 5DEJA 2AEQL 3NIDE 4RMSA 3DJTA 3WAJA 2WLLA 1IBFA 4RGMB 3G08A 2CDFB 4QXVA 1YJDL 3BDYL 1KSRA 1MIEL 3BAYA 2AQRA 5D1XA 4NC1C 3F65A 3BCDA 2KDYA 1YMMA 1MI5E 4QXGL 1N5YL 5IEKA 2I5YL 4IW4C 1TQUA 1S8DB 4HUWB 4XBEH 1DVUA 2ICEA 5DD1H 1ZLUH 3U25A 3VWJB 3HI5H 1NFKA 3PXLA 4R9HA 5F7UA 5I17B 1I7ZB 3GGWB 1EXUA 2CA4A 3WTSA 4QAMB 2FX7L 3UPCA 4OZGF 2BRQA 1JZIA 3QQ9C 2VJ0A 2BINA 4P3WA 1GCFA 2JJSA 4N2KA 3QUXB 1MCDA 3L08A 5JDSA 1TZ8A 3MA7A 2J8UF 3GT6A 3MLXL 5AKRA 4P59L 5GPRA 4JPKL 4B5EA 5HVGB 3QG6A 2HVJB 1MHPH 1NLDL 2DWSA 2QQNH 4UQ9A 4BV1A 4K3JH 2A6JB 4XHQA 1ADQH 3KPSE 4HUXA 5AOZA 1XGUB 4JJOA 1QEWA 3EDFA 4I1NB 4R4FH 3D08A 4LRIA 1F4YL 3Q5OA 4A6YA 3O81A 4OIAA 3VRJB 1XF4B 4K7PH 1ICTA 4WWPA 1U3HB 3PPEA 2FEDC 2FBOJ 7CGTA 2CBOA 4NS0A 4YSDA 1J05A 1BGXH 2V8LA 5AW3B 3BPLB 2CHNA 1M7IB 5FR3A 1T1WB 4R26H 5T1DH 2DQJL 5TE7L 2GC4C 1MWAL 2DQIH 2F19H 4HPOH 3BD3A 4Y4FA 5ERWA 5K1NA 1ERNA 2YSTA 1Z5HA 3CMOH 3KPSA 4WO4D 3WFEL 5LCVL 1KV3A 4FFZA 3JV0A 1BEYL 2XG4A 2X88A 2VL5A 2FIKB 1SUHA 3L4YA 4NBZB 3KW8A 4OH2A 1ZLSH 3MNZA 3ML8A 4LSDA 3NFPA 4FQLL 1N0LB 4WI0A 1RUAH 3OAYK 5B22A 3N42F 3QG7H 4NNYB 4OGYH 4BKLB 5FUCE 3LZOA 2CM6A 1RL1A 4LSPL 5D1ZB 2FATH 4PJ8D 3RDJA 4KROD 2J8OA 4HU2A 2AJYL 4KUZL 1QRNA 3NGBB 4MMXA 1JNJA 5I26A 4V11A 3PL6B 4NGHL 1UA7A 3ZMNA 1EUTA 1W8EA 2KMWA 4OM1L 3TVMD 4XPHL 2GJ6B 4PJ5D 3ZMRA 4EXPX 4HIXL 2O6EA 4HJ0C 4JY6B 3KVQA 1SJEA 3MCKB 4GAJH 5D70H 3VSQA 5DJCB 2DYPD 1SPDA 1NL0H 1ZTXL 1OGAD 2PW2B 3A6BH 4OLVH 4S0TD 2WNGA 5CLXA 4ZSOE 5F1NA 3P1VA 3WIIL 1UJ3C 2M83A 3I3EA 2R0KH 3QQDA 2NTFB 3T1FA 3TH2T 1Y07A 4L5FH 4YAQB 1ZA6A 3TO4C 3W9DB 3LEXA 3BZ4B 4JG5A 3A6CL 2PWDA 3BFOA 3D9AL 4P2OA 4EEEA 3IRCA 3BJ91 3QUMH 4QWWD 2JSFA 3SBRA 3STZB 1B88A 4PY7A 5ALCH 3CC5A 4IS6B 3DARA 2XWRA 3QB7C 5H35B 3AG4B 4IIQB 3L3OA 5IMKA 1N70A 4OV5A 3L3JA 1NC4D 2W9LA 3R06A 4Z95H 3SODB 2XIBA 3KR3H 4U31A 5F1IA 3VD1A 3BZ5A 4IGBC 5AVWB 2XHNA 4ZSOA 3P02A 1TPXB 4UQDA 4ONGL 4PYGA 3CZSA 3S0PA 5CZVL 1OM3H 5HYJB 2Y7MA 1DN0A 4XNMB 1C5DB 2YBRB 4H8QA 4U2YA 3IEAA 3MRJB 3QUYB 2WJ5A 4HWZB 5E24E 3WIHL 1RJZA 1Q1PA 3EGXB 5CR1A 3ETBF 3KWUA 1FPTL 3ZTNL 3SB3A 2G3ZA 4J4PD 5ESAB 5FYJU 3T2OA 4P4KA 5SWSE 3VCLA 1SEBB 3NJMA 3P9MA 5FFLA 4PWJA 5AYUH 5C6PB 2O5XL 5AOIA 3RA7L 5BRZB 3HAEB 2GITB 1KCUL 3HI1B 3WFZA 4QRSA 3QORB 3T6QC 4HKZA 4JFFB 4R2GC 2NUTA 1ETA1 4XNDA 3VI4B 2ATKA 5A3IC 3THML 4FZ8L 2EVIA 2VXTH 3GJFK 4BWUA 1KY6A 1PW3A 4NC2B 3TJPA 1JTTA 3LS4H 3FU9A 5KVFL 3OG4B 5HSFA 1P4LB 5C0RH 4GG8A 4JZOA 2X89A 1KYOJ 5AG9A 2BERA 4X7CC 2CO7A 4PWGA 5J89A 1AANA 5K33A 3MBXL 4G1MB 4XZ4A 4MXWH 1S9WA 4M56A 4XOAA 1FDLL 3NZHH 1X9UA 2L4OA 3MUZ1 1J18A 1I3RB 1MFEL 1EX0A 4PRNA 4XH2A 1AQ8A 4C57C 4OQTL 4RGND 4G8AC 2NPLX 4HH9B 4YIQB 5F9OL 1LDPL 3GMQB 5DD3L 5TF1H 1IGIL 3NZ8A 