3MA9L

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
IELTQPPSVSVVPGQTARISCSGDNIPYEYASWYQQKPGQAPVLVIYGDNNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCASWDSMTVDGVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 38
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9L01
2Y6SC 3MRPB 2DTSA 1MCPH 3LS5L 4YC2C 4MLSA 2HA1A 5JIHA 3VDAA 2QHRL 3ZE1F 4HIJB 4DN4L 1C5DB 3SPVA 4XHJC 3D1MC 3HZMB 3SKJH 1JZ6A 4KROB 4L3CB 5AWNL 5LXGH 3C08L 2IH3B 1OSPH 1Q94B 4JDVA 1BM3H 4Q6YA 4EUPB 1PVHA 3TO2A 1Z9LA 2NLJB 1ZHBB 1F45A 3HZYA 3PWPE 3LQZB 5EZOL 2YD8A 4QYOA 4JDTH 3UTTE 4IS6B 1G6RA 1XGRA 5C08B 3MRRA 5C2BL 1BHGA 4BK5A 5HDQL 3L95B 1K85A 4BFIB 3NZHH 3BN3B 4S1DC 2VZVA 1NCWH 4MD5A 3X14B 4KQ4H 1KJMB 5I1HL 3D39A 3PABA 3VXQA 3QXVA 5KSAA 2RQ8A 3KPLA 1T04B 1WTGT 4PLOB 4G8EA 1CG9B 2BXZA 5CP7B 3UP1A 1LWRA 5IVZB 4K9EL 4E9LA 1NCCH 2HLFD 4TNVK 1V3MA 2GSIA 5DK2B 4L29A 3TPUB 5C0FA 1O7VA 5FM5O 3WXVL 3T4YB 3VXMB 1OP9A 1FNHA 5HPOA 5CUSL 1MAJA 4Z8FL 4X7TA 4YHOH 3ULVC 1BZQK 3OGCB 4JHBA 3O6ML 3QZWB 5GS0L 4UT6L 3GJFK 1NCDL 3QRGH 4X6FB 1UZ6F 4N0FB 3NMEA 1RHHA 4JFZL 4CDGC 1ZA3B 4ZSOE 2ZUQB 3KPOB 4UQ3B 1FORH 1KN2L 5GGSA 1VGKB 1WT5C 5HVFB 1ZLVK 5CHNA 3P30L 1YEHL 3O4LB 3L3IB 3QH3B 3RIAK 3UYRL 1JZ4A 5CJOL 5CZVL 1OTUD 5I1LB 2OL3H 4JZJA 3IJSA 5C0ND 2GTWB 1IL1A 1CDGA 4HCRA 4R0LC 4K3JH 2YK1H 4ZDHA 4G8IA 5JW3L 4NN5B 4DK3A 1I9RH 4JRXB 2C3GA 3SKOA 3QSKB 3NCMA 4KK5D 2IEPA 5CILH 2UWEE 5CKAA 2LVCA 3QI9A 1CE6B 4JN1H 4D0CB 1UH3A 3FT3A 2OMNA 5GGRY 3LPWA 4ODXB 4HXBH 1IC5H 4UIMB 1AKJB 4RFOL 3FQTA 4O2CA 2Y36H 4OCRL 5TDOA 3JUZA 4ZUUB 2FR4B 3C09C 3LKQB 1HOCA 1WBZA 3RVTD 1KTLA 3VXOB 1OGAB 5CJBA 4NHUA 2YSSB 2UUDK 2OSLA 4GRMA 4RFEB 2AP2A 4EDXA 3KPPB 2NW2B 5T1KB 1DQML 1B6DA 1F4XL 4ZFGL 5EG6C 4N1HB 5D7JA 3PXJA 3SGEI 3O0RH 3D2UD 4YAQB 3HE7B 3WL9A 5GS1A 4B7IA 5F7EH 1T6VN 1AD0A 4OIAA 1CDYA 4BSWA 2CDGA 4YC2B 5I71B 1MHHB 3PXHA 4NT6B 5DK0A 3T3PF 3HR5B 4LRNH 4ZTPL 1A3RH 1NDGA 1QO3A 2D7TL 2F8OA 5E0QA 5IQ7L 5JOPE 1ORSA 1A21A 5FO7A 1I8LA 1FE8L 3QCVL 2Y07H 3UTSB 2X2YA 1X6NA 1G1CA 3V4VL 3S98A 2DQFA 4Y8AA 3BW9B 3F65A 2DL2A 1AR1D 2O5XL 3X12B 3VA2C 1FIEA 2ZOLB 3QUMB 5SWZE 5F93C 1NANH 2X4QA 1WFUA 3GHBH 3BWUC 3L7EA 4LBEB 5TGBB 1JGUL 4G7VL 2HMID 4XVTH 5EOTB 4ZNCD 3AROA 4F33B 5F1SA 1D5ZA 2AXFA 3BUYA 3KR3H 4WU5A 1R5WA 4KK5C 4KVCH 1NMBL 4FABH 4P4RA 3H9SE 5TQ2H 3GGWA 5IHBA 3WO3B 2F5AL 2JB5H 1VFBA 2CJUH 4E41E 4GLRI 1YECH 1F90L 5BV7H 5FYJE 4KMTH 3NGBC 2OL3A 2VDPH 3NAAL 4DJMA 1U8IB 1G9NC 2DDQL 3D25A 4HKBA 4XP5L 3LQAC 5JPNA 2I60H 3PWPA 3QFJE 4NP4L 2W0KA 4HQQH 1IAIM 3UTTA 1WZ1H 4XC3L 2MMXA 1KC5H 3BKCH 2IQ9L 3QRFM 1EEYB 1UJ3A 4N0YH 5HPMA 1CT8A 5ADPL 4XVUC 1A1OA 3MYJB 3VMOA 1MCSA 1F00I 5LQBH 3RUGA 3JV5A 4XWGL 2VH5L 2RGSA 3IJYB 1NGYB 3SDDD 5D70L 2B5IC 3HFML 3L3DA 3MZTA 5EU3B 3VFUA 2BNQA 3VXRB 2H41A 4RAHA 1NEZB 4HJGA 2W91A 3QIUD 4OLZL 3V2AR 4EEEA 1IGTA 4HC1H 1KIUA 4PV8A 1JWUB 1MCBA 4KQ3H 2HWZL 5IROC 4EZMA 3O6KL 2BNRD 3JTSA 5ERWA 3QO1B 1ZHLA 5IJVA 2VXVL 4OD3L 4H20L 4K94C 4HUWA 1YNKH 2R0WH 4TSBL 3MLVH 1AGBB 4U1IB 5E9DE 4YWGL 4KGLA 3ULVL 1S7UB 4ZSOA 1T1WB 4WEMB 2NNAA 2VZSA 4AL8L 3K1KC 3Q0HA 4FQQA 2KH2B 3NCEB 4LK4A 4QOKB 1ZLSL 3C09B 4ODTH 3STLB 4MSWA 3C6LA 5FYJH 1KXTB 1UG9A 5F9DC 4P3CL 3T77B 4E0RB 4Q9RL 3AVEA 4FQPA 3V4PH 3ARGD 4QRRB 35C8L 5GHWL 5E08L 3KYKH 3U7AA 3VWKB 5D7LE 3L6FB 3BHBB 3VRLE 4OD1H 2UWEA 5GGRB 2BOCB 4M6OL 3DMMD 3GNML 4PRAA 4F3FA 2D03H 1T7WA 2NXYD 4OBRA 5B4MD 2VTFA 3BKML 1UEMA 4HIXL 4P2OD 4PJBE 2A74B 1N64H 1AP2A 2KQNA 3PQYE 1IAIL 3PWUB 1QHPA 2HJKB 5EO0A 4WJ5B 2X05A 3N1FC 1MRCL 1AQKH 1TCMA 3RTQD 2AS5M 4MJ5A 3DHJA 1BLNA 2Y7QA 1PDKA 3JUYA 4NIKB 4RGMB 3SCMA 2F8XC 4NOBA 3QIUC 5I19L 1WITA 1ULVA 4GXVL 5IG7B 3W11C 2CLRB 2B20A 2BY3A 2EYTB 5D6DA 3OX8A 2IFFH 1NC2A 1PD6A 1RUML 4ZMAT 1BFVL 1KXQE 4NKOB 4U1MB 1DEEB 3QXDB 4HF5L 1NCTA 3P73A 4QLRA 1NQBA 1RFDH 4HWBH 4OLXH 1G6VK 1KCLA 1VPOH 2EDXA 3BP6A 4R2GD 1WAAF 4PGBB 5JLZA 1FZOA 3VFNB 4FZ8H 1DBAL 4LCWB 3EYOA 1UKTA 3MA7B 3H3KA 3LHPL 4OAWA 4ONGL 4N5UA 2DLTA 4HC1A 1FBIL 2COQA 2DQJL 4HK0A 1CGXA 4KKLD 1A14H 3WSQL 1G1YA 3QIBB 3HG1D 3Q5YA 5HGHA 1AXSB 5CMAA 4M6NH 4YHNA 1OAYH 4D9LH 5SWZA 3O45B 4RRPA 4ZFOB 3NCFB 5MP6L 2QSCH 4MD4B 3CH1A 3S5LA 4D0DA 5BO1H 4PV9A 1JF1B 3FL7A 4XPHL 4X80L 1UXSB 1SBSL 4LLQA 2AEPL 5I0DA 1C16A 2PXYC 1AD9A 5DJCB 2JJUA 4RDQG 5E5UB 1BFOA 5L2KE 2FO4A 1RUPH 2NY4D 3BMVA 1MH5A 3H9SA 1B88A 1AO7D 4KWUA 1JGLH 2BRQA 4I2XE 2B5IB 4XCFH 3TH4T 3WDHA 5GGVY 4EQ3A 1D6VL 2LFGA 4E41A 5HJ3A 2GY5A 5L7XH 2WWKO 32C2A 3RVXD 3ULSA 4P2OC 5B4MC 2EXWD 1CL7I 1FDLH 4NKQB 1RY7B 4YXLL 2O61B 5JQ6H 2MKLC 3CFJA 1HYSD 1S3KL 3QFJA 2X1XR 1UA6H 3RTQC 4GRWE 2VIRA 3M1BB 5IQ9B 1YY8A 5C9JA 1EZVX 3WIFB 3LQAL 5IW1A 1OF2A 2C4FU 3RGVC 1QFWL 4CVZA 2RIKA 4JJ5B 3PDOA 3GJEA 5FF6A 4JN2A 3L5WB 3MRCA 4N8CH 1EA9C 4DGIH 3KYOB 2B8OT 2DLHA 4G3YL 4G6MH 2ITCB 4KJWC 3WUZA 3DLQR 3KJ4C 1NEUA 2Z8WC 2XY1A 2EO1A 4OCYH 4Y4FD 4ACPA 3KPQA 1IQDA 3FT2B 2BZDA 1Y18A 3O9WD 1BBJA 3FONB 2WINB 3UC0H 4P4KA 3HCVA 5DJ6B 4PJAB 3G5VA 4PJGB 4YFEA 1RULL 3MFFA 1I1FA 4QHNB 3QFDB 1Z9SA 4ZS6C 1I8IA 1NANI 4WUUD 