4JG0H

Structure of phosphoserine/threonine (pstab) scaffold bound to pser peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCVTSGFTFRKFGMSWVRQAPGKGLEWVASISTPRGSTTYYSDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTRGYSSTSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab light chain
publication title Nature-inspired design of motif-specific antibody scaffolds.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jg0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jg0H01
5IUSA 1EBPA 4HS6B 2ILLA 5GGUB 1JPFA 5DD1H 2PO6C 3RRQA 4LSTH 2BSRB 5HDBF 5IM7B 4XBGB 3HAEG 3KPLA 3LIZH 4X9FA 1TZIB 2VDML 1YNTB 1IGCL 4WO4A 1LEKB 3BD3A 4O2FB 3T1WA 3MV8D 5F8QC 3LN9A 2FHCA 4A6YA 5F6HJ 3D18B 1KUMA 3TNMB 2PW2A 3KLAA 2X7LB 4IDLA 3GI9L 1AGFA 4PJIA 1LO4H 2ZUVA 5I66B 2HTKC 3RGHA 5HBBA 1TPXB 2W9EL 4MD4B 1ZWIB 3E8UL 1YEHH 4F9PA 3M17B 3PGCA 3LQAH 4OLWH 4JFZH 3UMTA 4NM8L 3P4MA 2F9BT 1NBVH 2VLJE 3ARBC 2BERA 1VSCA 3QUZA 1NKRA 4NFDA 1EHLL 2QADB 5I74B 4ZO6A 1EUTA 1B90A 1I7TB 3GHBH 4R96A 5TE6L 5BS0E 3GSUB 1T22B 3C5ZD 5FDYA 1LO3H 2KZ1B 2ZP0T 2XKSA 4RMVA 2C3VB 1RU9H 3LEYL 5E8PA 1PG7L 4BZ2H 4FN0A 4HUUA 2D0FA 4L29B 3CSBA 5D1ZB 5F9DC 2VDPH 3I9GH 4HZAA 1FVDA 3WSQH 4L3EA 4TTDC 4O5LL 2IPUK 4NQDA 4X4YA 2ZSWB 1HINL 1X5JA 1JZ3A 4GQPH 3CC5A 3X17A 2HRPL 1ZT4B 3SKNA 4OM1H 3HR6A 1U3HD 2DWEB 3MLSL 1A6VH 1XF2A 1RZKH 4KTDL 3RHWF 1QG3A 1JRHI 1J1OH 1ODAA 2DQFA 1IC5H 5A16B 3EJYC 3IFOB 1IC7L 4LHUB 4M7KL 2PYFA 2HKFL 2AJVL 4DTGH 3GDBA 1F6FB 3K2UL 3BW9A 1UB6B 1W2KT 4W4NA 4G7YL 4XMLL 1WUNT 3OAZH 1L7IL 5EU3B 2E6JA 2JJTA 5GRWA 3QIUD 4KGJA 3BE1L 2VDMH 1YN6A 4G80A 4Q6YA 2N56A 1EIBA 3MFGB 4B50A 1IGCH 3TV3L 1T83A 1OM3L 3W0WD 1HN1A 3KPQA 3EOBA 1FLTX 1A3QA 2APTA 3GIZL 3MJ9L 2R2BB 4ZYKA 3VW3H 1C8PA 5GGRA 3UTOA 4F7CA 1L6XA 1FL3A 2BY2A 3BPCB 3H9ZA 4EUPA 2W9EH 3S34L 3V4PL 3VRLE 4RFEA 4IMKA 4M8VA 4LSPH 1G7QB 4U6VL 3VU2A 4NM8H 4UU9A 4U1KB 3QXAA 1KNOB 1EHLH 1KLGA 3TBTA 1R5VA 5TE6H 3RKDC 3LMJH 2HLFC 1M7IA 5E2TH 3DVFA 4XVUC 3T1FB 1QFPA 3BIKA 3KPTA 1VDGA 3LEYH 3ZT7A 2X4UB 1T2QL 3X13B 2Q6WB 4KRNA 5CP7A 5GZOC 1RUQL 1QSFB 4Y1AB 3NCJL 5DQDL 4LIQE 1ZGLM 3THML 2OSLA 5J13B 4O5LH 1NC2A 3MLRL 5HD8D 5FYLL 4ELMF 1HINH 4IIQC 4WO4D 2HRPH 3K80A 1U58A 3FTGA 3TPUA 3MLSH 2N1KA 3NIFE 1HWHB 1EAPB 2NTFB 4KTDH 3PWLB 3OR6B 1SY6A 2ZUSA 3BH8B 4LPVA 1IC7H 2WUCL 2Y9RT 4M7KH 3QG6A 4DUVA 2HKFH 2AJVH 3ZYOA 1ZE3C 1JYWA 2VDKL 5JQ6L 3K2UH 3O3BB 3ZT6A 3OPZL 4MJ6A 5CMAA 5T1KA 3S98A 3NZ8B 2I07A 2HJKB 4JDZB 2NZ9C 2ENSA 1I75A 3QUZD 4OI9A 4G7YH 4XMLH 1AGCB 4GRWH 1L7IH 7CGTA 2FIKA 2BY0A 4XNQA 4HUXA 2C26A 5DHYA 3V5KB 3KDMA 5I1DB 3O81A 3TYGL 3BE1H 3MV7A 1T0MB 3FQUB 1ZVYA 2PYEA 4PGBB 5IW6B 3BISA 3TV3H 1OM3H 4AT6A 3RVXD 1RJLB 5E8OB 1JBJA 4EN3B 1N0XL 1XF3A 4KK9C 4X4XB 5IVXF 3GIZH 4L3ED 3MJ9H 3VWJA 1CU4L 1OGTA 4Z7QE 5CEYA 2VJXA 2F19L 5L2KE 4RBPH 1K85A 4NQDD 3MV9B 3LQZB 3QDJA 2AW2A 4I2XE 43C9A 1DLHB 5C6TL 1TVHA 3S34H 3DX7B 35C8L 3V4PH 3D5OF 4LASL 3EUUA 5F96L 2CRIA 3EKCA 1RK0B 3IRZA 1MAKA 4FQHB 2BNQA 4PRNB 3WS6A 1NDMB 5EB9A 3VD9A 2CUHA 4Y5VB 1W0VA 1CDBA 2NQCA 1DBKH 1T2QH 3AROA 3LKSA 2P7TA 3K8MA 3TO4D 1RUQH 5TE7L 3NCJH 5DQDH 3H6JA 5ISZB 1KIUA 3THMH 4LU5L 3MLRH 4Z7VA 4XT1C 1U8PB 1RHFA 5DJ0A 2VR5A 3I50L 1JRHH 3CVHL 1BD2E 2OTWB 4MAYB 4CADA 3P73B 3MNZA 2A6IA 1K3ZA 4HHAA 2QV2A 3OJVC 2WUCH 1RSFA 4XX1E 3T3ME 2X4RB 1R5WB 2VDKH 4HIEB 3HE7C 1MHCB 3OPZH 4Q7DA 4ETQA 4JKLA 1HILB 1NCAL 5KG9B 4NN7C 3U30B 3L3KA 1LEGB 1QSEE 4S1DD 3MPCA 1E4KA 3VFNA 3TYGH 5JLZB 2EC8A 3PL6C 2YD9A 3X3GL 5CEZD 1E6JH 4NQTA 4W6YB 1CXFA 2HAZA 5I1GL 1BZ9A 1N0XH 4PLKD 5E8DL 4D3CL 1U2HA 1NC2D 3VRJB 4J3XA 2F19H 1NEZB 2BY1A 1TQBC 2DBJA 3MYJA 3SPVA 4NO0B 5BVPL 4TUKL 1KACB 5C6TH 3UX9B 3RVWC 5EZJB 2JK5B 35C8H 4X6CB 4LASH 4QHLB 1Z5LB 2W59A 2PTTA 4IOIA 1C16B 5F96H 1W8OA 3GO1L 2JCCE 2OQJB 3KXFE 2Y6SD 5FUCC 1NC4A 3H9HA 3R0MA 2OBGA 1YEGL 5T1KD 1NBYA 1KJMA 5F7NC 1MCFA 3VGAC 1CD0A 5IEHA 4MQXC 3MRLA 4TULL 3QUKA 4F7TB 1AXSA 5I17B 3RTQB 3SDAC 3FFDA 3M8OL 3UTTA 3MV7D 5D2LE 1KB5A 4HJGB 4M3KB 4M1GL 5GSRA 4FFWC 4LU5H 5JDJA 1MCBA 2PYED 4O4YL 1PLGL 4R2GC 2JJSC 4F80A 4Q2ZB 1YNKL 3I50H 3F5WB 3CVHH 3TBSB 3HUJF 4RISL 4M8QA 3QRFM 3VWJD 4PJDE 2EDEA 1N26A 4ZS6C 3QDJD 5DJYA 3LOWA 4NRYA 1D5BB 4Y89A 1Q9KB 1NCAH 1U8QA 1KCSL 1MQKL 3QI9C 2VERN 1IKNA 4LLYA 1P1ZB 1ONQB 1UYWL 2BNQD 5TDOA 5CEXA 5IF0B 1YQVL 2WSKA 1XR8B 4P59H 3T3PE 2N7BA 3GSNL 5IK3A 3X3GH 5AEAA 4G5ZL 3H0TA 5DUBA 3OKEB 5I1GH 5I71B 5ID0B 3B5GA 1SM3L 4D3CH 2A0LD 4ZTOL 4H8WC 4EBQL 3T77B 4NFBA 2CPCA 3O3DB 1MF2L 2ATKB 5TGBA 5BVPH 4TUKH 4TVPD 2VC2L 4ZMAT 4P46C 4GRLA 3IT8D 3Q5OA 1T1XB 2CKNA 4LNVA 3HHRB 2MJWA 5IJVA 2GSIB 3GO1H 3MV8B 4JHWH 2MQ0A 1PZUB 3WNOA 1YEGH 1RJYB 2W07A 3U6RA 2HKHL 4R7DA 2OS7A 4EI5C 1IMHC 2IH1A 3EDEA 4X6DE 4M00A 1FSKB 4TULH 4NO5A 4OSUL 3RVTC 4OZIF 4K7FB 1OQOA 3B8SA 4PJCB 3M8OH 2YZ8A 3GSVA 1A2YA 1TZHB 5F21B 1MUJA 3LRHA 3L5XL 4M1GH 5DEFA 3S37L 3NCYP 4O4YH 1PLGH 3PHQB 4MX7B 4UT7L 4G7VL 4KKCC 3LV3B 3ZYJA 4XX1G 1I8MA 1YNKH 2UY7A 5JOFA 1BPVA 3C5ZB 4WV1C 4JLRA 1QBBA 3HMXL 3BDYL 2B4CL 1MCKA 2WIIB 3FO2A 5GIRB 3KPPB 2B0SL 4QWWC 1HYSD 4RGNC 