2MCAA 2WTOA 2Z0BA 5K9KA 1KULA 2VDNL 3NA9H 5HGDB 2VZOA 3CSPA 4FNQA 4GKLA 3FZUD 4LP4A 4I18A 2X1WL 1VFMA 1CWVA 2WW8A 2UZXB 4H8VA 1HWHB 3UZVA 4K23L 5T3ZD 3UBHA 3MBEC 3U1SL 4U6TA 3GBNH 1NCWH 2VISB 4GI6A 4PEEA 35C8H 4YR6A 1SBBA 3U6XA 1G7MA 2APXA 4JVPA 2OR9L 3NP4A 2VLJD 1G4MA 4BA0A 2QGCA 2UUDK 1E9OB 2YAQA 1QLRA 5D4IA 3QA3A 3V0VA 4FABL 4YDNA 3HE6C 4NQEA 5E2WL 4JY5H 4U49A 3CWGA 5HYQA 1KIPA 1S7XB 2E75C 3WS6A 1CFNB 2CE6A 4D9QD 2GUOB 5HYFA 4B97A 4GT0A 4IRZA 5TQ2L 3S96A 4Y9GA 4LZKA 3KL3A 5KYYA 5CZXC 2PTTA 3F7PC 2K78A 4ODVH 5BZWB 3CSFA 2EDEA 1IC4H 3FHEA 1F41A 2A83A 4AV5A 1J88A 1AY1H 2IADB 4R5XA 3ZGHA 3IDMB 4AGQA 1PZUB 5FKAA 3ARFD 3X2QB 5BVJB 4L4TA 4OLZL 1NOLA 3BP5A 1WBZA 2YLHA 5EMYA 3L4UA 2DLFH 2EDFA 4PVNA 5FYLL 3O2WL 2G2NA 3IDXL 1IJNA 1UWYA 5M95B 5HI4D 4MAYA 1YPZA 5JA8B 4X8JB 3UTSE 1XF3B 5DMIL 5JHAA 4RFOH 1JGLL 2V7NB 2W91A 3ARDC 1JN6A 3ARVA 4I7ZC 1KYOK 5DR5H 5FYLD 2H2SC 3N1MC 4YO0B 5EA0L 5EC1A 2VJXA 5KS9B 3N85H 1NTDA 3CNKA 1P4BL 3EOBB 4J1UA 2BY2A 5EZOH 1TQTA 3HZMA 2R4SH 3WV0A 1D7CA 3A22A 5C09B 5DJDB 3JZ7A 1X5IA 2E3VA 2V3DA 4G6FB 2J8UE 4TPRL 5IM7A 3HE7B 3EGSA 1AOZA 1MUJA 2R83A 2XIIA 4V1DE 4KJPD 1AD9A 5DZAA 3IFOA 3B3BA 2Y23A 3SY0A 1BM3H 2A1WH 3HHMA 4BK4A 4JLRB 2P24B 2ZOWA 3M1OA 3NCJL 4R96A 2JE8A 3LSOA 2OI9B 4GQZA 1VEMA 4HC1H 4OZGA 4QRUB 1E3FA 5ID1B 3O9WB 4YDJA 3N9GL 4HCRH 4LESA 2WINA 4L2YA 4PR5A 5ADPL 1ZS8B 4U3HA 3E80A 2HMID 3K0WA 3VXMD 5GZOA 4RLDA 1AP2A 2J8UA 2X70A 1NPJA 4A2EA 1CL7I 2EXWC 2NXZD 3PGCB 1NGZA 1VEOA 5TFSL 4XO8A 4DP4X 4EKXA 1AXTH 5I0DA 5F9DC 2Z93A 1DFXA 4FNRA 2NXYC 2UV3A 1SRDA 3LOWA 1U33A 2DQDH 2KH2B 4MJHA 3W1ZA 1M6OB 1XF5A 5IIEB 3FONB 1DLHA 2P42B 1I9EA 5KVEE 2YARA 3N55A 4J3WA 4QJ3B 4U0RC 1MCBA 3RGVC 2CRYA 2HWZH 3OV6A 5AVVB 3VG0L 1WWCA 1DCLA 2FWSA 3WGVB 4EMZA 5DA4A 3GRBA 5DFVD 2HRGA 2ROXA 2W92A 4MS8C 5B1CA 4HS3A 4PV9B 4D8PB 3VWJD 5HPMB 5D1QA 2NW2B 4Y2OA 4DKTA 1DE4B 1JSYA 2VZSA 2F08A 5FM4A 1CLYL 3NDZE 2ISDA 2ZAIA 3IDNA 1L7TL 3FTGA 4TUJA 3Q5YA 4RQQA 2A4ZA 3QE5A 4BZ2H 1PLCA 4KK6C 3WEMA 5AAPA 1EAJA 1P4UA 4PBWD 2VAAA 3QUXD 4AEIL 2WLYA 4P3CH 4L05A 5D71L 1AG0A 1S3KH 4ZO6A 3U7WH 4CL7A 4PSRA 1NCBL 1ZHKB 4JAMA 1E67A 1HYRC 5LGHH 3EKCA 1BLIA 1LO0L 3HZKB 3MRNB 2JB5L 4L1LA 4MDRA 4PGZA 3EYQC 4KVCH 2F7RA 5MERB 5C08B 1RFDL 4E41B 5I15H 1FP5A 3MUJA 3PHOB 4EI5B 5BXFA 3MRFB 3EUUA 4FTVE 3TJEH 4LPWA 1HFUA 2X87A 1U3HD 4N6RB 1YEHH 1P4IL 3AS1A 1NFDF 3MRMB 3S36H 4MA7H 3Q13A 1TT6A 2IAMC 2IEPA 4U1NB 4MXQD 2VDQL 4KV5F 2YFOA 1VRSA 3EYUH 1NGXA 4FG4A 3PLYA 2VTFA 3ASNB 4WWKA 3MRRA 5F2FA 4JQVC 4N8VA 3GSOA 3QJTB 3GYRA 3GBML 1KWKA 4LVOB 1JD7A 3HRZC 4GUQA 4I9WD 4IOFC 2DBLH 1YNTF 4ELMB 1ZE3C 4QPEA 1CGSH 1DBAL 2ZOKB 1M05A 2HG5A 5T8IA 1TQBC 2P5WE 2OXHB 4FXTA 2OTUA 2AERT 1EEUA 5FGSA 2LFGA 