4HWBA 2R9HC 1K5NA 5E9DA 4AIZA 5J6HB 4BJLA 3D18B 3MLYH 4WUKH 2G2RB 3CXDL 2KZWA 4HHAB 2AVGA 1XIWC 3CDYA 4NWUH 3TZVA 2BXYA 1JBJA 1CFTB 2P45B 3OKNB 4O51B 1F02I 2VAAA 4RBPK 2GCYA 2YRZA 5EU6E 4XRCA 1X4YA 3V6ZA 4GKOA 5FECB 3DECA 1CICC 2DJ4A 5D7LA 5E1AB 3TEUA 1BQHA 2J4WH 4LCIH 1XGQA 1P2CA 3RWDA 1LQSR 5SWSB 1MAKA 3BQUC 4UZGA 4KK9C 2AI0L 4U1KA 4PJBA 1IKNA 1H5BA 4XNMB 1GPOL 4OZ4A 4R7DA 3PQYA 2W9LA 4DOHB 1QSED 4UT9L 5EORL 2P47B 1D9KA 3SE4A 3VG0H 1ZTXH 4M43H 4ZS7L 3NTCL 1HILB 1DQQA 5ICZB 2Z8RA 4ZAKA 3BPCA 3GSUB 3MV8E 4NQCD 4EDWL 5AD0B 5KS9E 3U1SH 3K80A 4TUJA 1X4ZA 4WI6A 1K4DB 3HC3L 1T5WA 3P4LA 2PXYB 5F8QC 4HV8B 1V7NH 3G9AB 2ICCA 1WZMA 2Q8AL 4APQA 5A2LH 2AK1L 1GOHA 4WWKC 3BP7B 4JZNB 3WIHL 1HHJA 4PJ7B 1TJIL 4QY8B 4H26A 1DE4A 1NBYB 2Z8VC 3TV3H 3I50H 3IFOB 2N7BA 2AEQH 4U7SA 4PJAF 2FYYA 3ZKMC 4PJGF 2DL9A 4FTVD 2J3SA 5I18H 2CH8A 1ZLVH 4Q2ZB 3QUXD 1FNSL 5D1QD 5GGTH 5IHUL 1A5FH 4XXDB 2FL5B 1YNLL 3DROB 3RWJA 2ATKB 2EDYA 3ETBF 1D6EB 1XCTB 4HFWA 4F37K 3RGVB 4LLDB 1IAKB 4AMKH 1U8JA 3T1FB 3T08A 1FN4B 2HKHL 2AKRA 1MI5D 5L2KA 3MV9D 1PEZA 1VADA 4Q6IB 5IB3A 4MJIB 2VLJB 3W9DB 1T2XA 1FFOA 2A6IB 1J10A 1IGML 4MS8D 1F3RB 3BO8B 4I2XA 4M62H 4GAFB 3NH7H 1OB1A 1QEWB 2FHFA 3KJ4B 4H0IA 3KXFB 4OF8A 4KTYA 1LEKB 2LAAA 3V6OC 1UEYA 2HJFB 2DQDL 3OPZH 3RPKA 3LCYA 4OQTH 2UUDH 5DGQA 3TO4B 1EH9A 2A6JA 1F3DJ 4OIBA 3E3QE 4DGVL 3BVNA 1EUUA 4NNYA 1KELH 4IOIB 1RIHH 1JI1A 4EI5A 3W5NA 3F12A 3N85H 4U0RC 3CDCA 1U8LB 15C8L 3F58H 1U8QB 3K7UA 4S1QL 2OZ4L 4U6TA 4NNXA 3SJVB 3WUWB 3MODL 4HXAH 4XP6H 1IAOA 1XIWB 4U6YB 3TT1H 2QQNL 1J05A 3GMRA 3L1OL 5E8PB 5EZLA 4PFEA 5H2BA 1Z9OA 3I9GH 1EK3A 4YDKL 2AXGB 4IRSC 3ZHDA 4Y5YB 3KYAA 1SM3H 1C08A 2DTML 4BQBA 5DI8B 1S8DA 4MJ6A 1I1AC 4ZPTB 1MUJB 2IANB 3RA7H 4XAKD 3QUXC 4MA7H 2X4PA 1NGXA 1OSZA 1CICB 1WZLA 3BGAA 4NRXB 5D1QC 3UCRA 1MQKH 3GI8L 3ROLB 1YMHA 5HHME 4PJ7F 3KPSD 2EDQA 3BQUB 4X9BA 2R56L 1N8ZB 3FFCB 4GRLA 2CDEA 3SDCA 1CQYA 4WV1C 3MNWB 5E7BA 5HHQA 5E5MA 2EEBA 3CLFH 5KN5A 5HYJB 2EE9A 4RMVA 3HA0A 3OKOB 1BBDH 4FFYH 5GGTA 2P8MA 2R1WB 3D85B 4BM7A 4LDEB 4NFDA 5EU6A 1OT2A 4WEBH 4JEGB 3EOBA 2AJ3B 3AM8A 4K3DL 2O5YL 3QQ4B 2F53B 1JTTA 2AJYH 2RBLA 4J8RB 4YNYB 4LKCB 4P2RE 1OAQH 5FM5M 3TM6A 3R4DA 1AY1L 2UV3A 5GS3A 3CZJA 1EEZB 2IPKB 4IEFB 4IBLT 1DBJH 2NMSA 3DYMA 1OM3H 4DCQB 3QPXL 4WWKB 3VXTA 1OY3B 5FK9B 5DO2D 3RRQA 2CGRL 2CRIA 3LRGA 2W60B 1JGDA 1T7ZA 3N0PB 5IP4A 1SJVA 1KLGB 4HT1H 1A9BA 3TJEH 3MV8A 3C6SB 4OQTA 2HAZA 1J0IA 2YD3A 3RY4A 1MHPL 1P84J 5KS9A 2K9UA 4DZ8B 5BCAA 1CFVL 2NTFA 2CMRL 1X6LA 3UPCA 5I1AB 3ARBD 4G80A 1JIBA 1MIEL 4CL7A 5IWLA 3VFTA 4DOHE 4RMTA 5D7SL 1GIGL 5T3XD 5EWIH 4AIOA 4Y5XC 4KUCF 5DDHB 5HY9B 1A4KA 2ZCKH 1U41A 2DJUA 1U0QA 2ARWA 2ITDB 3PUCA 3MJGX 4D8PA 2H8PB 5EOCL 2A6KB 1SVZA 2CDFB 5TF1L 4LSTH 3QG7H 3QDGB 4ZFZA 1KYOJ 2HFEB 5C0JA 4M4RA 1JL8A 3KPTA 2P5WE 4ELME 1LO4L 3JTTA 3TWCL 4TULH 1HN1A 4ZUWB 1MAMH 3GEWB 4U1NB 4ODHH 4YDJA 5HHXL 1GL4B 3RPIB 1CXEA 1YEFH 4GW4A 1XR8A 4KJYA 4RX4A 1SEQH 3E2HB 4HLZH 1IRAY 4U0RB 1JI2A 2OTPA 5BVPL 1R3HB 3CFKB 4O9HH 4YO0B 1HDMB 4QWWC 2WWMD 5I30H 1ZGLA 5EO9A 1MWAL 4DZBB 1RZJC 1FL5A 4GBXA 4P2QD 3SO3C 1EBAA 3ZSTA 3WCYA 2AV1B 1HQRB 3TF7C 5IJKA 3BDBA 4ODSL 2XQBL 1KPUA 1VDGA 1NUGA 1MIMH 2V5YA 5DO2C 4IRSB 1T1ZB 1XF3B 3QISA 2WV3A 1NGWA 4XMLL 3F62A 5EULV 2Q7YA 3AU1A 5DJAB 5T1DL 3KJ6L 4RGNE 1I1AB 1U58A 1BAFH 5A2JH 4AEEA 2VR5A 1LO2H 4LEOA 1A6TA 1BD2D 1QSVA 2EZ0C 1R3LA 3FMGH 3P4OA 1HI6A 5DTFA 3T0ED 3D3VD 3AREA 4Z9KB 3GIVA 1HSAB 2VKWA 1T6WA 5GS2D 4JY4A 1QR1B 4Z7NF 4F9LC 1FQ9C 5I1IL 2V7NB 3ILQD 2WBKA 5F72S 4FFWD 5LCVL 4HJJH 4R7NA 3OB0H 4X0KB 4NQEE 4LPTA 4JM4L 3FB5A 5FKAA 1BIIB 2P49B 4KK8C 4OGXH 3MACL 1MCNA 4C56E 3CPLB 3MMEB 4I3RH 4PRID 1WICA 4NC0B 4OCMC 5I66A 5F3BB 1BZ9A 4U1LA 5JHDD 4KZEL 3V6FB 3C5SB 3D6GA 4Z77B 1QA9A 1LEGB 2MCPL 5DRZB 5FV1L 4FNLL 1NLBH 3IF1B 4FFZL 5IM7A 3SDYL 3FJTA 3DARA 1GGUA 4HIIB 1NCNA 2HH0H 1G7LB 4HK3J 1RZ8A 1JN6A 4HWNA 5DEFB 4LOUC 2X4OB 1D5MA 5F1NA 1MJ8H 1ZAGA 2Y1VA 1DFBL 3IJHA 1QOKA 2R2BA 2WWMC 1RV6X 4M00A 4XBEL 3NABH 1LK3L 4GG6B 4FOMA 2JB6B 1S9WA 3NFNB 2XQYK 1GC1H 3GRWH 4R4BA 3IS1X 4QXTA 4RZCA 2Z0BA 3BEVB 4U3XA 3VXUD 1A0QL 4YQXH 5E6IA 4P2RA 1FZMA 4HKXB 4R26H 5C86A 4L4TE 3QNZB 3UX9B 3BP4A 3MROB 5DJXB 2OLDA 4FXGB 2XN9E 5IOPA 1KBGH 2ZCLH 1TZHB 3S3SA 4JR9L 1A6VH 3JSSA 3V95A 4NM8L 4Y5XB 3BJLA 3T2PA 3VFOB 3B4NA 1P4IL 1M05A 4H8WC 5ESVB 3BPOC 2XZZA 1CYGA 5C1MB 4Y89A 1TMCB 4ZOAA 2CLVB 3ILQC 2WP3T 1LEIA 4K71C 1S9YA 3GSWB 1GVIA 3LEYL 3EJYD 3GO1L 3K2UH 4Z7UE 3I6LD 3DUUB 2ZP0T 2ZSVB 3NZ8B 3SN6N 3VDBA 1YEKH 1DQDL 3LS4H 1AKJD 1A4JB 4GQ9L 4TUKL 2DQIL 3T3ME 1VCAA 3PGDB 1TVHA 3WS3A 1OGAD 3HC4H 3IDMB 3T0VA 3IDNA 1NH6A 1RZKC 3SO3B 5HGBB 2XWBB 3ZKQD 5E8OA 3VMPA 4WTXA 5DUMH 1SYSA 1KTDB 1UXWA 3Q2CA 1RUQL 1YMMD 3QDJB 4NQDB 4W4OA 3FN0H 1J1PH 2N4IA 2YBRA 4ORGA 4I8DA 4UAOC 2P5WA 4ELMA 5FO8B 1U3HD 4U3HA 3WNPA 1KPVB 4A6YH 3OSKA 2C3XA 3C8DA 2NY0C 4NFCA 5J4MA 3RQ3A 2HRPH 1NAMB 5DHXB 3C60D 1U8MA 1WIUA 2AK4E 4PJ9D 4FQLH 4GAYB 4PRNB 1JPGB 1M7IB 3SGDH 4OTXL 3C5JA 4GG6F 4YHZL 5DZOA 3NCBB 1L4IA 3NCJL 3OKLA 2V2WB 4WFHE 