3JZYA

Crystal structure of human intersectin 2 c2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
IGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human Intersectin 2 C2 domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Intersectin 2
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
A PF00621 RhoGEF RhoGEF domain
A PF16652 PH_13 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3jzyA00
3OAWA 3LJ3A 4EZLA 1DSYA 4WWPA 4JPSA 4TUUA 4ANXA 1RSYA 2FJUB 2WXPA 2Z0UA 3M7FB 2V4LA 1GMIA 3APDA 3NSJA 2CJSA 3F05A 4WWOA 4XE0A 4QJ5B 4A55A 4FHKA 2DMHA 1E8YA 4FA6A 1BDYA 2B3RA 3QAQA 2WXHA 4LT7A 2R83A 3DPDA 4PS7A 1DJXA 4EZKA 4EZJA 2CJTA 2K8MA 3RPBA 3L4CA 5CCJA 4URKA 4ICWA 1DJYA 3QR1A 1E7VA 4KZ0A 2NCEA 4L2YA 2CM6A 4NP9A 4AJWA 3L9BA 1DJZA 2CHZA 3CSTA 3MJWA 3TJPA 1UGKA 1UOVA 1WFJA 3QARA 5KJ7E 3HHMA 5JHAA 1DJIA 3FBKA 1DQVA 2WXFA 1E8XA 1HE8A 3T8MA 3IM1A 4DNLA 2N1TE 1E8ZA 3L54A 4L23A 3F00A 4IQHA 4NPJA 3ZVVA 3QR0A 3L17A 3DBSA 5H4YA 4QJ4B 3ZW3A 3N5AA 2X38A 4FJZA 4GNKB 4ANVA 3ZIMA 4GB9A 4KITB 4L1BA 4OVVA 2WXJA 4IHBA 4WEEA 2A5UA 4L1LA 2ZKMX 3QJZA 4PS8A 4AOFA 3PFQA 3KWUA 2CHXA 2WXIA 2D8KA 5G2NA 1RH8A 2RD0A 4QJ3B 4DK5A 3HIZA 3L08A 3W56A 1A25A 3PYCA 4TV3A 3KWTA 2KI6A 4PS3A 4FULA 2WXMA 1QATA 2JQZA 2UZPA 2FK9A 5H4ZA 2YOAA 2DMGA 2ENQA 3QK0A 3PRZA 5CCGE 3L16A 5JHBA 2CHDA 1BCIA 5T8IA 3ML9A 4HLEA 2A4ZA 1V27A 3TWYA 2WXOA 1E7UA 1TJMA 1DJGA 2QZQA 3ENEA 4V11A 2K3HA 3ML8A 4NS0A 2Q3XA 4Y1SA 5EDSA 4OVUA 3B7YA 2Y3AA 2K45A 3GPEA 4J6IA 3IBEA 3OHMB 2ENJA 2NQ3A 2WXRA 3F04A 4FADA 4ICXA 4BGDA 1BYNA 4QAMB 2ENPA 4TS6A 2WXKA 4F93B 2QZ5A 3JZYA 3L13A 4FHJA 1E8WA 4F1SA 1YRKA 1RLWA 1W15A 4KZCA 1UOWA 3NZSA 1WFMA 1TJXA 2WXLA 4LCVA 4MJJA 1DJWA 4ANWA 2CM5A 3PS6A 2WXQA 2NSQA 4ANUA 2WXNA 4F91B 3HN8A 3APFA 2EP6A 2CHWA 5CCHE 4G11A 3NZUA 3PREA 2K4AA 3APCA 1W16A 2Q0ZX 4LDCA 5G55A 3SD5A 4FLHA 1DJHA 2BWQA 4F92B 2YRBA 1E90A 2WXGA 4FJYA 1K5WA 3CSFA 3F01A 1CJYA 1QASA 4NPKA 3FDWA 4WWNA 3R7RA 3S2AA 3TL5A 4XZ4A 4XX5A 4WAFA 3R7QA 3RDJA 4Y1TA 4HVBA 4BFRA 2LHAA 3P2BA 2ISDA 3W57A
chains in the Genus database with same CATH superfamily
2XA3A 3F7PC 1AH1A 4PY7A 3MI6A 3RNQB 3ECUA 5D7IB 3ETTA 5CLTA 4YXKL 2BM3A 1FV1B 5D70L 2ZX5A 4Z95L 5AB1A 4F9PC 1MJ7L 3DMMB 1JYXA 1M05B 1VJSA 5F8QC 3B7SA 3G5ZA 3P9LB 1S7UA 3ULAB 2YJQA 3BFOA 5F7HA 4N0UB 4QNPE 2MKWA 1FFTB 1ERNA 3QZOA 1KCVH 2ICWI 4S0HA 1EHLL 4PJCF 2VC2B 2BP0A 1TMQA 2XKNA 4MHHI 4APXB 4OY9A 3VFNB 1AD9A 1JYVA 4MGXA 3NCYS 3DO7B 4UM9D 4XCEA 4DO5A 5IR1A 3DIVA 4NQXA 4N5EC 2GQHA 4MCZA 4JB9L 1KCBA 1XCTB 3MBEA 3PWLA 3TBYA 1IC1A 4GRLA 4BELD 1AYRA 1BFTA 1GOGA 3AMKA 3RWEB 2GSIB 3LH2H 3TVMD 1LP9B 4RQQB 1CLCA 1O9ZA 3MRKA 2GJZA 3O3BB 5HGGS 5E8DL 4FYRA 5C07B 4GXUM 1QUNA 2EZ0D 3OTTA 4LCYA 2EC9T 4OZIB 3IGAA 1HSAA 3P3YA 3TPUA 3FFCE 2NT0A 1NCBH 4PJ7A 3VRIB 3HVNA 1FAKT 1OQXA 1UT2A 1NAML 1A4JB 1N9PA 2RHEA 4UILH 1LP9E 1KGCE 2Y5QA 5KBDA 1PDKB 4DTGL 1QKZL 1MRFL 4WU7B 3D85D 1MEXL 1BIIA 3MR9A 1FFQA 5FO9A 4AYMC 3VTAA 4PGJA 5C0IA 5C3LD 1DSWA 2C9XA 5DC4B 1I1RA 4EUPG 3T0AA 5CJ8A 4AM0Q 5J13C 4OD3H 1FC1A 1HHKA 1RZIA 2IDCA 4MJJA 5E8NA 3WCYA 5HVHB 3S88L 5JW5A 2I5YH 4AQAB 1ZTXE 2C4XA 2W5PA 3PUUA 2FATL 3MJ9A 1R17A 3S37X 5A6IA 4H2CA 4PLKC 4NZUH 1X9RA 1VGKB 1S8DA 5ENWB 4AC4A 3T2NH 4AEHH 2B39A 1X5XA 1RLBA 1WGVA 2BWQA 4LSVH 5BNXD 4OQ1A 1EUTA 4PWHA 4YNYB 2HAZA 4NN6C 5DUPL 2H26A 2EEDA 2H2PD 1GGUA 1QZ1A 3K0YA 5C0EB 5MEND 3HJEA 1U8HA 5FO7A 3VI3F 5ISZD 4UAHA 3NESA 5JIHA 4F33A 4UI2A 1G7LB 1H9VA 5FKPB 4KY2A 1FFPA 4PJEF 4NC1C 1A3RL 1CLOL 5D7IE 5B3NA 5F1IA 1BEYL 1PCSA 2W88A 4PBDA 4MNGA 4MCZB 2B0SL 3JVGC 2FL5B 3GMQB 4ZFQA 3QYNA 2NXZC 4WQOA 4G5ZL 4HJ0C 2Y2YA 4YHPA 5AD0A 4YHLH 2DQIH 5EC2A 3KW8A 3B37A 3NFNA 5CF3A 4UT9H 3V10A 2HFTA 1UT9A 2W60B 3ZKMD 1MH5B 5EUOF 4ZUWB 5FV2A 2G30A 5LNGA 2CUHA 1KCVL 4JG5A 4PIRF 3L6FA 4PLNC 3EYFB 3KCPA 3V0JA 4O51A 4HPYH 4CVWA 3QQNA 3ZVVA 3GNMH 4MCYA 4NO2A 4DZ8B 5E1IA 3ABLB 4OAWB 3J07A 2PR9A 1IZKA 2HVKA 2XFXB 4NDMB 4YLQT 1NDMB 1TVBB 3WGVB 4IHBA 3N06B 5F3BB 5I1AA 2YMOA 2VLME 1S7WA 3CHQA 3I9GH 4PS8A 3X3GL 4D9RD 5MI0B 2IVFC 3MNVA 5DD6B 5IM7B 1S7QB 4QR7A 2F54D 4H88H 1DO5A 2PW2B 2XSKA 2GTQA 3EGXA 4H20H 1A6TB 4LGPB 3BQUD 1FRGH 3I9PA 4Z7WF 4RGMC 3P9MB 3U4AA 1TJHL 3H9SD 1S9KC 4AM0B 3ML9A 2EDBA 5IKCB 4UTCA 4LLVB 1DP0A 5TGBB 1YNTB 3GHEL 3M86A 3CQFA 4M9OA 4U31A 4W4OC 4J3XA 5ALBL 4J4PA 3F3HA 2J21A 2NNRA 1PZ2A 3VXRE 2ENJA 1NCOA 1S9YB 2GITA 4YDZA 5TDPA 3VYNA 1FYTD 4KXCA 5C6TL 2UYLA 2AXGA 2QHRL 2HLAA 4DP5X 2XQYG 2CCLA 1C5CH 2EEXA 5AZEL 5GQBA 1AO7B 5JDSA 1X5MA 2BY2A 3L4YA 3FTVA 4R97B 4DVRL 4X6BB 4UMGA 3D9AH 3VWKA 2OMNA 3KPPB 4J3OC 3HFML 1M2VA 4G11A 3FUDA 4NRZB 1A1NB 3RVUC 5BOZG 1CLYL 1E40A 1MIEL 2EKSB 4KKBD 5L0QC 4F7CB 4FAAB 4P3DB 2Y9RT 1YEGH 3UFIA 2ZSWA 5DUPH 2CBQA 3QXVA 3PDOA 2O30A 4M4RA 2CGZA 4APQD 4GMTH 5FYKE 1ROWA 3HZYA 3IDNA 3AWFA 1SBBA 5FO2A 4G59C 1BFSA 1MF2L 3PIQB 1JPTH 4JPSA 2JIXA 4I9WE 3UJJH 2AJXL 3BZDA 4ZUUA 2DQJH 5ESVA 5TDOB 1S78D 3WHXB 2OZ4H 3D39A 1HL8A 2HH0L 1I7RA 4W9LC 3N1QC 4EZKA 1L9QA 2VDKL 3FQNB 3WBDA 3QH3A 3IJHA 5E1QA 4MJ5A 4NUMA 5K39B 4XNZC 1KEGL 2JLLA 1VSCA 5IB4B 