3JZYA

Crystal structure of human intersectin 2 c2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
IGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Intersectin 2
publication title Crystal structure of human Intersectin 2 C2 domain
rcsb
source organism Homo sapiens
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
A PF00621 RhoGEF RhoGEF domain
A PF16652 PH_13 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3jzyA00
4BGDA 3R7QA 5T8IA 3KWTA 2K45A 3QR0A 4L1LA 4QJ4B 4OVVA 1HE8A 3PFQA 3QJZA 4KZ0A 4DK5A 3F01A 1QATA 3W57A 5G2NA 1DJHA 2BWQA 4GB9A 4GNKB 4L23A 4LDCA 4NP9A 1RH8A 4XE0A 4AJWA 3CSTA 2V4LA 1W16A 3ZVVA 3ENEA 4F1SA 1QASA 2CHXA 2CHZA 2KI6A 3DBSA 2QZQA 1DJGA 3B7YA 1YRKA 3KWUA 4EZKA 1E90A 4PS3A 2WXPA 4TV3A 3L17A 3JZYA 3RDJA 4WWNA 3L54A 5G55A 4BFRA 3PRZA 2CJSA 3GPEA 4QJ3B 2N1TE 4XX5A 1V27A 5EDSA 2ENQA 1RSYA 2RD0A 2WXMA 3PYCA 2NSQA 2A5UA 4Y1SA 2CM6A 4FA6A 4KITB 4EZLA 1DJZA 4A55A 2ENPA 2WXQA 2Q0ZX 3HHMA 3L16A 3APCA 2YRBA 4URKA 4KZCA 3QARA 3TJPA 4AOFA 2NCEA 3FDWA 2NQ3A 3ML9A 4F91B 3M7FB 2K4AA 3NZSA 3N5AA 2ZKMX 3L9BA 1DJYA 1BYNA 2ISDA 3APFA 4LT7A 1DJIA 2YOAA 4L1BA 1DJXA 3NSJA 2WXJA 4PS8A 3F00A 4FJYA 2DMGA 4FADA 1E8WA 4EZJA 2JQZA 2DMHA 4ANUA 4ANWA 1UGKA 1BDYA 2WXKA 4WEEA 5JHAA 1TJMA 2WXOA 4LCVA 3F05A 4QJ5B 3IBEA 3L08A 1WFJA 3S2AA 3T8MA 3ML8A 2Z0UA 3QAQA 3CSFA 4IQHA 4ANXA 2CM5A 1E7UA 3SD5A 3ZIMA 2WXNA 2FJUB 2A4ZA 2QZ5A 4OVUA 1W15A 4ICXA 3MJWA 4G11A 4WAFA 5CCHE 2CJTA 1GMIA 3IM1A 2WXLA 5CCJA 4MJJA 4TUUA 1E8ZA 4NS0A 4FJZA 3QR1A 1DQVA 3PS6A 4IHBA 4FHKA 3TWYA 3TL5A 3LJ3A 2WXGA 4ANVA 1WFMA 1TJXA 4J6IA 3NZUA 3L4CA 2WXIA 4QAMB 5KJ7E 2X38A 1CJYA 5H4ZA 4F92B 4DNLA 2UZPA 4NPJA 3FBKA 2FK9A 4L2YA 4FULA 2D8KA 3HIZA 4JPSA 3OHMB 3RPBA 5CCGE 1RLWA 2ENJA 3ZW3A 2K8MA 3R7RA 3APDA 5JHBA 2LHAA 2B3RA 4Y1TA 2R83A 2WXFA 3QK0A 3OAWA 4PS7A 4TS6A 2K3HA 1UOVA 2WXHA 1E8YA 4V11A 3W56A 4FHJA 1DSYA 2CHDA 1BCIA 1E8XA 1A25A 4FLHA 1DJWA 3F04A 1K5WA 4WWOA 4WWPA 2Y3AA 1E7VA 3L13A 2EP6A 3P2BA 3DPDA 3PREA 4ICWA 4HLEA 2CHWA 2Q3XA 4NPKA 5H4YA 4XZ4A 4HVBA 1UOWA 4F93B 3HN8A 2WXRA
chains in the Genus database with same CATH superfamily
5DEZA 5F9WC 1GVIA 5G5DA 4JO5A 2Y5EA 3X3GH 2RMNA 3SBQA 5GZOA 4Z7UA 4JFXB 1U36A 4MAZA 3ELAT 4LK4A 1ORQA 3VXSB 4FXLA 1NAMH 1RH8A 1BQLH 1MNUL 2M83A 2HWZL 3QDMA 4GW4A 3POCA 4MJ6A 1YUHB 3FQRB 3V5KB 5BO1H 2XQBH 5MEQA 4HUVB 1FFOA 4IGBA 5I2IA 3PL6B 5F6HJ 2FECI 1I3GL 4Y4FB 3FPXA 2IQAA 2ATPB 1TSRA 1TKWA 2J43A 3BH4A 1MW0A 4CSPA 5DXWA 3QGVA 4I13B 5CJBA 4CW1B 1VADA 1QKZL 1N68A 1W91A 4GBXD 4AVJA 3JT0A 2H6PA 3DIFB 2DWDB 4KVCH 3DOHA 1I82A 1H3XA 1N59A 2PXYB 3GRGA 3I84A 4CN4A 5ALCL 3C60D 3NRQA 4NRYA 3P4NB 3VFVA 3DDFA 4JDVB 5AOMA 3BE1L 3AU1A 3MJ9A 5HJ3A 5GS3A 1PAZA 4OGYL 2BLFA 2DEXX 4JQIL 4MNQD 2E76C 1GW6A 3DGDA 3CFJA 4B6ZA 5I5IA 3OKNA 4BFJA 1G9MH 2GQHA 5DZNA 4HDIB 5KW9L 3NN8B 2WLLB 3DVGA 3T0BA 2HLFD 2XWJA 4P99A 3I74A 3IK2A 5L9DH 3AREC 4NNYB 2VRKA 5LGJA 2WIIB 1ZHBA 2Q6WA 2X9WA 1SBSH 1XGUA 2HRLA 2Z92A 5FHBL 1PZ5A 3MRIB 3TBYB 3FKUS 3II3A 3VXSE 5IFAH 1GIGH 1ADWA 1A6UH 2A9DA 4YZFF 1HEZB 3QWRA 4RMSA 5CHNB 4PVNA 4PRHA 5BUGA 4B9KC 2WYIA 1C5DB 2BW5A 4N26A 3QDAA 3QCTL 1KCSH 1AQDB 1EXUB 5B1BB 3M17A 3ETSA 2EDYA 1O5DT 1UZ8B 2X09A 5KUKA 5LO7A 2G3ZA 1W0VA 5GRVL 4M4RA 1I1AB 4GKNB 5MHSE 1P7KB 3CIQA 4FFZA 4LFHG 5JO5B 4PJ7B 2W65B 4IYKA 4OD1L 5DRWB 5HHNB 1XGPA 2DQTH 5KVGL 1MFCH 4NPYB 4NM8H 3GZPA 4PG2C 4HH9B 1LE9B 5F9OH 2Y22A 5F3HA 2CNZA 5LVEA 1LMKA 1Q9WA 5A3ID 1UUNA 3L3OA 3NQIA 1UKTA 3QJZA 2J8OA 4ZK8A 2BWQA 3OXRB 4P3CL 1ITBB 4RISH 1B4LA 1EO8H 1XGZA 4XZUA 3PABA 3RKPA 3HFMH 2AXWA 5CN2A 5C0GB 3FAWA 3PDOA 1U58A 4J4PD 2AJ3A 4TUKH 5DEJA 5FYLL 5CIPA 5BS0B 1EJ8A 5JHDB 5IBUG 1A7RH 5TDOB 3UPRB 3VI3B 1OTSD 4KQ3H 2BZCA 1RU9L 3GPEA 2P5WA 3VM7A 1XMWA 2APWA 3ZT6A 3L7FB 3B2XA 3D0LB 4FQ1L 1B2YA 4OZFH 4XX1G 4DZ8B 4NRZB 2IAMC 3CUPA 4P3DB 4ABQA 1A3RL 2Y25A 1ZGLP 1SDDB 1KPUA 4RMTA 1O9WA 2HT3C 3FN3A 5IBLD 1BM3L 3FSOA 2W0KA 4NO0B 4POUB 3QPKA 4JLRB 1T5WB 1CG9A 3WAJA 5CCKH 4IBTA 1E2VA 3T6ZA 3J2PA 4N2BA 5EOCL 2ZUYA 3F00A 2MQ0A 2WLJA 4PJ7E 3PWPD 1OGTB 3HB3C 2XXMB 3HG3A 4KJPC 2HUEA 1AQ8A 5C0CA 2VR7A 3ESNA 3L3IA 3A6OA 4JQIA 3TS8A 3NK4A 4JY6B 1PPIA 1JHKH 4IS6B 1AXSB 1CD1A 1MWAL 4IMKA 1NGYA 2X89D 1CL7L 1QLEL 4FQXB 3F12B 1SXNA 2EABA 2NXZC 3G6AA 4N25A 4AITA 8CGTA 5EU6D 5DVKA 4MMXA 4RSYA 1H5BB 1EEQA 4J3TA 1GS8A 3TM6A 4F58L 1FYTA 2A6KA 4D3CL 4ORGB 3T77A 2WXGA 2XWEA 3ZRFC 5INDB 1BPLB 3JV6A 5AOZA 3GGWA 1RUPL 5JHDE 1UFUA 1MJ7L 3IJEA 5BS0E 1MNNA 3HN5A 1V5JA 4GIOA 4YSAA 4IU2A 2IWKA 2FJGA 4XWOD 1RZKC 2FD6H 1J8HD 4L9LC 3CN3A 3FW6A 3ESVF 1IZJA 1WT5A 4X83A 1SUJA 4LRIC 4A63A 4BKTC 1R3JB 4Y9GA 2ZJSH 3IJ8A 5DFTA 2JI2A 4APXB 1JPSH 1E8YA 2CUMA 2YAPA 1TTCA 2WTRB 4PLKD 2B15A 3N44F 2ZYRA 5GZOC 5T33L 1RZQA 3PWVB 2WNGA 3GKWL 4GBXB 4MBOA 4H25A 4R83A 3OC8A 3MAWA 3EJYC 2J72A 2R69H 3LDBC 4MA1B 2VB5A 4AIXA 2C3VA 3X2QB 4A2FA 3U0PB 5AB0A 4AW4A 4AUYA 2EINB 1GAFL 4IGBC 3SE6A 1EAQA 5LGHH 1QI5A 1T4KB 2P80A 5EEWA 3B9KA 4HWUA 4QTHB 4MNQB 1FRGH 3RX7A 4EJ1C 2H2SD 4K3EH 5IJKA 4IKIA 2PR9A 1JGLH 5ELIA 3KPRD 2XTJD 3L17A 2GTQA 3QHZL 1T7ZA 