3JZYA

Crystal structure of human intersectin 2 c2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
IGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin 2
publication title Crystal structure of human Intersectin 2 C2 domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
A PF00621 RhoGEF RhoGEF domain
A PF16652 PH_13 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3jzyA00
3F04A 3APFA 3FDWA 1DSYA 4PS7A 4TS6A 1TJXA 5G55A 4QJ4B 2KI6A 2CM6A 3GPEA 2WXPA 4ICXA 4IHBA 2WXMA 2UZPA 3N5AA 3QAQA 3QJZA 4A55A 4TUUA 4XZ4A 1E8ZA 3TWYA 1E90A 4GB9A 4EZJA 3KWUA 5CCGE 3ENEA 2LHAA 1QASA 4EZKA 4F91B 4Y1SA 1A25A 2RD0A 3T8MA 4ANUA 2Z0UA 4QJ5B 4V11A 5KJ7E 4FADA 1K5WA 1BDYA 3JZYA 5H4YA 4XE0A 3ZW3A 3APCA 3APDA 3SD5A 1DJIA 4BGDA 2B3RA 3F00A 5JHBA 3CSTA 2K4AA 4GNKB 2WXKA 3OAWA 1DJWA 1QATA 3FBKA 4LCVA 1E7VA 4QAMB 5JHAA 4IQHA 1UOVA 4NP9A 4NPKA 2Q3XA 3HN8A 4LDCA 5G2NA 2WXFA 3L17A 4FJZA 2CJTA 2ZKMX 3M7FB 2D8KA 3CSFA 3W56A 2NQ3A 4AOFA 1HE8A 1V27A 2YOAA 4HVBA 1BCIA 2WXGA 3OHMB 5H4ZA 4QJ3B 3NSJA 3F01A 3DPDA 5T8IA 4WWOA 3NZUA 4WWNA 1E8XA 3ML9A 2K3HA 3P2BA 1DJGA 2K8MA 4NPJA 1W16A 2ISDA 1DQVA 3R7RA 2FJUB 2NCEA 1UGKA 3RPBA 2V4LA 3QR1A 4PS8A 1E8YA 2Q0ZX 2CJSA 3NZSA 2N1TE 1BYNA 2WXHA 3S2AA 4FLHA 2CHDA 1DJZA 2WXRA 4ANXA 1E7UA 3PREA 3HIZA 3L08A 4AJWA 4HLEA 1TJMA 3TL5A 4KZCA 3QARA 4EZLA 4DK5A 4Y1TA 2X38A 4FJYA 3B7YA 3KWTA 3TJPA 4PS3A 1RSYA 4OVVA 4G11A 3HHMA 3W57A 3IBEA 3L13A 3IM1A 4JPSA 4WEEA 2CM5A 4KITB 3QR0A 5CCHE 2ENJA 4DNLA 4FA6A 3LJ3A 4L1BA 2WXOA 1E8WA 4FHKA 2Y3AA 4FHJA 4NS0A 4MJJA 4OVUA 3PS6A 2K45A 1DJXA 2QZ5A 2ENPA 3L4CA 4LT7A 1WFJA 4ANWA 1W15A 3DBSA 4F92B 2DMGA 2CHXA 3L54A 1RH8A 3R7QA 2A4ZA 3PFQA 1CJYA 2WXQA 1WFMA 4WWPA 3F05A 3ZVVA 2WXLA 4URKA 2WXNA 2FK9A 3PYCA 3ZIMA 1RLWA 2WXJA 2EP6A 3MJWA 3ML8A 1GMIA 3PRZA 2CHWA 4ANVA 5CCJA 4F93B 2A5UA 2YRBA 4L1LA 2ENQA 2NSQA 1YRKA 1UOWA 3RDJA 3L9BA 4XX5A 1DJHA 2WXIA 3QK0A 5EDSA 4L23A 2QZQA 4J6IA 4KZ0A 4WAFA 2R83A 2BWQA 4TV3A 4ICWA 4BFRA 2CHZA 1DJYA 4F1SA 4L2YA 2DMHA 4FULA 2JQZA 3L16A
chains in the Genus database with same CATH superfamily
5ETUA 4N22A 3MCG1 4XWOC 3IJ7A 4JFXA 2Y36H 1V3KA 2XWJB 4P2OD 5JHDE 5F88A 3RWGB 3EO9L 1S5IL 2HVJA 5EA0H 2JK5A 2W9EL 3QUGA 4X8GA 5AZ2L 3VCLB 4QTHB 1J9TA 5HI4C 1KN4L 4DN3L 1KBBA 2QKSA 3NN8B 1M71B 5FYKH 2D31A 3G5VA 2XKNB 3HNVL 1KG0A 1OWRM 4KZEH 5M7QA 3QZBA 1LEGA 2NY3B 2ESVD 3KDMA 1KYUA 1D6VH 4HUXB 5D1QC 5HJGA 5IUSA 1J9RA 1J1PL 5T3XL 3HUJA 1X6NA 1Y7VA 3KYKL 2R69H 4KVCH 3D3VD 4UIKL 3CBJB 3DC0A 3K72B 3UBFA 2C9VA 4JB9L 4OM0L 4BQ9A 1QFOA 4D3CH 1ZDQA 2EYRA 4PJ9B 2NNXA 3HS0C 5C0NC 4HJTA 3BFQG 5CILL 4ZOBA 3D69B 3QH3A 3NA4A 1YYCA 2Q7YA 4XAWH 1E65A 4M5YL 1DLHA 3BW9B 2ESVE 5L6YH 4GBXD 2MQ0A 2DS4A 3V0VA 5BO1L 4OFKA 1S7SB 3GSNB 4X5WA 3MRJB 1FORL 2DD8L 2EDTA 2VDKL 3LNFA 3MCYA 4M3JA 4R96B 4UTBH 1I31A 3C6SA 4I2XA 5C70A 4JR9L 5BRZA 4YH6A 5LDUA 1LQSR 1USQA 1D5XB 3BZ4A 2HN7B 3MRPB 2L7UA 3NGBC 4TQEH 3MLPA 2CHDA 4G8GD 1L4IA 5CZVL 3SJVD 1T04A 1VERA 3L4ZA 4POZD 1T4KB 1NC2A 2B08A 3ZUNC 2F8VA 3V0DA 1KCWA 3FSZA 4LCIL 3IWVA 4WWKA 2HG0A 3N1QC 4PJ8A 3O6KL 3IDGB 2ROXA 3RDTC 2EDWA 3H3PH 5ALCL 5IB4B 4GW5A 3TIEB 1E9OA 1PIFA 4QIRA 4H0LC 1IM3A 2FAUA 3SKOA 4ZUVB 1O0VA 3C75A 3GHEH 1G94A 1KTCA 4TQPA 4XMPL 3NQIA 4ZAKC 5JPNA 2DWXA 1F4HA 3DTDA 4IKIA 5F9JA 3U46B 1EJOH 3LS4L 2H3XC 2PP7A 1UA6H 3O3AB 2ZTBA 3HC3H 1CI3M 1JD7A 2CRYA 1O6SA 5DUMH 5DMKB 4LVNC 5FLUA 1ZEAH 2ZYIA 1XEDA 3L45A 5EEUA 3GSVA 1KCKA 2UYLB 4K7PY 1MQKL 4H5SB 4L8DB 2GCYA 1HK6A 3CBRA 3VGAB 1Z3RA 3PL6A 4POYA 4G3YH 2BP3A 5GRUL 1YNKL 4BE6A 3P4NA 4FG6C 4M29A 3RWCB 3L9RB 4TNFA 2VMEA 1QYGH 1QOKA 1HDMB 1LP9B 4X7FC 3GJEB 3RY5A 5H4YA 2HLAB 4ABVA 3LKSA 1NCJA 3ECBA 3FB7A 5CR8A 3QJUB 12E8L 1GGBH 1P7BA 3PIQB 4XO5A 2CDEB 3ZT7A 4KTGA 1A5FH 2G0KA 2GQHA 2FGWL 3QEHB 3RNQA 2VDMH 3B9KD 3HB3B 3R0NA 1NFDF 3VGDA 3LXUX 2P80D 3DX0A 5FW6A 3T5WA 3WTUA 3N06B 4YDIL 1BGXH 2VLKE 1ACYH 1H3VA 1RUAH 1YY9C 1A65A 3ASOB 3O45A 1IQWL 1W0YT 1ZTXL 2QBWA 2Y22A 3DDFA 4HS3A 4FP8H 2GTWA 3ARFB 1HIML 5CSZA 2OK0H 43CAB 3LRGA 1KTDA 3E0GA 3H54A 4FZ8L 4PW9A 4Z3IA 3CFCL 3ZSSA 4C57C 1FYTB 2DI8A 3VTTA 3P2BA 3H9SB 2G3NA 4HF5L 4XP6H 2Y72A 2R1XB 5E8OB 1KB5A 5SX4I 3APNA 4OJYA 4E5XB 5L2KD 3NJLA 4AVHA 3B6SA 4L5FL 3ZDZB 1ZTXE 5HYQA 1NIAA 2X70B 4YGVA 3WL9B 4Y5VA 3MRDA 2CALA 4HH9B 4H1LG 3RX8A 2OULB 2P52A 3X1GA 2FO8A 4FFVD 1QW9A 4GRWH 2DL9A 4I4WA 3QRBA 3TZVB 1DQQB 2DZEA 4M6MH 3QCUH 2AXJA 4L9DA 3TNMA 4B5ZA 3IDNA 4O9HH 1SJHA 3IGLA 1MI5D 2WO3B 4HCIA 4W4NA 4GY4A 5E9AA 1I1CA 3CK0L 4I8DA 4UOQA 3U4EA 3AS0A 1RURH 5MEQB 1GGYA 2YPLD 3Q01A 5D72L 1JV5B 4F92B 4H8WL 2DMGA 5D1XE 3I02A 1A1NA 4AM0Q 1U8QB 3KCWA 5DRXA 2A6KA 2H41A 3K80A 4D9RD 5CAYB 4Y4HB 2D0GA 1PKQA 3NZHH 5KS9A 2VDQB 5ERWA 5JIHA 5I19L 4HD9A 2Y2TA 2XYBA 3MCKB 5I66B 4LCWD 1XGQB 2BOCB 2YPLE 5BQ7A 1R3KA 2YD0A 5DQDL 2XIIA 4FI8A 3CFEA 4O2CA 3DMMC 5B3JF 4OGXH 4HA1A 2M8XA 4G6JL 5ANMA 4DFIA 5JR1L 3HI6H 4XNMA 4LF3B 4KV5E 4KKBC 2Y7NA 4LK4A 1ZGLA 4HWUA 5I5JA 3FUFA 1PSKH 4I13B 4TVSa 3GS4A 4FL4B 5EU3B 2J4WL 1MFAL 4R2GD 2LLNA 4FQIH 1FJ1A 3HG1B 3FUDA 3U30B 1IZKA 5IF0A 3EGXB 1F45A 3I50L 