3FJTA 4WHYG 4ES9A 4MKMA 2GUYA 2QMJA 4M48H 4P4RA 4UILL 3RL1A 2JKRM 4M8VA 1UM5H 2VUKA 4WW2C 4E41A 2E6PA 2IH1A 3BPLC 3Q5TA 4NUGL 1FBIL 2UXVA 2XV6B 4L0PB 3D2TA 2P8LB 3GXTA 1UG9A 1CI5A 4XN5A 3O4OB 2WSPA 2XTJC 3HKFA 1QRND 4UNIA 3TBVA 5MHSE 3VFSB 1IAOB 3QT2A 3WTWA 4IBSA 2EXWC 3K74B 3PV6A 1HH9B 3RWIB 1DANU 2Z3FA 4G8IA 3N42B 2JLPA 4PM1A 1KCSH 2NDFA 5I8EA 3U1PA 3VE0A 3ARSA 3JV6A 1I1AB 1U8PA 4JFQB 3HI5H 2EIZB 1XF1A 4N90E 5D1XA 1LLAA 2BPBA 2WUCH 4HK0A 2NSXA 5HGBA 3ZE2F 3X2QB 2XZCH 3S8WA 3Q43A 4LIQL 4AUJA 1OAQH 5C0AB 1HINL 4YZWA 5DRWB 4KVPA 1VB9A 3D12B 3ZHLA 2BS71 3LRSA 3DGGB 1IKFH 4FTVD 1N6QL 4WDIB 1OAXH 4IKJA 1ACXA 4MD5B 4PVLA 2QQQA 3BQVA 2CR0A 3D0VA 4HISA 3IAGC 4TVPE 3IKKA 2OXGA 3HS8A 4HJTA 5TQ0L 1N10A 3A6CL 5KVDH 5GJSL 2J2ZB 1R3HB 2LABA 4LKCB 5GGTH 4YFEA 3NPSB 1AJ7H 1MWAB 3RWGA 3BKYL 5IB3A 8CGTA 3L5XH 2AJYL 3T04D 2IFGA 1KCLA 1HYSC 5F9WC 3NJVA 3O3EA 1WO2A 5ICUA 5E70A 4LL1A 5FV1L 4JKPL 3HJ0A 3Q8BA 4JHBA 4NQUA 5JDJA 1JTTA 1MAML 2WKLA 3FB6B 4ZMWA 4XCEB 1PPIA 4Y1TA 3X14A 4NPYB 15C8L 3SCMD 1V7NH 4AITA 4E41B 2XDHA 5DRNA 1N64L 3WMQA 4NQDB 1R0AH 1N6UA 4XPHH 3RL1B 1S3RA 2GB2A 5D1XC 5A7BA 5IV2B 2V4LA 4ILDA 5B1BB 4QYOB 5L4IA 2KT6A 4FQLL 1TR7A 2BSBA 1KCUL 3KYAA 2ZKWA 4FA8A 3UBXI 1KYOK 3QS2A 4FA6A 1GTNA 1OM9A 2D4FA 3OKKB 1SJXA 2R83A 4IRSC 4P9MH 5FGBA 2MTAA 4WCYH 2EE6A 5CN2A 1PYWA 4X0KA 3CD4A 4O58H 4YK4B 1OPGL 4FFWC 4W68A 3SJVB 1BQLH 4MJIB 4DO6A 3LEYH 5KVFE 3S6CA 5EU3A 3VI4B 5FS5A 3VXOA 2HTKC 1TTFA 1AXTH 3B8YA 4A63A 2VMDA 5C0FB 5IQ7H 3JV5A 5IREA 4WWKC 4ZYKB 1A8JH 3M1BB 3EOAA 1T89C 5TPWL 3BEWA 1YNLH 4KHXL 5EIIB 2HRHA 3WN5B 3N9GH 4WRLA 3UC2A 3A24A 1A5FH 3D1MC 2FWLB 3MLUH 3QJTB 4X6DE 1ZT4A 3NG5A 2XVGA 4QRRD 1J9TA 4FCAA 3CVDA 1FAIH 3I50H 3GEWB 3Q8AA 1LILA 4OI8A 2WXMA 1CQYA 2YEVB 4Q4IA 4PB9H 1SDYA 2X2HA 5DD1H 5CINL 4OZ4A 5IHWA 3S37H 1LNUB 2BMKB 1INEL 3P4OB 4P57B 1YNTF 1R3HA 1A7QL 5ABDE 3MLWL 3UDWA 3L3OB 5GS0D 1BF2A 4O2FA 2PYEB 2QZQA 4LFHG 5K9KA 1BQHA 2B1OA 5DQ9B 4X2UA 3V52H 2B59A 5F88B 4P07A 1PZ3A 2BLFA 5JW4N 1SHWA 2ZXGA 3NACL 3FSOA 4XOAA 2C1PB 3KGUA 3JV4B 1H8NA 5ALCH 1DFBH 3U9PH 4K23L 1F8TL 2B8OT 2VXUL 4W9ZA 3RWCA 3V9EA 1S7VB 3CAFA 5HPOA 1SHSA 1ZANL 2NW3A 1FLTX 1MVUA 2DZEA 4WSKA 1Z7JA 3GSQA 2ZOKB 4AZ8A 1SXNA 1J05A 1YEJL 4OLXH 3WNIA 1JFQL 1NMCC 2ZXBA 5HI4C 2EP6A 2IPKB 3F12B 2JJUA 2JV6A 4JL1A 5CCHE 3DVGB 4B7LA 3JV6B 2IALB 3ARQA 4FXKA 5GS0L 1PZAA 1FZMA 1G6VK 1CPUA 1M7XA 3TTYA 4ZFFA 5I9QC 3BKYH 2ORBH 1H3UA 1T4KB 5I6XB 1DBKH 2FSEB 3VVVA 3P77A 1TYJA 5D7HA 5C3TA 3UZEC 2YGPA 4Y19B 4ERSH 2DQTH 3KBEA 1GW6A 2BHZA 2JKTM 5T5FA 4X6CE 5DZPA 2QQLH 2CGYA 2F18A 3OKEB 4X5QA 3GBEA 4HAKA 5ESQA 2CAKA 4PCTA 4S10A 4CC4C 4PRBA 4MXQD 1DQIA 1BDYA 2CO3A 2J5LB 3IDXL 3V4LA 4MA8H 2BNRB 5GZOC 5L6YH 5L9DL 5DK3A 3Q8EA 3QULA 4UV4H 1KGIA 2B5IC 4AYFA 2WYZA 2XACC 5GJTL 2AJSL 3QI9B 4TUKH 3LS5H 2R7EA 4BK8A 3KWXA 5DFVD 2I26N 2FGZA 1BQLL 3IF1B 3FU0A 5BPPA 5F9JA 5HYFA 1IEBB 5KANG 4B9PA 4LSSL 3UG5A 3UH8A 1QG3A 1A6WL 3DVNA 4M61A 2O5NA 5DJ8A 3ULVH 3AFLA 3D3VA 3OMZA 4LOUD 2XWTA 2X4RB 4MAYC 5E8EA 5CJOH 4G80A 2XIDA 2EYTB 1RUAL 2UY6A 4QJ3B 3WE6A 3S0PA 3HHSA 1I8MB 2JCCF 2AZUA 2CLVB 2R8SH 4EQ3A 2DIJA 4WI8A 2WP3T 5DGQA 3KD4A 4AK1A 2UZPA 4M61B 1J05B 4P5MB 1ACZA 2F1EA 2AK4D 1INEH 4JDEA 1KGUA 3ULUD 4OAWA 3ZKND 2JK5B 3RTLA 3UYOD 3RIFF 5IUCA 1QSFE 1ZLDA 1JZ4A 4OTXL 3MRMA 2EIJB 2BOBA 2PO6B 3DGDA 5KAQG 1JV2A 2GIXA 4NQQA 4Y7OC 1XF3B 1NGZB 3N43B 5E94B 5FHBL 1V3MA 3W2DH 3FSZA 4H5SA 5HVWA 4DOHE 2JK5A 1IL1A 1OB0A 2CIIB 4YBLB 4UDUA 3VQLA 5E03A 1Z32X 2M26A 1TKWB 2B4CC 4TNWK 4I87A 3GMRA 3P9MA 1DBJL 2AQPA 1Z5LB 4UIMB 3F7LA 2IH3A 4YNYA 4YS4A 4XPFL 3IT8D 1G7LA 5FKPA 2KPNA 2L0DA 4JPVH 4OGYL 5HYSG 1CGUA 2NX5D 3JBG7 4P9HL 4FABL 4FQCL 3ZTNL 4P3CL 4M6ML 4J5VA 2DWSA 1ZLVK 3FTYA 3ZTDC 3BP6B 2OMYB 1I3GL 1ZLSH 3HMWH 4XNYH 4ZOBA 4HU8A 1CGTA 4OBRA 3AW5A 3LOWA 1CFBA 1PLGH 3K5SA 3K4AA 4YHPB 1O9VA 3FUHA 2B9AA 2RCSL 3WSQH 3T77A 1AFVL 2HJFA 3A4EA 3CZNA 3WN6A 1LQBC 5DMJB 3A6BH 4BK5C 4ZMYA 1YEDA 1MVUB 4XP5L 4HEMA 4RFOH 2KS0A 3RVVD 5LBVA 3ILPA 4N2AA 4UM8B 3QUZA 4C83A 1T0MA 1C1EH 3L3DB 3ZDYB 4ALAC 2Z92B 1ZKAA 3QDGB 4CUCA 1QMUA 2D0GA 5LQBH 1L6ZA 4I1PA 1OALA 1A9EA 3H9SA 1XZ0B 1BVNT 3K8KA 3OQRA 1H6EA 3QIWD 4A7SA 1I8UA 1M7IA 4F9PA 3ZE0F 1G9HA 2W9EL 3QWOA 5HI3C 4ZX4A 2A0LD 2X0VA 4YZFF 3VRIA 4ZAKC 3ZUCA 3X3GH 4HUXA 2NNAA 1F18A 3QW9A 5GRWA 3LRLA 4MAYA 1UWYA 2AABH 5I17B 1I1CA 4Z8FL 1DR9A 3VVWA 2Y7NA 3I6KB 5BZWA 5HDWA 3OF6A 5DWPA 5E6IB 1A6UL 1OP3H 2ZCKH 3CFIC 1ZK5A 4OD1H 1P9MA 3BW9A 2VDQB 1KPUB 2YC1B 3GJEA 1HZKA 2DWDA 3GKWH 1A1MA 3B56A 5JW5B 2VR6A 4BH8B 2ESVD 3SPVA 1F6LL 1QTPA 5I19L 2DL9A 1V27A 2B0SH 2HB0A 3AS2A 3ILDA 4N2BA 4WJ5A 2VRQA 2OMTB 5DEGB 1KCWA 1RERA 4NO5A 4B9GA 2WY3B 3II3A 1JWUB 4QRUA 3GBNH 1BAFH 1EGJA 5AWNL 3I02A 5FYJE 5L4FA 2CA4A 3Q5OA 4XBEH 3GD1C 5IK3A 3CLEH 1IAKB 1B2WH 5AKVA 2WIIA 3RAJH 1RHFA 2YZ8A 3HN5A 2XRAH 1J9QA 3CMOH 3GM0A 1RFDL 2ZCKL 3UTSB 4YDKH 1CURA 5LGHH 1ONQB 5FYJH 3IAQA 1BF5A 3NIFE 3BEWB 5EIIA 1KBPA 1NBZB 2IPTL 3Q06A 4J8RB 5DJ6A 1TEFA 2K6ZA 1IUZA 1YMMA 4N9GA 4BRJA 3GSOB 1NMCB 3B5HA 3FT4B 4LHUA 1F4XL 4F7PB 1Q72L 1CFTB 2UZXA 