5A2KH 1OAUL 1YEGL 1FFRA 4NGHH 3GRWA 3ECBA 4ZPVA 1RZJL 1I3GL 3QP3A 1LDPL 4JFEE 2DQHH 1ETZB 1ADQL 2WBJD 4M7LH 4PJ8C 4Y19E 4WI8A 1QLRB 1FC2D 2A0LD 3Q6GL 4MCYA 4HEME 4XBPA 1SBBA 4NO5A 4U6HA 3B6SB 4Z0XA 1H3UA 3C5ZA 2WMPA 4WHTB 3WMSA 3MRNA 4JPVH 4POZC 1INDL 1FZKA 1YDPB 3EYQC 4HWUA 2BSSA 4LLWA 3I3BA 1KJ2L 1K2DA 4JE4B 1YEIH 3ZDYF 4M6AA 4GS7C 5EZIH 5TFSL 3IFNL 1G7JB 1H0DB 5TQ0H 4NQEA 2VLLA 4O5LL 4ZQKA 1KIQA 5FB8A 5T3XL 5DFWH 4C56A 4HWEL 1P53A 3GDBA 4KKCC 1B9ZA 1YJDC 4OF0A 1U92B 4DFHA 3U9UA 2VISA 3S37L 4I0PC 4P46C 3MLTA 2X41A 4RDQF 1E6OH 1B0WA 1C8PA 4YBQD 3ZT7A 5KSBE 3HUJE 3BD5A 4UINH 3DXAB 5C0AB 1HCFX 4OFYA 5F7FA 1J0ZA 4GKSA 1LDSA 3BPOB 4C58B 1MF2L 1LO5B 3WXWH 2DWDA 2YA1A 1AGEB 1KXVC 2OXGA 4YPGA 4NFBA 2AJUH 2F74A 4PJFE 3JV6A 5AAMA 4GSDL 2P24A 43CAB 4C59B 5F7UA 4K71B 4NN7C 2BC4B 4A6YA 4ZXBB 2VLRE 1SEBA 4UTAL 2AQ2A 3MUGB 2VITA 3TH3T 5JORB 3HPJB 3ARDB 4XB8A 5IBUG 2Y5TA 4L5FH 4L9DA 1N59A 4KXZH 5D71L 2VLKD 1KOAA 1MOEA 4L4TA 1G7HA 2XN9A 4W68A 5EC2A 8FABA 1I3RA 4NHCL 3BEWB 1DP0A 2IPUK 3OG6B 4OUOA 3RWIB 4DN3L 2HTKC 1J88A 3WFDL 2A9NL 4YHKL 2I24N 1F97A 4FQ2H 4GQPH 4QRRD 5GGSY 3IS0X 1DUYA 3OKEA 1RK1B 3VWKD 3QEQE 2GIYA 3NFSL 1DUZB 2F19L 5DVKA 1NAKH 4ODBD 3T09A 4Z7UA 3QXTA 3C9NB 4GMTH 2NY0B 2DI8A 2FBOJ 5E99L 2P48B 3M8OL 1M71A 5ID1A 3X11A 2Z92B 5DQDH 4YXKH 4QXGL 1N5AA 1DVFA 4MNHB 2MHAB 3SKMA 3WS6C 1KSRA 4YBQC 3NIGF 3TYFB 3HI5H 4RAVB 3U46B 2HVJA 4WCYH 1A6UL 3QUZD 2ESVD 4DQOH 3H6JA 3O2VH 1J0KA 2Q8BL 5HHNB 4YX2L 4GAGH 4RISL 1SJEB 4IMLA 1RZKL 1S7QB 1IQWH 4PJ8B 4EIGB 3V8OA 2VDKH 3UAJD 5MEOB 1GGIL 1ONQA 4X6EA 3RWGB 1ZXQA 3ELAT 3QB7C 1R3KB 5HHOD 2FECI 1FFPB 3VXSB 4F7CB 2NYYD 4XNZC 4BH8A 4N8VA 5CFHA 5L6YH 2AK4A 4R4ND 3OZ9L 2ERJC 2FNBA 3VH8G 4OT1L 5JQHC 3RZCD 4MWFB 2IPTL 3QJFA 1N6QL 4YPJA 3QDMD 5BRZE 2ED7A 4GS7B 2IF7A 3OKDB 3HI1B 1NMAH 1T1XB 1BQSA 2UVEA 2VQ1B 5F21B 2VKXA 5BJTA 4JFEA 1FAIL 1LO0L 3QA3B 4PRPB 1OT1A 1ITBB 1CLZH 4Y19A 1CDUA 3HZVA 4PJCF 3BGMA 4OM1L 2EE6A 4QTHA 5D7JC 3NPZB 5EPMB 4I0PB 4P46B 5FM4A 1Z9MA 1D5IL 5GS1C 3U6RB 2VE6B 4X7FC 3PHQB 2G9HB 5F88B 1UM4H 1UQSB 2Q7NA 5FAAA 1JGVL 3KWWA 5F9WC 1IGCH 4YXHH 4Z7QF 5ECJE 3Q6FA 3HAEG 1MFEH 4UILL 3P77A 3ARXA 3SPVB 3KYNA 3BT2H 1WEJL 4XT1C 3N1PC 1C12A 4XPGL 4JDVB 1T0NA 1FLRH 3SKNA 4P5TA 4MX7A 2H3NA 4AEFA 4NN7B 5I1KL 3KYMB 2VDMH 1IGYA 3HZYB 4FP8H 5LWYL 2E9BA 4XNXH 4QYOB 4J3TA 1G6RB 1XGRB 3MRRB 2PYED 5KSBA 3HUJA 3DVNA 3BAEH 3LAFA 3VFPA 3QXWA 1YJDL 5KVGH 5HYSA 2V9QA 5KJRH 4MD5B 2NYYC 4LMQI 5IGXH 3D39B 1U91A 3PABB 3PDDA 2XA8H 4ODUA 3VXQB 4OIIL 1B2WH 5KSAB 4JM2D 3LKNA 2J6EH 3EHBD 4G8EB 3WFCH 3SGDI 5ENWA 1DL7L 2X42A 4PJFA 3RHWF 3H3BC 2A6DA 5IESL 2GSIB 1WFTA 1FGNH 4KAQH 1FP5A 2VLRA 4L29B 1MCIA 5ANME 5C0FB 4X4YA 3TVMC 3L3GA 3T0DA 1OD9A 4X7TB 1Q72L 3R8QA 1WCBA 1EZVY 4PJ5E 4M7LT 4OI8A 1UJ3C 4P99A 3BZEA 1PQZA 1J8HE 3LEXA 2APVA 3LS5H 1RHHB 3O2DL 1L9MA 4DN4H 3FO0H 5GGSB 1EO7A 2EH7L 1VGEL 4RA3A 5CHNB 4BYHA 5AWNH 4MQSB 3VW3L 3C08H 1QSFE 4XWOD 4XNQA 3K4ZA 1BP3B 4BZ1L 3QEQA 4JZJB 3IJSB 1IL1B 4JVWA 3KAAA 1F6AA 3LB6D 1RJLA 5EZOH 5SWSD 1CTNA 4ZDHB 4G8IB 3RDTA 5IHZA 5J12B 4JZOA 3CSPA 3TN0A 5C2BH 5DWUL 3SKOB 4XNZB 5HDQH 1IM9A 5C0DA 6FABL 3QI9B 1E4WL 2ERJB 2BVQA 3RWEA 5B8CA 1U36A 4NKMA 4KTDH 5I1HH 4JPKL 3FQTB 5C71A 2A83B 5TDOB 1VEMA 3BZFA 2JELL 3T0XA 1V5JA 1HOCB 1WBZB 2FD6L 5DRWA 5AZ2L 5HHVL 1KTLB 5C0BD 4K9EH 3FHQA 5FYKL 4NHUB 1NSNL 1K8IA 3KGRA 4LRIA 3EHBC 1RI8A 2OSLB 4GRMB 4P9HC 3MUZ1 4EDXB 5JXEA 3BDYL 1CGWA 3WLWD 5IBLD 3CX2A 4OM0L 5D7JB 5C07E 3WXVH 5JW4M 5GSRA 5CUSH 4JKPH 3QHZL 2DM2A 3WL9B 3LPFA 5GS1B 4PIRF 2X70A 4HZLA 1AD0B 3O6MH 5GS0H 3MCLL 2CDGB 4BSWB 3EJZD 1NCDH 2BVUA 1NDGB 1I8MA 1QO3B 4KXZI 5C6PB 3BZ4B 1ORSB 1GGBH 4PJHE 5FO7B 5BRZA 2J6EA 4PB0L 4F7EA 1XF5A 1KN2H 4MA8H 3P30H 1YEHH 3HPLB 3UYRH 1RIUH 4G6AD 4R6UA 5CJOH 4L9LA 2MTPA 3DGGA 3CVHL 3QO0A 4WI7A 3KLHD 3CLEL 5JR1L 2X4QB 4XP4L 2WK2A 3LMJL 5BZDA 4L3EE 3EYFA 5JW3H 3L7EB 3TBSA 3LB6C 5ICXB 1FC1A 1KB9J 3S4SA 4XCNA 5L2JA 4WHDA 4ZO8A 1LD9A 1D5ZB 5H94A 2AXFB 3BUYB 3NZHL 4WU5B 1R5WB 4UUJA 5DHVH 4P4RB 1Q9OA 3GGWB 5MEPA 3B2VH 1JZ8A 1VFBB 5F7MC 1YN7A 3FRPA 4OCRH 2K3TA 4JCMA 2OL3B 3TO4D 4NZRL 1WBYB 2X4NA 4HKBB 5JPNB 3PWPB 1TETL 5LKNA 3I02A 3TPKA 3UTTB 1DQMH 4CGTA 1RSFA 3NIDF 1F4XH 4ZFGH 5IMMA 4WEUD 3CGTA 1UJ3B 5IBLC 4YBLC 5HPMB 1CT8B 3C87A 1KB5L 5B3JF 1A1OB 1HHIA 4Y16D 4U2YA 3RUGB 2ADIA 5DVNA 2GUOA 2FIKA 4ZTPH 3U7YH 2D7TH 4JKWA 3ZO0A 3VRJA 5T1LA 3BZDA 3VFUB 2BNQB 3HMWL 1FE8H 3QCVH 2NX5E 4P23D 1CLOL 3V4VH 4CN4A 2R2HA 1IGTB 4PV8B 5DXWA 3MBEA 4NJ9L 4LVOC 5ANMA 2VN4A 1N3NA 2R4RL 2O5XH 5F89A 4PRHE 5ERWB 4X4XA 4JREB 2VUOA 1ZHLB 4BKLA 5KW9L 2VL5A 2XICA 5IJVB 4PJ5A 1FNEA 1ODAA 4K3JL 4HUWB 1J8HA 4BQ8A 1JGUH 3L5XL 1P7HL 4G7VH 3ULVE 5CILL 4ZSOB 5HYJD 3O3EA 1CD9B 3IU4L 3L5JA 2NNAB 4BSJA 3EO1A 2F54D 2EDWA 1NMBH 4I9WE 3B8YA 1OD7A 4FQQB 2F5AH 4JO3L 4XBGA 4HXBL 1QSFA 4Y4KA 1CL7L 5EIQA 4HIEA 1F90H 2Y36L 4MSWB 3C6LB 1BZ7A 1E4XL 2CR6A 2SEBA 4TN9A 2YPLD 5FGBC 3WLBA 5E03A 4XP5H 5I8OL 4P4KC 4NP4H 1NBQA 3QIWA 4XC3H 4Z0BL 1DANU 2IQ9H 2EIEA 1OTSD 2UWEB 4MQXD 4U33A 5ADPH 5F7EL 