4PBDA

Crystal structure of the n-terminal cs domain of human shq1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
102
Chain Sequence
b'AHHHHHHKMLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SHQ1 homolog
molecule tags Protein binding
source organism Homo sapiens
publication title Structure and Interactions of the CS Domain of Human H/ACA RNP Assembly Protein Shq1.
pubmed doi rcsb
total genus 16
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2014-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pbdA00
3IGFA 1WGVA 4YE0A 2MNWA 4PCKA 3GUFA 4YLBA 3AACA 3J07A 4MJHA 3W1ZA 2WJ7A 4RZKA 4JUSA 2N3JA 3L1GA 2JKIS 2N0KA 2Y22A 2WJ5A 5DS2A 2CG9X 3VQLA 2O30A 3AABA 3Q9PA 3QORC 4M5TA 4M5SA 1X5MA 2K8QA 4FEIA 2CR0A 5DS1A 2Y1ZA 4YDZA 2KLRA 2RH0A 4YL9A 1RL1A 3QORB 4PBDA 2KMWA 3GT6A 3Q9QA 4ZJ9A 4YLCA 2BOLA 2XCMC 3L1EA 1WFIA 3EUDA 3GLAA 1WH0A 3QORD 2Y1YA 3QORA 4JUTA 3N3EA 4ELDA 3VQMA 1SHSA 4I88A 1GMEA 5LUMA 1EJFA 3L1FA
chains in the Genus database with same CATH superfamily
1IE4A 1NFIB 3V5DB 3GRWH 4PS3A 4YNYA 1KCUH 4YHIB 1IBGL 1KYFA 4KU1A 4DQAA 4NPJA 3DPDA 3ESMA 1GZQA 2P43B 4NI3A 2D2CC 2V2XB 3LZNA 4R7DA 4P99A 3HMXH 3I2CL 4W9KC 4FOMA 2CCWA 3EDKA 4OJYA 1LO2L 2XA8H 2XTJC 2RHEA 1E42A 3ZKXC 3IE4A 4WIQA 1RMFH 4N8UA 4M3HA 3JV4A 3BN9D 3CPUA 1UH2A 5DEJA 4F9LC 1UC6A 3ULSB 1S7TB 4KVNH 5F8QC 1WTGT 1R5IB 3R0MA 1BZQK 1HYRC 4QRPE 4FQLL 12E8L 3SGJC 1AD0B 4M4PA 3L4XA 3MXVL 2XXMB 4GXVL 4NO3B 4OZ4B 3Q3GA 1WEJH 3OR6A 1MH5A 4XMTA 4HHWA 2HTLD 4QNPE 5C6TH 3VNZA 3SJVE 1RL1A 5GS1A 1BVNT 4C4UA 1THAA 2IFFL 4BM7A 4NUGH 3NCJL 3UO1H 2ILLA 3D85B 5F1KC 1JE6A 3LPPA 2VB5A 3CFEB 3ILQC 2Z91B 5D2LE 4YHPA 3MV9D 4JO8A 2DEWX 5TJWK 3SSGA 2AJUL 1U91B 4FNPA 2WJ5A 3PXHA 3W82A 4Q56A 3PV6A 3ZKMD 1T04B 3S37H 3ZRCC 3BQVA 3CHPA 5TDOA 1NC4B 2EC8A 1S9VA 1S7RB 1IC4H 4J39A 4HMDA 3AY2A 2B3IA 3UBXA 4FXTA 5K39A 4RWYL 1JCKA 2XZCH 4GP5B 3NCEB 5L0QB 2GUYA 4I1RA 3AREC 4NRZA 5F44A 2JELH 2W60B 1JP5A 2BSTA 1N0XH 2Y5TA 4NQCB 4QR7A 1II4E 4UM8B 3BJ91 3U1SH 4AYFB 5IM7B 1NMAH 1ACYH 4LL9A 3FPYA 3ESVF 2PTVA 4AMWA 2H4EA 3RZCD 4IEFA 5IOKA 2DQEH 1YMMB 2BNQA 3TJEH 1FIEA 3QQ4A 1RJYA 4HIXH 3RUGF 3VTTA 2H47C 4P2OA 4BCXA 4EBQL 4F7KA 3PL6C 2C4FU 1J48A 1KG0B 4BELD 1BIIB 1DVFA 4WK2B 4DZBA 2EDKA 3PJSA 3AZUA 4NQDE 5E9NA 1IO4C 4OJAA 4TM9A 2ITEA 4FJZA 3V6FB 4JZJC 4KXAA 4LAJH 4PJDB 3VXRA 3QFGA 3UBHA 2PXYB 4JY6B 3N41F 4R4BA 3L3HB 5AOLA 3E6FB 3KJ6H 4RGND 3STZA 4LF3B 4YGAB 3WUWG 4RWHA 1JI2A 4HG4K 5F9WB 1GIGL 1YEHH 5KSBF 4LQ1A 3SDAC 3A22A 4F80A 4RFEA 2A6KA 3TBSA 4E9XA 2W59A 4N86A 1HYSC 3FOMA 3QRBA 2PCFA 35C8H 5CJQH 5A16A 5CEZD 1BOGA 2CJTA 2FL5A 1CDGA 2XNAB 3BQUA 3QAZC 2YWZA 4PJCB 4P9HH 4WEEA 4YS4A 5E00B 2CHZA 32C2B 3SBPA 4NGHH 1OM9A 4BQ9A 1ZLSL 2GJ6A 4XTRD 5HP5A 5JMOC 2ZE0A 4N8VG 1KT2A 2QLYA 5I16B 5I1LB 4HT1L 3JV5A 3FU8A 4U3SB 4BGDA 4Z3FA 4Q9RL 3EOYG 4LPUA 3L4WA 5C7ZA 4Z7NB 2KDGA 2R56L 3AXLA 2Z7YA 3H9SA 4P0DA 2ODIA 2X89D 4P8QA 5GRXG 5F1IB 2DKUA 3QJOA 1UB6A 3DJSA 4XPFH 5KTEH 4LLMB 3WN5C 2O5XH 1FFOB 3OGCB 4BWTA 1UEYA 2XA3A 3UIZA 5ENWB 2O72A 3OZ9L 2F9BT 1CLZL 4N87A 3D8MA 4L8BB 1FVEA 4UM9B 1J8HE 4OFVA 5GRVK 4ZS6C 5LLIC 5KVEH 3I6KA 5D2NA 4WUKH 1XGYL 2HX7A 2PETA 2RACA 4ZXBB 4HBCL 4FKEA 2OSLB 3TCLB 4KTDH 5ESQB 1XCWA 2UXGA 4FP8H 3IS1X 3AT8A 4WTXA 1OT1A 2X4RA 4JO2H 4NZJA 4R2GB 4X50A 4F37F 2VLJB 3FTWA 2BMKB 1HHIA 1QSEE 2VUOA 5IIEB 3KLHD 3O0LA 4ATWA 5E1IA 2X6VA 4HJ1A 2L7QA 2H9GA 1HAWA 3TP4A 2WLKA 1FNEB 2HJKB 4B6ZA 5JPMB 4FQ1L 1DJSA 4TTDD 4KY2A 3MMEA 1AR1D 4FC3E 4LHQB 5AVWB 1JNNH 3O3BA 5FV2A 5EF3A 1FWXA 3RTQB 1M7DB 15C8H 5F7KC 3L81A 3OXSB 3T0EC 4JG0L 5IBTL 1VKXA 1UM6H 1XCTB 1ZDQA 1FFQA 5F7EL 3MO1B 2X2IA 1VZHA 3HC3L 5K9OB 1EAOA 4G8IB 5DO2C 5G5DB 3VRIB 3GSOA 4BRVA 4Y4KD 2DF3A 4UDTA 4QWWC 1H8SA 3D25B 3TV3L 5G4NA 5ANMA 3V9CA 3LKNA 5C0RL 5I17A 1J0HA 3RX5A 5C0IA 1OAXL 2BOBA 5I1DB 2IADB 5DD0H 3LKSA 2L0DA 2IXQB 2WK2A 4PGDA 3IU3B 1P6WA 4KVPA 3AQDA 4PVLA 3QUGA 1MJ7L 3SKMB 4NZRL 5ACLA 2E0PA 1BPLB 4NN7B 2CUIA 4OCRL 3BESR 1KXQE 5GQBA 2GG1A 4PR5B 4UV4H 2D31A 2R83A 2H3NA 3LNHA 1UFGA 5IQ9A 3MJ8A 5I6KA 3QIBA 5A3ID 1V3KA 2DJUA 3MBXL 1TEYA 2X4NA 4M1GL 3VG9B 2BSDA 4AV5A 5DK0B 1RZFL 2CLVA 1NBZA 3CU7A 3BAYA 3LNFA 4K71B 5AKVA 5D4JA 1GS6X 4G6AD 4Z7VF 4A7QA 1CO1A 5GZNC 3MV11 3VFGH 1KCRL 1KB5B 4MAYA 3MRMA 3FHEA 1NBYB 2DI7A 2JWYA 1E5BA 2F74A 2XQBH 5AW1B 4JM2F 4AENB 1QHPA 2FBOJ 4OJCA 3FU3A 4M48L 1SOKA 1SJXA 4JHAL 5T1MA 2N7SA 5H8DA 2NR6C 4M62H 1MHPL 1SJEB 4G7QB 1AP2A 3L7FB 2EQDA 1J1PH 1S7RA 3VX1A 1N5AA 4G7YL 3VMNA 3MUUA 4F7PB 2XVBA 4OTXH 2HVKB 1G7QA 4CVZB 2BO0A 2K6YA 1QQDA 4PS7A 3UAJD 5BZXA 2FJSA 1QSFD 4J23A 5LGKA 4F3FA 1CTMA 2DQCL 4PJ7B 5LDSA 5CXPA 3U4EA 2H8PA 1H15B 5HJ3A 1NTDA 4GY4A 1ONQB 1CLZH 4EZKA 2D4FA 2E46A 4UAOC 4F15C 4NRXA 5DQJB 4WFED 1ETB1 1YMMA 2BNQB 4H0HB 5FO2A 4JO4L 4CKVX 3JV6A 2YIHA 5FGRA 1CGSL 4LRIC 2IAAC 1ZVYA 1LD9A 3TWCL 1A4KB 4B97A 3FNKA 1G9NH 4N2GA 2IG2H 4KTDL 4JQXA 3QXAB 3ZN6A 4E0RB 2ZOTA 3IN2A 4XVJL 4OAWB 5B21A 15C8L 1A1OA 2GQHA 4S1QH 3MUY1 3HG1A 5EC2A 2A9BA 2GI0A 2WNXA 1AHMA 4M1CC 3L3DA 2J2ZB 3IKKA 2LU5A 3KD4A 1MAMH 2NDFA 4G6JL 1AXIB 4F93B 