4QCIB 3D4GA 3BDYH 5DRZA 4WNJA 4S1DC 1G7QB 2XQ0A 3P02A 5DVLA 2AK4A 2EH7H 2VL5A 2B3RA 2HCZX 4J8RA 5DJ6B 5EFIA 2B1AL 2BHUA 2MEJB 4Q7DA 2FRGP 4YGVB 5DD0L 4FZ8L 4ENED 4UNUA 3F6JA 1VFBA 1ZPUA 2KDGA 1RUPH 4MA3A 3EH1A 3MA7A 4GRMA 1Z5YD 4PH8A 3P3TA 4PJDA 5AL8A 1MI5A 7PAZA 1PSKH 1FNSL 3B3IB 3MBXH 1F2XK 3VI3E 3IWUA 1WISA 3O41A 4NZ8A 1QSFD 1ANUA 4XC1L 4Q97A 3H3KA 1CGSL 1Q8MA 3Q9QA 2WO2B 1UXSB 4P5TB 4JM2A 2R4SL 4MZ2A 5T1MB 4O4YL 2HX9A 4KGJA 5D1ZC 1ZLSL 3BP6A 3L4WA 4DCQA 4GH7B 3H9HA 4B9CA 4HK0B 3KZ8A 5IFHL 4XNXH 3N1FC 1F4WL 4JB9H 5D5MA 3W3BA 4BKSC 1JWUA 3EF7A 1E4XL 4FFZA 4KMTL 4QRUB 2FGWH 5D4IA 4WGKA 3ATAA 3ZR6A 1EFQA 2VAAB 5KTEH 4G9DA 1FORL 1KJMB 5L8LB 2NDGA 4KJYB 4CN6A 3P30L 1C5BL 3KXFA 3RTQC 2EE9A 4PR5B 1GS7A 1W6LA 1QRNB 1F2QA 2K8QA 2UVFA 3QQ9C 4B95C 4NCC1 1BCIA 1L0PA 3MDJA 4N28A 2XWJB 3KHQA 2Z64C 3STLB 2GSGB 1QR4A 3RY6A 1X9LA 2GC7C 1EXUB 1VFMA 4H8HA 3WIFA 2WPGA 5C0BA 5I6MA 1HHHB 2WXRA 3HN3A 3QWRD 4ABUA 2DWTA 2DQMA 3HS0B 3AU0A 4MD4A 1MXGA 1NBZA 1HOCB 5C0NC 1E8WA 3FB7A 2AMUA 3TC9A 3IDYC 4C54A 2E56A 3IDNB 5IT2L 1AR1C 2VDOB 4CSSA 3M6DA 4ES8A 4OZHE 3VWKC 1A7OH 1SUJA 4FFYH 4PRDB 3WS6A 3IJSA 1AHMA 5CBEA 1QFHA 3CVIL 5GGSY 5FDYA 3L1EA 4O2EA 1NCGA 4F7EA 2DI7A 4HBQA 3FT3B 2C9VA 1MFDH 4IBUA 3WS3B 2E8YA 5DWUL 3G04B 1XBDA 3I6GA 3D0LB 4JFZH 2FB4H 2R56L 2WLLB 5DJ2B 4ZNEE 3TO4B 5EZOL 2YGNA 3AM8A 1LEKB 4GRLC 1JDCA 2R15A 3U6RB 1IQWH 1XXFC 2XQYA 4P23D 1GS8A 4LDOB 3CSYA 4LQ1A 4JZJC 1MOEA 1E5CA 2JI3A 2XYBA 3HOGA 4O2CA 5I1DB 2Z4QA 2QGCA 1RURL 5E4IA 1PEWA 5LBSH 3FQXB 1QOKA 1QO3A 1RL1A 1SOSA 3IJ7A 3PV6B 3ZK0A 3IK2A 4F2MA 3VFSA 1CF8H 3QUXB 4MMZC 4HIQA 4NIKB 2YN5A 3JT0A 4X4YA 4UM9A 5I19H 1KPUA 2F2HA 3Q7JA 3NSYA 2WLZA 2OL3A 1XR9B 5T3ZE 4J2QA 3L4ZA 3QDHA 1SEBA 3QORB 3U4BH 3ARFC 2C9QA 4ONOA 2IQ9H 4BDVA 4JCWA 4JFPA 1J0KA 1Q9KA 1EHNA 3MCG1 3HHRB 5E51A 3D8MA 1GZHA 5A2IH 3ULVE 3O3DA 1EEZA 4MX7A 5IB5B 5IGXH 5MEOB 4U4BA 1NFIA 4MS6A 2VITB 4LHJB 3E80A 4GFXA 3FO9B 4PWKA 4R0LA 2EVIA 2D9QB 1DQMH 1ROCA 3KPSB 2PXYC 3KPNA 4IRZH 3HBGA 2O5ZH 4YO0B 3ZL4L 4LLMB 5LDSA 3D0VB 2XTJD 3MX0A 4HHAA 4EN3A 5C71A 1JUFB 1S3KL 4Y4FC 5DLML 1JYNA 4ZXBD 3C9NA 4GUPB 1UTDA 1HDMB 4HH9B 4OF6A 4ZUWA 4E41E 5I73C 4LSQL 1NCIA 1F90L 1IEBA 1KYDA 1S7VA 2D7MA 2ZWKA 3P73A 3BUDA 2YA0A 3MACH 3C09C 5ALCL 3EH5B 4QWWD 1WA0X 1Z0NA 3NFSL 4DPAX 2E7DA 4JQIL 3T0DA 2D3LA 3PAYA 4O02H 3WLBB 4H8QA 3L48A 5E6IC 2B4CH 3KJ6L 4GI8A 2XQBH 1HE7A 3CE1A 2AQ2A 3GIZL 4FADA 1QFOA 5K5YA 1AFVH 1IGTA 2RQEA 3WEXA 3CXDL 2O5YL 4R2GD 2QTEA 3CFKA 4Z7WB 1F00I 3VWJD 1YRKA 3B9AA 4Z7NF 2B20A 3KPLA 4TSBH 3V79C 4PP2A 3MJ6A 2XZAL 2VQ1A 3AWEA 3ZQWA 1R46A 5A2LH 4X6DF 4NI3A 5D93C 2YMXH 4U7MA 4YHKH 4ELMF 5GIRB 2I9TA 1FHGA 5CHNB 5F7DA 4F7KA 3R19A 4PRHD 3BVNA 4N90D 3O2DA 4HZLB 1C08B 4B9ZA 4NT6A 4XPGH 4S2SB 2X6MA 2XTLA 4HS6B 2NT1A 3DVIA 2BNQA 4EDWH 1UYWH 4X5WA 1E4WL 3IDMA 3WOVA 5TGBA 2QL1A 2DQDH 4K71B 1MUJA 5I74C 2CIIA 3BAEH 4C57C 4JRLA 4L8SA 2VCOA 1M57B 4ZSOA 2FX9L 1DCEA 3OXRA 4TF4A 4Z3FA 4J2XA 5EU4A 1JK8B 3CIAA 4NRXB 3CFEB 3CLFL 1J9SA 5DR5L 4ENEC 1J11A 4PJ9D 2PW1A 4JL2A 4JY4A 4QGTA 5C0RL 4LPUA 3O8XC 3T6QC 3KJ4C 1IC7H 3OXRB 2A74A 3EJPA 4QWWC 2XVBA 1PBYA 4NM8L 4W4OA 2ZYIA 4FL4B 4JW3A 1OPGH 5GGSB 1EERB 1DQTA 4Q52A 1LGVA 4YDJA 3D6GA 5EN3A 4F7CA 3SQRA 4EN3B 4U49A 5IG7A 5ABZA 8FABB 4J27A 1JGEB 1KTDA 1S46A 5IJKA 4B9KC 3APNA 4LPTA 3E6FB 3CTTA 4OCXL 1UQSB 4MAUL 4B27A 2OLDA 2WBKA 1JHTA 4CVXA 5C0AE 1T89A 4N22A 2V2TA 3DTXA 1BVLB 1I85A 2Y36L 2BRRH 1D7BA 1KEMH 2KHAA 1BXAA 3VFTB 5FB8B 3OG6B 2ARJQ 5DVMA 3ZT5A 5GGUA 4PBWD 1COBA 2BOBB 4AL8C 1L7TH 4AE0A 3KR3L 3A47A 2XCMC 5DJAB 3QUXA 2E86A 1GA2A 5FWRA 4HMEA 3DBXA 5EU6D 3IE4A 3W9DA 5B4MD 4QUOA 1MI5D 1DLHB 4QXVA 4XZUA 4PB9L 4FYSA 1IM9B 4QKXB 4WFGD 1LE5B 3JWOH 1TCMA 2B08A 2K3HA 4UTBH 4DKAA 3HE7D 4WTWA 4AV0A 4AVJA 4ORZC 1A6ZA 5ICZA 4W1TA 2CKNA 4JJ5A 3T3MF 1VGKA 3JWOL 5DD6A 4MFHA 3IMTA 4YJZL 4R26H 5CGBA 3E9UA 1NC4D 3BPNC 4L4VA 1T7ZA 1UD2A 1P0SE 1S5HB 2JJTA 5BJTB 1NCNA 5F7EH 1P7QB 4FG2A 2RR3A 1CTOA 2VTFA 1VADA 3HNSH 5AUMB 4ELMB 3ARFB 1I1FA 1XGRA 2AERT 4U1LA 5E24E 2DM3A 4WK2B 2ITDB 4IYKA 1TTUA 4AENA 5T1LD 2OMZB 5IWLA 5EOTA 1DQJA 5AALA 1E42A 3OPZH 5T1MA 3EG9A 4XZ4A 1IQWL 2X3CA 2EECA 3ROLA 2BVQB 1RZQA 2HJKA 4UT7L 4ZODA 1KELH 2NRDA 2WQVA 3IMBA 1K8IA 4BFFA 3G9AB 2AJUH 2IMNA 4N0YH 3ZSSA 3LNHA 5L2KA 1R75A 5L7XH 4WENB 4QHLB 3TV3L 1JPFA 5DC9B 2ESVA 3ARBB 3BP7B 1UKSA 2V7NA 4Z3TA 2ZAGA 3PHSA 3MPCA 3MXWL 1Q9LA 4PS7A 2FBRA 3QPKA 4LEOA 4GRLB 1QRNA 2UWEF 1ONQA 1XO8A 2N56A 1PKQA 4H1LB 1RIHL 1PX8A 2NCEA 5HVGB 5I9QB 3MLWH 4B96A 3CSTA 4ZUVA 2XA8H 5F7WC 3VJ6A 1IV8A 3O3EB 5I76A 5BUGA 2EDWA 3II1A 1CCZA 1A3ZA 1YMMB 5B3JE 3R4RA 1BXXA 3M07A 4NYLA 4AVIA 1F6AA 3TJEL 2CBOA 2IG2H 4GXVL 3QJHB 4FJ6A 4FNRA 4JRFA 1HHIB 3B9KA 1U3NA 1X6NA 4ZUVB 3QWQB 2I27N 3IU4H 4KHXH 1DLFH 3V4UH 5CIPH 2ZOLA 1YPZE 4FI7A 2H7WA 1KLGB 1SXZA 4HC1A 3D69A 4HD9A 4I88A 5E5LA 1T5XA 5L2KE 4LLDA 4HCIA 2D8KA 4YFLI 2QPUA 3QCVH 3L08A 3PWNA 2V2WB 1YEGL 4BV1A 1U21A 1ZT1B 2VSCA 4QRTA 1BZ7A 5BJTA 12E8L 1PY4A 5SWSE 4FNLH 4KTEH 1G1OA 1SMAA 3ECBA 4HMCA 1BP3B 3MNMA 2Y2WA 4GLRI 2X9XA 3WNMA 5IFAL 2YSSA 