3ZTEA 4XHJC 4WI6A 4YSTA 4I2XB 4JDEA 4MD0A 1SEBA 1RJLA 4HK0A 3BPNC 3WELA 4J8RA 4M4PA 4LQFH 1KJVA 2R2EB 4LE8A 1ZHKA 3X1NA 5BOPA 5EOQL 4WFED 5D5MF 5EUKA 5KSUB 4POZC 4L3CA 1BYOA 1OB0A 1V10A 5DD5L 1Z3GH 3MV8A 5ETUA 5I16A 3FRUB 2BK8A 3Q8BA 4IKKA 4N90E 3TCTA 4PJ7F 4S2SB 4S10A 5EZIL 1BYNA 4PJXB 1G7MB 1DBAH 1DBJL 4KKLD 1VPOH 1F3JA 4W9IC 1T1YA 4MA7H 2WBWB 1EEZA 3L7EA 1AR2A 1TJGL 1II4E 4FQPA 2Y3NA 1XVSA 1PY9A 5DQ9B 1IGJA 2DJ4A 3VGAB 3PY9A 2R1XA 1T66D 3VB8A 4TXVB 4WHYH 2GJ6D 5TE7H 5KTEH 1F6LL 4P2RB 4UQDA 4O58L 1HOEA 1GGUA 4BCXA 4HQQH 3RKDD 3QIUA 1MWAA 4GLRI 4M7ZC 3GM8A 3V5DB 4TUUA 4WNSA 1PZSA 3L4VA 1G6RA 5IVNA 5LKNA 1K8DB 4MNQE 3HBGA 3LN4A 4ZMTA 1TEGA 1TFHA 1MZYA 1J9SA 1I7ZA 1PFCA 3CMOL 1MCWM 4PR5A 2VR3A 1XZ0A 2HPTA 4I2XE 1EGJL 1JRHH 4RBPH 1LK3L 4P2CG 5DRNB 5JXED 2YK1L 2VE6A 3UAAA 4Q6YA 2B8OT 2GPZA 3EFFB 3ARQA 3QDJD 4F2MB 5B39B 2WBJA 4HX1A 1N6QL 1BZ9B 1JJUA 4KXZH 3FCTA 1UEYA 1E4XI 4LSVL 3L3OC 2KLSA 2FRGP 1GS7A 2R1WB 4M7LH 4N5ED 1H3UA 9CGTA 4U1GC 4PJXE 4OGXL 1S9WB 3OKDB 1G7HA 2FLBT 1TTRA 2YFOA 4M6ML 1L4IA 4BH7A 3E6HB 4OJFL 3FFDA 2IADB 3EJCA 4LEOA 4Y5VA 3TYGH 3V5HA 2P9RA 2B1AH 1A5FL 3CPLB 5KUMA 4F8NA 3EADA 4E9YA 2FGZA 2D2CC 4P2RE 1OSPH 4U1NA 4MDRA 5TQ0H 1CXKA 1J9TA 1WVZA 2J6WA 1NMCC 4NGHH 1UA6L 5BZDB 3ATAA 3CHSA 4MNHB 3F6JA 2CUHA 3IFLH 1VCAA 3CX5K 1CD0A 5A6MA 3CHOA 3MOQA 3EKCA 1S7QB 5EU6B 1DJZA 2OAAA 5D96B 2UXVA 3D2UD 2LFGA 3BMWA 4E41D 1KOAA 5GQBA 1OM3L 5EF1A 4H1LH 5D6DC 3MREA 2DQHH 2O6PA 1TZIA 1GGIH 3KWVA 2HTLC 1IFHL 2XN0A 3APFA 3LIZA 1I31A 2G9KA 3OSKA 3QO0B 3SO5A 3ULVD 4HJJH 2Z31D 3PXLA 5IF0B 3BAXA 1J7VR 5F8QC 4DK6A 4F2ME 1D6EB 3V10A 4LL1A 4IMKC 3HE7B 4KROB 1J8HB 5AOJA 4NQUA 5IVXA 3QI9A 3FQ2A 1S5IL 3K5SA 3LQAL 4MMXC 4NSKB 5FFOA 4I3SH 4Q4IA 5AVUB 4I0PA 3VFWA 2Q86B 1S9XA 2JNZA 4PWGA 2HTKD 4OZGF 4QYOB 1HSAA 5DD0H 4QAWA 1R3IH 2Y1ZA 3QCVL 4XPBL 1QNZH 4OT1L 2PLTA 4AYGA 3UC0L 5HYSG 4EI5A 2CGYA 1FH5H 3DOSA 3RWHA 1O6SB 4S0TD 5IK3A 3ARGA 3MGTB 3QNZA 3HRZB 4Z77B 1NCBL 1FUNA 4HWZA 1KPVA 1CICA 3UX9B 4Y8DC 1WT5C 5DHMC 1RZ7H 2QVTA 2J3SA 3ALXA 1XGTA 1BJMA 2VW7A 3FULA 3P4MA 1NMBL 4XNZC 1B4RA 1INEH 1IIKA 1QLRB 2NTSP 3OWRA 1ZWIA 4KY1H 3GLZA 3ECQA 3P11H 3JV5A 1VLXA 3LMJH 3WJJA 2H2PD 2YGOA 4ELKB 1WZLA 3BAKA 3OPZL 3QNXA 4YXKH 2FQDA 1RZJL 5EU6E 3U4BH 3S6CA 5HDQL 5DRZA 4DVBB 4PJIB 2FT8A 3I85A 4NN6C 4U4IA 2QSQA 1SVCP 2FSEA 5F7WC 2I9LA 1HTYA 1SJVA 2ALAA 3MVSA 5F3FA 4OSUH 4LBEB 3DARA 6TAAA 4DP9X 1MCKA 5T8IA 1N10A 3T2OA 3B9KC 1F02I 3O2VL 4GO8A 1J8HE 5LAXB 8PAZA 1MDTA 3K91A 5IJKC 1CBVL 4AY0A 2BXZA 3K2MC 3QO1B 2QTVA 2FEJA 3EYFA 4XPFH 1EEYB 3UPCA 3TZVA 2HJKB 2WQXA 1VZHA 4MJ4A 3E8UL 3ARXA 5AYQA 1UXMA 3R4DA 2K78A 3VFPA 1I9JL 1KFAH 2QKIA 1XGYL 5HVHB 3RFZA 4MB1A 4IIQA 4KI1A 1FFNA 5K69A 1H3PL 2GJ6B 4YLQT 2YQ3A 2F08A 3N3EA 4ZO7A 5DMIH 2NLJB 1TZOA 2DQIL 4Z7VA 1J5CA 3TWCL 4PHXA 4XNXH 4NNPH 4N2MA 1ZHLA 2P7TA 5AAMA 2NQ3A 4AC2A 5HXMA 3W9DA 1N8OE 1Z7JA 3KEDA 4YPGA 3O4OC 5I1AA 2V2XB 3GXPA 1U41A 3UTPD 1E6JL 4JFYA 1JYVA 1S78C 5IUSA 1ZANH 3CXDL 4MVBC 2XWBB 3DNKA 4PJIE 4X9GA 1AQMA 5C92A 4DUXA 2Q5BA 4KHXH 1VENA 1RZKH 1OF2A 1G4RA 4BZ2A 5IB3B 4ODXA 2WXOA 1ADQL 3LPGA 2ADGA 4DP5X 3QIUC 2Z0UA 1D7DA 3HBZA 1MHHB 3QDJB 1JI1A 3VTMA 1OLZA 2W91A 3O6ML 2L3BA 3BFWA 2VERN 3KXFA 3UERA 4XCFL 4OV6F 3LS4H 5BQ7A 1OQOA 4FKEA 3P0GB 3TO4D 1GMIA 4EKJA 2AGJL 1S7VB 5TE4L 4NM4H 4ZUUB 5C08D 4R7NA 4G6AD 4LEEA 4HJSA 3F84A 4M00A 1W0YT 3MOAH 1OZUA 3QIWA 4WI0A 4HXBH 3BVNB 4LB8A 1MCOL 3GJFH 4MMZA 3LRHA 4WO0A 5DK0A 4J3OG 3A22A 5KVDL 3OR7A 4QIRA 5HY9B 3NCJL 5GIRA 2WBJC 2UZPA 2J4WL 3H42L 2ZIDA 4M02A 2AK4B 2GJ6E 3D4ZA 3LH9A 4LCWA 4MNGA 1U21A 3TBTA 3QUXD 3B34A 1TZGH 2CALA 2RQEA 2X6CA 1G0DA 2RIKA 4CRPA 4UZSA 4BA8A 4KJQC 3ULSB 4LLMB 1AQKH 2YZ1A 4PREB 4ZW6A 4GSUA 4HD9A 4N0FA 5B3JE 1JHTB 4Y5VC 3EGXB 4F3FB 3L4TA 5T3ZL 5KYXB 4WWID 4AYBA 4LVOC 5CBAA 2WXRA 3BUIA 5HYSA 4AYSA 1OAQL 1L7TL 2QHRL 4E41B 1T0OA 4MCYA 3PFQA 2VZ3A 3MLRL 1J5HA 4IMLB 5SWQA 3MLSH 4MS8D 3G5XB 1DL7L 4NQVB 4HKBA 4L23A 1DBML 1F41A 4WUUD 2Z31B 5E8OB 3QDJE 1KACB 5E7BA 3EJUA 4HJ1A 1WH0A 4JHAH 1W16A 3QQ4A 2YJQA 3VGDA 5LQBH 1ZGLB 3A4EA 5CWSA 3KPLB 1AD9B 3KYNA 1A7OL 4V2CB 2BRQA 4LVHB 3BDYL 3KH4A 4PBVC 3LZNA 2HMIC 4XX5A 5CILL 5HYEA 1C8PA 4NQEA 2ENQA 4GSQA 3VFGL 1BFVL 2EJ1A 1FL5A 1B0IA 2BRRL 2Q7NA 1UWEL 5HSFA 5J3HD 5CZXD 3NFPA 4G8IB 2HAZA 2AK4E 3MA7B 4PJIF 3UCRA 2A1WH 2RACA 1NKRA 2G5RA 1PQZB 4UDUB 1F97A 5F8RC 1HCVA 3QI9C 3VAEA 3G5YB 4UQAA 2ERJC 5K9KA 4FQLH 2WQ8A 4KK6C 1ZA6B 1A9BB 1GGCL 1T1WA 5B38G 2JB6B 3L95A 4FFZH 4I0PC 4X98B 5E00B 3C2AL 3WTYA 1BA9A 3X1GA 1V7ML 4WVRA 4G8EB 4K5LA 5JIDA 1SHMA 5H37G 4JG1H 3F83A 1R0AH 1IEBA 3LEXB 4KJWD 1OAYL 2X2IA 4WI5A 4RIRA 3BCFA 1D6VL 4OIIH 4EI5C 2K70A 3TEWA 4E41E 1T1XA 3ARGC 3C6LD 3CBKB 4GS7C 4M6OH 1UJ3B 4PRID 4PGDA 1CICC 3KR3L 3ARDD 2CBMA 3SDXA 4HK3N 2F7IA 1UACL 3Q43A 3RBSA 3THML 1G87A 2CO3A 1Z5LB 3GHEH 1TR7A 1RIHH 3NPSC 1DDHA 4QTFA 3I6KB 2J56A 1NGQL 3WJJC 5GS0D 5DTFA 3W39A 1ZK9A 4XCNA 5GGTL 3GMQA 5FA4A 4IEFB 5CD5C 4RA3A 4CA4A 3UZEA 1MNUH 3OKOA 3OLGA 4NPJA 3FF8A 5DHYB 5BRPA 4IBVA 2HWZH 4JFPB 5C6TL 4R8WH 4QHLA 3CSYA 3SQBA 4U6YA 4DGUA 2NY1C 