1F42A 2VTFA 4FQ1H 3LRSA 1CI5A 1OAUL 3OXRA 4CMMB 2BY3A 1KTDA 3T4AC 3NK4A 3WFHB 1KY6A 3QR0A 1FNHA 4MCYB 1I85A 1XGUB 4GW1A 5GJTH 4X4YA 1KJ2H 2C4FT 4DW2L 3BZEA 1HOCA 4YK4C 4PJBF 2YD3A 4AK1A 1A47A 5CZRA 5EO1B 4FL4B 4UTAA 4UMGA 4KO6A 4PWEA 3RRQA 2B15A 3D39B 1HXMB 3F05A 5I1JL 1X4YA 1FZMB 3CPLB 2KLTA 3NQIA 4L8SB 3UADA 3VTMA 4LO9A 3OXRB 1YNLL 3WEXA 3WCYA 1HNFA 3SKNB 1MFAH 4ZOCA 5HHXH 1EWHA 3TN0D 1G9ML 4K3HA 1AHWB 4IMKA 2CMRL 3SKOA 3UPRA 1I1YA 1U8MA 2IALB 1KN4H 2ESVD 4Y1AE 4PRPB 2EYTA 1GZPB 1JGLH 1Q72L 4HKXA 4Z7AA 4KK5C 1I9RH 1TO4A 2YOCA 3SDCA 1NCNA 4UOZA 2CPCA 4YH6A 1T5KA 4UMSA 3HNVL 2EIJB 2AXHA 4ZI8A 1R3LA 3VI3F 3UTPE 1KJ2A 4XBGA 3V6ZA 3DIVA 4BZYA 4Z3IA 1BQSA 4NQEE 3AG3B 1BAFH 3INUH 4M43L 5ETUB 3WNJA 4HH8A 3G3LA 3SKOB 3UPRB 3EKCA 5A2KH 3ZE1E 1E5YA 5ESVA 1A3ZA 2IDTA 4Q89A 2VM3A 4QRTB 1S9WA 2V7NB 2AVGA 1UACL 4U0RC 3LKOA 2A6KB 2WPGA 3F65A 4LBEB 2BMKA 3UJIL 4G1EB 5JW4N 5C7XH 3IDIA 2PTTB 1KELH 2ZCZA 3BSGA 3DRQA 4P9HC 5F9DC 4X6BA 1I7ZA 3TPKA 1WISA 1VADA 5IG7A 2AJYH 1QBBA 4JPVH 2VDOL 3DX8A 2OK0H 2AJSH 1LO0H 1JPST 3UAFA 3ZHDA 6FABH 2DBLH 4AOFA 4Z23A 2ITFA 4ADGA 2B39A 1KNOB 1X5LA 1MNUL 3F84A 3PYCA 5F7DB 2B4CC 1XAKA 2ICES 2IMNA 3KPRA 3GEFA 3AROA 1I1YB 2WNWA 4JPIA 1LNUB 4PJAE 5ID0B 1SYSB 4NNXA 5F6HI 1KWKA 2JCCF 3ZTEA 4N22A 4I5BA 5KJRH 2ZCKL 4JFPB 2V8MA 3OF6D 4HDIB 4ONGH 3T2NH 5IFHL 5CBAA 3VXMD 1O75A 4S2SA 1G7JB 1K4DA 3CE1A 1N3NB 4LASH 4PRDB 3HFMH 4NP4H 3P3YA 4PUBH 3V0IA 4WI9A 3RUGA 3MLSL 4GIOA 4TPRH 4P2CG 4TUJB 1I8MB 5JPNB 5FCSH 2DWDA 4JRYD 4EI5C 4YZWA 1UVQA 4BH8A 4HGWA 2HN7A 1O7SA 4HZLB 5LN8A 1RULH 5T1KB 3ZKQD 5K9KB 3REVB 3Q2VA 1FFPB 4KK5D 3EHBD 4XXDB 1K8DB 2B1HL 5GGVL 4RRPM 3RWCB 2DQHL 3IRPX 4OKVA 3TF7C 4YE4H 3S5LA 2YWYA 4QXGH 1UADC 1D5RA 2K6ZA 1YYCA 2GC4C 1KJ2L 4X6DF 4AYSA 5KWYC 3KR3H 5EZOH 2RGSA 2NX5B 4JZOA 3IRZA 4R7NB 4TUJA 3N1PC 4YDVA 1AQDA 4ISVB 5MP6L 3GGWA 3Q6FB 2Z31D 1EEYB 4RVBA 4BGLA 3FO0L 4R96A 2WKGA 3ZIMA 1ORSA 2DQGH 3TEWA 2WIIB 1OARL 4UT9H 1PY0A 5HYFA 1EERB 4IM8A 4BBWA 4XN5A 3SDYL 3L2LA 5GGRB 5IJVB 4PJXB 1TKWA 4MSWB 3RAJH 5D1ZI 3S5LB 4KZ0A 2JQAA 1HU8A 5FIEA 4X9FA 3OMIB 3P77A 4WEMB 4L4TB 4P2QD 3WKML 1Z3GH 1NLBH 4N3UA 4OZFA 2XKNB 3TOPA 3NK3A 1DJIA 5C97A 1WT5C 2VDLL 1YECL 2ADJA 4HV8A 2KUTA 1TU2B 3UEZA 3NPSC 2B7DT 3QEQE 2MQGA 2ICEC 4XCNA 3IDYC 3AXIA 4PAZA 1KC5L 4DHLA 4ZMLA 5C2UB 1JZ8A 1P5VB 1YCSA 3DXAE 4A63A 4ZFOA 3LS4H 2D2OA 2GI7A 3IDYB 3QIUC 3SQOL 3CZNA 5KANI 3Q1SL 2Q5BA 3UROR 2QPUA 1JGEA 4OKVB 4U05A 1JBJA 1NIFA 4WHTA 3N40F 1RUKH 4OJFL 5EDSA 2ZKMX 2DWEB 3OWEA 4JFUA 3QQ4B 1C5BL 1HI6B 4QJ3B 4Q4IA 3GIZL 2YEZB 2ZKHH 2W9EH 3UZEC 5E0FA 2JJTC 2DLFH 3IYLW 5KJRL 3P4OA 1QG3A 2OAAA 1SPDA 3TNMA 2COQA 4OZIE 2JQMA 3D33A 3O6FB 3UTTA 2LT9A 3BO8A 1P7KB 4GYBA 4PP2B 3Q7JA 1Y6MR 4AMXA 4MA1B 4NO3A 3KBPA 1YYMH 4JO5A 2E8YA 3V0DA 2VR4A 1G1OA 4N8VB 3IRCA 1IVLA 1H3XA 1S9XB 1FNEA 2I9LA 2NX5E 4XWOD 5CINH 3ECVA 2EUXA 4ZFQA 4Z7QF 3O11A 1NDTA 1ERNA 1OSZB 4LOFA 4YFDB 3CPLA 4IOIB 4XP6L 3IJEA 3QZWB 1T20A 4LLDB 3MCLL 2B1HH 5GGVH 2R2EA 5I73B 1EXUA 2FGWH 3V4VH 1W80A 2P24A 1IC5L 4ZPTA 4Z5RA 3HE7B 4E36A 2PO6D 3FOLA 1EHXA 4EI5B 5IVZB 1LEGB 3VD5A 4HW6A 5DD0L 2R29A 2WMPB 1WFUA 5KS9F 2G9KA 1OSEA 2Q20A 4S10A 4F7TB 1NM9A 3A6CH 3QDHA 5I26A 1RUAH 1N6QL 4A2FA 4OCWH 4DUWA 4PJGA 5DHDA 1XF5B 4MA3A 4LP8A 3V5HB 1J9CT 2EH8H 3PAUA 4JBSA 1IGIH 4NQSB 3P4MB 5J1AB 1LK3L 2DYPB 4YDLB 2O6DA 4KUCF 4MQTB 5DZ9A 1RUQL 3BAEH 1MLCA 2CRIA 5I28A 2G5BA 4LU5L 4UIMB 3V10A 3WLBA 2X2JA 2EIZB 1O5DT 3UO8B 1RUPL 4WUUA 3WFEL 1KGCE 2QV4A 2Y25A 3V4UH 3WIAA 3SDDB 5AYTA 2GEEA 4Y4FD 3ZT7A 2QQNL 2IWGA 4UTBH 4BZ2A 2I25N 1JZ6A 4QT5A 5F71A 1LJMA 3HCVB 1LM8V 4G9FE 4M02A 1CR9H 1KTDB 1JZ2A 5CJXC 3O11B 3HAEB 2A4CA 3APFA 5ID1B 1XB6A 3EO1A 4TQ8A 4D0CA 3SCMD 5IEKB 4XNBA 3WHXB 1HDMA 5C09B 1JN6A 3EIFA 4L8SA 1JGDB 4ZTOL 5F1IA 1LK2B 4LSQL 4C55A 3MGOB 3EBIA 2DQDL 4BFJA 2MIZA 1KV3A 3FFCB 1NDMA 1R3HB 3SDDA 3QWRD 3S37X 5CLWA 2XBDA 2XIBA 3CFMA 4X99A 5DUML 5BZDB 4ATTA 3OPZL 1BGXH 1ZV9A 4ZPVB 1OW0A 1PIGA 2J1WA 1NBYA 2ZSWB 5FW8A 4LLUB 2E27L 4ANUA 4YHNA 2ZX5A 3SPIA 1GPOL 1O9ZA 2B59A 2VWEE 1M6UA 3K8KA 3HC2A 3HZVA 3B5TA 4FEMA 3VWKA 3DTXA 3M1BA 4XN1A 1TQCB 3UG5A 3UPCA 4MJHA 3BIBX 1A22B 3M7FB 1G9NL 2XNAA 3BQUB 2R29L 2VJ8A 2H0JA 1QACA 3UTZA 3U36B 2AGJH 2VDRB 4PV9B 4OLVH 5E4EC 3QZBA 2GAZB 1VJSA 5F3FA 5IIEA 4I89A 4DVRH 5D71L 5FHBL 2JK5B 2Z6FA 2WOBA 3OG6B 4G6JH 5MENE 5SX4I 1T3FA 3SDCC 1FL5B 4XO4A 5I18L 3FK3A 5D2NE 4LEOA 5C8JB 5I5IA 5DEFB 4KKPA 4FLRA 1UA7A 2ATPA 2YD2A 3UAEA 2MOGA 2FT8A 2VLLA 1J0ZA 5AYUH 2YLHA 4R9HA 4JO1H 2EAEA 3WIFA 3QNZA 1U91A 1X9RA 3PJSB 2P5PA 4PJFE 5I0XA 2OJZL 3T04D 2W0FB 3BVNB 5K69A 5F96H 4TULL 1BQLH 5B8CC 4XN2A 4DH2A 3L5XH 2X5PA 4K5LA 4NZRH 2ZIDA 1TPXB 4LEOB 1QSED 5AW0B 1MRCL 3IDNB 4JFWA 3B9VA 2YPLA 4UNIA 5AUMA 1BAWA 2A9DA 4KK9D 1GC1C 3O41A 2EDXA 1OSPL 3HC4L 4F27A 4BE5A 2EEBA 2WQXA 2JB5H 3ZPDA 3SD2A 5LCVA 5CNHA 3B9KD 3V5HA 2NY3D 3VDAA 4BFIA 3RVUD 5DDHA 3K0YA 2VR7A 1BYNA 3SKNA 3HI1B 4KJPC 1HEHC 1OCOB 4JJ5B 5HPMB 4MX7B 1XD1A 1XSIA 4Y0GA 2WBKA 3TLRA 3EF4A 4KFZC 4L3AA 4F2MB 4JHBA 1JRHI 1PZBA 2X4SA 2WTRB 2FDBP 3DUUA 1KCRH 5GRVL 5C0AD 5BW7C 