1FE8L

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
DIAMTQTTSSLSASLGQKVTISCRASQDIGNYLNWYQQKPDGTVRLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLESEDIATYFCQNGGTNPWTFGGGTKLEVKRADAAPTTSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2000-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L01
4P4KA 2HJLA 1CGSH 5EU7E 1MCSA 2AK1H 4UTBH 1H3TA 1X5XA 5HYQA 3WJJA 5DJYB 2AABL 1FIEA 2V2TB 1LK2A 2IANA 3HG1E 5GQBA 3ZKMC 2D9CA 3DIFB 4GRWE 4KJWD 5DD0H 5C8JB 4N8CL 4XNZB 3S3SA 3ZE0F 3KLDA 3VXOB 2QJDA 2JKXA 4G9FE 5CCKH 3DBXA 3KPSE 2UZXB 1G7LA 5FO7B 3KS0H 2BNRD 4ZPVA 5FA4B 3CDYA 3GJFB 4CVZA 4HH9A 1CGVA 4BQ8A 1G6RA 2AEWA 4J8RB 4KKCD 3HI6L 3TNMA 4NN6B 3BMVA 3LEYH 4P57B 5F44A 1MI5A 4NCC2 3CC5A 3OB0H 3H7BA 5I8KL 3KYMB 5F1KC 1E4WH 4MCYB 5C0CD 3IDIA 5C0GA 5CP7A 1VFOA 4W6YB 4D2NA 4PB0L 5HY9A 5JXAL 4X4MA 3CSYB 5BV7H 3RHWK 1AFVH 4DZBB 1S7TA 1OVZA 4OLZL 12E8H 1MFAH 4NJAL 1MCPH 2EDOA 2P47B 4LK4A 1AXTL 3TPKA 1I1AB 5GZNC 1NGZA 3SE8H 3HR5B 5C0RH 1R6VA 1MREL 4M7JH 5I71B 3VGEA 1B88A 3MLSH 4DN4H 2APTA 2DKMA 1YNTA 3HPLB 3SCMB 4JKKA 4HW6A 4NKIL 1FG9C 3C5ZD 4OKVA 3D9AH 1H3UA 1PY9A 2XZAH 4LKXB 4X6EB 1F4WL 2EIDA 4WEUD 3LQAC 2OSLB 2ZWLT 1AR1D 5E00A 4AIXA 1KJMB 3BZDA 1S5IL 4ODXB 1BQHB 3NAAH 4EKXA 3K1KC 3RWGB 1NDMB 2BVOA 2H2PD 1UJ3C 4M1GH 3O8XD 5DHXB 4S1DD 1H3XA 1P6AB 4KAQH 1BM3L 4U1JA 5FYKL 1GOHA 3IXAB 1CLZL 1BX2A 4UDUA 3C5SA 2F54A 1MLBA 4NBZB 3KG5A 4IS6B 2DLFH 4GUPA 4OFPA 3QDJE 4XT1C 4XP5L 1KBGH 2ENYA 2NW2B 3HZVA 1TQCC 3SY0A 3IDNB 4RNRB 1ETZB 4WI7A 2YRLA 3MUZ1 2YPLA 3ILPA 3GI8L 5HD8D 4QNPE 1U8OA 1WISA 3DYOA 4RWYH 4NNYA 3WJLC 4LCIH 3TIEA 4Y16B 5GRJL 3DV6A 3QWRD 3B2VL 3FRPG 5CUSH 3O11B 4LRIC 2HRPH 3S35X 4J1UA 5BS0E 4RMRA 1I1RA 3MACH 3B9KC 4CN6A 3B9EA 3RVWD 1FZKB 2XPGB 32C2A 3ARZA 1KPRA 3VFTB 4X9BA 5CEXA 4JRXA 1JZ3A 5KANG 2LAAA 1FIGH 5DMJB 1R5VA 1OTSC 2ZUVA 1FVDB 5AWNL 1U8IB 4GQPH 2X1OA 4YO0B 1OSZA 2ERJB 3M17A 1FP5A 2R4SL 2CDFB 5ALCL 3V5DA 5D8JL 4M5ZL 2DWDA 4DW2L 2XKNB 1RFDH 1MRFL 1YY8B 2VDRH 4KK6C 1RUAL 3TM6A 