1E6OH 1LGVA 2D7TL 2WXFA 3US9A 3FFCD 1I3GH 5B3JF 1QO3A 2OA9A 1FDLL 4LPXA 3BN9C 2CHDA 5L4JA 1E8XA 3V4PB 2JQMA 2EDWA 3K6SB 2W07B 2DH2A 1XV8A 4Y0GA 4LKCA 2MCPH 5CGYC 1PCSA 2B4CL 3CLFL 3KWTA 3TZVC 1FAKT 4RAVA 1CFSA 1EEUA 1OQXA 5ALCH 2YXVA 4N3TA 3CDZB 1ES0A 3DTUB 2CK2A 2QKIC 3BE1H 4R26L 3M6DA 3RFZC 4LQ1A 3VXNA 3NCEB 4IIQC 4JQIH 1BOGA 2G75B 3U36A 4AJVA 2V4LA 1NKOA 2YD4A 3GI8L 2VLKD 3OKMA 4U1SB 1KENL 1ETJA 4KUCF 1TOXA 5I17B 5I0VA 5KW9H 2WWKT 4LSSH 4Y2LA 3ZMNA 4HOZA 2FWUA 1N6VA 4FL4C 4MA3A 1L9SA 4O02A 3RP1A 3TN0C 3ZL4L 5FB8B 3D69A 5IMOA 4YDIL 2K6ZA 4G8AC 1FL6A 1EANA 1KYFA 1OSYA 2EEDA 4PWJA 4XB7A 4KK5D 3VWKA 5FHBH 4ZUSB 3SQOL 3HI1A 3TO4B 3IPBA 2XQYG 5FK9B 3TU6A 4HWNA 1IGYA 1L5GB 2DQGH 1JIBA 1ZA3A 3SY6A 5C08B 5DVLA 3T8XA 2BFVL 4N2LA 5MERB 4NO5A 2V9TA 2XU9A 4E0RB 4HFWA 4ODTL 5LBSL 2XVLA 2X1WL 3IKCA 4X6FA 2ZCKL 3C5SA 3UZVA 4JRWA 3QCTH 3RWDB 1S6NA 4EUPB 3VG0L 1UGKA 2OQJB 4MAYA 5AUMB 3MLPA 3QDGD 4M5SA 4MLSA 1OZTG 4AYID 2BM3A 2DI7A 3LQAC 4GOSA 1UWYA 1TVHB 2LTQB 4S0HA 5D7JA 3L3HB 1JUFA 4BJLA 3ZR6A 5CZVL 4OD1H 1NBZA 3FT2A 1CT8B 3QIWC 2N01B 5KVGH 3RVTD 3GUTB 2YAEA 2VN6A 4NUGL 4PV8A 3CN1A 4RBPK 1NAMB 5C3LD 3DX1A 2JLLA 4MMZC 3UTPE 3RRQA 4KKZA 3O3AA 3W0WE 1D5BA 3H6AA 1P6FA 3M45A 1XBDA 3DHUA 2VR9A 4HW6A 3PS6A 4NJ9L 4QRPA 1F13A 4JBSA 4QRAA 1JPGA 2DL9A 4M7KH 4EDXB 3TJEL 1CE6B 1DQJB 3AUWB 3GDCA 4JANB 5B38A 3BFQG 5D1XC 2PCFA 4L5FL 3WDHA 4AH2B 4R90L 5GGTA 4LDLB 2W5PA 4JG5A 2B3RA 4M1DL 1ZV9A 3FQXA 4M6AA 3EOTL 3KL0A 1A4JB 3DO3A 4HKJA 3K1KC 3P9WB 3ZMRA 3N0PB 2EDKA 4NCC2 3DSNB 5C08E 4NKQB 1RU9H 4WWOA 3ZO0A 1QA9B 5F1OB 1VFBB 3WIHL 4TTDD 4XPGH 2HKAA 1U8HB 5CEZL 2JSFA 1AG0A 1YEDB 3SKJL 4OUOA 1SUHA 4DVRL 3MJ8B 4F7PB 1A3RH 2HVBA 2YJLA 3NYKA 3QJTB 4R9HA 3NDZE 5F7MC 2Y36L 3EFOA 3IDGA 1BM3H 5E8NA 5E6ZA 1DJHA 3GIZH 3U9UB 5JW5A 2BY2A 1M1XB 2ADFL 1Z9OA 1A14H 5CBEB 2GIMA 3RL1B 2NYYD 4U1JA 4OLZL 5CU5A 5DVMA 5ERWA 1SY6L 3LKRA 3S8GB 1UYWL 3SKNA 3HOGA 4C59B 4JDZB 1ZJAA 2MMXA 1JZ5A 3FTGB 1UVQA 3IAPA 4BDVB 2NT0A 1MWAH 3C6LB 3O8XA 2N7AA 4LP8A 1JL8A 1QLEH 4WSGA 2Z7UA 3ARDB 2V5TA 2BDNL 4NC2B 2LT9A 2BSSA 3D0AA 3FXIC 5JTWA 1G4MA 3LKOA 3VFTA 4DFHA 4XCEA 4F9PA 3FQ1A 3WIIL 3D85A 3TPKA 1QTYT 1PG7W 1ACCA 5BJTA 4D3CH 4IKNA 4WO4D 1YZZA 4PRDB 3SOBH 4XNMB 2Q3ZA 4NKDB 2XY2A 1RUPH 1USQA 2KL6A 5AOIA 2XTLA 3CZLA 1TTAA 1E3XA 2XC8A 4CNIB 4Q2ZB 3G9AB 4PWKA 3B3IA 1HC1A 5F7BA 2XV6B 1R34A 1BDYA 5LBSA 3MX0A 5IROA 5LCVL 3MQIA 3AB0B 3HEIB 5DVPA 1RJYA 1A6WH 1RPUA 3FFCB 3LKQA 2MQ3A 2LVCA 2N56A 2MNJB 3L3JA 2BY0A 2XWCA 3DA0A 2WXNA 1MSPA 3MCLL 2DWEB 1G84A 1ZMYA 4PCSA 1M7UA 1MFVA 2HZHA 3RZCA 5T33H 2ZUTA 2V2WB 1P0SE 1U0QA 3GKWH 2VABB 4BFIB 4MYWB 1DVZA 3ZE1B 2XQYA 4L3ED 5HDBB 4R97C 2LU4A 2O5YL 2LFEA 3BP7A 3UZEC 3QEGL 3U4EA 2VO8A 1G7PA 5DJXA 2EYSA 2VRAA 4K23H 3BH8B 4N1HB 5EIQA 3D4YA 2NQCA 4N6RB 1WBYB 4M8QA 2BIOA 4OKDA 2XSKA 1BW8A 1DVFA 2VLKB 1SYSB 2CCVA 3VSVA 4WKXA 3RU8L 3IWVA 4OZFB 2NNRA 4JPWL 3QHZH 3RWFB 2NY5L 5EC2B 3LRSB 2OMTA 2IBGA 5B1AB 2WO4A 4X5XB 1HOCB 2EDXA 3A6CL 4PJDB 2NMSA 3P2BA 5FYJL 3S0PA 3VQ1C 5FGCB 3IFPA 2OMVA 4IKLA 1TENA 4J3OC 5EOQH 5D7SH 3O6FA 1W72L 2FGWL 3LIZH 5AVQB 5DD5H 1HKLL 1KDIA 3BP6A 1I4FB 2VMFA 2IDUA 3R19A 1EDQA 1VF5C 5B4MC 2TSBA 4P4RB 4YK4C 1EHLL 2BHYA 3H8NA 2VLMD 4DGVL 4AMKL 1CTNA 4Z0BL 1JK9B 3EOAB 3RY4A 3AT0A 3MRHA 1WA2X 1FN4A 4QTIL 1FPTH 2CCLA 1LJMA 1T20A 3QDGB 3AG4B 1N26A 3VWKC 4RAUB 4XN1A 1MEXL 2RBLA 3FU3A 1JD7A 2CK0L 3GXDA 3S4SG 3VSTA 3WLBB 3ZE1E 1XCTB 1SY6A 2FQFA 5HDBE 5J1SC 1N2RB 5HGDB 2EZ0C 4D9LL 2GBTA 5KYNA 4O58H 1I9RL 2H4EA 2X4QB 3T4YB 1K3IA 1RFDL 3ZUCA 3KDMB 1TXKA 4LMQE 2RGSA 3O9WA 4YNYB 5GS2H 2VDRL 5AD0A 3QVAA 4AXWA 1JDAA 3FUMA 1QR4A 3DO7B 3GB7A 4MAYC 2VLKE 3PHQA 4MDJB 1J05A 4X4KA 4IRZL 4WEUD 4X8JA 1UD8A 3CMOH 2VQTA 4GP4B 1EHXA 3GMOB 2EDDA 2C7UA 1YSOA 3CFIC 3CH8A 5D7JC 3HR5B 4JO3L 1EHKB 4BFEA 4L8DA 5BPPA 1L9OA 5E8EB 1I3UA 3ZKMC 1BG1A 1LK3H 4DW2L 4PJDE 2YK1H 3EBIA 3NA9L 2ZYIA 3BP4B 3GJFK 4JRLA 3T8MA 1J8SA 1TU2A 2AP2A 3QJVB 5FGCE 1RZGB 2CM5A 1T7WA 5FCSH 2F53D 4A7SA 1E5CA 1YPZA 4OZ4A 3X13B 1KCRL 2F0CA 3II2A 4C4KO 2Q7AA 4AYEC 2WUCH 1Z9SA 2O5XL 1NCCH 4FTVE 1E28A 2YBRB 3UTSD 5BVJA 4FHKA 1SDYA 1G1KA 2X2UA 5J6GA 5ID1B 1GJWA 3QDGE 2NDFA 3T1FB 2VDLL 2Z34A 3GS4A 1N9PA 4G9FA 3RILA 1JZ2A 2Z65C 3OGCA 2Y72A 2Y69B 3U7AA 2NX5A 4XGZB 5DK3A 1QRKA 1UOVA 3P0YH 1DTUA 3COOA 5DK2B 3STLA 4OZIB 3MRRA 2IAMD 3CC5B 4GKSB 1UA6H 4X80H 5GSVA 3FN0L 4FLHA 3RGHA 4RFEA 2D4DA 2PCPB 2Z8VC 1T0NB 1U8CB 3HHSB 4J23A 2KUTA 1Z9LA 2CR6A 3GMLA 5LB1A 1L6XA 2B4CC 3RGBA 2FO1A 3ZKSD 3SPGA 4NZRL 2OMWA 5I66A 3CDFA 2VXSL 5DYFA 4HUXA 2RFXB 4KJPD 3MZGB 1OM3H 4L9DA 1D5IL 2BCKB 1HHIB 1K8IA 4CN1A 1CBJA 5CP7A 1IFHH 5DD3H 2P8PA 2G9HA 4X0KB 2V6HA 1B0WA 3CSTA 4MX7A 3OMNB 3ZE1F 5HDBF 1NCIA 2E6PA 3O8XC 3B7YA 4NI3A 4NENA 4AKQA 4DCQB 1IGTB 2NXZD 2EDHA 4A2GA 3PWNB 1S5IH 3I9AA 3LQAH 2W0FA 3T0EA 5F9WB 3ZTNH 4F9PC 4ORZC 4G9DA 4NO2B 4UQ3B 2CXKA 4K71C 5BXFB 3LTVA 4L8BB 1F42A 5I75C 4XPBH 3SB3A 2WXQA 4X7CC 1JN6B 1MY7A 4JS7A 4ZG1A 1A6TA 4L3EB 4XH2B 3UC0H 1BVKA 1E27A 3T0DA 1D5ZA 1NCBH 1LD9A 3QT2A 2K6WA 3EGDA 2X0WA 3F7YA 3OAYH 5IROC 4XC1L 5TQ2L 5M7QA 