3MV7B 1INEH 5DHVA 4O2FA 1IC7L 1T5XA 3AMLA 4FXKA 5DEZA 3UXFA 4PRAB 4F3FB 4LHUA 4XWGH 2HT3D 2ENYA 2VH5H 5BV7B 1AP2B 3GMPA 5D70H 4N9OB 3HFMH 2FJHA 5EO0B 3KDMA 4MJ5B 1NFIA 2O26U 4OLZH 2YD9A 2Y7QB 3SCMB 1OAXL 2C9AA 2XTJD 2DLGA 1ZMYA 4FRWA 2HWZH 4YH6A 5C07A 4N8PA 3O6KH 1L9NA 3VGDA 3RUGF 3OR7A 4HLZG 3OX8B 2VXVH 4P9HL 4JGMA 4NUJA 3T2NL 1BGXH 4OD3H 1YPZE 4H20H 2CXGA 4EXKA 1FV1A 3GHBL 5D1ZD 4TSBH 3P73B 2ZNWA 5HI3D 1L0XA 2RR3A 3U83A 3O6LH 4YWGH 5ETUA 4PJHA 3ULVH 3EYVA 3S3PA 3BP6B 2J5LC 5HXMA 5J1TC 5JLZB 3QG6A 1FZOB 4D0CA 3FAXA 3EYOB 4AL8H 2R0LH 1TZIA 4KVCL 4Z5RA 3SE4C 5EIIA 1UM5L 2CJUL 5GZOD 1BECA 4HK0B 5TH2A 1KENH 3N1GC 3MOQA 2YD7A 4ZAKC 5HGHB 5CMAB 4P5KA 4YHNB 3SGKA 5SWZB 4Q9RH 4JDZB 2I60L 4J4PA 2Q20A 4N1EA 5FDWA 2F58L 4L3EA 4D0DB 5DMKA 4PV9B 2PO6D 35C8H 5GHWH 5E08H 3K4AA 4YBLB 1QFOA 4LLQB 2B1HL 1C16B 1AD9B 1CFSA 4N0YL 5F7DA 1MHEA 1BFOB 2FO4B 1MH5B 3H9SB 1I9EA 2L7UA 4APQC 2NW3B 1C7TA 4UU9A 4HIXH 3BKMH 3JBG7 4E41B 5HJ3B 3HNTL 3OAUL 5GRJL 1IAIH 2VNCA 1RU9L 32C2B 2QTEA 3ULSB 4JFFE 4KI1A 1MRCH 3VI4E 4LCWE 4L1DA 3CFJB 4NC1C 3QFJB 3UJJL 4EQ2A 5ISZD 2VIRB 4NKDA 2UWEF 5DMGD 1YY8B 5I19H 1YA5A 5C9JB 4GXVH 3ARTA 5IW1B 2EDJA 4QXUL 2BOBB 1OF2B 3PG2A 1RUMH 5F6IC 1BFVH 4CVZB 2J88L 3MNZA 3PDOB 3GJEB 5FF6B 4JN2B 4HF5H 1CR9H 3L3KA 3MRCB 1SHMA 4MVBD 5EOTA 3G6JE 3MOAL 4WHYH 2NX5A 2I07A 1DBAH 1EFXD 3LN5B 3LHPH 4ONGH 2H45A 1WVZA 1X5HA 1FBIH 2QHLA 5JXAL 2DQJH 3KPQB 3PWNA 1IQDB 3MRDA 3WSQH 4R97B 1Y18B 1BBJB 4PRHA 2V2XA 5GZOC 4P4KB 3N50A 2R2EA 3HCVB 5DUBA 3G5VB 2VDQL 5MP6H 3MFFB 4D3CL 1I1FB 4XPHH 4YDVA 4X80H 4EI5C 4QRTA 2AEPH 1K5NB 2H2PC 4GT7A 2PO6C 4N5ED 5E9DB 1CXLA 3RNQA 1T0PB 4AIZB 5BS0D 4LAQH 1T22A 2YKLL 3FOMA 1A7BA 1AGDA 1D6VH 4AENA 3U2SA 1N64L 2R8SL 2JF1A 2UY7A 3KLAA 1WT5A 4YXLH 2BSED 3OAYH 2VAAB 3GZKA 2GCYB 3FB8A 1S3KH 1BPVA 1OPGL 2ZUWA 4XRCB 4R9HA 3RNKA 3FN9A 3V6ZB 3PWJA 4AEHL 2BSRA 5D7LB 4R0LA 3LQAH 5DMGC 1BQHB 3IDXL 1JZ3A 4B50A 1XGQB 2EYSA 1QFWH 2IFFL 2JJSC 2XZCL 4M61A 1ZT7A 4K8RD 3RWDB 3LDBC 4NQXA 2C1OA 5E56A 4U1KB 4NNPL 4PJBB 1H5BB 4L8CA 4GRLC 4OZ4B 4R7DB 3PQYB 1Q1JL 4G3YH 5DS8A 1D9KB 1M6OA 3RAJL 1IKFL 1FAKT 4WU7A 1DQQB 2EIZA 4ZAKB 2GQHA 2E8YA 3BPCB 3MV01 1IVLA 4RGOL 3DO7A 3AM8C 2W65B 4MYWB 4M6NL 4C57C 3T77A 4TUJB 1T5WB 4OCLC 1YPZA 1MRFH 5CJ5A 2R4SL 4K23L 2BNRE 1L0YA 3V52H 1UADC 3QDJD 4NQDD 4APQB 3CXDH 2BHYA 1HHJB 1UCBL 1T66D 4H26B 3BRGC 1JGLL 1DE4B 1FH5L 1WC7A 2FYYB 3VMNA 4C4KT 3K0WA 4HH9A 2V5RA 1T2QH 1U8NA 4UIKH 4HKJA 3KPMA 2NPLX 1CDJA 4G6JL 5K9JL 3SE9H 25C8L 2FWOB 3RWJB 1HXYA 4LCCC 4HFWB 1XH3A 2AJXL 5IWLC 5F6IB 1MCRA 3C2AL 1GZPA 1U8JB 3S96A 5I1EH 2AGJH 5L2KB 5IB3B 3VGAB 1FFOB 5KSVA 2H6PA 1V05A 2BJML 5DRNA 5FHAL 5F1IA 4I2XB 1P7QB 1T3FA 2AI0H 1EXUA 3G6DL 3BKYL 4DKDC 1BJMA 4LPCA 4ZNEE 1GPOH 1OB1B 5C0GA 4ZTOL 2X5PA 4JFFA 4UT9H 5EORH 1CQKA 3MRIA 4LCWA 4ZS7H 3NTCH 5CSGA 2N1KA 1W8NA 3VRLF 4F7MA 4EDWH 1QRKA 2A6JB 3UC0L 2V6HA 1PJ9A 3BVNB 4XVJH 3W0WD 4NNYB 3HC3H 3MX0A 4EI5B 4PJBF 3F12B 4N8VG 1FFNB 1AR2A 1NUFA 2FX9L 4M1GL 4K2UL 2NY6D 4DW2L 4NNXB 4M7KL 1R3IL 1XF4A 3G6JA 4GBXC 3D2UA 1XF2A 1IAOB 2Q8AH 2AK1H 4LLYA 1GHFL 2YD6A 3WIHH 1J05B 4LPYA 4NKIH 1TJIH 3GMRB 3WFEL 3CUPA 5H2BB 4ALAL 4PGZA 2MQ3A 1OARH 4UDTA 5CEZD 3REVA 1FNSH 1C08B 5C0AD 5CGTA 1SMAA 4MJ6B 5IHUH 3ZL4L 2X4PB 3JWOH 1NGXB 1OSZB 1YNLH 2ZNXA 4L4VD 5E1HB 4CKVX 3DX6A 3TLRA 2FX7L 3M1BA 1JHTA 4NO3B 3GSNH 4MHHI 2G5RA 4ENED 4NRYA 1YMHB 5TDPA 1J86A 4JFQA 1HINL 3AREC 3E6FA 3G04A 3LDBB 2HKHH 4JJ5A 1IGMH 4GRLB 2CDEB 3SDCB 3FTGA 4ZXBD 3WO4C 5H35A 5HHQB 5E5MB 2NY7H 3RX7A 5KN5B 3ARDD 2GITA 4U7MA 3GBNL 2C4XA 1HNFA 1ZKAA 2P8MB 4HMCA 5EU6B 5JW4R 5JUEL 2DQDH 4RFNC 3VU2A 5HDLA 2EECA 4DUWA 4OQ1A 1A7QH 3BKJL 4PP1C 4DGVH 2IAMD 5CD5D 3EBAA 3LIZL 1F4WH 1QHOA 4BQCA 1VSCA 3IFLL 1HIML 2R39A 2BY0A 15C8H 3IDUA 3PGFL 4GW5A 5FGCE 2HT2D 4S1QH 1CF8L 3INUL 1V7NL 3BSZL 3MODH 2VSCA 3ES6A 3VXTB 5INCA 5J6HA 2E9WA 2QQNH 2IALA 4LSDA 5T5NG 3QNYA 3L1OH 1MCWM 1RJYA 2PUQT 1A9BB 3AMKA 3FN3A 4YDKH 2CR3A 5D2NC 5KS9B 5JO5A 1T1YA 2PYFA 2DTMH 2DF3A 4D2NA 5E6IC 4FQJL 3QIUA 4ZO6A 2XFXA 2WIIA 4ZOBA 5EC1A 3VFTB 4ZO7A 5EO1B 4YHYC 3FT4A 5ID0A 3MCG1 2BNRA 2EIDA 4KRLB 3RVVC 4PGCA 2CIKA 5IKCA 4ENEC 2R56H 4O00A 1A4KB 5EA0H 3WIHA 1R0AH 3V6BR 3OR6A 3PGCA 3SDXE 5B39A 3CX5J 12E8L 1NUNB 2D0HA 2QQQA 2BMKA 4D8PB 2D4DA 4JGJA 2LTQB 5SX4I 4ZFZB 4XTRC 5SX5K 5EBGA 1IILE 3VXSD 3HNVL 5IEKA 2AEWA 3JTTB 4KI5D 1A8JH 2C1PA 4K3DH 5AEAA 2O5YH 2DMCA 2JJWA 4WTWA 3WYRA 3AGVA 4UT7L 4YDJB 4NO0D 4Z78A 4GW4B 4KJYB 1XR8B 4FMKA 3RWFA 3ZKSD 2HVKA 1CDIA 1VFAA 3EOAA 1AY1H 3VCLA 4JGUA 1S7SA 2JLLA 4OUUA 1ZGLB 3ARGA 5GSVA 5EO9B 2PXYA 4XCCL 4EVNA 4GBXB 1FL5B 5GIRA 3LV3B 4ZNEA 2F9BT 1JPFA 3CMGA 3RIAF 2HT2C 3RY5A 3O8XD 3QPXH 4V2CB 3TT1L 5GPRA 3PL6D 2HT4D 5DVMA 2CGRH 1KPUB 3O3AB 4L8DA 3QUYD 1NGWB 2OJZL 3EGSA 4P2OA 2QADC 3HI6L 3SKUD 3AU1B 3LRSA 2Q7YB 3VWJD 1UWEL 5F1KC 3V6OE 3QDGE 1U58B 2QSVA 1QSEE 4DUXA 1A1MA 2JIXA 1CFVH 5CKGA 1UJTA 5EBLA 3RTQA 4LEOB 1A6TB 4ETQA 5KAQG 1MIEH 1R3LB 3MJ8A 2FL5A 1HI6B 3P4OB 2VC2L 5DTFB 1CGUA 4HX1A 3AREB 4YFLI 2XV6B 1JNHA 5D7SH 1GIGH 2WUCL 