1RZGA 3FTYA 3V9EA 4K4KA 4NZJA 3EJYD 3BH9A 5D1ZD 1NQBA 4GJTB 2ARJB 2VR4A 1PG7L 4P04A 3G5VB 1KDIA 5KYWB 4LRNH 3B7TA 3PL6D 4PWEA 1UWFA 4N0FA 4DVRH 1OCRB 3IFPB 5JW3L 4U6HB 3OGOE 4K3EL 4XB3A 3VH8A 2GJ6D 4IBQA 5F72S 3WNJA 4G83A 1FAIH 4U05A 4E9WA 3UYOD 3TFBA 3SKJH 5F70A 5AUMB 2AF2A 1NCGA 1TQWA 2AKRA 4XMPL 2HSIA 4TN9A 1IUZA 1L9RA 4CVUA 1XH0A 3JZYA 4JBSA 4TLSA 4BSWA 5I6XC 4YNYB 1O7SA 3SJVB 3SKUD 4Y2DA 4D0DA 5C97A 3HI6H 1MZYA 4HJJL 1IM9B 4NO2B 4KKLD 4PJDE 3V4PB 5DVNA 2E8YA 1SMOA 3HFML 3QS3A 2H6UA 2W9DH 3V4UH 2VUKA 1LVEA 1MCOL 3KYOA 5I6LA 3MLUH 1YEFH 2IH1A 4TSCL 4Y5XA 4WTWA 4Z7UB 1EQWA 4AL8L 3GD1C 3FC8A 1UB6B 4AK1A 1CFMA 1ZLWK 4MCZA 5HGAA 1ZDSA 3KE0A 5J0BA 1MFDH 3MA9H 3PNRB 5IESH 3QUYD 4N9GA 2ZOLB 4BM7A 4HXBH 3BQUB 2HH0L 1I8KA 3MFFA 4AYSA 4RDQG 3WTUA 4A7VA 2LLGA 3ERXA 5IQLA 2C9PA 3G6AB 4N0CD 3O11A 2X2JA 2EIBA 4Q4EA 4I9XA 4PB9H 2G3XA 2W38A 4LVNC 4PY8J 5BRZD 2RFXA 1LP9B 2OMVA 4IRSA 3QORD 4RMWA 1A1MB 3T6VA 2HLFD 1JUFA 4JFFD 4Z7QB 4UINL 3HJEA 1MH5A 2IFFL 2IALA 2JJVA 4PJ6A 2ENSA 2OMZB 2DWDB 1S7QA 3BGMB 3RFRA 2CK0L 3TA3C 5I1DB 1J9SA 2Z3FA 3OHXB 3Q2LA 4Q0XH 3D4GA 3NABL 2CBMA 1N5AA 5HJBA 2ZXGA 1S7TB 2NY1C 2Z31A 1AACA 1G7HA 2R2EB 3L6FB 3P2BA 4EVNA 2LT9A 1LO4H 5DEGB 3Q6GH 4LSUH 4FG0A 1S2EA 2E27L 4OCLC 4LBEA 2XQBH 1IC5H 3QO0A 3ULAB 1E27B 3AADB 2MH4A 1KCRL 2R9HC 3MLYL 4I3RL 1ADQA 1T66D 3D09A 4EOWL 4PM1A 3OJDA 1R3KA 1KC5L 1IGTB 2ADJB 1FHNA 3MV01 4JCMA 1GYVA 4HH8A 5CGMA 2XCMC 5AOJA 1HESA 2A9NH 3VFPA 1FFPA 1BXXA 1RZIB 3IFLH 1HSBB 3PWPE 5ENWB 1EDYA 1F90L 3OZLA 1T03H 4WJG3 3S4SB 3ZDXB 3MRHB 3RYMA 2H5UA 3T0EB 5EC2B 4XX1E 1G43A 5FV1L 4HZLA 2Y69B 1YYLH 4OGXH 4P5TD 1CB4A 2YJLA 1ETZA 4WWID 1X4XA 1UURA 1WUNT 4Y4KB 3ZU8A 1A7OH 1GYCA 2X1PA 3MV9B 3PWVB 1EV2E 4F2EA 1NCAL 5DD5L 5DVMA 5KSAB 3BI9X 2QMKA 2VITB 4XTRC 1W9XA 4J2QA 1TQCB 4EBQH 4XMZA 1ZLDA 3VXRA 3K71B 2X2YA 3NQKA 2XWJB 4M1CC 1OEZW 2FQGA 4N24A 4BH8A 4ZUSB 1DTUA 4OZHE 4XNYL 3INUH 4A2DA 5CMAB 1T7WA 3FBKA 4DK6A 1K5WA 1G9NC 1PY9A 4G7VL 2ZE0A 4NZUL 3ESVF 1FRGH 2A4CA 4DP5X 1U8KA 2PN5A 3MODL 1FI8C 2QFRA 1B3IA 1ZHBB 2HZHA 4ZBJA 5BW7C 3A4FA 4NQCE 5DK2B 1IAOA 2CU9A 4U3CA 4UBDD 2LW3A 3NSYA 4H13C 2YN5A 2JTYA 4Z7VF 3GSNH 3OSKA 5EF0A 4LMQE 4RDBA 3X1EA 1A9BA 4NI6A 1CE6B 1YNKL 5MP6H 3QUMA 5C09D 2M2DA 3W39B 3B8YA 4G6FD 4P2RB 3U7AA 1YUHB 3HE7D 4RMTA 5EZIH 2JWYA 1LE9A 3EYSH 3B9KB 1JMXA 1THCA 1CUOA 4PRPE 2ALAA 2A74B 1RJLA 1YEJH 2A0LC 4KXZH 2QJDA 3GJFB 4NQCA 2N7SA 4PS3A 4ADIA 3VXTB 2J6EL 3DDGA 3LNIA 2WQVA 3RX5A 3D4YA 2NNAA 2I5YH 3ATBA 3O9WD 1NFDE 3M1BB 2X4UA 3ECQA 2CGRH 4P2QE 2VSKB 1DQMH 3HN3A 2FT8A 3L1EA 1NUFA 3BKJL 3BVWA 4HIJA 3NJLA 4BBWA 2Z4TA 5F7FA 3QBTB 3NEOA 3GSUB 4DPBX 3BEWB 1ZV9A 3IU3B 4L0PB 1VKXA 1XXFC 3MMEA 4PRPA 4PGDB 1R33A 1D5RA 2XWZA 