1NMBH 1L9NA 4OZIE 2P1YA 5EC1A 4WTXA 5DSCB 5GZOD 3RZCC 4LCVA 2JXMA 1Y18B 1F1GA 1QACA 2X4SB 3OPZH 4OQ1A 5DJ2B 5HDQH 3S4SA 3BZFA 3EJYD 3LS5L 3MO1B 2LU3A 5MP6L 4ODBD 1RK1A 3QDMD 4WAFA 4LIQE 3MUJA 4BWTA 2V2TB 4YLCA 1TT6A 3KVPA 4I5BB 4QT5A 1SEQL 4YFDB 1SPDA 5DEGA 3GSVB 3O2VH 2Z35A 4KXCA 4JO1L 4OI9A 1JZ4A 2WYTA 1DVFC 1KLUB 3SGDI 1CBVH 5D2LB 4U6XA 3GMMA 4XHJD 3ZN6A 4DO4A 1GGBL 3AREB 1ILSA 3V0FA 5KVMC 5E6YA 1M1SA 1JGDA 3SE4A 3OHMB 4ZFZA 3WI9A 3U30C 1UEMA 3ZW3A 3WTVA 1FVDB 3LZPA 1I9JH 1XGYH 1ORSA 5ESQB 3DX7B 5EMYA 1TQSA 3B2UC 2EUZA 2YOCA 2ARJQ 2F8VA 2E8YA 4L3EE 5HYQB 3V0WH 3KL5A 3O6FC 4POZD 4H1LB 4DWHA 2ADJA 1F45A 4ETYA 2DQIH 3K80A 2EYRB 3MYJB 5ICZA 1G6VK 4LKXB 5H4YA 3ES6B 3TWCH 4M43L 2ZOLA 4TN9A 2EEAA 3BW9A 1OT4A 3BPOC 4MHHG 3HAEG 3KPQA 3QRFM 3HS0A 3BZEB 3QQ9C 4IBYA 4LNRA 3D5OF 4HEMA 1E5BA 4UT9L 3VXTB 1YEJL 4V33A 1UXSA 1MFEH 2X4OA 4ANKA 5FF6A 4O2CA 5DF0A 2NY7L 3JUZA 4K3JL 3MSPA 2UVEA 2DQUH 1U8OB 2W81C 4PMEA 5IEKB 2OP4L 3OF6A 4PH8A 4ZDHB 1ADQH 1AMXA 4PRHD 2IDTA 3GZOA 5DWUH 2FJHB 1DLHB 2IPKA 4PYHA 4ZOEA 3CN0A 3O9WC 2VDPL 4N86A 2DLHA 3O6MH 3LHAA 2Z7ZA 4ONFH 4XO8A 2F53B 1JTTA 4BHUA 3BWAB 3AQDA 5JYLA 5D2LE 2AGJH 2CCWA 5IIEA 3RG1C 2VLME 2I07B 2QGBA 4UT7L 2H26B 2NY6C 4KRLB 1J5OL 4KMQA 3UTSB 3QFGA 4OZIF 3APNA 5CLXA 5C9JA 5HHQB 4HOXA 1EBPA 5I6KA 1NPUA 4PP2B 2GSGA 5AB9A 3UIYA 1N5YH 4DEUA 2ZYSA 3KBHE 4HS6B 5KVDH 4NQCD 3NCJH 4PRAA 3H42H 4ANUA 1G7JB 2OXHA 1ID2A 3WGVB 3TH3T 1AYRA 1FVEA 1PG7L 2PN5A 5I6MA 1RVFL 4I9WE 3V4LA 2X3BA 3CN2A 1Q0EA 3U7YL 2AXGA 4R96A 2IAMB 1LP9A 2XBTA 1ET7A 3CVHA 1QLFB 3R1GL 4GW1A 3NABL 4KJYB 5SV3A 1B4JH 3L81A 3VA2C 1KXQA 1TQVA 5T3ZH 4PD4K 3NK3A 3VE0A 4JGNA 1L7TH 2QHRH 4HUKB 4QXGL 4J3OH 1YEFL 4JG0L 2FH8A 3MLRH 4UV4H 2NTFB 2P5WD 3OZ9L 4G6FD 1BVOA 3P69A 2OX5B 4QGTA 4XOAA 1OALA 5GISH 2X12A 3DX8B 1GHFL 4YO0B 3O45A 3C75A 1HNYA 1RUAH 3JTSA 1JVOA 4YQXL 3RA7L 1IRAY 4OM0H 4YHIA 1DVSA 2F53E 2NXZB 1P7BA 4O02H 1KB5B 1N19A 2NY5C 3I3DA 4XNQA 2ZPKL 4P48A 4Q52A 3QIBD 3HZMA 4W70A 3BDYH 3FRPG 3NA4A 1PZDA 4U6TA 3S3PA 3SYAA 3UTSE 2P5PA 1TVBA 5CILH 2YQBA 3VFGH 4LOEA 2EXWC 5C0CD 4XNAA 5LBGA 2A73A 2BRRH 1BZDA 1KFGA 3SGJA 2H1LM 3NAAL 2YSTA 4TUJA 1JDDA 2X1PA 5AEAA 3D05A 2X4TB 4JFSA 4L9LB 1CDGA 1X7QB 2V8LA 4EIZC 1Y7VA 2EO7A 2IWEA 5FPIA 3OLDA 1YAIA 3V4UL 3WNJA 1UM4L 4XPHL 2J2ZA 3T0EC 3W82A 4F1SA 1X6LA 4EI0A 4ZUWA 5G5DB 5GGSA 3RPIB 2R7EA 4NB7A 1AGCA 3V0DA 4HWBL 4F57L 1OAYH 3B7UX 5C3IA 1ORQB 2O6FA 4QWWC 1KF9B 1XF4A 1E4XH 1XF3A 2VLRA 3LDBB 2VMCA 1MCLA 4CGTA 1NCHA 2WNWA 3QDMB 4GW4B 4MJ6B 3KR3H 5MEQB 1NIDA 1FFOB 2D9QB 1UACH 2GUOA 5I2IB 1SF3A 2TSAA 4HMEA 3HAEA 4KI5C 2IQAB 1AR1C 2XG5A 2YWZA 3OLIA 4AEIL 1TKWB 5F0JB 4FP8L 3M1BA 1FV1A 2XWXA 3VD5A 1VADB 1PCXA 5GGTH 5H37H 1XB8A 3LXAA 3CX2A 2VLJA 5K9QI 4IOIA 4L29A 1OCZB 1N59B 3BPNB 5IG7A 3QXDB 4YZWA 2ZZUT 5DJ6A 4NRYB 5I1IL 3QPXL 1P6AB 1FDLH 3AU1B 5HJ3B 1LWHA 5AW5B 1FAIL 2P80D 3B9KD 5C0DA 3E9TA 4BXSV 4BINA 4Z7NB 3CFJB 3O3BA 3OKNB 5E2VL 4P5TA 2WO3B 3ZT7A 3DVGB 2DQDL 5AALA 4Z3FA 2B4CH 2XWJB 5I19L 4TVPL 2LLGA 4HXAL 5EU4A 4PY8J 2E8ZA 5LGJB 1ZHBB 2Q6WB 3SE4C 1QSFA 1XGUB 3S3JA 2EE6A 4Z7UE 2XZQL 2Z92B 4N9GA 5FUZL 1AD0A 3RTQA 4KKQA 4O2EA 5I15L 3QSKB 1DBKH 3GEFA 2Q87A 4TUOB 3MV8D 3HZVA 2X1XR 1F4YL 3VD0A 3QDME 4ZSOA 1KENH 4JVPA 1MHPH 4PRHB 2JFCA 4LLYA 4R84A 4M7ZB 1KCBA 3ZL4H 3HS0C 4FYRA 2UZYA 3M17B 4F8PA 4YDIH 1HHJA 2XIDA 1WJ3A 1W0VB 4M4RB 4RSVA 3U83A 1S78D 3MGOA 1Z9MA 2ORBH 4OBSA 4MVBD 2WTPA 1AIFA 4JKNA 3A6BL 4FOMA 4DK5A 2BFVH 1JV2A 3QFDA 3T8VA 3WV0A 5LDUA 4ODTH 1VJSA 1XGPB 4R7LA 4JRFA 1OXYA 3EO9L 5LBSH 2DEYX 3VUAA 1Z5HA 2ZCKH 3QIUD 4RRPG 5D7EA 3VG0H 5F3HB 5DHEA 2DLFL 4WY7L 1Q9WB 2X3AA 3JQOB 4WI3A 3ZQ9A 4PLJC 5F0MB 2WJ5A 3L3OB 4D8PA 2BSBA 2E9WA 1V7NL 2WN2A 4Z7NE 4U1GB 3FRPA 3PABB 4HWBA 5CZVH 3RVWD 4DUWA 1TZ8A 2X9ZA 2A5UA 3NJJA 4A2HA 5I1LB 1KPRA 3UAEA 3PDOB 1U58B 2AJ3B 5CIPB 1BHGA 4QXTA 5IUCA 1KGUA 1ZEAL 2P5WB 4G6FB 3T3ME 2PWGA 4JHVA 4PRHE 4ZW3A 4HV8A 3TJEH 3HC4H 3WKNA 3E6FA 1QFUL 5T3XD 4KJQD 1NMCB 3L3DA 3CUPB 2F5BH 1W6LA 4L5FH 4LSQL 1D7FA 4R90H 3RFRA 1KPUB 4F7KA 1QP1A 4M1DH 4OLXL 5DJZA 2VZTA 3EOTH 1CG9B 2WLIA 3GMPB 1X7SA 4AEHL 1TQWA 5CNHA 5CGBA 2ZXEB 3MLVL 4H88L 1CDCA 4R0LA 3WIHH 2Y1VA 5H2BA 3ATFA 5C0CB 5CEZH 4J1UA 4YHOH 3L3IB 2E27L 1MAML 4Z7UF 3SKJH 4DVRH 4H2CA 1NUFA 1YQVL 2I32A 4ENEC 5A43C 1CD1B 1NGYB 2DS4A 3HNTL 1JVKA 4EAEA 2Z4TA 3G3LA 3MKKA 4JW3A 5KN5B 1H19A 3ECUA 1XD0A 3G6AB 2WJ7A 1CFTA 3L5HA 2A9NL 2PP7A 4YBLC 3REVA 4BYHA 3SN6N 3HPJA 4MMXB 4CJ1A 5EIIG 4PJGF 2BVUA 4Z9KB 1FYTB 2HMID 4I77L 1SY6H 1U8MA 2A6KB 4P5MA 5IT2H 5DUBA 3T77B 1UYWH 3EYSH 1T6BX 1QBAA 3JV6B 3GGWB 5FA3A 1KEGL 1BZOA 2KHAA 3IJEB 3H7LA 4ZO9A 3SGJC 3NMEA 4IU2B 5I1JL 2FJGB 2P8MA 4YUEL 3NJIA 5EO0A 1RUQL 3HE6A 2P5WE 2BDNH 3D1MC 2ZSWA 1JTPA 4XNZB 2ZWSA 4KK6D 3SE8H 4G3YL 2IALA 1BMGA 3Q5TA 4I0PD 5DVOA 5ABZA 4WFGD 3LQZA 1A8JH 1NUNB 1LDPL 5A40E 5LN8A 2I9TA 3WHXA 4M3HA 4GIAA 5I6NA 4H25B 5A7EA 4Z7NF 1IAKA 3NFSH 4NN6B 4EI5D 1NBCA 3ARGD 1PZCA 3E80A 2C3VB 1M05A 3IGKA 3WL9A 5GS2D 1FIGH 1LO5A 3OAYK 3LH2L 5C0CE 3NZHH 1ZT7A 4YHLL 2CE6A 1JZ3A 2A6DA 1RZ8A 2IDSA 3D4CA 3MCLH 2VL5A 