3DYOA 1R5VA 3EYSH 2VJ0A 1JVLA 5FYKU 3WTYA 2OMVB 1DJGA 4AL8L 2A9ML 2BDNL 2QKSA 4FQLH 4JRXE 4ZFGH 2NOYA 2VR8A 2Y06L 3MV7A 3BT0A 4BM7A 2OTUB 2WLKA 1OSZA 3GIZH 3ULVD 4L18A 4OCYH 5E08L 3PP3H 3BT2L 3GXNA 3L13A 4Q6YA 4YVUA 1DVFC 4RAHA 4KZCA 5TH2B 1PG7H 1KPRA 1G9ML 3D48R 3MBXL 4UUJA 3QQ4A 3W0WE 4FQ2L 3I6LD 5IB1B 2JELL 4WI3A 2VDLB 5HHOD 3VH8G 3VXUE 4OQTA 3DX4A 4ANUA 1CFNB 1LO3L 5FB8A 4HQQL 5C0CA 2NY2C 5CD5C 5HYSB 1GSKA 5DEFB 2AK1L 3Q48A 2WZ0A 1G5AA 1XGPA 3AADB 4R7DB 4AIZB 5BQ7B 5DK0A 4XN8A 3GT6A 2Q8BL 5BMFL 2PCFA 1RVFH 3QUZB 1EMTH 1OGAB 1PVHA 2IFFH 2OCJA 1F86A 4PIBA 1AG0A 2C9RA 4WF7A 1OO2A 5EUOE 1I3UA 3TYGH 4F8TA 4YSEA 1A9EB 2WLHA 1TZHB 2D03H 1UA6H 2N0MA 3OAUL 4Z18A 4WKXA 1ZLUK 5ICZB 3DV6B 3IFLH 1ETA1 1SDDB 1SLWA 3BHBA 4XPTH 2VLKE 5EU6A 1F41A 2V2XB 2IIJA 4CSZA 1NCWH 2GJ6E 4PJ8C 5BVPH 4BZ1L 1SPDA 3FQ2A 1KXHA 2O1AA 1JNJA 3FU8A 3FO1A 4AW4A 2X0UA 3K72B 3UYPA 1MAJA 3OX8B 5CWSA 5INCA 4NP9A 2DLTA 3UAFA 3QPQD 1DJZA 5BVJB 3N85H 1FSKB 4Y2DA 1JHLH 1HKLL 2HXAA 1BVOA 4JRYE 5C9JB 3MRRA 5B4MC 3WTTA 3ME0B 2XG4A 3ALPA 1W0VA 3U2SB 5CP3H 4YGAB 4BINA 1KCKA 1NPUA 4IBTA 2DI9A 1ETZB 2DMBA 3WNOA 1HKLH 3IJHB 3HAEG 4EOWL 1NAKH 1UACL 2BFVL 3B5TA 5IMKB 4WY7H 4XRCA 3VFUB 2G4EA 3QCTH 2Y7QB 5EZOH 4UIMA 4DPRA 1BQUA 2QV4A 4LEXH 5EF2A 4I2XA 5ABAA 1VEMA 4OV5B 1R5IA 3KEHA 1E6JL 2P8MA 1WBXA 1H5BA 4RMSA 2PPDA 4NUPA 1NC2B 4PLJC 5CCGE 5J57B 1A6VL 1NA8A 4G6FB 3BH8A 2YWYA 3SHSA 1XH2A 4HWZA 2WUBH 2YQ2A 4WU5B 4H20L 2Y6SD 1A6AB 3KWWA 3P3UA 4AT6A 3H4HA 4I2XB 5KBMA 2X41A 2DWXA 2EYSA 2Q3XA 1A6VH 3QZWA 4JRYA 4N2KA 1MEXH 3EDKA 3N1GC 1K5NA 4LLMA 3H2WA 3CZGA 2DI8A 3TZVC 4KVNL 5C09D 5IHBA 2YUZA 1MW3A 3ASNB 4GKOA 5BOJA 3RIAF 3OZ9L 5EWIL 4K3HA 2FCBA 1NEUA 3NZSA 4X7EC 3BZEA 2L7EA 4RFOL 4ODHL 1AXIB 4ANWA 3RURA 4WTXA 4G8FB 2A1WL 5D2LF 4D3CH 5E8DH 1PG7L 1L9OA 1UXWB 4MLSA 2OYMA 4K55A 1TQWA 5I2IB 1IGIH 5JUEH 1T21B 5DUJA 4TUOB 1JGLL 1HXYA 3KPTA 4IGBB 5E6RB 1NKGA 5CLWA 4ECNA 1ZS8B 2EDTA 2VDMH 4PCYA 5IVNA 2X4SB 4KKAD 1U92B 2F54B 3I74A 1M3JA 4HKBB 4KK6C 4M8QA 1GRWA 3C6LC 4LASH 3SGJA 4G6MH 3VW3H 1EGJH 1W6WA 3D18B 4HT1L 4HDIB 5DXWA 2BOCA 3Q6FA 1TQVA 5CEXB 4XNUL 2CLZB 1WSST 3NYKA 5H37A 3GWJA 2DM4A 5TFSL 3NIDB 3P77B 4ICWA 2EH7L 1S9VB 2BW4A 3FAWA 3OG4B 5FHBH 2NYKA 3W2DL 2J25A 2VMFA 2YD5A 4MMYB 2ZT9C 4WI2A 3JWNE 3MUJA 5EOQH 2APSA 5HJ3A 1Y6KR 1JS4A 2YAHA 3MZGB 4A6YB 2DQGH 2O6EA 1OB1A 3C2AH 3MRDA 5EF1A 1PQZB 3BH8B 5TDNA 3WXWH 5D1QB 4L1BA 3ESMA 4JFFD 4CU8A 3JT2A 3BO8A 5KSUA 5ANHA 2BNRA 3U7YH 3CFUA 3X1BA 1WS7A 3D09A 4I1NB 4DERA 2OXHA 1HHHA 1G7MB 4X6EA 1Y1DA 1WA2X 1UH3A 5FUCC 1A1OA 2KI6A 5IQ9A 1NIFA 3QQ4B 5IB1A 3LN5A 4DGVH 3TURA 2OJEB 1E4KC 1IAIM 3BSZH 4JG9A 3V0FA 3TO2B 3O6FA 1NCWL 1AGEA 2DS4A 3QQ3A 4P59L 3NMEA 1LO0L 4FCHA 1CLZL 4M1CC 4APXA 3WN5C 4RGNC 4DFIA 1UOLA 4U3SA 2DTSA 3FC8A 2PTTA 2YMTA 4XE5B 3RDTA 1EO7A 2IDUA 1SBSH 1YZZA 2BSTA 3QO1B 5IVXF 4DP7X 3HLKA 3TBSB 4B50A 2F8VA 4LVHC 1JXJA 5C9JA 1IE5A 3G04A 3I6GB 5K59F 4RA3A 2V7HA 5EO0B 3RWHA 2PP9A 3GBNL 1UCTA 2EYTA 2UY6B 4HLJA 3LIZA 3VB8A 3P4OA 3UPRA 3GSNB 5D9SA 2NQDA 4FLRA 1TQTA 4LNVA 3HNVH 3V95A 4E9TA 2DEWX 4LCUA 3ISWA 4Z0XA 1JPSH 3II2A 3JWOC 5J6HB 1BJ8A 2FQEA 1B9ZA 3PG2A 1DBAH 2F61A 1FH5H 3RI5F 4JUTA 2VR9A 2H2PC 2JE8A 2HX7A 1JK8A 3TJEH 5I75B 3ZUNC 5LGJB 5T1JA 4L4TA 3GSQB 5C3IA 4WHTB 1HHIA 4KDVA 4RX4D 2RCSH 3G6AB 3V6ZB 3MZTA 1TJGL 4J4PC 5AKTA 4ZFOA 4Z7IA 4D0CB 1N2RA 2DPKA 3HS0C 1E5UI 1XF5A 2ROYA 3SDDB 4KKCC 2XOTA 4MSWA 1Y18B 3GSUB 5KYYA 1QBMH 4N8CH 3Q1SH 2GK0B 3L3GA 4PG9A 5HHOA 1I1YB 5F1NA 1J86A 1WP6A 2NMSA 3EO1A 3QAQA 3H3PH 3DPDA 1L9SA 1UUNA 2NY4B 4FQ2H 2MNUA 1OVZA 5LQBL 1U8IA 4U3XA 3AXIA 4FNQA 4A2MA 3MRLA 2H26B 2DB8A 3UP6A 1E9QB 3GSUA 3UMTA 3SB3A 4AJWA 4OLYH 3S5YA 4Q9CA 3CC5A 1EO8H 5DD3H 4JFOB 3FQ1A 2J44A 1E8ZA 5KSAC 2NY6B 1U4FA 3UTTE 4IQHA 2IBZY 2XWDA 2F19L 3HC3H 3OB0K 4HAFA 1WCBB 5MI0C 3RB5A 2RQ8A 3AVEA 4Z7VF 3U30B 1R9FA 4GBXD 4I0PC 1B3IA 2V9TA 4QIRA 1JAEA 2P42B 3QJZA 4IU3B 4M5YH 4JPVL 4OGYH 3OMAB 3X12B 3WJJA 5FM4A 3IGUA 2RD0A 1DANT 4U6HB 3HPJA 2R0KL 3INUL 4BCXA 2NXZB 1ACCA 3MKGA 3PNWB 4JFXB 2AFNA 1BZDA 3RUGE 4BZ1H 1MZZA 1CVSC 4JM2D 2B2XL 4M02A 5TE6L 3KYOA 2L3BA 3A23A 3MA7B 3GSNA 5D9SB 3CZLA 4MB3A 4G72B 2WP3O 3RX8A 4AMKH 2CHDA 1QLEH 1GW0A 4ZXBC 1KENH 1E7UA 1AHKA 2R0ZH 3OC5A 3PNWA 2ATPB 2CGRL 4WJG3 2FD6H 2Q3ZA 3CH8A 1N5AA 4JFED 3FQWA 5BV7C 4OVUA 1XIWB 1IQDB 5DQDH 1QHQA 1U8KA 5B38G 1HL9A 3EFOB 5E5RB 4OCRL 3FQTA 1RIHH 2KDYA 4K8RC 3SQOL 3H8NA 1A1MB 2GIYA 4YBHA 5JXAH 4M7ZB 3SKMA 3OZKA 4JFQA 3RKPA 3GMPA 5KS9E 3TIEB 3K72A 1R5VB 3MAWA 2YSSB 1FL6B 4G6JH 5J06A 3VU1A 5D4QA 5KYUB 1DQQB 3K5RA 3LVTA 5MEPB 5IROC 4OF5A 5C7XH 1EXHA 4APQA 4RBPK 2OW6A 5KYYB 3QWRA 2DWEA 4JFDB 3EYQC 3MRLB 5I6OA 2YD8A 1XH0A 3QI9D 3QQ3B 4Y2LA 3OLGA 4HGKC 4PGDA 3NK3A 3G5ZB 3ULUF 2ALAA 1LM8V 1RZPA 1YECL 4LE8A 2APVA 2F7PA 2QQLL 4N8UA 3TYGL 1XSKA 1ZHNA 1TQCB 3RX9A 4GG6E 3ZKMC 2R9HD 2LLNA 1AE6L 4HKXA 2F53B 4L8DA 3VGAC 4PP1D 4NYLB 4UTAH 4Q0XL 2DMHA 5KSUB 2F6AA 3RG1C 4BE5A 3CHOA 4IKIA 5HHVH 4PV9A 4PRDA 2VDRB 5LAPA 4YHZH 4YDVB 3VXUB 3O9WC 4YN3A 1E65A 4M4RB 5E99L 4XO5A 4OI9A 4LOFA 4D9LH 4A2DA 1KBBA 4R26L 