3GIVB 4HFUL 3RGVA 1XAUA 4JY4B 3GMNA 2YR3A 4AY0A 7CGTA 1GC1C 4R7NB 4YBHA 5KS9F 3CK0L 5EOCH 2X4SA 4YK4C 5TF1H 3CLFL 3FB5B 4K55A 1BMGA 5FKAB 2YA2A 3TNNA 2N7AA 4HGMA 3F6LA 5FUZL 1I1RA 5I66B 1LO4H 5DJYA 1BZ9B 4U1LB 3TWCH 3VFMA 2K7PA 5T3ZD 3C5ZC 1A6AA 1QA9B 2HRLA 4KI5C 5HHXH 1EJOL 4FTVE 5HHMB 5IM7B 4G9FB 5E4IA 3OAZH 1OAQL 2IG2L 1RZ8B 1PZUB 5BVPH 1HH9A 2NY2C 2AERT 4NCC2 1D5MB 5F1NB 2DQEL 3JV4A 1MWAH 4GW1A 2X7LA 1NCUA 3IJHB 4JFXA 2R2BB 4TYUA 3BP5A 1UH2A 4URTB 4HS6A 3F7VA 1GZQA 1S9WB 4LCYA 5IW6A 3MV9E 3O8XC 4ODSH 2XQBH 4R4BB 1V3LA 3DVIA 4QXTB 4RZCB 5IR1A 3RKPA 4XMLH 3TJEL 2Q1EA 5T1DH 1CGYA 3KJ6H 3VFVA 4QT5A 5E6IB 1W8OA 1FZMB 4KRPD 2X10A 2WZPD 3ILPA 3MLXL 2VWEE 2YS4A 3BP4B 2YEZA 3DETC 1CICA 5IOPB 1YEDA 2C3WA 4XI5C 1MY5A 3GSQA 1EAPA 4ZODA 3UTQA 1JPTH 1BVLA 4O2EA 5EWIL 3V79C 4YZFE 5K59E 1M05B 5KZCD 5KVDH 3B83A 5LJYH 4YHLL 5I1IH 2WIMA 1GCFA 1UACL 5LCVH 2EXYD 4EN3D 3VA6A 3T2QA 1LEIB 1S9YB 4JM4H 4CDHA 5E6YA 3MACH 2D31A 2IFGA 4FZEL 1SJHA 5KG9A 2ZOKA 1VB9A 2I26N 1P5VA 3B5TA 3FRUA 3GB7A 3NCYP 2MCPH 3W39A 3O9WA 4FNLH 1X5AA 5CEZL 1DBML 4YNYA 5CBEB 4OBSA 4X8XA 4S0SD 3AAZA 1TVHB 4RWHA 3WS3B 2DKMA 5CGYC 3IDNB 1B4JL 4JPWL 3ET9F 4XAKE 5D1XC 3SDXA 3DUSA 5FHBL 1DFBH 2H32H 5I76A 1SYSB 3DX9A 3VGHA 5CZKA 4XBEH 1UXWB 1LK3H 3H7BA 4MNQE 2LAGB 1XZ0A 2YBRB 4ORGB 3V4UL 2P5WB 4ELMB 2QADB 3TJHD 3ZYJA 1TTUA 4TSAL 1KLGA 2AV7A 3EFDL 2Q76A 1A0QH 1V7ML 4JRWA 5F6HI 3C6SA 4N9GA 4MD0A 3JWDC 3PWVA 3SDAD 1U8MB 1LO2L 5M95B 4HUXA 1DVFC 4YHML 4Q7DA 3AXLB 5IMOA 1MWAA 4JR9H 5E2WL 3C5JB 5DGRA 4NM8H 3UO1H 2XZAL 4KKNA 1O5DT 3OKLB 1QRND 1P4IH 4MQ7A 3FZUD 3SHSA 3M17A 4ZPVB 4YK4B 1F4YL 3B2UD 5HGDA 2Z4QA 5E00A 1JGEA 1E0OB 2V2TB 2NR6D 2WAHA 4ZD3H 4Y4HD 2EXYC 4MCYB 3LEYH 4RGNB 3V6OA 3GO1H 1QSEA 3HE6D 4XBPB 2BDNH 4I3RL 4NO5B 1MJ7L 3C5ZB 1PEWA 2DIJA 2MSPA 1QKZL 4GAJL 1FYTD 1DQDH 1A7PL 3MRNB 4JG0L 3QNXA 3U0TA 3OWEA 4LAJH 4GQ9H 4TUKH 3IAPA 2DQIH 2X09A 1FZKB 3RPIA 2NY2B 2FB4L 5IFHH 2BSSB 3LH2H 4RSVA 1NJ9A 4LLWB 1K2DB 3PWPD 1MREL 3O4OC 4XAWL 5EDXA 5DC0A 3VFGL 4F7PA 2BERA 3HTLX 4NQEB 2VLLB 4ZQKB 1KIQB 5FB8B 5T3XE 4PPTA 2IADA 4AIXA 1RUQH 4C56B 1HNGA 3QDHA 4NOFA 3NCCB 1HHHA 2FBJL 1II4E 4M1CD 3U9UB 2VISB 2FJGA 3MLTB 1HHGA 2FECL 1G0XA 3FAWA 5DJAA 2OBGA 4IIQC 4R96A 4FTVA 3QUXA 3WFZA 2LV4A 5D1QA 3NPSC 5HI4D 1U8PA 1KBGL 4OTXH 2H32A 4YHZH 1A6WH 4GKSB 3FOLA 3NCJH 1HSAA 4ELMF 2DWDB 2X4UA 4QCIA 4WO4D 1WK0A 1OAUH 1T2JA 1MI5A 1YEGH 3MV9A 4P5TC 4YPGB 4WV1A 3HR6A 2F74B 3JV6B 1I3GH 2P24B 1LDPH 1QFPA 1DDHA 4XX1E 4A6YB 1SEBB 3QEGL 4P2QE 4YDIL 4BFGA 1FL3A 2VITB 3Q6GH 1P84K 3W9EA 5FKPA 4WY7L 1VFMA 2V5SA 2BVEA 2Y5TB 2QR0A 3MMEA 1N59B 4XGZA 2XG5A 2PCPA 1IFHL 2FLBT 4L4TB 1G7HB 2GK0A 3LS4L 3CVIL 2XN9B 5EC2B 5MEND 8FABB 2D9CA 1I3RB 3C6LD 1LEGA 4LFHD 1INDH 3ABZA 4W4NA 2WBWB 5DJ8A 2EH8L 1EEUA 2P7TA 5D1XB 3DXAE 3HC4L 4MDJA 1CIUA 1BD2E 1KJ2H 5DEFA 4HW6A 4LVEA 2WP3O 1AHWC 5TFSH 3IFNH 1DUYB 3D3VE 2L4OA 2CD0A 1TDQA 1EMTL 4R90L 3T0EE 1QSZA 4O5LH 3I6KA 5T3XH 1KYOK 1MRDL 4F7TB 3MA9L 3OJDA 4HWEH 3FN0L 4Z7UB 5CEYA 3EO0A 5E6ZA 4OLUL 1TPXC 3S37H 2R0ZL 1M71B 4A6YL 5ID1B 3X11B 3Q48A 3OKMA 1ORQA 4LGRB 1N5AB 1DVFB 3SKMB 1EHLH 4PRIE 3QQ3A 4PJCE 5I75B 3L5HA 4QHUA 2HVJB 1K4CA 5DA4A 3G5XA 5JHDE 4Z6AT 2YRPA 5HI4C 5EUOE 1MF2H 3CFDA 3DTXA 3QEUA 4IMLB 1Y6MR 3GSXA 4XPBL 4MNQA 1NC2D 4MHHG 3HMXH 4GSDH 1ONQB 4X6EB 2X4TA 4WDIA 4ONFL 1LP9E 4YIQA 5JOPD 2C5DC 3RDTC 3TN0C 3DVFA 1OOAA 2QBWA 4BH8B 3DSFH 3DUUA 4N8VB 4UNVA 1Z3GL 2AK4B 1KCVL 4OZIE 4EOWL 1G7MA 3VXUE 3JWDL 4HG4J 3QJFB 3BD3A 1I9JL 4NHCH 4JPIA 3O4OB 1WFOA 5SWZD 1JRHI 4DN3H 4CU8A 4HS3A 4YUEL 1B4RA 3WFDH 1I85C 2A9NH 3GK8L 4JFEB 5BJTB 5BW7C 1ADQA 3EZ8A 4LRIC 4Y19B 2Z35A 3HZVB 4OZFG 5JIIA 3UJTL 5F44A 3BGMB 3NFSH 5J1AA 1R3JA 2F19H 4QTHB 2D9QB 5GS2H 5HHPA 2ICWA 3H9SD 4BH7A 5E99H 3M8OH 2M2DA 3L9RA 4E41D 4X6BA 2VABA 5I1DA 3KWWB 1E6OL 1NLDL 5FYJD 3Q6FB 4QXGH 4WHYG 3P77B 2ZCHL 3NPSB 3SQBA 3KYNB 2MOVA 3I6LE 1KJ2A 2KDGA 4U1JA 4LF3A 1A6UH 1Y6NR 1I7ZA 4D0BA 5IVOA 5FUOH 1NCBL 2NXZC 2Q8BH 4YX2H 1T0NB 4Z7UF 4P3WA 3SKNB 4P5TB 4MX7B 5GJTL 3W82A 1W2KT 3UROR 2H3NB 1RZKH 1PAMA 3Q5OA 5C0EA 1WTLA 5ACMA 1IGYB 1GGIH 4CNIA 4QRPD 5KVMC 3T3MF 5SX5H 2XY2A 5A2FA 1HZHH 3V9FA 4IDJL 1MY7A 5KSBB 1IGJB 3HUJB 1F8TH 3MRMA 1YMME 3DVNB 3VFPB 4I48A 5HYSB 4AQ1B 1A22B 2RFXA 4OT1H 5I0ZA 1U91B 2IPTH 4ODUB 1N6QH 4Y2OA 5GZNC 3LKNB 4FFVD 2P4AB 1XCQA 5BQ7A 1S7XB 5ENWB 1QLFA 1BFSA 1W0WB 5I1GL 2A6DB 1FAIH 1LO0H 1FRGH 1G0DA 1UH4A 4P2QA 5BMFL 3TBVA 3ZE0E 3LQMA 5B22A 4X4YB 5E9DD 3L3GB 3ZKND 4MAYC 3AB0C 4H88L 1WCBB 5DD5H 1D5IH 3BZEB 5LGKA 1U6AH 1PQZB 4HGKC 1YNTA 1JNJA 3LEXB 1JGVH 3TZVD 4JFOA 4EJ1C 5HVHC 2DQTL 4UILH 4JQIL 3DXAA 1BD2A 2C3VA 2NY1D 1J12A 4K9EC 4Q97A 2IMNA 3DI2B 3D3VA 4XNQB 4XPGH 3T0EA 1FFQA 5F6HJ 3MBEC 1XGPB 3QEQB 1UENA 3BIBX 5I1KH 1DN2A 1F6AB 5LWYH 1RJLB 2HKFL 3JVGC 3RDTB 5IHZB 4JZOB 4NZJA 4DTGL 3TN0B 5I8EA 1Z6JT 4BFBD 2DQGL 1IM9B 5C0DB 4XMPL 1D9KD 4PRIA 2BVQB 3P11L 1YJDH 4PJCA 2APXA 3RWEB 5B8CB 2VDOH 1WBXA 1NGPL 4NKMB 5JHDA 3GSRA 3ULUD 4ZUVA 2WANA 3QCTL 3UTPE 4OIIH 1WWCA 4Y4KC 3BZFB 5EUOA 3UMTA 5DRWB 