2APXA 3B9KB 4L2LA 5FM5O 4U05A 3ME0B 1XWVA 5IZ7A 2OPCA 3T3MF 4I18A 4ODSL 1DLFL 5CD5D 2O5YH 4FQ2H 2ZKHL 4JDEB 3L9BA 3QEGH 1H3VA 4CSTA 1SEBB 1FYTE 1RJLB 4HK0B 5E6RB 4J8RB 3KD4A 2NY1D 1KJVB 3OR6B 1ZTXL 3MRBA 3QP3A 1NTDA 1BZ8A 4RRPA 4FXGA 1E8WA 1S7UA 2SEBA 2XT1B 2YS4A 3BN9D 4XXDA 5E23A 2FL5A 3P30H 5EUKB 5I73C 4L3CB 2EH7L 2XN9A 2HRHA 3IU4L 3MV8B 4XTRC 5ETUB 5I16B 2CDFA 4H0GA 1JFQH 1U8NA 5EZPA 2VXQL 5CGYD 3VU1A 2NY5H 4P5TC 3WNPA 3TZVD 4TNWK 1F3JB 1YEHL 1T1YB 4FFYL 5BZXA 3A6CH 1NEZG 1EEZB 1TNNA 3L7EB 4LLVA 1TQBB 5FYJH 3O4OB 4S1SL 5E56A 3ZX1A 4JKPL 1FLRL 5GHWL 4HOMA 3NFNA 1IGJB 2AI0L 3MLXH 5J12C 3UMNA 2R1XB 4TTGA 5IBUB 4UQ2A 2ZAHA 2FGWH 4XHQA 3SYCA 3O3UN 1HKLH 2ADYA 2KQNA 3TV8A 2XETA 3ETBJ 3DBXA 1BXUA 5KVGE 4G5AA 1EHLH 5J0BA 3TGXA 4HFUL 3QIUB 2X3CA 3I2CL 5A6IA 3RVXC 5DJYA 1QLEB 5SWZD 3TN0D 1G6RB 5DO8A 2CBPA 4GXFA 4QTIH 4LBAA 3CTTA 3CZSA 3B83A 2EE3A 1MEXH 4H13C 5FM5M 1I7ZB 5HD8C 1JNHA 4WV1A 4PR5B 3IPFA 2DIJA 4D9LH 4K5NA 5GGQH 5BRQA 3TH4T 1I9RH 1L0XA 1MDAA 1U9KA 4URKA 1RFDH 1FNSL 5DUPL 5JMOC 2VE6B 1X4XA 1WAAA 2B5IC 3GS7A 1AXTL 3GSQA 2VDRH 2WBJB 4HX1B 1KYOJ 3KL3A 4F1ZA 3KXFD 5A1AA 4MS6A 5C0JA 2B2XL 3FCTB 3MV8E 5JIHA 4GG6A 4TLKA 1AGDA 2OTWA 3I3BA 3O6KL 4IRZH 2W60A 4H40A 4LOUC 5E2UL 5EIIA 2DF3A 1YNLL 2ZD0A 4JO3H 1G7HB 1CGUA 4WF7A 5IQMA 1QUNA 4UZUA 4W9ZA 5A2CA 4BH7B 4H7VA 3JZYA 4DW2H 5HGHA 4LEOB 1TJHL 1AZNA 1NDMA 2H6OA 4N8UA 4Y5VB 4TL4A 4EMZA 3PRZA 4LVOB 3V5HB 5ADPL 3B9EA 5AAWA 1SRDA 4RQQA 2EE0A 2YD2A 5JORA 4LCWD 3AY4A 2O26U 3F65A 4U1NB 4X5QA 1KCRH 1KNOA 4AUJA 4AOFA 2EIMB 4OY9A 1C12A 4XX1E 2Z1PA 3V0AC 4JPKH 2EC9U 3HC0A 4DP1X 4LCIH 5D1XD 4F2EA 4RNRA 2P48B 4KO6A 3KZ8A 4GRWB 4QEGA 2VDLH 4HG4K 4PBXA 1IGFL 1FNEA 7PAZA 2QQLH 4NDMA 1LEGA 5I0YA 5CJQL 3F05A 4WI4A 1RZFL 2DJMA 4NHCL 1IFGA 3MREB 4R0LC 1FGNL 2X6AA 1TZIB 2DIBA 5T1KA 2X6MA 5HPMA 2VAJA 3D18A 1NDTA 3FN0H 4U0RC 1BMWA 3T2PA 2QFPA 5FOJA 2VXQA 3LNDA 2XWTB 3BRGC 5IVXB 1D5RA 1KLFA 3QJHA 4WKZA 3KGSA 2ERJB 4FFYA 2ZXGA 4ZFZB 3VFWB 2VXSH 5EBLA 4I0PB 5T3XE 3VG9C 1S9XB 3DVFA 4JN1H 1D5IH 3NSFA 3G9VA 1G0YR 2APBA 4NQED 5EN2A 1HSAB 4GW5A 5ACMA 4YBQC 1PKOA 2VSDA 4APQA 1W8OA 4UTAA 5BCAA 3EXJA 3V6OA 1R4XA 4EI5B 3DOSB 3RWHB 2BSEA 5IK3B 1GYVA 3ARGB 3IE4A 3QNZB 4GS7B 3I6SA 4HWZB 1KPVB 1CICB 3BVWA 3QK0A 4JM2A 5A16A 4FQQA 1CXIA 3Q2VA 1QSEA 4FCAA 2WP3T 3HE6C 1XGTB 3P4MB 3A4FA 3R8BB 1ZOXA 2FJSA 4G42A 3UL4A 2W92A 2EDQA 4I1PA 4LGPB 5AW6B 3DPDA 1ZWIB 3NPSB 4G1MA 4B95C 4GPVA 2BX5A 4M7JL 5JR1L 4GRWE 3P2TA 3BXNA 2QVMA 4ZMOA 5I6OA 5DRZB 2Q1EA 3CC1A 1GCFA 2FSEB 2I9LB 1OD9A 2Y6SC 2NY1B 5CAYB 4XC1H 2YA0A 4XAWH 1KIPB 5TQ2H 1U2YA 4AQ1A 2AZAA 5ES4B 2HT4C 5DVNA 3NQKA 1FWXA 1ITCA 2DM7A 1C7SA 2CHNA 3AQZA 4G6ML 4ENZA 3CVHH 4XMUA 1CI3M 1JK8A 1MQKL 1OWWA 3EYFB 3EGSA 4NWUH 1ILUA 3CVCA 3LS5H 4Q9BA 5MP6H 1PVHA 4I18C 25C8L 2Z8RA 3TZVB 3V7MA 2QLVB 1IEAA 4WFGE 3BWUC 3FCGA 5DC4B 3BAEL 5J7CC 3VFPB 3RFZB 2WK2A 2ITFA 3QG7L 3OSVA 1A7NL 3QJOA 4IIQB 4RMQA 1SEQH 4FXGC 4N2GA 1BFOA 2ZF9A 1ED3B 2E7LC 5I5RA 3UTQA 4Z7VB 3C8HA 5J6HA 1MWOA 4ZS6C 2YXMA 1GGBH 3CFCH 1BBJA 3EYOA 4FL4B 1NANI 4FYQA 3VFRB 2P7TB 2XYBA 3TN0B 2QHLA 1QEXA 1P84K 1ZXQA 3W9DB 5KJ4A 4YPGB 1OEZW 1JGIA 3UBXG 5I1AB 1Z6JT 3P9MA 3Q3GA 3QULA 4JFYB 2C9XA 3D8MA 2FH6A 2WGNB 5B4MD 2NPLX 1T89A 1P5UA 2C3HA 3AXHA 1OF2B 4ODXB 2E4TA 2ADGB 4M3JA 1VFOA 2F2HA 3FQ4A 2WBXA 3EIFA 3TWYA 5B3SB 3KXFB 4H5SA 4R7XA 2L7EA 3VWKD 1I8MA 4JVWA 5KZCD 2NY7H 4P5RA 4K3JH 4WGKA 4WV1C 3UJJH 4KO7A 4R7NB 2E9BA 3LNIA 2Y7QA 4WI0B 5AL0A 4YFLI 4V11A 2XVGA 4MMZB 5DK0B 2YKKA 4FQIL 3OR7B 3CHQA 5BZZA 4Y16A 3X17A 5FHAL 5GIRB 4WGVB 1EJFA 5I8KL 3HAEH 3A3YB 3DHJA 4LCWB 5AB2A 4MAYD 4HIQA 3TBTB 4KUZL 5AOKA 4Z7VE 4TQPA 2YIHA 5HGGS 3I9PA 1TCRA 4JY4A 3D34A 1NCNA 3FH7A 4UT7H 3S3DB 2DRUA 1XGQA 4ZRGA 3C08L 5D1XB 4YVNA 4AC4A 5CFHA 4FTDA 3ZKMD 1JXFA 4KTEL 3NN8A 4N0FB 3FTYA 4X8CA 3EO1B 5IY5B 4EOWH 5CBAB 5HYSB 5AAWC 1V3JA 3S88L 4JL1A 4MCYB 3FSVA 3QDHA 3G5VA 3HJEA 4YXHH 4G80A 5B1KA 5IJCC 3AY4C 4QRPD 2LAGB 5SWQB 1FYHB 2YD3A 2TRYA 2P42B 4HKBB 3U7YH 4N0CC 2KZWA 1E9OA 1ET8A 1CD9B 3NESA 3D07A 4X4XA 2Y2TA 3R1GH 3QQ4B 1V3LA 4BK4A 3NABH 3G6DL 1VACA 3KXFE 4FEMA 5CWSB 5I0DA 4E9RA 4AGLA 1M71B 5DD1L 1XH1A 3KYNB 5J1TC 3TJPA 1MFUA 1EXUA 1MPAL 3PF2A 4CBPA 3IFOA 4RA0C 2LQRA 2HN7A 1DEDA 4FQJL 1ZLUH 1AO7A 1LO3H 4ZS7L 4UOJA 1YEFH 4JG0H 3UG3A 5A2FA 4PJ8A 1CE1L 1AOHA 3D12B 2MKWA 4UDTA 3OZ9H 4NQEB 1XEUA 4O9HL 2XX0A 3B7RL 1SJEA 5EUOA 1GHFH 1QFPA 2FQEA 1FL5B 2OJEA 3HC2A 3GNML 2ZUQC 1PZBA 3PAUA 5IVOA 1R24A 4XN4A 1HE7A 4Y7MA 3NFPB 1BWMA 4YQXH 1OIOA 3ESMA 1KB9K 1Z9PA 4HGKC 5TFSL 3AZUA 3E3QC 2Y7SA 3MRLA 4LCWE 3SD2A 3QQDA 4YDJA 1LE9A 2ZPKH 3F58H 4GH7B 5K9KB 2YSSA 1ZVHA 3BAWA 2Q3AA 5FO2A 1T1WB 1I53A 4EIUA 5FLVA 4MJIA 3L95B 1XSIA 4Y4HA 4UMGA 4GY4A 4LHUG 1JYNA 4YHYC 2M1KA 3OXRA 2AF2A 3PPEA 1IEBB 4APQC 2IH1A 4WI2A 1FSKC 3TPUA 5I1EH 4RIRB 3D50A 3NAAH 1PL3A 1X5LA 3VH8G 1I9IH 2V5MA 3V6OC 1S7SA 2HFEA 3ISRA 3O8XD 4NZFA 3OKLA 1JXDA 4PGDB 4JM2C 3KVQA 1YHPA 1J88A 3SDXB 3V4UH 2HVJA 1UM4H 1QHPA 2X53A 4HUUA 4XPHH 3VI3A 1EAPA 3LNGA 3D85D 1T6VN 3EH4B 4HULB 3OV6A 3UBXA 4HWBH 1DDHB 2OMYA 3QZBA 3DXAA 