3V4PH 1CFSB 1VGEH 5EEZA 3TJPA 2FBJL 2B1HL 3AU1B 5DVNA 4J3BA 2GT9B 5CSBA 2EDJA 2DLEA 2XPGB 4ZS6C 3QAZB 2WCGA 3RFRA 1NBVL 1OAXL 1VACB 5F7KC 4XBGB 1IMHC 4G7SB 4RRPA 2C3GA 1CFTA 4LKXA 4UNTA 5CGYC 4XZUB 1B0GA 2W65B 3RVUD 1LE5A 2ATPA 2QQKL 3L3DA 3PQYD 1WVZA 1Q94B 5EO0A 3RWHB 3OGOE 4V1DD 4ERSL 2BP3A 2NTFB 3MCKB 2ILLA 1NGWB 3RWJA 5A3IC 3SDCB 1NAMA 3VGAB 4AH2B 1BW8A 3KLSA 1KYOJ 5LAXB 2HFGH 1H8SA 3ZBMA 2XI9A 3RVXC 3ARDB 4N0CC 4LVOC 4Y5XA 1HXYB 5EHFA 4ALAL 1UB6B 3QUXC 4KUZL 4P5KA 2H3NB 4HUNB 4J3OH 3MACL 4CU7A 5IFJB 5AFAA 4DEWA 4DCQB 3ENEA 4FNTA 5IMLA 2FX9H 4JO5A 2ITDA 3CDGB 3LMJL 4YHNB 2Y3AA 3EJQA 1EAOA 1T7YA 3H0TA 4HX1A 4M5ZH 5D7LD 1RU9L 5BZXA 3ETSA 1W0YT 4OV5A 2IOIA 3RGVC 2K1MA 4FFTA 1O7DC 5GS3A 3UMNA 3DX3A 5D7JB 5HHMB 1P5UA 2YMXL 4YHKL 5JA8B 2O6CA 5C86A 3EO1B 5DJZB 4L5FL 3VXRD 2FJHA 5I30L 2EYSB 1P1ZA 4HWUA 4LDCA 2J88L 2GFBA 4F92B 5DUBA 4KC3B 4UQEA 5LCVH 4YVNA 5JPMB 3MLUL 1L0YA 3BIKB 1E9PB 4M7LL 2N7BA 1CD1B 2AEWA 2YPLB 3Q8CA 1JXFA 5E56A 3DRQA 2PYFA 4DK3A 1KT2B 4JQIH 1XR8B 15C8H 4BCYA 5D2NE 2ZJSH 4JZOA 1BD2E 3GO1L 1JGUH 3VRLF 3SKJH 5FK9B 3GDBA 3QISA 2DY2A 2XTJE 5CIPB 3SE4C 2PPFA 3EHBB 2F9BT 2VM9A 5DLMH 2XZAH 4TUOA 2CJTA 4WCYL 4AIEA 2CR6A 4ZPVA 4LGSB 3U2SA 3DI3B 3ESUF 2HT2C 1KTBA 5B39A 2ETWA 1KB5A 2WANA 4PJCA 1EDQA 3HHMA 4Q14A 5F7EL 3FBKA 2CWRA 4OZFH 4ZMZA 2AJ3A 1TETL 4K0OA 4RGNB 3BCFA 5KVEE 4MNHA 2OA9A 2MOGA 4ABVA 3CHSA 5ID0B 2E6JA 4NERA 2XQBL 3KPQB 1R5WB 5IFJA 1KZQA 2GJ6A 2ZKYA 3JWDC 4M7ZC 4FFWD 5HJGA 2EC9U 2Z7ZA 4TTGA 2NW3B 4OVVA 4AYSA 5ISZE 3HB3D 3OXSA 4M5TA 1L5GA 4PJBF 3V5HB 2P8MB 1IX2A 1YPZF 2PW1B 1DZ0A 3N91A 1S9YA 3NEEA 2J12B 3WIFB 5CJXC 3QFJB 4FNPA 4YSPA 3GLAA 1KPRB 5HHVL 5IEHB 1IJNA 5E0FA 4G6AD 2UVEA 3LZPA 1CMOA 2PXYB 4HU2A 2G2RB 5JXEC 4MX7B 3QZNA 2R0ZL 2LLGA 2LLLA 1SZNA 4PJHF 3CWGA 2QFPA 4UYQA 5BQ7A 1W72A 1SBSL 2RFXA 3KM2A 4HPYL 3MJ7B 2BRQA 5TQ0H 3V4VA 2YUXA 1JZ3A 2K78A 2NQ3A 4HJJH 1FO0L 1NC4B 5E4EB 3MN8A 3BE1L 3N40F 5GGVY 4G80B 5F44A 1KYUA 4H8WH 1A6PA 4PRIA 4RMWA 4XP4L 4FERA 3WDIA 1UB5B 4QRAA 5A6LA 2QPFA 4N1HB 4HJGA 4M5YL 4DVRH 3TCXA 5I6XC 3U0TA 4FTVE 4P46C 2DICA 2DYPD 5I5MA 5IFHH 1MNNA 1I9RL 4IBLT 5EEWA 4L37A 1IC5L 4HOMA 1WG3A 3AXHA 5CJQH 5D6DC 3FXIC 1GHFH 1G0XA 3G5YB 4N2FA 4JFEA 4YHYC 3MOBH 4N86A 4MA3B 1K8DB 3FDWA 4X0NA 1WWAX 3OLIA 4GFTB 4AQ1A 3ASWA 4MQ7A 5F3FA 5DO2D 5LBSA 3EYVA 1CDIA 3BWSA 3MLYL 2ISDA 1YDPA 3U7WH 5MEQB 1PG7W 4HIPA 1RK0A 4PJHE 1HQ4A 2V37A 2B5IB 1EANA 5G5DA 1G9NC 2XG4B 1KBVA 2H6PB 3NGBC 4M7LT 4ZOEA 4MLIA 1CN4A 3EUDA 3UAEA 3WUWB 1D5XB 2I9TB 3IN2A 1IBHA 4KX9A 1P6WA 3DX6B 4N0RA 2Q5BA 2ZUVA 4TLSA 8PAZA 1IGMH 4IHOA 3NUKA 3CVHA 4HHGA 4Y19A 4EN3D 5DC2A 1ZAGA 2DYPB 2CQVA 1IZJA 5DEJA 2A73A 4ONGL 2VR5A 2VN4A 2MNJB 3RUGF 2QSVA 5F96L 3N3EA 1XIWA 2GFBB 4MNQD 3US1A 2B9BA 4FL4C 1NTDA 5ESQB 3ZE1F 3GSRA 4YIQA 4DJMA 3N5AA 4M5SA 1I8LC 2YD1A 3QZMA 1MCEA 1UH2A 1HHKB 3DXAE 4TQEL 4YPJA 3W0WA 4G42B 5AKRA 1QUPA 1OANA 1JNNL 2PN5A 1KTKE 3KNBA 5F97E 4HJ0D 1AMXA 5ESAA 2I60H 1T1WB 3MRGB 1UEMA 4TSAL 1B4JH 5EOCH 2DWEB 2VERA 3NGBB 3OKDB 1CLYH 3LHPL 2KZWA 3UJTL 1GZPA 2FWSA 3HNTL 1CXFA 1FIEA 2BCKA 3FMGH 3LIUA 3T0VA 4LSUL 1QI5A 4KDWA 4PYHA 4CVZB 5DVOA 3DRTB 1QSVA 4HSAC 3SGDI 5JW3H 1TNMA 2O5XH 3QJHA 4N8PA 4NS0A 3ZX1A 5MP6L 5L4MA 4XTRC 1MFBL 1W8EA 1ESOA 5J6HA 3V0EA 4G5AA 3O3BA 4XP9H 4E36A 3A67H 4L3CA 1HU8A 2ZOLB 1E2WA 4UBDC 5HGAB 4XC1H 4L48A 4BZ2L 4GKNB 4FHBD 1NBQA 4XXWC 5DQ9A 4K73A 1U8QA 2B77A 5D96B 4XP9L 3AM8C 4FZ8H 4P46A 1BHGA 1OT4A 2NUTB 4X8CA 4NWTL 5CZXD 2EDYA 3QGVA 3WJMB 2R0WL 3QUKA 5BRPA 5I8EB 2FH8A 3KPRE 2W0FA 1CIUA 4Y16D 5HJDA 3APCA 4WGVB 4IBQA 3SDDA 2H1LM 2X4QA 3WLWD 1KB5L 4HXAL 1KXTA 4FLHA 1VACA 1KOAA 5K39A 3BXNB 1QSEE 1J0YA 3NPSC 4GI9A 4IHOB 3WJMA 1BYPA 5I82A 2DYRB 1DZBA 1SOXA 2D7PA 3EGSA 5FLVA 3CUPA 1M05A 5GZNA 2WZ5A 3HNTH 3UIZA 4E5XG 4EQ2A 4BSWB 2EXYD 2E8ZA 4WTZG 2VLLA 1BBDH 2BOLA 1GCYA 4BKTC 4LSDA 3GIVB 1KN4H 4Y7MA 3RY6C 1WQVT 1EGJL 3DTDA 2IBZX 3BKJH 5AYTA 4K5OA 5DRXB 3BP4A 2N7AA 2FT7A 1HCYA 2PXYD 3ARGD 4ODTL 3UG3A 1MCOL 1T66C 3GINA 1DQJB 5EEUA 3BE1H 3AUWB 4Y8AA 3DHPA 4JRXB 3UP1A 4NRXA 4PI2A 4G7RB 1JZIA 4G1MA 3WY1A 4IIQC 4LSSH 3VX1A 5DEGA 4PQXA 1UD6A 2D7NA 5E7FA 4EBQL 1UFGA 2WMPA 1WZKA 5T1KA 3LEXA 5ELIA 1ZGLB 3WUZA 3KAAA 2WGXA 3ZMEA 1XGUB 1CE6A 1KB5H 4HXAH 4AQZA 3CFTA 3OWRA 2LQRA 2XFGB 4L4JA 1NQBA 2DQHH 3EW3B 2AK1H 5A16B 5FOBB 3AGWA 2BFVH 4ODHH 4FA7B 3GKWL 1UACH 2GEQA 3T2NL 3CFJB 1JXDA 4GP8B 3FK3A 5EC1B 4W9KC 3WS6C 4C56B 3S8FB 5IMMB 3PWPB 3VI3A 4CMMA 3H2PA 4Z7UF 3WFBL 1C5BH 3NAAL 1BFOA 5H4ZA 3KPLB 1MCDA 3CJJA 3T2QA 4N0FA 3GBLA 3NCWA 1MDTA 4G6ML 1OP5H 4OTXH 3SPCA 4YSAA 1M3IA 2X2IA 3N85L 2BIQA 3WU1A 4GG6F 3BVNB 2CRZA 2VLJE 3V5KB 4OD3L 4D8OA 3MV9A 3PIQA 3ZDZB 1MN4A 1XGRB 3MNVB 2FIKA 3O6MH 4BGDA 2VOTA 2DTMH 2VLKD 5FYLE 2R69L 5SX4H 3BUIA 1CLVA 5JNYA 1U3HB 2R27A 1C1EL 4ZJ9A 4E42A 1A6TA 4ENZA 4K7PY 4FKEA 1OP4A 4YHIA 4G42A 3T1WA 5KYXA 3VXRA 4JO2H 4U6XA 1BZEA 5E9AA 5BQDA 4LHUG 3F7YA 5C09A 3UAJA 1KJ2H 3L3JA 3VG9B 1Q9OA 4P4RB 3LH2L 2F15A 3SD5A 5IQNA 4JRYD 5KG9A 1FGVL 4B3EA 2Q8BH 3GXDA 2EIBA 4NNYA 3VXNB 3KYKL 4Z78A 1OCRB 4RVBA 3NIGE 4GUOA 