1DL7H 5FYKE 1BEYL 3DVGB 3UTZB 1K8IB 4EBQL 2ADJA 5IESH 5DMYA 3LZFH 2V17L 1LP9A 5KSBF 3HUJF 5IB4A 3EYSL 4JY6A 2FHCA 3RVWD 4PJXE 5ICYA 5GSRB 4H1LG 1DUZA 3TYGL 1Q72H 2X70B 4HZLB 4JFDD 3RKDD 3ZKNC 2JCCE 4OZIA 2XPGA 2R23A 1I8MB 3CDGA 3PF2A 2ICWI 3VXUA 4MGXA 3O2DH 3ZHKA 5BRZB 3TCLA 4F7EB 5ACZA 5IMLA 1XF5B 1LE9B 5B3NA 2VLKE 1VGEH 2NY3C 2XKUA 3VW3H 1EO5A 4IRZL 4BELD 5B3JE 4FQXC 2XWJA 5DJ0A 5J11C 5FOBA 2ZUUA 4UV4L 4L9LB 4WIQA 3DGGB 4BZ1H 2O5ZL 3QO0B 4N0UE 5D96C 1SJEA 4W81A 1F42A 2VDML 1IGIL 4FP8L 5BZDB 3EYFB 3RWGA 5CSBA 3S37X 3TBSB 1JWSA 2VB5A 1FVCA 4U31A 3S4SB 4XCNB 5DWUH 4DUVA 5L2JB 3GI9H 1P4BL 1LD9B 4OFVA 2Y25A 5H94B 4F15C 4I77L 1E4WH 4ZYKA 4UUJB 1U2HA 5HYEA 4LLUA 1Q9OB 3T2OA 5MEPB 2VLMD 5B39G 5DZNA 4JPKH 1YN7B 5IGXL 1KTRL 2BSTA 1YZZA 3BYTA 1BREA 2JELH 1Z0NA 2X4NB 5AZ2H 3MC0A 4Y88A 5HHVH 5AYUL 2BVPA 3OKDA 5FYKH 1KCRH 3MLWL 3I02B 3SGKC 4G42A 3N9GL 2ESVE 2VN7A 3BDYH 3CU1A 4G8GD 5AZEL 4J4PC 4MAYB 4OM0H 3AB0B 3MQIA 5TE4L 5IMMB 2VUYA 3QHZH 1S9VB 3RVWC 1YMMA 1CDHA 1HHIB 3V0VA 5EU7E 2RHEA 3MCLH 2ADIB 1P5UA 1U3HA 1ZANL 2GUOB 4ISVB 2FIKB 2G9HA 1F3DH 5HVHB 5D8JL 1ED3A 3ZE2E 3VRJB 5T1LB 1FNGA 4XNYL 1G9ML 4AEIH 1EDQA 4PB0H 3C60A 1QBLL 3FO0L 5HHOE 1LVEA 5EOCJ 4X7SL 1I9IL 3EOYG 5DD0L 5J3HC 2R2HB 3EUUA 1IARB 4S0TD 1FNFA 3B9DA 4WI9A 1B0GA 3MBEB 3QULA 1RZ7H 5ANMB 3L7FA 1N3NB 3TBTA 1JYNA 3QDME 2P5EE 5F89B 3R0NA 4X4XB 3CVHH 1VEPA 4BKLB 2VL5B 3CLEH 2ILLA 5JR1H 4OCNC 5KAQF 4PJ5B 3HZKA 1JFQL 4Z18A 1FNEB 3KYMA 3ARFD 4XP4H 3VG9C 3LMJH 3CAFA 2GY7B 3SDCD 1VFUA 1J8HB 2WBJA 1RIVL 3S36X 3O2DA 3ARVA 2OX5A 4YHIA 3O3EB 4L8SA 3CFBA 4X99B 3CFCH 2QV2A 3UZVB 3EO1B 4PRBA 2G60L 3RUGE 4XBGB 3OMZA 4Y4KB 1QSFB 4KTDL 4HIEB 5FXCH 3LKRA 2YZ1A 3F5WA 5H37G 2Y5EA 4L3AA 4BZYA 1BZ7B 2SEBB 4Q9QL 1EPFA 1X7QA 2BNQE 2Q6WA 4UOW1 4NZRH 3WLBB 3QQ9D 4UI2A 1TETH 3QIWB 5DURB 2X6MA 4WFGD 2DQCH 4HEPG 4OCXL 1T03L 3QWRD 1WQVT 3D9AL 4JKPL 1KB5H 3U7WL 1F5WA 5DHVB 4O2FB 2VR4A 3R06A 1T5XB 4FXKB 1NGZA 4LHUB 5HYIA 3NVQA 5J13C 4OZHE 2IBBA 4I3SL 2DKSA 3MV8D 3GMPB 3WS6A 1GGBL 2PYEE 3HMWH 2FJHB 4J3UA 3EOTL 3KDMB 4S2SA 1CLOH 1OTTD 3QR2A 1NFIB 5DFVD 5J11B 4MA8L 2B0SL 7FABL 4M1DL 4NJ9H 2PTVA 2WQRA 1RIUL 2EICA 2R4RH 5C07B 4PJXA 1Q9LA 5KW9H 3OR7B 2R2CA 5F9OL 4NUJB 2Y9RT 2JCCA 3LN4A 1FV1B 3I2CL 3L5XH 1OHQA 5TDNA 2Y06L 5AYQA 5ETUB 4PJHB 3EYVB 3O6FD 3GMLA 2V5MA 1UM6L 4PJDE 3IU4H 4QRQA 3QG6B 5ESQA 3MV7E 4G7YL 1VESA 2OR7A 4PBWD 1TZIB 2VLKA 3OQ3B 4Z5RB 1OP5H 5EIIB 5GJSL 4JO3H 2R1XA 4MA1C 5GGQL 3B2VL 1CL7H 4J2XA 3N1MC 5TH2B 1CD0A 2A83A 1E4XH 4OLWL 5L88H 3CVHA 2GK2A 3DV4A 4N0UA 1KCUH 3VGBA 4PY7A 4P5KB 1QFHA 5BVJB 3M45A 5I8OH 2ID5A 5FDWB 4LARL 4L3EB 5DMKB 1RQ5A 2DRUA 4HWZB 2HLFC 4Z0BH 3DYPA 3X3GL 1V8HA 1CFSB 3ZKXB 3RWCA 5F7DB 1MHEB 3FQNA 1IC7H 3TBWA 2MNUA 1L7IH 2VAJA 4UU9B 3U7YL 3BZ4A 4MB5A 5J89A 4RAUB 1KPRA 2FJFA 3PIQA 4KV5E 3QPQD 3QUZA 2ESVA 3HPLA 4NKDB 3ULUL 1OAXH 4LDOB 1FIGL 4C55A 3V7AG 1MELA 3ARWA 1UYWL 2EDFA 3VG9B 1KB5A 3TFKD 2VXQL 4P9HH 5C0BE 4JRYD 1OTUC 5JDSA 3T2NH 2BRRH 5C0NC 1MVUB 3MNZB 2FGWL 3WEXA 4OFPA 2J8UE 2XNAA 3L3KB 5FGSA 3TIEB 5ICXA 1NC4D 9CGTA 5HD8D 3TA3D 5HHOA 2NX5B 2I07B 3O6FC 4PRDA 1P7KA 1U8OA 1X4XA 4NWTL 5MI0C 1UM5H 3X17A 3PWNB 1A3LH 3RZCA 3MRDB 3QDMA 2P5EA 1F2XK 2V2XB 4PRHB 1MCLA 2R2EB 3NFPA 4LL9A 1XGTA 4DKEL 5DUBB 1NMCC 5GGUA 1WBYA 2Q3AA 4DWHA 4LVHC 2F58H 3RVTC 4PJHF 3TVMA 3IVKA 4YDVB 4QRTB 1F6FB 2B1HH 1PY4A 3RNQB 1FHGA 1T22B 1INEL 5JA8B 1NUDA 1QP1A 4QF1A 4OCSL 3A0OA 3FOMB 1AGDB 4AENB 3U2SB 3HNTH 3OAUH 4LU5H 4EIZC 5C6WH 4HAFA 5GRJH 2XKNA 1RU9H 4NSKA 1RZIB 1MNUH 3KLAB 5FA4A 5C0RL 4P2RD 4Y7MA 3V7MA 1MCQA 5IF0A 5EBMA 3B5HA 2YPVL 3FB8B 2DYPD 5LVEA 3RNKB 3UJJH 4XVSL 4QKXB 3PWJB 3MJ7A 2ICWJ 2VR9A 3MYZA 5GISL 2BSRB 1ZLWH 1T89A 4R0LB 4QXUH 4TUOB 1AR1C 3BGFC 2EYSB 3VD9A 4X4ME 1BGXL 2J88H 1ZT7B 4M61B 3IXTA 4NQXB 4YFDB 2C1OB 2QSQA 3GFUA 4IJ3C 4S11A 4OZHA 5F7KC 4L8CB 5DQJA 3O6LL 2PYEA 3MOAH 5T33L 1U8KA 4S10A 3AFLA 2VERN 5DS8B 3U0WL 3U36A 3VGFA 4MA1B 2HMIC 4LIQL 1M6OB 2R0LL 5HD8C 5IB1A 3TA3C 5EFIA 4WU7B 2FCBA 5JXAH 3CCHA 2EIZB 2XACC 2HTLD 3MGOA 2MCG1 4LDLB 1KENL 3WHE0 3DO7B 1CTOA 4JM2A 5DD3L 1BF2A 3IFPA 4ZG1A 3OF6D 1K8DA 1FG9C 4HJ0D 4JB9L 2XRAL 2VDQH 4GO6B 2CK0L 4F8QA 4OFDA 1YPZB 4D3CH 2OTUA 4X7CC 1KB9K 3NOIA 4PJDA 2V9RA 4PGDB 3MV7A 2YKLH 2P5WD 5GGVH 2C3HA 4P9ML 1IC4H 4J3XA 5CJ8A 1WC7B 5F71A 1CZ8L 4HH9B 2R8SH 3ARYA 1U8NB 1QVOA 3SDDC 1UWGH 3KPMB 4HKJB 4PLKD 2F54E 2IH1A 1OPGH 3UBXA 2AQ1A 5T1MB 3ULVF 1HXYB 2J8HA 4AEHH 4HKZA 1XH3B 2YPLE 1GZPB 3IDXH 3TNMA 3S96B 5JOFA 3CXHJ 2IBZY 2XZCH 1AIFA 5KSVB 2H6PB 1X5FA 5DRNB 5F1IB 1T3FB 1EXUB 1CR9L 4NNPH 1J87A 4M8QA 1Q1JH 5C0GB 2EDHA 4RGND 4JFFB 4PLJD 1M7DA 4UQ2A 3MRIB 3OB0K 1GGTA 3RAJH 1IKFH 4X6CE 1B6UA 3HRZA 3NGBB 5DQ9A 4F7MB 4CADA 5F9JA 1NMCB 3JWOC 4RGOH 1ZE3C 4ONOA 1U3JA 4NC1E 2Y72A 5C0BA 3U9PL 5CLTA 4JDZA 2VXSL 1XR9A 5J7CC 4LSRL 2CPCA 1GGCL 2J8UA 3R0MA 2XTJE 2R4SH 4K23H 3ALXA 4MZ3A 1OGTA 3ARGC 1XF4B 3G6JB 2D0GA 1MJUH 3D2UB 4RMWA 1XF2B 4LAQL 4LLYB 5J0BA 1NL0H 1TENA 3WHXA 4IOFD 4Z7WE 1UCBH 2WUBL 1WFNA 2Z31D 3CUPB 3QXAA 2NW3A 3DMMC 3UTOA 