4J8RB 4N8VA 4TVPD 1CVRA 1FBIH 1FV1B 1DJIA 1JZ3A 4OGAC 2VZSA 1HQ4B 2ARJA 1Q0YH 3O6FC 3NFPA 5JHAA 2HRPL 1JWUA 5HHNA 3T77B 3AM8A 4JFDD 2TRYA 3RGVA 1EK3A 4IIQC 4GXUM 4DKEH 3F58L 2J55A 2PWDA 3WLWC 4TVPE 4L8SC 3SE9L 4ZG1A 4U1NA 4ZNCD 3D18B 2C7UB 3DX7B 1QRNA 1G5AA 4XN2A 1B6DA 3FZUD 4JZNA 3BPLC 5GISL 5TPWL 3MV7B 2IQ9H 1DJGA 2D73A 4BFIB 3R0MA 2HP4A 3B5TA 2XG5B 4E42A 4N68A 1USZA 1WBZA 3GS0A 4I18B 3EDKA 5JNYA 2HT4C 3GO1H 1KBGH 3MCLL 1NOFA 4P8QA 1SGKA 1DVTA 2OW6A 5E4AA 4X0KA 3MNVA 2VQ1A 1YEFH 3TFBA 1HEJC 2B16A 4WU5B 1KFAL 1A6ZA 1K4DA 1N7ML 3BE1L 4JM0A 5E1GA 1C08A 4K7FA 4JGJA 3RWJA 1F3DJ 4GEJA 3STZB 3HZYA 5D2NB 2J1WA 4TSAL 2WXOA 3TH4T 1CICA 4Y9FA 4QXWA 3FQ2A 5HGAA 1T3FA 2JI1A 4NN5B 4OFYD 5LCVL 5KW9H 3CXFA 2GUOB 5HDOA 2JE8A 5BZDA 1ZK5A 4ZS7L 3ZHLA 1FLTX 1I1RA 2OMNA 4F7TB 2Q6WB 3T3MF 3OGCA 2VO5A 3AREB 5I17A 3Q6GL 2FEDC 2G5BB 3EJUA 4O02A 4HUMB 3WXWL 3PRZA 2OZ4H 2NX5D 4OZIB 3V7AG 5HY9A 3KM2A 3KWWB 3UTZA 3W37A 1RZ7H 1QFWM 1ROWA 25C8H 2ZPKL 4RMUA 7FABL 4GT7A 1G7QA 3NP4A 1S7WB 1L0QA 2NQDA 4UTCA 1P1ZB 2ZCKH 1P1VA 2EKJA 4PJCB 1HXMB 4NGHH 2VSCA 4D2NA 1KLFB 2WGXA 1U8JB 4EZJA 5TGBA 4B5EA 1B9KA 3OJ2C 1DVFC 1Y0LB 3T0WA 1MFEL 3QS2A 5J13B 5FKPB 1KT2B 2B1OA 1J87A 1O7VA 4IJ3C 1RJCA 4JLRB 2IGFH 2CRMA 5IK3A 2CU9A 2D7QA 1LD9B 5GS2D 2AGJH 1YEHL 3OSVA 4KNTA 3MRMB 4NJAL 2J5LB 2R29L 1WCQA 3U7WH 4M56A 4Q8BA 4F7PB 1M7DB 3ASWA 2LV4A 3I3DA 3OKDB 4PWGA 5DJAB 2Z0BA 2PXYB 1NCIA 3ATEA 3TONA 2YHGA 2JLLA 5K9OA 2XWZA 5GRJH 2HRHA 1AGDA 3ZE0B 4HUCA 3EOTL 1DSFL 4N1HB 3RGBA 2Q8AH 3CLEH 1YMME 3ZTJH 4C56B 4ZFOB 1WA1X 3FB8A 3P4OA 3EOYG 2BS8A 4WV1B 1U8HA 2CSPA 3QUMH 3WYRA 1RP8A 5L88H 1RJZA 4XP1H 3VI4B 4GSDL 1VGEH 1TZ8A 1C5BL 5E94B 3UABA 3L3IA 3QPQD 5JYMA 1BAGA 2HG5B 2TSBA 3VXUA 1IARB 5DF0A 4MD4B 3RA7L 3OHXB 3VYNA 1BLNA 2OLDA 1PZ5B 1I1YA 1SN2A 5I1CH 3QVAA 4NCC2 3P73A 2WUBH 5AUMB 4HU2A 1U9KA 4LEBA 2EVIA 2UWEF 4AC2A 2ZIDA 4UMGA 1QRKA 2IWFA 2OYKA 1E8YA 3BVNA 3TVMB 2KQNA 2P4AB 2DYPA 2MJWA 3TO4D 4F80A 4JO8A 3JVFC 4R4BA 2FUQA 4JCLA 1BX2A 2FLBT 3JZ7A 3TFKD 3HS9A 4UILH 3KPRA 4BKLA 2P5WA 3GJFB 4KXAA 4XCEA 3IAPA 5KEZA 2J6WA 4RISH 4U1SB 4XXCC 1GTNA 4LASL 1MVUA 4YDNA 3ME0A 3DNKA 3FN9A 4JHBA 4NUMA 3K6SB 5I1KL 4QY8B 2P8LA 4XE5B 5I8OH 1AHWB 3QUXC 3D08A 1J8KA 5E8NB 3AWEA 4XTRD 1MH5B 2BX5A 5CCKH 2WZ0A 4X6BB 4ES9A 4XHJD 4DFHA 3QR2A 4QRQB 5HI5C 2EVGA 1NCCH 2ZUQC 3I6KB 1ZANL 5FYLL 1TPXB 2WBXA 4JGMA 4HWNA 4N2LA 1MN4A 4ZO6A 3IPBA 2YBGA 3OKEA 1DFXA 4LLDB 4LNVA 1P2CA 3QUZB 1YHPA 4YHML 5GS0D 4YDMA 4Y7MA 3HUJF 5DHVA 1A7QH 4P4KD 1T5WB 5ESAB 5I1HH 2YUWA 3RU8H 3RWEB 1MLCA 1Z9LA 1PY0A 4TNEA 1E4XL 3E38A 4TL4A 4MMZC 4UNTA 4XCNB 1OGSA 5ENWA 3SDDB 5BV7L 3UBHA 5I6LA 3JT2A 1KCVH 3M7OA 4ODVL 1PZDA 4K3JH 5C0AE 4Z8FL 4AWJC 4N0YH 5IJDC 1HKFA 3WN5C 1AXTL 1JK9A 4QCIB 4KVPA 3S3DB 3GUFA 2CWRA 1SM3L 2YEVB 4HSQA 1E4WL 5A3ID 1LYQA 1A25A 2J2ZA 2GJZA 1Q4NX 3QIUC 4HISA 3N85L 4YL9A 1BDYA 4RFNC 3P11H 4A2DA 1IGFL 3S0PA 4YLCA 1U91A 3Q8EA 5CEYA 2P5EE 2YEZA 1BYOA 2CLRB 3WIFB 3WFCL 2J72A 4RIRA 3FMGH 1BPVA 4XP4H 2ZAHA 4G5ZL 4EAEA 5DFTA 4HCRL 1ZOXA 1QSEA 3D85A 1IKOP 2EDEA 1CLOH 3CPLA 2QPEB 4P46C 4B95C 4Q9RL 4NZJA 2GJ6E 4KH2A 2R4RH 3LB6D 4KJQD 1ILSA 4L4VE 1TF4A 1DZBA 1SOKA 4M1GH 3UXFA 4UT9H 3GMNB 2EIJB 1BD2D 3VDAA 4OIIH 2XN9D 4YSAA 3HLKA 3P3TA 2CK0H 4X6FA 3ZKMC 1NC4D 2DWDB 2OMZB 2BFVL 4BSJA 2HB0A 1VFBB 1FGVL 2IMNA 4MA7L 5D1QB 3BLKA 1MRFH 1A6AB 1Q72L 3KYMA 1J88A 2OYLA 3EJZD 1MCHA 3QARA 4K07A 3MNZB 4MZRA 1R3IL 5FF6A 2D9CA 2EABA 1D6EA 2GYSA 4G11A 2VJXA 4QTIL 5F1IA 3HS0B 3N9GH 3HC0B 3AXHA 3KL3A 1D5IL 1LO0H 1WZAA 2IWGA 5D70L 3LIZA 3UBXI 3QIBD 2F6AA 5CO1A 3DPBB 5CP7B 4BA0A 2EJ1A 1JFQH 5I8KL 1KJ2H 5HYEA 1OL0A 1Y18A 2D2CC 4J3OG 5CJXA 4ABQA 1EJFA 4LSVH 4KY1H 4E9RA 2QELA 2X88A 4HJSA 4N85A 3BSZH 4LLUA 4MS6A 5HHOB 2BRRH 4HPYH 1VFOA 4AQ8C 1ES0A 3E8UH 2YPVA 4ZDHB 4X2UA 4X4ZA 3B3IB 4WAFA 1M05B 1S7RB 4Z7WE 2ZXAA 2BNUB 4PJ9A 5FFLA 4K0OA 4OD3L 1IIIA 3STLB 4WKZA 2I07B 3JTSB 3D69A 1CS6A 3QRGL 3RDTB 4AYGA 3BW9A 2WSKA 1DQMH 2CDGB 4CU7A 2OFQA 4X50A 1PZUB 3F7VA 3TWYA 3IMRA 8CGTA 1S7SA 3MRJA 1P0SE 1QNZL 4RZKA 2X87A 2V7NA 3EO9H 1S5IH 5H37A 2VYRE 2RD0A 3FQTB 2GIYA 1U95A 4BH8B 1T1XA 5HDBE 1KN4H 1U8NA 4XE0A 4RMBA 2J20A 4LVOC 4ZAKB 2VZVA 3PJNA 4G6MH 3FBKA 1ORSB 2J5WA 3PWPB 5EG6C 5IBUG 3QDMA 4QKTA 1SN0A 5JHLL 3L5XH 2N56A 1OF2B 3KYKH 1TTRA 4PP2B 4LVNB 2Z1PA 5ICZB 3FUEA 3IDGA 4FCAA 4BK4A 3KGTA 4HK0B 4TUOA 2PTUA 3MC0A 2IG2L 3AXIA 1I3GH 5IB4A 5ISZB 5SV4A 1Z5LB 4A38A 2AJ3A 2ORBH 2VDOL 4M7JL 1TJIH 2V5TA 4NO3A 4ZUVA 4MAYC 3L7FB 5AW6B 4ERSL 1XCWA 2Z4TA 5F7MC 4KTEH 3NPZB 3W39A 4X83A 5AYQA 3LZQA 2D3VA 4TTDD 4B60A 1JZFA 5KG9A 4HIHB 1KXVA 5IVXB 5KS9F 2UV3A 1E5YA 3BYYA 4LRIC 1J12A 1MJJB 2R1WB 4JMNA 1TJMA 3VXPB 2CJ3A 1NGPH 5FYKD 3T8VA 5DMKA 1NDTA 4YDZA 5JPMA 3LZFL 3U4AA 5AKRA 1KLUB 1SXZA 4OY9A 1MCPL 3C5ZC 3NEEA 3PXLA 2BNRD 5I71C 5CKAA 1IC7H 3QIWA 1NUDA 1HVXA 3O6KH 1PAMA 3V6FA 4FTVA 3RFZB 4BFKA 3E3QE 3DUUA 1CDBA 2A9AA 3H7LA 3QPXH 4ONGH 2ITFA 1SDAB 3NOIA 2Y1AA 4JDEA 3BVTA 4JY4A 3ZVVA 4B9KC 1LP9A 1OP5K 4HKZB 4Q6IC 2HLAA 1CD9B 2PABA 2WO2B 2QGCA 3NIFF 3RTQA 3NA9L 2H6OA 4ZFZA 1YQVH 4XMPH 