3JZYA

Crystal structure of human intersectin 2 c2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
IGRLMVHVIEATELKACKPNGKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDLYQDVLCLTLFDRDQFSPDDFLGRTEIPVAKIRTEQESKGPMTRRLLLHEVPTGEVWVRFDLQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin 2
publication title Crystal structure of human Intersectin 2 C2 domain
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
A PF00621 RhoGEF RhoGEF domain
A PF16652 PH_13 Pleckstrin homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3jzyA00
2WXOA 1DJXA 2K4AA 3L16A 3F01A 4V11A 1UOWA 2RD0A 5H4YA 4HLEA 3IM1A 4NPJA 2X38A 4QAMB 3LJ3A 4PS8A 4GB9A 1UGKA 2Y3AA 3N5AA 4KZCA 3L13A 3HIZA 3RDJA 3TL5A 4QJ5B 4FHKA 4LCVA 2WXHA 4FLHA 4IQHA 2CM6A 4WAFA 4F1SA 4LDCA 4G11A 2B3RA 2WXQA 2K3HA 4L1BA 2CJTA 4XZ4A 2CJSA 3S2AA 4GNKB 2A4ZA 1E8YA 2ZKMX 5G55A 1DJYA 1E7VA 4NPKA 4PS7A 4WWNA 2QZ5A 5CCJA 1TJXA 5KJ7E 1E8ZA 2KI6A 3TJPA 4QJ3B 2WXIA 2R83A 4PS3A 1E8WA 3PFQA 2NSQA 3APCA 4KZ0A 2K45A 2N1TE 3L4CA 1W16A 3L9BA 1CJYA 2Z0UA 4TUUA 4OVVA 5JHAA 1QATA 2ENQA 2DMHA 5G2NA 3TWYA 3W57A 2QZQA 3KWTA 2D8KA 2EP6A 4FULA 2WXGA 3CSTA 3QR1A 2WXJA 4F92B 4ANWA 3PREA 1QASA 3F04A 3RPBA 2WXPA 4QJ4B 2V4LA 1A25A 1E90A 2A5UA 4Y1SA 1RLWA 3OAWA 1RH8A 4HVBA 5CCGE 3MJWA 3FDWA 4TS6A 2WXLA 4F91B 4DNLA 3F05A 3NZUA 1BDYA 3SD5A 3R7QA 4EZLA 3P2BA 2ISDA 2BWQA 2CM5A 2WXKA 2K8MA 3HHMA 4AJWA 3M7FB 1BCIA 2Q3XA 3DBSA 2WXFA 3QK0A 4ANVA 1RSYA 1W15A 3ZVVA 2FJUB 2NQ3A 3B7YA 3IBEA 5CCHE 4A55A 4EZJA 4FHJA 3T8MA 3CSFA 3ZIMA 5JHBA 4WWPA 2ENPA 3ZW3A 4XE0A 1DJIA 4IHBA 4Y1TA 4OVUA 3ML9A 1DJZA 1K5WA 1E8XA 3QAQA 2ENJA 3GPEA 1WFJA 4TV3A 3APDA 3NSJA 5H4ZA 3ENEA 4FA6A 2LHAA 4ICWA 3KWUA 2NCEA 3APFA 1HE8A 3F00A 2FK9A 1DQVA 2WXMA 2CHZA 4J6IA 1DJWA 1DJHA 1UOVA 1E7UA 4WWOA 2YOAA 4L2YA 4BFRA 4BGDA 5EDSA 4FADA 1BYNA 3L08A 4NP9A 3PRZA 3NZSA 4XX5A 2WXNA 1WFMA 3HN8A 3OHMB 4ANXA 2YRBA 4URKA 4AOFA 3PYCA 4ANUA 2JQZA 1DJGA 4L23A 3QJZA 4ICXA 2DMGA 2CHWA 4LT7A 4NS0A 4KITB 2WXRA 4FJZA 4DK5A 1GMIA 3QR0A 2CHDA 4F93B 3PS6A 3ML8A 1V27A 4FJYA 1DSYA 3DPDA 4JPSA 2UZPA 4EZKA 2Q0ZX 3W56A 4WEEA 3R7RA 3L17A 5T8IA 1YRKA 3JZYA 2CHXA 3L54A 4L1LA 3QARA 3FBKA 1TJMA 4MJJA
chains in the Genus database with same CATH superfamily
3EYVA 3FQ2A 4UDTB 1QFHA 1ILUA 3MLUL 5LNEA 3L3JA 1RSFA 2DQHL 3L1OL 1D7CA 1TZ8A 3GRGA 4NKQB 4Y1AD 4DK6A 1OIOA 4XOCA 1E28B 3N91A 2YEZB 4RAVA 2DYPA 2LW3A 5JR1H 4DTGL 2B4CH 1FCCA 3ULVF 2CWRA 1FI8C 2HVJA 1IGCL 4FQJL 4PWEA 2QGDA 4GNKB 5G55A 3RNKB 3QDAA 1JAEA 4I88A 3U4BH 4BSVA 3OG6B 2ESVA 4KTYA 4PJ8D 4FXGC 1GKOA 1L9NA 1HI6A 3SDXE 3FQYA 4PJ6A 1WT5C 4WJG3 3R4RA 4KXBA 3EJYC 4BZ2H 4KROD 2IH3A 3W57A 3HZMA 1NCWH 3BD4A 1JPGB 4F7CB 3EYSH 4HJIA 5LXGH 1XR8B 5FS5A 2UY6B 2B1AH 2XQ0A 3LEYH 2VO8A 1GC1H 5GQBA 2IBGA 1YJDL 3IFPA 3U4KA 5DURD 4K7FA 1MJUL 3O4OC 1QLEH 4K55A 1JPTL 1UURA 1N9PA 2DL2A 2WQWA 4DCQA 1CICD 4EN3B 3VFVB 3ZGHA 3P2BA 3DGGA 4L4VD 3E2HC 1GGYA 1Z9OA 2ZXDA 4MMYB 1JNHB 1A1NB 1EPFA 2VN4A 3NYKA 4O2FB 3VYPA 4Z3EA 2GIYA 2X0WA 5D1XA 5JOFA 3NPSC 4CJ1A 1KJMB 1GTFA 2BNQD 3OHXC 3VA6A 3ILDA 4LSSH 4MAYD 4OZ4B 4OF6A 4M1DH 2FBJH 5I1JH 1CXIA 4PRHD 3NZ8A 5AW8B 4TUJA 4I9XA 4AEHH 2DYSB 4HLZH 1VFOA 1KBGL 2G2PA 5FGCE 3WN5A 1S3KL 4NZTH 1Q38A 4JRYE 1H6TA 5HHOE 3FU0A 4QYOA 5FA4B 2RCSH 3RU8L 4N8VB 4APXB 2E3VA 4P2OB 2K6WA 4F9LC 4IKIA 1RPUA 2HT3D 1NCIA 2EDHA 5KSAA 2C9XA 1W2KT 2E7CA 1N5AA 1H19A 3MLTB 3LKQB 5CFAA 4KZEH 1SLWA 1WHOA 5IQNA 5E7FA 3EBIA 1IBFA 4G42B 3V5HA 4N0UA 1U30A 4JY4B 3WNKA 3KLQA 3TCTA 1IC7H 1U93A 1PKQA 1E2VA 1QZ1A 1A6AB 4KPHL 3AACA 5FGSA 2WZPD 1TKWA 2C26A 3SDYL 1PL3A 5LG6A 4XVUC 2E6PA 1ZHLA 2ZUTA 2R23A 3VH8B 3SKJL 4POZC 1B3IA 2F5AH 5E6ID 2C1PA 5AW5B 1BV8A 4X9FA 5MEPA 3THMH 2NY0B 5IY5B 1KXQE 1KCLA 4KXDA 1I9IH 5I0VA 4XX1G 5C2BL 4JRLA 4GEIA 3HR5A 2AZAA 4AL8L 3AM8A 2PW1B 4Z95H 25C8H 1MAJA 5DF0A 5BO1H 3ZO9A 4KNQA 1RK7A 1AHWC 4XMTA 1VCBC 1KPUB 1I1YA 3QDHA 4L3CB 3D4GA 5DR5H 1N3NB 4LARL 5F71A 4DEWA 2N0KA 3OQRA 1KTLB 4FFZL 3WEXA 5E8NA 2CDGA 4FI7A 4QJ3B 3VG9B 3GBML 1CG9A 4FQLL 5L0QB 4OSUL 4ZD3L 2JTDA 1HIML 5H37H 5HHQA 1D6EB 5EZIH 3VFSB 3BZ4B 3JTTB 4R0LB 3TV8A 1A7QH 5B3JF 5TQ2H 5F9JB 5D2NC 4PSPA 3CZUB 3EJJX 5T1LB 4RSYA 1YNKL 4NENA 5C0BA 4BCYA 3P11L 1J9TA 4XHJD 4MXVE 3ZHFA 4ZMVA 5I8OH 3ZDXB 1J9RA 3PP3K 4R96B 4JG9A 4WWKB 3UDWA 2BVQB 2DMCA 3C08H 4NO3B 1F90L 1T0PB 4ZW6A 3X3GH 1GSMA 5FAAA 4DWHA 3K8KA 4NNPL 2MHAA 2WLLB 4YSRA 4LBEA 1L9MA 1Q0XH 1SLXA 3QQDA 2IJ0C 1E4JA 3D4CA 1FE8L 5KYNA 1N7ML 1A7OL 2EECA 2XWTA 5BZXA 4NC1C 4AV0A 2BDNH 2KLRA 1BA9A 2E75C 3QWOA 4AM0B 5GGRB 1PZ3A 1JVLA 2A9NL 1AI1L 2CCVA 3CH1A 3ESNA 4XPTL 3DURB 1XD1A 5GS2H 2I32A 2LVCA 2Z8SA 1J5CA 2ZOLB 1KB3A 1QRNA 5F9WB 4BFJA 4U0RC 5EOQL 2H6PA 4UBDD 4I18A 5AB2A 4YBHA 5JA8B 2GSMB 3I50L 5IJDC 2VIRB 5A6MA 4F7TA 2OW7A 3FN3A 5DUMH 2X70A 2QHLA 4QI3A 1KUMA 4Y19D 2CA3A 4WI5A 5B38A 3NH7H 4Q0XH 1EANA 4LO9A 1QR4A 4OGZA 1AO7D 4ZUWA 5HYSG 4M3KB 1A6ZB 1HWGB 1MLCB 1UB5B 4FFVD 5IW1B 1RLBA 2WKOA 4R4BA 3SDAA 3ESMA 5EEZA 2P5EE 3FU7A 4G59C 1QSEA 3CC5A 3VRJA 3CVBA 4PWJA 2PR9A 3BPNB 5ISZA 1Q8MA 2YPLA 1MCEA 2QVKA 2FWOA 2JVUA 1BSIA 1S5IL 1T2QL 