2FUTA 2ZXWB 3N2JA 1CFMA 4FXLA 1DSFH 2W65A 5C8JA 4A2DA 4NOBA 3DIFB 2Q8BH 3SOTA 2B16A 2PR4H 3MROA 4I0CC 1SJHA 1O6TA 2ICEA 4LF3A 3TT3L 1CF8L 1MLCB 1PLGH 1PYWA 3EJCA 3MLTB 3D34A 3OKOB 4PJGF 4OZGE 1ZRUA 5CEYB 2H1PH 5I2IB 5HGAA 5IB3A 3D4ZA 3CNKA 4MX7A 5C09D 4EZLA 2A6JB 3I6LE 1DQDH 4GW5A 3AS2A 1IKNC 4S1SH 4U0QB 2OMXA 5F7EH 5J7CC 1JCVA 2H2SC 5CZVH 4ECNA 3WI9A 2YXFA 4I48B 5F72S 2YBRB 2AJVL 1IBFA 1W15A 4OZHA 1D7FA 3VD3A 1YO4A 4HFWA 2YKLL 5H94B 2RR3A 5FB8B 4N0RA 1A6VH 4HUUB 5E1QA 3CSFA 5JHMA 4FX5A 4ZOAA 2I60H 1WPCA 5FDWB 3TCLA 1J5CA 4KKBD 2JJTA 3RGVD 4XR8C 2ZKXA 4H2AA 4XN4A 3UBXG 3ABZA 2W5PA 5B4MC 2DWXA 5HVFB 3CXHK 1UGNA 4DKEH 2DYSB 4F2EA 3MRLB 4P3CL 4XI5D 4E9RA 5JPMA 3IXAB 1M7UA 4KQ3L 1NGXA 1NANI 5IOPA 1IM3B 1N26A 2G3MA 4Q0XH 3FMGL 1AP2B 5IFAH 4NKDA 1W6LA 3WO3B 1KBVA 3U0PB 4GT0A 3CV5A 3VDCA 4XH2A 4M29A 5HVWA 1IARB 2EVGA 2VDLH 3MO1A 2O6EA 2Y0SA 1JGUL 4LKXB 3CBJB 4PRHD 4Y16D 4X8XA 3VYOA 3DMMB 3SGEH 3WJLA 4R0LB 4R2GD 2YD6A 5DRZA 4LEBA 4WFEE 4PRDA 5KJ7E 3KLLA 3HS0A 1F11A 5DD3L 5IQNA 3Q3GB 2YARA 1WIOA 3EJZD 4X4MA 1WBZA 3D7PA 3WUWA 2W9LA 5GZOD 3RWGA 3UJTL 3I2CH 1DR9A 1PLGL 4FZ8L 1BPVA 1XB3A 5D71H 1JVOA 1CJYA 1XR8A 1SVZA 1R34A 1JNLL 1T7ZA 1T2JA 2BZCA 3CFQA 4XNMB 3N55A 1KBBA 3EBAA 5KBKA 2AI0L 2NMSA 2YPLB 3FONB 3LD8C 1G6RL 4JFZL 3DMMA 4PCYA 3UTQA 1D5IH 1BG9A 2DQIH 1MCKA 4QXTB 5K1VA 3KHQA 5E94A 3V7MA 4NNPH 3U9PH 3UAJA 4HWZA 3LD8B 3GLZA 4LDLB 1CG9B 5A2AA 4U49A 4ZXBC 5B1JA 1JI1A 5AKRA 1E4XH 3QJHB 3ISWA 1UWXK 1Q9LA 1IM3A 3U83A 5CP3A 1TZGL 1DQLH 4FFZL 5HYIA 4J3WA 4X9BA 4HIEB 4ZAKD 1DQQA 5IROA 3P4NA 4HHAA 4PYGA 5DDHB 3WTVA 3DO7A 1Y1DA 1NCJA 1FC2D 4ZT1A 2A0LD 5A7EA 5AW5B 5BS0B 1HKFA 2BVYA 4R0LC 4H25A 3ULVC 3U7WH 3U25A 4PJ6A 4TSCH 3GMOA 3L17A 3E6HB 2QSVA 4KKLD 5L8LB 4X8GA 5B1AB 4FKKA 4P2RA 4G5ZH 3WMPA 3ZSSA 2FJHA 2PNDA 2E59A 4UQAA 1ZHBA 4TVSa 2FX8H 2WLIB 1HH6A 4ZSOA 1ZEAL 4L48A 3ZZLA 2IWFA 5E8PB 3M07A 1USZA 4LLQA 4M6OH 3S0PA 3VI3A 5K5YA 1U93A 5DYOA 4PRPA 3QRGL 3C5XA 1DQQB 3NZHH 5EIQA 3GRGA 4YMPA 2YBRA 1DDHA 1HHHA 3ISYA 5EO0A 4A2MA 3ZYIA 3A4AA 3ET9F 2E5EA 1MFEH 1LMIA 2X4PA 5IB2A 4MCZB 3UC0H 4HGWB 4PREA 1H5BB 4JFOA 4PJAF 3NIDB 5EZJB 4JO3L 2DJSA 2HAZA 3FO9A 2YXVA 4HD9A 4E9SA 4P59H 4EBQH 1KN2L 4AH2B 3RWEA 2Q6WA 3L7EB 4F58L 2Z35B 4RGNE 3QQ3A 5IMMB 5KVFE 3T2OA 1O5PA 1BBJB 2Z93B 3T6VA 5KBNC 4MHHG 2HRLA 2QPSA 3D2UA 5C0JA 3D08A 2Z92A 5AVVB 1YPZA 3GKZA 4ZYKB 3MNDA 1AQMA 3RFZC 4XPGH 2F15A 3U46A 4TSAH 1D7CA 1OAYH 2GJ6D 1E9QA 1U6AH 4YHOL 3T0AA 4DK6A 2ID5A 4ONGL 1FGVL 2X40A 3O4OB 5AYQA 3QJFA 1G1CA 4JG5A 3SE9L 3TIEB 1UURA 1A4CA 4FHKA 3VG9C 1VFMA 5F9OH 1ZHKB 3B2PA 1E9PA 3HZMA 4KO5A 3ZE2E 1A6TA 2G60L 5DJXA 1BQ5A 3C12A 4MXWH 4PS4L 4U3SA 4EOWL 5FW6A 2DMHA 3U6RB 3TU6A 4FQQA 1HZHL 4GP8B 4LKCA 4RCAA 1AYRA 2YSTA 4HJ0C 5HTSA 3BWSA 3MLPA 2YAEA 2OP4H 5FA4B 4HDIA 4FQXB 3GINA 4ADJA 1RZ7H 5HXMA 4L8CA 3P9MA 2Q87A 5G55A 4NXSA 1XCQB 4EIBA 3CH1B 5DJ0A 3QB7C 2O6CA 4ZW6A 3WN5A 5TFSH 4JQVA 3CFTA 3RA7L 1ZOXA 3VA6A 4V1DD 4H40A 3UBFA 3BAWA 4QDGA 5J6GB 2F7RA 1DZ0A 2V3DA 1KCUL 2D7QA 3SDXA 2W81C 3CN4A 2ZCLH 3G6JF 4W9IC 2EIZA 3W11C 4F7EA 2V5SA 4ZO9A 3FONA 2VC2H 1SBSH 1TPXC 4H88H 5GSRA 1EHNA 4H8WH 4L8DA 4NDMB 1G9NC 1N70A 3F7VB 4O2FA 1IILE 2MEJB 1ROCA 1KB9J 1YMHA 1QO3B 2FQEA 4LLAA 4ZFFB 2EE6A 1EXGA 1ZIAA 2AK4D 3GMQA 3NIGE 3VSTA 4XAKD 3EH2A 4DFIA 4GSUA 5CGYD 3ZL2A 4HOXA 5IQ7H 2VH5H 4PLKC 1HJBC 2IGFH 5BXFA 5D7HA 2EECA 1PFCA 4EMZA 2WWMC 4W9ZA 3NCXA 4YHYB 2PWEA 2XRAL 4J4PD 2VYRE 4KHTH 3V7AG 5J6HA 1MY7A 4NQQA 4GUCA 4Y19B 5JQIB 4BDVA 5FHAL 3L1OL 4UIKH 5DWUL 2VISA 3ZKXB 5E5MA 2YEVB 2ZKYA 1UQSB 1PL3A 1ONQA 4LVOB 4JM0A 3FHAA 3SKMA 4XVTL 2PW2B 2Y72A 1DVFC 3U30C 1OPGL 3BQUC 4Y1TA 1FQ9C 1ES0B 2Y23A 4J3UA 1HQRA 4M56A 1TQCC 3GMLA 4RAVB 5EU6B 5LHDA 2CAKA 5BO1L 2X53A 3OJDB 2VM4A 2RBLA 3CMOH 3PXJA 4MMZA 5DHXB 3PV7A 4DETA 3BUBA 3B3BA 1BD2B 1AD9B 1ZAGA 4A7UA 3MACH 1NC2A 1SM3L 2DWYA 3RUGB 3L45A 3GIVB 5KOMC 2XQBL 2HKFL 1WFNA 4LCUB 1U36A 4BSVB 1RUMH 1FE8L 5JLZB 1FV1A 2NR6A 3ARUA 2Q1EA 4OCLC 4PSRA 4AJYV 2K70A 1A6ZA 2DMCA 3DGDA 2HLEB 4FTVE 3ZY7A 4HJJL 3UTTE 4JL1A 1S3RA 4NUMA 1DLHA 3CHRA 1UD6A 5AL8A 1SBBA 4I48A 4PJFF 1VLXA 1GOHA 1IC7H 1F58L 4WHTB 4JNXA 5TE6H 4TUKH 1HK6A 3SDXF 1KXVA 4L29A 2PCFB 3FT3B 3JWNH 4Y5YA 1CLYL 1NMCC 4ZFZA 3A67L 2VL5B 4ZXBD 3FQ1A 1Q90A 4X5WA 5KSBB 4HKZB 2RQ8A 1QNZH 1M1XB 2BSSA 1GOFA 2C3GA 2DQHH 3WAJA 4B0MM 1R75A 2RB8A 1A2YB 3QUKB 5DS8A 2DBJA 4P2AA 4NN5C 4OV5B 2Z8SA 3MRGA 1CVRA 2VABB 3GSRB 1LO5A 1ZXKA 2C34A 3B4NA 4K0OA 1R46A 2NXZB 3IXAA 1T20B 4LLDA 3FFDA 1A65A 3U9WA 3UTSB 3BKYH 3MV7D 1UM4L 2R1XB 4MLIA 3LY6A 4I3GA 4FJ6A 1DVSA 1E27B 4J6IA 4M48H 1D6VL 4YJZL 2FBJH 4W9CC 2F1EA 3D25A 1E5UI 4X6EA 4JM2D 5E8NA 4LASL 1OOAA 1BFVL 3TVMA 4AYMC 1HL5A 1WP6A 1SN5A 4S1DD 4Y19E 4MXWL 4M5ZH 4LGSB 5CHNB 2VR9A 4ZUWA 2BW5A 3VRJA 2ZWZA 2EEFA 3GHEL 1F4WH 2QV2A 3PREA 4OD3H 3T2QA 3WNMA 3ZGHA 3GJEA 1DVXA 4GKLA 3ZTJH 4A6YA 4GFTB 3ZOAA 3QUYA 1MIEH 5DRXA 5C2BH 4PI0A 5JQ6L 2ETWA 4MGXA 4OIIL 4KI5D 1GGCL 2NNRA 4Q97A 3GI8L 4LSPL 2Q0ZX 1JV5B 2FCBA 2VLKB 3QIWB 3TO4A 3NRFA 3EZJB 1YEFH 1C5DB 3HMWH 3QG7H 1U95A 2UX6A 5E2WL 1NDGB 1QLFB 1NIBA 3EFFB 