3T0AA 3G5YB 3P4MB 4TKWA 4P59H 4H0IA 4FQPA 4HJSA 4RNRA 1Z3GH 2C1PB 1AZCA 4XI5D 5GHWL 1RP8A 4WY7L 1HOCB 1NFDA 4QRFA 4YSRA 1T5WA 3MR9A 4P2QA 5E70A 3FT9A 5E56A 3CHQA 3RQ3A 4GRWE 4HIEB 4XVOA 4MD5A 2LLLA 3T8XB 1V7ML 2G9HB 4YDKH 2IBGA 1X5YA 1DSFH 3EO0A 3WMQA 1U8HA 3WFBH 2WCSA 3FQUB 1JNNL 2EEXA 2H1XA 3VQ1C 1U30A 4NJAH 1HH6A 2QVFB 5E9AA 3SCMC 2Y9RT 3WI9A 4TNWF 4XP6H 1YNTA 1L4IA 5D7KE 4IRJA 4QRPB 3VG9C 5ICYB 3CFIC 3KLHD 4PRIB 3B7YA 2P8MB 3FB5B 1VEPA 3MGTB 4F2FA 1BJ1H 1IILE 3LZLA 2AANA 3QIBB 4F58H 2JJTA 1V7NL 4WFFE 3SGJA 5DUPL 3WTVA 3CBKB 5C08D 5DJXB 4E41D 4EI5D 1K4DA 1LHZA 2YPLE 3FOMA 2XZZA 3CXDH 3D39A 1G9EA 3IPBA 3ZGIA 1GYWA 4MXVF 1JZ4A 4QHUA 1AS6A 2J2ZA 4JHWL 3RL1B 3MLRH 3RJOA 1XIWB 2GJZB 1BPVA 3LIZL 2X9XA 4H88H 4OCXL 1QPKA 3VM7A 1CD1A 3OR7B 4I48B 4WCYL 4OM1H 3VRLE 2V7HA 2B0SL 5JIKA 2DQHL 4KI1A 4R4NC 1OTUC 3V8CA 4XMKL 4KHXH 4FF9A 4BH7B 1I53A 4KQ3H 2JXMA 2ORBH 2Q7YA 4E5XB 1EZSA 1G6RB 4XNAA 2FWOA 3QC6X 3VXUE 4NYLA 2VABA 4BFKA 5IMOA 1MEXL 4IJ3C 4KTEH 2KZ1B 4FOMA 3HG1E 3U4BH 2XG5B 5FCUL 3MYZA 1GGCL 2Q86B 2ZSVB 1B3JA 3DSNA 3GIVB 1YRKA 1PCXA 2AK1L 3CLWA 2J88L 3DOSB 1KB5L 4J23A 2H0FA 2MFNA 4PJXB 4M5ZL 2MOVA 1P5UA 3QEQA 1HEJC 1CDCA 2BW5A 3LZNA 3QRGH 3RNKA 3VFWA 3DNKA 3E2HC 3LRMA 4DT2A 1F42A 3U0TA 1FJ1A 1B4JH 3RB7A 3QW9A 2AK4B 4ONGH 4K3HA 3U0PA 3PWUA 5CZVH 1HZLA 4NKDA 1N4XL 4Y9EA 5L6YH 3D3VE 3RIFK 3EHBB 4ZX3A 4MMZC 1A6AA 4WFGE 3T5WA 2DQUH 4JB9H 4YSAA 1ACZA 2NQCA 3SJVD 5AW0B 3RVWD 3V4PL 3EH5B 3QQ4A 4Y1AA 4NN5B 2MWCA 1X7QA 5CEZH 3C5JA 1IM9D 4MB1A 3HJ0A 3N1QC 1EJOL 1R19A 4HC1A 1M7UA 1AGBA 1OTSD 1FVEB 2WUBH 2CBPA 4NRXA 4HCRA 5CHNB 5DI8B 5IG7A 1VHPA 2VLLB 3BLBA 2J5LB 2X4SA 4OCSL 4QKXB 5JHDB 2IG2L 3FAXA 3SOBH 2NY0B 2W88A 1MCIA 1Q1JL 1J87A 2Y1VA 3D3VA 4LHJB 4AVJA 1IGMH 1MVYA 1RY7B 5KVFH 1F2XK 1MCFA 4BK5A 3OKKB 1YQ2A 2ZUQB 5IHWA 3DRTB 2CK2A 4RMBA 4MS6A 3UTPE 5CBEB 1KTBA 2OP4L 3KPQA 5J8OA 5DJ6B 3GI9L 3QAZC 3RURA 2NZ9D 1VACA 3VFVB 1IKNA 4KJQD 5EO9B 4YHYB 4K8RC 3BQUD 4XCCL 2XNAA 3IS0X 2IQAB 2C9QA 4MJ5A 4HCGA 2W94A 4KDVA 4LIQH 1R46A 4UM9B 2PMZA 1WCQA 1FO0B 4X5XA 2ZCHH 4KKNA 2EIZB 4DZBB 4P4RB 1CICA 2KZBA 3FFDA 3VX0A 1G1YA 1J8HE 3SGDH 2GJRA 1AKJA 4FLHA 3E0GA 1JZEA 4NZTL 1MCWW 5T3ZH 4JHBA 3HMXH 3PUUA 3V0HA 2YWZA 1PNDA 3HG0A 5LLIC 3ULVD 4NRZA 1FE8H 3DX9A 4JPIB 5KW9L 1I9IL 5EORH 3C2AH 4BZ2A 1TQVA 2ZONA 4MB4A 3DV6A 1NC2B 1NEUA 1U8PB 4XO4A 4UNIA 2ITDA 3PWNA 1DL7H 4LLYA 4CBPA 3Q1SL 3GSRB 4WU5A 2HPOA 1MJUH 4O5LL 2W8CA 3WDIA 4EXKA 4KXAA 3HRPA 1OOWA 4O51A 5F3BA 2FJFA 4AWJC 3MSPA 1XGRA 2LR4A 2Q8AL 4XAWH 3IMRA 2ZUWA 4HZAA 4JKWA 4KVPA 5IQ7H 1JV5A 4GFTB 1WO2A 4KI5C 2N01B 5BO1L 2H6PA 3ARTA 1BA9A 4O58H 2NY2C 1KZQA 5DRXA 3KPRA 4HT1H 4D0BB 3I9GL 2J8HA 1E4JA 2CIKA 4YQXL 1BX2B 3I74A 1B2WL 2HTLD 