2Y7QB 4YDKL 2F8VA 1JGDB 2Z7UA 3EGXB 4L1TA 4BZYA 3H9ZA 1HEZB 1BLNB 3UZEA 3C12A 1BIHA 1OAJA 3K2MC 3RFRA 4DGUA 2ADIA 3I02B 2VWEE 4YUEL 2GK2A 4MLIA 2J72A 1OSEA 1JGUL 3C5SA 1HS6A 3T8XA 3ZHDA 2UWEA 3R4DA 3TWCH 4NRZB 3IAPA 3GM0A 2JK5A 4KQ3L 5BQDA 2WZAA 2YXMA 3QIUB 4U7SA 1ZSHA 2C5DC 4FF9A 4ONFH 4P4RB 3TCLA 4Z76A 1BFSA 3DX7A 1JMZA 4J23A 5C9KA 4WSKA 5AKSA 43CAA 2EIEA 3FT3B 1FNGA 1ZVYA 1BZEA 1OAYH 2E8YA 4YXLH 2ZICA 3FTGA 5FKPB 1DBBH 3MRJA 3N6YA 4E36A 3MRIA 4NKMB 3X14A 5F1KC 4FGMA 1QASA 1DVYA 3MUJA 3WKML 2CDFB 1MDAA 3H53A 5E4OA 3LNFA 5LUMA 2EABA 2C7UB 1DQJA 1P7QA 2FIKA 2VDRH 3NZUA 1PG7W 1MELA 2GJRA 4DPBX 5IROD 3MX0B 1FVCB 1ITBB 3MC0A 4WFEE 4XP5L 1BBJB 3CFJB 5IHUH 3HA0A 5DI8B 3T2OA 3HNVL 1B0GB 1NLBH 1YPZE 2DJUA 3RL1B 1HJBC 1BBDH 3EH5B 4QCIB 3B9KB 5KN5B 4TUKH 2HJKB 1EHLL 3VXRD 4NO0D 2ADJB 4PJHB 4Y2DB 4PREB 2HT2C 3W39B 2V2WA 1TXKA 1JHLL 1F13A 4FFWD 4YFLI 4X6CB 5ESAA 3E38A 2BSTA 4GIOA 4N2BA 1A47A 4BKSC 2CUAA 2WTRB 4YHLH 3UOAB 3QEUB 2GUOA 1BAFL 4FABH 4KK9C 4YSCA 4LAQH 1AH1A 3KYKH 4JG5A 2AABL 4PRDA 4EMZA 2VXQL 4QEGA 1U95B 5MP6L 4XMLH 2WN3A 3OAUH 3VQLA 1UXLA 1A66A 1BOGB 4OI8A 2GBUA 3CD4A 5EBMA 1AKJA 2J2ZA 3PWNA 3TPKA 3VWJB 5KSAC 4N86A 5DK2A 3B9VA 1ZE3H 2ZOWA 3OKEB 3OLDA 4N90E 4V1DD 1WAEA 4GRWH 1A3LH 2DMGA 2TAAA 2QVMA 1Z0MA 3O3EB 3A6BL 3BCFA 1C12B 1NBVH 2XA8L 3J8F7 4JR9H 5FW7A 5I6LA 5IREA 1EA9C 1JERA 4JJOA 1NFDF 5IUSA 1WBXB 4UAHA 1CD9B 2MNJB 3EG9B 3BMWA 4L8DB 2YBRA 4PJAE 5CLXA 2NW3B 3QWNA 5FM5O 1BQLL 2FLBT 1QFWL 2OP4L 4G5ZL 4NT6B 2P8PB 3RUGF 1CE1H 4YO0B 4GI6A 3QCTH 5H4YA 2HJLA 1RUAH 2NZ9D 2VN7A 3QXAA 2EVJA 4OD2B 4K5LA 5E8EA 4WHYG 2YXWA 2ERJC 4JFEA 2OJEB 3AM8C 4ALAH 4AE0A 2F74B 2K3HA 3MBWA 1SHWA 5ALBL 3DROB 4OUUA 2FAUA 1E27B 4PY7A 3LH2L 1OCWL 4ZX6A 3IETA 1KEMH 4OZFG 4P5RA 1U8IB 3RLSA 4ZUUB 3VE0B 4TNWF 1J9SA 5I73C 3HNTH 1IE5A 4OV5B 4FQHA 2QPUA 5I15H 3BN3B 3TEXA 2OMZA 4WUKH 2GBVA 4Y8AA 4XMXA 1I7RA 3ARGB 5D4QA 4HULB 2ADFH 3ZRSA 3QIBD 3EO0B 4JDVB 1JZ8A 3X11A 4XAWL 4PGEA 4Q4EA 5GRZA 2CHNA 1H8LA 2XX0A 3CVHB 1AG0A 4RGNE 2QBWA 3RI5F 4J3TA 2G3ZA 3LIZL 2EDXA 3UDWC 4LAJH 1PEZA 3OR7B 4Z7AA 1NCAL 4PJ9A 3FRPG 3ESVF 1D9KD 4I13B 4NKDA 3QUKA 4CGTA 3CZFB 1BVNT 2D4DA 3JV4A 4U1IB 4X7TA 1XL4A 2NDGA 2HFGL 5EZPA 4WWPA 3D0LB 1XB6A 4XNZB 1SF3A 4C57C 1CFQA 2X0VA 3KPNA 5I1HH 4LLYB 4NERA 3S35L 1ASPA 3LCYA 2I27N 3DV6B 1S78D 4OFIA 4ZMXA 3O9WA 3SJVD 1UWGH 3UTPD 1SFHA 2VM4A 4ICWA 4WI0B 5DZAA 2ZNXA 1XSKA 5J3HC 3MRCA 1ZT4B 3KCWA 3BFQG 2WZ5A 3GXTA 5TH2B 4L3AA 2YD7A 2UVFA 4OAWA 1AKPA 5DTFA 4MYWB 4ENZA 1VACA 3UTTB 1A4KA 1MCLA 4RISH 4KAQH 5IR1B 3UP6A 3RWJA 2VISA 2W38A 1OM3H 3KPPB 1K3ZA 1AP2A 1KNOA 3BH8A 5GZOD 1NOFA 2EE0A 2NW2A 2NY1D 2DICA 4WEEA 5HJDA 3LMJH 3VMOA 3U30B 3QORD 5FHAH 4MDIA 4PCSA 3SDAC 1OQOA 3FULA 3CHOA 2DQIH 2K4AA 4OU3A 3K8MA 4DP5X 3GJEA 2WK2A 3HUJA 2XZQL 2H8PA 4L3ED 1ADQA 4LCWB 3ZUCA 2EIKB 4P3DA 4OFKA 4U2YA 3UJTL 5EOCH 1MRFL 3DV4A 4DP9X 3ALPA 4Q14A 1XQ4A 3ZSSA 2FO4B 2XKNB 4YDIL 4H88H 3PABB 4DKFH 1EDHA 3DDGA 5SWSA 1B6UA 5IW6B 2K4WA 2YQ3A 4HWUA 2O26U 4HCIA 4APQA 2Y07H 4QUOA 2AKRB 3GRBA 4NKOA 4UZUA 2W81C 3BUTA 4P2AA 2XETA 1OOAA 1IVTA 5IFHH 1K2DA 1Q9KB 1TQCC 3KPRA 3WO4C 2HRLA 1WO2A 3MRPB 4HT1H 4ACTA 3Q8CA 3U9WA 1FG2A 1X44A 5EORL 1NDGA 1MXDA 3WE6B 2AXJA 4KRPB 1TVHA 2XN2A 2OX5B 5E5MA 2MCAA 4ZYKA 1EK3A 2DDQL 1QSFD 4FNTA 4OIIL 1JGVH 3H4HA 5KS9F 1P69B 2MCPL 1R24B 3S2CA 1S7XB 2APBA 4LOEA 4QJ4B 5I18L 4J3OC 1RLWA 2PYEE 5SWZA 2ITDB 1GJIA 2ZX7A 1DBAH 2HTKD 2DKMA 4B0MM 1HL8A 1W80A 2HG0A 4Q97A 4KTDL 2WBKA 4XVOA 2A9DA 4MGXA 4XNQB 3EXJA 3REVA 2AF2A 3NEXA 2X6AA 5F7BA 2V7HB 4OM0H 4FFYL 3ZTJH 4J39A 3T6VA 2B15A 4M1CC 2EINB 4LSRH 1WC7B 1SGKA 4XPFL 5INCA 1XCTA 1Y18B 2ENJA 2PCPB 2VE6A 3AVEA 2OXGB 1FGNL 3DSFH 1ILSA 1KV7A 3GKWH 4KNUA 2ZSVA 5DFVD 4R97B 3BEWA 4XPHH 1PAMA 5KVGH 4AMWA 4KTEH 3ZUNC 5IHBA 5B39G 3DJSA 4JX0A 2V2XB 1RMFH 3HS0A 4HIJA 1O6SA 2E8ZA 4EI5B 2IQ9H 3MNWB 3KPQA 4JN2A 3S0PA 3CDZA 2DKUA 5CWSB 3T0DA 1V54B 2OM5A 2WIMA 3P9WB 5A2JH 5IFJA 4YVUA 3MRNA 3OHMB 4LVOB 4NUJA 1X4ZA 4F58L 3DUSB 3QRFM 1SMOA 1QSZA 4R4FL 1JZHA 4MB3A 2C34A 2XZAL 3GMNB 1NDMB 2J56A 1CLYH 3LZRA 4IOSA 1YMMB 5HVFB 4ZFGL 4EDWH 2NXYC 2IAMD 2OJZH 3MJ6A 4XWOD 2P7TB 3VU2A 2Y2TA 3E3QC 1IGYB 5L2KB 3L7FB 2ZCKH 1FO0B 1PJ9A 2Q76B 3CXDH 1NKRA 3DOSB 1FG9C 1CFBA 2VJ0A 3IPBA 1RHHA 4P3CH 1MRCH 4YR6A 4E5XG 3VGEA 2A74A 5B4MD 1IUZA 3W3BA 4UTAA 4G7YH 2DLEA 2BO0A 3TFBA 2O5ZH 3TBWA 4OZIA 3QI9B 2P49B 4YLBA 1NBCA 1SUHA 2EZ0C 4Y2OA 3LNIA 1K8IA 4HIEA 5HTSA 4N5EC 5DJXA 1YNLH 2EDJA 4JGUA 3ZX1A 4F7KA 1ACZA 3VGBA 5BZWA 4R84A 2VAJA 2I69A 2VLRA 4KV5E 3QPQD 1CXEA 1E4HA 4NUGL 2ZE0A 2CR6A 4X4MA 3GMRB 3QQ4A 5AW2B 5LCVL 3TU6A 2E27H 4DFHA 1O0VA 4LQFL 5HJBA 2PCFA 2N1TE 1FFTB 1NAKH 4MA7L 5G2NA 1V05A 1BLIA 4XAKE 2E9BA 5CMAA 1NC2A 3QR1A 3RHWK 1C5DB 3HPJB 3QEQA 4ODSH 3F7QA 3QS3A 4O2EA 4XCFL 3OKYA 2R1YA 3UTSD 4OFVA 3HG2A 3RL2A 5CCGE 3ILEA 1EHKB 3CX2A 3SBRA 3ABMB 2ENSA 3HAEB 2ZUWA 2HMID 1L0PA 1O9VA 5DEFA 2WVUA 3IK2A 2WMPA 1PZBA 1TEFA 4PTUB 2VH5L 4TVPH 4KO6A 3M7OA 2J5LB 1CICB 1RJCA 3FMGH 1BQKA 1LO5B 3KGSA 1EJ8A 1UCBH 4JG0L 5I1AA 4A6YL 5DD6B 1YYML 3RWGA 1LO4L 2PO6B 3GBNL 3BAKA 1PIGA 