3C8HA 1FH5H 4HIHB 1AQDA 4J23A 4UDTB 5SV3A 2NXYC 2EEAA 3DRQA 3REVB 1YPZF 4XH2A 4C54A 2B4CL 4D94A 2E9IA 4G6KL 1E4XI 5D72L 1NCAL 4G6JH 5K9JH 3BWAB 25C8H 3DX6B 4PLKC 1JHTB 3S7GA 4POYA 3BGFB 4NRYB 2AJXH 3VI3F 1PSKL 4DVRL 5TDPB 4JFQB 3CNKA 1TVBA 3C2AH 1ZVSA 1J0YA 3G04B 3E6FB 2W38A 2IBGA 2DD8L 1UC6A 4IJ3B 2BOBA 3DBXB 5FHAH 2BJMH 3FTGB 4PBVC 2DIAA 3G6DH 4PLNC 5H35B 3BKYH 1KCSL 5CD3A 3I6GA 3VRIA 4ZTOH 4U05A 2VJXA 3HAEH 3S35L 2GITB 5J06A 3LN5A 4XPAL 1Y0LA 4L4TD 4R2GC 5CWSA 5DD1L 4CAGA 1TNNA 1WSST 3N06B 5FGBA 4ODVL 4UBDD 2ARJA 3IKCA 4KKLC 1IAMA 1KUMA 2OCFD 4RIRB 1CIDA 3ZDXE 3OXRA 4X4MA 5FA3A 4M1GH 2FX9H 4K2UH 1HWGB 5I1JL 4GW5B 5ISZE 1C1EL 1GXEA 1MRFL 4CN6A 2RAMA 4DW2H 2IQAA 4M7KH 1R3IH 3VI4F 3ES6B 5INCB 3V52L 2IC2A 2IALB 4KMQA 1GHFH 1U93A 3QNYB 4Y16A 3WFEH 2BVYA 5D9SA 1AXTL 2WM0A 4XX1G 1RJYB 2NY4C 4ALAH 3SDDB 5JO5B 1T1YB 5JMRA 1T2QL 2PYFB 1CDBA 4UIKL 2FH6A 3KPNA 3RVXC 3ZL4H 2EXWC 3QIUB 2XFXB 1C5CL 1K3IA 4NQTA 2WIIB 3G6JF 5EC1B 3SE9L 2FX7H 1ZK9A 4JLRA 1HYSC 3FT4B 5ID0B 5D93C 1DSFL 3F7YB 4RMRA 2BNRB 3UBXI 1HINH 4PGCB 2CIKB 5IKCB 1X5XA 5I1EL 2AGJL 2EO9A 3VD3A 2L0DA 2FSEA 3OR6B 3PGCB 4BA8A 4C4KO 5B39B 3VH8A 3HS0A 1QR4A 5HTSA 2BMKB 4AH2A 4TOYL 4YFLF 1CVSC 3RVUD 1JF6A 3MRGA 3GBNH 2F54A 1MQ8A 5IEKB 2OJEA 5BOPA 2QQKL 2C1PB 4YGVB 5JUEH 2FX8L 2VMFA 1UB5A 3GSNB 3MNVB 3PP3H 4Y4FC 4HK3N 2ORBL 2D7NA 4Z78B 1CXKA 2W65A 3BKJH 2YPLA 3RWFB 2HVKB 1VFAB 4XVJL 3LIZH 3EOAB 3LKOA 3O9WC 3VCLB 1FSKC 1S7SB 4HH8A 3IFLH 1HIMH 4IRJD 5AAWA 4OUUB 3ARGB 3PGFH 5GSVB 4TVSa 4EVNB 4Y19D 3KS0J 5E4EC 5GIRB 5A3ID 4F2MA 4HMEA 1CF8H 3INUH 1JPFB 3IDGA 3BSZH 5BOZG 3HAEA 2KZ1B 4U4BA 2DAVA 2FH8A 1S78D 4U1GC 4ZOCA 3H0TA 4NKIL 4L8DB 4X6CA 2R15A 4O58L 2NXYB 3EGSB 4P2OB 1RD6A 3LRSB 1QQDB 5AUMA 5I8CA 5EIVA 1OARL 1KGCD 3BESR 3OHXA 5FM8A 2W1NA 1A1MB 2JIXB 5EBLB 3T0WA 3I3EA 3RTQB 5CSZA 1UT9A 4FQJH 2GAZA 3QZWG 4ETQB 3JWOL 3MJ8B 1EFQA 2FWOA 4HX1B 1VERA 3STZA 1JNHB 3GSNL 5IV2A 3RI5F 4PTTA 4OCWL 4Y2DD 5IB5A 3GMNB 3SY0A 4Z7WA 1J7VR 1GJIA 2VQUA 1AGFA 12E8H 5D1ZA 3QYCA 1P7QA 3H7LA 2X4SB 2H26A 3I75A 4K3HA 3EKCA 2NY7L 3DI3B 5F7YC 4GKZA 3OGOE 3TNNB 4JJHA 2GSGB 4GKNA 5JDJA 4J6RH 3HNVH 3BPLC 5DJYB 3RGHA 4JFYA 3VFMB 2DKUA 1A6AB 5L8LB 1CI5A 1EVUA 4UT7H 3PE9A 3S88L 3L3OA 4UTBL 3HG1B 1A7QL 5TE6L 3WFHA 1F4WL 3ZSSA 3BH9A 1HH9B 1FFNA 3JV4B 4GUPA 4XCCH 2PO6A 4GW1B 2VLRD 2X7LB 3B9KD 4Y5VC 4L8BA 4IRJC 4JFXB 1IJ9A 3BP5B 4HS6B 3F7VB 1NBVH 1GZQB 4LCYB 5IW6B 4S1RL 3P9LA 2NY4B 4YR6A 1TQBC 5IR1B 1MEXL 1ZLUK 3LN9A 2OJZH 1PFCA 3HI6H 1L6XA 3IDJA 3KPRD 1UWEH 3VFVB 4QT5B 2XZQH 4LSQH 5K9OA 1AI1L 4KRMB 4OI7A 3ILPB 3EDJA 5MEQA 3MXVL 2YEZB 2BNUA 5D93B 2PW1A 3OV6A 2VC2H 4ZO9A 5FGCB 1YEDB 5ISZA 3WD5L 3GSQB 4NO3A 1CK0L 1EAPB 3Q1SL 2WUCH 3UTQB 4HFUH 2YC1A 3QEQD 1BVLB 2JJSA 4G9FE 4O2EB 3CSGA 4KPHL 5EA0L 1R0AL 4OKVA 5C2UB 2EC9T 2IGFL 3CK0H 3GMMA 2CKNA 4MS8C 1JHKL 2VSDA 3FQRA 4LHJB 2D31B 5J9PB 5FUZH 2PKDA 1EFXA 5DJZA 5ALBL 5HI5D 1SJHB 5KG9B 5J6GA 4F57L 4Y4FB 4FMFA 2ZOKB 2YD2A 5D2NE 3FRUB 3GB7B 2VWEC 3W39B 5CEZE 3IDIB 1EJOH 3O9WB 2Q86A 4N1CA 1FSKB 1FPTL 4KMLB 3AAZB 5FUCC 2IG2H 4Y1AD 5EUKA 1NFDE 5E4EB 3UYPA 4CVWA 5EOQL 2DQEH 3SDXB 4OF6A 3DUSB 5C0CD 3TBYA 4WUUB 2UY6A 2ZJSL 5I76B 4KDTA 3DX9B 2AJVL 3PHOA 3B9KC 4U1GB 3H7BB 1T83C 1XZ0B 4LPWA 4X5LA 3E1F1 1JJUA 4DEPC 4JG1L 4JHAL 1DTUA 2AV7B 2Q76B 4MXVF 4M02A 4X9IA 4N9GB 4MD0B 4DKFL 1I4FA 3PWVB 2KBGA 3EDKA 2YN3A 4HUXB 4YDLC 4WENB 1JV5A 1E4JA 2R1YA 3NN8A 3MLXH 2AJSL 4LCCA 3T65A 1OQXA 4M9PA 5IMOB 3B8SA 1MWAB 4W6WB 1H8NA 3TIDA 5EO1A 2LU3A 4D9RD 1U8HA 4LASL 4YE4L 2GKIA 3WBDA 4MQ7B 2V7HA 5JOEA 1NEZG 4YHLH 3M17B 1UACH 5HGDB 2Z4QB 5E00B 3RBGA 1JGEB 5DUPL 1Q0YL 4K7PY 3BPLB 1QSEB 4WGWB 2PW2A 3HB3D 4FZEH 4AQOA 5E94A 1BX2A 2C4FT 5B38G 4K3GA 1VFOA 3QNXB 3U0TB 1MCFA 4X5WA 5CEZH 4N0CD 1DBMH 3S34L 1XF1A 2R29H 4J3SA 4U1SA 1NJ9B 3BIKA 1B4JH 4JPWH 2B7DT 4LSPL 4M48L 5TJWK 3E6HB 4FG6D 5HYFA 2H9GA 5CEXA 1EV2E 3CFIC 1MJJB 1QBML 5FHBH 4F7PB 3K3QA 1RVFL 3LV3A 1F3JA 3DX8A 1H15A 2WQ8A 2IADB 1PKOA 4LCUA 5FYLD 5E8DH 1J8KA 3V4UH 1BJ1H 1HHHB 1IBGL 3O3AA 3RJDA 1I3VA 5JZ7D 2FJGB 4TSAH 3MUY1 1QPXA 3EFDH 1HHGB 4BUHA 1V7MH 2DOCA 5GRUL 4R96B 4FTVB 5C3LD 4R8WH 4PJIE 3QUXB 2M1KA 3SDXF 4MA3A 2JJTA 5D1QB 4KROD 4YHMH 4KI5E 1U8PB 1VKXB 4KVNL 4XCEA 4OZGF 1S5HA 5E2WH 2H32B 2ED8A 1JRHL 3ARBC 3GMQA 2XZAH 3FOLB 4M93C 1JPTL 1S7TA 1DLFL 1AFVL 2E6QA 2X4UB 4QCIB 5KVDL 3GBML 1MI5B 3P2TA 3MV9B 4WV1B 2VDNL 3GKWL 4P0DA 1JWMA 1F4YH 1DDHB 3IAQA 1CDCA 3MV11 5EZJA 5C08D 1FL3B 3F7QA 2YXFA 3W9EB 5MHSE 5FKPB 2GT9A 3ME0A 2QR0B 1MFCH 1OAKL 4XGZB 2PCPB 5IVNA 1MJ7H 4ONHA 5HVGB 4GAJH 1KLFA 1QKZH 2GK0B 4OGAD 1A7PH 4WRLA 3RL2A 4JG0H 1X5ZA 3LEVL 1ITCA 5F7LB 2ZWLT 4M7ZC 5DJ8B 2FB4H 4G9FA 4K7FA 2P7TB 3DRTA 2E6JA 4MDJB 1MREH 4XAWH 4J7RA 4N90D 5ALCL 3CX5K 2DLFL 3QIWD 3VFGH 1GH7A 1EJ6A 1Z5LB 1AE6L 3VXMD 4PB9L 3I6KB 4UV7L 3GSOB 3OJDB 4OV5A 5CEYB 4K3EL 3EO0B 2YMXL 1VACA 1P9MA 2FBJH 2J1KA 3IRPX 4LHUD 5D2NA 2YD5A 3OKMB 1LO3L 1ORQB 4TQEH 4LMQE 4ETYA 3QQ3B 1R5IB 4MNGE 1NFDA 4QHUB 1EHXA 1ACYL 1QYGL 1K4CB 3G5XB 2MQ0A 3K4DA 3O4LD 5F9AC 2FZ3A 4KROC 