1DANU 3DV4B 1OTUC 8FABB 5LBSH 2AK4E 1BBJB 2R2EA 3EYQC 3MCKB 1KCSH 1MRDL 2A73A 1MQKH 4HUVB 2Y36H 1NC4D 1U3HB 3TIDA 2ZOLA 4JO4L 4HBCL 4OTXL 4BQBA 1UYWH 1A0QL 1B2WL 1MQ8A 1I1AC 2J6EA 3D3VA 1YQVH 1C5CL 2VAJA 3GSNH 3DMMB 4KJQD 4G5ZH 3A0OA 4AIZA 3UTTD 4Y5XC 5IQ9B 4JFPA 3ARYA 2H8PA 3RVUC 1LP9E 1SM3H 5GS1B 5C0DB 4ZTOH 1CF8H 1U41A 2DI8A 3T0EE 2NLJA 5I0DA 1B88A 4JFYA 5DMIL 5DVNA 1MF2H 3VFTA 1FYTA 5IIEA 4TQEL 3KS0J 2VDRL 3ZE0E 2EDRA 5F1IB 3QEUB 3AFLA 4QRPA 3CZFB 3RWGB 4JG0L 2RBLA 3U4BL 3W0WB 5DFVC 3T2QA 2VISA 3WIHL 1ZHNB 1H8SA 3HZVA 5LGKA 4MNQA 4NQEE 4NT6B 1UZ6F 5C0IB 1LGVA 3DIFA 3WFHA 3BZ4B 2BNRE 4OSUH 5SX5H 4LAJH 3SE4C 2HVKB 1H3UA 3ARFA 4U2ZA 3R06A 5HY9A 1O7VA 3HCVA 4WI4A 3L5XH 1QUNA 3S37H 3SN6N 3FRUA 2Q8AL 4GOSA 5C08E 1WC7A 4UT7H 4G7VH 5EULV 5C07E 1EPFA 3O4LE 5E4IA 1UB5A 2Q76A 1JPFB 5HGHA 1P53A 4HWNA 3HMXH 2NY5L 3BDYH 3D39E 5INDA 4EQ3A 2FJGA 2B0SH 3GJEA 1A3RL 4XP4L 1CGYA 3KPLB 5CCKL 4YE4H 4GRLD 2W0KA 4PV8A 4KFZC 3HRZA 1SJEA 5IB4A 1P9MA 3MJGX 4I0CC 1T21A 4TUJA 3KPSE 5CKAA 4WO4B 4KVNL 3QNZA 3C2SA 5KANG 4A6YB 1L0YA 4JO4H 4HBCH 1FDLL 4OTXH 4MMXC 2PW2B 1A0QH 1B2WH 3KLAB 2XZQL 1Y6KR 1AGFB 4PJIB 4MXQD 1DANT 1C5CH 4X4ME 4WFHE 5DTFA 3WO4C 2D3VA 1NGPL 3W5NA 2I9TA 1I8LC 4KHTL 4MCYA 3PGCB 3EGSA 1T7ZA 1GC1C 2H3NA 3P4MB 3RI5K 3BKCL 4WWKA 3QUZB 3Q5TA 1G0YR 1KJVA 1ZGLP 4OCSL 5DMIH 4XVTH 3T0XA 2CIKA 4R96B 4K9EH 4OFVA 1F4XL 4TQEH 1KF9B 2VDRH 4MCZA 4JFEE 2J8HA 5HHQA 3DECA 5E8PB 1WAAF 3RY6C 4HUUB 5KSAC 2J5LC 3QO1A 3KGRA 4JG0H 4IEFB 4U6HA 3MUZ1 5EZIL 4ZNEA 1WV7T 2D4FA 2HFGL 3DSNA 1FVDB 3FO0L 3WIHH 4L3EB 3SE3A 3GZKA 3H2WA 4KI1A 1WK0A 4PY8I 4KMTL 3O6KL 4NQDB 5EIQA 4X4YB 5FGCB 3CC5B 3OGOE 2IANE 3SKNB 5CZVL 4K55A 4RRPG 4U1GB 1XF2B 1IAIM 2X9WA 3CFIC 4L4VD 2AS5M 3ALWA 1VESA 4TYUA 2DQFB 4TN9A 4HWBA 5KTEL 4YC2B 2MKLC 2Q8AH 3BXNA 3JXAA 5CIPH 2PYFB 1IKFL 2IAMC 3QNXA 2EDWA 4NSKA 1OOAA 3MACL 3EOTL 1NUDA 3WFCL 3BW9B 2FHFA 5C86A 4JHZA 4OCRL 1NGWA 3OX8A 4AQ1B 5TF0A 4OF3A 5HJ3A 3LQAC 4ODHH 4LVHB 1UJ3C 1XZ0A 2NY5H 5I1IL 5E99L 2NY1D 3H3PL 4G8GE 4XP4H 4OJFL 4U0RC 2Z92A 1CIUA 1KCLA 5CCKH 2DTML 2R0WL 1YN6B 4G80B 1JHLL 4JQXC 4KVNH 4QRPD 4JQVA 1C5BL 3R4DA 3N1FC 3HPLA 3KPQB 1OP5K 2BOBA 3EOBB 1FDLH 2CUMA 1HDMA 5MEPA 2XZQH 4MNQD 4ZYKB 3O41A 5GGRB 1NGZA 4F7CB 1FL3B 4EUPB 1CD8A 1NGPH 3ZTJH 4KHTH 1WTGT 4RFEB 3ARFD 4O9HL 3RL2A 1PW3A 2V9TA 1UADC 3BKCH 3BO8A 3KAAA 4RAHA 1RZKC 4TVSa 4UU9B 3QXAB 3MLUL 1KLGB 4OCSH 1MCPL 3TBTB 1R5VB 2XKNA 5FEBA 1F4XH 2HT3D 1INDL 1M7IB 2LE9A 3WS3A 4B53A 1FLRL 3BIKB 3UPAA 4PJBF 1HEZA 2HT4D 1X5XA 5I30L 3BRDA 5CP7B 4QGYA 4RFOL 3G04A 5EZIH 3RFZC 3PWPA 2HFGH 1XF5A 4M5ZL 2OSLB 3RPKA 1NC2B 4MVBC 4P5TA 4MXVF 4HG4J 4KMTH 3O6KH 3B2VL 4LQ1A 5CZVH 1U58B 1G0XA 3FTGB 4ONHA 3TPUB 3QB7C 5JHDE 3LH2L 2ZUTA 4Y2DA 3SBWA 3JWOH 1N5YH 4P4KA 1ERNA 5KTEH 3QG6B 5T33L 1IKFH 4YFDB 3RIFF 3MACH 3EOTH 3WFCH 2BVPA 4HIJA 1YEKL 4MJ6B 5CMAB 5T1KB 4OCRH 4OQTA 2I07B 3SO3B 5K9QG 4WWKD 1TXKA 4MMZC 4K71B 1F5WA 4JFOA 2QEJA 2FIKB 3DUHA 4EXKA 2Y7QA 4XNQB 4HUXB 5DHYB 5FO9A 3KDMB 4K3DL 4J8RA 4OJFH 3MV7B 3WDJA 4S11A 2DTMH 2R0WH 2PYEB 5HI3C 1JHLH 2YPVL 4OCLC 5EUOA 4AT6B 2NXZC 2BRQA 1C5BH 2R0LH 1PEWA 4XNXL 1U8KA 2A9ML 4CDGC 5GISL 4GRWE 1XF3B 4UBDC 4I4WA 3VWJB 5HI4C 3LD8C 1OGTB 3QIBA 4J6RL 5CEYB 4GAGL 1G7MA 3QDJB 4ZOCA 2ED7A 4M93C 1J87A 4Q74A 43C9B 1TVHB 3PXHA 3GJFH 2ERJC 4LHJB 5EO0A 1I1CA 2I24N 3D25A 1GGTA 3FB7A 4LCCC 4ZXBC 3MLUH 3CMOL 2YKLL 1Y6MR 3SDDC 1MCPH 4RCAA 4N90E 2BNQB 5FV2A 1I3RA 4XWOD 1INDH 2VLKD 3QQ4A 4PRBA 3T8XA 1W0VB 1FLRH 3CXHK 3HI6L 4L4TE 5M95B 1QO3A 3JTTB 1TFHA 1N8ZB 5I30H 3LKSB 2P7TB 3FFCE 5JO5A 3H9SA 1ADQA 4JFDA 5C0AA 4RFOH 4OD3L 2YUVA 4OGYL 1T66C 4M5ZH 5E95B 1A7NL 4X98A 5DS8A 3T4AA 4Z7VB 3SDYL 3QDMA 3B2VH 4MNGE 5DJ0B 5FHAL 4OI8A 5CBEA 4I1NB 1A1NA 4CADB 3MNZB 2NR6D 2A6IB 2P46B 4HHAB 3V0AC 4OD2A 1ZHLA 2AJUL 5M94B 4KRMB 4RX4A 4I77L 4MJIA 5T33H 2X70A 4JRXA 5CHNA 3T09A 4JZJA 1Z0MA 5IMMA 5LGHL 2VSDA 5ENWA 2BOCA 2P49B 1OHQA 4PJ7A 1YEKH 5ESAA 3U2SA 1LE9A 4ETQB 4HWEL 1FFOA 4AEIL 1RAMA 2NCMA 4MGXA 4PRPE 4JKWA 3L3KB 3QWRA 3IRPX 3G6JE 1HXYA 1AGBB 4K3DH 3VFNB 5DGRA 5H94A 1F3DJ 4HMDA 4Y4FC 4PJAA 2YPVH 4YHLL 2V9RA 3CAFA 4XNXH 2A9MH 4G9FA 1BZ9B 5GISH 3HPJA 1X3DA 3PWPD 3AGVA 2XZAL 4D0CA 4J6RH 3T65A 4P5TD 4XNUL 5HYJE 1CFVL 4GAGH 4Q0XL 1AP2A 2DM4A 3NPSB 3MYJB 3SPVB 1SJHA 3OKYA 3KR3L 3ZLQC 1N6UA 4XXDA 4Y2DD 2DB8A 3MROA 4N1EA 4P4KD 4ODTL 2PTTB 4IOIB 4NKOA 1N7ML 4P2QA 4CMHC 5IESL 4UAOB 2VNCA 3CMOH 3DX8A 4H20L 2HT2D 1NC4B 5CSGA 2YKLH 3H9HB 4XI5C 2E6PA 1KJMB 1NBYB 4I13B 4G6ML 4ZFFA 5IEHB 3HI6H 1G7JA 3MRLB 3QUKB 1AXSB 3TH4T 4PTTA 3FFDB 1G6RA 3UTTB 2G75A 4NYLA 1ZANL 1KB5B 4LBEA 4OGYH 3AAZA 3EIFA 4NC1E 1A7NH 1AQDA 5GSRB 4F3FA 1WWCA 4UNTA 5BS0A 3RWIA 2OI9B 4ZO8A 4HDIA 1IARB 3SDYH 1T7VA 4PRAA 1JGDA 5FYJU 3RL1A 1JI2A 2E3VA 4K7PL 3GGWA 3N1MC 4M8QB 3LY6A 1AFVL 3DETD 3QIBD 1RFDL 1OSPL 3NH7L 1I1FA 1WBZA 2DKMA 4RWYL 5K9KA 3ULUE 2AJUH 3LRGA 3NFNA 4I77H 5DJYB 4LSUL 5LGHH 4NRYB 3CLEL 4X8XA 3BPNC 5CP3A 3D9AL 2LU4A 3T0AA 4MQSB 4HWEH 4AEIH 1U8QB 3RA7H 4N0UA 4DN3L 4OUUA 4LLYB 4B7LA 1K9TA 4YEEA 3GRWL 4O2EA 5TDOB 4K8RL 3TVMC 