3H2QA 5EIIG 3RYMA 1DP0A 1FFQA 3QW9A 4JFPB 4R8WL 3OXSB 4OUOA 4BFIB 3FRUB 5JHDB 5EPMB 4MJIA 2IPTH 2WHVA 4F1ZA 1NGWB 4N0CD 1BQSA 1J0HA 2XVKA 5TGBA 4G6KL 2AEQL 3D5OF 3LIUA 4NDMB 3WFBH 1TF4A 3K46A 3BW9A 2WXNA 4JO1L 5KVFH 4X98A 4Y7MA 1T66D 5KSVB 4HKXA 5LGJB 5TPWL 3D39A 2QSCH 5IEKA 3ERXA 5DJ0A 3QPXL 3D0VA 1JPSH 1YEJL 2OZ4L 4JZOA 5F9OH 3RY6C 5LGHL 4JFFA 2BSED 5T1MB 3D1MC 5JUEH 3QUMH 5D7KD 4KH9A 3STZB 3ZE0F 1T4KB 2KZKA 3QXDB 3RDTC 3D30A 5K9OA 1HCVA 5J13B 1HSBA 1A8ZA 1ZEAL 2N0MA 1WF5A 3L3GB 5CP7B 3FFCA 3AU0A 4WO4A 4M8UA 2ATPA 3ZE2E 3UAAA 4FHKA 5IVZA 5IQMA 3RFZB 5HY9B 3SE4A 4EI6B 1YY9C 2DLFH 3FQXA 3OR6B 4IGBB 1JTOA 1B4JH 2WSKA 4GT7A 2SODB 1JHKL 1TJGL 1V7MH 1EO5A 1U4FA 2ZXQA 4XN9A 4EOWH 3CK0H 4NNXA 4Z3GA 5A40E 2IWKA 3EZJB 1U8KA 5D71L 1VGEH 2CKBL 4F8OA 1QWNA 3VFGL 2HVBA 1E8WA 4P3WA 4BHUA 1P84K 3EJRA 4JGJA 1AR1C 1IKFL 1ETA1 1W16A 5CZXC 4NSKA 4HX1A 5JHLL 1YEEL 2XC8A 3QIWC 4QLRA 1ORQA 1VIWA 2GTZA 3CVHH 1LP9A 4XH2B 5I76A 2EC8A 3FXIC 1NMBH 3S36X 1AFVH 2V4LA 5IBUG 1EO8L 3DX4A 2TRYA 5I16A 4LSUL 5DGQA 3K71A 5AVTB 2L4OA 4B9KC 1G9MC 3EGDA 4DW2H 4MS8D 2QLYA 3CVCA 1CBVH 1PX3A 3KR3H 3LHAA 5DRXA 1RUPH 3B9AA 4Y0GA 3P3YA 4KI5E 4MA1B 2EKJA 1LO2H 1T89A 3EJSA 1NGYA 2F7QA 2G0KA 5E1AB 1QFUH 4LASL 4MD0A 3BP7B 1LEKB 4KDVA 1FAKT 5FDYA 4KVNL 3GIZL 4PRID 1OT1A 2VUOA 5BCAA 1MLBB 4TNGA 3LV3B 8FABB 1L6PA 3QR2A 1ZLVH 3ZOAA 4YHNB 1TNMA 1I75A 1PZ5B 1D5IH 1VEOA 4HAFA 3C6LA 3LZQA 2NX5A 5DJAB 5EDSA 5EWIH 3HS0C 5ITFA 4EDXA 5K9JH 2O72A 3HCVA 5B7MA 1TTBA 2Q8BL 2C4XA 4XO9A 3NJNA 5MENA 1ZANH 2XICA 2A38A 5C08D 2YRBA 3SPJA 2ZXGA 1G7MA 2BNRD 1IT9H 2Y1VA 4OCMC 1M6UA 3GK8L 3NIFF 4ZO9A 1Q9LB 5IG7A 2F54A 5JDJA 2FB4H 4KJWD 4XWGL 5DRNA 3F7PC 3IF1A 2F8IA 3DETC 2WWMD 3SCMD 1EFXA 3IPEA 5T3ZL 3RKDC 3WU1A 1XTMA 2XQYA 4CKVX 5C0DA 3R7RA 4LL4A 5CGYD 3R1GL 1SBBA 4K5NA 2F18A 3QBTB 5CU9A 4X6FB 3IMRA 1UA6L 2D3VA 3SDDB 2CRIA 5FV1L 4EUPB 4S1QL 4YH6A 5BMFL 5DJZB 2O93L 2A74C 1Q72L 3DXAE 2XQBL 1MZZA 2P52A 5DLML 2HKAA 4IQHA 5AOZA 5D6DC 1JV2A 3VXPB 1CFTA 2R7EA 2HLFD 4ONHB 4XGZB 3WNPA 2R4RL 3K74B 1FZMB 3C9NB 3MA9H 2E7LA 4PJDA 3I75A 3DVNB 5IHLB 4XC3H 1QFWM 4Y4FD 2XSKA 2Z35A 3ZR5A 3WMQA 4QWWD 2P24B 5E00A 1IM3B 1MJ7L 3IJYB 3O11B 5CBEA 4HS3A 1U8MB 2HXAA 4NO2B 3V6ZB 4PJGB 1R3HB 4AYBA 3CN3A 3BD5A 4OLYL 1EQWA 4L8BB 1NFDB 1CXLA 2OMNA 4AC4A 4DUXA 3Q2LA 4KJYB 4YDJA 3BDXA 3KYNA 2AEWA 4NFDA 1G7LA 4F57L 1N6QL 5DO2C 3BAJA 5C8JA 3TBBA 4N85A 4XBGA 3RUGB 5J12B 1G5AA 4XNXH 4N2KA 3BUDA 1T22B 2YKLH 3BP6A 3ULVH 1KGXA 1QW8A 3AXLA 1AZNA 5D7JD 1KFAL 5H37A 1YMHA 5T1KA 3WJMB 1TJIH 4LB8A 4UAOB 5BRQA 2IQAB 3V0EA 2NNRA 2VO5A 3TONA 1SM3H 2C3HA 3FZUC 3ZQWA 3HC4H 3T1WA 1UD3A 2JMRA 3WXWL 5F6IB 1GYCA 3CQQA 3KWUA 4YQXH 3H9SD 2G9HB 1FFPB 1DJWA 4P2RA 1JRHI 3LNHA 4X50A 1I8LA 5HDOA 3QQ3A 4ZMQA 2YD3A 3T08A 4MTMA 5AALA 3OKMA 3GSUB 3TYGH 1YEIH 3FSOA 1U2CA 3PYCA 4AOFA 1HHGA 1GA2A 3RZCD 3O3BB 5FA3A 2VDNH 1VADB 3FQRB 1JCVA 1UYWH 1KB5L 4R26L 5EO1B 2C1OB 1FO0H 2F7PA 4XXCA 4M43H 2CBTA 2X9WA 1W0WA 2IOIA 2X9XA 3P73A 3WUZA 4H8WC 3EHBB 3BWAA 4Z7WF 2DQCL 5K39A 2ZXWB 5BVPL 4RMBA 4WFFE 4NHUA 2YAFA 1IAKB 5DEGB 4M3HA 3GLZA 2NXZD 1EAPB 3CZKA 2VJXA 2CIIA 3N42F 4Z7VF 4WO4C 3ILQC 1ZS8B 4A2DA 4G43A 1NKGA 1K6QH 4GKLA 3VFPB 3WEMA 2AI0L 4G80B 4PBWD 5AZ2H 3VXUB 1GL4B 4Y4KD 4ZJ9A 4KMTL 1LQBC 1P1ZB 1U92B 2NY5L 3WI9A 5C09B 1LM8V 3BRGC 4MQ7A 1MFDH 1UM6L 3QUXA 2J4WL 4XO4A 3AADB 3D69A 5GS1B 3N9GL 4X9YA 3C09C 3N1FC 3GMMA 1JWSA 4J3UA 3M45A 3VWKB 5JW4Q 4Y4HA 4F7PA 4JUTA 3MCKB 3S4SA 3EJQA 4NPYB 3DO7A 4I0PB 3HAEH 5IM7B 2QQNH 3IDXH 5CNHA 5AW9B 3RWEB 1IBGH 4O4YL 1F6AB 2B4CC 5H35B 4XR8C 4FQIH 4NKIL 3MMEB 2E4FA 1M9WA 3IXAA 3NMEA 4L9LB 3DJTA 3Q8EA 1KIPA 1A3RH 3H8NA 2E7BA 1KGCD 5E56A 4AJWA 5C0CB 5BV7H 1MRDL 2XN9D 2X2HA 1IJNA 2OQJB 2XIDA 4R3SB 1SYVA 4N1EA 1T89C 1OWWA 2FQEA 3UADA 4X7SL 4GRLA 5GIRA 3VGDA 3M1BB 3JWDH 1E4XI 5EC2B 4OF0A 1OP9A 1E6JH 3MCLL 3OPUA 4E9VA 3A4AA 4QRPD 3WEOA 4BINA 5BJTA 3ZDXE 4ZDHB 4K94H 1LWRA 5DD0H 3ZTNH 1VJSA 4NUPA 1KBPA 2GKIA 2HFTA 2X1PA 1GC1C 3OLIA 1FLTX 5DVPA 3TTYA 3U0WH 1EEUA 1DQVA 1ID2A 4KHTH 5JDSA 2DI9A 2ZD0A 2AGJL 3KYMB 3C6LC 2X4SB 1CQYA 2AS5M 1B2WH 1WBZB 2P3YA 3PWPB 3SJVB 5DUBA 1HU8A 3DUHA 1Q0YL 1DLHA 1JWMB 4FN0A 5DRWA 5E1IA 1I9RL 3S5LA 1HX0A 4RFOH 1LVEA 4GKZA 5KS9B 2B1HL 1S7VA 1JFQL 1I7UB 1IEBA 3BZFA 3BSZL 3I6GA 3P0VL 1NUGA 3KPLB 5D2LF 3VJ6B 3BWUF 4JY6A 4LPWA 4A37A 3MLZH 3RVVC 1DSFH 1HILB 1KCUL 5KVGE 2EH7L 3FBKA 4JHWL 1KCVH 2QMJA 1IC5H 3AG4B 4U6HA 1ROWA 2ORBL 4AZ8B 1CLOL 1BXUA 2WQSA 2OPCA 4LSTL 5HYJA 2X0UA 1MI5B 3Q9QA 3Q6FB 3B7TA 3CFKB 4QRUB 4I3RL 4HKZA 4JO2H 3IBOA 1ZTXL 4G6AD 2NY7L 2BVTA 7CGTA 5AOLA 2ODIA 3WHE0 1FL5B 2NOYA 3O3DB 1ZLSL 1NCHA 1C08B 4DUWA 2GBTA 3BFWA 2VQTA 4JFOA 1I8IB 4TNVF 1NGZA 1E7VA 2F1AA 3FJTA 1IGFH 1YEDB 1TJXA 1WSST 1E8ZA 1X6LA 2BH0A 2CNZA 3UTZB 1SJEB 1LO0L 2ED7A 3L9RB 5I23A 4LLMA 3CMOH 1MH5B 1T0NB 4M9PA 5JHAA 1FYTA 3B83A 4C56A 3P9MB 4YHYC 1NUNB 3ARBB 4DFIA 2HLEB 3V52L 2AQNA 2AXGA 2O5XH 4HU2A 4ANWA 1S7TA 1TQSA 4KK5D 2A6JB 4YN3A 1CU4L 4XC1L 5FWQA 3O0LA 2YZ1A 1WFTA 4RX4D 2Z92A 3CHSA 3NN8B 2CCLA 3GF8A 3OAYK 1WFNA 2WVSA 1QZNA 1QSFB 4O58L 3HNSH 1DUYB 4LEEA 