1A5FL 2BINA 3KXFD 1BVKB 2CLVB 4TRPL 1BYOA 1U8OA 5DJDA 1KCLA 4I87A 1KN4L 2E4TA 1MNNA 4JB9L 3T8MA 1TZ8A 1EBPA 2HX9A 2OYMA 1BEXA 1EFQA 4HXAH 1G5GA 4XN7A 3U0TA 5IESH 4LCCC 3W57A 1VKXB 2L3BA 4K8RC 5DMKB 5GS1B 1YNLH 1BMZA 1R4XA 4JM4H 3PWLA 4FGMA 4R4BB 1MRDH 4V1DA 3ALWA 3E1F1 2WSKA 1OLLA 2EIMB 3N1GC 1CD9B 3NG5A 3S4SG 2MNWA 4ADIA 1PKOA 1A8JH 3JBG7 4M7LH 4K2UH 1QNIA 1C5CL 2XZAH 3ATFA 2QR0B 5IW3A 5G2NA 5C0IB 2E9GA 1JXKA 3A4EA 1DQKA 2E76C 2JKJA 2X6AA 4XNUH 3ZX1A 4PRAA 4I9WD 2Z31C 2DQ6A 5CJOH 1ET8A 1G7IA 1CFBA 3SDCB 4N2KA 5EN3A 1F02I 2WINB 4IRSA 5BRZB 3V4PL 4HPOH 4C57C 3FSWA 2K3TA 1X7QB 4D0BB 2CIIB 3GMNA 3BKML 5DC9B 1QA9B 1PZAA 2QTVA 3IFPA 4L3EA 3A6OA 2DAVA 4ZUUB 2ZWYA 3QFJE 4JFED 5FM5M 4WK0B 3SO5A 4N2NA 1DANU 3VCLB 2PPFA 3U9PL 3QWRA 1DJXA 4HWUA 4DN4L 1NUNB 3RNQA 4YGVB 3DO3A 3QORA 1KXHA 4APQD 3HE7D 4LSDA 4KV5F 3C8DA 2JK5A 5IB4A 1M6OB 2QSQA 1TTRA 3SY6A 4GXUM 2R29H 1N18A 3HG0A 3WXVH 3QJFB 2MMXA 4OVVA 3VU1A 2AGJL 3ARFA 4CILA 1MY5A 3B2VH 4GQPH 4LHUB 4MA8H 3UGEA 4JB9H 1PX3A 2GUOA 3CQPA 2FLMA 3QUYC 4M6ML 1OALA 1CLOH 3NZ8B 2NPLX 2X87A 5M94B 3S3JA 1QUNA 3CG8A 5LBVA 2NUTB 3IPBA 3T4AA 3C6EA 1QLEB 3OMZA 2L04A 5I2IA 3PWVA 2CJ3A 5E2WH 3A24A 4E9QA 4JFYB 3EYSL 1JTPA 5I1AA 3WDIA 5I1GL 5I5RA 1MZZA 4PJ7F 4M8QA 5C2BL 4ICWA 2WVSA 5ALBH 4G9FA 5I16A 2Y36L 4MMZB 2YGPA 4H1LB 3SY0B 4UB0L 2ICWI 3L4ZA 4JLRB 2YFNA 3B43A 2ZX8A 1P7HL 1RURH 1ZCRA 5CBEA 5IVOA 4OFYA 4OF3A 2GHZA 4LOVA 1DDHB 4HPYL 3HI1A 1ZA6B 4GAYB 4ZUTB 3T3PB 1FAIH 3BFWA 5FYKD 5KSAD 4KQ0A 1N2RB 5AL0A 1MFNA 3CN1A 4QHLB 2R39A 1QX1A 3C60D 1B0GB 5AAMA 4LU5H 1CLVA 2EIKB 3BKMH 5CJ8A 4UT7L 1IQDA 4R4FL 5JQ6H 2J8OA 2BCKB 1HXYA 2KS0A 4J6RH 4K9EH 1KBGL 5IJKA 4XB3A 3JUZA 3T0WA 1G1YA 4JDTH 5KW9H 4KNSA 1QVOB 5IWLC 3IKCA 4UT9A 1F2XK 1OGTA 2CJSA 5LO7A 2VN3A 5CJOL 3CDCA 4EUPH 2A6IA 3UAJC 3ARGB 5DZPA 3EO0A 4R7VA 1RVFL 1INDH 3ZTJG 4GAFB 3GMPA 4XT1C 5KZCD 3M1BB 1BG1A 4Z18A 1XB8A 2XX0A 3O0RH 1YAZA 1CF8H 5DK0A 1H3WM 1MQKH 4JFEA 4MJ5A 5GZOA 1OZTG 1H8OA 1T1WA 2IFFH 5TGBA 5LBSA 3U2SA 2J6EH 2QDWA 3WE1A 3S37L 1ET5A 4OGQC 4UV7L 4JDZB 1FZMA 2FWOB 4JM4L 2ZOLB 4H20L 5HGHA 4BK4A 3EOTL 5BV7H 1AGDB 4M93C 1AS7A 1S7UA 4B5ZA 1E7VA 4G8EA 4UWQB 3GBEA 2OXHB 4OCXH 4XNMA 4DTGL 4P5RA 3TYGL 1I1FB 4FMKA 4IKLA 1NMAL 4JPKL 2O5XL 1XDTT 3ARZA 1ES0A 2HMIC 4PRID 2FQGA 4OJDH 4W4OC 1M56B 4KKCC 3LQAC 5EC1B 2Q8AH 1P7QD 5BOPA 3WEOA 1RZKH 3MRLA 1QZ1A 4L4VB 2F7PA 3GMNB 2QGEA 3CSPA 1F6LL 3LKNB 4XPBL 3CX5J 1QAWA 2XA8L 3K4DA 4MRBA 4QRPD 3VI3B 3LVTA 2IH1A 3BO8B 1OPGH 4JKLA 4G8GA 3IF1A 2Q2EB 3PFQA 2Q86B 4PRHA 1QZNA 2WLYA 4Y16A 5AD0B 2HG5B 1QSEB 3MCLH 3Q8CA 2EE9A 3SJVD 4HIIB 2GIXA 4MDRA 4BZ1H 1DFBL 2NTSP 3VXSD 3BLPX 3OB8A 3HI6L 1U3ZA 3RNKA 2BS9A 2EUZA 4R4FH 2VXUH 4ODWB 1A0QH 3LRMA 4GW5B 4L5FH 2HJFB 4I2XE 1OL0A 5KEZA 4F5CA 2PWDA 3R7QA 1U3JA 2NX5D 1T22A 5ADOL 5IR1B 4L8DB 4NDMA 3K71B 4JMXA 1J7VR 3QGVA 1FP5A 3PCYA 3VGGA 5IBTH 1FO0A 4DZ8A 1VCAA 1YEEL 1JHTA 3D48R 1G5AA 4YXLL 5I24A 4M7ZB 3V8CA 1EZSA 1CDJA 25C8H 2X1QA 3QP3A 4YOKA 5MEOB 1OQXA 4I1PA 2GY5A 1NL0H 3I85A 3DJTA 1LHZA 3TBYB 4L4TD 4NQSA 3ULAB 2BVOB 4Q6KA 4D2NA 1DVFB 3U30B 3WS6A 5F2FA 1MCWW 4IRJC 3DRTA 4N8CL 1QR1B 4XVUD 2HH0H 5I66A 2ZZUT 3W3BA 1CXIA 4KJWC 5EZLA 4JE0A 4YX2L 5EIIG 3L3IB 1HH6B 1KYOK 4Y4KA 2UYLB 4X6FA 1WAEA 1KLFB 3BPLB 3NACH 2I27N 4N2CA 3GMOB 1NWOA 3ZDZE 5E8EA 2ITDB 2YD9A 1FZJB 3QT2A 4PJ9A 2GBAA 4HIJB 2V2WB 3KS0J 3QUMB 2ZWSA 1F18A 1DE4A 1HSAB 5LNDA 2F2HA 2VMEA 4Y5XC 4LCVA 3QORB 2Z7WA 2HP4A 1G6VK 3BSZL 5HHOB 3V0JA 3X14A 1OTUD 1KYDA 2JKLA 5TPWH 1UCBH 2LOEA 1W72H 5ECJE 1Q38A 3GTVA 4LAQL 3NCYP 1WAAE 2XACC 3ARGA 1OB0A 2OZ4A 3KMDA 3IFLH 1Q9WB 1EEUA 1SMDA 4DO4A 5AKSA 5FGCB 5FA4A 4PWJA 3K1KC 3QWOB 4HIPA 3MCYA 1OTTD 2JV6A 3KDMB 3EJUA 2FX7H 3UTQB 3KYNB 1GJWA 4NCDA 4HSAC 1YEJL 3DYOA 2I69A 3BE1H 3G08A 4HOZA 4Z7WB 4M03A 1L4IA 1U8CB 3GM8A 4PRPD 3TO2A 1KYOJ 1A9EB 2P5WE 2KI6A 5CSGA 3VNYA 1GGTA 1IKNA 2J8UF 2IAND 4UOW1 5AZEL 4HXAL 2CXGA 3DSFH 1ACZA 5HVHB 4RMTA 1KY7A 1SYSA 1UD2A 4QYOB 2RCSL 1C1EH 5C0CA 2CKBB 1GZHA 4QF1B 2WV3A 4HUNB 1I3RB 4GRWF 4K94L 1ZLUH 4H2CA 5E99L 5DO2D 3P3RA 3VDBA 3QQDA 5GSRB 1R24B 4FNSA 4U3XA 2MCPH 1DLFH 1N68A 1KIPA 4P2YA 4BD4A 1A9VA 1WEJL 4RMUA 3NZHL 1NCIA 2YAQA 1LWHA 4LQFH 4ORGB 5IROD 5SWSB 4YHMH 1C8PA 1YEFL 1RIUL 2YD8A 5GRJH 1H3TA 7CGTA 3OSVA 2X6MA 3VD7A 3V0WH 1KLGA 4DP2X 4Z78B 2NY2C 3CVHB 1NANH 4L3FA 3KBFA 4MD5B 5KSAC 1D2PA 3PRZA 4A2GA 3MRRA 3WFDH 2VERN 3ZDWA 2PCXA 1NAKH 1M05B 4ZUUA 1RKRA 2F5AL 3LCYA 3PWNB 1O7VA 5JHDA 2OV0A 3NMEA 3EFFA 4N5ED 1PCSA 3WTYA 2IPTL 3KNBA 4I8DA 3RVXC 4YR6B 1KCSL 3OVUB 4CBPA 3QIWA 2ZPKH 1HILA 2OZNA 1CK0H 3WY2A 5TPWL 1FJ1A 4ONFH 3B8SA 3II2A 1OSPH 4FQCL 4P59L 3QEHA 2WYIA 1UT9A 1DP0A 2YBGA 2X4TB 2PMZA 5EO9B 3LPFA 1H5BC 1MCBA 4AQEB 2HLFD 2YFOA 3H2WA 3LEYL 1YNKH 5F7FA 3QNYA 3Q6GH 1CICD 1I1AA 1VA9A 1VGEL 3P40A 1KT2B 3ZYJA 1XGQA 5BMFH 4AX3A 2AXFA 5IY5B 4F8PA 1G6RB 2X4UA 1M9WA 1K8IA 2JJSA 4WU7A 5C08D 1LEKA 5F0LB 2JLLA 2JF1A 3BT0A 1OY3B 4NCC2 5HHQA 1TCMA 5CP7B 5AB0A 5FFGA 5F70A 3RPBA 3MLUH 3OAZK 2ZYIA 1RIVH 4IBLT 2PTUA 4DKFL 2EDEA 5DJCA 3FO9B 4LGRB 4XTRC 2YKKA 4ETYA 2WVVB 2R2HA 3Q2NA 4RSVA 