4XMPL 5CEXB 1NCTA 4WW2F 3CDFA 5HVHB 5IK3B 4RNRA 4YHLH 3H9SD 4JFDD 3H0TB 5DUBB 5C0AD 1EK3A 1RZJL 3WHXA 1FG9C 3N1GC 3DWTA 1NKOA 2XZAH 1NCCH 4JY5L 4XNUH 5GGVH 5LVEA 1CFVH 3QDMD 4Q0XH 1XH3A 1NANH 5TGBB 5E6IC 4I3SL 3KR3H 5C3LD 2PO6D 2FR4A 3HFML 4GRLB 4Z76A 3QHFL 2G5RA 1G7PA 4ODTH 1BJ8A 1SYSA 4LOUC 3VCLA 1N7MH 1U8LA 5IJVB 4GG6E 2EO9A 4RX4D 5IESH 4H20H 4JRXD 4EQ2A 1NCNA 3U6RB 4IIQA 2DI9A 4R7DB 5AAMA 4J3WA 4G6MH 3ZE2F 4QHUA 2IH1B 5D7IF 4NO5B 1JZ2A 3QWRD 5CLTA 5BRZE 2EH8L 3GSVB 3K4AA 1A2YB 5HYSG 1MUJB 4IS6A 1ZANH 3WNKA 3QRGL 5DEFB 4ZFZA 4MLSA 1RVFH 1HH6A 3BKML 3FONA 1I8MB 1ZLUH 4G9FD 1YEJL 5I75B 5FUOL 5JOFB 4K7PH 4JLRB 1AFVH 1HH9A 3FOMA 3ISWA 4W81A 1RFDH 1OSPH 3NH7H 4M62H 1KJ3L 3FO2B 4RWYH 4KC3B 1P4LA 3OGCA 3P9WB 4H26A 1KCRL 1JF5A 4NQUA 1WFOA 4GAFB 4LSUH 5T3ZL 1IC4H 3CLEH 5HHVL 4HC1L 3U9PL 5LAXA 1OGAE 5D8JL 5D70L 2R2EB 2EKJA 1QSZA 2A73B 4P2QD 4DN3H 4TTDD 2NW2A 5DVOA 3TIDB 2ZOLB 1X7QA 2ZUQB 4HQQL 4LPXA 1IILE 3G6DL 3LHPL 4KWUA 4XPHL 5E7FA 4K8RH 4XMPH 3D3VB 1BP3B 1RULL 3SGDH 1OAXL 3DNKA 2YZ1A 3EJYD 1OAYL 4AIZB 4JFPB 2H8PB 2RFXA 4YPJA 1BF8A 5BS0D 4HK3J 4JY5H 2NLJB 1A1MA 2NY1B 2JJUA 4JFYB 2E8YA 3MLYL 2P43B 3NIDF 4JFFE 2K7PA 3VFTB 2BFVH 1FYTB 4I3SH 5DA4A 5IIEB 4P9ML 2YWZA 3IDJA 3HFMH 3QHFH 2WNGA 1DE4A 5L8KB 1X5AA 3L7FA 2H45A 4G3YL 4QRPB 1ITCA 5FO7A 4XB8A 5C3TA 5L2KA 5E9DA 3N85L 2VISB 4OV5A 3KHQA 5IFAL 3HZVB 4MNQB 3NAAL 4XP9L 4XGZA 3KPRE 3DIFB 3WFHB 3EFDL 2ICWA 2VZ1A 5D1XC 2EH8H 1QKZL 3ARFB 3BWAA 1W0WA 3R06B 3QXVA 5HY9B 3HCVB 1MEXL 3QRGH 1VB9A 2ZNXA 4F37F 3TO2A 3HE7A 4U3XA 4KZDL 1WC7B 4JFHD 5ESQA 3BKMH 3FN3A 5C0GA 1UB5B 2Q76B 5FUOH 5CSBA 1B0GA 1DLFL 2BHZA 4UZGA 2W9DL 5HGHB 2J8UE 2Q8BL 5A3IC 4GRMA 1KJ3H 5FF6A 3I3BA 3RKDD 5INDB 1EX0A 2FJGB 2HLFD 3GJEB 2GT9A 1KCRH 3PL6A 4XVUD 4PV8B 4MDJA 4HC1H 4QRUA 3HRZB 1CE1L 1SJEB 5GZOD 3K7UA 5D8JH 5IB4B 1BD2A 2VUYA 5D70H 4TUJB 1T21B 4WJ5A 3P0VL 3QNZB 4L4JA 4J4PA 4X80L 3S36X 4HQQH 5DK2A 4XPHH 1OQXA 3LHPH 4HCRL 1TPXC 3LB6C 3FMGL 4OGAC 1JPST 1TJHL 1RULH 2HFEA 4J23A 2B1HL 5DTFB 1OAXH 2I9TB 5DRNA 4MCYB 4PJFA 3STLA 1OAYH 3I6GA 1UM6L 1G0DA 3EGSB 5EN2A 5FHBL 2H3NB 1QSEA 3TWCL 4WWKB 3AS2A 1KJVB 4RMWA 3ULVF 4X99A 3MLYH 1SBBA 2CIKB 2NZ9D 1JYNA 2EDBA 4P9MH 5C6PB 4KK6C 1SMOA 4MCZB 5HHQB 5D1ZC 5D93B 2NW3A 3ZKMD 1X5LA 3QO1B 4G3YH 4WFFE 4U6HB 4BZYA 1MWAL 2B4CC 4KPHL 3N85H 4AL8L 1I85A 3OG6B 2GTWA 5IFAH 3V2AR 3NAAH 4XP9H 3WDIA 1J1PH 5J4MA 4KK9D 4NHCL 3EFDH 1BVLA 5BZDA 5IFJA 3OXSA 4DVRL 4XP1L 5HTSA 4LPTA 1QKZH 1R3KA 2JCCA 5F7WC 1TVDA 1KJ2H 3D69A 4ELME 3BXNB 4LGRB 3QNXB 5C71A 1MHEA 4KZDH 4NSKB 2GKIA 3BOVA 4C4KO 1MCEA 1HCFX 1NGWB 3OX8B 2NY3B 1QQDA 3QI9A 4LCWA 1DEEA 1U93A 1DLFH 3L3IA 5HJ3B 3GMPA 5D2NC 2R4RL 2XT1B 3OMZA 1XZ0B 2Q8BH 3UYPA 1AD0A 1W72L 4BFBD 1S7XA 4PD4J 5DUPL 2Z92B 4DGYL 1WCQA 2VXUL 1CE1H 4NGHH 3P0VH 4PJDA 1EEQA 3HPLB 5L2KD 5E9DD 4X80H 2BOBB 1UH4A 1GGCL 1HDMB 4HCRH 4JPIA 5MEPB 2A77H 3FMGH 1CS6A 3O41B 3IETA 3VG9B 2UUDH 2VQ1A 2DI7A 1NGZB 4ORZC 3MRGA 4N0FA 1TJHH 2EIBA 3H9YA 3ILQC 2NXYB 4FOMA 1UM6H 2XKUA 3RL2B 2HRLA 3V6ZA 3T0DA 5BCAA 3V79C 2E5EA 3BO8B 4WU5A 3TWCH 1FNAA 5C09E 3VXRE 2X09A 4OB5L 3ULVC 4ZQKA 2V5MA 3HE7D 3O2DA 2A74A 2XKNB 4U49A 4Z18A 5SWSE 2GJJA 4U31A 3PWUA 1JPSL 3EDKA 3WS3B 4OFYA 1AO7A 3OR7A 3UEZA 1HEZB 2GTZA 2X41A 4U3CA 4JPVH 3LN4A 3PL6D 2OP4L 2NY5C 1MWAH 3G04B 4KPHH 3SY0A 1JCKA 3PWPB 3WLBA 1CDCA 4AL8H 1XF5B 2CDEA 1YEFH 2VZVA 2L7UA 3P0YL 1IGTA 4OCWL 4P5TB 1NAMA 2LQRA 3HUJA 1BD2D 3OKLA 4GAYA 2WWKT 3MGOA 4WHCA 4NHCH 4ONHB 2H41A 4DVRH 3OKDA 4PJ5E 4J3UA 4Y2DB 4OIAA 4P4KB 4GH7B 5EZOL 1MCQA 2YPLD 3RVWD 2NPLX 2EDTA 4EOWL 1CFBA 1FZMA 5ADPL 2KDGA 3P30L 5C0JA 2BVPB 4HIJB 1P5UA 1RI8A 2QQKH 1R3HA 3DRTA 4QEGA 5T5NG 4GW5A 4GJTB 4I48A 3ZDYF 4FZEL 2R4RH 4AEHL 4JFOB 3MBXL 4Z6AT 2CH8A 1I8KA 2Y7QB 5FO9B 4C54A 3I84A 4N1CA 4J8RB 4RRPA 4MQXD 3KYKL 5DUPH 1QYGL 1UGNA 4DGYH 2VXUH 4KKNA 5MI0B 3ZKXB 1EGJH 4Y5XA 5D6DC 1RUAL 3X14A 5DK0A 1DVFA 5EUOB 1FJ1A 3B9AA 3VD4A 1U8KB 3QCTL 4FFWD 1LVEA 1AR1C 4I4WB 4R2GD 4XP5L 3QIBB 4MHHI 2PN5A 1G7MB 3VFMA 4OLXL 3QR2A 4X6CF 3ROOA 3P9LA 2AK4A 5F9WB 3OF6A 2XACC 4ZS6D 1CD1A 1F2XK 4UIKL 4PP2A 3TYFA 1YMMA 3DBXA 1K2DA 5EO0B 4IHOA 2YS4A 3D25B 3FB7B 5BVJA 3N1PC 5GGVY 1CFTA 4OCXH 2A38A 3ARUA 1DZBA 3I75A 1JPSH 1I3RB 3QI9D 4LCWD 4OZIA 3QQ4B 4PRBB 1CBVL 3T8XB 4JPWL 1A4KA 1QO3B 1GRWA 1E6OL 1CDGA 5IHLB 5EC1A 1LP9A 2HMIC 5JO5B 3H9SB 1JYXA 2OP4H 5C0AB 4LVEA 3VXUE 3WJJC 1EDQA 1BFVL 4X98B 5DS8B 3P0YH 3T4AB 4OCWH 4M48L 5AD0A 3QDMB 4MAYC 3VXTA 1X5ZA 4XNMA 5CBEB 1QPPA 2DN7A 1A02N 5A2FA 1A47A 2K1MA 2R1WA 3FN0L 3RJDA 1A1NB 3CFCH 3DHJA 4M7LL 1AD9A 3WXWL 3DVNA 5EZOH 4GAJL 3VXME 2BVTA 4OD2B 3VI4E 1ZHLB 5J89A 4MJIB 4P46D 3WIFA 4EOWH 4NQEA 2X70B 2FLBT 4JRXB 5CHNB 4JZJB 5ADPH 4KUCD 5IMMB 3P30H 5ENWB 2BOCB 5ESAB 5EWIL 4PJ7B 3U2SB 1LE9B 4D94A 3ZE1F 4QOKD 5GGQH 1FFOB 4HUKB 4K7PY 5E0QA 4FZEH 4AEHH 4XPAL 2XYCA 2YRLA 3MBXH 4XHJD 4JKPL 4E42A 1S3KL 4LSDA 4EI5D 1HXYB 2C7UA 5D7JA 5C08A 5H94B 1QYGH 1S7UA 1C08A 4OFYD 4PJAB 5HI5D 1AO7D 5C07A 3AU1A 1RUAH 1P4BL 3MRBA 3DYMA 1PFCA 4H1LA 4X4ZA 3B3IA 3QCTH 4G9FB 3HPJB 4UMGA 4D0CB 4KKCD 