1RERA 3S36L 4F57H 3W56A 1KYAA 5DTFB 3W39B 4XCNB 3EXLA 3DURA 3GMQB 3JVFC 4R97B 4Z7VF 5FA4B 4PV9A 3P4LA 3QQ3B 1OAJA 2V3DA 1KTKE 3FU8A 4QHLB 3CSYB 3HN8A 3SQBB 5IROD 3X11B 3VNZA 4NQEE 2KBGA 4DGIL 1HZHH 4KKAC 2K45A 4MXQC 1QO3B 3VQMA 4AQ1C 4AEIH 1HINL 1NFIA 3MBEA 4LCYA 3RZCD 3EF7A 5F7HA 2GUYA 5CLYA 3H4FA 2VM3A 4HSQA 4YLBA 4LKCB 3PUCA 5I5JA 3LNHA 5D1ZI 2WCPA 3QUKA 4RAVB 5GJTL 1CFSB 2P45B 3VMNA 1B9KA 4LASL 5I1IH 1H5BA 1E5ZA 1UUSA 5L6YL 3VXNB 2N1TE 3TIDA 1VA9A 3ZIYA 2FHCA 1M6UA 3GHBL 1NFDA 1BOGB 3U36B 1LXMA 5DQJA 3IPEA 2RA1A 3EOYG 4YK4B 5FM4A 1JZGA 3OKMB 1FJ1A 3UMTA 1W8EA 5I30H 5E2VH 5I6XC 3SDXE 2DQDH 3HPLA 5F1NA 1CF8L 4TVPH 3KPTA 4JPVL 2R23A 1RURL 4MA3B 4JHWL 2PPFA 4O02B 5IMOB 1GYUA 1ZS2A 3M1CA 1IBYA 1R3JA 1FL6B 2AQSA 3MRMA 1M2OA 3Q13A 3VWKB 3D6GA 5FUZH 4J3BA 5CM1A 5KZCB 3HI1B 1F58L 5I15H 1IGYB 1ZA3B 4JFOA 3AS3A 4I3RL 2BP8A 2LGNA 3T8XB 4IJTA 1T89C 4NN5C 1P5UC 4NO5B 3VFNA 4HFWB 4XT1C 5KVDE 1FBIL 3IKCB 4X6FB 3C5SB 3UZVB 4HISA 3WKMH 4PLOB 3C60A 1KCKA 2QVKA 3CFTA 3QQ9D 4J28A 4Q8BA 5HYIA 2JJWA 4MAYB 5EA0L 3BZ5A 2E4FA 4I4WA 2BP3A 2BMKA 1N3NA 2VQ1A 2BPBA 4H0HB 4BZYA 3CFDB 3FUIA 3NCFB 5D7JB 1WA0X 1LE5B 1JUFB 2BP5M 3A6BH 4K73A 2O61A 1TJXA 1NBZB 3ZTCC 4PI2A 3FT2B 4MCMA 3STZA 4NZUL 1UOKA 5T3ZE 4X2UA 3EO9H 4PGEA 4PV8B 4I2XA 3O9WD 5IEHA 3O3AB 4TNWF 1D5BB 1AKJA 3NSYA 4LSPL 4P0DA 4Y16C 5HI5C 2DLFH 3L4UA 5JHBA 2R2EA 1T5KA 3IU3A 1H8OA 4QRPB 5J13C 4L4TA 3MRPA 2NY3C 1V7NH 1Z2KA 4XPTL 4LPTA 2YPKA 4Q7DA 3TV3H 2XPZA 1FG2A 4HLEA 4DOHB 4LHUA 4R4BB 2PCFB 3WLWC 1U8QA 1KUMA 2J5LC 3FQXB 4NFBA 2AK1L 1FO0L 2KLRA 2YD7A 4HKJB 3VH8A 1EHNA 1ZEAH 5DQ9A 3RX8A 2AEQL 5AZEL 4ZMQA 1LILA 2DI8A 1ECZA 2J1YA 3V6BR 1WF5A 3RWJA 3OKYA 3X3FH 1QFUH 5FYKU 4XN2A 1DJGA 3MODL 1WFUA 2IBBA 4LSQH 2YAMA 3EFOB 3IDGB 5E8NB 1KDJA 3U7WL 2OTUA 1IO4C 2E56A 1M2VA 4DPBX 5JW5B 4OQTA 5ILTL 4HJ0D 4B9GA 1I1YA 1UT2A 2WQUA 1CLVA 1K8DA 3SDXF 2APSA 1WA1X 5FR3A 4U1JB 4H88H 5ERWB 3WY3A 2ZUVA 4PJ8C 1XQ4A 3LKRB 3Q1EA 2NX5D 3HLAA 4N5UA 2NCEA 1MAMH 1P4IL 1PX8A 2IH9A 3SKNB 1VKXA 3EDFA 1UVQB 1YQVH 4LP5A 4XP9L 4NC1C 3NCBB 7FABL 1F00I 3O8XB 4AGPA 2WYHA 4GO9A 4B7IA 2OCJA 1ZHNA 2WUBL 4IOFC 4QRPE 1OE1A 4JFTA 5MI0C 2A9NH 1IVTA 1BZ9A 4GEIA 1NC2A 4YN3A 5GXBB 4NQXA 2BSSB 1DQLL 1HDMB 3LKOB 2MH4A 3VFTB 4XCEB 1MCBA 3D85B 5C0RL 4FNTA 4K71B 5C7XL 4Y4HC 1P7QA 4DOHE 5BJTB 3HG2A 3QAQA 5TH2A 5HVWA 5I75B 5IP4A 5HPOA 3K4DA 3DUHA 3S98A 2WWKO 2CJUL 5D2NA 2IH8A 3VXQA 1A7QH 5I1JH 3ZDXF 3B3IB 3GYRA 3T6XA 3DSFL 3D48R 3ROLA 5IGXL 1RUQH 2PNDA 3MX0B 3S8FB 3KGRA 5L0QC 1RJYB 4NP4L 4NIKB 5DJAA 3LKQB 4G3YH 4GQQA 3L3JB 3T0ED 2ATKB 3PWPA 4DN3L 3QZOA 4ODVL 4J3OF 1O7DC 3UBFA 5IBTL 5C0IA 3RZCB 2P46B 2EVFA 3N1MC 1JWSA 5F93C 1XF5A 2FWOA 3L9YA 1OL0A 5HHMB 4QWWD 4MNHA 4UINL 2ZXCA 1U3JA 2JTDA 4JCMA 1CFBA 3BP7B 2BNUA 5DGQA 2R29L 5CGTA 2VKWA 3U4EB 4KGLA 1S7QA 5EZOH 1G7PB 3HNVL 3UO1H 4AGNA 5DJXB 2A3TA 1NBQA 2EYSB 2EC9T 4YHLH 4KI5D 2PTVA 3L13A 4PSRA 4XVTL 5KYWA 1CB4A 4M8QB 5CINL 3MBEC 3WTXA 1QZNA 2Y23A 3EG9A 1DVFB 4X9FA 3QO0A 4ZUVB 1HILA 1D6EA 4ODSH 1DLFH 1I8IA 1HVXA 1PMYA 2AJZA 2WVVB 2ZKHH 1UD6A 3LRKA 4A7VA 2DQJH 3V0IA 2NUPA 2OMTB 5I6PA 3U30B 1GZPA 1SQ2N 3OG6B 3PGCA 1FO0A 3MNZA 1ZTXH 2N7SA 4CDHA 5GGRA 3WTWA 3RL2A 3IFPB 4X7SL 2QQKH 2H5UA 4WTWA 3O6FB 1WWBX 4JZJB 3L3GA 1SFHA 1S2EA 2FUQA 3IU4H 3BP6B 3HCVA 1CK0L 3P3UA 4KXBA 4K9EC 2DJUA 1GKOA 3QZWB 1U92A 1QPXA 2VXQH 5DMKA 3BPOB 5EULV 2XYCA 3HZYB 1HAWA 3WFBL 4FFYH 3MRHB 4KTGA 3FK3A 1T20B 1FLRH 3L16A 5GHWH 3U2SA 4AMXA 2VJXA 4WNJA 2AI0H 3FT0A 1FZOA 3BRDA 5HHME 1TO4A 2DYPA 3GPSA 2VR4A 4UTAH 4YC2C 4GUOA 3KPRA 4KDWA 4OCLC 1OK0A 4YEEA 4KVNL 1MJUH 4PN6A 5IW1A 1MFMA 4DVBA 4A37A 4YDKH 3OAUL 3O9WB 3D39D 3I2CH 2P43B 5AD0B 4QOKA 3FTUA 4AXWB 2QV4A 3C60C 1JZDC 3UCQA 2Z8WC 2MCAA 1EA9C 3GB7B 3B9VA 3R18A 3PHQB 4OI7A 1J05B 4X8JB 3ULVL 3L8QA 2KT6A 5EZJA 4TNEA 2YLKA 2C7UB 2NY6B 4GAJL 3O41A 4TNVK 4U31A 5F9JA 3T0XA 2D7OA 2E75C 4L8DB 1LO0L 4GSRA 3OF6D 5I23A 3FU0A 4A04A 4QXWA 5DUPH 3TBVA 1DUZA 5IFJB 1QFWL 4ZW7A 1QUPA 4B5EA 1AXTH 1TU2B 2QDWA 4GXVL 4HIJA 2H47C 4RESB 2FCBA 4OUUA 2B2XH 4PLJD 3CQPA 5KSAD 4GAAA 1E43A 4OZ4B 4DNLA 2OYLA 3EFDL 4FULA 4XMZA 5C86A 1E28B 1YNLH 1TFPA 1X9LA 5BVJB 2VDML 4HC1L 2W1NA 1JXGA 3FTWA 1TJHH 2D3JA 2WWOA 3IXTA 1ONQA 5ADPH 1A25A 1BEYH 1JZIA 4KZDL 5EF0A 2RTTA 4G9FB 1DQIA 4NPKA 2A9CA 1EUTA 1KN2L 1ZAGA 5TTRA 1WS7A 3OGCB 4AL8L 4U1MA 1T2QL 5SX4I 4H8WL 1WICA 2NX5B 4K94L 4OGZA 3JTTA 4HSAC 5FC9A 3TIEA 4EKXA 1ZCRA 2XWBA 3STLB 1OGPA 3MRRB 5GSVB 2X10A 4RFEB 1JGUL 5IB3A 2A0LC 5DJCA 4NJAH 4KY2A 1K85A 4HKZA 1IBGL 3GMLB 3MRQA 1IGFH 1J1XL 3DBSA 1S9KC 4NWTL 5E2WL 3ZHFA 5I66B 4X5RA 5CJQH 4N68A 1OAUL 4HUXB 2DBLH 4DKDC 1YO4A 1RZFH 4UQEA 1ZIAA 4AM0A 1K8IB 1M7XA 2CBOA 2WVSA 4HF5L 1CZ8L 1FGNH 1Z3RA 1S7VA 4PWIA 5E9DA 5I18H 5CP7B 1PY0A 2KERA 2P8PB 2G9HB 4FZEL 3FCBA 3ZHNA 1GY1A 4LLUA 4MX7B 4ENED 4KTYA 1W80A 1Q72L 5F70A 2HFFA 2HLEB 4NENB 2UZXA 3RWCB 3DX2A 2QSCH 1YPZE 4X7EC 3ARYA 4C47A 1TEFA 3WD5L 4JJHA 4YMPA 3Q01A 3KG5A 4K7PL 2W0FB 3SEPA 3T0EB 2EEXA 4B9IA 5GRUH 4G9DB 3V4PL 3ULUC 4NBYB 4X0NA 1C9SA 2J44A 2WKGA 4PIRF 2OZ4L 4PRPD 1X9UA 3TX4A 