2L7UA 1O7SA 4OZHF 4IRZH 3BPOB 4TNWK 2WP3O 3II2A 2D0GA 3LQZB 3HG0A 3ZIMA 1GPOH 3WNMA 2BNUB 3WIFA 2WLIB 3EF7A 3BHBA 4N25A 5DQJB 5I2IB 2Q2EB 1A1MA 2YEVB 5DA4A 1WP6A 2Q7YA 3KPOA 4QHLA 4MJHA 3EH3B 4H40A 3MNVA 1V3LA 4IBZA 3SDCB 4LHUD 1Q94B 2VLKA 3DUUA 5EC1B 3B2DC 2FTAA 1I8LC 3RI5K 2GJZB 1PQZA 4YOKA 3P0GB 1QBAA 2ITCA 3T0XA 5JOPD 1J8SA 3DIFA 2BSRB 4U6TA 1VHPA 3CX5J 1JF6A 2KLSA 3DMMD 4XNUH 2WXRA 1T7WA 4I5BA 1DQLH 2YA2A 4R90L 3LKPB 4XXCC 1DN0B 4R2GD 4KKZA 3TBSA 2EKSB 3MLPA 1FIGH 4B0MB 4EUPH 2OL3L 2VDML 5KYYA 1HQRA 3M17B 3OKNB 4D0BB 1PD0A 4JFZH 2DWEA 3A6OA 2ATKA 2DTMH 2EXTA 2X1QA 3HBZA 3MBEB 4H2CA 1JVKA 2ZX6A 1J1XH 2JB6B 3ULUE 1AGDB 1WEJH 3E1F1 1F2QA 1RZGB 4JKPL 4QOKB 4UQEA 5DK0B 3X12B 3DKHA 4U0QB 1MREL 1BZ7B 2WD0A 4PD4J 4PB9H 4GYBA 4LIQE 3U1PA 2MTAA 1MUJB 4J6RL 4CW1A 3UERA 5HYSB 3NSCA 2RTTA 2AJZB 1HT6A 4ZK8A 3GRWA 4MCZB 2YAMA 3BIKA 4E41D 3ARUA 3OVUB 4PLJC 1IV8A 1CLVA 1ZV9A 3DTUB 1Z9NA 2MPAL 1OPGL 3Q43A 1L0XA 2E86A 2XFXB 3ARED 1N26A 1Z7JA 3KHOA 4JDTL 4QRSA 5H94B 1KLUA 1NIEA 3GUFA 1FCGA 4JFQA 3SE8L 5EZJA 1I8AA 2FJSA 4YL4A 1U8JA 2A4EA 4L8SA 4P46A 3RY5A 4M6NL 2QPDB 3OZ9H 1FIEA 5BVJA 4JFDD 4HBCL 5D9SA 1O9WA 3D3VA 4GINA 4Y4HC 4DGIL 5SX4I 3NFPB 1Q1PA 1RJLB 4YJZL 3Q9PA 5ICXB 4AIXA 1HHIB 3E8VA 2X88A 5DD3L 3DX1A 3FCTA 4AG4L 2HPTA 4XMKL 1G0XA 1N64L 3LEXA 3T0ED 3ZL4H 1C9SA 3RIKA 3ZE0B 1BQHA 3CPUA 1NICA 4PG2A 5DDHB 5E4IA 2H2PC 4UQ3A 4FL4C 4HZ1A 4H0LC 3LXUX 4ADIA 4JLRB 5LWYL 1Q9WB 4HZLB 1JZ5A 5FLUA 3DVFA 2WXFA 4NFBA 5FO7B 3UH8A 4YLCA 1HVXA 3MZGB 4ZUVA 4YHMH 4M8VA 3B7YA 2R2CA 4X6DA 5JPMA 4IU3B 1J0YA 3CFCL 1OKEA 2IH1B 4P23D 4WEBL 2Q7NA 4YXHL 3QNYB 4LCCA 2BVYA 2J20A 3BP4A 3M6DA 1GAFH 3CJJA 4GO9A 4TV3A 3I9GH 3SKMB 4DVRH 3CMGA 3EH4B 3IB4A 4HGWA 4LEOB 1HE8A 1OALA 3LKNB 1R19A 2WXMA 3MV01 4X6BB 4D8OA 5HPMA 4HKJB 3K2IA 4LOFA 5LDSA 3JUZA 4L2YA 3VFWA 3KBPA 1TTAA 3ARDD 3FO9B 1UT1A 4E9SA 3PHQA 4JVUA 3TJEH 4LNRA 3QC6X 3KW7A 2V5YA 4W9IC 2J1WA 1RZKC 3MV11 3STLA 5E6SB 1C5BL 5SWQA 3SHSA 4OBSA 1ERNA 4ADJA 2H26A 4R4ND 3V7AG 3DPDA 2E5EA 5FW6A 2EVHA 2JLLA 4HH8A 2B1OA 2UZXB 3UTTE 1FP5A 3DHJA 4JZNB 3S36H 2KDYA 3NEOA 3LQAH 3U7YL 1ETZA 1HYSC 4XNDA 3T0WA 3L48A 2CU9A 1N19A 2BY0A 1Z9SA 4YHPB 4KXZI 3FFDA 3O8XB 3TT3L 3VM5A 1TVDA 3ESPA 4O02H 5FFLA 4JM2A 3L2NA 4PW3A 5AYUH 6FABL 3C60D 1ND0B 1UA7A 2YS4A 4XVJH 4IRJB 5HGHB 3NZHL 3QJFB 5B38G 1TOXA 4NUQA 4AMKH 3G7TA 4IIQA 1T3FA 4LCWE 1K4CA 4LSVL 1KACB 3DPBB 4ZRGA 3HLKA 1ZSDA 1FJ1A 2FX7H 2NYYC 3FT4B 3K6SA 4AENB 4LLDA 4B97A 4L48A 1GS8A 3GO1L 4P2CG 4PLKC 1QBML 3ISWA 4HALA 5CSZA 2IPUG 1CFMA 3TS8A 2GSGB 1GYUA 1HZHH 4XP9H 4KX7A 2EEFA 3DX6B 5D5MA 2I9LA 2FWSA 3HR6A 2VLJD 3NIFB 2Y7SA 3PV7A 4HZAA 1MFAH 3UTOA 3E1ZA 1OAUL 2DD8H 5IIEA 4P8QA 1R5WB 3ZTEA 1U3NA 4HJGB 3WFCL 5T5NF 2CIKA 3FPYA 2FIRT 3FB5A 4OZFB 4QRRD 4ALAC 1AAJA 1G7JB 1C1EL 4GBXD 3MOBL 4DNLA 5E94B 3EYUL 1OAZL 4KX8A 1EEZA 4YE4H 3MV7D 4OGAD 4X9HA 3P2DA 3B2UC 3C5ZA 1S5HA 3D85D 3K5SA 2C3VA 1C7SA 1RK1B 4K3GA 4GLRI 1VF5C 5DJCA 1BXVA 4DKEH 3MGOA 5C0JA 3T3MF 2KKQA 1MXGA 2QTEA 3GI9H 4HDIA 1T1YA 1C8QA 1A4BA 4G71B 2W5PA 2DIAA 4R9HA 4AQ8A 3TH2T 4W9JC 4JRXD 1XGPB 1KGJA 5IK3B 4DPRA 5HPOA 2LHAA 4HUWB 1YY8B 5IOPB 3S98A 3V9FA 1QHPA 4ZFOL 4J3OG 4UB0L 4PRIB 1N68A 2GK0B 2Y5TB 3P30H 1A0QL 2RGSA 3PXHA 3WD5H 1P6WA 2WTPA 3G04A 1S7UA 1T7YA 1IGML 2KDGA 4NLAA 3MXVL 1CR9H 4LEXL 1JK8A 5A6LA 3ULVE 3W2DH 4UT6H 4ANUA 2AEPL 2G60H 4UIMB 1NAMB 4OD1H 1O7DE 1H5BB 3S3CB 3NACH 3R06A 4JS7A 4B9FA 4PWKA 5JIMA 3LZFH 5I6NA 3RVUC 2H1LM 3HS9A 5C6TL 5AKVA 2OI9B 4TSBH 3GMLB 1T5WA 3ZYOA 1GR7A 2R0LH 5HDQL 4GW1B 1SY6A 2ZKHH 5G4MA 1TJHL 5T3XL 2QQLH 3VUAA 3N06B 3ZKXB 2X4QA 4KY1H 4BSWA 4HLEA 3O4LB 3SCMB 1OGTA 3MRRB 1L7TH 1RJZA 3L13A 5BUGA 1YMME 3TL5A 1D7FA 4BRJA 5L88L 2QGEA 2XG5B 3EO1B 4B5EA 4HMDA 5L2KE 2CXGA 4MMXA 1MW0A 3QDGB 4R7LA 1UQSA 4X83A 3BXNB 4PBVC 2WNKA 4YK4B 4G7QB 4ILDA 4UIKH 3ME0B 3NFSL 4HFWA 5DD1L 1G9ML 1R3JB 2I85A 2VDQB 2ICWA 4UMSA 5I1IH 3QUMA 4WY7H 5IB5B 4NYLB 4J3SA 3JBG7 4MS6A 5JPNB 4IBLT 1L0YA 4HGKC 4S0SD 2OK0L 1D6VL 5AW4B 4L8SC 4P46C 1MW2A 3T1FA 2BWIA 4NWTH 2OMVB 2X6CA 4Y4FB 3ETTA 3PNWA 2K6YA 3HG1A 3K4AA 1H8NA 2VXUH 4QPEA 2DQFB 4HVBA 4WKZA 3U6XS 3FDWA 1RUKH 3KJ4C 1VFBA 1EGJA 5JTWA 3LZOA 1GTNA 4X5LA 1A6TB 4ODTL 2OULB 2VL4A 1QA9A 2X2JA 4MX7A 4P2QD 4PG2C 5D7IA 4PB0L 2DYPD 4ANVA 4YBLB 5IBTH 2RR3A 5C0GB 2WLYA 4O2CA 3MRDA 1HH6B 1MW3A 2H32B 3N42B 4Z7VB 3SQOL 1N8ZA 3VFRB 2WLHA 1AQKL 4XODA 3WXVH 1HQ4B 2FNBA 3DJ9A 4IHBA 5A6IA 3JVFC 1KPRB 1QI3A 3GJFA 4K3HA 3ML9A 4MVBC 3C5JB 4ZQKB 5C7ZA 2ESVD 4TULH 5F3BB 2HFFB 1IM9A 1WZ1H 3BGAA 3DLQR 4QHUB 4JHAH 4G6FB 5F3HA 5CJOH 1SEBB 2ZQKA 5FPIA 1LE5B 1D5MB 1W6LA 1GGBL 3BO8A 4UM8B 2DQHH 4TPRL 4OZGA 3AFLA 1A9EA 3B2VL 1OB1B 4JFYB 4WEUD 3BUYB 3L1GA 3S8FB 4JG1H 4LHQB 1F6LL 4JO3L 1BM3L 1KBWA 1WIOA 5L8LB 4HIIB 4JPKL 4S11A 5D7SH 4UTAL 4M5ZL 3NFNB 1J7VR 3KBHE 3LX9A 4K07A 4JBSA 2R29A 3QJHA 5IB2A 3KPMB 5JHDE 4NOFA 5CSGA 1RUML 1GZHA 3V7MA 4HIQA 3PL6B 4FJYA 5CFHA 2GEQA 3IVKA 5B39B 3AXHA 5D1XD 1G5GA 4XMVA 5DC9B 5L7XL 1KBKA 5J0BA 2A6IB 5J1TC 3DHPA 4YHOL 5L9DL 1YECL 3NK4A 3UTQA 4H8VA 4U49A 3WFHA 1XIWB 3RWHA 1QBBA 3UBXA 2Q10A 4PUBL 