4XP5H 2KUTA 3T65B 5BMFL 3F6IA 2DBLL 5GPRA 3L3GA 1MCCA 3RP1A 4OLXH 1AP2B 5C2BL 5SWZE 2YBRA 5DD3L 1SJHB 3E6FA 4X7SL 3RY6A 4XXDB 5KSAA 4OI7A 3MROB 3FRPG 1CR9L 5A2KH 5FAAA 5C0CA 1NCBL 4QWWD 4HXAH 2QQLL 4NKOB 3NABL 5CAYB 3ZTJG 4P2QB 4RGND 3C8HA 3DX8B 1OTUD 2C9AA 2UV3A 3TC9A 3EYQD 5I73C 5HHNA 4U1NA 5JPNA 3IDUA 4X4MA 4ZFFB 4PJCF 1V3JA 1G7JB 4JPWH 3ECBA 1I1AD 4JFQA 4YZFF 4PTTB 4OIIL 5K9JL 1QFOA 1G6RB 1KELH 1NAKH 2G75B 4NYLB 3W82A 2WLYA 2IAMA 5IBTL 4LBEB 4K3EL 3AAZB 2DLEA 1AQDB 1BQHG 2GW5A 3CXDL 4F3FB 5BS0B 4KMLB 3RWIB 4M48H 4HDIB 1GZPA 2DLFL 4PRAB 1DVFD 1JGDB 3RVUD 4CVXA 4KV5F 4YFLI 3RL1B 5HGBA 1VCAA 3JV6A 3GGWB 4HUNB 3DURA 1DJSA 4M7LH 3WXWH 1G6VK 3BGFB 4GAJH 1I1FB 1WBZB 3G5ZA 3HRPA 5K9KB 5DRXA 5L8JB 4D2NA 5EOTA 2DIAA 4M61A 2APVA 4CU8A 3NFNB 3ARDC 2P8MA 2AK4D 2CLRA 3OF6D 1PVHA 1C5DA 1YEDA 3NCFB 4M7ZB 5TQ0L 5EWIH 4JQXA 1YMMD 3DOSA 3NPZB 4PUBL 2CXKA 4DCQA 3EBAA 1RPQA 2E9JA 4N0UB 3GNML 5DFVD 2E7MA 4XPAH 4Z7WE 4OUUB 1S3KH 2A9NH 5I1AA 5DFWH 1J0ZA 4XWGL 1EAJA 5T1LA 4OLUL 4O2EB 5DHVH 4GS7C 1KT2A 1I9IL 5CS7A 5I71C 3DPBA 1P4BH 4RNRB 4N0RA 4DKFL 1X5YA 4U1SA 3OB0K 2D7TL 3CSPA 3WHXB 4K7PX 1ZVSA 4G8GA 2FIRT 1XH3B 2AJSH 4OT1L 5DD3H 1WAAA 1MJ8L 2PCPA 4I3RL 2FR4B 3S96A 4Z76B 2F8OA 5F7DA 1HKLL 1CR9H 5KW9L 2GK2A 1G7PB 2YR3A 1BFTA 1NCBH 1SYSB 3VCLB 1U8LB 2RGSA 3NABH 5T3XL 4NQED 2NYYC 2CO7B 3QCVL 4IIQB 2D7PA 1QZ1A 1YPZE 4QHUB 2PTUA 3WXVL 1HWGB 3G5XA 4N1HB 4R4BA 2XZZA 3JVGC 2JF1A 1YMHA 5K9JH 1FFNA 5A40E 5D7JD 1QFUL 2F5BL 5C08D 4FZ8L 4IS6B 1OY3B 5IBTH 4K3EH 1FYHB 4ZFZB 1PGRB 1UZ6E 3CXDH 4TOYL 2UVEA 2DLFH 4NHUA 4WEBL 3FONB 2Q20A 3QXDA 4QHKI 4RGOL 3BX7C 4FTVA 1HH9B 1K5NA 2DS4A 3FOMB 3QEQE 4QY8A 4UB0L 4DW2L 1P4LB 2C1PA 3D0LA 4KQ4L 1G7IA 3OGCB 4F7PA 4H26B 4DWHA 4X7TA 2Q87A 5TQ0H 3IGAA 5KSAD 2LU7A 5DWUL 1OP3H 1UWXH 4PRID 5LAXB 5C0CD 2BDNL 5E2WL 3GNMH 1HXMA 3MBEA 2NW2B 5A43C 1BVZA 1X7QB 2QSVA 4XWGH 4QHMA 4PJIF 2G9HA 2I27N 3DMMC 2Z4QA 5J11B 4OLUH 3QG7L 5KOVC 4LFHG 5GRVL 4YHML 1I9IH 3ZDXF 3AB0B 3PWVA 4DKFH 3QQ3A 1AH1A 2D7TH 2IAMD 2RFXB 2AJZA 4GT7A 3SDDA 1H5BA 4OKVA 1A1MB 4Q58C 1IEAA 3I2CL 4OT1H 5JUEL 1PEZA 2Y1VA 1YC8A 4P49A 1I7UA 1MJ8H 1NMAL 3IDJB 4I3RH 2AEWA 3BJ91 1ACZA 5KW9H 1DE4B 4MXWL 5GGTH 3L7FB 4G6FB 2C1OA 5T3XH 5FO7B 1MCSA 2Y4SA 5L2KB 5E9DB 3QCVH 1IGJA 3U79A 4Z77A 3IDNA 3OWEA 4LEOA 3EAKA 4XGZB 3WXVH 4N9OB 4JAMA 2Z8RA 2ZJSL 5FB8A 4UI2A 1RHHA 2ICWB 5F6HI 4FRWA 1JGLH 1E4WL 3BWAB 1W0WB 1QFUH 1BFOA 2F5BH 1UT9A 3MJ9A 4FZ8H 5T1LD 5KJRL 2EXYC 2VR4A 4AIXA 5E5MA 2X9YA 4TOYH 4FQ2L 1JUFA 2IPTL 3TO2B 3HE7B 3WNMA 5ESQB 3KLDA 1L6ZA 4WEBH 4CVZA 3BYYA 5C0GB 3PIQA 4NN7B 3W11C 1B0GB 3MA7A 4G8GD 4RGOH 4OZGE 2VZTA 4GRMB 4UB0H 4DW2H 1RZJC 5FF6B 5E5RB 1J7VR 4AM0A 4KQ4H 4ISVA 5JA9A 2GT9B 2ZUYA 3PL6B 3DI2B 3QPQC 4W6XB 5AUMA 4Y4FA 3IDGA 4MNGA 1D6EA 5DWUH 4MDJB 4QRUB 4HH9A 5HYSA 1ROWA 1S9VA 1BD2B 2BDNH 3UROR 1DBAL 4WJ5B 3U7YL 3QUYA 2AQ2A 3U1SL 4KI5E 5DK2B 3RUGF 1HOCA 1MVUA 2AV1A 2P5EE 3QG7H 5ILTL 4F9PC 5D9SA 2FLRT 4WHDA 4TRPL 3HLAA 5J56B 4GW4A 3IDYC 2HFEB 4PJGA 3NIGE 1OAKL 2QQNL 4JKKA 4KKLC 4PJFB 4WUUE 5DRNB 2VZUA 3STLB 2WM0A 1II4E 5EN2B 3V0WL 1QSEB 2YD7A 3G6JA 3TT1L 4LLWA 2DWDA 3I2CH 4P57A 5B38G 4X99B 1KIRA 3VGAB 5JUEH 1MCNA 3RAJL 1NMAH 2PUQT 3MUJA 4FTVD 1F6AA 2NW3B 2DM3A 4MXWH 4L8CA 3IFNL 4YHYB 5HYJA 2LTQC 3OAZK 5HI3D 4R2GB 2EDLA 2GTWB 1HQ4A 5DJ6A 4RDQF 5EFIA 5EU7E 2NXZD 4PRHA 3VMNA 2OMBA 4ZUVA 2ZZUT 5BZDB 1BVLB 5I1JH 5IFJB 4NCC2 2Y5TA 3OXSB 5HI4D 4YC2C 1OAUL 1E4WH 1A5FL 1R3KB 2JCCB 5JNYA 1JWUA 1UZ8A 5AZEH 3VI3F 4LVOB 2D9QB 3D69B 3Q1SH 2GHWB 4FQ2H 2IPTH 1LDPH 1MHEB 2BVQA 4OFIA 4LVHC 4N0YL 1WWWX 3TCLA 4NDMA 1CN4A 2KQNA 2NY4C 2YD5A 1PBYA 4YLQT 4ZXBD 1QQDB 3QI9B 4LCWB 5MEOA 1DEEB 1U93B 3L3IB 3T2OA 3GMPB 3SDDD 4TSAL 4ODUA 3VWKC 4XB7A 1AD0B 5EU5A 2XTJE 3D85D 3NMEA 1BIIA 4JY6B 5KS9E 1AGDA 2QKIA 1T83C 4FQLL 5EU7C 2V2TA 3O0RH 3VD7A 1CD9B 4N8CL 5TPWL 1DBAH 1XR9A 3U7YH 5KVGL 4PJDB 1T66D 3U1SH 4G43A 1ZLSL 3LKNA 3UJTL 4JPIB 4LCIL 2H2PC 5ILTH 5E6IA 3IETB 3MQIA 4M7JL 1T89C 2VQ1B 3MRGB 4TRPH 4N0FB 1QSVA 1T03L 4R90L 2EIZA 1JWSA 1IT9L 1OAKH 2QQNH 1CK0L 3V0WH 3V6ZB 4MA1B 4WU5B 5FA3A 4FQJL 3TT1H 4N90D 4ZQKB 4JN1L 3G6AA 3OKKA 4OAWA 2VLME 2A74B 4LSVL 3RAJH 1AJ7H 5DFTA 3NA9L 1PZ5A 2G2RA 3PWUB 5FYJE 4PGEA 1AO7B 3UTQA 4RA3A 3OR7B 4PTUA 3HNTL 3CU1A 4C57C 2GTZB 1GHFL 5DZLA 4NKMA 4AEFA 3IFNH 5DD0L 3LN4B 4PB0L 4Y4FD 4Z7VF 3ZSTA 1QR1A 3SY0B 2EKSA 3WLBB 3E0GA 2CDEB 1XEDA 1FORL 5DA0B 4DFIA 1IGTB 4HBQA 1NAMB 4YX2L 3HUJB 2VXQL 3OKLB 1LQSR 3HS0A 3MGOB 4GAYB 3UAJC 3OKDB 2GSGA 2FECI 3PDDA 3PHOA 1OAUH 1SYVA 3IDXL 1A5FH 1WTLA 4GG6A 1QBAA 5FYLD 1INEH 4CN6A 1SHMA 2YXMA 1FZMB 1S7TA 4RBPK 4K71C 4N0YH 5C0JB 5FYKL 1AR2A 5FGSA 3U36A 1R3HB 3DRTB 4LK4A 2J88L 4GW5B 4DKAA 1QLEL 4I48B 5BRZA 3WJLA 3T0WA 4TSAH 5GS0C 4JKMA 1I8KB 3TCXA 2AEIT 3RY4A 2FEEI 1N64L 2QHLA 4FQLH 1M1SA 2J7LA 4KDTA 5TJWK 1J86A 1X44A 4Y5XB 4N8CH 4BK5A 4RGMC 4JREB 5DK0B 5TPWH 3VGGA 1DVFB 3X14B 5KVGH 2BSSA 4ZAKC 4M6AA 1FJ1B 2DJ4A 1U36A 5HYJD 4LLQA 3PHSA 3VFWA 3ROLA 1HHJA 1BJMA 2W65A 4JJ5A 1ZLSH 2R56L 3UJTH 4LCIH 4PRHD 4M7JH 3VFMB 4CU6A 4XPBL 4IJ3C 1A4JA 1T03H 