1Z5YD 3LQAL 3T0ED 3MRGB 1IFHH 1A6UL 1QASA 2YA2A 1UGKA 1EAOA 1HHHB 3G5XA 5DDHA 2Y7QB 1HL9A 4Z7VA 3IF1A 3OX8A 4Y4KD 4F3FB 2DH2A 1DUZA 1MVUA 3MV9D 2FB4L 1JYNA 1EXGA 2Y5EA 3G6JF 5DMIH 3KXFB 4ZUUB 4Z3JA 1F2QA 3HNVH 3QFDB 4TRPL 1NAKL 2YUXA 1WFMA 1U58B 5D55A 3T4YA 3WBDA 4W4OA 5HHVH 3C09C 3ZRFC 1UM5H 2WGXA 3TOPA 1RHHA 3AREA 3HEIB 3US9A 3MJ9L 5E8OB 4ERSL 2OM5A 3HC4L 4U1KB 4YHML 3ABLB 3QQNA 1R24B 5FOJA 3RWCB 4O2FA 4UZSA 4A7TA 4G6KL 4ISVA 1JWSB 3M8OH 4HKBB 3VFSB 3MRQB 5C9JB 5E1AA 1AJ7H 3KWVA 3O8XC 3RL2B 3STLB 4JHZA 5EEVA 2YJQA 5EO0A 4ONHB 1OAXL 2DM4A 3TZVA 4DP6X 4Z1PA 3VGBA 4QCIB 2UXTA 4FHKA 2K7QA 3JV4B 3AY2A 3G9AB 2YUZA 1GC1L 2EADA 4Q9RH 5L7XH 1MCPH 4WEUD 2YRBA 3FB7B 4K9EC 5DJZA 5C0DA 4Z5RB 1OP3K 3DYPA 1A8ZA 4R7LA 2C4FT 2PO6B 2BSDA 3NSJA 1CG9B 1QSFA 4QRTB 2O5YH 4UV7H 5TDPB 1H8LA 5I74B 3HZVB 4P2RD 3WCYA 3GLZA 4R0LC 1EFXB 3L3IA 3B9KD 4BXVA 1I7UA 5JW4M 5G4NA 4EI6A 4LCUB 3SDDC 1GMIA 1K8DB 1UA6L 3FTSA 4IEFA 4PGCA 4O02L 4OSUH 1IL1A 1J0IA 2HUEA 5TH2B 3WN5C 4Z77B 5CD5C 2X7LB 3BHBB 5IJVB 4WHTA 3R8QA 4E9SA 5L0QC 4MXVE 5J1AA 1NEPA 4UTBL 3DMMC 1UCBL 5IB3A 2DLIA 4FLSA 2YSSB 3O3DB 1WP6A 2OQJA 4TSBH 1T7YA 4RVBA 4DP8X 1KENL 2EDNA 4KGJA 5D7IB 1N3NB 3WJJC 1FYHB 2A6IB 4GKOA 3W11C 1L3WA 2OMYB 4YXLH 1A6ZB 3WG7B 4JRYB 3LN5A 4JQIH 4X4XB 1BD2B 1IIIA 3KMDA 2AQQA 4XCEB 1MFAH 3CZGA 3UH8A 1T89C 1K4CA 4Y4HB 3HB3C 1MSPA 2EAEA 4JM2B 1JNLH 3EH4B 2BSSA 1A7BA 3MAWA 1RUKL 2JB5H 3CGTA 3BWSA 3OLIA 3V2AR 1H3WM 1YMHB 2VLRE 5JHLH 1JF1A 1GOHA 1O5DT 4HMEA 4CN6A 8FABA 3K6SA 1E5UI 3H7BB 2WWKT 4CN4A 1FLRH 2CRIA 5BRQA 4APQB 4NHUB 1GMEA 4X6EB 1HI6B 2ADGA 2WXLA 3L17A 1RJCA 3BSZL 4N8PA 2Z35A 1KXVA 3WL9A 3M17A 3GKZA 1KCLA 3QUZB 2IV8A 4HGWA 1A14H 1I1AA 1ONQB 3MLVH 1HAUA 4DIXA 4DUWA 4GRLB 2VR7A 2EDBA 4QRPD 3TLRA 1EHLH 3ELAT 4PRID 3V6FB 4IOSA 1AHKA 4WKZB 3GMMB 2VLRA 3HZYB 1U8NA 2QGBA 3QIBD 5CIPH 3M45A 1RPUA 4BFOA 2F1BA 1DJYA 3QRLA 4M8RA 4MCYA 3KPLA 4JFSA 1TJMA 2Z1KA 1VCBC 2EIKB 5IZ7A 2MTPA 2AV1A 3TN0A 1AKPA 4PJFF 1A4BA 4AMWA 1J7VR 3QULB 5E94A 3UAJC 1AOHA 1XIWD 2P5PA 1D5MB 2GJJA 2V2XA 4ODWA 1OT2A 2EECA 3P0VH 1A7RL 5FS5A 2QL1A 4ALAH 4FQ1H 4FE9A 5KJ4A 1G6RL 4AGLA 2GHWB 3J2PA 2UZPA 1T4WA 4UQBA 3EDDA 3FQXB 2OL3H 2GG1A 5IVOA 4KFMA 2NZ1A 3UMTA 5E4AA 4IMKC 5DHDA 7TAAA 1LEIA 1JWMB 4ZPTA 1YEGL 5HGHA 1OSPH 3POCA 4NFCA 3T9WA 5EF3A 1KV7A 1T20A 1QLEB 3B43A 3WU1A 3UG5A 2E6PA 1QQDA 4GI9A 4YHNB 1IC1A 1BQSA 1ROWA 2F5AL 4JR9H 3DVIA 1BYPA 4PUBH 3BAXA 5LKNA 1SLWA 1WT5C 4Q4IA 1EAPB 2PTUA 4NKMA 2BS9A 2PABA 4RRPG 3RVTC 2IGFL 2UVEA 2DQTL 1RZFL 1Z9SA 1IBDA 4MDJA 3II3A 3KYMA 3WE6B 3GSNA 4MB5A 1O6TA 1ULVA 4P9HC 2AK4D 3I9IA 4ZDHB 1JGVH 3KJ6H 5C0ND 5C0FB 3MRLA 1E9PB 4FKHA 3L3GA 3ROOA 1A0QL 1H3PH 2BWIA 1JZ6A 4OLXH 1CVRA 3ZE0F 5ITBL 1IT9H 