3ABMB 2GABA 2P8MB 3CLFL 2CDEA 1U4FA 1OLLA 3PNWB 3QEHA 4NQCB 2Y1YA 4AIZB 5IM7B 4JQXC 3RGHA 1BG1A 4NIKB 5KSVA 1FNFA 1SLUA 2E9BA 5D1ZI 2PW2B 3ARFA 4N2CA 4Q9BA 3N43B 1LE5A 3JWNH 3SDXA 1JDCA 3K8MA 4HT1L 5A16B 4ZQTA 5DUBB 2BHUA 2Q20A 4Z7UB 5C07D 2VCOA 5IR1B 3EYUH 4UT6L 2R1XA 2NR6C 1EAQA 3ATDA 4E5XA 3EBIA 1NAMA 3D50A 1P84K 4AGOA 2BVUA 2CPUA 1F4WH 4QHLB 1CF8L 3SQOL 4F7EB 4P2YA 5F1SA 4PRAA 5CIPB 3INUH 1NJ9B 3BVWA 4M8QA 3TZVA 4NQDE 5C07E 5SWZB 2Y0SA 3DMMB 3MLTA 2RFXB 3VFSB 4XWGH 3P4LA 4U0RC 4R0LA 4HIJA 1NL0H 3O3DA 1J05A 2FEJA 2WBKA 2E7DA 3K1DA 4MX7A 3ULUL 4YXLH 4ZMVA 5CJQH 2H32H 2VLME 4MKTA 2DQDL 4JL1A 2QDVA 1X9LA 3E9TA 2HCZX 1ET8A 4ZPVA 1JTOA 1LK3H 2V6HA 1KOAA 1RJYB 4HC1A 1D2OA 4XMKH 1S78D 5KSUA 4LRNL 1L6ZA 4G80A 5CLTA 4OF0A 5DVKA 4JRXD 3NIGB 3O6FB 5F0JB 4M43H 3HI5H 3TJHD 4HV8B 1VFAB 2YPKB 4HFWA 5JXEC 2Y3NA 4XRCB 1EWHA 1QO3A 3BHBB 1SUJA 4FHKA 1ZHBB 5IJVA 1OKEA 4L8SB 2Q87A 3IFOB 4Q52A 3ETBJ 5MP6H 1PYWB 1SFHA 1YYML 4IK7A 1GZQA 4ANWA 2OSYA 15C8L 3WI9A 5D71L 3BPLB 1U58B 1NTDA 1NLDL 3HG1A 1QUNB 4C58B 5IVOA 3EOAB 2FL5B 2NYYD 1MJUH 2A5UA 1CF1A 1FV1A 3OB8A 5GGQL 4ZMLA 2AQPA 4GKSB 4QHNB 4XMXA 4PRIE 1FL6A 4GG8A 3RB5A 1ECZA 2ZOUA 4JKMA 2XWTB 2DQFA 4GQQA 1H0DA 2ICWA 4Q97A 3ARXA 3VFRA 2KS0A 1PDKB 3IFLL 5K39A 1TETL 4RDQG 2BRQA 2GB2A 2LW3A 1MRCH 3FC8A 3ZIYA 4ETQB 1L7IL 2VITA 4CILA 3PWVA 5F6HJ 5JR1H 3QDJB 2C7UA 3DX7A 3VXRA 3IFNH 3KLDA 4JE0A 2C3VA 2G2RA 4X7TB 3QI9C 4KXDA 2Z64C 2ILLA 4J4PA 4XMLL 3U83A 3GKWH 4UV7H 3MV7A 5I30L 1FGNL 3P0GB 3DKHA 1FE8H 1RI8A 2IXQB 1AKJD 1PZSA 1G5GA 3NUKA 4S1RH 2QTVA 4I18A 4G43B 2H26A 3K2MC 4LO9A 5FM8A 1WGVA 3GRWL 4GBXC 2FIKA 4IOIB 4YO0B 1H8OA 3QA3B 3GLAA 43C9B 4HSAC 2CO4A 3TBSA 2C8NA 1ZAGA 3G5ZA 1M9WA 1UOVA 3NSDA 3BZ5A 5E4OA 1RJLA 2AQRA 2NY2B 1UWXK 3NCJL 1MCIA 2WSDA 3HPJB 2J8OA 2J8UA 1DVFB 1XH2A 4HUKB 3SIKA 1XGTB 1R5IA 4H88L 4BEIA 5L8JB 3BZDA 4IJ3B 4POZC 3MODL 2YWZA 4F7TA 1QA9A 5KJ4A 5GZND 3MX0B 2MNJB 1SQ2N 3I3EA 3UL4A 1U2CA 5KYXB 1IJ9A 4Y4KD 1FFOB 5JW5B 4NM4L 4AX3A 5AWNH 4GSQA 4OLVH 5IGXL 1BMWA 4RETB 5IFJB 3MCLH 3PP3K 5DK2B 3V4PB 2KC0A 1S7WA 4GYBA 4Q2ZA 1CE6B 3W9DA 2N1KA 4ZFQA 1G7LB 1HXMA 1KLFA 5DO8A 4LHUD 4N8UA 3WEAA 1E6OH 1RIHL 3FQXB 3CUPB 3VTAA 2ZICA 1RZKL 1NANH 1XB8A 3QO1A 3NIDB 1RAMA 5JW4N 4JLRA 4RFEB 2I9LB 5DMGD 2PN5A 1UD6A 3MRMA 4J3XA 2ZSVB 3OKDA 2FATL 3BWUC 2PXYA 1MUJA 4KXZH 1U93B 3V5KA 3VFOA 3HRZA 4JQIA 4CGTA 4IU2B 1S9YA 1T7ZA 1EZVY 2BK8A 3KVQA 1OM3L 3EF7A 5DHYA 1K2DB 4G1MB 5C0GA 3Q2CA 4C56A 4CN1A 1I8MB 5ESQB 4FKKA 1ADWA 2JI2A 3NABH 2JJWA 4EPSA 3TN0D 4WV1A 3V9CA 4KAQL 3VRLF 3MV9D 3VI4A 4S2SB 1RK0B 2HX8A 4FQLL 2WCGA 1OT1A 2WXPA 1HSAA 3CDZA 4MD4A 3QUXB 4CVWA 4M7LL 1PZ5A 2HFTA 3B9KC 3HNSH 3BESR 3MGOB 4GP8B 5AUMA 5C6TL 1NGZB 2LLGA 2XX0A 3ATFA 1T0MA 1YEDB 2ZUQB 3MV9E 3C12A 4X4KA 5ABAA 3L3OC 1MFDL 3KYNA 4L1TA 3ZOAA 1JAEA 4P2QA 5CNHA 4DZBB 4YQXL 2OJEA 3OJDA 5D1ZD 3KCPB 3GZOA 3HZKB 3GJFA 1DBBL 4Z7QF 2P28B 2O5NA 1NGYB 1P53A 1JVLA 4MCMA 4Y16D 1T4WA 3EO0B 3OJVC 1OP5H 1ZS8A 4QXUL 2PPCA 1E27A 2DN7A 5D4IA 2CGZA 3C8KB 4MMZB 2Z7ZA 3Q1SL 1OAKL 2X2IA 3D87B 4QY8A 5C09E 4C4KT 1KSRA 1AHWA 4MCYB 5DR5H 5HVWA 3WN5B 2P48B 4HH8A 3FQRA 5D1XC 3F2LA 2I24N 4K5LA 1JGEB 1JGVL 1XMEB 3SDAC 1DQVA 2DLEA 3FU7B 3N2JA 3PJLA 3QDGB 4HWBA 4XXDB 5KYNA 5KANI 2FD6H 3I6KA 4JFYB 4EOWL 1JSYA 3QIUB 5K9KB 1D7DA 5IEKB 5DYFA 4DGIL 1GY1A 2E47A 4YHZH 4GLRH 1XSKA 3QCVH 3QUZA 4YHLL 1OW0C 1THAA 1J8HD 4H8WC 3UZEA 1T5WA 3FCSB 5ESAA 4YX2H 2LFGA 5DD5L 3VA2C 2X38A 3MACL 3DRQA 3RWEA 5K1VA 2PP8A 3D05A 2KZKA 4GAGL 2ODHA 5G4NA 3ZKSD 1ACCA 2FYVA 3BT0A 3IMWA 1EEZB 2WQRA 4L0YA 2Z8VC 2Y3AA 4Y19D 4R9HA 3RBGA 5CN3A 3GPSA 4NWTL 3POCA 3QQDA 4OQ1A 4QCIA 5IQ7L 5E99L 1J8HE 2ZCHH 1C9SA 1OAQL 3OC8A 4LB8A 5DK0B 4DUWA 4N3UA 4PP1D 4PY8I 4Y4FD 4PTUA 3D4YA 4NO2A 3KLHD 2B0SH 1XIWD 3PYCA 4PPTA 3QZNA 4Q9QH 3QFGA 3VVWA 1KIUB 4EN3D 1QLEL 1M4KA 4KO5A 4Y19E 2CLRA 2DYSB 1UOWA 4Y2OB 2WXIA 4KQ3L 2GW5A 2G9HB 1KIQB 4R2GC 2QMKA 4KTDL 5C1MB 4XXWA 1CI5A 1NCAL 2H47C 4TOYL 1SF5A 3B2UC 5EULV 3GZPA 1SLVA 4NZUH 4M61A 4PIRF 1E4XH 5TF1L 4OLZL 1BYPA 1FNEB 5BV7H 2IH8A 4FEMA 5DC4B 1AXTH 2AEQH 2D03L 5CCGE 3AT0A 3GMNA 2BCKA 1QASA 5DFVD 5AYUH 1JYXA 4OCWL 5C0RL 2D7PA 5LGJB 1YYLL 5D96C 3NJHA 3CLWA 2Y7OA 3KPSB 1OM9A 4ELKB 2OMZA 1FZMB 2DQIH 3F00A 2XWDA 5AW4B 3FFDB 4LOVA 1A7OL 4QF1A 4CKQA 3FZUC 2FYYB 2UVFA 3QISA 3B34A 4FFYL 3LPFA 3PP4L 4P05A 5DRWB 1KBPA 3BUDA 4PEEA 3QXDA 4RMTA 4FQXA 5EEYA 4OI8A 2FO1A 2GSGA 3HS0A 3HC0A 1CFNB 5B3JE 4Y9EA 2P49B 3W56A 4M1CD 1X7SA 3T0EE 3IU3A 1ZA6B 2M26A 4TN9A 4E41B 2F7OA 1AGBA 3ZDYB 2XN1A 5SWSB 4F9LC 4PWIA 5C0FA 2D0HA 4N2NA 4QXGL 4YK4C 1G87A 4Q4EA 3MJ9H 1LO4L 4FRWA 3DTUB 2R2EB 1LP9F 3IKKA 2DLIA 1JMZA 3PAUA 5BS0E 1UURA 2N3JA 3KGSA 2DM7A 4LVOB 1UWGL 4N0UB 3F8UB 4MGXA 4P5MA 3ZYJA 5D7LE 5DUPL 1S7RA 4YIQB 1Q72H 3ZSTA 3ARPA 3WCYA 2BNUA 4F2ME 2R0LH 3LCYA 5K33A 4YE0A 1TCMA 4R26L 4WGWB 3UBXG 2I07A 1OCRB 3H9HB 2JKXA 3TJEL 5ACLA 1JF6A 2IPTL 3RL1B 4X4YB 3G5WA 3IGKA 1KC5H 1KXTB 1FO0L 1T89A 3SDXF 2DPKA 5IP4A 1QUPA 3QW9A 4FFWD 3F7KA 5FX3A 1F4YH 3WDJA 3S3CB 1MHHA 2CUHA 3ZE2B 5EB9A 4BH8A 5EZIL 1UWXH 2X4NB 3ML8A 