4OM1L 2KQMA 2ODHA 3TEYA 3QYMA 3SE9L 2B15A 4OZIF 4PLOB 2OULB 4PWIA 5ETUA 3T1FB 5CP3A 1QW8A 4URTB 1J0ZA 4N3UA 1IAIH 1JZJA 2FJHB 4BXSV 4IU2B 5T5FH 4BZ2H 2BVUA 1SXAA 1A64A 1FYTB 3QDJD 3T6ZA 3MOAL 3BIKA 1DJXA 5FYKD 5H35B 1AHWA 2BC4B 3K6NA 3OHXC 3TV3H 3DX9A 4URKA 3KDPB 3B2UD 3PDOB 4AV5A 2CM6A 2H6UA 2IANB 1TZGL 2R9HC 3BPOB 2YEZA 2HVKB 2XFXA 2AQ1A 1CYWA 3FCUB 3GZOA 3LIZL 3IE9A 1L7IL 3EJCA 5IW1B 5J11C 4GKSB 1ND0A 3IM1A 4TLTA 3IU4L 4HIEA 4L23A 4IKKA 3SE8L 4YSSA 2EVGA 4MD5A 4NM4H 4OKDA 1EEQA 2ZKHL 3LYRA 3TNMA 3BVWA 5JMRA 1D7FA 4PVNA 2N1KA 4ZSOB 2OI9B 3WAJA 3NCBB 5KBNC 4HJGB 1YEJH 4BH8A 4XB7A 4FRWA 4YDIL 5DLLA 2OK0H 4DK5A 5CBEB 5IMLB 2FYYB 3QEQA 2I07B 2NY4C 4HHWA 4HWNA 5F7BA 3KYNA 3MBWB 2J6WA 4XN1A 4AZ8B 4OI7A 4BQ9A 1RZIB 4Z3EA 1SJEA 2F68X 3FFCB 3VMPA 3FRPA 3QUZC 2PPAA 2VJXA 3DIFA 2BP5M 2HVJB 3AS0A 3PAVA 5CEZL 5BO0D 1EAPA 4HALA 4LCWE 3FTXA 4EO5A 3IFLL 4KJWC 1X4XA 2VWEC 1ZGLP 2TAAA 3N6YA 1I31A 4PHXA 4UTBL 3IAPA 2CCVA 4JCMA 4NAQA 5D1ZB 2BFGA 3E6FA 4JQVC 1IM3D 2Z31C 3VB9A 1WV7T 1IGML 2G3NA 2UX6A 3VD3A 1T03H 5E2VL 3WFCH 3QQ9D 2L7UA 2H41A 2WQAA 1CE6B 2EDLA 2E9IA 4ISVA 3FO0L 3LKNB 2NX5A 4GW4A 4OZFG 4OZGF 1XEUA 4F3FB 4KJYA 2PXYA 2WXLA 2F0CA 4WGWB 2DEYX 4X4YB 2ZNXA 2BP8A 5DHVA 5E9DD 4O9HH 1E9PA 5IHHA 5SX5K 1YEKL 1NGPL 1SXCA 4PU2A 3MNWB 2F53A 4A67A 1XR9A 4QTFA 3QC5X 1RHHB 4KXZH 3LNGA 4LSRL 1WWBX 4RRPG 5IHUH 1QFUL 3UC0L 2VXVH 3FFOA 1MQ8A 4PRPA 2ID5A 4AEFA 4ZYKA 4K7FA 3BESR 5JQHC 1U30A 4G6KH 2X12A 5FO8A 2X40A 1ZHKB 3KDMA 5E9DE 3F2LA 1DQLL 3V52L 1TZIA 1KBGL 2Y7MA 4MMZA 4I3SH 5ID1B 5FYLL 5DVKA 4ZTOL 4UANA 5D93B 4AIZA 2QVIA 2D73A 1SYSB 4IRSD 4ELKB 5B7FA 1TT6A 5A2JH 2O5YH 5A7EA 4QHKJ 4ACPA 3HG5A 3QORC 4I3SL 2OJZH 4KK8C 2COQA 4D0DA 2WZPA 1G9MC 3GXUB 4J6RH 1LEKA 5L7XL 4TMPA 4X8JA 4DVBA 3QQDB 1LNUA 1Z5LA 2BMKA 5ITFB 2JNZA 1ETZA 1M7DB 3RNKB 5DMKA 1JTPA 5DRZB 3DROB 4PRHB 2R1WA 5EU6E 1ZS8A 3W5MA 1N7MH 3IDJA 3IB4A 3J27A 4IOIA 1NAMB 4N2HA 1FVDA 3O3AB 4G7VH 1MREH 4WO0A 5CSZB 1IO4C 4NPJA 3BN3B 1OW0A 2W0LA 3FQWB 4WV1A 2EXSA 4ZTEA 3RPIB 2WKGA 3BUQA 4JO1L 4ZBJA 2R2HA 5DZ9A 4UZSA 3F83A 5A6MA 2X9ZA 4GXUN 4QXGL 4GB9A 2R39A 5FUZL 5TF1H 3RLSA 1F5WA 2BRRL 2F5AH 4A04A 1FHNA 4JRXD 4ZW7A 1KWKA 1I8IA 3W56A 2X2YA 1LO4H 2HPTA 2R29A 3X17A 4WW1A 4APQC 3CIQA 3DGGA 3MXWH 3HG1A 2WN2A 4YL4A 1T80A 3NRFA 5GGRY 4N26A 4BKLB 2OXGB 3QK0A 4TL5A 2UWEE 1E67A 2AJZB 2B1HH 4IS6A 3D07A 3QUYC 4ZO8A 1GAFH 5D1QD 4OUUA 1CICB 3GIVA 2NY6C 4E9QA 2JWYA 1PD1A 3MV8B 4FOMA 1GTFA 1FLRH 2XG5B 4HBCH 4W6YB 5C0RH 5F1KC 1TQSA 2BWDA 4CJ1A 1MJUH 4AJVA 5EF3A 3HC2A 4YDLC 1OGTA 4FQ1H 1HVXA 4PJAE 3R8QA 5B39G 4D0BA 5GZND 3MGOA 5E6IA 3ZL1A 3FN9A 5J11B 3IGAB 3T0EC 1HK6A 2K4AA 3QO1A 3LEVL 4QRTB 5F88A 3RDTB 1JHKL 5IEKA 5IV2A 4HJUA 2EE3A 5DRNB 3BD3A 5CEZD 5KW9H 1WGOA 1AZRA 2XC8A 3QH3B 4D0BB 3SPVB 3ZDYE 2MRYA 5IVZA 1MFDL 4NKDA 4WWNA 1BMZA 1MI5E 4FDWA 4XPHL 4Y16A 4YLBA 2OZ4A 1TMCB 3QUYA 3GHEH 3R0NA 4FMVA 3EZJB 1I4FA 1ZWIA 3SYAA 2CKBA 1MAMH 2W0FB 4GRWB 1MHPH 2D31A 4WO4D 2P8PB 1WAPA 5H2BB 1S7SB 1JZ8A 5AVRB 3FUJA 4HIJB 3TXAA 2DW5A 5HYIA 1UJ3B 5I71B 3NCFB 3UBGA 1OAUL 2ZXEB 1NCAH 3I02B 4PJFB 4A6YA 1YYLL 3T2PA 3VFWA 4AENB 4GT0A 2GUOA 3DO4A 2HLFC 3CUPB 1SYVA 4KK6D 2XIIA 3FBQA 4HIJA 3F65A 1D5BB 3QA3B 2R2BA 3OKYA 2W80C 4XMLH 4PY7B 2WN3A 1OCOB 1MCJA 3AQDA 1DQDL 4OCXH 4TPRL 1Q0EA 2R69H 4RDBA 2E9WA 5DWUH 1GZPB 5A43C 1X6LA 3GS4A 3UXFA 2EADA 1AGEB 3QDME 1S7RB 3ISYA 2X5PA 4OJFL 2FLMA 4ZTOH 2OSXA 1GMEA 3UERA 5DZJA 3IXAB 4G6JL 1ZXQA 2F58L 4FN0A 4LP5A 5E9DB 5ANMB 4PV8B 1MHHA 2BP8B 2QDWA 5DHVB 3TP4A 3O3UN 4JN1L 1RURH 4WWKB 5DJDA 3KPMB 3SN6N 1H8OA 5I1KL 2P43B 4CVXB 1R3LA 2MTPA 1FNSH 1NFDA 1N8ZB 1ZSHA 5H94B 2LOEA 2FD6L 1RUPL 3GSXA 3HRPA 1RZ7L 4ZS7L 1PFOA 5I16A 1FBIH 4PRHE 3DOIA 1R3JB 3CH1A 2ICWB 3LNEA 3VMNA 3APMA 4YSUA 3WY4A 3PWNB 1HIML 2C3XA 2Z34A 1MHCB 3GTVA 3IJ9A 5DF0A 2HT3D 4QTIL 1PGRB 4ZW6A 4FFYL 2NSQA 1KGWA 5AVUB 2XVKA 4NBZB 1QQDA 4LARH 4OFVA 5IT2H 1SQ2N 1SRDA 2EDFA 5EEYA 1ADQL 3GRWL 2ZCLL 1F6AB 3O11B 4OU3A 3DWTA 2R4SH 4EDXA 4IEFB 2HTLD 3R06A 4GMTL 3AQYA 3ZHDA 4JGJA 1OE3A 3ORJA 2O61A 1RY7B 2Y5TB 3KPQA 1DQKA 4U3CA 4S1DD 2MHAB 2WKOA 4WV1B 4BIKA 5GRVL 3U4EB 4L0YA 1I8KB 5CO1A 1FE8H 3BVXA 3DX1A 4ZO6A 4JPWL 3APDA 1XQ4A 1LMIA 2PR4L 4NO0D 2X89D 4YXLH 4RDQF 3LSOB 3LTVA 5EO9A 1OSPH 1KJVB 1HL4A 4Q9BA 3TH4T 4XN9A 5EWIH 5D1XD 1KXVA 4WO4C 2R29L 3B7RL 3EADA 4GRWH 3Q1SL 4FTVA 3VH8B 4MJIE 1QPPA 2GYSA 2BVOB 3LH8A 4IW4C 4KY1L 5C0AD 5T3XD 4HWEH 3LQZB 2ED8A 1DE4B 4LCWB 3RZCC 5KJ7E 3ERXA 3FQRB 1OWRM 5ETUB 4P5RA 4EE2A 1U58B 2HKFH 1IGYB 3I2CH 4NO5B 5AB9A 2HJFB 2WLYA 1ASQA 5FYJL 1WJ3A 2X44D 3DBSA 5GGSA 1PAZA 1CFQB 1UZ6E 4KKLD 2RALA 4GNKB 2AW2A 2PWHA 2VMEA 3SBPA 5IB2A 1N67A 1ITCA 1A0QH 2D03L 5EBLA 4P5MA 4Z8FH 1ZGLM 2G5BA 3PFQA 1U8MA 4PBXA 3REVA 3WXWL 5KVEL 3HS9A 4M93B 4L3EE 3RDTC 2DQHL 4HIEB 3ZRSA 3QWNA 1RXLA 4GKSA 5ICXA 4FQIH 1KUMA 1N12A 2TSAA 3BD4A 1X7SA 3M7OA 5PCYA 3T0WA 2DJ4A 5CEZE 4OZGE 2AXFB 3HBPA 3QUYD 4LESA 4K7PX 1B4JL 1QWUA 4NI6A 3ZMRA 4M8UA 5J12B 2NNAB 5I1HH 2R29H 2YK1L 1RJYB 2YN3A 3CZSA 1JHLL 4ZFFB 3SPGA 1QEWA 2V9RA 5TFSH 1NCBL 1NLDH 5EZJA 4IKLA 5SWSA 