3ROOB 3P9LB 4R90H 2AK4B 1OGAA 2YD8A 1CD1B 1IT9H 1NMBH 2N7AA 4FNLL 4PP2B 3TYFB 1YMMB 3DBXB 1K2DB 4LGPB 2F15A 4IHOB 4FQJH 3BGMA 1MPAL 3SKJH 5BVJB 4UTBL 2E7CA 1CFTB 4LSVH 3NA9H 1MFDL 3I75B 4OZIB 1IAOA 5D1XA 1A4KB 4ONFL 1KEGL 3HNTH 1CQKA 5EC1B 1GHFH 1LP9B 4P3CL 5DD0H 4XCYA 4PB0H 2CLZA 3QEHA 3MLVL 1FORH 5JPMA 1RIHL 2H6PA 5AD0B 4YX2H 2VXQH 1KIPA 3GSNA 4LSRL 5CJXC 3VXTB 3MRIA 4XNMB 1FGVH 5BV7L 3SEPA 1QD0A 2OMNA 1VA9A 3HNSL 1KC5H 5DQJA 2R1WB 3L3OA 1FNGA 3IDXH 4PFEA 4R7NA 4D0DA 2H26A 3WFBL 2KBGA 1AD9B 2IQ9H 3DVNB 5IVZA 1MCRA 2MCPL 5E6ID 2BRRL 1T4KA 1MCDA 1JI1A 3V8CA 1PKOA 3WIFB 2BVYA 4NQEB 1SMAA 1ZV5A 3AXLA 2EE3A 3RDTA 4LOUD 5FYKH 3BD5A 2J88H 1QLEH 4OQ1A 2GK0A 1H3VA 3CDCA 1S9WA 4E42B 5FKPA 4Y7MA 2C7UB 5D7JB 5C08B 4WEUD 1N64H 2B39A 4HUMB 1S7UB 4PYHA 5FECA 3S5LG 1MFBL 1C08B 3RI5F 1R5IA 5C07B 4RMRA 4LIQL 5J6HA 3AU1B 3NCMA 4O51A 4M5YL 3MRBB 1HE7A 4H1LB 3B3IB 2DMBA 5ADOL 5ID1A 2R56H 3TM6A 1EO7A 1NUNB 1G1YA 4YNYA 3O4OC 3L3GB 1T5XA 3A6OA 2YBRB 1DR9A 2ARJA 3E6FB 5EU6E 4FNLH 5KSAB 4XVJL 1U2CA 2R2HA 5C0CB 3HMXA 3MRMA 4C59B 1MPAH 3TLRA 1QLFA 5JIPA 1IAMA 1JZ6A 1NUFA 2X4TA 5GRUL 3AM8C 4S2SA 5HHNB 1B3JA 3K74B 4U1NB 5JPNB 1MRCL 1MFDH 4KJQC 2IALA 4BZ1L 4ONFH 3VXQA 1KEGH 5IW3A 5JDSA 3ECBB 4JFQB 2NX5E 3M07A 1JHTA 3EDJA 4P3CH 5MHSE 4MB5A 2PETA 1NGQL 2IAMB 3ZE2E 1Q9WA 4HXBL 2MWCA 3MLVH 5HSFA 1RIHH 4LPYA 2ESVA 1GZPB 3NCCB 1L0QA 4ODSL 1V7ML 5BV7H 1OLZA 5HGBB 2GIYA 3HNSH 5D2NA 3JV6B 1XGTA 2VXSL 2BNUA 3DURB 4XNYL 2ZOKA 3WFBH 4KY1L 2MCPH 3G5ZB 1WEJL 2BRRH 4PJEF 5DRXB 4U0RB 5E24E 5EOTB 4M61B 2IWGA 5LQBL 4Y16C 4F15C 2P8MB 1IJ9A 1OGAD 2CLRB 1C5DB 1YEDB 4A6YH 4KRPB 5KVDL 2IG2L 4DCQB 2AQ1A 1BJ1J 2Z0BA 3TGXA 2IC2A 1DN2A 1A7RL 2OX5A 5I1AB 2WWMC 2VQUA 2PF6A 3WIHA 5KAQF 5T1LB 3VFVA 1MFBH 4U1KA 5D1XD 1KT2B 2UZYB 4LIQH 3F7YA 1JF6A 4HKJA 4M5YH 3BN9C 5KZCD 5I19L 4U1SB 5T5FH 5EU4A 1P84J 3BKYL 5HGGS 1ZVSB 4G8GB 5ADOH 1ZGLA 5CIPA 2X4UA 5AZ2L 5CEZL 3MA9L 2VOTA 1B0WA 2PCPB 5A3ID 1VEMA 3CVIL 4XVJH 1ZA6A 3S96B 1P7QA 5F7DB 4BQ8A 1S5IL 3GM8A 3NIDE 1UA6L 3QZWG 4YGAB 3ARZA 3B9VA 1NQBA 2NY7L 5D5ME 4Z95H 5GRUH 3RDTD 1WF5A 4WTZG 5JIKA 3QJHA 5J06A 3G5XB 4BZ1H 2MCG1 4R4BB 1BIHA 1KV3A 1YMHB 3A67H 1FFQA 3LB6D 4S1SL 5C09A 3VXRA 1FFNB 4OGAD 1NGQH 2HJKA 5GGSY 4C55A 4HXBH 5C0EA 4CDHA 5I75C 2FZ3A 2FNBA 1Z2KA 2QJDA 3KVQA 5IBUG 4ODSH 5DLML 4NHUB 5E7BA 1V7MH 1ETZA 1KN4L 4PS4H 5AWNL 4U1LA 3LKRA 4MLIA 3QXDB 5HHMD 1YC7A 2VXSH 1KULA 4FTVB 1K5NB 4QY8B 4XNYH 4KY1H 4OGZA 1WEJH 3SKUD 2C1PB 3D0LB 4OGXL 1G7IB 4F7PB 1AHWC 4KK6D 5LQBH 4RMQA 4X7TB 5D1ZD 4TPRL 3IGAB 5D6DA 3CX5K 5KVDH 2IG2H 2NXZB 5C7XL 3K1DA 4PJ5A 1OWWA 1BQHA 1UEMA 3MBEB 1A7RH 5C0RL 3NACL 1T2XA 3U7WL 3UCRA 4CNIA 2G9HB 2K3TA 2Z4QB 4QKXB 4M93B 1T3FA 1P7HL 2D4DA 2ERJB 3GIVA 4FXLA 4UQ3A 3PWVB 2CIIA 5I19H 3QQ3B 3O6FC 3BKYH 5SX5K 2AJZB 3SDDB 1C12A 1T80A 4G6JH 1H5BB 4OKVB 2ESVD 1IEAB 4HKBA 2HWZL 3BP7A 5AZ2H 5L88L 5CEZH 3MA9H 2XXCB 1I7UB 1WIUA 3CVIH 2F5AH 1LD9A 3DXAE 2HFFA 3TZVA 4H5SA 2QSCL 1S5IH 4HS3A 4L8DA 4X5XA 2C1OB 1UA6H 2CO6B 1X5GA 2NY7H 1O7SA 4TVPL 1ZAGA 1IGJB 1D9KA 1DDHA 4Z77B 5JZ7C 3IDNB 3ABZA 4LEOB 1SY6H 4Y1AE 4JAMB 2UZXB 2CMRL 1MLBA 4O58L 1GIGL 2W0LA 1H9VA 5FB8B 1RHHB 5ELIA 1NL0L 4KH2A 1WZMA 4S1SH 3ETBF 3QDGA 4Z7UA 3VFPA 5T3XE 1BFOB 1J5OL 2EIDA 3WHE1 2BX5A 3ILQD 5E5MB 4M1DL 1JUFB 1QVOA 3FB6A 5DLMH 3QUML 1KN4H 4CVZB 5AWNH 1TLKA 3G5VA 3GJFA 4CAGA 4MJ2A 4NZTL 3V6OE 1G9ML 3PIQB 3GSWA 2VN7A 4I9WE 3MA7B 3VXUA 1FIGL 5EO9A 4AM0B 4OGXH 4ISVB 2R0KL 2AJXL 1G7LA 1JGUL 1QSFD 5AUMB 4Y4FB 4UUJA 3IDGB 3N0PB 4MNGB 4TPRH 1D6EB 1PG7W 1P7QD 5HYSB 4HH9B 3BPLB 3ET9F 1S9VB 5C7XH 4YBLB 5EIIA 4ZOAA 1P6AB 3BT2H 1KBGL 3QUYB 3KWWA 2M8XA 5KSVA 5C0RH 3NACH 3VXMA 3U7WH 3V6BR 3RWFA 1HOCB 1MVUB 2AV1B 3UJIL 1HKFA 2GI7A 4TUOA 1UC6A 4DK3A 1BBDL 5D9SB 3HLAB 4GW4B 4PJGB 4DQOL 4QYOA 4WWKC 2DDQL 5C09D 1KXVC 3MV9E 4PRPB 2AP2A 3G6JB 2R0ZL 4LLWB 1MCIA 2DWDB 3OKMA 4P57B 4MHHG 4PG2C 1KIRB 1L7TL 2HWZH 5D93C 3EYFA 5L88H 1ZT7A 4NKQB 2E7BA 5F3BA 4I18A 4OZHE 2SEBA 4WFGE 4OIBA 1F6AB 3O2VL 1ND0A 3RJQB 2QSCH 4G8EA 3SE3C 4L8CB 1A6UH 5HYJB 4TVPH 1MY5A 4CMMA 1FO0L 5EFIB 1OAQL 1HQ4B 5DJ6B 5SWZA 1BOGA 3FQWA 5B21A 4JGJA 4PRHB 4PJ5D 1NJ9A 3IXTA 4ZUVB 2IBBA 3IFLL 1AR1D 1TJIL 1U8MA 2CMRH 4O58H 1GIGH 2Y5TB 3CFDA 4C56A 1T1YA 1NL0H 2Y5EA 5F6IC 2JB5L 5JNYB 1JWUB 1UZ8B 3ARDA 1J5OH 2H32A 5FIEA 2YPKA 1Q9KA 3AREC 3PWJA 5C1MB 2NY3C 2G5BA 2BVQB 3BPNB 3DLQR 3QUMH 4RMUA 2V9QA 3TCLB 4NDMB 3DVIA 3OV6A 4NZTH 2QLVB 5MEOB 3ZSSA 2CD0A 5M7QA 4ODUB 4P23C 3GSOA 4B5EA 3KS0H 1FIGH 5EU5B 5L2JA 1FL5A 2R0KH 1BIIB 2BJML 1JGUH 4PJ9A 3S35X 1AGDB 2QKIB 5ISZD 4JQVC 4LQFL 5EUOF 2HMID 2V2TB 2EC9T 3TZVD 3C8KB 2MMXA 1XR9B 1KBGH 1UVQA 3LAFA 3RNQA 4NCDA 1D9KD 2VB5A 4G43B 3UJIH 2VRAA 4MAYD 4QNPF 5F97E 3LKNB 2NXYC 5E6IB 4HIHA 1BBDH 1EERB 1HZHH 4P48A 2EIZB 2ITCA 2VDLL 4GBXC 4DQOH 3UZVB 2DDQH 4CVWA 5JORA 1JWSB 3PABA 3QDGD 3BESR 3OZ9L 4Z7WA 3MRRA 5CWSA 5FA3B 2R0ZH 3G6AB 3CFBA 3OKKB 4OAWB 1L7TH 1U3YA 4JB9L 2XWTA 3BZEA 1PZ5B 2G2RB 1RJCA 2DQDL 4PGEB 3TJEL 1A7OL 1UH2A 3O2VH 3UTQB 4PTUB 2MPAL 2DM2A 2W9LA 3LN5A 4NKMB 4XMKL 3TEUA 4PLJC 3KPOA 