4HWEL 3BSGA 1J9RA 1A6TB 2PF6A 2K1MA 3R8QA 1ZLDA 1BVKB 3BUDA 4GYBA 4JAMA 5D2NC 1E27B 2DAVA 4YHPA 3WUWG 1D5ZB 1GYWA 2ZCHL 3MC0A 1LD9B 4G9FE 4ZUTA 5LG6A 3EGDB 3F7YB 5DR5L 5FFGA 1AZVA 3H7BA 5I1CL 2NX5E 2P44B 3D2UA 3F6LA 2DQCL 2J1KA 3ESOA 2P52A 1R1CA 1FNAA 4H8QA 1AR1B 2P24A 1BEXA 5EC1B 5DFAA 3QRGH 1E4WH 4M7JH 2A4CA 5JR1H 2JXMB 1H3TA 1ZT4A 5GRZA 2D3NA 4W9CC 4G7SB 4UI2A 1S3KL 2VLRD 2APFA 5AW7B 5FYJE 2C8NA 1URIA 4F2FA 1RK1B 3RB5A 3G04A 2OR8A 3DYOA 1PGRB 4M8VA 5AVWB 4HIHA 2CO1A 4KTDL 1Q1PA 5IMKA 3Q2LA 1RL1A 5CCGE 1W0WA 4QT5B 3GI9L 3CFKA 5DEGB 2V3FA 1QZ1A 3L9EA 3QCUL 4A68A 2Z35B 4XP5L 1XF2A 4G6MH 2XJKA 5DRXA 3AQYA 5DQDL 1HHHB 4BQBA 1MQKH 3RURA 4U6XB 1DJWA 3GMMB 2VLJD 2RJMA 3T0EE 1XBRA 1EZUA 1WFIA 1JGDB 5CSZA 3SD5A 2EH8L 4Q74A 4ONHA 1BJ8A 2R0ZL 1I9EA 1DFXA 2VDLB 3BAEH 4ZD3L 5HYFA 2EUWA 3G5YA 1ORSB 1ZA6A 3QG7H 2E59A 1A7NH 4O5LL 5IB1A 1P2CA 4H0LC 2WCGA 3CCHB 4ZOBA 5I0ZA 1MXDA 2BVQA 5EHFA 4XTRD 2ADJB 1WWCA 3UYOD 2YFNA 5KYYA 5ICZB 2RB8A 4LLDA 2OJZH 2ZOLB 2IDQA 4M5YH 4P5TD 1M7DB 3BW9B 1AHWA 4KI5E 3HS0B 3O0RL 4LNRB 5E0FA 1P84J 4L1TA 3VRIA 3B2MA 1QSFD 2X4OB 1N8ZA 5I8EA 3W38A 1Z5LA 5FF6B 5I6LA 4O2CB 1YPZF 1ACYH 2BS8A 1SOKA 2VLLA 4HJGA 1AY1H 4I9XA 3GLAA 4ZOCA 3S7GA 1ETZA 2XTJC 4U3HA 4TSCL 3WEXA 2BXYA 4OZHF 5IW3A 1OM9A 4HBCH 4NKOA 3WOVA 3BN3B 3IDNA 2IPKB 4EBQL 3N5AA 4JO4H 3RVXD 4EF3A 2W80C 3T9WA 4M62H 1PDKA 1LO2H 4YHNB 5HD8D 5IIEB 3Q8EA 2GTWA 2KDYA 5EU7C 1SFDA 2G3NA 4RGOL 4ONOA 5F0LB 5C9JB 4P23A 2GW5A 5C6WH 4HUNB 2A4ZA 1GTFA 4KKLC 1W15A 2GSGB 3HN3A 5F89A 4Y2NA 4ELMA 3MV9D 4FQIH 1IIIA 4PRAB 3BLKA 5I8KH 2CJTA 1DVXA 5FW7A 2OXHB 2DTML 1FVEB 4KUZH 3C12A 3KHOA 4LOUD 1ZT1A 2G75A 1U2CA 2CGZA 5L4FA 2AXGB 4R96B 3GDBA 4K07A 4EEEA 1A6UL 1LP9B 3QJFA 4D9QD 2GY7B 3BQUA 4TSAH 3CVHB 1BSIA 2ZUSA 4HEME 4N28A 1E4JA 4G70B 4HZLA 5A2LH 5AAPA 2C3XA 4XP1L 4JY5H 1TQCC 3BVDB 3VE0B 3WUWA 1VZIA 1Y0LA 2D03L 1BF5A 1PNCA 3LXCA 1WIOA 4WK2B 2Y1AA 1K2DA 3ZBMA 3I50H 1NA8A 3TO4A 2ICWI 1HZKA 2WIMA 3RJDA 3VWJA 5GS0L 1WZ1L 3O45B 1Q9KA 1G94A 3EUUA 3T04D 3V9EA 1P1VA 4E0RA 3JTSB 1G7QA 2A83B 2DQTL 3G6DH 1XL4A 2HRGA 2YLHA 4YHIB 5F7KC 1ZE3H 1M3IA 3RUGA 5DD1H 3K6OA 3GWJA 4PJBF 4YBLB 2P5EA 4XNQB 5F9OL 1MPAH 3RWDA 2JKNA 4WTZG 1F86A 3HZMB 4FQJH 4KXDA 4R4FL 4U6HA 3QUXA 1CE1H 4KI5F 2K8QA 1TVBB 4LP4A 2WB7A 4OZFG 5FYKD 4O9HH 4A6YA 3MV7D 4PRPB 3RHWK 2Z7YA 3GXIA 4E42A 1KGJA 3GNMH 4NLAA 4UOW0 3E0GA 1NIEA 2FNWA 5DWPA 3HFML 4TUJB 1KB9J 3H9HB 5TFSH 4JPIA 3VI4F 2IH3A 4N1CA 2WLNA 3WN5A 3EJZD 2CJSA 1A7RL 2YGVA 4CU8A 3ZYIA 2FWLB 3D2TA 5HDLA 2J2ZB 2OSLA 5JQ6H 1LP9E 5CO1A 4YSDA 4ZUWB 5GGSB 2EIKB 2R7EB 2AQ2A 1AGCB 2UVFA 2YAHA 3NPZB 5C0BD 4WUUA 1NM4A 3FTZA 4XP6H 3CBJB 1KXQE 3K7UA 4U3XA 1XF4B 1XF3B 2VLRB 1MRDH 3NRFA 3NZ8A 2H0PA 1J86A 3KM1A 4BQCA 4XOEA 1MF2L 3HE6D 1R3KA 2GUOB 3ARPA 1HL8A 2SODB 3FYIB 3HAEB 2XG5B 4AJYV 1MN4A 1ZXKA 5E5UB 1MUJA 3CSPA 4Z7AA 1T22A 4Z0XA 3M1BB 3S48A 1FV1B 3S36H 3ULVC 3P3RA 4Z7IA 4KKRA 1LEKA 3QYMA 1WCQA 1FC1A 3T5WA 2VLJB 1HL4A 4IOIB 4L29B 2ZAGA 5LUMA 2W8CA 1PTZA 3B5TA 5IG7B 3WE6A 2Y6SD 5DJ6B 1FVCA 1WUNT 4DGIH 4E36A 1XTLA 1NDGA 3MCYA 5FFLA 2XVBA 1EPFA 4PJEA 4XO4A 1G5AA 2HT4D 1P1ZA 1VIWA 4CU7A 4U1IA 5I73B 2J7LA 4TF4A 4DKAA 1CDBA 5C0DB 3QORD 3O3BB 1Y6KR 4ZX4A 2ZXAA 5HDOA 4P5TB 5CJ5A 4BQ9A 1JWMB 4OQTH 4PRIA 2BVPA 5EU4B 1NPNA 3ARDA 3BRFA 1CTOA 1OAZL 1QSFB 3WKYA 4LASH 3OXSA 1CDJA 1Z66A 5J12B 2F5AH 3AVEA 4N9GB 1AD0B 5T1LD 4O2EB 4Y8AA 3GHBH 3DKHA 2VLRE 4AL8C 4H8WC 2XN9D 2F7PA 3UROR 3HZVB 5DI8A 4ZSOB 4ZS6D 2WBKA 4LLYB 2QVIA 1FP5A 3M7OA 1BWWA 1AOZA 1CF8H 4JPVH 1AQHA 1AHWC 3LD8C 1RURH 4JHWH 2UZYB 4NKIL 5I8OL 1HHJB 2B20A 1IKNA 2C9PA 2WPGA 3BAIA 3FFCA 3ULUH 1X6NA 3HKZA 5LGHL 4LRNL 5T5NG 3WXVL 4FFVC 1F58H 2XG4A 2XPYA 3MGOB 2CLRA 2VN7A 3VO0A 3S9DB 2VLJE 3V6ZA 4YOKA 4ZOAA 1U93A 4I3RH 2DQFA 1JGLL 3FSWA 1JV2B 1LP9F 3QFDB 1NC4A 5JOEA 3ABZA 3HS9A 5IM7A 5AW2B 4HJUA 1FBIH 4A67A 2B5IB 3MACH 1XHHA 1CIDA 3QE5A 1WGVA 4JX0A 1OTTD 4Y9CA 1HKFA 5FGRA 5C6PB 3V9FA 5AG8A 3BAJA 1J0YA 4D8PB 1ND0A 3Q1SL 4PUBL 4N6RA 1WBYA 4WTZA 3VFUA 5EU5A 2MSPA 2VC2L 3N41B 3FRPB 4BZ1A 4CSZA 1Z3GL 4PI0A 3UJTL 4CVWA 4WCYH 3UO8B 2WXJA 2BS71 5ICXA 4E5XG 4NZUH 1QSFE 1KPRB 1XX9C 2XFXA 3G5ZA 1DBAL 4P23C 3OC5A 4X5XA 4RFNC 4LSPH 4MA7L 4CL7A 4QXTB 3HFFA 4MTMA 2JB5L 4BCYA 5J9PA 4V1DA 4BEIA 4LIQL 2F1BA 3P73A 4ZSOE 4XPTH 4J7RA 4ZMLA 1ML0A 2F8IA 2IMMA 3Q9QA 4HV8B 3E6FB 1X5GA 3L4XA 2FHBA 2YUZA 3L3DB 4YDMA 1ETB1 1JXKA 3EYQC 3BQUC 3N1GC 5EF3A 5DJZB 4HS3A 1QPPA 5IHWA 2WLIB 5F7DA 2ZXDA 2AK1H 1FO0H 1KN4L 4GRLD 3WO3B 1EBAA 5DT1L 1DN2A 3TEXA 3US0A 4R0LB 1TJIL 3WXWL 1WHPA 3N43F 5H2BB 4DEWA 3IDJA 4J1UB 3VWJC 5HGDA 1ZVNA 4TNVF 5C3TA 3ARZA 4U0RB 3L1EA 1NCWL 1RV6X 1YYML 3P3SA 5DUJA 2L7JA 4UAOC 4EN2A 1WEJL 1CFTB 1S7XA 3REVB 4OKVA 5DA0B 3HPJB 3VG9B 5ITFA 1XB3A 4W6WB 1U8MB 3QUXC 4P5MB 1KBGL 4KAQH 3ATDA 3QR0A 4GRMA 1CLZL 1P4IH 3E38A 2LVEA 1FNFA 2B9AA 5FA3B 2AV7A 5T1KD 3CZKA 4IBWA 4BKLB 3A5VA 4XP9H 5E8EA 2QT6A 2CQVA 2P8MB 1DANT 3BP4A 1IM9A 3CG8A 1TMCB 1ASPA 3L2LA 5EO0B 3HE6B 2ID5A 1QASA 3AT8A 3WN5C 3ZRCC 3LVTA 2ZSWB 5F21B 1PKQA 3H56A 2IALB 2WXPA 2VDNB 5C0RH 4G72B 1OSPL 5C7XH 