3VFGL 3ZYIA 4RFEA 4LVOB 1VESA 3SZKC 3ZKXC 4TS6A 4HCGA 5F1OB 3RKDD 2EAEA 4U2YA 1KNOB 3QDMD 4LPYA 4DN3H 5JR1H 4AM0A 2WBJA 1N5YL 4CN1A 1QHPA 3EBGA 2WBWB 5E9DA 1NFDE 2YBGA 4XPAL 3TN0A 2HG0A 5AVQB 4LHQB 2YPKB 5HI4D 3UJTH 1OP3K 2VDNB 1RFDH 4Z3HA 1X4ZA 1BOYA 1G43A 3F01A 1XGQB 3I75B 4KRPB 4N2DA 4JLRB 4U0QB 2VDPH 3CLWA 2EUVA 1TVHA 1UGNA 3QCVL 2BK8A 2IQAA 3CXFA 1AO7D 2DQCL 5KEZA 2ZICA 2D2OA 3UGUA 4TQEH 2G3ZA 1JDAA 3VFPB 1EXGA 4YPGA 1FG9C 4K3JL 4R5XA 5F9JB 4ACTA 4NQTA 5D96C 3KPRA 2PYEE 3C08L 4DAGH 1XGYL 3T3PB 4G83A 3E8VA 3FHAA 5FW8A 4NCDA 3PWVA 1SXSA 3KBPA 4FQXA 3HG0A 2QGEA 2VQ1B 1KF9B 3ARFD 1AO7E 3PLYA 1K72A 2G9HA 3ES6B 4JJOA 2J57A 1NINA 3GLEA 3QARA 2JCCE 4POUB 5JW3L 3L3HB 2IBBA 2MH4A 1YCSA 4MNGB 4OQTL 2J8UF 1JDDA 1F11A 2X4SA 3HC4L 1AC0A 2QQNH 4MA1B 2YUVA 3RPKA 2O61B 4YGVA 2BVPA 3H6JA 7PCYA 3DPBB 3MYJA 2J8UB 4XP4H 4WWKD 3JV4A 4NUJB 5CZVL 1HSBB 4Q89A 4PJ7E 3SGJC 1MW0A 3T0XA 4UT7H 1KN4L 3CFKB 4EI5D 3FUIA 4AKPA 2Z7WA 3J8F7 5CM1A 1HJCA 1OCZB 2Q2LA 4M43L 3C5JB 3QUKB 3L3IB 3S3JA 1EEYA 3TTSA 1B88A 1CU4L 3MMEA 1SF5A 1EA9C 3G08B 4K07A 1J10A 5C08D 1O6TA 3D69B 5KYXB 4KZDH 2WC7A 5IMOA 4K5MA 2ZONA 2L7QA 1Q72H 1YUHB 1T4KA 2Q2EB 3C5SB 4OKVB 1UWGL 1I9EA 3PWUB 3WKPA 4Z7VA 4M1DH 4HV8B 4XB8A 3BVDB 4UV4L 1HTYA 4DEUA 1QD0A 3ILQC 3MRIB 1Z9OA 1G9MH 5HGDA 1AQMA 1PLAA 4LGRB 3E6HB 3V6OC 4R3SB 1H9DA 5BZDB 2CUMA 3MRCA 4Q9RL 5ITBH 3VW3L 2KL6A 5DDHB 2EIZA 1MJ7H 2CPUA 1JHKH 1N6VA 3BT2H 4IGBC 1RUAH 2PCFB 3S5LB 3T2OA 1SM3L 5DURB 5J9PA 3QS3A 4B60A 5GSVA 2TRHA 5LXVA 3ULVL 1I3RB 4YMPA 1IRAY 1NGXB 2E46A 3B9VA 3TNNB 4JFPB 2DV6A 4Z7NE 2DM2A 4P3CH 1IGIL 5JUEL 5L8JB 3ZL2A 3F7QA 5EFIB 4NZTH 4KPHL 1XB8A 4QY8B 4ANKA 1G94A 4LCIL 3CHXA 1SY6A 1T22B 3FO1B 3TZVB 1RPKA 2APBA 1TCRA 5AW5B 4ANXA 3MV8E 5IB4A 5F0JB 4YHYB 4N5ED 3BN9D 4XVUD 3BGMA 4ZMNA 3RWEA 3FT3A 1WWCA 1MLBA 2Q10A 2D7QA 4P46D 2VN3A 1UD3A 3FUFA 3PGCB 3WSQL 1TYEB 1X5GA 1U36A 2WLIB 3D85A 1MCPL 3JVGA 3WFDH 4DGUA 1A7BA 1N0LA 5F96H 2EYRB 3SE6A 3JSSA 3PQYA 1CB4A 1OCWL 4GI6A 1QLFA 1KULA 1IB5A 3BXNA 4F15B 1YMHA 2ZPKL 2CMRL 5MEQA 1G7JB 4R2GB 4D0CA 1F6FB 2XA8L 2XN0A 4OV6F 4DIXA 5DD5L 3H9YA 4GS7B 1A7RL 4S1RL 5AW1B 3V7MA 2WTPA 1JGDB 3O6FD 4KTDH 2Z1PA 4MHHG 3A4DA 3QCTL 3OKKA 4PJFA 3S4SG 4ZK8A 5I0DA 3L3KA 4ATTA 2FX8H 3LD8C 1UM6L 3UG4A 1FFNB 4Y4KC 4B7IA 4JKKA 1A66A 1MRCL 1DLFL 1GOHA 2C1OB 3V4UL 2PYED 3IVKA 3FSAA 3E2HB 3Q6GL 5C8JB 3WELA 2A4CA 5FM8A 2AJUL 2A73B 4LO9A 2BVYA 2XHNA 4IBYA 1E0OB 2J73A 5AVWB 4XPGL 4JN1H 2DQUH 3BLKA 3MCYA 1PKQB 2E9GA 3OPZL 2VDQH 2AF2A 1X5IA 2NLJA 5EOCJ 4J6RL 4KRPD 5C2BH 4J12A 3DMMD 3IFNL 5DK2B 2XKNB 7FABH 5J4MA 4N87A 2WQXA 3LN4B 3VFOB 2L8AA 1UHVA 1ASOA 2YPVA 3FF7A 4FNUA 4JKWA 4P2OC 3GSVA 3ULSB 5D2LB 5FM5M 3HPJB 3KLAB 4P99A 3ILQD 4N2IA 5ECJE 1LEIB 5F89B 2FDBP 4M5ZL 4TYUA 2JMRA 4PW3A 3B6SB 5FA4B 3KPRB 4XMVA 3OWEA 1AHWC 1JFQH 3OHXA 3TYFA 2HUHA 2YD9A 3HN8A 4WO4B 1SYSA 4RX4A 2WZAA 4ESKA 2J8UE 2DBLH 3QRFM 1SN5A 1WD8A 3MV7E 1YNLL 2AAVA 4X9FA 5FUOH 2CIKB 2PWEA 1GXEA 2G9HB 3ES6A 4X5RA 5C07D 3ZE1B 4ZMQA 1YMME 3CVHB 2IEPA 4YE4H 1OSYA 3WFHB 1L7TL 3D2UD 3EJYD 2R2CA 5CP7B 3W5NA 3LXAA 5ERWA 1B90A 1WC7B 2K9FB 3M45A 4WWOA 3S37L 1S7WB 5F7DB 4CDHA 3S4SB 4J3OG 3I6KA 3ZT7A 3GJFB 4JG0L 1BZOA 3VD4A 3MU3A 5I17A 5HHNA 1XGTB 3POCA 4N8VA 1RU9H 4YDMA 3QEHA 4UDTA 3EYVB 1SN0A 2BSSB 3BD5A 1JP5A 5CEZH 1QPXA 4XP1H 1EEYB 1PZCA 3QNXB 3OVUB 2I32A 3VUAA 1G4RA 4WI6A 4NQCB 1UXMA 1I8KA 2WD0A 1XB6A 4ONHB 4GP4B 2NZ9C 4G3YH 3WJJC 1HS6A 1MCSA 2OXHB 3WEMA 3J7HA 2BJMH 3AY4A 2A9AA 2OQJB 4UU9B 4NGHH 2YPLA 3U9UA 1CE1H 1HT6A 4LCIH 4W9IC 4AMXA 2OJEA 5JXAL 1MG3C 4RAVA 4MD0A 1R3KB 2WSDA 2P5WE 1PW3A 3E6HA 2HRPH 3BHBB 4BGLA 3LKQB 2C7FA 5JPNB 5M94B 1KTDB 4FGMA 1J87A 3GO1H 3BO8B 3GEFA 4H1LG 3DLQR 2CGRH 3GSWB 2YZ1A 3VFRB 3ILEA 2CKBL 1CFQA 2OS7A 3L1OL 2RACA 1G7PA 2EO1A 3L4TA 4AMKL 1FDLH 3BUYA 3VGEA 4LRNL 1A4AA 2I24N 1IKFL 2QKIC 3F6LA 2AJ3B 3VM7A 4O58L 1X5ZA 1N8OE 1M6UA 1LO5B 1U8MB 4FQXC 2WNWA 4Y0GA 4YL9A 4KUCD 4NN7C 1P6AB 4F5CE 2IAND 1KGYE 1PL3A 3LZFL 2EDEA 5TF1L 3FQUB 4JUSA 3L5IA 2X9YA 2QPEB 5I6PA 1CTMA 4U33A 4TRPL 4WKZA 2DEXX 4M6NH 1BLIA 3PS6A 1QEXA 4ATWA 4DEPC 2PWFA 4X5WB 3QB7C 4IRSB 2GTWA 4FZEH 4J23A 2UZYB 5I1EH 1FGVH 3FQXA 4HKBA 2Y7QA 2BHFA 1N7ML 4Y5VB 5KN5A 1T1YB 3PREA 2ADFH 3KM1A 3ESOA 4WHDA 1BPLB 1D9KC 2D4DA 3P9WB 1AGFB 5C08E 3BRGC 4PW9A 4TULH 2DDQL 1IBGH 2YRBA 3FT2B 4M7KH 5JW4M 4OZHA 3NSDA 4KUZH 3MA9L 4WW2F 2DQ6A 2AEPL 2V5SA 2X1WL 5HHME 5D1QE 5FYLH 1HINH 2A6DA 3H4FA 3EYQD 1S7XB 4BFIA 1OZUA 4GUCA 3F7YB 4DUXA 3S36L 5IG7B 4NM8H 4KRNA 5D7JA 4UQBA 4NBXB 1PFCA 1H3XA 3WN5A 2OW7A 4OCSH 5HHXL 2B4CL 1P69B 1LDPL 5KS9A 5JO5B 2YBRA 5DI8A 5DR5H 5LCVA 3FNKA 1MPAH 4JDTH 4U1MA 4LP8A 3S3CB 2G0LA 2NY0B 3RNQA 1F0LA 5FGCB 3OJ2C 2OMYA 4L05A 3HPLA 2FBJH 4LEEA 4NQCE 4QRRE 1XD0A 2VDPB 4A2FA 1AAJA 3RHWK 2IQ9L 2MPAL 3VRLE 4EPSA 3DSFH 3TVMC 4BA8A 4QO1A 3T1FA 1NFKA 1KIUB 2HMIC 4JZOB 1S7UB 5M95B 1R3LB 3STLA 2LW3A 3D05A 1A7RH 3QULB 2X38A 4K15A 4NJAH 4E41D 5AD0B 4CC0A 1NANI 1ZOXA 2C9AA 4WEEA 1OLLA 1QSFA 1RP9A 3GMQA 1EWHA 3HFMH 1AHWB 2BC4A 4GEIA 4GW5A 4WI5A 5DU7A 3ZJAA 2Z91B 3GSVB 5GGTL 1RQ5A 3ULSA 