1QR1B 2EKSB 2A6KA 2AXJA 4PJXE 1FO0H 1OAQH 5DD5L 3SBWC 3HS0B 3KPPA 3IFLH 1TJIH 4FXKA 4NO0D 1OT1A 2VDNL 2GSGB 3GMRA 3PHOB 1SYVB 4GG6B 1UXWA 2JB5H 1RZ7L 4FQQA 5I6XC 4XNZB 1P5VA 4PJ7F 2QR0A 1YPZA 4WEMB 1S7TB 2VXTL 1Q0XL 3B5HA 1GGBL 3U36B 4TSCL 3FKUS 1OPGL 5L6YL 5IQ7L 5BRZB 4BQ9A 3QWOA 3GJFK 1WT5A 4X5WA 1Z9MA 3UJJH 5IB1A 3M1BA 3ZKXC 5D1QA 2BJMH 4PJAF 2JB6A 3RY5A 2Z8SA 5A2LH 5DEZA 3VH8A 3DYPA 3ZE1E 2DKSA 4LQFH 1MFNA 2R23A 1MOEA 2BSSB 3EJZC 3QEQA 4EIGB 4LLQB 3VFWB 3ROLB 1HHJB 2H1PL 2W65B 4JJ5B 4YHPA 5SWZD 3GBNL 4MB3A 4MA7L 1A4JB 4U1HA 4C56D 1CTNA 1OGAB 2VDLH 3SGKA 1IRAY 4FP8L 2O61A 2XWJA 3WSQL 4F57L 2BZDA 4B7IA 1OT2A 3OZ9H 3ARDD 5JW3L 4QF1A 2DF3A 2WAHA 3BGMB 3BYTA 4U6TA 3EOYG 4JB9H 2BSED 3MV8E 1IAOB 2AXFA 4DKEH 2DQDH 5D1XB 4F9LC 3TJEH 3JV5A 4X7FC 3LDBB 2MPAH 1V3KA 5KZCB 4YBQC 32C2A 3KYOA 1UKSA 2WBWB 4XCYB 4XMKH 5JIHA 1EEZA 4PJ9D 5JW4R 5DJAA 3GRWA 3D6GA 2CGRL 2CLZB 3QEHB 2C3GA 3VFSA 5IGXH 1DQJA 5JPMB 2FHBA 2H6PB 5DD5H 4HEPG 4QCIA 1KIPB 3GSNB 3NN8A 2X1WL 3MRIB 4QXGL 4YZFE 4BKLA 3QWQB 1CL7I 2VDNH 4OF0A 5DQJB 1MAML 3L3OB 1FNGB 1ZLVH 2ADIA 4R7NB 4D0DB 1RZ7H 2H26B 1MCHA 4JZJC 5IVZB 1JF1A 1DQTA 2APWA 1T4KB 4JCMA 1RY7B 3AXLB 5GS2D 3ZHLA 2VXTH 1RD6A 1Q0XH 4OUOA 3RDTB 4P2YA 3C5SA 1GGBH 2P44B 4TNWK 4TSCH 4OM0L 1OPGH 2J6EH 3VW3L 5L6YH 1EHAA 2NYYD 5IQ7H 1BEYL 2GK0B 5C9KA 5MEQA 1S9WB 5DJ8A 5FKPB 4JM4L 4J1UA 1WITA 4LSPL 4ZUUA 3LPGA 3TBVA 5FECB 1R5IB 5J6HB 2FO1A 5FYKE 4O51B 4EEEA 4DFHA 3MRHA 4CGTA 5GGRY 4OZGA 1FBIL 1T6VN 1RZFL 3LMJL 3V5DA 3KJ4C 5HHMB 2H1PH 5E2TL 2RJMA 5ID1B 5L8LB 3GBNH 4YNYB 3UBXA 1OSZA 1PQZA 3FL7A 1CIDA 4Y19A 1LO0L 1T5XB 1B4RA 4OD1L 4AEEA 4MA7H 4DOHE 1Y18A 2XN9E 2YK1L 2ARJB 2E8ZA 5F71A 4FP8H 3L5JA 4X5LA 4F57H 2R2HB 3MGTA 5JW3H 5JIIA 3MRMB 1NLBL 2Q86A 4UOJA 4KTYA 3EO9L 4LLMA 2P45B 3VGDA 1QLFB 4NWTL 2X4TB 4S2SB 1VHPA 3VRLF 3FT4A 3HG1E 4HC1A 2IALB 4H0GA 4WUUA 3W0WE 2ZUWA 3VXQB 3ESVF 5JDSB 3DMMD 3FO1A 2YRZA 4NNXA 4YDLC 1JHTB 4L8BA 4Q9RL 5D1QD 1BZ7A 1UENA 2DLGA 3K3QA 1KB9K 1Q9WB 2CGRH 1CL7L 2ESVB 2X1PA 4XBEL 4JZNA 4HK3N 4QXGH 3QEQD 2AXGA 3BGFC 4L3CA 1VFUA 3GMOA 5D2NB 2OL3L 1MAMH 1O0VA 3VWKA 1XGTB 2BNUB 2F53A 2WP3T 2ZOKB 1HIMH 4M7ZC 3TPKA 2WQRA 4UV7L 3VE0A 3LKPA 5DGQA 3K8LA 3FHQA 3GMLA 1NFIA 3NIFF 2NZIA 3GK8L 2IEPA 3RKPA 4OM0H 2AV7A 1SEQL 3RUGA 1BEYH 4LPCA 3B4NA 3U0PA 1O5DT 4PGDA 4W4OC 3JWNC 5DRZA 4HF5L 5BQ7A 2FWOA 4JM4H 3QJFA 1HHHA 1T89A 5K59E 4R3SA 1JPGA 3SDXE 3VFVB 3CFJA 3IU3A 4D0BA 3EYOA 3VGFA 3F7YB 3P9MA 3BP5A 4HKJB 3ES6A 1ZEAL 2EXYD 2GYSA 3DUSA 4N68A 1FBIH 5EU4B 1RZFH 4U7MA 4PJIE 2J4WL 4K23L 3RWCA 4K8RD 2VDQL 3MGAA 3QHZL 5KS9A 4WUKL 1ZGLB 1MFCL 3HKFA 5CIPB 1DBKL 3ZDXE 1LO0H 2IQAA 4OD1H 4P2RA 3W11D 2YK1H 2V5RA 1EHXA 5E00A 1ZA6B 1P7QB 4Z7QF 4NN5C 1ZLUK 3QPQD 4L1DA 2E27L 1NLBH 3EO9H 4KUZL 1JRHL 2DYPA 3JWDL 4NWTH 1MFAL 4R4NC 4XC3H 1FNSL 5B39G 1Z6JT 1MAJA 2R2CA 3TIEA 3B8YA 3FB8A 3QJHB 1M6OA 2F74A 4FQXC 2FH6A 1NCWL 5F7YC 4L3EE 1F3DH 4HH8A 1CDHA 4Q9RH 5C09B 3VXRB 3CMGA 1QBML 4KTEL 5FGCE 1BQUA 5D7LA 4HCRA 4YJZL 5IV2A 1KYOK 3F58L 4OQTL 5I1EL 5C0EB 1X5IA 2DOCA 3L5HA 4KKLD 2FZ3B 4QT5A 1CL7H 2X2YA 2X40A 4XBEH 1H8NA 4MNHA 3QCUL 1ETZB 1FVCA 3OB8A 4Z0BL 3ZKMC 5J6GA 1PDKA 4U1LB 3LKRB 2OL3H 1ZMYA 4ZOBA 1AI1L 5IJKC 1TZGL 2GQHA 2O5ZL 4Y19D 4L8SA 3U0TA 4UV7H 1E6JL 5F7MC 2E6QA 5E08L 3ALPA 3GK8H 4ZAKA 1I1RA 3WNPA 4PV9A 1U92A 3EO0A 4KI5D 4PJ5B 1SEQH 3JSSA 4JE4B 5J11C 1BQHB 3T3MF 3U4AA 1KPRA 1MWAA 4HF5H 4P2OC 5AYQA 1Q9LA 3GKWL 3AB0C 4CNIB 5T3ZD 2VWEE 1T3FB 2AI0L 4WUUD 4PJFF 5EORL 1KOAA 3GIVB 1N4XH 3F7RA 5I2IA 4UQ3B 1ZEAH 2CIIB 3L3JA 1XCTA 2X89A 2J4WH 5I8OL 4K23H 2E7LC 1D3CA 2VDQH 4OLEA 3BUYA 3QHZH 1C12B 3QFJA 1YECL 4WUKH 1MFCH 3JTTA 2NY4D 1N8ZA 3NA4A 5JXAL 4HKBB 2GAZA 4J3VA 2CK2A 5GXBB 3BP7B 2ORBL 3ULUL 3VWKD 4WRLA 4B41A 4KVCH 1LD9B 3PG2A 2F53D 2ITDA 2HFFB 4LF3A 3TZVB 4H5SB 4HS3B 3B9EA 4LCYA 2E27H 4L8DB 4RZCA 3BP6A 4X5XB 3C6LC 1W72A 4KUZH 4Y4HC 1NMCB 1ZKAA 3JWDH 1VERA 1MFAH 1D9KB 5GZND 1DDHB 4LVNB 4ESKA 1FNSH 5CJXA 5CEZE 4V2CB 3MCLL 2DL9A 2JCCF 2DMKA 1MLBB 1NCWH 3DJ9A 4PREA 4X0KA 2H2PD 4ODVH 2K7QA 3QDGB 4Z7UB 3VFPB 1QBMH 4KTEH 4XXCC 3F58H 4OQTH 5I1EH 3RBGA 4OCMC 1QVOB 3FB6B 3Q0HA 1R24A 2EDOA 1BF2A 1DUZA 3UPRA 1RQ5A 1YYML 3QCUH 4Z0BH 3QZWA 3G5VB 3GJFB 1AGBA 3C09B 3RWDA 4KK8C 1OARL 3GSWB 3H8NA 3TN0C 5BOPA 1AI1H 1ZSDA 4MA3A 4WTZA 1TZGH 3VXUB 4P59L 2O5ZH 5EO9B 4PGZA 4P2RD 1G7LB 4UUJB 1FHGA 5EBWA 5E08H 2D2OA 3X3FL 1QEWA 3EJJX 4HW6A 4PJDF 4J4PC 1A6TA 4WI7A 5EIIB 5CGTA 4HMEA 3KWWB 4NP4H 5KSVB 5FCUL 3ZO0A 2DYPD 3VXMB 4HV8A 3RWFB 4FQPA 3GKWH 3UAJD 1QHOA 2Y06H 3NCYS 4TUOB 1IZJA 4KUCF 4PJHE 3U46A 2AI0H 5JOPD 4PP1C 5EORH 3RGVC 1H3PH 4JHWL 3VRIA 2A1WL 4QYOB 3WKML 4FFYL 2O26U 1GL4B 3QDJE 5I8OH 5D7LD 1F3RB 2VLMD 5FKAA 2JTDA 2NMSA 3NVQA 3KLHD 1YECH 3AM8A 3EHBC 2FX7H 5I73B 3OKMB 3T3PF 5JXAH 4A2MA 3EYFB 4BSJA 1BZQK 1ZT7B 3I3DA 5F3BB 4I18B 5GS0D 2ORBH 3ULUH 2X1OA 2SEBB 3BQUC 3BH9A 4YHYC 1ND0B 1I85C 3BMWA 2BNQE 1GAFL 4G8EB 3UTPD 5I1CL 1HHGA 1YJDC 3EZ8A 4V1DA 3MJ7A 2WUBL 2VAAA 4CMMB 4Z7OE 5SWZB 4LHQB 1BOGB 3FQWB 3W39A 4ZAKD 4R8WH 1NJ9B 3IXTB 3MCLH 1JFQL 1GCFA 1U8MB 1DBJL 