3WMPA 1HZHH 3EHBD 3AG2B 5B8CC 3S9DB 4FLQA 2I9TA 5D2NE 1F6LL 4KO6A 4AG4L 3OKEB 4HFUL 2H0PA 1QSEE 5D6CB 5DA0B 2XA8H 3HAEH 3NIFF 1CQKA 2HB0A 5JW5B 4UQ3B 3RZCD 1TYJA 4W9IC 2F53A 4WGVB 2DF3A 5TPWH 5AAWA 1CDUA 5JHDD 4QXTB 2NY0D 4AK2A 3TBTA 5MI0B 3D18A 4HPYH 4ZT1A 4FYQA 3IRPX 5C2BL 3EUDA 2KZKA 4HV8A 4XP1L 3VXSB 1IBBA 4MQSB 4ES8A 3JYBA 5EN2A 1MW3A 1V3JA 5D2NA 4BXSV 1WIUA 4Y9CA 3MRBA 2Q2LA 5E23A 4PRDB 5J9PB 4AC4A 5A7EA 1XZ0B 4PRAB 1BQHB 3PJNA 1IGJB 3QIUB 3M86A 3CH1A 4WI8A 1OCOB 2FECL 4UM9D 3IFNH 3ATDA 3STBA 5CS7A 2XLLA 3MV7B 3F6LA 1ASQA 4EDWH 5E2TL 2D7MA 5C0IB 1MNNA 3PNWB 1RZKL 4NHCH 2GCYA 1KTKE 1WZ1H 2B4CC 3KPPB 4FHBD 3RWHB 1FUNA 2X4OB 4LCYB 3G6JA 1LK2A 3NJKA 3QWOA 1AG6A 4LLWB 3V5HA 3WEXB 4J2XA 1NC2D 5IVZA 1F6AB 4PV1C 2R27A 3WFHB 4KKCD 4PJ5E 3O6KL 3R1GH 3VQMA 5FKPB 2E59A 1T0MA 4N28A 5I75B 5DFAA 3WFDL 5HD8C 2H3NB 3BVNA 1TJHL 3K81A 1BAFH 5HGBB 4A38A 2GAZA 1S9KC 5BV7H 1VZIA 4V2CB 3CQPA 1ODAA 4B9GA 2MQ3A 5ECJE 1KN4H 1ZTXE 1V55B 3NCYS 1KWGA 1TEGA 1YN7B 4PJ8A 2X4TB 1ZJAA 2DN7A 4IGBB 4WU7B 3R0MA 3OJ2C 1AMYA 1I75A 2R1YA 4LPXA 1KLUB 1YDPB 1WH0A 3TVMA 1U21A 5JTWA 4PJ5A 2YA0A 1UM6L 5I9QC 1CK0H 4I87A 4JDTL 2GFBA 3X1FA 4YSCA 1TZHB 5AW9B 4XRCB 2DYPA 1QMUA 2LTQC 3AXLA 1QW9A 2QVIA 3L13A 1OGAA 3P4OB 4L3CB 3SE3C 5DRWB 3Q2WA 5I66B 1SN2A 2WXGA 2HT3D 1SJVA 3KXFD 3N44F 1AO7B 3Q9QA 3P2TA 4R5TA 4KNTA 2XWTB 1UWXK 1KFAL 5GZNC 3CE1A 1BJ8A 2ZUTA 1SLVA 1FH2A 2VSCA 2FJGB 1G7LA 4IK7A 4FQCL 2EIDA 3K8KA 4MQXC 4W9ZA 1MJ7H 1I1YB 2WZAA 4XPTH 1NC4A 3CFCH 1MN4A 1OB1A 4KTDL 4G43B 5C7XL 3CHRA 4CMHB 1EBPA 4X0NA 4G6ML 1IQWH 2F68X 1GAFL 1WAAF 3VFGL 5DEFB 1E6OH 4O4YL 3ROLB 3SN6N 3M46A 4CUCA 5B1KA 4U1LA 3DK2A 4XXCC 4AEFA 3MLTA 1HQ4A 4J3OD 1U95B 3MV8B 5MHSE 3WAKA 4WK0B 4J4PA 1OCZB 2DAVA 5KVFE 3SQOL 3ZBMA 1FZJA 5DD0H 4MNGB 4Y5VA 1J0ZA 2VLMD 2QSQA 4WW1B 4EIGB 5CP7B 5HHOB 5IFAL 3PDOB 3S8WA 1NMAL 3OKOB 2PO6D 3K1KC 4HUMB 1OP4A 2J1KA 1B4RA 4RGNE 4I0PB 1OPGH 1PD1A 4LIQE 2MNJB 5IV2B 1E2VA 4DW2H 1EFXD 1AS7A 3GMOB 4PJIE 3PWLB 3S6CA 4BZYA 1A9EB 3PDDA 1ZVNA 2MMXA 5I76B 1YEKH 3T2LA 4JFUA 3SDCB 2Y07H 1AGEB 3HE6B 1K2DB 4PRBB 3UTTA 4Y5YA 4XCFL 3KPMA 1F11A 3PQYB 1R47A 3CBRA 4NN6C 5LGYA 3S4SG 3RTLA 5CEXB 4PJFE 5CCHE 5E99L 1JHTB 2CO1A 4HXAL 1J8RA 4AW7A 2FNBA 4CKQA 3AACA 4GLRI 2X44D 4EZMA 2VLJE 4ODTH 4L9LA 2MJWA 2ZJSH 1OAZH 1T21A 3U36A 1NJ9A 1T4KA 5I24A 5CFAA 4Y19B 5I8CA 2BRRH 4LCWB 2YZ8A 3LV3B 3QHFL 4D9QE 5JO5B 1S5HB 4JRYD 3AY4A 2DLEA 1BD2D 1U8LA 2I07A 4PV8B 5L9DH 1J11A 1JGDB 3O6FC 4AGMA 4Y4HD 5FUZL 2HRPL 5GS0H 4Z7IA 4JM2D 3O45A 5EZJB 5IQ9A 4PJFA 3MXWH 5CUSH 4U1MB 4WTXA 3VI4F 3ARDB 3JSSA 2QFPA 2VLJA 5K1VA 1HKLH 2FHBA 3WDHA 5KSVA 3RAJL 3UJIH 3HPLB 1BZOA 1YEDA 3MRKA 3DUUB 2ZX5A 2GIMA 1I3UA 3AW5A 4R7NA 5D7JC 2EYRB 3MLZL 4PJGB 