4D2NA 4KMTH 1ZT7B 3STBA 1VDGA 4JFEE 5IGXL 1KY7A 1LO5A 2X87A 1AIFB 5IBTL 5I1IL 1AY1H 1A4JA 2Y72A 2NY3B 3MGOB 2OZ4L 2EXYC 5IJVA 5EU7E 1KZYA 4MZRA 1G5GA 2YOAA 3TIDB 1MCPH 1MQKH 3C6LA 3EIFA 4K3EH 4ZUTB 1KCUH 2UXTA 5I5JA 2W65A 1OCWH 3K4ZA 4A7GA 3UTSE 1TVBA 1FNGB 2E75C 2KERA 5C07A 4ODTH 3IFOB 3VFMA 3NFSH 4JX0A 4PUBL 2Q6WB 4LLDB 4XH2B 3OHMB 2EDRA 3L3JB 2NY7L 4ICXA 1NGWA 3ABKB 4QAMB 4TNEA 3RWJB 3QIUD 5LBSL 1SJHB 4UOW1 5KAQF 3U83A 5DTFB 2HFFB 4KX8A 4U6TA 4Y5XB 4PJ7F 3QDGD 2XJKA 3SE8H 2XV0A 2CE6A 3G5VA 1HHJB 1RK1A 2AJYH 5AEAA 1UA7A 3QJSB 5CEYB 1MCRA 3FB5A 4NM4L 5K1JA 4CKQA 4WJ5B 5SX4I 3P40A 4KK5D 3FUKA 1TIUA 3MRRB 1DJHA 4CMHB 4AEIH 3DMMA 1G1KA 4YDKL 1P7HL 3IJ8A 3IMWA 2Z8SA 3KBFA 5TE6H 2EIMB 3QI9A 2YRPA 3ARBA 4UUJB 3SO5A 5H35A 4HVBA 1IVTA 2VT0A 4CRPA 5HGHA 5L2JA 1N4XH 1P7KA 1WF5A 3FSVA 1ZRUA 2Q1EA 1MFBH 4KI5C 4UV7L 1NEZA 4YDVA 3U7YL 1AKJA 3IDGB 1IJ9A 3A67L 4HIHA 4LASL 2NCMA 3CDZA 5IK3B 4DGIL 4A55A 1CR9H 1WFIA 1L9MA 2DQJL 1HXKA 3SE9H 2FO1A 4GSQA 3WNJA 1MWAA 2QJDA 4UCFA 1I3VA 1FJ1A 1UWGH 4Z76A 1TZAA 2ICWJ 9CGTA 3H2QA 3L4CA 3NJLA 3PP3K 3V5DA 2VXSL 4H25B 3IMSA 3FZUD 4L0ZA 3FMGL 1N3NA 2DIEA 1DVSA 1ORSB 1QLRA 5G4NA 3T4AB 3B34A 1PSKL 4HXBH 1Q0YL 3QUGA 5GGRA 1LWJA 1T22A 5E5UB 4KVCH 4BZYA 1SDDA 1WBYA 3DV6A 1ZTXL 5AAMA 5J3HD 3QR0A 5DJCB 4IRJB 1XH3B 1P5VB 2V5YA 4RGMB 4IM8A 4GO6B 1Q0YH 5K69A 1WCQA 3ILPB 4NZRH 3PNRB 1EHKB 3AWGA 1B2YA 1FVEA 4GSDH 3UTPD 3WHXA 1T6BX 2KZKA 4CW1B 3O2DL 1CIDA 1U3JA 4PAZA 3RWDA 3SBWC 1QBML 3W37A 1XMWA 2W1NA 4KRMB 3B9KD 1TU2B 1ZLUH 1RD6A 3BWUF 2HFFA 4LAJH 4OH2A 4D9QE 1G1CA 1BEYH 5JIKA 3MJ8A 1MXDA 3UTPE 5EEVA 1P53A 1XB3A 2G60L 4MAYB 4PLKD 4S0TD 4ISVB 3WY3A 1K6QH 3FUEA 4NFDA 3RVTD 3UZEA 3EOAB 4NJ9L 4G8IB 3U7WL 3QXAB 1KIQB 2BP0B 3SY0A 3ZKNC 4K5LA 5AWNH 1H3TA 4NKIL 4ODBD 5FGCE 4DGYL 1I3RA 3IVKB 4PWFA 1HOEA 6CGTA 3MCLH 4TNGA 2VAAA 4CSTA 1N2RB 4ZS6D 2PP7A 3WEBA 1T0NA 2UY7A 1EZVY 1KCRH 4PR5A 3VGHA 2AXWA 2HG5A 1T1ZA 1ZIAA 4Q9QL 1WT5A 1YYCA 1OLZA 4L3ED 1I9RH 4XMPH 5D6DA 2YD2A 5E8OA 1D2PA 4JFXA 4TSAH 5EOCL 5ID1A 3MV11 5EF0A 3AY4C 5K9QG 3IXTA 4ORGA 3F84A 4YFDB 2ENYA 4M6OL 3MLVH 3P73B 1ORQA 2MCAA 2ZOOA 4HJSA 1JWSA 4XAKE 1CLZH 1B2WL 1BX2B 3RAJL 4H26A 4H25A 1QVOA 5TDOA 5DFVC 1GOFA 3RTQA 1UQSA 5FLUA 4DK6A 1Z9NA 4UOZA 3ZKXB 4DGVL 4XH2A 4BXVA 3IEAA 2YK1H 4IJTA 4P4KB 3RFZA 2XWTB 5CFHA 2CJ3A 3O2VH 5CS7A 1B4RA 1ZVSB 4HS3A 4PGEB 4FP8L 1JJUA 1IKNA 1A3RH 2GCYA 5FO8B 4Q4EA 4KTYA 3ZPDA 1E6OH 4ZNEA 2CLRA 1TITA 4JM0A 4YEFA 5EOQL 1WZMA 2K6YA 4NKDB 4AYGA 1E2ZA 2XV2A 5DJAA 3LS5L 4H8PA 3QCUL 5CIPA 2V33A 2J6EL 3BN9C 1EO5A 3OKMA 1RUKL 4Q8BA 5KSBE 5CGTA 1DJIA 4I4WB 4DPBX 1WZAA 3S98A 5G5DB 2V17L 5JHMA 1PAMA 4G7YH 1KWGA 2Y7LA 4L8SB 4L8CA 5GZNC 2P9RA 4FJZA 1CL7L 4X6DB 3MRFA 4H5SB 1I8LA 2YAFA 1ZLVH 5D7EA 5C0BE 3FULA 3WG7B 2WNGA 5CJOL 4LFHD 1TTCA 1Y0LA 1T6VN 1F4WH 1XFPA 2ARJA 2BNUA 2OMUB 2OSLA 3FCSB 1RZGB 1FA4A 1WTGT 2F7RA 2JQZA 2V6HA 5D1QC 4AYBA 1J5OL 1VADB 3S5ZA 4Y19E 2CCWA 3PRZA 1OB1B 5CILL 3S96A 5BRZE 3OR6A 4WEBH 4Y4KD 1TJMA 4PREB 3MA9H 4X7DC 3GF8A 3IYLW 4XP6H 2NUPB 2X7LA 1X7QA 3UZVA 3SE4A 3IF1A 5K59E 1ND0B 4A2HA 4HBCL 3JTBA 1A1NA 4JM4H 3LRMA 4WW1B 4YO0A 5HGBB 4R97C 3VFGH 3FOLB 4W9FC 4X5XA 1EAQA 3MRGA 3D3VB 3MRQB 4PJEE 4Z7QE 4Y19D 3U9PL 4NDMA 3QPQC 4OGZA 1GIGH 1ZHBB 2G75A 4FZEL 4YXKH 3V7AG 3VFRA 4JZNA 1T2QH 2HT4C 1D5MB 3QHFL 4H0GA 4JFUA 4NBYB 1U8JB 2FQFA 4LBEA 3O6FB 1HDMA 3X1EA 1BFOB 1LQSR 1NUNB 4KVNH 4WTZA 2FATH 2F54E 3LZQA 3QIBB 1U92A 2ADYA 4R0LC 2J8HA 1Y6MR 3PP4H 3GLZA 4P9HH 4FABH 1LL1A 1XZ0A 4XVUC 1O6SA 1DBKL 1X5KA 1BFVH 2W9EH 1QASA 4O02B 1BJ1H 1C9SA 2CLRB 4PJGE 1GY2A 4WUKL 4MB5A 1WFUA 1FAIL 4MJ5B 5EU7C 1J9RA 1URIA 2OR9L 3DX6A 1IL1B 4AZUA 2CLZA 3PGFH 4GEJA 3WLWC 3BAIA 1KLFA 3ZO0A 3GXIA 2IALA 4K8RH 4U6VH 3WDHA 3VXRB 1MFEH 3P0YL 5IVXA 5I1KH 4PYGA 1UUSA 2AVFA 4ZMAT 3U6RA 1T1XB 3EFFB 3EJZC 2GY5A 4LPXA 2FSEA 1W72L 4MA7H 3T65B 1JXKA 5FF6A 4JAMA 2ZYSA 2OR8A 4JDTL 2R2EB 3NACH 1D9KB 5D1ZI 3IETA 4LLUA 5EZLB 4B9JA 4TL4A 2ARJB 2BNUB 2A9MH 2BDNH 3FO2A 1KFAL 3OJMB 4B0MM 3ETBF 1QWNA 4WU7A 2EH8L 4UINH 3NBNA 4J3VA 5EU4B 5DURD 5F6IC 4X0KB 2NR6A 1KGJA 4B97A 1YNTA 2PP8A 5IIEB 3P3SA 1LD9B 2GSMB 3QNZB 4UOQA 1L6PA 3T6XA 1HZLA 3GUTA 1DQLH 3L3OC 2O93L 4G7QB 2FBOJ 5FECA 4K94C 3D87B 4HEME 4GKZB 4Y2DC 2VZOA 4L1LA 5EBWB 5B7EA 4R96A 1VZHA 1RZKL 4WJKB 4AGPA 1AR1B 1IEAA 1T66D 3KS0J 5D55A 5I1IH 1P6FA 1UA6L 2UY7B 2WJ5A 3EJUA 4ZZFA 3E8UL 4AQ1C 5GISH 3RUGB 3FN0H 4ADGA 1K4DB 1ZT4B 5IB5A 5MEOA 4LQFL 5T33H 2YR3A 5K9QI 35C8H 5C6WH 3X3FL 5IR1B 3RJOA 2VZ1A 3TWYA 3OSVA 2FQGA 2HPOA 2OI9C 3LKOB 3BFQG 1BZ9A 1ZA6A 1NDGA 1ZMYA 1E5AA 3HFFA 4LU5L 4PV8A 4Q0XH 1LP9A 3CX2A 2YA1A 4RQQA 1J1PH 1UM4H 3QPXL 2Y1YA 2UUDK 4X4XA 1UVQB 3CFJA 4LLQB 1HFUA 3AACA 3VDCA 1JTOA 4U1GB 2H47C 3L9RA 3NA9L 5IROD 1KJ2B 3AB0B 2AQRA 3BLPX 3IKCB 1A7PL 3PL6C 3D2UB 4Z77A 4PPTA 4FYTA 1DVZA 5C0ND 4ZD3L 1WHPA 3ZZLA 1KIPB 4NENB 1XWVA 4AGLA 5IHLB 4CNIB 2VISA 1EFXA 1UASA 2J56A 4QYOA 4U1HA 4ODXA 5GGRB 3SDAD 4BSWA 2WUCL 4XPBL 2OSWA 3KH4A 4WEUD 4BFIB 2YSTA 3QJFB 3ZZQA 5B39B 4XWOD 4LCWD 1PMYA 4E42B 4F7MA 4HIXL 1U91B 4UB0L 2QQKH 2LVCA 5KSVB