5B3JE 2P80A 2CO6A 4PS4H 5DZJA 2ZNWA 3QZMA 3MLRH 5AL0A 4WV1B 3TN0B 5I5RA 3LRHA 4YL9A 1YJDH 3QEGL 1UD5A 2GPZA 4YHZL 1CB4A 4ZS7H 4Q8BA 3NABL 3H3KA 2PXYD 2NXZB 1NH6A 2OMYB 5IB3B 1G0YR 1I7TB 4JM2C 5JNYA 2H41A 4OCSL 4AQAA 1IAOA 3LH8A 4B6ZA 2ZOKA 4X9IA 1INQA 3SYQA 4JRYA 1FFRA 2BY1A 5D1QD 3SD2A 3GSWA 2VC2H 1EAOA 5EU6A 2GY7B 1AHMA 2J55A 2VB5A 3KWTA 1MF2H 3FUEA 4X80L 2WXGA 5ITBH 4RNRA 4NNYB 2QEJA 5FYLD 5D2LB 4WU7A 2A5UA 4TSCL 3LRKA 1FZKB 4K23L 1PG7L 5GSVA 4Q7DA 4DGYL 2UVEA 3LN4A 5ENWB 5MEOB 1BVOA 5HHXL 2WNWA 1YAZA 4WK4B 5GS0D 1R46A 3C5ZC 3I2CL 3VSTA 4PP1C 3FHQA 3QDJB 1UXSA 2E7DA 4UZSA 2WBJB 3QZWA 4NQDA 1OD9A 2A0LD 5DJ2A 3A47A 4BFFA 1UJ3A 4P49A 3VXTB 3P4NA 3WN6A 4LKXA 4AQ8C 3IEAA 2VQ1A 2VW4A 3SDYH 3HHSA 4DO5A 5D55A 3SKJH 4ZFZA 2GYSA 1I1AA 4QY8B 3O0RH 4N0FA 5EBGA 3WJJA 5FYKE 1NBYB 2W60B 3DX9B 1J5OL 4JQXA 2QL1A 3QCVL 2CO7A 4NFCA 5AVUB 4ZMOA 3BQUD 2AXFA 2ZUQB 3S7GA 3UO8B 3EDJA 4PGZA 5GRUH 5C0BD 5FCUL 3VI3F 2ZXAA 5F1NA 3FQUA 3WY4A 4BK8A 3UO1L 1A7NL 4DQOH 2KPWA 3ARFA 5EIIB 5CEZL 3LS4L 1IGIH 5I19L 3FSVA 4Y2NA 2XRAH 4ZO8A 2EYTB 5BQ7B 3P02A 3L5HA 1NKOA 1Z5LB 2P8MB 3F62A 4GI8A 4X7DC 4RFEA 4UTBL 4AIZA 4AGOA 4RMQA 1MIEL 2A99A 4G8EA 1KXTB 3PWJB 4PRPA 1IQDB 4YHIB 3NAAL 5IOKA 3K1KC 1J86A 4XI5D 1NA8A 2GT9A 2WLZA 2AJYL 3VXSB 4P59L 5D96B 3WV0A 3MRFA 1NC4B 4BELD 1DVFD 2WXHA 2RFXA 5AAMA 2BHYA 4MMXC 2BOBA 1F90H 5F7DA 2B4CL 1QRND 3HW7A 4P0DA 2DQ6A 4N0RA 4WHYH 1I3VA 5GRXG 3FU5A 4Y5YA 3E80A 4ZTPH 3DVIA 2LAAA 2O5YH 2AQQA 4B3EA 3U4BL 3V5DB 5CJ5A 3KDMA 5DRZB 1QLFA 1UHVA 1AGFB 2FDBP 4GUPA 1OV8A 2AQ3A 3CDCA 3NDZE 2ZCLL 4PJBF 5EUKA 5FOBA 4BQBA 1SN5A 1L4IA 4BZ2L 2UY7B 3P3UA 1AI1H 3NJIA 3PHAA 4OKVB 1NCWL 1QSED 1R5VB 5LXGL 4I0CC 4Y1AA 5ISZD 1SDDA 2B1AL 4MXQC 1OTUC 3LEYL 5ESVA 3L2MA 1GC1L 1DTUA 3GMOB 2ZX5A 5AKRA 4HEMA 2GQHA 1AGBB 1QLEL 2VAAB 4RZCA 4Z3TA 1I7ZB 1JYNA 3L6FB 2J5WA 1MCFA 1S7RB 4TLKA 2NR6C 2P5EA 3L81A 5MI0C 5IKCB 4KZDL 1DE4B 3PJSA 3X1GA 3OX8B 1RZIA 4FHJA 3PPEA 1NFDE 4PJ8A 4A2GA 5LQBH 5MHSD 5FYJU 1RZ8B 2JCCA 1PIFA 3KPSB 3PGCA 2MQ3A 2P5WB 5IBUB 5I0ZA 1JZEA 4E42A 1LK2A 1EXGA 4M1DL 3QEHB 2FBJL 1EBAA 1JHTA 4WHCA 4MZRA 2CAKA 5I1JL 2FR4A 1DZBA 4PJEA 4QXTA 5FO8A 1T1ZB 2XWBA 4ZFFA 3APFA 4G6JH 2EEXA 4AEHL 1F11A 5DJYA 1PY4A 3WFEH 3BAWA 1S5IH 1TSHA 3QH3A 2EH8H 2Z93B 2JXMB 1RXLA 15C8L 1NAMH 3ZTCC 4L29B 4HEPA 1K8DB 4H20L 3HB3B 4NZTL 5F7EH 2RCSL 4L4VA 4IK7A 1GH7A 4G1MA 3QWRD 4KKNA 4OCLC 2W0FB 3MUGB 1P7QD 1T0MA 2AK4D 2C4FT 4PGDB 4HIXH 4ZAKB 1BPLB 4KQ3H 1RJYB 2BNQA 1TMQA 3CZNA 1WLHA 4FNLL 4ZS6D 4MAYA 5F7YC 4KZEL 1GZHC 3RTQA 2OMUA 3T6XA 4QD2E 3DX8A 3F5WA 4BA8A 2KERA 4TMPA 1IC7L 1DQDL 2XZZA 3MFFA 1ETJA 3DMMB 2VDOH 2WKOF 1FSKC 3JTSA 1DJXA 5E2UL 4URTB 3MJ7B 4KO5A 2IDTA 4M56A 4X4YA 4NQED 4MAUH 4U2ZA 2F5AL 4NN7C 4PR5A 3GBDA 3TVMB 2WCGA 3IWVA 1J87A 3THML 2A77H 3TF4A 1I9IL 3U2IA 2VDQH 1CGWA 4S0HA 5C6WH 2NLJA 4ZPTA 2JB5L 2VABA 4Z95L 25C8L 5HD8D 4TL4A 5J6GA 5BO1L 4PHXA 5TDPB 2JKLA 2I07B 3WS3B 4PRBA 5DR5L 3VB8A 4LDEB 3TCXA 1DO5A 3APCA 4F37F 4UOZA 2JQMA 4E41B 2WZPA 4W6YB 1GSKA 4FYTA 3VXUE 3AG1B 5E6IA 2VCOA 1BWMA 3QWQB 2GJ6D 4A6YB 5EZIL 4H2AA 3T65B 4DN4H 5C3LD 2AC0A 2H6UA 1CF8H 5C09E 1J12A 4U3HA 1BAFH 1DDHB 4OFDA 5TQ2L 3W5MA 1TCMA 2FSDA 4J3OF 4RFNC 2XXFA 4P48A 5EF3A 2XWJA 1SXZA 4Q6IA 2W1NA 1U8OA 3Q5YA 4P5TD 2DAVA 4TNVK 4NBYB 5I8OL 1MVFA 1RIVL 3UCRA 3VD2A 4PW4A 5E8PB 4FXKC 1ULVA 3A6BH 2XA8H 1KGWA 2AQTA 4KBPA 4KRPC 4TLSA 1MFMA 2G5UA 2JJUA 1N2RA 1J8KA 2WBXA 5GJSL 2E9GA 1GZPA 5DQ9A 5JIIA 1KLGA 3RB5A 1AOZA 1BQLH 1PTZA 3RJOA 4X0KA 1PY9A 3MRBB 4Q52A 5C0CE 3T2NH 3ROLA 3EKCA 4P23B 2XTJC 4KUCD 4UQ2B 2FJGA 1RY7B 2BPBA 5IF0A 4LGSB 4Y16D 4JQXC 1U8HB 4FXGB 3QDMB 2EICA 3HC0A 2FT6A 1QFWI 1UWEH 1XZ0A 3CHPA 5IBLD 4JB9H 2WINA 4J4PD 3KYAA 1XZWA 3JXAA 3WHXA 4YZWA 4AQZA 1T21A 1XDTT 4HG4K 4JFVA 1WCQA 3TNMA 3ARDB 3ARFC 4OLVL 1CGXA 1MCWM 5I0XA 2XOTA 1GW0A 3KVPA 4OGYH 3CBJB 4OF7A 5DUML 5IFAH 3IGAB 3O4OB 1ZHBB 4PJ9D 4MAZA 5I6KA 1CPUA 5F93C 3VW3H 2D7TL 3NH7L 3PWPE 4KOBA 4PH8A 2CKBB 2ZF9A 3UROR 2GCYB 5F7UA 3E2HB 4HK0B 3QCUH 2XDHA 4JHUA 1RV6X 3ECUA 4UU9A 5C0FB 4MBOA 2FQFA 3VI4A 4IU2A 3N55A 3NPSB 1X7QA 1MCKA 4L0PB 4RQQB 4A39A 5KS9E 3O9WD 3OHXB 3U9UA 3OPZL 3T3MB 3V4VB 3FO2A 1U36A 3MLSL 3KGRA 4PP2B 5C07D 2DQTH 1OSPH 3PG2A 4WEMB 4XPAH 5LNDA 4EIUA 3U6XA 3CUPB 3BQVA 3SGKA 4MZ3A 2OW6A 2AJ3A 1KYUA 1FZOB 1KTDB 1R75A 4D0DB 4L8CB 1NCAH 3MLWH 3SPGA 1DEEA 4Y19A 1B90A 1R9FA 4Y5YC 1MI5E 3TWCL 2XQYG 3EFFA 1AO7A 1QWHA 2CDEA 3MI6A 5H8DA 2WUBL 4ONFL 4OFQA 2NTFB 2G4GA 3CH8A 3U25A 4BZ1A 3N3EA 1JV5B 1ZIAA 2XG4B 1OAYL 2ZOUA 3UAFA 2DV6A 2PWGA 4YXLL 2MTPA 5GGQH 2QLVB 1DBBL 1E9PA 1HXMA 2KYIA 4R7NA 5JMRA 1LO3H 2H0PA 3I9IA 3KW8A 2XUWA 4MNQD 5AOIA 1NWOA 3QC5X 3FCSA 5TD4A 4NZJA 4ZI8A 3FU3A 2VDRL 4IMLA 5DYOA 2G3XA 4UV4H 2FVNA 5ID0B 2H2SD 1OOWA 1Q9OB 1CVSC 3OGOE 4APQD 1IJ9A 1NLBL 2FEEL 2QPFA 4FLSA 4PJ8C 3ZIYA 1VFAB 4GW4A 4W9FC 1BBDL 2ARJQ 3MV7B 9PCYA 3T6WA 4D9RE 1ICTA 5GSRA 4B9PA 4OM1H 4TUKL 4KROC 2BS71 4WJ5A 3BZ5A 3NG5A 4HHGA 3CSYA 1AHWB 3VXMB 4NIYE 2UV3A 2ITFA 4HUXB 4PVNA 4NI6A 4HS8L 4BFRA 4YHLL 3FT9A 2FBOJ 4G9DB 5MEQB 1JP5A 2HSIA 4EO5A 2QJDA 3QO1A 4BFBD 4FABL 