1BGXH 3LQZB 3MRNB 2HG0A 2XKNA 5TQ0L 4G7YL 2DLEA 2BSRA 5EBMA 2I9TB 1IGCL 4QRQA 1PJWA 3WHXB 4APQD 2IV8A 1UXLA 2CJUH 1YC8A 2VZUA 4ZJ9A 1IAKB 1NIBA 3IJYA 1RJCA 2LV4A 2BSED 3DSFH 5KG9A 4FXKA 4Y19A 5IQ7L 1M05B 4BFGA 1QSED 3GXNA 2Y07H 1LO5B 4JFFD 1FCGA 4PG9A 4ZNEA 1ZT7B 2IQ9L 3U2IA 4DN3H 2ATAA 4KKCC 2A6DB 1VHPA 1OB1A 1JCVA 4ODVH 1NGZA 3VX1A 2VL5B 3B9DA 2DQHL 4GI9A 1BQSA 1GGIL 4YL9A 5DK2A 1BQRA 1U33A 4JZNB 1R3LA 4HJJL 4UINH 4F8QA 1CLCA 4TVPE 2VW4A 2R9HC 3QUML 4I18B 4I7ZC 3ZE2B 2PCPA 1CFVL 2KC0A 4K5MA 1FNHA 2UZIL 1L6PA 3HNVH 4RFOL 3MLTA 3MRBB 4MXQD 3ALWA 5T1LB 4XVTH 4FXGB 1S7UB 2SEBB 5H35A 4FLQA 4YSOA 2FL5B 4WO4A 2XN9B 2YPLD 3MCG1 3FTVA 4KJWC 1JYWA 4OCSH 1U8NB 4UBDD 3RDTA 1CI5A 4E9LA 3ZL1A 2FBOJ 2IOOA 3ATBA 1EAJA 1WIPA 3MJ6A 4CKVX 4E5XA 4LLVB 3QUHA 4BBWA 3JYCA 2C4FT 1T7XA 3FUFA 3NFNB 5GGSY 4F27A 4UQ2B 3QYNA 3S37H 5BXFA 4GSXA 4LSDA 3N41F 1UH3A 4M48H 3NUKA 3VD1A 1IUZA 4PCKA 1GTNA 5E9NA 5GS0C 4XH2A 1HFUA 4F8TA 1PLBA 2GBUA 3ARBA 3RWEA 3MXWL 3CHRA 4A7GA 1QOKA 4W6YB 3WFBH 4AQOA 3Q48A 5DJYB 4BKSC 4J6IA 1IKNC 2EDMA 2GY5A 3NJVA 1JNHB 4G82A 4WV1B 1B88A 4AE0A 3CFQA 3UH8A 2FEEL 3ZE2E 5JHLL 4NP9A 3CHPA 4A2DA 5L7XL 2R1YA 4LHQB 4OF5A 3LZQA 1GW0A 2CA4A 1AGBA 3HBPA 1H3WM 3GSQB 3DRTA 3RX5A 2KS0A 1A6PA 3BVVA 3DMMD 4EI6A 4HIPA 1MJJA 1KFAL 5C0JB 2XN9E 4ZX3A 2JWYA 3NJGA 4GG6B 2OTWB 2PPAA 2W60B 4UQ9A 3ULVH 1IBHA 3MI6A 4ZTOH 4GAJH 5EIIB 4OD2A 4FMFA 3WNOA 1J10A 5FIEA 1LO0H 1QUNB 3O2WH 1MCDA 4TLSA 5HGHB 1KB5L 1NDMB 1JE6A 2FYYA 4GXVH 3KPPA 3QJXA 4RQQB 4Y16D 3AWEA 5HI5D 3SDYH 1ZKAA 4IJ3C 3CD4A 1DJXA 5JORB 2IO5A 1INQB 3N55A 2NY3D 1KNOB 3EFDH 4EPSA 4KC3B 2OBGA 1C12B 2MQCA 3HC0B 1SJHA 2EYRA 2EDBA 4PTTA 2VDMH 4X4MA 1RZKL 3UTTA 1A3LL 4RNRB 3WLWD 5K9OA 4P4KA 3QUMA 3VFOA 4WENB 4F80A 3S96A 1SHWA 1FNEB 4GSDL 4KZDH 5E5LA 4NDMB 4JFVA 1KN2H 2WSDA 5BV7C 4RZKA 4AL8H 2TAAA 1AJ7L 1T2QH 1G9NC 2YAQA 3L1GA 4H8WH 4LLWB 5H8DA 5KEZA 3WN6A 3FOLA 5AW1B 1YNKL 3AY2A 2ZUQB 1WAAE 5T1KB 4L1HA 5HPMB 3D18B 3SGKA 3MOAL 5CS7A 1J12A 1JGUH 1MW1A 4H20H 3MUY1 4BE6A 3BZDA 4AVIA 2FJHA 1WAEA 4GG6E 2K7QA 1KLFB 3QJHB 4WKZB 1J1XH 2YEZA 3FSAA 4OFYD 4NWTH 5E2WH 3IMRA 3GZKA 1OAUH 5EBLB 1AO7D 3F7KA 3PG2A 4YHYB 4P57A 4JFQA 4PJ8D 5E4IA 1CZ8H 1RHHA 2HX8A 1D5XA 3WNIA 5EN2B 3K6FA 3PFUA 4GW5B 4CJ0A 4APQB 4K3HA 4AM0Q 1FSKB 3BPLC 1OVZA 4FZEH 1T83A 1AQKL 2C9AA 1Q72H 4NUMA 3FQUA 3H9YA 4Y9FA 3ZE2F 1Z0MA 5A16B 4JM2B 4FQQB 1QSEB 3TBCA 4JFFB 2CD0A 3WYRA 4K7PH 1G7JA 3MJ9L 3SIKA 2VW6A 4WW1A 4DJMA 3O11A 3SE3A 4G42B 3O6LH 2V8MA 4MJID 4Y4HD 1WV7T 4TTDC 4G1MB 3V0GA 3GRBA 2YD9A 1IVLA 1J87A 2IMNA 4HWEH 2HFTA 4AG4L 4ADGA 5J4MA 5LQBL 5F96L 3TF7C 4R3SA 2NNAA 2Z64C 2ZCHH 5E1IA 2XTSA 3SYOA 4NYLA 5JUEL 5I1CH 4FXKC 1EMTH 3CVBA 4AW7A 4Q89A 5FGBA 2DQCH 1HL9A 1CGWA 1WCBA 4AQ1B 4N2KA 1UTDA 2VQUA 4EIBA 1O75A 2FX7H 3W37A 1DP0A 3SODB 2JK5A 2JKJA 3DX8A 3E3QE 3PAVA 5HI3C 4BM7A 3RHWF 1CLOL 3M7FB 2WO2B 4NAJA 1JK8B 1EO7A 3EGSB 1UH4A 5DZAA 1S3KH 3QAZC 2IGTA 4ZMVA 4ZQKA 2A1WL 3QPQC 3BYTA 5HYJA 1IEAB 3MKGA 4Z1PA 3KMDA 3QBTB 2WVTA 4KTDH 3JWOL 4FQLL 5KSBB 3H9SD 1HWGB 1KXVA 4HYTB 3GI9H 4L3FA 3GBML 4MJHA 1BFOB 3B5HA 3V6OE 4WO4C 3EBHA 1KJ2B 5E2TL 4ZPVA 2XY1A 4Y88A 4G8GA 2C9RA 3UTQB 3ILPA 5DQDH 5I6XB 5J6HB 1QSEE 2KZKA 4JFFE 4B0MM 1OSEA 1QX1A 5F9AC 4PJ6A 1C16A 2WZ5A 3RDTC 1BBJB 3EYOB 5AQ0A 4KX8A 4QRRA 1WAAF 4NERA 4M6OL 3GD1C 2EH8H 1U8IA 1ZLSL 2R0ZH 1NFKA 3RI5K 4ZD3H 3P9MB 1WSST 3Q3GB 3QULB 4O5LH 4A6YH 3UG4A 4J3SA 3TEYA 4H8PA 4GG6F 2C3GA 3RPIA 3Q6FA 3GHEL 1KGXA 1CJYA 1RIHL 3CV5A 1PLAA 3MXVL 5KANI 3WFCH 2ICCA 1P5UB 4NN5B 2WZ0A 1W9XA 1JF1A 4JRYA 3TTYA 3ARBC 3R7RA 4N2AA 1EO5A 1HXYA 2WNKA 3TA3A 3O0RH 2GIYA 1QBLL 2K3HA 4R8WL 3GSOA 4H5SB 3N2JA 1E6OL 4Z7QB 3N42B 5DMGC 3UAFA 3TCXA 1I8MB 1JAEA 2GTZA 5D5MA 4EVNA 4FKHA 1AE6H 3PWLA 3VD7A 4BGDA 3GSNL 1BECA 1IAIL 2Y7QB 5JIPA 4TSCH 5ESVA 1I1FA 3CMGA 3U82B 1BQUA 2MCPL 1KTJA 1TLKA 4EBQH 2MKLC 4PEEA 4ZFFA 1KJ3L 5KSBE 1TTUA 2PKDA 4E9SA 3QXDA 4Y16B 4HK3J 3DX0A 3IGFA 5J13B 3PDDA 3IMVA 3Q9PA 2NY3B 5EOCJ 3US1A 4JY4B 1TCRB 2YN3A 2R2HA 1XGQB 3PXJA 3QXAA 4W68A 2PPCA 1E0OB 1MCCA 2I7SA 4RGOH 3BT2H 3AMLA 3MCKB 9PCYA 2J5LB 4LSSL 1KYUA 4DZBA 4DPAX 3PP4H 4Y1SA 2IAAC 2AABL 1AKJD 2A99A 2GCYA 4WI9A 5DHVA 3UG5A 4LVEA 5BO0D 3ARUA 3EDEA 1U8JA 4ZAKA 2DTMH 3G5VB 3Q44A 3BO8A 3CZFA 2XXFA 4G80B 4JGJA 4JHUA 4L4TD 5IESH 3SJVA 1SDAB 2BSTA 4UWQB 2DQGL 3VMPA 4TUOA 4HLJA 1E9OB 3FUDA 2HPOA 4X4XB 3RB7A 2KKQA 5FWQA 3F5WA 4LHUD 1RK0A 2DMGA 4X6CA 3LQMA 1VACB 4K15A 4Z7QE 4DSYA 1BXAA 4P4KC 4XP1H 2GI7A 2H3KA 3DVIA 3L5JA 3MV01 1EK3A 4JM2F 2D03H 3IFOB 5D6CA 2EIDA 2HN7B 1OE3A 1AO7B 1ESOA 2FO8A 2VN3A 3EJQA 4PJ8B 2X9YA 3FQNA 1VEPA 4UDTB 2IFFL 5D1QC 1QFWI 5E2JA 3U4KA 1SJEB 5GS0H 5EUOB 1WZ1H 2OJEB 4DO5A 1VGEL 4JO2L 4YS4A 1D2OA 1R24B 1IEHA 1OTUD 1TCMA 1R3HA 3SGKC 2A0LD 4FGMA 4YDZA 3MRLB 5MI0B 4NQCA 2QQQA 3QQDB 5F72S 4YDJB 2NXYC 2BZDA 3ASOB 3GJEA 2XDHA 2A9AA 2YSSB 1H8LA 4R4FH 4R5VA 4C55A 5GGVL 1QRNA 3CFEA 4MJIB 4Y4HB 2HH0L 3U1SL 43C9A 4M7KL 5DMJB 1BJ1J 2ZICA 4Z3HA 2K4WA 2IH1B 3TPUB 1T83C 3DVNA 4XBPA 1S7SB 2BVOA 5DS8A 5I1LA 3MNWA 2HFEB 3TH2T 1X5AA 4BK8A 4M3KB 2DM3A 2OJ1A 1H6UA