4R7DB 1E43A 1OANA 3APMA 2VXUL 1QFPA 3SYAA 1N64L 3GJFA 2PTTA 2EC9T 1G0XA 1NJ9B 3FULA 3HOGA 4WVRA 2Q7NA 1PJWA 4RISL 4ZMYA 4JY6A 4K8RH 3F6JA 1HHJA 4MQXD 3OKNA 4WNQA 3BN9C 3B9AA 4LARL 3B37A 3FF8A 3I6LD 4ODVL 2R0WH 4EKXA 1B4JH 1XBRA 1OVZA 1JDDA 5FM5O 1OM3H 4BHUI 3O8XD 1X9UA 4XWGL 3VFTB 2EACA 3DYPA 3CVHH 1BM3L 1EGJL 2LHAA 3IXTB 4KK8D 2FO4A 4P2QB 4W9JC 5GJTL 1ZHKA 4JGMA 5FB8A 4FYTA 5DGQA 3X12A 2X05A 1VESA 3QH3A 5IB4B 5E6RB 1HI6A 5TE7L 3TVMB 1TTAA 5FUOL 2F58H 3LIUA 2R9HC 4LDEB 5EPMA 5DZNA 1W72A 2CHWA 2G9HB 5I74B 1LEKB 2CM6A 3EGXB 3RWHB 3NFNB 5A2FA 1MF2L 1NAMH 2UY7A 3X2QB 4M3KB 1NC2D 1E5ZA 4DPCX 2AEWA 1SHWA 3RJQB 2N7AA 5GGSB 3W11D 4UDTB 2UZIH 4Z78A 1AR1C 4TL5A 4HCRH 4YZFF 5DUPL 3DBXA 3S3PA 3ILEA 3FO2A 4PTUA 3VRLF 4OI7A 4PJ7E 5I1CL 1GRWA 5K9JH 4HH9B 2D03L 1G7LB 1GAFH 1H3VA 3POCA 4WHDA 2X88A 3ZKNC 5C0BD 1FVDB 4QY8B 1D5IL 2RIKA 4PJEE 4Y4KB 4NN7C 2ZUWA 4K7PX 4OF8A 2ZXQA 3BLBA 4I3SH 4UTCA 5B1JC 1R19A 2R1XA 4P2OB 2ZP9A 1TJIL 3U7AA 2ZWKA 1AO7A 3AABA 1D9KD 2GB2A 1DEEA 4XO3A 4Z3TA 3QEQA 1OXYA 4Q8BA 2RH0A 1XL4A 5EF0A 3H55A 4JO2L 2X4TA 5EO9A 1BQRA 1WZAA 5D7SL 3FO0H 3X1GA 2NZIA 1XSOA 2BNRD 3CFNA 1ND0B 4LCCB 3CVDA 4LLWA 3P73B 4WO0A 2B1AH 2R0LH 3JWDC 4JY5L 2ALAA 3EJSA 4GQQA 4YDJA 2R0ZL 4HHAB 5IEHA 3ISRA 5I1EL 4OLYH 1EFXB 1URLA 5EU5A 5C0NC 4WDIB 5IB1A 2X2HA 3LXBA 4KITB 4Z7UF 2P5EA 4ERSL 1SF5A 1QLFA 1BZDA 1INEL 3EJYC 3UCRA 4J3OC 3ZR6A 3QE5A 3GSOB 3MC0A 3CFEA 2ZF9A 2PKDA 1PLAA 3N91A 1U30A 2BP0B 2XKUA 1SJVA 1SNRA 4L9LB 3AUWB 4JW3A 4NERA 5LKNA 1LILA 4ODHL 1ORQB 2GSIB 3E8UL 4OZFH 4PW9A 4KXZH 3MRIB 1ZDSA 5D5MF 2A74A 1MF2H 1NAML 1BM7A 3OKYA 3L3OC 2GJJA 3MV01 2EXTA 2QQKL 2E9IA 5D70L 2VXTL 1S9VB 3QCTH 1WBXA 3H9YA 4M8RA 3BPCB 1TJHH 1RPKA 4XC1L 3KWTA 1IV8A 1W8EA 3CX2A 3CTTA 4QYAA 4A2HA 5E6IA 2DM4A 2FGZA 4R83A 1RJLA 2JQZA 4FP8L 5A7BA 4WUUE 4KX8A 2P8MA 5HI3C 4FTDA 1SJHB 3T8VA 1XV8A 5MEND 4JM2A 2V5TA 3QIBD 3VFGL 1ND0A 4LCCA 4RIRA 5EU7E 5F7WC 4B9CA 2NY6D 2QPEB 2Z1PA 3QPXH 4C4KO 2OKMA 4MAZA 4HJJH 3V2AR 1IGML 1LVEA 3GJFH 2VN7A 4JFFE 5C08A 4TTGA 1SVCP 2PO6B 4PJFA 3QDME 3VCLA 4V11A 4OB5L 2XHNA 3OC8A 3KDPB 4NZFA 3K2MC 3TH3T 3JVGA 5IVNA 1KTCA 3UZQA 4XC3H 3QAZB 2ED8A 2DEYX 5EPMB 4RGMC 3EYOB 3LQAH 3UP1A 1LXMA 4PEEA 4K7PH 2AITA 4N6RA 2X42A 1CICC 2GJ6E 4BDVB 1BXVA 3QEQD 1M1SA 2JNZA 1H3PH 2HFFB 3MRKA 4M5TA 4Y4HD 1RFDL 3EJJX 2E9BA 4IBSA 4OLWH 5I8KH 2YRPA 2AAAA 5DR5H 3KZ8A 4LXFA 4ZZFA 2C9UA 4UINL 3KBEA 1W0WA 3I74A 2IO5A 5IVXF 5SWZB 1RH8A 2X0VA 2HJLA 1FYTA 3REWA 3WO4C 2R0LL 4JY5H 4RGNB 4JKWA 3ULVL 5E6SB 5HD8C 3FQ4A 2IADA 2BWDA 1J5OH 1MG2C 3FQUA 1I8LA 1HHGB 5EIIA 3RQ3A 2EEXA 5MEQB 4XP4L 4B96A 3WNIA 4E5XB 5KVEE 2UZYB 3FQ2A 3DVGA 4A7GA 2AEQL 5CFHA 4E2OA 4IJTA 4CVXB 5L4MA 1N7ML 2F0CA 3ARFD 1A7QH 3LDBB 4XZUB 3AREB 3VD1A 4JFOB 5IREA 4P5TB 1WWBX 3O6ML 4L8BA 2DYPA 3UYPA 1F1DA 3G6JA 3PY9A 3ARGC 1S7WA 4QRUA 2WYZA 4MB5A 4ZNCD 3MRJB 5AVQB 3EADA 2HJKA 4A2EA 5I1KL 3P2BA 1IU1A 5DC2A 2AQPA 4X8CA 4LCIH 1AFVL 4D0DB 2OXHA 5L8JB 4PSPA 3TT1L 1YUKB 5E4AA 2VLJA 2F8VA 2HRPL 2A74B 4FMFA 1Q0EA 2WP3T 4TS6A 1DFXA 3DURB 1QSVA 2IV8A 2BHZA 3CDFA 4QHMA 4L9LA 5ECGA 1ZT1B 1RCYA 3GBDA 4U1JA 3ZZSA 3TIEA 1IC5H 1LO3H 1JN6B 2VUYA 4AXWA 5E1AA 1OGAE 4G70B 3FT9A 4PJEF 5GGSA 3Q01A 4HLZG 1OGAA 3I02B 1KEMH 1TJHL 5FA3B 4X6EB 5KANG 1FE8H 1TJIH 4U7SA 4W81A 4ZX6A 4NZTH 5ITBL 5D1QA 2VN5A 3MV8B 3D18A 4K9EL 3WGUB 3MRCB 2ATKB 1QFHA 1JOIA 4HMEA 4DESA 2VXQH 3E8UH 4XNYH 4NO0D 3ZDXE 2JIXA 1ZGLB 5B1KA 5CGBA 4EJ1C 3IMWA 4JG0H 1X5KA 3E0GA 3F7YB 3Q1SH 4PBWD 5J11C 5GZND 4F7MB 2JCWA 3M46A 3RVVC 3CBKB 1A4KA 4BFNA 5E7FA 5DVLA 5L8KB 1CC3A 3GBLA 1T89A 1ZEAH 4L29B 4U1NB 4ZUSB 2X4PB 3FQRA 3QDJD 1F8TH 2DH2A 5KYWA 2YJLA 3J8F7 1Z7JA 3WUWB 4FF9A 4MNQD 4XP9L 1J5HA 2J55A 3GS4A 3HBZA 3QXVA 4HUMB 2R51A 2AHIA 4X6CE 2TRHA 1S5IH 3R0NA 5DK3A 3W56A 2BHYA 5I74C 5ELIA 2H32H 4D8OA 3GTNA 1RD6A 1MFEL 2H6UA 1KGWA 2QFPA 4OGAC 2J4WH 3OL2A 1IM9B 1KCKA 5T5FH 4R7XA 1W9XA 2E7LC 1MPAH 1W8OA 1WC7A 3MLXL 1E5CA 4XVTH 5CN3A 5T1MB 2NDGA 4XODA 1AXTH 5ERWB 3QUYD 1F13A 2O30A 4D9RE 2OCFD 4IU3B 3PJLA 2C9QA 1IAIM 1ML0A 2GTWB 2IH3B 4P5MA 4ODTH 2OL3B 1MIEL 3PWUB 1X7SA 3KJ4B 3MV8A 1Q1JH 4ACTA 4HCRA 1J05B 5DQDL 2ZT9C 4FQJL 1I31A 1SDAB 3CWGA 4ZMAT 3CMGA 2E4FA 3EYSH 1E8WA 2J73A 1TIUA 1JHLL 2AW2A 1WBXB 3QZPA 3NQKA 1OP5H 2BFGA 1WV7T 3RZCA 1COBA 4Y19D 4HH9A 3TIDA 5JOPD 3QEGH 2FJHB 5E9AA 1X5MA 4M6NH 3Q1EA 3UMTA 3BAXA 1G7MA 1ZK5A 3IETB 4I3RH 3VFMA 4OZHB 4WEBH 5L6YH 2BVEA 3ZQ9A 2ODHA 1AD9A 2ARJA 4YHKH 1A7OH 1M4KA 1URZA 2OMYA 1S3KH 3HG1E 2UZPA 1J8KA 2HFGL 1SGKA 3BH9A 3GMRB 4RFNC 3ZDXF 4B9JA 1EJOH 3HR5A 1WZ1H 5DFVD 2LLNA 1Z9LA 5DEZA 4WFFE 4QGTA 4AKQA 5DVOA 3IGLA 1CU4L 3DHJA 3G6JB 5E6UB 3A6BL 4JHWH 4WCYH 2I07A 1AGBA 1B0WA 2AXGA 1MFVA 2XKSA 2XXGA 4JE4B 5EEWA 3PPSA 2JIXD 3U79A 1YJDH 3LN5B 3P73A 4JDZA 2Y3NA 3QWQB 2WQWA 3VH8G 1QKZL 3D69A 1ZTXE 2EO7A 1H5BA 1TTBA 4NKDB 1GZQB 3EJQA 3BP5A 4HK3J 2BP8B 5K59F 2DZEA 2X9WA 1JUFA 1RVFH 4M3JA 4PJIB 1MG3C 1ASOA 3VD4A 1WQVT 4EPSA 2AVFA 1QRND 4X4KA 3SDAD 1VEMA 4MAYB 1P53A 2KT6A 3K8LA 3O4LB 1CE1L 2SODB 4KJQD 4LSQH 4HETA 4QRBA 4XMKH 1DSYA 2WXNA 3O6LH 4MJ6A 2XWTB 4WI4A 