4LAQL 3KYKL 1CICC 2LV4A 3QUZA 1SUJA 1SOXA 4XMLL 2K78A 5IROA 5BV7C 3OAUL 4YC2C 4AT6A 1GGTA 5E08H 4YWGH 2E6JA 1FH2A 2Z8VC 4W9GC 1VENA 5SWZD 4B5ZA 4HOMA 2MSPA 4YLQT 5ANME 4FJ6A 5D2NB 3GGWA 5JZ7D 1QW9A 2F0CA 5H37G 4DP7X 4MAYC 3RWCA 1NBVL 2YGOA 4JR9L 1P6FA 1D5ZB 4Z7IA 2PKDA 4ZTOL 4LRIA 3VXRA 2YEQA 4K94C 4PIRF 4X6EB 2EEDA 1KGIA 2Q86A 5ADPH 1SMAA 1QO3B 5DYFA 4Z77A 5H2BB 3PDGA 2OYMA 3HRZA 5BS0B 3NGBC 4CMHC 5J1AB 1HHKB 3H6AA 3I6LE 3CC1A 2ICES 4RAUA 1P2CA 4XNMB 5EU4B 1AD9B 2B3RA 5KSUA 2HT3C 5JLZA 4V1DA 2TRHA 2HVKA 2NY4D 4ALAL 3ZR6A 5CLWA 1MFUA 4MASA 1G1KA 1EUTA 1YEKH 4GKSB 1UB6A 4LLVA 1OAKL 2DQMA 2YD9A 3MREB 2EDNA 3NJLA 1KEML 4QOKE 1NBZA 4AXWB 2JI3A 4Z9KB 5LGKA 4MNGB 1XF5A 4U0RB 1CQKA 3AS0A 1LYQA 3OB0K 4DO4A 1VRSA 4W9LC 1KENH 4X5QA 5E6IC 5BUPA 5I15L 3HC3L 4WUKL 2IPKB 1YYLH 2ADFL 3PQYB 1LGVA 4HBQA 2H47C 2CK2A 5C6PB 2FL5A 1FGVL 2NDFA 4K15A 2BSSB 1FUNA 4FOMA 4OH2A 3KCPA 2AERT 2D03H 3D18B 2NPLX 1E40A 3FTYA 2QDWA 4I2XB 4FNSA 3MNZB 4Q6IC 5ICZA 4YGAB 2WWOA 2G30A 4WK2B 1W15A 2XZAH 2Q1EA 1WRFA 3EYVB 4G8AC 1CS6A 1X5HA 3L3JB 5EUOA 3WMSA 4DP1X 4WQOA 3PV6A 4KKAD 3DYMA 1OM9A 1IVLA 4RAVB 5JIHA 3WLBA 2DYPB 5EU5A 3Q05A 3ZE0E 4ELDA 1D5XB 1JJUA 2HVJB 5IMOA 3S4SG 4HYTB 4MFHA 3QIBA 3R19A 2MOQA 5I1HL 5LJYH 3F8UB 4KDTA 1B0RA 1JPST 1UWGL 2Q9OA 1NOLA 4MA1C 4G8GB 4BSVB 4HJJH 4UILH 1BD2D 1NC2D 3NCBB 4OLXH 4PGCA 3NCJH 4XHJC 2LLGA 3QUHA 4MQTB 1M1XA 1HI6B 1KTJA 4FTVE 4BXSV 1WA1X 3BVNA 1WITA 3KL5A 3FOMA 1HEHC 1V55B 3ZKMD 1G7IA 3HZMB 4RISL 1D9KA 5D1ZD 4KAQL 1BQUA 4RCAA 5FUCC 1TQBC 2QVIA 2J6EH 4LGPB 2GSIA 3IFPB 3IMBA 5IB4A 4C47A 1OCZB 1KYOJ 5IV2A 5E95B 4GH7B 4D2NA 1IC4H 3ARWA 3DGGB 2BVOA 2X1XR 3G6JE 2DM3A 3LMJL 3MPCA 5FHAL 2D3JA 4YPGA 3MKKA 5B1JC 4Z3JA 4S10A 5JOFB 1UGKA 4G7VL 5I6PA 1E5UI 3QULA 4XCFH 2GC4C 4N2MA 1KBVA 2JKSA 4NAQA 4HPOH 4KXCA 3FKUS 5ACLA 3JT0A 2F5BH 4MJID 4UT6A 4OZIF 2IEPA 3S8WA 2QT6A 3NZ8B 2YO3A 4UBDC 4TUJB 5AVZB 4FKEA 3H42H 3S5LG 2HP4A 4EVNA 3SGKC 4H88L 3IJHB 3PAUA 4DKFL 4ZMYA 2FX9H 1IMHC 4NC0B 3GXFA 5GZOA 4NRYA 1P4LA 2Y07L 4QYOB 3CU1A 1F4WH 4U6VL 2WLKA 1YYMH 4FFVC 3QORA 5IFHL 3CLEH 2GAZA 4JFFD 3L95A 5KSAB 3VI3B 3WTSA 4Q9RH 1N5AB 3D8MA 1ACCA 5CKAA 3K2UH 1BJMA 2EIJB 4L3EA 3VVVA 2CRMA 2W92A 1GMEA 4X99A 3V5HB 2CR3A 4N0UB 1N10A 3N2JA 1WFIA 3RWDA 4IDLA 5KJ4A 1PKQB 4KGLA 4PSRA 1FNAA 4DP6X 1G7HA 5CXPA 1NGPH 1KB9J 1TSRA 1TKWB 2Y22A 2WYTA 4UT9A 5I66A 1HL5A 5B1CA 3OKDB 1DBAL 1ZHLB 3MV8A 4XE5B 5TPWH 1I3UA 2R23B 3KM2A 3QK0A 3NIFE 2WY3B 3D51A 2C1PB 5TF0A 1FHNA 5BZDA 4N2NA 4TQEH 2QSQA 4TM9A 1RIUH 2XJLA 3H7BA 1N67A 1B0IA 4QRQA 3BUIA 4OM0L 1DFBH 2YUWA 4KRMB 3HR5B 1DQQA 1YZZA 2LFEA 1JK9A 3GPEA 3UPAA 2ROYA 1ZEAH 5KBNC 3CG8A 4F5CE 1I1YB 1FV1A 2LU3A 4F15C 3DSFL 1TUPA 2YMXH 1UOVA 3GKWL 3ZRFC 1RERA 4JM0A 4PVLA 4U1LA 3WEXB 2FYYA 4XPHL 1MIMH 5E8NB 2CDGB 3RVXD 1TTFA 2HTLD 2WZ0A 4KTEL 2AJXH 2GB2A 5I73B 1WD9A 2DMBA 3VGHA 1T6VN 1PZCA 2IQ9L 3QUZC 4JPIA 5IROC 3O6FD 3QJZA 1S9YB 4PJBB 5HHQB 3AGVA 1JHKH 1CXHA 1TJGH 2R1WA 2VLME 2Q3ZA 2A9ML 5GISH 5E9NA 2BSBA 5EDXA 1AIZA 1RZFL 4P5MB 2CKBH 5HHMD 2EDFA 5C0AD 1U91A 4NENB 5C0BB 4EN2A 1X5YA 4AC2A 1WE5A 1CLYL 4V2BA 2IO5A 2L0DA 4LRIC 1IKFH 4EDWL 2Y6SC 1HNGA 3QPKA 1CD1A 2X4NA 4FFWC 5DK3A 3KAAA 1OY3B 2ZCKL 3V4VH 1E5YA 1F02I 2WQXA 3IDGA 4XVTH 3CXDL 3K5RA 3IM1A 2MHAB 4LVHC 2BW4A 4P3CL 5K9QI 1MRCL 5FF6A 4JJHA 4FQ1H 1ET7A 3QQDB 3D7PA 2QR0A 4Z3HA 5AVVB 4LSUH 1O9ZA 4G7YL 2O5ZL 2XWTB 2MOGA 2D3LA 2IALA 5E6UB 4Q58C 4W6XB 5K1NA 3QWOB 1YNLL 5F3FA 3GTVA 1T80A 2QGBA 4MCYA 3UJJL 5KJ7E 3O4LE 2WB7A 1PD6A 4CKQA 1DL7L 2ZWKA 2IAMA 1E5ZA 2F54D 2Z34A 3L4CA 3QXWA 3GIZH 5LXVA 4TUUA 1QRNB 2E27L 1G7QA 3DC0A 1WISA 2E0PA 3NDYE 2YSTA 2F53D 4HUVA 4KQ4H 3QDGE 4G5AA 4I18B 5D70H 1ZT7A 4F7TB 2OZNA 4WSJA 2KC0A 3MRLA 2GI7A 2X70B 3EUDA 2NZ9C 3F04A 1LP9F 3QHFH 4M6AA 1VB9A 2O61B 2ZWLT 2PCYA 3ALWA 3V4PA 4OJFH 4LPVA 5B38B 2VW6A 1Y1DA 1PZ2A 4ODSL 1FQ9C 4ZUWB 4I3SH 1ZA6A 2HJFB 3SDAB 3TOPA 3L3OA 1JGLH 3L4XA 1CC3A 3H54A 3FU7B 2P28B 1QSEB 3CC5B 3R18A 3VRJB 4XWGH 2CNYA 2YPLB 5DGRA 5ILTH 2FWOB 3QJOA 1RD6A 3EBGA 5SV3A 3GSNH 5T3ZH 3P2TA 4TVPL 3DXAA 4Z7WE 4Y1TA 4LVNC 2XWXA 3FMGL 4BH8A 3R1GH 2MIZA 2VUYA 1B2YA 2QFPA 2ADIB 5FX3A 3VFTA 2JI1A 4Z6AT 2W65A 3QIBC 1E3XA 3IYLW 5TDOA 2CE6A 2VUKA 3C5SB 4P2YA 3T8XB 3VSQA 4A2LA 5BMFH 2UWEB 4MD4A 4KDTC 3VB9A 2UXGA 5FECA 3UTSA 2JK5B 2BX5A 4Z7VE 4ZD3H 1TQCB 1TYRA 3WO4B 1SY6L 1M1SA 4Z76B 3TCLB 4QRAA 4F80A 3DX7B 1BQHG 5ICYA 43CAB 1FNGB 1JGIA 3WFBL 4Z5RA 4ZG1A 1JF5A 3N1GC 4IYKA 3FTGB 1DQIA 5INDA 5KVFL 2VKWA 3MRJB 5CGBA 3B43A 3KXFD 1D9KC 3MRIB 3IN2A 1CTMA 2QSCL 1M42A 5D4IA 2QELA 2DH2A 3HG4A 1JPSL 3QZNA 5F9OL 4WHTA 5JQHC 1M6OA 4CVZA 1MJ7H 3DI2B 4D9QD 1P7QB 5JUEL 2FIKB 5T1KD 1AXSB 1S78C 3QUML 4JO8A 4ETQB 1XAKA 1A7BA 1BMGA 4ZT1A 2R15A 1J0JA 1M2OA 3QYNA 1F4YH 1KJ2H 3B8SA 3RGBA 2C7FA 2OR7A 3EFDH 4XO8A 1X5XA 1ZHKA 1N6QH 4P2RD 5DUPH 4CVUA 3AWEA 3BSGA 1ROCA 2YWZA 2PWHA 4F33B 2V2WB 1J8HD 5ESAB 2DLFL 4EN3A 1PKOA 2BSTB 1F1DA 1B4JL 3VFVA 1VZGA 3FN0L 1W8OA 1BM7A 1MCHA 3TZVA 2MQCA 1EGJL 1V7ML 2GUOB 4EOWL 5GZOC 1QG3A 3CK0L 4WU5A 5EULV 2NY1C 3MN8A 4PGBB 3V0GA 3LQMA 2YK1L 2R8SH 3QORC 1AKJB 4NX0A 