4XB7A 1B0GB 2VW4A 5EFIA 4Z5RA 3GNMH 4ELDA 3LS5H 4ZAKA 2C5DC 1GMEA 2DM3A 2XYCA 3LPPA 4L3EE 4R7LA 5I6OA 4TULH 1OWWA 5DQ9B 1OF2A 4UINL 5E95B 2OX5B 3PY9A 5EC2B 4UM8B 3TS8A 3JWDL 2ZYSA 5GQBA 3OSKA 2BFGA 1DN2A 3VXTA 1KTJA 2OI9C 3C5ZB 4XBMA 3V8OA 5AVTB 1UXSB 4HK0A 5I71B 5HJ3B 3PP3H 3MRLA 2XFXB 5ISZA 2HFFB 3L6FB 3GSWA 4D0CB 4D9QD 5FKAB 2ED6A 4U1MA 5F3BA 1Z5LA 3IT8D 4G59C 4OT1L 2CBQA 3GMMA 3QUHA 2HFEB 5FM5M 2GT9B 5F97E 4ZMXA 3L7FA 3NYKA 1P4IL 1P4BL 2W9LA 5DD6A 4DVRL 4KDVA 2LU4A 3T3ME 5GJTH 3PV7A 5D2LB 4NXKA 1FYHB 3E9UA 5A2AA 1O7DE 3LMJH 2OR7A 4HJ1A 5AW8B 5GGRB 1GOGA 3RPIA 4D9QE 2X9XA 2R1WA 2E75C 3X3FH 3VFGH 2F74B 3L3KB 2VXVH 4DP0X 3ZMNA 4MYWB 2AJYL 4WI5A 3IU4H 2EQDA 2YPVH 4JQVA 5E9DD 2H2SC 1N0XL 1J0ZA 1PW3A 4LPXA 3U79A 2H0EA 4MMYB 2AEOA 1Z32X 2VR4A 5GGSA 4G6AC 3RFZA 1ZE3H 2EH7L 1Z3GL 4R7NA 5B38B 4JM2D 2ED7A 1JZGA 2UZIH 2PWEA 4WWOA 4BFOA 2WN3A 3AAZA 3AG2B 2NUPB 1LEKA 1B3JA 4M7JH 3I6GB 3FT9A 3GXPA 4DAGH 1R5VB 1T0PB 1QWHA 4HKBB 1I1AD 3V0GA 3UC0H 4WUKL 1JPFA 3O4LB 5GRVK 2P8PB 5H37H 1RMFL 1ETJA 2HWZH 4NQEE 5DJ2A 5LG6A 4XTRC 1ZPUA 2RGSA 3ZGIA 2PR9A 2BJML 4NQCA 2V3DA 4XHJC 1NIDA 7CGTA 2BC4A 1F4XH 2AK4E 4PY7A 1NCDH 2WTRA 3QFJB 4G70B 4IGBD 5AW1B 1WHOA 5D7IB 1OD9A 4L1BA 3DGGA 3LHPH 4NS0A 1H3XA 4U0RB 3OKMB 4MNQB 4AZ8B 4LLQB 1PLGH 1XR9B 3KLLA 4ODSL 4AH2B 1U21A 4HIIA 4N6RB 4WI3A 3H42L 3UO1H 2VN4A 3MYZA 2NMSA 3RI5F 5D6CB 1INEH 3U4BH 3VWJC 3WEXB 4AIXA 5C2BL 1KLGA 1DVUA 1V3MA 2R51A 5CEXB 4RAVB 3H6JA 1E4KC 1BMGA 3UZQB 3G6JB 2HH0L 4AQ1A 1L5GA 4MD5B 1IX2A 1YRKA 4WO4D 3SGJC 3QRFM 3CVBA 3SHSA 1HC1A 3Q6FB 5LQBL 1MF2L 1NCWH 4YXHL 3DI3B 1X5XA 4KUCD 5DJ0B 2PW1B 5CIPA 1NANI 1U3YA 4J2QA 3UTTD 4JRYB 5E2WL 1NJ9A 1U8OB 3PUUA 4UM9B 2RCSH 3WD5L 1QI5A 4IEFA 3VFSA 1J9CT 1THCA 3CVHA 3DX3A 3JVGC 1NLBH 4B9JA 2QVMA 2J8UF 5JHDB 1MCNA 4HIEA 4PHZA 1HCVA 4KXZI 1AMXA 1KWKA 2EE3A 5ELIA 2PR4L 4KKAD 4JREC 4KROD 4UTAA 5C0CA 4KK5D 1ZLSH 4GQ9L 1YN6B 2FWLB 4PV8A 3AU1B 2AAVA 3WGVB 4CU6A 5LNDA 4PJ5A 1RJYA 3ZT5A 5GZOC 4N0CD 3LB6C 1SZNA 2WB7A 4KJQC 2OTUB 2JKTM 5FFGA 3MA9L 1IGTB 2WVUA 4EI5C 2DTSA 2B1HH 5FB8A 3HUJE 4NQXB 4HV8A 1VFAA 1LHZA 3QG6B 4B97A 5KYYB 2Z31D 4J5VA 5H35B 4XRCA 3BHBA 4M8VA 5HPOA 1JCVA 2ESVB 5J6HB 4HK3J 4GAJL 3IFOA 1DBKH 4Z3HA 1PYWA 4YEFA 3CCHB 3D3VB 3I75B 4N2KA 2ZG3A 1FPTL 3QQ4B 4M6NH 1NKGA 4HKXB 4W81A 4OLWH 2AZUA 1NM9A 2FL5A 2P3YA 1BQSA 3PABB 3T4YB 5ITFA 5B1AB 4I2XE 5EBMB 3NCFB 3ZMEA 4ZW6A 5BRZE 5J1AB 4QHNA 3QIBC 4M48L 4GBXB 3PHAA 4A2HA 4AIOA 3UTQB 1NA8A 3ZE0F 2XWTA 4DK5A 1F58L 1NAMH 3I2CL 5T1KA 1Y07A 1MFNA 1PDKA 2H1LM 4JKLA 4JJ5A 2I60L 4BGLA 3P3RA 3VI4F 2KLTA 3BP7A 3ZDWA 4UDTB 5TQ2H 3QG7L 2K45A 3X14A 4G8GB 2AXGA 4X7TA 4QRTB 3TCTA 3SJVB 5HHME 3L54A 1K8IA 1T2XA 4JK0D 4UQEA 15C8H 1WIUA 2IXQA 1OAZH 4G43A 1ERNA 3TBBA 3BRFA 4BSWB 4CW1A 2JELL 1SOXA 2APBA 3R06B 4XPTH 5L2JB 4YO0A 1T1ZB 1YAZA 4XX5A 43C9A 1LILA 3P02A 5J7CC 1YDPB 1G9NC 2GBAA 3ECUA 2JTDA 3NAAL 3RIKA 4HC1H 1UXLA 1OARL 4OH2A 4WNQB 1IU1A 4XP9L 2XRAH 3VXQB 2G4EA 2GFBA 4S1SH 4Z95H 3HPJA 4H20L 1DVFA 3BAIA 1XGTA 1HWHB 2BNQA 3SKUD 1L7IH 4MA3A 3KXFD 4AKPA 4JL2A 1CBVL 1WYJA 1CMOA 3MX0A 4R4NC 4Z0BL 1C8QA 1MWAL 3ARQA 5EO9B 3AWFA 2NY0D 3FT3A 4HMCA 2V2TB 1WUNT 2XFGB 3GMLA 2B3RA 5KSAD 3IMVA 1SHXA 4OZHB 4OAWB 5ECGA 3DSNB 2IJ0C 2BWDA 3QPKA 1E7VA 1GAFH 3CMOL 4PJIA 5IESL 1E4XI 3OB0K 4LVHC 4XC1L 2XWRA 5BOPA 3BVDB 4OJFH 1G7LA 4LESA 1A7BA 5EN3A 2EDRA 1A1MB 3BZFA 3SGDH 4PWFA 2VLKB 4MJIA 4TTDC 2ALAA 2NY5L 3DHJA 4NP4L 1GPOH 1PZ2A 3CUPA 5AKTA 3E3QC 4NENB 2FH8A 1KB5L 2AV1B 3NCJH 2F1EA 1MW1A 3S8WA 4MDRA 1HH6B 5ICXB 3B9KB 4FG2A 1BPLB 3NSXA 4FQ1L 5EU6A 2ZSVA 2YAEA 3FRPB 2HX9A 1AQMA 1AR2A 1R24B 2MCPH 4YSSA 1INQA 4NZTL 3NCWA 3FB6B 1FNHA 4NM4H 4PUBH 4J23A 3L3OB 4P5KB 5LXGH 2DQGL 3A21A 1I8MA 1K2DA 4G1MA 4WTZG 4X42A 1RZQA 1PEZA 5ESQA 3B4NA 4M3HA 1KGYE 2F58L 3OAUH 4JDTL 3WDIA 3D30A 3TYGL 3DYMA 2UZXA 5L2KB 1DHKA 4OQTA 2ZXCA 3G6DL 4UZGA 3BIBX 4L8CA 3GLEA 1K72A 1NCOA 3EFDL 2GI0A 3V4UH 2F2HA 1VGKB 3NCYS 1F4AA 4Q0XL 2X3AA 5D1XB 2BSSA 2BP0B 4OIFA 3PHSA 4UQ3B 3QJFB 2OXGB 2IBZY 4BXVA 1VB9A 1XZ0B 4ZUSB 1OP4A 1JHKL 5ID0B 1SRDA 4PBXA 3BUIA 1MI5B 2WOYA 1TZHA 3MHZA 4LIQL 5EZJA 2Y25A 5KS9E 1PKQE 3KCPA 2YPLB 3HZKA 4E9QA 2H0FA 4XBEH 1HL4A 5JA8B 1CXIA 4KGJA 1I3RA 5B39B 1HSBA 2NT0A 1BVNP 1T0OA 5D8JH 2EH8L 3OWRA 4OCYH 2A2QT 1TG8A 1CFTA 2KI6A 4K5OA 2DLHA 3F7PC 4MCYA 3V55A 4H40A 5ANME 3WUWB 4AEEA 4LIQE 3P3YA 4MQ7A 2K78A 4JX0A 4TPRH 4QRFA 2B15A 1M7IA 3LPGA 1DBAL 3FCTB 4RA0C 1JGEA 4LCWB 3SKNA 3IYLW 3ENEA 5AOMA 4PJHB 5B8CA 2VO8A 4AQOA 1L3WA 5GGTA 1JUFB 3PAVA 4JFYA 3FAXA 3QIUA 3DBXB 5I1JL 3SD2A 5IEKA 3KWVA 3TBTA 1EH9A 3DIFB 5AW2B 1ZWIB 3ZUCA 3PGDA 4KDWA 1RPUA 2FIRT 4LCVA 4PI2A 2FSEA 1J1XL 3FCSA 1U8PA 1E28A 4MXWL 5I1GL 4JQIH 2P42B 4HUWB 4R2GB 1JVKA 5JA9A 3UGUA 1J0KA 4UOW1 1VEOA 3EADA 2ZCLH 4AEIL 3AZUA 4PJGA 4AQAA 1EEZA 2X1WL 3UEQA 2R8SL 3VMPA 1F86A 3WNJA 3U9UA 5IEHB 1GZHA 4EUPG 1OAKH 1XCTA 2K1MA 2W60B 4HBCL 2FJSA 4CNIB 1P4LB 3TJHC 2LGNA 3NFSL 4HOXA 1AACA 1QRNE 3QWQB 3IPEA 4JFDB 2EILB 2A6IB 2A9NH 2OR8A 2HLEB 2IBGA 5D96B 4B9ZA 4L4TD 1TJGH 2ZXEB 4S1DD 4H2CA 3N55A 4Y2OA 5FGCB 