4LVOC 3CFDB 5DMJB 4C56B 1YA5A 1T1YB 4R4FL 2IBGA 4Z7VE 4RSVA 3I02A 2EO1A 5EZLA 5LBSL 3ARDB 4Y16A 2H32B 5I9QC 4RFNB 2YPKB 2YN3A 4TVPE 3PWJB 2G5BB 2Y36L 1YYMH 1CTOA 1B4JL 2B1AH 1JYVA 4ORGA 2UUDK 3FN9A 2X89D 5LXGL 1OARH 4WDIA 3QFJD 5D72L 3GSOB 4PG9A 4YDKL 1FFPA 4U4BA 3K8KA 5LG1A 2XNAA 5L2JB 1FL5B 1QRKA 4PJ9B 4GS7B 2ARJQ 1U8HA 3S6CA 1TDQA 3X3FH 1EO5A 4H0HB 1QA9A 1CF8L 5I18L 5IP4A 3QULA 4DAGL 3WHE0 5FCUH 1UVQB 5F9AC 3RNQB 3O6ML 4MB4A 1RIUL 4D9LL 1P7KA 4HIHB 1Q0YL 2W0PA 4EUPG 3I6LD 1TTUA 2KH2B 4MA1C 2ITCB 2A1WH 2B5IC 1WZKA 3WKMH 4FFYH 5JORB 3PABB 2P8PA 3FAWA 3QQNA 4XHJC 1S5HA 2NY6C 5ANMA 4Z7WB 4YDJA 3MRRB 1F3JA 5CWSB 4Q9BA 2IF7A 1P69B 3CFBB 4G42A 3HZKA 5HI5C 3IAGC 1J10A 3V8OA 3BDBA 2XWTB 3BZEB 2F54A 3N50A 1LP9F 5KVEL 5EH1A 1G9MC 2ID5A 1GAFH 5I1CH 3WUWG 3CFKA 3LN5B 1G9NC 5HPMA 2YA1A 1R3IL 3KPOB 2WUBH 3QYCA 1A22B 2A6KB 3BRGC 2FRGP 3ZE0F 3DGCR 5DHVA 3UDWC 3UTTE 5IR1A 1DN0A 1JFQH 3D0VA 2PNDA 1DBJH 4FXKB 4B0MM 4AYFA 4R4FH 4PJEA 3GMRB 4K94C 4MSWA 1SBSL 2J1KA 3FQNA 4YE4L 1UXWB 1AHWA 1NFDE 1YEEL 4FQQB 1EA9C 5D5MA 4URTB 2QR0B 1BREA 1YPZB 1IGFL 2ZG1A 1B4JH 1EMTL 1NLDL 3CSGA 5LXGH 2EEAA 1S78C 3V7AE 5D72H 3QWOB 4X5WB 4YDKH 5J12B 4ZFGL 5IB1B 3M1BB 5D1QB 1JK8A 1CGWA 2JB6B 4JREC 1DVFC 3VH8B 3QAZC 5JW4M 5I18H 2R23B 1Q8MA 3O6FA 4XVTL 3GMMA 3QEQB 4V1DD 3V6FA 2WINA 4DAGH 4K9EL 3WUZA 3O6MH 1CGXA 4POZD 4OFDA 4YHPB 5I15L 1D5ZA 1RIUH 4LKXA 4D9LH 2EE9A 2Q3AA 4NKDA 5D6CA 4P99A 1Q0YH 4YBHA 3HR5A 4U1HB 2X44D 2PXYC 1J12A 2O61B 2XWJB 5C0BA 1E4JA 2EDKA 2J8OA 4Y16D 4WI3A 3K46A 4QF1B 2LAGB 4ONGL 4FQ1L 1S7SA 4NQCA 3S36L 4X6FA 3MRPA 1NSNL 3NGBC 2AXFB 2APBA 3T0EC 5CD5C 2WWMD 5KVEH 5FK9A 1IE5A 3GBML 5IT2L 32C2B 1JNHA 3KYOB 4K07A 2X10A 1EEZB 1R3IH 5DJAB 2XY1A 5C92A 3BN9D 3C6SA 3VFSB 4ODHL 1DQJB 3O9WC 4QCIB 5DI8A 3NN8B 4E0RA 1C7TA 4BKLB 3DXAA 2ZCHL 5I1KL 5CGYC 3OAUL 4APQC 1SBSH 2ADIB 2LV4A 5CD3A 5K93A 1YEEH 1F2QA 1JF1B 1JTOA 2OCFD 4QRRE 1A21A 4IBLT 1A6ZA 1MCJA 1WCBA 4LKCA 4KKBD 4XH2A 3SJVA 1IGFH 1KCVL 4Y8AA 5F1KC 1EMTH 1NLDH 4HWUA 3AS0A 3C5SB 1T0NA 2P1YA 1B6DA 3LS5L 2HN7A 1CQYA 3HZMA 5D7JC 3KNBA 5DJ8B 5MEQB 4ALAH 1FN4A 4ZFGH 2EDNA 1JNJA 4BFIA 4J1UB 4WGVB 4ZUUB 2AEQL 2F54D 2V6HA 3IDYB 3GBLA 3TBVB 2ZCKL 1KPUA 5KBNC 3WD5H 4JY4A 1I3GL 4L4VE 4EDWL 3MRHB 1V7NL 3D1MC 4OZGB 1XGYL 3NTCL 3IS0X 3V5DB 4L9DA 5BZWA 3TJHC 5I15H 4MA8H 4PG2A 4WFED 5E1AA 3UBXB 1OSZB 1PQZB 1U3JA 1W8NA 2R69H 4Y19B 2WIMA 1Y18B 4X7EC 4BSVA 4JO3H 4AG4L 3MLWL 4JGUA 4J3OC 3MGTB 3IS1X 4V2BA 2LTQB 2Q86B 4ONGH 4LLMB 3W9EA 4H25A 4FQ1H 4CKVX 5HHPA 3S36H 1L9NA 4Q6IC 3O8XA 3JWOL 3FT4B 1N5YL 4QRPE 1NSNH 1KGCE 1GOGA 3QIWC 3D3VD 4WUUB 1PX4A 4RWHA 1EJOL 3STBA 3FO1B 3GBMH 5IT2H 4MNQE 4WI5A 1NGXA 3FQXA 4NNXB 4L8BB 4XPTL 2EE6A 3AREA 1BZ7B 5DJ2A 1WIOA 3CIQA 4XAKE 2NY4B 4OZHA 2HTLC 1FAKT 3O6FD 4JZNB 4KKAC 2AXGB 3DX9A 2ZCHH 4L3CB 3GMOB 1FYTD 4IRJC 5I1KH 3OAUH 4P23A 3VWKB 5B8CC 3BI9X 2F53B 3F12A 3EFFA 5J7CC 3MRCA 4KRPC 3VE0B 1NGYA 3V7AG 3LKPB 5I8CA 1DQQA 2R0LL 2HH0L 1KCVH 4F8TA 5BO1L 4H8WL 3GMLB 1NFIB 3PJSA 1FE8L 3FAXA 5C0BD 5GSVA 2EDJA 3LS5H 2AV7B 4O02L 2OZ4L 3RUGB 2DQIH 3U0PB 4PGDB 5JZ7D 2GY7B 4IRSA 1RZ8A 4NQCD 5DRZB 2NNAA 5GGSA 4H88L 2FWOB 5BQ7B 5KSBE 3QJFB 1HHHB 3DTXA 4NKIL 2AEQH 4R3SB 1JPGB 3HAEA 3CFJB 4GBXA 5KSUA 2ZCKH 3IU3B 4D0BB 3AMLA 1M05A 1T04A 3EYOB 5FFLA 2OXGA 3P9MB 1I3GH 1S7RA 3BP5B 5JW4N 3ES6B 4EDWH 1V7NH 3DUSB 3QXTA 1XGYH 3NTCH 1Y6NR 2WZPD 3RWCB 5B4MC 5KS9B 2BCKA 1ZXQA 2UVFA 2IQAB 3AY4C 4P2RB 2ATPA 3DXAD 2IPKA 2DQEL 3KG5A 2HLAA 4GRWF 4AG4H 1CXHA 2LABA 3MLWH 5E00B 3RNKA 4UV4H 3SQBA 1H15A 4ZODA 3NFPA 4ONOA 5IMLA 5DRWA 3SJVD 4JANB 2DYPB 2R9HC 2VLRE 5EOCJ 4S10A 2DQHL 1KTRL 3L7EA 2IGFL 4HLZH 4IM8A 3IJYB 4JPKH 3TIEB 3FB8B 2DM7A 4LL9A 1M6OB 4OLVL 2F74B 4ZNEE 1U8IA 1EJOH 1BM3L 1OP3K 2COQA 1UWXK 4XPTH 4ENEC 5FA4A 3CLFL 5F93C 3OBAA 5D7LB 5IV2B 4OZFH 4Y5YC 1T5WA 4QT5B 3SGEI 1E0OB 1JWMA 4MNHB 1FVCB 1LE5A 5J6GB 2FX8L 4P3WA 1UWGL 1FGNH 3VXSE 4L8SB 3U0TB 1FC1A 4PJXA 5ALCL 1G1CA 2VLKE 1ULVA 2HH0H 1DQLL 5BO1H 2HP4A 4H8WH 3BPOB 4Y88A 4RGMB 1FE8H 5GRZA 3MBEC 1X4YA 4UDTA 5DMKA 4ZAKB 4O02H 4PV9B 3EO0B 1U92B 2OZ4H 1TETL 5C6WH 1ZVHA 1W0YT 1VADA 4D9QE 5F7KC 1QRNE 2EDDA 1KPRB 1B0RA 1YNLL 3L95A 1MWAB 1A64A 4H88H 1RUKL 1Q9LB 4NKIH 4QLRA 4IJ3B 4PJGF 1PJ9A 1LEIA 3UTSA 1IAKA 5KAQG 5JHLL 2BVUA 5I2IB 1H5BC 3G6JF 3L3JB 1XCTB 1EXUA 3ARED 5HPOA 3FB5A 2W38A 2Y25A 5HYFA 2NY3D 4LPWA 3GFUA 3BUYB 3QFJB 1AC0A 2GAZB 3VFGH 4YAQA 4LPUA 2DQEH 3IDMA 4F9LA 2W91A 5LKNA 4P23D 4F8QA 3E3QE 2GJZA 2P47B 4M02A 1E27A 3IJHA 2ITDB 4LF3B 1IZKA 4JM2C 2ZCLL 4LCYB 3B6SA 3CXHJ 4RZCB 3BP6B 3MO1A 5C0NC 1W72B 4DGVL 1CICC 5SV4A 2DQHH 3TFKC 3VXOA 1JVKA 2UWEE 2IGFH 3QH3A 5L0QB 2I9LA 4OLVH 4DKDC 2AAVA 3PWPE 1BM3H 4IRSD 4PREB 4X0KB 2NXYD 3CLFH 4HKZA 4JRYA 2G60L 2Z93A 3KPNA 1FNFA 4GBXD 2YXFA 4NQVA 3RA7L 2OTPA 2W60A 3UPRB 1R24B 1DUZB 2BVEA 2X42A 3DI3B 1FH5L 4UDUA 2ICEA 5GRVK 5CJ5A 2FX8H 3QZWB 2EZ0C 3RWDB 1UWGH 4C58B 3MREA 3HTLX 3MMEA 1ZSDB 5B39A 3QISA 4MA3B 4PBVC 1AKJA 1WICA 1HQRA 8CGTA 1YY9C 5DZNA 5ALCH 1GC1L 3BPLC 4YBLC 1DQLH 1VFBA 5EBWB 3QUYC 1QEWB 1A6TB 1NCCL 2ADJB 5GGVL 