3PWNB 1UJTA 5DK2B 2YJLA 5BPPA 3APMA 2WLJA 4ZX5A 3KWXA 1C8PA 1L9QA 2NXYB 1DQML 1NMBL 1Q4NX 4TS6A 3VYNA 5EEXA 3D08A 4A2FA 2ZKXA 2AANA 3O6KH 4IBQA 1T0OA 3WL9A 1UT2A 1EIBA 2YBRB 5E2JA 4AZUA 4DW2L 4KU1A 2QKIA 3RGHA 1RP8A 1A14H 1X9QA 2EE9A 5EZLA 1CBVL 2HJLB 3FYIB 1RUPL 3MLTA 2Z91B 1S7WA 1Z5HA 4ZXBD 5CN1A 3QXAB 5D2LE 1LO2L 1H3XA 4G42A 5E8EB 1TO4A 4JFEB 4HGMA 1VGKA 3QUXD 5F1IB 4JY4A 2X4RA 2EYSA 5BVPH 3FOLA 3IRCA 3MBWB 1N5YL 1XR9A 1CIDA 3CQFA 4W9ZA 4AJ0A 1TZOA 4PY7B 2WAQA 4FA8A 3IETB 4OR1A 2ZWYA 5KVMC 1KCRL 3KLAA 4NP9A 1ES0A 2W9DH 3HE7D 3QDJE 2EDOA 3T71A 3BZEA 3UYOD 2ICEA 5HI3D 2FUTA 2HTKC 3H2PA 5EWIL 4YIQA 1ZWIB 4FQHB 2OMZB 3D07A 4FKHA 4Y9GA 1I7RB 1M3IA 3BEVA 3SODB 1VAHA 5BUAA 4NP4H 1XF2A 4JRFA 1IT9L 4DGWC 2X3BA 2D3NA 5I1GH 2X6UA 3X11B 2W9EH 2FB4L 3TEUA 2MKLC 4XTRD 1N3NA 3J7HA 2B7DT 1AJ7H 1OSZA 5BRZD 4GRLD 3EH2A 2XXGA 1NCUA 5DFVC 4H13C 5E4EC 4OLUL 2FD6H 2X38A 4PJ9B 1BFOB 3FO0H 1JZGA 3BZ4A 3OQ3B 4NKDB 4DIXA 2FE0A 3JVGC 3QUKB 5HSFA 4QJ5B 3JV4B 4X7TB 4S0TD 5ABZA 4Q6KA 3TESA 5T1LA 3ES6A 2V5RA 3JYBA 4L1BA 1P9MA 5C08A 4ONOA 2BNRA 4ODUA 5HHNA 2DJMA 2LLLA 4NCDA 3O9WB 1MRDH 4OZHE 1ADWA 1MZYA 4ZOAA 3Q1SH 3VXSE 4X7SH 4XWOC 2IAMC 3MA9L 2PCXA 5E03A 3S5ZA 3MRCB 2VERA 2K45A 3UYRH 4WFGD 5KZCB 4XC3L 4OAWB 2IPUK 1SOSA 3B5GA 3L45A 5DTFB 1WVZA 1VACB 1A4KB 3L7EA 4IEFB 2DYRB 3MKGA 3GXDA 3RWJB 2VISB 1QPPA 1T83A 4MDJA 1BPVA 5B4MC 1X9LA 1AP2B 4BQCA 1KNOB 3BH8B 3MYJA 3PY9A 3LPOA 2X3CA 4UOQA 2IANE 2NW2B 3S96A 4AYMC 4BUGA 3AQYA 3LRLA 4C8XA 2YXVA 4F91B 5HI4D 3CPLA 3VRLF 1W72A 2P47B 2R2HA 4FLRA 1XAUA 1Q0YH 1Y7VA 2ZOLA 4MDIB 3A4DA 4LCYA 3TA3D 4DF9A 3QPQC 3RE0A 4U33A 1R3IH 2VR8A 4QHPA 4M6MH 4F37K 4JPQA 4XNXL 4PCTA 2IDQA 2H8PB 5GS0H 1M4KA 2JI2A 4P3DB 3HE6A 1LTXA 3V0AC 2BP5M 3DV4B 1FVDB 1KCUH 1TJIL 3BD3A 3MR9A 3IJEA 3BIAX 5SWSB 2CRZA 1UB5A 1MLCA 1ODAA 1QTYT 4LU5L 4YFDB 2ORBH 1SM3L 3FQ1A 5B7EA 4APQB 4WFHD 1CLOH 3HC4L 2Y7OA 4NKOB 4JAMA 5EA0H 2OSWA 1L3NA 4I3RH 2E74C 4YQXL 3ARSA 1K2DB 3KPRB 3UC2A 1AR1B 3KPSE 2P5WE 2HLAA 4GFXA 2HMIC 1SXNA 4UF7C 1FG2B 4FERA 1BLNA 4XBPA 1NDGB 5I8EB 2DLGA 3V6OA 4K3JH 3TYGL 5E5MB 1CE6A 2WWKO 3L2LA 2OAAA 1ZV2A 4PBXA 1MQ8A 5CEYB 3QE5A 2VDNL 2Q0ZX 4I1PA 1LO0H 2X4UA 2QKSA 5SWZB 1XGUA 1XWVA 4OY9A 1X7TA 3FT3A 4RBPH 4S1SL 3V52H 3H9SA 5BW7A 2H0EA 2DB8A 5IQ9A 3REVB 1DR9A 4N0CC 4BCZA 4CAGA 2QADD 5B1BB 1JGEA 4XC1H 5DHYA 2DF3A 5IWLA 4YGVA 1ETB1 4GRWF 1XEUA 2AV7A 1T66C 2R9HD 1K6QL 3IFLH 1N12A 3PJLA 1XCTB 5F1OB 5INCB 3RZCA 5AZ2L 3B1TA 1L9OA 2ZSVB 3T3PF 3BEWB 5EEUA 5LGYA 4ZUSA 3J07A 5D7LD 2WXIA 4YE0A 4DJMA 2F15A 2EVFA 4XO3A 1R0AH 1CXKA 3HS0B 4HIJB 1HKFA 1MCPH 3IDJA 1O6SB 2A2QT 1MFDL 3KPQB 2BY3A 4MWFA 4L9DA 1MFEL 4A38A 5IFJB 3HG5A 1Y0LA 2HJKA 2J1KA 3UBXG 1P7HL 4JNXA 1KIRA 2RH0A 3K72A 1YEGL 3TEWA 5JQ6L 5M94B 1CDHA 3NUKA 4L4TE 3MROB 2APTA 4NZ8A 3P40A 4CU7A 1R1CA 4UM9D 1XSOA 4KRLB 1I53A 2WTRA 2R1XA 4HKBA 4FQ2H 1W6WA 5FWRA 2QQNL 6PCYA 3IDXL 2EXWD 3Q7JA 2CSPA 1TCRA 3SEPA 2JCWA 4FQIL 4DP8X 3FU8A 4HIPA 1RHHB 3TT1L 4H8UA 3Q06A 2QKIC 4YR6B 1A3RL 1MW1A 3PWLA 4NM4H 3OKEA 2A74B 5BV7L 3IKCA 4R90H 3K91A 3C6SB 4ZOBA 4OZIB 1AYRA 1UCTA 3AWGA 1XX9C 2K0RA 4Y2OB 4OVUA 1NCNA 4HIEB 4UQAA 1KBBA 5BZWB 4L8DA 2MKWA 2VLRB 1L9SA 5CJ8A 4K94L 5DD0L 2FZ3A 2V33A 4BFEA 3L9EA 4YO0A 3QQ4B 1FVEB 3U0WL 5AW3B 1SXAA 4KHTL 1MREH 1BP3B 4MS8C 4J6RH 2FSEA 2ICEC 4URKA 2IMMA 5KOVC 1IX2A 3AY4A 1B2WL 4J3OH 3SY6A 5CGMA 3ZKND 2XN9A 1AZBA 5CMAB 2YD1A 1PJWA 1L5GB 1SXCA 4RFOL 3QEQB 3QZWG 4N9GA 2R1YB 2ZZUT 3SE8H 1OCRB 3RL2B 4QRPA 3QDME 5L2JA 4A04A 2YFNA 3MLZL 4QNPF 3A6CH 4IKJA 5DEFB 3KBEA 2ATAA 5DJ8A 2YIHA 2WMPB 3EOAB 3CFQA 1KCVL 4TQPA 1IC5L 3DRQB 5F44A 3H2WA 1HXYA 1G6RA 3BUQA 3EO0A 4UMGA 4PRNA 4AG4H 2JKXA 3U4AA 5I1AB 4HJSA 3SYOA 1NFKA 1MAMH 2EE2A 5FYJD 1UH2A 3RWGB 1E50A 1P9MC 2APSA 3C75A 5LWYH 3BVVA 4IOIA 4JY5H 2G3MA 4KJWC 5GXBB 1X5MA 3CTTA 4GAFB 2F58H 2WWMC 3LPFA 3SCMC 3V10A 5TGBB 5LVEA 1IGFL 3ARZA 1S6NA 1MN4A 3T3ME 1TNNA 4EKXA 2AVGA 5CGYC 4XOAA 3U1SH 3CMOL 5LBSA 4NRXA 4X98B 4J2QA 3IKKA 4WTQA 2YGPA 3D39B 3DV6A 5DJ0B 1H3PH 1T83C 3D0VB 2MRYA 4PMFA 4LESA 4JZOB 4F7EA 5I6MA 1RVFH 1RUQL 3B2XA 3KS0H 4JFFB 2HN7A 3IRZA 4WI0A 3W0WD 3TJHD 3ZGIA 4POUB 5HYEA 1IKNA 2HLFC 3ASNB 1ACXA 5JPNC 5K9OB 4K5PA 3X13B 1HSBB 3DBSA 5DMGD 1C5BH 5CGTA 4F7MA 3ZVVA 3UTTA 2OSYA 3G5XA 3G5YA 3ETBF 3T9WA 3FFCB 4IRZL 2VR3A 2M26A 4IIZA 5JHBA 4WO4B 4Y4FC 1LD9A 2ATPB 4OIBA 4GSDL 2XN0A 4QWWC 5IVZB 2JTYA 1UFUA 4NZRL 1GPOL 2C4FU 1PVHA 2V9TA 2X4TA 3FQXB 4GKOA 3V0DA 4E9TA 4PVBA 1NOAA 5F8QC 3WAJA 4WI4A 3BZDA 3U7YH 3RX8A 4BRVA 1ZT1A 3NESA 4NNXB 1AQDA 1U8KB 4YBLC 1EDQA 4Z7UF 3H9YA 1PEWA 4RX4A 3C09B 4LCWA 5KUKA 4Y9EA 2OBGA 2E46A 4KKQA 4NSKB 4HX1B 4JANB 2H45A 3HFMH 4LT7A 1ORQB 5T3ZE 3PABA 2JIXD 3V6OC 2GTZB 3GXMA 1LP9B 1AMXA 3NZHH 3VXME 5I76B 1MCSA 4F93B 3QHZH 4YSQA 5D7JC 1TEYA 5IQ7H 4HSAC 4H5SB 4TQIA 5F7LB 5CR8A 3L4TA 3D34A 2ZX8A 4KRNA 4AVKA 3FSZA 3K71B 1MVUB 5E24E 2CHXA 3EGDB 5D93C 2O30A 4GRMB 2AV1A 1AIFA 3BPCA 5DWUH 3QA3A 5DRXB 3F12A 4JFZL 3E6FA 3O3UN 2V6HA 4UOW0 4Q2ZA 5BW7C 2DTML 4LHUA 3WE6A 4RETB 5D2NE 1NGYB 2VQ4A 3IGUA 3ZYJA 3O2VH 3AJ7A 4HEPG 4U7MA 3BI9X 4MD0B 5B21A 