1DVSA 1MCKA 3D4CA 3P0VL 1CICD 2AXFA 3GZKA 3JQOB 5E6ID 2AJUH 2G9HA 4KZCA 5FV1L 4KHTL 3IXAB 4NZRL 1A3LL 3IS0X 1GXEA 3FUJA 5DD5H 4TSCH 1D9KC 1VPOH 4XN7A 2NYYC 3LRLA 1EDHA 3DX1A 1MVYA 3IJ9A 5E2VL 1FNEA 4BK5C 2X1XR 4AVJA 4JG1L 4O02L 2XICA 1TZGL 1F8TL 3BOVA 4XVUD 5E1AA 1UG9A 4BWTA 1MFBH 4TSBL 1TVBB 2Y06H 4M6OL 5KUKA 3FU9A 4NZ8A 5E99H 3MLUH 4B9FA 5I8CB 2YMXH 3MV8D 4F9PC 3DOSB 3O2WH 5EO1B 3KPOA 4YK4B 4DP4X 1IFHH 4B7IA 4L37A 5IMLB 1SHMA 4GSUA 3KJ6H 1FZMA 2Q9OA 5ADPH 1M6UA 5KBDA 4HWBH 3FFDA 3R18A 4AQ8A 3MRNA 5IQMA 1H3PL 4AK2A 2DMKA 5DRWA 3O0RL 3REWB 2VDNL 5D4QA 1CFVL 1VKXB 4LLMB 5LAXB 1IMHC 2NX5B 3B37A 1BQRA 1ZPLA 5F96L 1RFDH 2JQMA 1OGTB 5TF1H 5CEZH 2AS5M 1V54B 5SWSA 4OCSL 5TE7H 4CC0A 2GSMB 2JJSC 1TTUA 2YC1A 4G5AA 1JWSB 5IJKA 2MNWA 3HFML 1F11B 2XCMC 4LKXB 3D2UB 3WFHA 2R2EA 4C83B 2JSFA 3N42B 4MQXC 1QSFA 4J1UA 2XV0A 1J8RA 5IQ9A 3SKJL 5DS1A 2WK2A 4N0UA 4HHAB 5DWUL 2IDCA 1GCYA 3L1OL 3LD8C 3H3BC 3VXUD 2AJSH 5GZNC 1WFOA 3FN0L 3PP4H 3L4TA 2BHZA 4BFJA 2VLLA 4Y4KC 4K4KA 4HFUL 1K8DB 2FGZA 5EBLA 1KACB 4LOUD 5TDOB 3VD5A 3VXMA 3T0BA 5HYIA 3OHMB 3AS2A 4ZUTB 3N04A 3W2DH 3CH8A 2DYPD 3N43F 5HDRA 1EHAA 1Q9KB 2CA4A 2IPUK 3U0TB 4KXCA 4P3DB 2WWOA 1KGCD 4U2YA 3VXUE 3TASA 3ISRA 5T1DH 2NCMA 1G7MB 2ENYA 2F19L 5IT2L 1F2XK 1FL3B 1MCCA 3NJMA 5J8OA 3FQYA 2IV9A 2C4XA 3FRPG 2VC2B 1U2YA 4ZUUB 4I1PA 1KYAA 1PJWA 1ZT7B 5CWSB 4NO5B 1HINL 5EORH 2OMUB 5DMGC 2BZ7A 4NM8L 3B7YA 5K1JA 5DQ9A 2CIIB 4I1RA 4LCCC 2FT7A 5EC2A 5EO0A 4W4OC 1WEJH 5GGVH 1EMTH 2WVTA 1K6QL 3CN1A 3KPRE 2P5WE 1OK8A 1S5HB 1W0VB 2YQ3A 3C5ZA 4FA6A 2JKNA 4R26H 4U1JA 5HJ3A 1JPSL 1LO2H 5EZLB 3MLRL 3MLYL 2DJ4A 4D0CA 2V5YA 5DZAA 3MMEB 4ZI8A 4W9EC 4Z0XA 5INDB 5I6XC 4UOW0 4XBPA 1XGPA 2HFGL 3OB0H 2X4OA 4NERA 4XN5A 3P3UA 2HFEA 3MLZL 5FDYA 3RIAK 4PS4H 3TN0C 4FZEH 4Q6YA 4B96A 1OT2A 2CBTA 4EBQH 2VLRA 3WFDL 2AI0H 3KM1A 1BLIA 2XZQH 1A6PA 1QFWL 3V4VL 1N5YH 1MNNA 1I9IL 3QCTH 4IBYA 4RGMC 5I1AB 5GGRA 3U36A 1YECL 2WYTA 2Y6SD 5D7HA 4JRLA 5HHQB 1JYWA 3L3KA 1JBJA 2TAAA 1T6VN 4XNDA 4AV4A 1PCSA 3DX9A 4JEGB 4OB5H 3APFA 3GIVB 4YSOA 2QLVB 5HHVH 5C0AB 2GY5A 2LOEA 1J5HA 1ZT1A 4LHJB 4MD0B 1X5FA 4DESA 5FW7A 5B38A 2EUWA 4XZ4A 4MJ6A 4NUPA 3VJ6B 4P4KB 4PTTB 2D7TL 4Y16C 1XR8B 3C5JB 3I6GA 4LSUL 4WVRA 5GJSL 3VWJB 4UNUA 4WY7L 4HKBA 2QSTA 4FQHB 1QSED 3D85D 1P4BH 1H9DA 5BNXD 4G71B 3ISWA 2P5EB 3O4LA 5LNEA 3GMPA 1YG9A 5CLZA 5AAPA 5DJDA 3WIIL 3GB7A 3OKOB 3RPKA 1F3DH 4YXKH 4NPKA 5CM1A 1T6BX 2CKBB 3LNHA 2XQBH 3GSUA 3RY6C 2MNUA 2AJYH 2CJTA 4OCRL 5MEOB 4KJWC 3HAEH 3C6LA 3D48R 1QSEE 3C2SA 1KZYA 3MBEA 5KBKA 3VRLE 4PCYA 5L9DH 4MNQA 4MJ4A 2X89A 1D7CA 4AZ8A 2EAEA 1Z1WA 2E8ZA 4DP8X 3WO4C 1T20A 1A6TA 4UT7H 4JGUA 4N6RA 4UWQB 2J88H 5AW0B 1Q1PA 2EEFA 1X5AA 1J9SA 2JV6A 4JREB 1AQHA 5F0LB 3GWJA 3BRDA 2ADYA 5HYSB 2OP4L 3G6JA 2WP3O 5DA4A 4O2EB 4YGAB 4MD5A 3QEGH 3SGDI 1IEAB 5IW6A 4RZCA 4NBYB 1RMFH 1F6LL 4YFLF 4XPHL 5DJ0A 4EI5B 4KFMA 2BIIA 2JB6B 4PP1C 3LIZL 4Y4FC 1BD2B 1U8OA 8FABA 4UM9A 1S7TA 2XN9B 1XIWC 5FV2A 2O6PA 4BD4A 4FERA 5JW4Q 4Z7QE 2EIZB 4EN3C 2JWYA 1NC4B 4DN4H 2J25A 5JDSA 4TLSA 4FLOA 4M02A 1I4FB 4V2BA 4HS6B 1JNNH 1VEMA 4OJEH 4OF6A 5I16A 2Z91B 3T3PF 1QWUA 1D5BB 4OSUL 1NM4A 4WK0B 4GW4B 3L1FA 1YN6A 1L9MA 2DTML 1BM3H 1LDPL 2E7MA 3AU1A 5E1IA 4QGYA 3BD3A 3MBXH 5FYJU 2XX1A 3ROOB 3WU1A 2C9AA 2J73A 4JO3H 1AD0B 1CXFA 5KN5B 2OTUA 1VA9A 4P2OA 3QIBB 1IGTA 4U7SA 5I18H 5IBLC 3CC5A 3MROA 2BVTA 2BH0A 4Z7WB 1KV7A 4CMHB 1KYDA 1TQTA 4PJIF 3W11C 4NQXA 4CA4A 2H9GB 4FULA 5KVFH 5D9SB 5KYYA 1E2ZA 2VQTA 5AEAA 3GSNL 3T0EC 1G7JA 1XH3B 4LKCB 4GS7C 3F64A 3V9EA 4ATWA 1ZGLP 5CUSL 1SMOA 3CFNA 5J6HA 1BA9A 1T6WA 2WUCL 3P4MB 4FABL 5DLML 5EEVA 5DJ6B 2QFRA 3NIDF 1S7XA 5TFSL 3CCHA 3D3VA 1L3NA 4HPOH 3C9NB 1YJDH 4RNRB 3OAYK 5HDBB 3ZYZA 4ZW5A 2CJUH 3PABA 4GQ9H 3WY1A 3CFDB 1UVQB 3CFJB 3QJHB 4GBXA 5CMAA 2OMYA 3B3BA 3G5XA 4YLBA 2EDMA 1MPAL 4ZW7A 3CN4A 4CC4C 3MA9H 1YEJL 4UCFA 4NNPL 4LSDA 1OVZA 3GBDA 3QDME 3ABZA 5CF3A 2W0FA 1FDLL 1SLXA 4JE4B 4GI6A 2R0WL 2V2XB 5CSBA 4JFFA 1XGYL 2A38A 4UDTA 3U9PL 1HNYA 4GMSL 3RVWD 4QRTA 3SJVA 2C3XA 4KNUA 3X12B 4HJGB 3QXUA 3CVHH 3LKOB 4LPUA 1KPUB 4Z7VB 4QRRD 4QI3A 1JV2B 3WIAA 3WHXB 3TEYA 1N3NB 4LSPH 1CK0L 1NAKL 2PCXA 1SVCP 3K2IA 4MAUH 4PD4J 3VSTA 4BSWA 3R06A 2M2DA 2WXRA 5L2JA 4Y5XC 2FX7H 3OPZL 3QIWD 4ATTA 4FTVD 1W72B 3Q1EA 2BERA 3JWOH 1G6RB 3FHQA 4POUB 4RGOL 4LVHB 1KTBA 1BZ8A 4FXGA 4I3RL 1EQWA 1A66A 1BZ9B 3VXQA 1F1DA 4BCZA 4PMEA 2H6UA 2EYSB 4R97C 4GI9A 2Q76A 1NIBA 2KDGA 2BSTB 3A67L 2ZWLT 1UACH 3QB7C 1AQDB 5DJXA 2FUTA 4AYEC 3ARDD 1I8AA 1A2YB 1M7XA 3BP4A 5DI8B 5E5RB 5KYUB 4TRPL 4BKTC 2CO3A 4PGZA 2PPFA 4LFHD 3ZL4L 3QZWB 1O7DC 2BNRB 4D9LL 2V2TA 4ZMNA 2XWBA 3RRQA 3WMSA 4AYFA 3AB0C 1FZKA 1LP9E 3DSNA 5I74C 3K4ZA 4D7PA 1SMAA 3I9GL 1IBDA 1F6AA 4PB9L 2BW4A 1DQTA 2G30A 3NAAH 4PLKD 1A1MA 2AJVL 3X1NA 3L16A 5I23A 5IIEB 4A63A 4RQQB 1KUMA 3IMSA 4PJGF 1OK0A 3HI1A 1W8NA 4OIAA 3UMTA 3IN0A 3RWDB 2AV1A 4M7ZC 2R2BA 1XGZA 2Y2WA 3HZVB 4GB9A 5AB9A 3QBTB 4ODUB 4U6VL 5ICXA 3E80A 4XMTA 3SDXE 1ET7A 2F5BL 2P80A 1FYTE 4S1QL 5D7SH 1GZPB 1R24A 4IYKA 3H9SE 4ZOAA 4F7MB 3FB6A 2EE2A 1DZ0A 4CVZB 3KVDD 32C2A 