5I82A 3L3DA 4APQD 4Y16B 4X4KA 3D87B 2Y5TB 3RDTB 4AV0A 4ETQA 3L5XH 3GEWB 3LIZH 3QHZL 4HCFA 1IC7L 4QF1B 5DWUL 5FYLE 5AZ2L 5T5NG 4AEHH 3L3HB 1USQA 3LZPA 1TJGH 1WGVA 3QUZD 2VUYA 1MAMH 2B0SH 2MCG1 2KLRA 1XH1A 4GRLD 4CDGC 1I8MB 2I60H 1H6EA 2YQBA 4LSSL 1EEYB 3NEXA 4KAQH 4QD2E 3BMVA 5DMKB 2WLIA 2ADIB 3QJZA 5JORB 2UXGA 4N20A 4ONFL 4L9DA 4AQ1A 5J6HA 5EEYA 4D9RD 3MO1A 3KLAA 3NIFE 1WTLA 3GK8L 3Q43A 2NR6C 3ATEA 3HLAB 4G6AC 3MDJA 2DKSA 3QO1B 3V4LA 3DGCR 1MNUL 1LILA 3D52A 3HN5A 4KRPC 4KDWA 3L2MA 5TK2A 3WTXA 1CFSB 3F85A 1I8LC 4NM4H 2NXYB 3VXME 1A1NB 3K80A 3CFMA 3IXAB 3SOTA 1WE5A 3WKPA 4P2CG 1ED3B 2FO1A 1KBGL 1JYVA 2XKSA 1UH2A 2DWEB 4HF5L 5E08H 4I5BB 2QZQA 4KMTH 2R7EB 1JRHH 3A5VA 2LU5A 4PJCF 1FNGB 3H6AA 3Q2NA 4JFYB 4B0MB 1EVTC 1LO3L 1ZWIB 3CHXA 4LCVA 4YL9A 3TIDA 2DYSB 3TO4A 1DVQA 4JW3A 4OFYD 4IKLA 1JPTH 3ZKMD 3E6FA 5KYUA 2WXPA 4K5MA 2ED7A 3ZDYB 2MQ0A 3QQ9D 3VXMA 1VIWA 3D2UB 1UATA 1L9PA 3CZFA 3U2SB 1TNNA 4JFHD 4JDZA 3CFKA 1UD5A 5EOQL 3LRSB 1DQLL 2Z8SA 1X5XA 5HTSA 2WNXA 2Z7ZA 1JTPA 5LBSH 4ZS7L 1UADC 1NCNA 4HJ1A 4ZMYA 5HHMB 1UC6A 1WD9A 2R29H 2YFNA 3HG3A 5CN3A 1R5WA 4XN1A 1OWWA 1ITCA 1BQKA 2FEDD 3D25B 1BWMA 1XL4A 1RK0B 1QP1A 4GAYB 2IF7A 4XP4L 1NMCB 4PGJA 4Z0XA 1S8DA 1E9QB 4N85A 2R0ZL 5EEXA 2DV6A 3IJSB 2BK8A 5I17A 3GGWA 5C71A 2HTKC 3V4VB 1QLFB 3ULVH 5IHLB 1FBIL 3QI9A 1SJHB 3B56A 1WBYB 4U6XB 4N26A 4ZO7A 3HRZB 3I6LD 4Q9CA 1LXMA 1FZMB 1RPKA 2APVA 3MOAH 4PJ9C 2VXQL 3ISWA 3VXSD 2K70A 2V5YA 1W80A 1SY6H 1SYSA 3EJSA 4G7SB 4JQIA 4MD4B 2X4NB 1FLTX 1RVFL 2XWCA 3TEYA 4WAFA 2OSWA 3OAYH 1HIML 3QIUD 4MLSA 1L6ZA 3KYNB 4I9WE 4L4JA 3T77A 4POZC 4HJUA 2CDGB 4X50A 1N6QL 3BCFA 5I71C 1MHEB 4HW6A 3V10A 4E5XG 1JTOA 1T0NB 3MV7D 3VRJA 1SM3H 1JPGB 2KPWA 2GBTA 1KLFA 5JHLA 1FORL 3OB0H 4JE4B 5HY9B 5EOCL 3UZEA 3UPRB 4IU2B 2YUVA 3ILPB 4C55A 5E4EB 4YWGH 5TE6H 4L8DA 1T1WA 3RWFA 5KN5B 1EFQA 4HJ0D 4DKDC 5EUOF 2WBJC 3UADA 1AYOA 1FN4B 2BOBA 4HG4K 1U6AH 3MBEA 4PJ7B 4EN3C 5CILL 1UM4L 2XFGB 4JVUA 4ZXBC 5I6XB 5GGVH 1F4AA 3NACH 2VM4A 3ATAA 3LIUA 4M7ZC 4XPFH 2GJ6E 2FIKA 2OMXB 2GTQA 1HHIB 4MASA 1JMZA 1J1OH 2HFGH 1RIVL 2DDQL 2FWLB 1R3LA 5CIPA 4E2OA 2X05A 4AZ8A 1HNFA 2R56L 5F89B 1J86A 3BO8A 4GQRA 1AI1L 2W5PA 3L1GA 4IGBD 4ERSH 1WAAA 2PXYC 1H3VA 3TBWB 4KKAD 4MSWB 3PL6A 1K72A 2CJUH 3FU7B 2A9BA 3GPSA 4ENEC 3FQ2A 4KY1H 1UZ8A 4RMRA 3TT3L 2CALA 3S37X 2BXZA 4NB7A 1PLAA 3FT3B 4HZ1A 2QTEA 4JY6A 5HI5C 3BZFB 4G8IB 4GKSA 4YHIB 5DJCA 1Q4NX 4M48H 1OAKH 2FQEA 2PW2A 5JPMB 1JF6A 4A2HA 3TO2B 2HVKB 4E0RB 2OL3A 2DEXX 2WXFA 4YDIL 2NTFA 3O3AA 2X6CA 5D1ZI 3ECWA 4YAQA 1AO7D 1ETB1 1H5BA 4P5KA 4DP2X 3MKGA 4M61A 5T1KB 4AENB 3STZA 2ENQA 1NGPH 1GGBH 5AW5B 2EIJB 1ZEAH 4ELMF 5H35A 2N3JA 4IIQA 3ULUC 1TMCB 2LU7A 4Z7NF 4HK3J 1JERA 4BDVA 1IM3B 4A1RA 