1TETH 4PLJD 1UH3A 5JOEA 5ACMA 1BWWA 7FABL 1YNLH 4HV8B 3O4OB 3HA0A 4GMTL 5F44A 1RUKH 4TTGA 3LKOA 4Z7NE 1A6PA 3MRNA 5DJCA 3J7HA 3U46B 3UC0H 2ENYA 5JHLH 3HB3C 1A3LL 3VRIB 4EI6A 1JV5A 1MCOL 3PUCA 2EICA 3JUYA 3T04D 1JL8A 4P9HL 4AH2A 5FKAB 1J0JA 2CK0L 1A9EA 3SGJC 1VFAA 2VLJA 1UWEL 2J2ZA 5E94A 4HULB 2HJFA 3BH9B 4U6YA 5B3JE 4NZUL 2ZCLH 1X4XA 1RVFL 2PR4L 1HHGB 4KZEL 1QTYT 2M26A 3MJ7B 4KJWC 4V1DB 4DGVH 2VAAB 3UZQA 2LFGA 2XN9A 3B9DA 3W39B 5HYIA 3EJZD 3H9SE 4PRDA 4M62L 4JFDE 5C0AE 4X9HA 5F70A 4OBRA 4GG6F 4HUWA 3TA3C 1OWRM 3QIUA 5MENE 1IC4L 1T1WA 3I02B 3SGEH 2G60H 5EZLB 3CDYA 4Y16B 4F15B 3UTSD 4ZTPH 2CQVA 1YQ2A 3HG1A 1UJTA 1FH5H 4J3SA 1Z9LA 3MCG1 4ORGB 3RIAK 3INUL 4W4OA 1CE6A 1EHNA 4NC1C 3W2DL 4WDIB 4X7CC 4PG9B 5DR5L 1WWAX 1FFPB 3OXRA 5AAWA 2XNAB 3BVNA 1GC1H 1BECA 3I6KA 4HFWA 4H1LH 4KAQL 1U8HB 4YBQD 4QRSA 1QA9B 4KK5D 3ULUC 2VYRE 1DFBL 3QULB 4GW1A 7FABH 2BFVL 3ESUF 4J2XA 4PJAE 3N9GL 4GMTH 2GCYA 4BH8A 5JXEC 3KYAA 1P7KB 1UCBL 4HLJA 1Q1JL 4G9FE 2AJYL 2VE6A 1A3LH 1T20A 4MJID 4P4RA 4ELKA 1MCOH 4LSQL 2P8PB 1S5HB 5ANMB 4JRYD 5FM4A 4P5KA 4P9HH 1RJZA 4YDJB 1U8NA 2X9XA 1XIWC 1F3JB 3RWEA 3I85A 3SCMC 3SDXA 2CK0H 2Q7NA 4G42B 1KTDA 3HZKB 3PGFL 1QFHA 3SKMB 3EOAA 1UWEH 4FQXA 5E4EC 2F54B 4P2QE 2JE8A 4JO2L 5GQBA 4ZFOL 1AKJD 4NZDA 4NZUH 1ZHBA 4WU7A 2PR4H 2D7OA 3CFKB 4KZEH 1M71A 5EUKA 1U42A 5HPMB 3FT2A 2AKRA 4NQSA 3REWA 1WZLA 5CINL 4Y8DC 5DHVB 5GJSL 2RAMA 4JG1L 5IR1B 1DN0B 4HS8H 4YHNA 3D0VB 2V5SA 5IJKA 1DBML 3CUPA 4PJEB 4XNZC 4MSWB 3OJMB 4I0PC 4EDXA 3FQNB 1IGML 1QFWI 4YPGA 1AHWB 5C9JA 1ZS8A 5D5MB 4NZRL 5F7UA 3DGGA 3HE6A 5HDBE 1F4YL 1PSKL 3WJLC 1F11A 4IOFC 5CJQL 4YK4B 4Z78A 3INUH 4CW1A 4P3DA 1FP5A 5D71H 3W2DH 5IBLD 4CN1A 4P2OA 2QBWA 3CH8A 3V5HA 5DR5H 4BYHA 1WVZA 3FHAA 4KDTC 2VLJD 5E2VL 2CKBL 3TBYA 1JK8B 5FYKD 3MLZL 4K3JL 4N0UE 3ZKSD 4KAQH 3BDXA 4TSBL 1GXEA 4XRCA 2J8UF 1DFBH 2RCSL 3EYVA 3O6FB 2E7LA 1JTTA 3GMMB 3V6FB 2BK8A 2WINB 2XIDA 4DGIL 1XGRA 5T5NF 2EDHA 3N9GH 1D5ZB 2LAAA 4JFHE 4LKXB 2XN9D 1UCBH 4NKDB 5D6CB 1Q1JH 3MV11 4MQTB 2AJYH 2XI9A 3HR5B 5DMGC 1EVUA 3TO4A 4LSQH 1Q38A 4KRLB 5HGAA 4LSSL 5C0BB 1SVZA 2V5YA 3C6LA 3OKNA 1VGEL 4I2XA 2FJHA 4Y4HA 4UQ2A 1I9EA 1J1PL 2DQCL 2OJEA 1KXTB 2D7MA 3HG1D 4ZUTA 1S7SB 4NQCB 3PGFH 3LDBC 4X6FB 3MRPB 1U8JA 1A14L 1KJ2L 4JO2H 2OM5A 1FNHA 3GI9H 4M1CC 4PJ8C 5D96C 5FK9B 1NCUA 5A2JH 4RAVA 1VPOL 4M9PA 1JNHB 4XXCA 2VMFA 1D5MA 3ZZ1A 2CR3A 3E8UH 4QXWA 2OLDA 3C6SB 4WIQA 5CINH 5GJSH 4W68A 4JG1H 5DDHA 2B7DT 2OR9L 4QTIL 5DI8B 1BFSA 4E0RB 4OLYL 3TN0A 1QFWL 3DXAB 1DBMH 1U6AL 5DQ9A 4EKXA 4LLDA 2WBJC 3SE8L 1IGMH 4JVWA 5CD3B 4OCYL 3SDCA 4X8JA 1EEYA 4WNQA 3RDTC 1PG7H 1NH6A 4NGHL 4NZRH 1PX3A 5DEGA 1A6ZB 1WCBB 4LKCB 4XH2B 3SJVB 1F4YH 1PSKH 3WUWA 2Z35A 1D5XA 2ZWLT 2CDGA 5F7EL 1T0NB 5CJQH 3BRFA 2R1YA 2HN7B 1UACL 2A77L 3HZMB 2NTSP 4R4ND 4EJ1C 4AQOA 3KNBB 3OAYH 1WBXA 5FYJL 1FN4B 4BFIB 5E2VH 2CKBH 5IW1A 5C0FA 3MLZH 1TITA 4FQXD 4K3JH 4ACPA 4NN6B 3RGVA 4IMLA 4TSBH 1J0HA 1S7QA 2MOVA 1KPUB 1MSPA 4JY4B 3PE9A 3O11A 2RCSH 2VZSA 4HGKC 5J1AA 4N5UA 4Z0XA 4DGIH 5BZWB 1M7XA 2YUXA 2ZG2A 5E1AB 4YGVA 1JZ5A 5BW7A 1CT8A 5E2UL 4JPVL 3WFEL 1MCLA 3WBDA 3BQUA 3ZHKA 4BSVB 1R0AL 4LSSH 1YEFL 1U9KA 4HPYL 5CUSL 1VGEH 4WI8A 1MCWM 1OF2A 4YFEA 2DQCH 2EXWD 4X9IA 2DTSA 3HE6D 2YA2A 3MLXL 3W9EB 3DROA 3FJTA 4H25B 1IVLA 5HHPB 4PJHA 4KXZI 1CFNA 3O8XB 3QXUA 4N9GA 5CZXC 3KXFA 1YZZA 1A14H 2FGZA 5E9DE 2GEEA 4P2OD 5F6IB 1FNEA 5B22A 3R8QA 1NGXB 1VEOA 1VPOH 3FQXB 3AREB 5DJ2B 2QQKL 3MZGB 2AXHA 1V8HA 2XG4A 4OCNC 4D8PA 4U6VH 2L7JA 4YIQA 5ICYA 3ILPA 3O45A 1I1YA 1ES0A 1KLFA 4OZHB 2OR9H 4QTIH 1N6VA 3U0WL 5LJYH 5D2LA 3WV0A 1JMZA 4WI6A 4OLYH 2IBZY 1QFWH 3DX9B 4JY6A 1U6AH 4P23B 3ZMRA 1NFKA 3SE8H 3F12B 4K9EC 4OCYH 3EFFB 1EGJL 3MRCB 1JZ7A 4G6FD 4XAWL 1NGYB 2WV3A 1JTPA 5I8CB 1DQQB 2FBOJ 4XCNA 2ADGA 3PJSB 5F7EH 3RVVC 5GSVB 3C6LD 3U9UA 1UACH 4Y4HD 5FYLH 3T4YA 1PAMA 3VFOA 1U8OA 4IRSB 1RZ8B 5FYJH 2NNAB 5GGSB 5TF1L 3DTXB 2YC1A 3L3HA 5IVXE 5SWQA 4JVPA 1LWRA 1PKQE 3BEVA 3HAEB 4GBXB 5KSUB 3QA3A 3TF7C 5LWYL 1M05B 1T04B 4HK0A 1S7RB 1WISA 2KQMA 5MERA 5HGDA 4OCXL 5DZOA 5JQ6H 2YPLE 2N4IA 1DCLA 2MSPA 3GI8L 2DKUA 3Q5YA 3GMNA 4PJFE 2BCKB 4WWID 4W70A 1MCWW 4LLVA 5DJZA 4KK8D 1ORSA 2FGWL 5E2UH 1OL0A 3QUMA 3TN0D 2ATPB 3WFEH 2IPKB 5FUCE 3E6HA 5EDXA 2DQGL 1RZGA 1GH7A 2HLAB 1R0AH 1J0KA 1KEML 4KJPC 4HPYH 5CUSH 1JGEA 3RNKB 3SDCD 5GRJL 1H15B 1DP0A 4RIRA 4ZPTA 4F33A 3MLXH 3NFPB 1CXLA 2DD8L 5IMLB 5DRWB 4J4PD 2EECA 3SHSA 3UDWA 3CFCL 3L7EB 4LARL 4HJJL 3CK0L 1CU4H 5H8DA 3WFZA 2V7NA 1U8IB 1H3XA 4Z7UF 2P24A 5DD6A 1IQDA 2BY3A 2O5YL 1KIQA 5I6XB 5FA4B 2D7QA 4X6DA 1XCQA 5GGQL 4PP1D 3RGVD 4S1RL 1QSED 4R26L 2ICWJ 2QSTA 3LKQA 1AY1L 4FFVC 1T5WB 1A7QL 1NCDL 4OLZL 3U0WH 2FB4L 4GFTB 1JWMB 3KYNA 1LE5B 4OF6A 3EHBD 3HN3A 1JHKL 3WMSA 4F58L 5EIVA 1YY8A 4CJ1A 1KSRA 5ECJE 4PJXB 4XAWH 4U6XA 4LCWE 3BQUD 3IF1A 3EYSL 1S9KC 1I7ZA 5TE7H 4Z9KB 3U4EA 3MJ8A 4AMKL 4UDTB 5DMKB 2QTEA 3BFOA 3WLWC 3QBTB 1VADB 2NY0D 2IBZX 3VI4F 2ZUXA 1URLA 1TJGL 1BVKA 1B0RB 1NFDA 3L95B 4PGCA 5TF1H 1IM9B 1FO0A 3KXFD 1LEIB 3UTSB 1IAKB 4HXAL 2PXYA 2YD3A 4HIIA 5LWYH 3JWOC 5ACLA 3HC0A 3BZFA