2A2QT 5E8OA 4H0LC 4C58B 1FLRH 2BDNL 4LDCA 2X89A 1P84K 4IKJA 5BRZA 3LH9A 1Z9SA 2A1WL 4KH9A 2RQEA 2B4CL 2YAHA 2ZPKL 5BOZG 4P5KA 3RDTC 2FQDA 3BD4A 4OLXH 4FADA 1WT5A 1YQVL 1JHTB 3ZMRA 2FD6L 2VMJA 1LO0L 1PW3A 3QUXD 3HN3A 4HA1A 5DMYA 4XB7A 4G9DA 1E3FA 1NC2B 2YPLD 3OJVC 4P4KB 1RZJC 4U1HA 4GUOA 4CC4C 1ZA6A 1WA2X 1H15A 5HJ3B 4OQTA 3VSQA 3P11L 1WD9A 2CUHA 3Q6GL 3BI9X 3T0XA 5F7AA 3EH5B 2XVGA 4B60A 4B3VA 2DMBA 5B4MD 1RP8A 1PPIA 4WHYH 4HULB 2KLRA 3K4AA 2BSBA 4HKBB 4FQXA 1UB6B 3L08A 3NCJH 2IDQA 2IOMA 1Q9OB 4IRZH 4M5YH 4ZS7L 5CZVL 1ACXA 1DJHA 5HVGB 4HIHA 2R1YA 1DUZA 4XNQB 3MR9B 1FZJA 4PJ9B 3WGVB 3EJRA 3TGXA 1CLCA 4MNGB 3X1FA 3FUFA 1Z5LB 4Z95H 5FX3A 1XCTA 4JFFB 3RX7A 1DEEB 4UU9A 4PH8A 4JFHE 2NUTA 4Z3JA 5CJXA 2OL3H 4MNHA 5C3TA 2ESVB 1IJNA 1SN2A 5JW5A 3ARXA 5BQDA 1ETZA 2F53A 3CDGB 1JGVH 2X4QA 1NCCH 3O2WH 1DVFD 4JJ5A 4J1UA 2GUOB 4ONOA 3PQYB 3E3QC 3KLKA 4PJXA 1WFIA 4WO4B 2VJ0A 4ZTPH 2C9AA 3Q05A 1QSFE 2IPKA 1CZ8L 4ZPVA 5D55A 5D7KD 3OKMB 1CXHA 2V8LA 1F5WA 3SCMC 1BWMA 4AYFA 1S7UB 3I9GL 2XDHA 4EXKA 1UYWH 4HWEL 5DD5L 4OZIF 3U0WH 3QDJA 1W0VB 2ZTBA 4LL1A 1MCOH 5T1KD 5IF0A 1YY9C 5I5MA 1N5YL 3MJGX 4WK4B 1J0IA 1EVTC 3LXUX 2FH8A 2BDNH 2DQJL 4G6AC 4POYA 2OJEB 2R23A 1YJDL 1K2DA 4GG8A 2X9XA 4GKSA 4KMLB 2BSEA 4B3EA 5HHQB 2D7OA 3FTGA 4N8CH 4LVOC 5DZAA 4HX1B 4LP4A 1T7VA 1HNYA 5EFIB 2FSDA 3AB0C 4AL8L 1WUZA 2HX8A 2A77L 3RPIB 3DTUB 3O2DL 2WAQA 1C5DA 1KSRA 3S97C 4XCCL 5ISZD 5JHDE 1EEZB 3DXAA 3PIQA 4I2XA 5TH2B 3WJLC 5EN2B 2YQBA 3LHAA 1DJZA 1P1VA 4WEBL 1DQTA 4FL4C 4LCUA 1WFJA 4M7ZC 4BSVA 1S5HA 2XWBA 3QNFA 4Y4FA 5E2UL 3Q6FA 3RILA 2YGQA 3H9ZA 4U1KA 3LH2L 4KNTA 4MLSA 4E9LA 1BJMA 4AVIA 4DW2H 3OR6B 1BEYL 1TR7A 1YEGH 4FQHB 3VH8A 5I1LA 1JGDA 5E08L 4H26B 2FX9L 1CYWA 3PQYA 3VD9A 3MCKB 1UZ6F 3ES6B 2E7BA 1I8AA 2YKLH 3G7TA 3PWJB 4G43A 4LHUA 2XJLA 5FEBA 4FFWC 3PNWA 3NIGB 2P7TB 2X41A 4LLUA 1MFAL 4AGQA 2YAFA 2GW5A 2JE8A 1FLTX 3F83A 3N1MC 2HPTA 5AAWA 5CIPB 4PW3A 5E95B 4Y5XA 1KCWA 1NFKA 5HJDA 3EHBB 2H0PA 5FUZL 2ZYSA 3SPVB 4G82A 2P24B 1I75A 5D7SH 4P3DA 4DKEL 1P9MA 5IK3B 4UF7C 1V55B 3BAJA 4OSUH 1XF1A 3B56A 2WQRA 3KVDD 4IOFC 3K6DA 2MSPA 2X1OA 2ADJB 4YVNA 1CU4H 1KXTA 3EJYD 4TNFA 3W81A 4DKDC 3RWGB 1EJ8A 5A2JH 1KEGH 3KPNB 4PB0H 4Y4HB 4Y1SA 3V4PB 1TDQA 2I5YL 3FB8B 4XPAH 2CIIA 4N68A 2DQUL 2C7UB 2I32A 5DJ6A 1YMHB 1SUJA 1N6VA 2CNYA 3FQRB 4YDZA 2ZF8A 4NUQA 4U1GC 2MQ3A 4W9GC 3BGFC 5C0BE 4ZJ9A 2Y7QA 1HH9A 2WB1A 1NMBH 2VWEC 3O4OC 4PGBB 4PMEA 2C9XA 1J5DA 1D5XB 1SMOA 4NIKB 1DO5A 2E56A 5KBLA 2WP3O 3BVNA 1NFDF 3NFPB 5J6GA 2P8PA 6CGTA 3FTVA 1DBAL 4H1LG 2VO8A 2ZUUA 4NC1C 3AJ7A 1NIEA 1GTFA 3C60B 5CCKL 1ESOA 1UZGA 4OKDA 2FAUA 2XPGB 3DPBA 4WI3A 5DVMA 4ERSH 5AVZB 2CUAA 5C0AA 3WL9A 2AXWA 3JWDL 3SE4C 2APVA 3P0YH 4O02A 1IAII 2VDRL 1BIHA 2H2SD 2PPEA 5F7LB 3VXRE 3DK0A 2EVFA 5G5DA 5LN4A 3IBEA 3EYFA 1SFDA 3RU8L 1A7RL 1SZNA 3WKPA 4CVUA 2F6AA 3GSNB 4M62L 1YMMD 2WLZA 3H0TA 3DUUB 1UWEL 4NZDA 3MRNB 1BQKA 1S2EA 2O61B 4L4TA 5GRUH 3FSVA 2HT3D 4YDLC 3VO0A 3WNNA 3ATEA 4FNQA 5EULV 1BCIA 3B2VL 3GD1C 3QVAA 3BP4A 4CW1A 2NY0D 5D7JC 5ICZB 1DUYA 1AQHA 1IGCH 3ATDA 3P4LA 1LMKA 4IEFB 3ULUF 2VLKD 4TVPE 5DMIL 4YDNA 2PUQT 3MJ8B 3MKKA 4Y4FB 5D7LA 1TVDA 4PB9H 3ALPA 3WJJC 4AVKA 2Z4TA 3CFBB 4UQ3B 5D6CB 2GJRA 3RDTB 3RWEB 4GUPB 2GSIA 3DIFA 3NESA 1YUHA 4M7JL 2DD8H 1MWOA 3O3DB 4M6AA 4BXVA 1ZA3B 3VSUA 3RTQC 1DL7L 2E7MA 3H42H 4WQOA 4Y9FA 4E5XA 3BKCH 2WBJA 2AJ3A 2G4GA 2YOAA 1ED3A 2VL4A 3F7KA 3I3EA 4CSSA 1KBPA 4MDIB 4QAWA 2R0WL 2DQTL 4A7TA 5DCCA 2UWEF 3DPBB 3WY4A 3HCVA 3SIKA 5JIDA 4XBEL 1RURL 3L1OH 2XV0A 1XO8A 4WNJA 4CSPA 2I85A 2NXZD 1OTSD 4FQIH 3ULVH 3ULVE 1E4HA 1MW2A 1CFNA 3MV7B 5DQ9A 3R19A 3FSZA 2EDDA 2UZXB 4MZ3A 2QQLL 1I3GH 5AWNH 1NFDE 2WO3B 1J10A 1P7KA 1U2HA 3NZUA 1UH4A 3IJ7A 4R5XA 3ZT5A 2ADFH 3D2TA 3MUGB 5DK2A 9CGTA 3RWIB 1AC0A 1KACB 3X1BA 3ALXA 3WKYA 3GT6A 3CQFA 2PCPB 4AITA 4D0DA 4LDOB 2IPKB 5CHNA 4NQUA 5D1QE 3UDWA 4X7TB 1GYVA 4LCWA 4U6VL 5AYUL 4JCWA 4C47A 4XOBA 3U82B 2AJXL 2C7UA 2VDML 3ZDZB 3OKDA 4I7ZC 1U8HA 4EN2A 3JUYA 2ARWA 4QYOA 1RZJH 4NEHB 4Q58C 4RFNB 1VIWA 2B2XH 4P2OD 4XCEA 5KYYA 1OB1B 1A6UH 2Y69B 3UYRL 1MI5A 3QI9C 4GG8B 1Y6KR 1ZWIA 4ZTOH 1LO5B 5E8PA 1MJUL 4HSQA 4U6YA 3HRZA 3WTTA 3VG0H 4L1LA 1JWSB 4XH2B 4OSUL 3SE3C 2PWFA 4NRZB 2AEPH 5IHLB 4YHZH 4X4ZA 3DX7B 4NS0A 3VVWA 3ZVVA 1NUDA 1BGXL 1CT8B 2EH7H 4JFYA 1K4DB 2XQ0A 5T3ZD 5I0WA 2ZAHA 4K7PL 1IKOP 4B7LA 2R9HD 2EVJA 3JQOB 4O4YH 1JZGA 1M3IA 4RGMB 3H54A 3D3VD 4NT6B 1KGXA 3I75A 1JSYA 1EFXD 1OB1A 3WFHA 1RZIB 5ICUA 2IAMA 1PEZA 3FFCD 4B7IA 1WGOA 2IOOA 4R97C 5IP4A 2AP2A 2ZUQC 2J21A 2BIMA 5CLZA 1TZAA 2HN7B 1BA9A 2ESVA 4OBSA 1OAZL 4U1NA 5EF2A 2VDQH 4Q9QH 2VLKA 3OLIA 1CDIA 2DQTH 3A21A 5GS1C 5T1LD 4O2CB 5DJAB 1OZUA 4AKOA 2V9TA 1DEDA 3LEXA 1U8IA 3CVIL 3BT2H 1A3LH 5D7IA 4OBRA 5FECA 4KGJA 2D0HA 1MCFA 2YJQA 1L9SA 5FF6B 2CKBH 1DCLA 5BS0A 1I3GL 1YNTB 4HP5A 1ZHNA 3Q48A 4HK0B 5D6DC 5I6MA 4GG6A 4GKNA 4FHBD 3F6IA 1SOXA 2Z0UA 2D0FA 3BDYH 3W9EA 3L2NA 1OAQH 4U6XB 3QNXA 3BIKB 1E8XA 1X7QA 2HG0A 4JPWL 2V9RA 4X7CC 3P3TA 4Z0BH 5EWIL 3DJ9A 4CVZA 5HYSG 1L7IL 2CDFB 2E6JA 4N25A 5E1AB 2VT0A 4DSYA 2VQ4A 4X6CF 4GW4B 3FCTB 3HEIB 3MRBA 