1RZ8B 2EXSA 3W1ZA 3ZDZE 3VUAA 2OA9A 1T0NB 5EIVA 3RUGA 3FTXA 3X2QB 2P43B 5C07B 3GXIA 2APFA 2WXFA 1UH3A 4FJZA 1I1AC 4G1EB 1UA3A 4I0PC 3O6ML 2X12A 3TIDB 5IFAH 5L2KA 5ECJE 4RDBA 3VI3B 4HVBA 4MS8D 5KBMA 3SGKC 3CQFA 5KBLA 4ZMPA 4LCUB 2X4SA 5AFAA 3QO0B 1KXHA 2VDQL 2VNCA 4O5LL 3UAFA 4BFBD 1UQSB 2BP0A 4UQ3A 2OXGA 4P9MH 1ZVNA 3MLVL 1WE5A 4IGBC 2W91A 2CA3A 3HG2A 4G42B 5HPMB 4DEUA 1J5OL 3T1FB 3FYIB 3B7RL 4N8CL 3EKCA 2QVIA 1EGJA 4RWYH 5HYSG 1UFUA 2CMRL 2GTZA 4APXB 5BUGA 2CLVB 3N1FC 5AD0B 2RB8A 2FT8A 4PJAB 1R3HB 3VE0B 2ZKHH 2I5YH 3FULA 3IFPA 3ECQA 4XCYB 4APQA 5IOKA 3Q5TA 1M2OA 5I6NA 2F0CA 1KENL 1KBKA 1Q9WA 2VT0A 4Y0GA 4YZWA 4NCDA 2A0LD 1FVEB 4DERA 1AOZA 2A9ML 2IALB 3FCTA 3FO0H 4LCWA 3V6OE 2W07A 4JRXB 4U6HB 3F05A 4KI5D 4PJHA 3L9EA 2JF1A 2CLZB 3ZK0A 5AOIA 2F5AH 2R39A 5FA3B 1TSRA 2LLLA 3HG1E 2GBTA 3TTYA 3MOAH 1ZWIA 4ILDA 4PRPD 2VDMB 4NT6B 3PGCB 1JWMB 1MCBA 3O11A 1J5IA 2GC7C 3S36X 3VXRD 1CFQB 1NDMB 3E6FB 1ZHNB 4HUWA 2QPDB 4L0ZA 1YUKB 3EXLA 8PAZA 4E9WA 1ZTMA 2A73A 1T5KA 2EDNA 2XNAB 1BFVH 3VH8G 4QHPA 5IMKB 3CN3A 5DXWA 1D9KB 1SMDA 2HTLD 1VDGA 1B4RA 5IEHA 1AXIB 1V3JA 2X6CA 2VH5L 2YKLH 3D34A 5E6ZA 3WTXA 4U1GC 1NGWA 1A6WL 1XMWA 4XVTH 1BG9A 4X6DB 2MKLC 3H85A 5DZOA 2Q86B 1P4LA 4OQTH 4WHYH 5LDSA 2HPTA 4MDIB 1ORQB 1PG7X 1JTPA 5BZXA 4E9TA 1X9QA 2Z31C 2E8YA 4JFDA 4KNSA 3ZE2F 1BWWA 3FSOA 3MV7E 1N6QH 1OSYA 1LQBC 3MBWA 3MUGA 3IF1B 2K4AA 2YSTA 1SF3A 2X05A 1IAIH 3NFNB 1FC2D 4FYRA 3H4FA 4AEHH 2NYZA 3BKJL 2F1BA 3NZ8B 2ADIA 1XB6A 1EHNA 4ISVB 2X2YA 2NNRA 2GHWB 2HJFB 1AKJB 4I9WD 5CGMA 4PJ8C 1HL9A 3I6SA 3JWNC 3MRGB 4JDZB 5E2JA 3D0AA 1SVBA 3VFPB 5E6RB 1PD1A 1AI1L 1TCRB 1IGML 3ML9A 4QNPF 1AO7D 4NPJA 4RAHA 5I8CA 1J5DA 1UZ6F 5AW9B 3ZRSA 2IFGA 2YUVA 4KKPA 5IMLA 5TE6H 4JHWH 4I9WE 4N20A 3KGRA 4DKFL 3U6RA 3NCEB 2JXMA 4HIXL 2AV7B 2X4UB 1ZLVK 4OFYA 5JPNC 3CFBA 5GGTH 4OGZA 1M6OB 3LD8B 4RMRA 1S9XB 1ZSHA 3OAYH 1VKXA 1L6XA 2D0FA 4NO0D 4N2EA 1EVTC 4NNYA 3WLBB 3JTTB 4Y4KB 3RAJL 1RUPH 3VYPA 1ZCRA 3KGUA 2CGYA 2RA1A 3MUY1 2XSKA 5IBTL 4HWZB 2K0RA 4LSRH 5GSRB 2RQ8A 3PL6C 5A7BA 4OZFA 5C7XH 2HA1A 2XPZA 5IMMA 4GAYB 4Y5YC 2WPGA 4PWJA 4XOCA 2V7HA 5GIRB 4RVBA 3GXTA 1JWSA 4TSBH 4K7PH 5AZEL 5FM4A 4B3EA 5GGUB 1EO8H 3THMH 4LKXA 4ZFOL 5E2UH 5JW4M 2VXUL 4XVJL 3IB4A 3TH2T 4B41A 3REVB 5DD3L 5C08D 3BH9B 3ULVH 3O0LA 4HHAA 3HS8A 5D93C 5HSFA 4PLJD 3QZWG 4W9JC 3AG3B 2CHZA 4U1IA 2DW5A 5C0EA 3ZE0E 1UKTA 3KE0A 3KLAB 4PREB 3TBCA 3KZ8A 4LCCB 2F18A 3QEQD 4ALAH 1URZA 4C56E 3F6JA 1CFVH 1K8DA 2NY0C 3NRFA 5A2LH 1YEKH 4CMMB 4ZO7A 2DLFH 5KSAC 1HS6A 2AVFA 3BPCA 2VMCA 3N91A 4JN1L 2WYZA 3VI4E 2QVFB 3T2NL 5I6XB 1I1FB 4LSQL 2WLMA 1MJ8L 1OAUL 4O51A 4GO8A 4QEGA 3S88L 4OCSH 3TN0B 1G7MA 3MV9B 1HKLH 1FL3A 5HVFB 3IKCA 1KIRB 3N0AA 4M4PA 4N4YB 4W9HC 3UTPE 3G6JF 3B1TA 2XHNA 1NZRA 4HMDA 3GIZH 4LVEA 3ZTCC 4RGMB 2E9GA 4DGVH 4NO5A 4Y5VC 3BSGA 3HJ0A 2MCAA 3DVNA 3V52H 4CC1A 1H6FA 2WLJA 5I73C 1MAJA 5DCCA 1Y6KR 2CIIA 1X7QB 1F90H 3MRHA 2NPLX 4JKNA 4P2QE 3LEYH 2ZUVA 2WLLA 3L17A 2ZKMX 1VADB 4IHOB 2G3XA 4DP7X 4HFUH 3UCQA 1RK1B 5INDA 2WXGA 3EH5B 3U0WH 3TO4A 5F7YC 2XTJE 1GGIH 2N0MA 4X5RA 2C1OB 5DZPA 4OLUL 3NJGA 4YC2C 2HJLA 3KYOB 4Y16B 2G2PA 2YWYA 2KKQA 4RMSA 2A6DA 2MOQA 4U3SA 2I9TB 2WLIB 1A7NH 1XD0A 3VGEA 5CEZD 1MIMH 2F19H 3K8KA 4FDWA 4PGCB 4NKIL 5I1AA 2E59A 1MG3C 3AUVA 5AAMA 3OKLB 5D55A 4QUOA 4AL8H 1PX8A 2Z8SA 1KXQA 1X5IA 2EYTA 1NFDB 2P26A 2QPFA 4WW1B 3PCYA 1OAXL 4OZGA 1WAAA 3GIVA 1SXNA 3EOBB 1PJ9A 1RKRA 4FS0A 1ZKAA 4OLXH 1F0LA 2VAAA 5DEGA 4ZTPL 5CEZE 1G0YR 1G4RA 1ONQA 2TRHA 4DW2L 1J8HB 3IDYC 3D51A 3VJ6A 3A22A 4P4KA 3WO4B 1XR8A 4LMQE 2XZCL 4FNQA 3KHOA 1OQXA 4YBQD 3GC3A 1CTMA 4FQHA 3OMAB 1OHQA 5JIMA 4NSKA 5T33H 3KAAA 4Y19B 2JB5H 2FQFA 1WT5A 5DJZB 3SGJA 1QFWH 1MY5A 4DCQA 1U8MB 3KBEA 1IBGH 1A3RL 3QUMB 2EZ0C 2CKBA 3M1BA 4Y4FB 4NZFA 2WB1A 1T2QH 1XIWB 5MEOA 1PLCA 2FX8H 3AM8C 4AVIA 4MNGB 4EN3B 1E5AA 3JT0A 3PJSA 4QWWD 3SE8H 4P59L 5FK9B 2CXKA 4P4RB 4R90H 4H1LH 3PGFH 4YHKL 3D8MA 3WIHA 5DMYA 1FAIL 3K74B 2Y9RT 4FOMA 1MHCB 4WSGA 3MNMA 5IHHA 4A7UA 5AVZB 3LEVL 3LEXB 4FQXD 5IB2B 4OUUB 5F8RC 5E7FA 4WFFD 3SBPA 1HHHB 4LPWA 3BD5A 3O41A 3MRFA 4KDTA 4ODXA 1A1OB 4NQQA 2X9ZA 5B7FA 4NN7C 5DS2A 4A6YA 1FI8C 2JB6A 1BD2A 2PKDA 2YA2A 4QRAA 1UB5B 2AK1L 2BY2A 2XN9A 3C08L 5F0PB 1EVUA 2IFFL 3QWOB 2EIZA 4OCXL 1DR9A 3MOQA 4FFTA 1NC4A 1SYSB 4P9HH 3T0EB 2VLJD 4HS6A 4GS7B 1R5WB 4S1DC 3F01A 4WFFE 1CICC 5E6IC 2VR6A 1O7SA 4UQIM 2Z91A 4R4FL 3ILEA 1D5BA 1SEQH 1Z9SA 1M7UA 1GGUA 2XN0A 2ZP9A 4R7VA 3QULA 5C0IA 4BSVA 1ANUA 4P3WA 3D6GA 3CFIC 4M5SA 1A3ZA 4E0RA 3WS6A 4HGWA 3DRTA 4PVBA 1V55B 2EEAA 2FJGB 1V7NH 2NTFB 3BWUF 4ONHB 2Y7QB 5KN5A 4XVUC 3TV3H 1T1YB 4NUJB 3Q7JA 3D0VB 1MNUL 3EH2A 4OIBA 5EWIL 2H9GA 4LQFL 1E3FA 3KG5A 4NOFA 5D9SA 5TJWK 2ADFL 4L8BA 3NJNA 1LWHA 2DOCA 3NTCH 2WVVB 3F5WB 3MPCA 5CJOL 1JTTA 3QXWA 3QUKB 3Q13A 5E0FA 4J3SA 2V8MA 4P3CH 4XNQB 1IFRA 3BH4A 2MFNA 3BLPX 2YD4A 2X28A 3ARGD 4QRBA 3UJIH 3C9NA 5J89A 1YMHA 4WSKA 2NZ9C 4RNRA 1IAKB 1QEWB 2CUIA 3UZVB 3UACA 2XVKA 3S35X 1KGWA 4N87A 3CFDA 5E5LA 1L9QA 2XUWA 1L9TA 3A4DA 1A4JB 1J0YA 1JNLH 3EUUA 4Y5XB 5FAAA 2X4QB 1ND0A 4P04A 4IW4C 1S4IA 