1QFPA 1FVDB 3UO1H 3ZL4H 3FCTB 5BRZE 3MCLH 2VSDA 2NY1B 3GJFH 2OJZL 1H3XA 4JFFE 4RAVA 2J6WA 1R75A 2W07B 3VI4E 4KUCD 5IB1A 3UAFA 1A4KA 4J3VA 1C5DA 2YBRA 4NKIH 4XNMA 2YWYA 3MRJA 3QUYA 4WSJA 2E0PA 3MCG1 3EGXA 2B2XH 3LQZB 3MJ7A 2PTVA 5HJGA 3MV8D 1ACYL 3IMUA 4UDTB 2O5NA 4KJWC 2IGLA 5AW8B 4AMXA 4P0DA 1MCEA 3QZNA 3ISYA 4S1RL 4OI8A 1ORQB 1AD0B 5DZJA 5HHOD 4DKFH 5JIDA 4HHWA 1XHHA 2V9TA 5LXGH 3O0RH 6FABH 3I6SA 2EJ1A 3HAEA 2GITA 3QORA 4FZEH 1UWEL 3E1F1 3RWJB 4ABUA 4I0PD 3VI4A 4UQEA 4PREA 3ZW3A 5IB2A 2EVHA 5D2LB 4XMLH 1S7WB 3TP4A 1X5HA 4BQ8A 1AQKL 2WP3T 3VVWA 43C9B 3SDCD 1IBHA 3EJCA 2V2WB 1GRWA 3PXJA 4K94H 2JI3A 3HE6D 5DVKA 2WWOA 1FV1B 4XE0A 3PQYD 3T6XA 4WI4A 3QJOA 4G3YL 3V79C 1SDDB 3WTTA 1U2CA 3WO3B 4X4YB 2YD7A 3NFSH 4BINA 4JKKA 4O2CB 1KYFA 4RFEB 4PMFA 4HH9A 2WXMA 3A0OA 3K6IA 4Y19D 2GSIB 4LCWD 1ET7A 3ZN6A 5HGDA 1GS7A 3KLDA 5KYXB 4N2NA 1X5AA 3QJFB 4X7FC 3MUY1 3IDGB 2D7PA 4FXGB 1GR7A 1XCQB 3H0TB 3PP4L 5B7MA 1LP9F 1BVNP 2I9LA 1LQBC 4G8FB 3EXLA 3VSTA 2VISA 1WFNA 2YOCA 1NUDA 3FQRA 3L9YA 3P73A 4HFWB 4Z7QF 5C0BB 1F4WL 5EIIB 4PVBA 4F5CA 3ARDD 4P5TA 3X17A 1YN6B 4UQIM 3ULVF 1LE5B 4I0CC 4N0YL 4LHQB 1JPSL 5JMRA 1CGVA 4PN6A 1CJYA 1QVOB 4OZFH 4KK5C 5TGBB 4LAQL 1M42A 1UACL 4Y16D 3RDTD 4OUUB 1W0YT 4J3OG 4ZUTB 5FECB 2DJUA 2O30A 4YDVA 5BZWA 3CN3A 1P7QB 3MQIA 4PJCA 5BZDA 5KS9E 1UXSB 4G11A 5KTEH 2BVPB 5G4MA 4JQVA 2CHZA 2WVTA 3PHSA 4GSUA 1RV6X 3IDMA 2Q3ZA 5KJ7E 1N59B 5C09E 5BVJA 5EG6C 2NW3B 1IVLA 1IAMA 3AM8A 3C5ZB 3CFJA 4LEOB 3F2LA 2X6BA 4EN2A 4URTB 3SIKA 4EE2A 1R3IH 2ZG3A 3IAPA 1W0WB 3NESA 2MCPL 3MJ6A 4GAGL 3P4LA 4M7JL 3ZDXF 5IWLA 4X8JA 4TOYH 4LGPB 3ARGC 3HPJB 4G5ZL 2FO4B 1J9RA 2C4XA 4N2CA 3NA4A 3DO7B 3GXMA 4L4VA 1EZUA 3EOBA 3KBHE 3TNMA 3QSKB 3P4NB 3INOA 2NXYD 4NNPL 5C09A 1NFIA 5DJDA 4B41A 4L8SC 5IJCC 4U6YA 5A2BA 2D03H 1E43A 5GISL 2A5UA 1KIQA 5DHVH 2AAAA 1FH5H 3AWEA 2XKUA 3TWCL 5ITBH 3IETB 5ETUB 5DD6A 1URLA 4MS8D 1J8KA 4LE8A 5KUMA 3GB7B 4JLRA 1L0XA 3CUPA 4JDVA 5DJYB 3SYQA 5ID1A 4NQXB 1KJ3H 2WLNA 3O9WA 3WLWC 5I1AB 4UTAH 5I30L 3X14A 1MREH 2HJFB 4D8OA 4TVPH 3CK0L 1Z1WA 2HLAB 4GRMB 2L0DA 2AGJL 1U8IB 3KPNA 3FTZA 4EDXB 1N2RB 4ZFGH 4C56B 5C2BH 1UOKA 3PGCA 1A4JB 2NY3C 4G7YL 5F3HA 3TH3T 3IVKB 4P57A 3EYFB 4PGBB 3SE8H 3T2NH 4OZIB 1WZAA 5HHMD 4KDTC 2VZUA 5IIEA 2YMXL 4OLEA 4Y1SA 5GS2D 5JW4R 1FO0H 2X1OA 4P99A 2GTZB 2NY4B 1F4XL 4ELKB 1AZUA 3S98A 5C0JB 4AYGA 1WFTA 4RRPA 3V4VL 4JCWA 4D8PA 1M9SA 2V9RA 1COBA 5EUOA 1GY1A 5IROD 5C08E 5C0CB 1WA0X 5C1MB 5GIRA 4E41E 2NW2A 2ZCKL 3V6OC 4NKQB 2EDMA 2FQDA 2C9RA 3VFTA 2VCOA 2CMRL 1JXKA 5K9OB 1HXYB 3FU8A 1HKFA 2EH8H 1RIHH 4YGVB 2E9IA 1IBGL 5L2JA 3TBSB 3QEUB 2VZ1A 3BAIA 3ILQC 5D1XC 4IOFD 4BFIB 2XRAH 2AQNA 2X6AA 4OLWL 3VXNA 4HJGA 4PYHA 5I18L 1ZHKA 5ILTH 3T2PA