1T0MB 5I76A 1DQMH 4WLCA 5L0QC 4I0PA 1MNUH 3KPMA 2OYPA 3SD5A 4X6FB 4BIKA 2WUCL 3APDA 3IDIB 4K07A 4MCZA 1F6AA 1L7TL 2WTRA 4AEHL 1CD8A 3DV4A 4KROD 5AFAA 1NGPL 4Z77B 2V7NA 1AO7B 2LGNA 4NN6C 2NY5L 4R8WL 5C6WH 2HJLB 2PW1B 1FFOA 1GGCH 3DHPA 3OAYH 3P0YL 4XAWH 4KDTC 5ISZE 1RSYA 4ABWA 3QFJA 3VH8B 4O2EA 3OD3A 3OLGA 1IZJA 4G1MA 2P8PB 3CXDL 4L4JA 4L3EE 5HI3D 5HGDA 1OCWL 3SOBH 4NP9A 3SBQA 4NZUH 2XWBB 2BVPA 1AZZC 1RZGB 2OL3L 3FTYA 1F2QA 1TOXA 1NLBL 3CCHB 3LEXB 3PHSA 4RETB 2GT9A 1F4AA 3FKUS 4OCYH 1E28B 5E9DB 4QHKI 3LZOA 2KH2B 2YPVA 5FC9A 1VF5C 2XQYK 4LBAA 4MQ7B 3CFUA 4UDUA 5E1HB 4DPRA 3L54A 3P02A 1QW8A 3HC0A 1P1ZA 4P2OC 1CTNA 3ES6A 3P1VA 2XPYA 4KDTA 3W9EB 1BM3H 4PU2A 2FL5B 4NO0A 3VM7A 4PG2A 1FYTB 4HC1H 1H6EA 3MOBH 1KCVL 1H19A 3RWFA 5AW2B 3TESA 2OZ4H 5EUOA 2B9AA 2MNJB 4NKMB 3S48A 2BPBA 2DTML 2W07A 5EUOF 3A6BH 4GFXA 4TSBH 2Q2LA 5FDYA 2J8UB 3WS3B 3ZQWA 3W2DL 3MZGB 5BQ7B 1T0NA 1MJJA 2A0LC 5HHVL 2GVYA 1I7RA 1CDBA 1YEIL 3IWVA 4WO4D 1FPTH 5TE4H 5TGBB 4AUJA 4F57H 4KKLC 3CBRA 5D93B 3HHSB 3EO9H 1FYTE 1E50A 1OIOA 5FUZH 2FRGP 2F1BA 1LWRA 1PKQA 4NQXA 2AQ1A 1AGFA 1N67A 4RNRA 5D7JA 3CVHL 3FO1A 1JHKL 5EA0H 1JF1B 1MREL 4ODSH 4A7VA 4NWUL 4HX1A 1YECH 5D93C 2N1TE 4JFEE 1AJ7L 3WXVL 2P49B 1REIA 4AW4A 4X7SL 1HHJB 3QC6X 4PVNA 1OGSA 4PJIA 1S4IA 4FRWA 3VFVB 3F7VA 4KAQH 1JYXA 4MD5A 4ZDHA 1ZVNA 5K9QI 3FU7B 3S7GA 3VXNA 4FFZA 1KIQB 3VI3E 3VI4E 5ESQA 4DN4H 1SDDA 1JAEA 5CGYC 5L7XH 1XGPB 4I0PD 5LAXB 5ISZB 4RSYA 1WDAA 2AK4A 3RDJA 2GTZB 1KENL 3L95A 4NPYB 5DD3H 2WGNB 1DJGA 4ZZKA 5BS0D 2EDWA 1ADWA 3HUJB 4U6XA 3QYMA 2ZOKB 1L3WA 5INDB 1QLRB 4V33A 4Y5YC 1ADQL 3WU1A 1N4XL 1ODAA 2AJZB 4CU6A 4X4ME 2ZKHL 2OPCA 3TNNA 1HZHH 5J8OA 4U31A 4UTAL 4OGYL 3TEYA 1UT2A 1TLMA 3CUPA 3L5IA 4ZFOL 5E5MB 4LCWB 1IGTA 1CG9A 2BCMA 4H26A 3VAEA 2YK1H 4LOEA 4FLQA 4NB7A 4N0UB 3K72B 3MA7A 1U8QB 3BEVA 4N3TA 1CB4A 4KNUA 2GPZA 3ROLA 2IQAB 3EG9A 3K6IA 1UENA 1K5NB 4PGJA 5CBAB 4AEIL 3GXDA 5KUKA 4XI5C 4Z7WE 3KJ6L 4POZC 3HKZA 4YPJA 3RHWF 1VZIA 4YDKH 4MAUL 3MLXH 1OV8A 3E1ZA 2WW8A 2DWEA 3W5NA 5ADPL 2C9VA 3ARRA 1EDQA 1SLXA 2IVFC 1FH5H 2XJKA 2C3XA 1X5FA 5I8CA 2FH6A 1IC1A 4GKSB 4BH8B 4GSQA 4GBXC 4JCLA 3UTPD 1KPVB 4NZUL 4OCSL 4ABUA 3AREA 2EXWC 2WYHA 1CFTB 3T0EA 3HE7C 1G7HB 3O3DA 5AENA 1MREH 3D4GA 4JGUA 4NQCE 3VXTA 2G60H 3CVHA 4P5KB 1J88A 1RIVL 1DVUA 2BVPB 4YXHH 2ZQKA 1UCTA 1I3UA 2HT3C 4NENB 4JFDA 5SX5K 3HFFA 4ORGA 5AOKA 3ECQA 3G6AA 4R8WH 3C60C 5AOZA 3ZE2B 1XHHA 1R5VA 4D3CL 4X5WB 2EEAA 3QULA 3LEVH 2YS4A 4F7CA 1TF4A 4MJIB 3X13A 2OMWB 2ADGB 4Z7OE 4WI7A 4MA1C 1BWWA 4OFYD 4Z9KB 1N8ZB 2O6PA 2DLTA 1MN4A 5JO5B 3SOBL 2AJSL 1RUQH 3BAEL 4NUJA 3TBYA 3M1OA 3V5KA 4PQXA 4G6KH 1DQML 2WLLA 3GYRA 1NLDL 3F58L 3SQBB 2O6FA 5HGBA 5IV2A 3PHQB 2XC8A 3O6LL 5AVRB 2NY7L 5FYKU 5C0CE 3EYFB 2C9SA 2NW3B 1ECYA 2BSTB 4NQCA 3FF7A 3KPRD 3BWUF 4OGYH 4RBPH 4XCFL 1HT6A 1XGRB 4FD0A 4Z0XA 2AK1H 2YZ1A 3KPQB 5L88H 1QEWB 1QFUH 5CEZL 5T33L 3ENEA 3OZKA 3FQUB 3MLRL 4PI2A 4XNXH 1M2OA 1KUMA 3VXMA 4Z6AT 3FT0A 2AV1A 3QIUB 1H8NA 1JYWA 1F4HA 1T7YA 4U1LB 4B9FA 5FWRA 3L5WA 1HAUA 4QT5B 3V79C 4YFLF 1KYUA 1FSKB 3BW9B 4L0PB 3K4ZA 4KK6C 3NA9L 2OR7A 5T1KA 3VXSA 3W9DA 5I1KH 3HMXA 1KZQA 5JQHC 3L3KB 5SV4A 2R2HB 4AQAB 4UB0H 1NBVH 4BFBD 2ZG2A 1I8MA 3L3HA 2RFXB 4Z7VA 3LN5A 1RHHA 1G87A 2XN9E 3KPLB 3RG1C 4OUUA 5H2BA 5JXED 2QMJA 2VMFA 3Q8EA 1YRKA 3UC0L 5HGDB 3BRFA 5F97E 3QHFL 3KLDA 4ELMB 3H3KA 1IKFH 5AW8B 4IU2B 3HB3C 3LSOA 1N8ZA 1E4KA 2ZP0T 3T0EE 4DP8X 4GIAA 5HHPA 1BVOA 2AEQH 4YXHL 1J0KA 4F58H 1DCEA 4L2LA 3QORC 2NRDA 4M9PA 5IGXH 5IB3B 4H5SB 1IEHA 1YEDB 3IPFA 1XF3A 3KLAB 2ZUXA 2L8AA 1V7NH 3GSXB 5T5NF 4ZO7A 1BXAA 4KVNL 4MBOA 1I9IL 4WKZB 1XT5A 3WG7B 2BNUA 2VZ1A 1TZOA 3QUXB 4NKMA 4Z7UB 3DK2A 1CFNB 4ONHA 1S7XB 3BVXA 3FN0H 3MRCA 3AACA 4N6QA 3RUGE 3W5MA 4JR9H 2Z8VC 4JFDD 5J12B 1BVZA 1T89C 4F9LA 1XH2A 3AITA 3BX7C 3MCKA 1CGTA 2UY6A 3LNIA 4PRIE 1BREA 2PR9A 1AXSA 1F45A 3C09B 3HI5L 3EOAA 4PY8I 3GHBH 2E9WA 2VISB 1Q8MA 1TYEB 1NGZA 4N0CC 4HWBL 3KYOB 1OLZA 1MCCA 4LKCB 4Y4FC 5HHME 2CR3A 4DTGH 2BHUA 4QI3A 4BWWA 2F54B 3OKEB 3SBWA 5LCVH 5C0RH 4X4XA 1GJUA 2OA9A 5DRWB 1YYLH 3OAYK 1N2RA 4BSWB 2KQNA 4JHAH 3VXSE 1JK9B 1WIUA 5LNEA 4ZMPA 3GXTA 4HD5A 2YD1A 4AEHH 4EO5A 1R3IH 3NIFB 4OI8A 2Q9OA 1EHLH 3MJ9L 1INQA 4ORZC 5KG9B 1QBLL 4J27A 4L1SA 2ZAGA 5IROC 4BZ1L 4F7EB 5EZIL 3TEZA 4MFHA 5C08B 2K9FB 2VDRH 3QIBC 2WHVA 3J07A 4JMNA 4PJHE 3T3MF 1LQBC 1ZLWK 1U8NA 3BC9A 1B0IA 3QC5X 5DQ9B 4WRLA 2IQ9L 3ARFC 3ZKMC 4BSJA 3R06A 2VL5A 1J9TA 2P8LB 2K4AA 2KC0A 2N7BA 5AKTA 3I6GA 4UUJB 4A2LA 8PAZA 2ZSVB 4NUGL 4KRNA 3PDGA 4NJ9L 4NNXB 4KY1L 2BFVH 4OM1H 3BHBB 5DFAA 4AQEA 3S2AA 4WF7A 4GI9A 3VFMB 2I60L 4J4PC 5TD4A 4NYLA 1Z3RA 4LMQE 3KPSB 1E5AA 4Y19A 2FTAA 5IFAL 1P9MC 2XIDA 3FQWA 4PJBE 1EPFA 5JIPA 3WTWA 2ZOOA 3MLWL 3OKLA 3CZFB 1BJ1H 4Y2LA 4S0TD 3DVGB 3NSCA 4GKOA 1MFDH 2V2XA 5EEVA 1XVSA 2CGRH 4EUPB 3CDZB 3FUNA 3WFCL 4PY7B 5TK4A 1G0YR 4S1SL 2DLHA 5E2TL 5F7NC 1ZLUK 2Q10A 1OTUC 4OD1L 1L6ZA 1FAIL 1BZEA 4MXVE 5CSBA 1E2VA 1SQ2N 4GPVA 3S5ZA 4N2MA 1JV2B 5I30L 3DETD 4WFFD 3NTCH 1OF2A 2RJMA 1F6AB 4BINA 4PJAA 3BGMA 3ZK0A 3RFZA 2FYYA 1TT6A 1IBZA 1CXKA 5TQ0H 1NM4A 4XBGB 