3RIAF 4MCNA 3OC8A 1J1XL 4K7PY 1R24A 4JREC 3LD8C 4RMTA 3MOBH 3GHEH 5IWLC 4ZO7A 4EBQH 3US9A 5K33A 2ITDA 4PB9L 5DHMC 4CVXA 1EJ6A 1N8OE 1E8YA 2J6EA 3RZCC 4JM2F 2G0LA 2W80C 3SQBA 4I87A 5BS0E 5B1AB 1A22B 2GHWB 4P5KA 3C6LB 1IFHH 3WELA 3ZZ1A 3OAZH 2NX5B 5ITFB 4EDXB 2ZYSA 1NGXA 3HCVB 2VL5A 2PPEA 4MJ2A 3WAKA 4NC1E 4C58B 2J1ZA 3U36A 5AFAA 5MENB 2E47A 3V8CA 3UPCA 1G7MB 4G1EA 5D5MF 3LXBA 3VG0L 3OZ9L 4KFMA 2CK0L 1X5AA 3PREA 3SPIA 2F54B 2NXZC 4ISVB 1JDCA 5DRNB 3TV3H 4OFYA 2RBLA 3UBFA 1XCWA 2ARJA 3LHPH 2QFRA 1EFXB 3GFUA 2DWYA 2V2XA 5C0DB 4MNGE 2G2RB 32C2B 4G70B 2IDCA 4Y4KC 2JKJA 1ADQH 1ZK5A 2O6EA 3ZL4L 5DEZA 1UEYA 4OQ1A 2YN5A 3JWNC 1USQA 1U8NA 3DUSA 3LS5H 3PQYE 3WUWA 1QEXA 4YHML 4NQSA 3IAGC 2VRAA 2R0WH 1YMMA 2BSDA 1NL0L 3HZ3A 4XOEA 3T4YA 4AYEC 4BCXA 2VNCA 1CFTB 5T3XH 1IGYA 1S9WA 2R7EB 2FQDA 3H1ZA 4I2XE 1MHPH 4KKCD 5HDBF 2Q6WA 2FHCA 2ZAHA 4LLUB 1M57B 2B3IA 2FBRA 1L6XA 3QRGH 4DVRL 1GAFL 1I3GH 2HKHH 1IBZA 3ATDA 3I9GL 1KN2L 3QFJB 4GG6A 3I75B 3P3RA 5IT2H 1OGAD 4E9QA 4PBDA 1S9VA 1CT8A 5BOPA 3IDYC 5L88H 2Z35B 3QUGA 4Q9CA 1OXYA 1QNZL 4N3UA 2XPYA 3PDOA 1GGUA 5E00B 2UUDH 5C70A 3LRSA 3GUTB 1JYWA 2JJSC 5CBEB 3TJEL 4CC0A 3AY4C 4HS3B 1Z9PA 2X6MA 3SQRA 1OEZW 4M61A 2BW5A 4HMCA 1OP5K 3SGEI 4M03A 4R7DA 2YD8A 2QDVA 1K72A 1CL7H 1V27A 3EYFA 1ZLWK 1MCQA 3T0VA 1OLZA 2A83B 3O45A 4NEHB 4G8GE 4YDJB 3N43F 3FB7A 1LDPH 3KYNB 5E6ZA 1BMWA 1G7LB 5I6OA 5C8JB 3AT8A 2BIMA 4XBGB 4ZX3A 3TH4T 4Y5VA 3AMKA 4RGMC 2LU4A 2Z7WA 4HCRA 1IM9D 3GNMH 3S36L 3RWFA 3L4ZA 5BRPA 3AXLB 4GEJA 1YMHB 4NAJA 5T1KB 1GZQA 3HPJA 1TTUA 1JFHA 5CF3A 2YRZA 1KULA 2AK1L 3F7KA 1L7IL 1VERA 2DPKA 2NSMA 3FTSA 3O3AA 4O02L 1BF5A 3MODH 3TTSA 4XVJL 2O4EA 3MU3A 3QQ3B 2J8UA 4PTUA 1KXHA 2LQRA 3UCQA 5DSCA 1M05A 1CJYA 5GGTA 4AMKL 1WUNT 2YRPA 5C2UB 2FX7L 5CJBA 1A7PL 3MNDA 4JO4H 2IWEA 2VXVH 4MXWH 1OARH 4I1NB 2K9FB 1HHGB 3WJLC 1ZGLP 1HZHL 1VFUA 4XNAA 4GOSA 1NZRA 4PJCF 4UQIM 4RIRA 1HYRC 4JFPA 3T8VA 1F42A 1MFAL 3OXSA 2XYBA 3HZVA 3P73B 4GQZA 1W0WB 2VR4A 2DD8L 3CFEA 3N1QC 4G6AC 4TPRH 3BKMH 5D8JH 5EPMA 1WZLA 3BWAB 3H6JA 1CLZH 4NJAH 5EO0A 5K39B 4JO3H 4Z0BH 4KVPA 3GQFA 2BHZA 5ABDE 2R69A 2WSPA 5I0YA 3C60A 1QQDB 3VI3E 3EDFA 4G8FA 5D7IF 2K8QA 4NHUB 4RZKA 2EUZA 3ECBA 3EUUA 1WCBA 4YE4L 1G1OA 1QLRA 1RUMH 4JGNA 2CIIB 3W5NA 1BWWA 2RB8A 5L8KB 1JZ3A 4TNFA 4G43B 4IKNA 1PKQE 2WIIA 3F7YA 4Z18A 2VLJA 4JRYD 5I9QB 5HHOD 3K6FA 1HZKA 4QRTA 1T4KA 2UZYA 2VSKB 4QF1A 5A2LH 3DI3B 1XBRA 1RURH 1WWCA 1ONQA 4V33A 5DC4B 4KK5C 4GSRA 4BE6A 3WDJA 4QRRA 4F9PA 3NJVA 3QUXB 3ZY7A 4GBXA 3FSWA 3D69B 1ZGLM 2W88A 4OZGF 4AK2A 3P30L 1XGYL 3WD5L 2IBBA 5HJGA 3GMMB 1JWSB 4O5LH 4UOJA 5IESH 3EJUA 3IU3A 4Y4HB 1CR9L 4EI6A 3CZJA 3W2DL 4UT6L 3D85A 3WIHA 3DO7B 2IIJA 2B59A 4OD1L 2V3DA 2OMTA 3NACL 3D25A 3PWVB 1SQ2N 3WTTA 3D2UA 5LHDA 3TBVA 4WCYL 3IXAB 1WD8A 4TSBL 4FL4B 2WXOA 1KIPB 3V5KA 4PJBE 2R0LL 4CSTA 1P1VA 1ZTXE 4HWZA 3FPXA 5E7BA 2E7HA 1JN6A 4W6WB 3TX4A 2YR3A 4A7SA 3BESR 2QQLL 2TSBA 4U6YA 1SYVB 4KY1L 4K0OA 1UKSA 1I1AD 2OMXB 1KIQA 3JWOC 4WAFA 4GW5A 1L7TL 3CVDA 3F6JA 4GRLB 4IK6A 3CN2A 5GIRB 4EQ3A 3OKKB 1PLGH 2DM7A 4ZX4A 1EVUA 5AKTA 2X10A 5BJTB 1BQRA 1PD1A 1V3MA 4UT7L 3WNJA 5HHPA 4G8IB 3RVTD 2Z31D 3WY3A 2B14A 3GBLA 4HV8A 1HWHB 3DMMC 4KI1A 4B96A 3OB8A 1BVKA 1UZ8B 3ISYA 4N0YH 2R83A 1E9OB 5I30H 5JDSB 4R2GC 2VDRB 5AWNH 3S5YA 5I1IL 1F4XL 4LOVA 4WY7L 4WK0B 3V7AE 1Y6NR 1ED3A 5F0MB 4HK3N 1LNUA 3U0TA 2QZQA 1GYWA 2VQUA 3ZQ9A 1KDIA 4Y5XC 3F2LA 1OE3A 2WO2B 1DLHB 1VESA 3DWTA 4H8WH 5IQLA 1KJ2A 5DRWB 5HDRA 3S5LB 3PPSA 5JORA 1S7VB 4NWTL 4P4KD 3CZGA 1IEBB 5FR3A 1PZAA 3BZFB 3I6GB 4U3CA 4W9HC 1J5OH 1FBIH 3QCVH 5DQDH 4JY6B 5F6HI 4N2OA 4Z8FL 2XYCA 4IRSD 4JKNA 3M7FB 1U8QA 4K71B 1P4BH 2AQ2A 1TQTA 3UO1H 1AG6A 4U6HB 2EE3A 3LS4H 2FYVA 5GGSA 2DH3A 5I17A 4DOHB 5IVOA 5HYJB 5IBTL 3AREC 4H4NA 5J5EA 3U4EA 1NIFA 3KWVA 1DJZA 1MJJA 3WXVL 1OVZA 4GRWB 1FN4A 4HD9A 3EDKA 2CH8A 2EXYD 3CCHA 1DCEA 2V8LA 3X1NA 3NAAH 4TULL 3T3PB 4JFOB 4GO8A 1NGZB 1WZ1L 2YPLE 4JHAL 1JYVA 5CJOL 2DIBA 2RAMA 5JXED 3A4EA 3AITA 1A1OA 3T0EC 4LLMB 3KM1A 4P2QA 3JT2A 2ZUVA 2JQZA 5HJ3A 2OCCB 1FYTB 4NB7A 2F61A 1OTSD 4JG1L 4C56B 4AI7A 5DFAA 3NT0A 5CLZA 5KEZA 4HH9A 2JELH 4QXGH 5D7SL 2IDSA 4JZJA 3C9NA 2A6DA 2BLFA 1WZAA 2P5ED 4P23C 1P4IL 3MDJA 3JZYA 1E6OH 2Z92B 3KDPB 4DVBA 2EQDA 2ZG3A 2UX7A 4N2AA 4KXAA 2R4SH 2ZCLH 3AS2A 1KDJA 3GHBL 3G9VA 2J12B 5EU7C 35C8L 5EOCJ 4M7KH 4PS4L 3ARDC 5L8JB 3MLRL 1CO1A 2CCWA 1J05A 4PJFF 1XMWA 3WIFB 1F1AA 1YUHA 3RGVA 1DVZA 5T5FA 2X12A 3BHBB 4ZS7L 1A1MB 3V4PL 2ZKMX 1TYJA 1U4EA 4NPKA 4QHLB 2Q7YB 2I5YL 4LKCA 4F2MA 5AAPA 4KZDH 4R4NC 1SF5A 1I8KA 3MNVB 4YHKH 2HG5A 3Q48A 5I74B 1T22A 2VLKB 3GT6A 4DP2X 3DUUB 3CE1A 1MCCA 4Z0XA 3SO3C 3LKSA 5HGAA 5KSBA 1ORSA 2WJ7A 1PQZB 4AW7A 1CLCA 2E9WA 3KH3A 4P5SA 3PGDA 2N1KA 4QGYA 3RTQD 2ITCB 2NY6D 2LT9A 2D8KA 4I48B 3RILA 3DIFB 2VC2L 2EUVA 1MCWW 4WUUE 5SX5H 3LTVA 1MF2L 4YDZA 4I5BB 5TJWK 5ITBL 15C8H 4WFED 4H20H 5DHVA 1HQRB 2K7PA 2PXYA 2WQRA 5AVYB 1NIAA 2O6FA 5FKAA 2DWEB 2WYHA 4ABQA 5LB1A 3GEFA 2ATKB 2Y25A 3C60C 4AGPA 2NQ3A 5DS8A 3DO4A 2IWGA 3G08A 4FNLH 2HPOA 3SKNA 4XPBL 3S8GB 1I3RB 3PAVA 2X5PA 3MV9B 1VADA 5D1QA 4XPGH 1UFGA