3UO1L 2OP4L 3ROOA 3CFDB 3T0EC 3DTXB 3QEUB 3GSXB 3KPSB 4MNQB 3MGTA 2X4TB 1OQOA 4WDIB 3U82B 1T7XA 4WNQB 3U4AA 3QEGH 4YIQB 1IM3A 4YDIH 4M5YL 3ZZ1A 2LQRA 4JRXD 3C2SA 4FFWC 4ZD3L 4WY7H 4HUNB 2BDNL 1IFHH 4QNPE 4A2LA 1G7MB 3CVIH 2DLEA 4KRNA 3K1DA 4KKAD 2FIRT 1JNNL 3BFOA 4JPIB 2EH8H 5CBEA 5IFHL 2IAMA 1P6AB 1T20A 4HS3B 3LH2L 5HYQA 3KG5A 2F8VA 1QFUH 1Y6KR 5T1KD 1QBBA 4KJPD 2P8LB 2E5EA 5DD6A 4R90H 1EMTH 4H0GA 2Z35B 3VGGA 1JP5A 2W9DL 3ZTNL 4X98A 5J1AB 1MRDH 3HE7D 1R3JB 1G9EA 4I4WA 3G08A 5HHPB 3MA9H 2ICWB 1EGJL 4BH7B 2Y6SD 3EZJB 4OLUH 1WWBX 1I7TA 2R0ZH 3RY6A 3L9RB 1S7WA 4X6BB 2VABB 5I1DB 4YZFF 5K59F 4XHJD 3VFSA 5DZLA 1DBKL 3UTSD 5DEGA 4KK6D 1KJ2B 4U1JB 4LF3B 3RIFK 4LP5A 1PW3A 1I7ZB 3ARBB 5IEHA 4D0BB 3AXLA 5DMJB 3OL2A 3Q5TA 3P0VL 1A6WL 1E27B 2I9TA 4XPBH 1A2YA 1MCCA 3MRBB 5C0EB 3S97C 2AXJA 4BQ9A 2APWA 4PJEE 3UBXG 4CNIB 4ONFH 1WIPA 4S1DD 2V2TA 1YN6A 4NN5C 1ZSDA 3U79A 1RK0A 3MRMB 4PJIA 3RWHA 1L6ZA 4I48B 3EJYC 1Z3GH 1KCVH 5FGRA 5I15L 4EOWH 2RFXB 2W92A 2OM5A 4M7ZB 3JWDH 4NJAL 1V3KA 2EYRA 1I9JH 4U6VL 4PRHD 1H3GA 3RU8L 4NO0A 5IW3A 1XCQB 5BQ7B 5A40E 1QLFB 1LK2A 4YUEH 4PY8I 4LGPB 3GK8H 4TRPL 2B1AH 4LSSL 4P2QB 3TBVB 3MRJA 3UJTH 5C6TL 3J8F7 3O8XA 1QRNE 3H2WA 3FQUB 2YN5A 1KEGL 3PL6A 4HCRH 4I9WD 2P44B 3FCTA 3QUYA 1YNTB 1JUFA 2CKBL 2JJVA 1XGYH 1F13A 2C7UA 1U3HC 5I71C 3VWJA 1NLDH 4JFOB 3FHAA 4GXUM 4FQCL 2YRLA 2ZCHH 4WI5A 1EHNA 1QLEH 3VXRD 1YYLL 1EHLL 1BD2B 2C3VB 3C60C 3QJHA 1FYTE 4KK6C 1NCBH 3T0EB 3D3VB 1L7TL 3DV6B 1I7RA 1BQLL 2CRMA 1KJVA 4PJ9C 3PJSA 5GJTH 4F80A 3P40A 4YJZL 2YUZA 1P1ZA 2EDBA 2Y23A 5D2LE 2Z9TA 2X4RA 3HMXL 1JYVA 4I0KA 5ITFA 5EN2A 5I8EB 3H3PL 1YYML 4IDJH 2WBJC 3WN5A 5GRYA 2A0LC 1FO0L 4PRIB 4EKXA 4MNGA 4PJCB 5FYLL 3DSFL 4MMZC 1WBXB 4L8SC 3W5MA 2I5YH 4M03A 5JHDB 3GSRB 4QOKD 2APFA 4ZUVB 1MFAL 1TXKA 5JMOC 1F58L 5EUOB 2AABL 2CO7B 3HN3A 4ZUTA 5D1XA 4OLYL 2ADJB 5I1GH 5E2UL 3VDCA 4MCZA 3QBTB 4XNUL 2VZOA 5JIPA 1LP9B 3ZYZA 5IB4B 4JY6B 4G43A 3EFFA 5BMFH 5ICYB 4UAOB 1OP3K 1PLGL 4F7TA 1ZLUH 4H88H 3WKML 3H42L 2HFFA 4OZIB 2XPGB 2R23B 3CDGB 3OJVC 1QZ1A 3VXUB 3S36L 3WUWG 5E7FA 2DQTH 4JQIH 3TCLB 5ACZB 5IMLB 4G8FA 2MQCA 4HUUA 4HGWA 5KBNC 2GYSA 5DJ0B 2XWJB 1HSBA 5FUOL 1HXMA 5IIEA 1CGSL 5MENE 5FOBB 1G84A 4KHXL 4CU7A 1X9QA 4V1DE 3CMOL 5CIPH 1JTPA 1WCQA 4MAUL 3DURA 3BRFA 2HKFH 2MWCA 4DTGH 3BE1L 1JWSB 4EN3A 1FVCB 3ZDZF 3ALWA 1HZHL 1V3JA 2DQGH 3NCYS 4JFFD 4Q0XL 1F8TL 4XMPH 4ZYKB 3P11H 4LCWD 4LLUB 5LBSL 1EUTA 1NGPH 4TPRH 1DBBL 3QCTH 2BSTB 1G7QA 3J7HA 1INQA 2RB8A 3QIBD 4GFTB 2ENSA 5ILTL 2A73A 3X3FH 1BEYH 2BVPB 2BVTA 5IK3A 4EBQH 2X89A 1GRWA 4G42B 4PJEA 4XZUA 2V17H 1FRGL 5DA0B 3EYSH 1VEOA 4XVUD 1CCZA 3TYGH 1YMMB 3VWKC 8CGTA 3B5GA 3V0VB 5DD5L 5C09E 4CVXA 4KTEH 3QAZC 1U3HB 4P3DA 1U6AL 1HHKA 3F7RA 4IIQA 5EUOF 2GFBA 1N5YL 1ED3B 1FNGB 1XGUA 2OQJA 4KDWA 3C60B 4M8VA 4KU1A 4JO2L 3SDAA 4AG4L 3D87B 1LP9F 3TP4A 3LSOA 1MFNA 4IRZH 1B0GB 1P69B 3QULB 4PJ9B 3PV6A 3A6BL 3OAYK 3L7FB 3TBTB 3PWLA 3QUZC 4UV4H 5E2JA 3TH2T 2O5ZH 4RGMC 4HSQA 1QRNA 4KH2A 4OZIF 3HZKB 1Q9KA 4FQ1L 1IGIH 1Q38A 5E8NA 1LE5A 2WBJB 5EU7C 5KVFL 3UAJC 3O2WL 4Y4HA 4YHIB 1P4BH 3SGJC 1IGJA 4L8SB 3CFBB 3HE6A 4I77H 4HUKB 2NY5L 1HWHB 1FVEA 4PRBB 2VDOL 3QWOA 5T5FL 1FYTA 3H9HA 5HGGS 3LKRB 3F5WB 1ZVHA 4R4NC 1OLZA 1X7QB 3RZCC 2Q6WB 1QACA 1MCOL 5CIPA 1S7XA 2MFNA 5AYUH 3QIBC 4LP4A 4MMXC 1AHWA 1CN4A 4OSUL 3MLWH 4JQXC 1W0WA 5D2LA 1A02N 3N9GH 5I9QC 1CLCA 3LZFL 5AZEH 4XP1L 5TE4H 3RJQB 4FN0A 2ZUVA 4FQHA 3QUML 5FYJU 3R06B 1JHLL 1RUAL 1KN4L 1NGZB 1ZANH 4QRPE 1KIRA 5D8JH 4HG4K 4WI3A 2GEEA 4XHQA 4XNYH 1G9MH 1KV3A 1QBLH 2CUMA 4CJ1A 2PR4H 1G0YR 4S2SB 4X7SH 2W0PA 1A1NB 3ALPA 1JNLL 1I9IH 2EDDA 5DD0H 4CMMA 1A64A 3IGAA 3W11D 2XKSA 4P5MA 4NYLA 4WW2A 4PJXB 1XGPA 1Q9LB 4YHPA 3V5HB 4QHKI 1J1XL 4WO4A 1JFQH 1T89C 5DRXA 3X13A 5B38B 2JCCB 4J1UA 3LN4B 1RIVH 1ZOXA 2FATL 5TDNB 3C8KA 4OFKA 1MCWW 1JF5A 1BOGA 4L1HA 3GI9L 3GMLB 3WV0A 4WFED 4QRQB 4JY5L 5ESQB 2VLKB 5JHLL 4FQIL 2G60H 3ZE0F 4NZTL 2R1XB 1AGCA 1LILA 4AM0A 5MENA 3RI5K 5EH1A 2BK8A 4Q9QH 4JO4H 1ZHNA 3CVHB 3DV4B 1I85A 4N0UB 4PY7B 4V1DA 5BW7A 4JM2C 5DSCA 3DVGA 1KCRL 3UTZA 3HC0A 3WDIA 5HDBF 2PXYD 3HNSL 1CLYL 2DQUL 4NDMA 1HH6A 5C9KA 1F6LL 4OCXH 1T03H 4RNRA 1RURL 1ND0A 5DMIL 3D9AH 1KULA 4HPOL 4OV6F 3RWCB 3QAZB 3U7WH 2ZKHL 2D4FA 2ZUSA 3FQNB 4PY8J 3MXWL 1G7PA 3TBWB 5F9WB 3BRDA 4WI4A 3ZTJH 3P4NB 4I3SH 1N6UA 4O4YL 1A7NH 1QFWM 4AEIL 2W0FA 1KPRB 4KZDH 3EOTH 2JIXD 2FJFB 1N2RB 3PIQB 1LE9A 1QTYT 2B0SH 2EC9U 3O3DA 7FABH 2P42B 3QUZB 4M1DH 2ESVB 3ULUE 2UZYB 1RZ7L 4J3VA 1ZHKA 5F7HA 1JYWA 4BSVA 4PD4J 2ICES 3G5ZA 3RGVD 5IFAL 3BUTA 4XWOC 4G5ZL 1KB5B 4F58L 5F9OH 4GJTB 5JDSB 5C09A 5FEBA 4MJID 2VLJD 4NC2B 3WEXB 4PS4L 4GG8A 3MLRH 1AH1A 2XNAB 3I2CH 1MCJA 2Y06H 4KJWD 3JXAA 3KXFD 1UM6H 3T4AA 5HHOB 3CFCL 1FL6A 1XFPA 2CRYA 4G7YH 4JFDE 4PRDB 1P7KB 1U8OB 2LU7A 5GJSH 4PJXF 5GGQH 4TTGA 3RZCB 1YUHA 1ACZA 1BJ1J 2FEDD 3PDGA 3QDMB 2P5EB 4OLWH 3NFPB 5IB2A 4OGZA 1XGTB 1TTGA 5IMKA 5GGUB 2JCCF 3LKPA 1LMKA 1YEJL 5I9QB 3V0WL 1IEAA 2OI9C 4ZS6D 3VXNA 4LARH 5I1CH 1UVQA 2GJ6E 1UKSA 1OW0C 2R9HD 3TVMB 3IVKB 1F4AA 4GMSL