2Z92A 1C1EH 1MIEH 1XGRB 3RUGF 1HILB 4J6RH 3AFLA 3P9MB 3HZ3A 4H8HA 1WRFA 2VW6A 2Y07L 3QE5A 4J27A 5KBPA 2V2XA 1ZLVH 5MEPA 1OOWA 4YHNA 3GSNH 3K2KA 5FDWA 1HL5A 3E2HC 4HBQA 4R97B 1KYOJ 2OL3B 5EUOA 2OR9H 5AVYB 3MLWL 3WKNA 1JHTB 1N8OE 1RK7A 5DLMH 4HJGA 1KCUH 4JFED 5ISZE 2LABA 4F20A 1CDGA 1KPUA 4Z7VA 1N3NA 3T3MB 1HYSD 3O8XD 3SYAA 2QHRH 2A83B 4LOUC 1CT8B 1NMBH 4LLYB 3AB0B 5EOCL 4IBZA 3NH7L 3TPUB 3U7YH 5I74B 1W72A 4R3SA 3EDEA 5DT1L 1JZ5A 2R56H 2NY1D 2X10A 2DQUL 2IH1A 3VFNA 3S35H 2H8PB 1FC1A 4L05A 4QOKD 4GIPD 4ZMQA 1FZJB 4TQIA 4HJ0D 4X5LA 2BSTA 1OEZW 1KJ2B 3F83A 4M7ZB 4BFEA 4XCFL 1AQDA 3QJQB 4B7LA 3WSQH 3DXAD 2Y4SA 2H1XA 4JO2H 5DI8A 5IOPB 3SPIA 2EDFA 3OR6A 2H6PB 4J7RA 4PJHF 5EF3A 3NPSC 4UV4L 2WNKA 2BZDA 3NZSA 2QQLH 4W6YB 5E9DB 2CO2A 4M1DH 2BNRA 3FQNA 4I0CC 4ODWB 3S2AA 2C3GA 2ZXQA 2BOBA 1T21B 3GRGA 3WY3A 4NQEB 3ZDXF 4HU8A 3QJOA 1DCEA 5B21A 5E24E 5KSBA 2BVEA 3TF7C 4MVBD 3BPNC 1H3WM 5KAQF 2IAND 4PJ6A 3RG1C 3ZR5A 4HJJH 1N64L 1SBSL 1UH2A 3EYQD 5E08L 4NQCE 2ZSWB 4AQEA 1VIWA 1I1AB 4W6WB 3T6ZA 1U3HA 4I0PB 4NYLB 2A3TA 4HOWA 3CFKB 4OM1L 3A23A 4K15A 4KZDL 2KLRA 3PDDA 3MRCB 4JHAL 3BQUD 3IDXL 3ZRCC 1QZ1A 5K93A 5T5FH 4Q89A 4PG9B 3KNBB 2FK9A 1ZT4B 1AGCB 4ABUA 4IGBB 2DIEA 2UWEB 3DV6A 3PAYA 1TEYA 5I1LA 2KBGA 5ESVA 1ZLUK 4YBLC 4F7MA 1JDDA 3GI9L 4KK8C 2OMXB 2CBOA 1RZ8A 4M7KH 4YHPA 3ZE1E 4X6EA 1VRSA 1D3CA 4BA8A 5CJ5A 3IGAA 1WIPA 2VN7A 4IM8A 5E6UB 2Q1EA 4XPFL 4G1EA 4L3AA 4ZSOB 1FIEA 5G55A 1BXAA 3TIDA 4UTAL 2AJVH 4WUUA 3SPHA 4Z6AT 1AGEB 3WKMH 2VDPH 4ENED 4LCUA 5ETUB 2CO7A 1IVLA 3DETD 1HWWA 1CGWA 1IAOB 1YEGH 5F88B 3S5LG 2HVJB 4FADA 2AEPL 1H19A 1LMIA 4QRPD 3O2DH 5HD8D 3ZR6A 5C0CE 1SXBA 1BFOA 3P69A 4P2RD 2Q3AA 2DQJL 2D31B 1TZIB 3G5VB 2VM4A 1DVQA 1JHLH 1RZGB 4NUGL 5EV7A 1TJHH 3FOMB 4PJ5E 3KDMB 5D7JD 1DBML 3HUJB 5JW3H 4JNXA 3GBMH 4F37K 4ZMOA 2CLVA 3N40P 1A6VL 3CSFA 2EYRB 4PJAA 3TOPA 3VE0A 3DHPA 4PJFA 1ED3A 4XCYA 5HGGS 4AQZA 4JFTA 2DWYA 2HYMA 3QH3B 2Q7YB 1Z0MA 3LQZB 4U1GB 4A7VA 1DLHB 3BWAA 2IALA 3DWTA 4JRXA 1OF0A 2CPCA 4IMKA 3ZHFA 4WO0A 3BP6A 1ZS2A 5ILTL 2CLZA 1K85A 4O5LH 2EICA 5CJXC 2Z31B 2O5ZL 5FA3A 5T1KD 3WG7B 5HDLA 4Q14A 5EZOL 1ZXKA 3C6SB 4FQ2L 4I2XB 4ODTH 5FYKU 3N42F 4BQ8A 1Q0XH 4DQOL 3VXSD 4A7TA 3MXVL 3UP6A 4JFOB 4Z78B 2HKHL 4ZTOH 1BW8A 1CFQA 1NDMA 3E6FA 1ZHNA 1A9EA 4KVNH 1AD9A 2DKMA 4B9GA 4JN2A 4Q74A 2O6EA 2XXCB 2XNAA 1NC2B 3LN5B 3LPWA 1J86A 3QR0A 4PJ9C 3UYRH 2MTAA 3KH3A 1ZE3C 1A0QL 1CD8A 3ZU8A 4PJ8B 5LGKA 3F7RA 2WHVA 2NLJB 1I8KA 2NZIA 4ABWA 4N0FA 4GMTH 5EOTB 4JMXA 5I2IB 5JW4R 1CE1H 2FX9H 3K7UA 4X6DA 5KVEH 2Q86A 3Q8CA 4GW5B 1BEYL 1HXKA 5C92A 2YMTA 1ORQA 4MDIA 2WM0A 2YAPA 3FU5A 4YE4H 5E2TH 1E9OB 3UERA 1IM3B 1UKSA 5CN1A 3SKOB 1BVLB 2QHLA 2YD8A 2WQ8A 5AVQB 1WSST 2AJXL 5C0DA 2BMKB 3NFNA 1J18A 1FHGA 4U0QB 1MHPL 5JPNB 4BFRA 3KH4A 5F9JB 3OKNB 2BNQD 1BEXA 5F2FA 2YARA 2COQA 1O6SB 1TVHA 1AKJA 2HJFA 3HHSA 1EGJH 4TTGA 5DDHA 2YGPA 3QJXA 3UAJD 2IDTA 3MRGA 1QACA 1S7UB 4MKMA 2GCYB 2H32B 1XAKA 3AC0A 4FHBD 3VFPA 3PL6B 4YHIB 1UM6L 2MEJB 4NKOA 4Y5YB 2L7JA 1BF8A 3P4NB 2BNQE 3V4PL 1RUML 3BI9X 1QFWI 3T3PE 3SY0B 4KHXH 4U7MA 4BGDA 3OAWA 5I5RA 1YEIH 4W68A 1GVIA 1NBVL 1REIA 1KXVC 1QHPA 1W2KT 3J8F7 3PWUB 4XCCL 5D93B 1COBA 4CSPA 4KWUA 4IBWA 3QZLA 2H2PD 3KXFB 4UZSA 5EHFA 1S9XA 1UYWL 2GSIB 2R2HA 1WZKA 4J3OH 5JPMC 4PJDA 1XF2A 4PJIE 3WLBA 3PDOA 4Y4KA 5EU6D 3TWCL 2NY0B 2VB5A 1WIOA 3FHEA 4OZGF 2V0AA 1WAAF 4FNTA 3WJJC 3UG5A 3BO8A 4HWZA 5KSAB 4KKCD 4MJIE 3QIWC 3GUTA 2W38A 1FH5L 1OTSD 4HS3B 4EEEA 4P23A 4FGMA 1UOLA 4XB8A 2NCEA 3BAEH 3NIDE 1KTDB 4NC1E 1IGMH 3GSOB 3L4VA 1UCBL 3V8CA 2DQCL 5GGUA 1EPFA 4LHUA 4NI3A 3HMXH 1CU4H 5EU6E 3D1MC 4CADB 1AP2A 1B2WL 1WFTA 2O6CA 3D0LB 1P4UA 3BKMH 5FUCE 4ONFL 3RTQC 3B6SB 5HYQB 3DSFL 3TURA 4HIXH 1BBDL 1JIBA 4FJYA 3ARDC 5I73B 3S37X 5J56B 3KLAA 4NWUH 2BO0A 1M57B 2ZF8A 4ZUWB 4XAKD 4U6TA 2CM5A 1FH2A 1HHIB 1KDJA 1C7SA 5ADOH 4N2FA 1MVFA 5I28A 5BXFB 3CH1B 1C12A 3B8SA 1IL1A 4NHCL 1WBYA 1RERA 1WFJA 3HLAA 4PJ7B 3IDNB 3TNMB 1I1FA 3M8OH 2VXQH 1QLFA 4BZ1L 3CXHJ 1FFPA 2YK1L 3U4EB 1KGUA 1W9XA 4FNRA 4YC2B 4PLKC 3ZIMA 1I7TA 1TQVA 3TN0A 4ORGA 3EH4B 3IK2A 4U31A 5DD1H 2DJUA 4DHLA 1A1NB 2JTYA 4TNVK 5CKGA 1L9RA 5IHUL 5I15L 4NEHB 3S36L 4XC3L 4J6IA 1O75A 4GIAA 4BCXA 5KVGH 3A6BH 1IC4H 5DZ9A 1BXVA 1A7PH 2JQZA 3DK2A 4X80L 5BQ7B 1R3KB 2VGLM 2VN3A 3DVGB 1CLZH 5K69A 4ADJA 5ANMB 1XZWA 2DBLL 3RVXD 3QJSB 3RILA 3CN2A 3U82B 4B50A 4K3DL 2XU9A 4JUTA 4R0LC 5D1ZA 3IDYB 3V0FA 1PG7L 3O2VL 3T2NH 1XXDC 3VXOA 1ZGLB 5C3LD 2CGRL 4Y16A 4NQSA 3FFOA 2OZ4A 4V11A 3IDMB 4OZFH 2E7BA 3S88H 1FJ1B 1R1CA 2CNYA 2I9TA 1WZ1H 2GIXA 1CWVA 2WLIA 1D5ZA 3NIFB 4WNSA 5FOJA 1RIUL 2NXZD 3DOHA 2OQJB 4GP4B 1RVFH 4WFEE 5IW3A 3SGEI 2ZJSL 5E6YA 2ARJB 1S7QB 3OXRA 2Y7LA 3K0YA 3VG9C 2XIBA 3UTSA 3FQ4A 4OLYH 3HMWH 4YVNA 5B1JA 3NFPB 4K5MA 1ZLUH 5L7XL 2IADB 1JWUB 5HHNB 2MRYA 4K8RH 2EINB 3ULVD 3X1FA 1IEBA 4BZ2A 1HE8A 1M42A 3FTSA 3MUZ1 3ARZA 4X5XA 3GSQA 4DUVA 1QI3A 4PJGE 5F7DA 2VXSL 5G5DA 5FECB 4NLHA 2OMBA 2XZAL 4ZMZA 3V79C 4LOFA 4I3SH 5J12C 3VAEA 1U6AH 3HBGA 2Z8WC 4N2HA 4JKPH 3GLDA 2G60L 5D7KD 2F53D 3WFZA 5KVMC 4I7ZC 1ICTA 1N4XH 2EIKB 5JNYB 