3O3EA 4K7PY 3OV6A 3ZZQA 2ROYA 4WUUB 4BZ2L 3HZKA 3G5VB 3ILPA 2NY4C 3BCDA 3BH8A 4PGBA 3VFPB 4GUPA 3AAZA 3SJVB 4N4YB 3BXNA 4W9LC 4WI2A 5C1MB 3KLHC 3VFTA 4FLOA 3O0RL 4KFMA 4KI1A 4LBEA 4R26L 3ZR5A 1JPGA 1IX2A 1G1KA 5I1JH 3SEPA 3ZHNA 4HUVB 3UZQB 3E7JA 3ETSA 3STLA 5K1NA 3IAGC 4LSTL 5F1NB 3BP6A 3ECWA 5C08E 1J5IA 4AYDC 1WBYA 1FL6A 1YYLL 4K4KA 5DUMH 4LCWE 2YGVA 2J1KA 4MMZC 4QRRA 4DP0X 2DM7A 3CSTA 3VXOB 3EG9B 4PJEB 1A4BA 1I8IA 3C9NA 3AAZB 1CD0A 3CZFA 3SJVA 3P0GB 3EJZC 3OBAA 1D9KB 2JB6A 1EHLL 1WWWX 5D2NC 5B38A 4U1SA 2NNCA 3ZMEA 2YN5A 2XTJB 3KXFB 1KPVA 5DF0A 2EDBA 2DQEL 3IMVA 3C5SA 1SM3H 3BUQA 1MDAA 4IRSC 4WSJA 5TDPB 1ITBB 4Q9RH 3TFBA 4PFEA 2C9RA 1XH3B 4IQHA 4LPXA 1CFSA 2FZ3B 1BF8A 1KCSH 1QQDB 2FECL 4TNWF 2QHRH 4B9PA 5JORA 3GMRA 2VDNB 2V5MA 3QUMA 2XCMC 1CT8A 2GSMB 2MTPA 2ZYHA 4LHJB 5J1SC 4QXTA 4U1KB 1FL5A 3VQMA 1HL9A 4NNYA 3EFDH 4HMCA 3FU7A 5MI0B 5LGJB 1UUNA 4PWHA 1KULA 1UM5H 2QVMA 2O5YH 3TH4T 1J8HA 1YNKL 1NFDA 4OD2B 5CLXA 4CC1A 3FS9A 4OT1H 2CLZA 4QKTA 1TQWA 3FFOA 1AVAA 1BVLA 4NLAA 1B4RA 4IK6A 1R5WB 3HPJB 1X6LA 1PNDA 2OMZB 2VCOA 1ZTXH 2F53B 3DHMA 2GBUA 3VYNA 2IAMB 2WKLA 2YMXH 4GRLD 4WI5A 4QXVA 5AW9B 4UNUA 3LKPA 5ISZA 3ZDYB 4HQQH 3U0WL 3HNTH 5KOVC 5J11B 1GGYA 2QFRA 2ZICA 4IDJL 4PLKD 3DVFA 4DZ8B 5IMKB 5DMKA 2Z65C 4XBEH 1B2WL 1OPOA 4TQPA 3RDTD 3ZYZA 3BPOC 1BD2A 5FGBA 4ELKB 3DLQR 5K39B 4HFUH 4OM0L 3MVSA 5JIQA 3Q5TA 1L9MA 4PBVC 5EZJA 2CRYA 4FN0A 3PHOB 2GIMA 2W88A 3DBSA 5KS9E 4K3DL 1MFBH 4UQBA 5CWSA 1PZCA 3LRGA 4WFGE 4F2MA 1ZLEA 1J11A 3TXAA 4JS7A 3I9GH 3C5ZA 6TAAA 1D5ZA 3C8KB 2HXAA 4Z3GA 3LN4A 5FA3A 3SGEI 3KYMA 1XZWA 1JZFA 4OZHF 4J2QA 3MLWH 1C16A 2QL1A 3QG7L 1V27A 4HALA 3L6FA 5JHBA 5D2LF 4YSEA 4F20A 3VFWB 1S8DB 4UIMA 5KVDL 2XWEA 3CD4A 4XMXA 1NINA 2BX5A 1BJ1J 3IF1B 1HHKB 3MUGA 5DK2B 5FCUL 3ZL4H 3S6CA 4N6RB 4LSSL 4FHJA 2DJ4A 1EZLA 4H5SA 4H1LH 1OEZW 3C75A 3ILQD 2BOLA 4NJ9H 3QFJB 3WOVA 4QHLA 1M71A 2QELA 5GHWL 3BP6B 3ME0B 5CU5A 2VW4A 5I30H 3BKJL 1AR2A 4BKLA 3LN4B 2IC2A 6PCYA 2QPFA 4MJIA 5I8OL 2IH8A 3FCUB 5DFVC 4BE6A 2AXJA 3GFUA 4Y9GA 1TQVA 4HS6A 3I50H 5HDQL 1OOWA 1OK8A 1L9OA 3AS1A 2FLRT 4QTFA 2EE2A 3WV0A 2GTZA 4RAUB 2HTLC 4IRJD 2J6EA 5DYFA 1HXKA 4RMBA 5B38B 5FKPB 5JUEL 4ANKA 5ILTL 3POHA 4OFIA 3T6QC 4JQXC 5CN1A 4JN1L 2NNAA 4YXKL 2YUXA 1LWJA 3OM3B 4OQ1A 1Z9SB 5LG1A 5HGGS 5MEQA 1X5ZA 1MUJA 4DPBX 3AWFA 3M86A 1ZPLA 1KIPB 5DJZA 1Q0YH 3BZ4A 3IDJA 4PJ8C 1OSYA 3WN5B 1BECA 1FIGL 2CDGB 5JHAA 8FABB 1CFQB 1YN7B 3HA0A 1PZUB 3V4VA 2N0KA 3EOBA 2HFEB 1KTRL 2FJUB 4BUHA 2NXZC 2NZ9D 3KPRB 3DTDA 5ANMB 3UYPB 3U4BL 5E2UH 1ZANH 4O9HL 3EDFA 1L0QA 4IGBA 4YSDA 4Z0XB 3EYUH 5IQOA 3MV8E 4QKXB 1TENA 3L3OA 2BWQA 1MRCH 3VQ1C 1Z2KA 4ENZA 2BXYA 3IJSB 2I7SA 3TO4D 2H6OA 2B5IC 1AIFA 2YD5A 3CSYA 1MZYA 2WXOA 2EYSB 2JVUA 2W9EL 1EEZA 3DXAB 3IK2A 3PIQB 4I13B 1OAUH 3GWJA 1BD2D 5M95B 2OR9L 3E3QE 2HWZH 3BW9A 2BRQA 3P2DA 3WLWD 5DD6A 5BO0D 4HKBA 2WTPA 5LG6A 5FOBB 2HT2D 3BUPA 3GXFA 4KJPD 1TFPA 1HE8A 4GKNB 4EAEA 4TF4A 3TL5A 3IJ9A 2B1OA 3C5ZD 2Z93A 1PMYA 2DLFL 2WY3B 2J7LA 2J72A 3CLFL 1PY9A 4PGZA 4AIXA 4UIKL 5DWUH 5FLUA 3STZB 3D69B 4MB3A 4Q6IC 4YSRA 4DP7X 4ZDHB 3ABKB 4QCIA 4MZRA 1TYRA 3MACL 3FYEB 2V5YA 1D5MA 3FW6A 1GSMA 1UWYA 2F74B 2L7EA 2EADA 3S96B 4PB0L 4CDGC 4NYLB 3WXWL 1OCWH 1KLUB 3PHQA 2RMNA 4OV6F 3H4FA 1PQZA 5KYYB 1YMME 2X70B 3EYVA 2FHBA 2BH0A 2XZQH 4QO1A 3UTSE 4ALAH 5C6PB 2AXFB 2OMTA 2DMGA 2PW1A 3KM1A 5GGRA 2GBTA 4LLVB 1TETH 1NC4D 4XX1E 3PWUA 2VDKL 3VGEA 4G83A 1KXTB 2AQSA 4L37B 4RAHA 1JVKA 1CE6A 4QOKB 1OWWA 3IGFA 2WD0A 3W1ZA 4WV1B 2AKRB 2P28B 5HHOD 2Q8AL 5LB1A 2CK2A 3D09A 2OZ4L 5FO7B 5EN2A 2EYRB 3RZCB 2FJFA 1UG9A 3FTXA 1I7ZB 4GQRA 4M1DL 5F88B 2QVKA 2D73A 2ZJSL 3RPIA 5I8CB 2CO7B 3IJEB 3PUCA 3QZWA 4ANVA 4XAWL 4WJKB 2CR6A 4DK5A 1AG6A 3IJYA 5HDQH 3MZTA 4BQ8A 3B7YA 2ADIB 4Q0XL 3LYRA 3V0VB 3O8XA 4JPQA 2M83A 1TZHA 3BMWA 5BPPA 3T09A 4Z1PA 1DLFL 2X1XR 3EXJA 3KCWA 2PCPA 4X5PA 4TQHA 5FO7A 4NP4L 4PUBL 5DS8B 4P2QA 2NY4B 4WWKD 3BVUA 5GGUB 3MLSH 5EU3B 4G8FA 3RVVD 5I1AB 4RMWA 2FB4L 3CC5B 3IBOA 3WDHA 2XWXA 3MNWA 4GAAA 1QRKA 1Q9WA 3H4HA 3MUZ1 4Y5VB 3NDYE 5F6IC 1CI3M 5AW3B 1BVNP 3NIGF 2GSGB 3RPKA 1TZHB 4TYUA 2CBMA 5SWZE 2WQSA 5JW4M 5E00A 4WY7L 4LVNB 3O6MH 1QLRA 4KKBC 2XZZA 4PJIE 4XNXL 1QWUA 3PL6A 1JUFB 4KQ4L 4FQXC 3UYOD 6FABL 3RJDA 5JW5B 2XTJE 4FA7B 2DQMA 2APBA 2DIBA 1FVDA 2JTYA 4QY8A 5H37H 5H4YA 3R06B 1WA1X 3LDBC 4NC1E 5B39B 3ESOA 5JW4Q 1I3VA 4E42A 2WQVA 1IGJB 3ESUF 2WZ5A 3A5VA 1AFVH 2QKIC 4UQ9A 1KIQA 2PF6A 1AGBB 5FHBH 4M9OA 5C9JB 5IW1A 2XN1A 2FEEL 3RWDB 4G6KL 3BOVA 1UD4A 1RZKC 2FATH 1FZKA 1TTFA 3D3VA 3MLVH 5I66B 4CJ1A 4WZ9A 4JKPH 4PD4J 3NZSA 1CL7I 2XN9A 1HHHB 5DD6B 2Y07H 4MQXC 4FI6A 4NOFA 3OC5A 1T2QH 2Q7YB 3SYQA 4AEEA 2ARJB 4EUPA 1MVUB 1A7QL 5EMYA 3D39E 4L8SC 3FU9A 4OI9A 4UQ2A 5FWQA 4HIJA 2WIIA 4MMYB 3RX8A 7PAZA 1EX0A 3MCG1 4A39A 4BQBA 1CICB 2F53E 3QIBB 2C8NA 4OF5A 4YSPA 5F6HJ 4AKPA 4X9YA 2NCEA 3N43F 3WSQH 4YSAA 4D9RD 3NH7L 5H37A 3US9A 1BP3B 4XAKE 1NLDH 4JJHA 4AIZB 1KJ3H 4HGMA 3UYRH 3VFRB 3N6YA 2F19H 4YXLH 1EAPB 3T65A 2DIJA 1NCTA 1YPZB 4M6NL 3D18B 5T3XL 1I1FA 2HRPH 2CK0H 4FG0A 2VDKH 2R1WA 3M45A 4B50A 4NHUA 3E9TA 4OV5A