4I3GA 4C59B 5B4MD 3C6EA 2A0LC 1U8MA 3RKDD 2X4RA 1Q9OA 3DX6B 3ZQWA 5F3FA 3IJEB 4YS4A 5FC9A 4NAQA 4NN7B 4X0KB 4KI5C 3MNVB 3UFIA 2WINA 3ESMA 5T3ZH 2W9DL 5EU4B 3KW8A 4WJG3 3KLHC 1A6ZB 1K4DB 2ZUSA 1HI6B 2ERJB 2R4SL 4MNGA 1GYUA 1LXMA 4EN3A 3RP1A 4K7FB 5J1TC 5D7KE 4LL1A 3RWJB 3HZYB 4L4TB 4JPVL 5FK9A 2WN2A 5D6DC 4P4RA 1CICB 5E6IB 5HGAB 3EDDA 1FCCA 5EUOF 1T3FB 1GIGH 1OGAA 3CZNA 1MHCA 1QBMH 5KWYC 4HQQL 4L3FA 4J4PC 3MFGB 5I6MA 2IOIA 5F7EL 4Z7VF 2WXJA 4DOHB 2XZCH 1RU9L 4KMTL 2HTLC 3SEPA 5I17B 3LKNA 4OUUA 5IVZB 5E8DH 2YA0A 1TYRA 1HHHA 3BT2L 5HY9B 1A1OA 2XN2A 3ES6A 2ZOKA 5SX4H 1BJ1J 1G7QB 1NPJA 3N44B 5I1IL 5HJBA 3QWOA 2O5YL 5KVDH 2Q5BA 4W9LC 3SZKC 2YKKA 1SYSA 1BAFH 1NUNB 2YAFA 3FT0A 3ZO0A 4IIZA 2XIDA 2ZWKA 1KCSL 5TGBB 1U41A 1QSFD 1MFVA 5A2KH 1CL7L 4NN5C 4XMVA 1KDIA 1BQLL 3G3LA 4MNHA 4FX5A 4NBXB 3TO2A 3PU7A 5IK3B 2KERA 4P99A 1SOQA 5SWSE 3D9AL 4I77L 1VACB 4XNYL 1SXAA 3R4RA 2UX7A 3SD5A 2FJGA 1XTLA 1T03H 1DJWA 1B6UA 1EZVX 4H8UA 3VXMD 3QHFL 1H9VA 1UM5H 1QSFE 5K9OB 5KSBF 3D0VA 4DIXA 3CU7A 3S48A 4CC4A 4N0UE 1SY6H 3PHOB 1TYEB 4TVUA 3AS1A 4XB3A 2P1YA 1PAZA 4YSUA 5CHNA 4G6KL 3FB8B 3P4OB 4DTGL 1U8HB 2VR7A 4YAQB 2WVVA 4G7VL 5B7MA 4AGQA 3E2HB 3VD2A 2J1YA 4ONOA 4NQVB 3L3IB 4XNQA 1VEPA 2GY7B 3VXUB 1FRGL 4JO1H 4ZRGA 2JQAA 4HEPA 4Q4IA 1AE6H 5LUMA 4WIQA 1BLNB 4P49A 1QEWA 1VENA 1U36A 2DWEB 4FFZL 1XBRA 2UXVA 1CD1A 5GHWL 3WIHH 3ZE2E 3ZBMA 3CVIH 3VA6A 3HRZC 3Q5YA 4PR5A 3BH8A 2DYPB 1P6AB 1PG7W 3FS9A 4K9EH 5KJRH 4PWHA 3P54A 1G0XA 1BX2B 2YRZA 1HILA 4TNWF 3MLSH 1LE9B 3E1F1 1A4KB 1E8WA 4WV1C 5FYJL 2OS7A 4A6YH 5BQDA 4WSJA 2Y1ZA 5A6MA 2VLRD 1NMAL 2YD5A 5IJBC 4UT9A 3ME0B 4XVSL 4PLJC 1DLFL 2P8LB 1P5VB 1DL7H 1WD8A 5JUEL 4KKZA 2J6EL 5JQ6H 4W9ZA 3BISA 4HJIA 1A6UH 4QNPE 2IOMA 1RCYA 1V7MH 4EI6A 4PB0L 2OAAA 1HFUA 3NPSB 3A47A 2A83A 3MDJA 2FR4B 2YRBA 1G9MH 1UZ6E 3BKYL 3OLGA 1CT8A 1JZJA 4LLYA 2PTTB 3RZCA 2R1YA 4UAHA 5D2LE 5FO7B 1MJ7L 5CSGA 4MA8H 1HN1A 1PX4A 3ZN6A 5BPPA 5F9OH 2BIOA 1EA9C 3BPNB 1P2CB 2AQ2A 2BVPA 4WLCA 4YNYA 1SOSA 3L5WB 4QHMA 4GUPB 1DSYA 1GGCL 3RL2B 3EBGA 5E0QA 1KCRL 2NW3B 5HVHC 4PJFF 5ENWB 2XTJC 1A14H 5I26A 4F58L 3SDYH 5JQIB 2XV2A 3ABKB 4MXVE 4F3FA 2DICA 5DEJA 1HAUA 2QADC 4PGBA 4L0PB 3L4UA 5CINH 3BSZA 5E9DA 1A3QA 3FQUB 1AR1D 1T7YA 2FT6A 2J2ZB 2GJZB 4ODWA 2E27L 4YBLB 4O4YL 1V8HA 3TP4A 4OF7A 3MBED 2WZ5A 4EJ1C 4JM2A 5CEYB 4A04A 3O4LE 2YEZB 35C8H 3QUZC 5JXAH 1TKWB 3UZEC 5C7ZA 1QBLL 3BIKB 4N8VG 5E00A 4ZJ9A 4HXAL 4GXVL 4RRPM 2VDRH 3FT2B 4LPCA 1QSEB 3D85B 2X9YA 1IM9A 3CQQA 3CPLB 3CFKA 2QDWA 5DVPA 4X4MA 2EXYD 2EDKA 4LSSL 3ARYA 4DZ8B 3NZUA 1CGSH 2G3ZA 5L4FA 2OJZH 3VYOA 4ZFGH 4MNQE 2FJHB 4X6DF 1ETA1 3CPUA 4XVOA 3FN3A 1UGKA 4KO7A 3WMQA 1CQYA 1ZT4A 4G8AC 4PS8A 3T08A 3CZSA 2EDLA 1RY7B 2PCYA 2UWEA 4UV4H 1L7TL 4KOBA 5BMFL 3FPYA 3W5NA 4ZPTB 3WFBH 2VKWA 4GRWF 3G6JE 1F5WA 1XF3A 4FNLL 3IJ8A 4WI6A 1B0IA 4ZTEA 3W57A 3BJLA 1CTNA 1I8UA 4YBQC 4PD4K 1J0IA 4XXWC 4Z7QB 1CLYH 3CBKB 1SDYA 3RURA 5E08H 5FF6B 4ZSOA 1D6EB 2WNGA 3OKYA 1AGEA 5F1IB 3BP5A 4WO4A 5ABZA 5J0BA 1UZ8B 4Y1AA 4O58L 1MCQA 1IAOA 5F7NC 1TTAA 2P45B 1Q90A 3UTTA 1MW0A 4B9PA 3L2MA 1CR9L 2Z65C 4P57A 1Y18B 1QPPA 4HXBH 3SYQA 2IAMD 3LKQA 1WFNA 4UMSA 4QWWC 3UJJL 1RIVH 1TZIA 2B4CH 1RZGA 4EKJA 5HXMA 4AJVA 3FOMA 1RUKL 3EYSL 4LLUB 5DGQA 2ICES 1TOXA 1ES0B 3L2LA 5M94B 2DKUA 1QWNA 2YUZA 4PJDF 3MUUA 3OPUA 4FQXC 4PJXB 2G75A 2VE6A 1HNGA 2PO6D 4WKZB 2L3BA 3KWXA 3K5SA 3WNIA 1I9RH 2VERA 4UYPA 4XNXL 5DVOA 3LQZA 3GD1C 4KQ4H 3P1VA 1FLRH 1VSCA 5FUOL 3WENA 2DKSA 1TMQA 1E2WA 2XT1B 4YUEL 2Z0UA 3ARBA 3F7VB 3T9WA 3D3VE 1DE4B 4YPGA 4IRZH 4ZW8A 2Z31A 2V7NB 2VDLH 4X0NA 3S97C 3VSQA 2N01B 4BQBA 3WV0A 4HKJA 1U95B 1T1XB 3CZFA 3QNFA 2A74A 4JFOA 4Z78A 1U8NB 4ZYKB 1SDDB 3P9WB 1KEGL 4JFFD 3T4AA 4JCMA 3L81A 4NUGH 3VG0L 1WCBB 2BW5A 2MOVA 2XWCA 4Y2DD 1GC1L 3QDMB 2XY2A 3LN5A 1XBDA 4UAOC 3S34L 4Q6KA 3WXVL 1DSWA 1Q38A 3VXNA 3ZL1A 2NLJA 1I3VA 5FCSH 4TUOB 1MCOL 4RRPA 5F7KC 3CZJA 5EOTA 5I2IA 4JPWH 4PVNA 1JXKA 3G9VA 1T89C 1HYRC 1IJNA 1FIGH 2WMPB 2AJ3B 4GKLA 1BHGA 4RAUA 2XWEA 4G8GE 4V1DA 1MEXL 4LE8A 3SJVE 2BVQB 4NO3B 1OAYL 3IJSA 1E6JH 1BVLA 3T1WA 1CN4A 3W39B 5DFAA 5I24A 2NNCA 3HIZA 2BMKA 5EZOH 4FQ2H 1J8SA 1D5MB 2VL4A 3EJYC 5KG9B 1UM4L 2BDNL 4DETA 1AFVL 4CSSA 3OKNA 4AXWB 3ARGC 3L13A 4K23L 4QRRB 3C8HA 1E5ZA 3OXSA 4IMLB 1FFRA 1QFUL 1V5JA 4N2GA 4MBRA 5JPMB 3GXMA 1IC5L 5C71A 3H9YA 1NGQH 5CBEB 1S7UA 3BXNA 3VFTB 1A0QH 4EIGB 5EEZA 1ZGLM 1IGCH 2V8LA 1F02I 2H32A 4A2EA 4JY5H 4NXSA 3QIWB 4TLTA 1AHKA 2A4CA 3LY6A 4YHIA 2MOGA 3V6FB 3R7QA 4FTVB 3MRKA 3DUUB 4Y5YA 3V0WL 4IOSA 1G7IA 1KB9J 4FI6A 3SO3C 3SY0A 4FXTA 1XCQA 4JDEB 4JY4B 1XWVA 1IGJA 1TLKA 3EW3B 4LGPB 1NFKA 4AG4H 4F57L 1X9RA 3PWUA 4LMQI 3RTQB 3OV6A 4ZFZB 3EFOB 1R17A 4Y4HD 1DJYA 3KXFA 4OZHE 5ALBH 5EBWA 3ARDB 1S8DB 2GSIA 2JI3A 1HYSC 1BWMA 3F04A 4JM4H 4XH2A 2HKFL 1G6VK 4JQVC 4QPEA 3F62A 1MFUA 5DD0H 5KSAA 4MB3A 2DAVA 5KSVB 1S3KL 4S0TD 1JRHL 3RFZC 4EDXA 1LE5B 3SDXB 4Z7NB 2NY1C 2FNBA 4OI7A 3GSOA 3A24A 4NAMA 3VQLA 2QQKL 4NJ9L 4PLNC 2YRPA 1ZHLA 2W0LA 3GMQA 4K94H 3ERXA 5HHPB 3WDHA 4CADA 2JKIS 3D0LA 4KKQA 4IS6A 5DVLA 2GPZA 2MIZA 3GEFA 1NAMB 4L3CB