2I9TB 2CR3A 4R90H 1G7PA 3QUYA 1U6AL 4JY4A 2FHBA 2ZUYA 4FHBD 4WTXA 1YEIH 3QEUB 2LVEA 3D3VB 1K4DB 1C16A 4P5KA 3V6FB 3BUYB 3NCMA 4Y4FA 1UG9A 3QXTA 3QA3B 1C7TA 1KFAH 4NSKA 5D2NC 5AAWA 2EXWC 1CTOA 5KS9E 3WHE0 2J5LC 5ITFB 1X7QB 1QLRA 4MNQA 5DD1L 3S96B 5L8LB 2X7LA 3MFGB 3QFDA 4BZ1H 5T1DL 1UKQA 3NGBC 5CHNA 3O45B 4G3YH 1MRCL 4FTVA 2BRQA 4BFIA 3SDAD 3TZVB 3QH3B 4IMLB 2DYPB 3MBEA 1QRKA 4HS6A 2CMRH 4Y5VB 1MOEA 4M8VA 4S1RL 3R0MA 3GSNH 4JFXA 4X5XB 3SKUD 3GRWL 3QDHA 1D9KB 5HHOE 4AMKH 1VFBA 4P5MA 3ZKNC 4PJHA 1WTGT 2G2RA 4JLRA 4X9HA 2L7UA 2DQIL 1WWWX 2ICWB 1FQ9C 5F21B 5CGTA 4Z8FL 1IAKA 1ZVSA 4I5BA 2BSTA 1VGKB 3GHBH 2FJHB 6CGTA 4PJIA 3BO8B 2ZOLA 2NY2B 2WAHA 1FPTL 5GGVH 4PR5A 1YNKL 3TO4A 3MV8A 4K9EH 5EU4B 3X3FL 5FKPA 1P84J 2W0FA 5D5MF 3RL2B 2DQTH 3UP1A 3QZWB 4U1HB 4HKJB 5E6IA 4B7LA 3N1MC 1DBBH 3SJVE 3OPZH 1RZJL 4PB9L 3W0WA 3BQUC 3QO0A 3GMPB 5J1AB 4UINH 5JPMA 2H6PA 5EOCH 4HGWA 1KGCD 4L8BB 2O5ZL 3HNVH 5B39B 4F7EB 5A2LH 1D3CA 4NDMA 2Q87A 5DZLA 3SO3C 2WLYA 4S1QH 4X9FA 2FO4B 1G6RH 4GBXD 1YJDL 2Y23A 1P2CB 3UYOD 1YYLL 3VXSA 3S88H 4IHOA 3RWJB 4ETQA 1H3GA 3KPLA 1E6JL 1JF1B 3E2HB 2BHUA 1YMHB 3QXDB 2ADFL 3DPBA 4GJTB 1WTLA 1QFUL 4QOKA 1CXEA 2ESVD 2NY7H 4OUUA 1G7IA 3RVUD 2YD8A 4YBLC 4R0LA 4N68A 5E1AB 2XXCB 2XQBH 4GW5A 3VE0A 5GZOC 3FQNB 3UCRA 1XZ0B 5I6XB 3CZJA 2AJSH 3WKML 4MDIB 2X4PB 1MCKA 2A1WL 1RZFL 3V0VA 4OI9A 4H26B 4HMCA 3MJ6A 4JY5H 2OM5A 1LO2L 1KCUH 3AXLA 5DRXA 1UZ6F 1XGQB 3RZCA 1SEQL 4DUVA 4DJMA 3BEVB 2WV3A 4F8TA 1WVZA 3KPRA 4NN5B 2YOCA 4UUJB 3VI3E 4P2OA 5TQ0H 4NNXB 4H8WL 4HIJA 4K55A 5EWIL 2GI7A 4BH7A 1QSFB 1FL3A 1QR1B 1IE5A 3BH9B 1TTUA 3SOBL 4ZG1A 1N8ZB 1J5OL 4NO5B 1BGXH 5FM8A 1G0DA 2W0LA 4KDWA 3R06B 4PRAB 2PW2A 1MEXL 3RP1A 5DD5H 4OJFH 4YQXH 1K5NA 2MCPL 1DUYB 4JQXA 4OIAA 5EUOF 5KAQG 2H3NB 4ZUVA 4F7PB 4K7FB 2BNQD 4Q0XH 1M05A 1IEAB 2XWJA 3R1GH 3O2VH 1OTUD 1PW3A 3FO0H 1R24B 4H5SA 4EN3A 2VXQL 2RGSA 3CVIH 2R2HB 1W0WA 1R3KB 1EGJA 5IFHH 4KVCH 1GAFH 4KKAC 3CSGA 4TRPL 2V5RA 2JJSA 1DL7H 1CDYA 3GFUA 2GJ6B 1OT2A 1MF2H 4WENB 2NY0D 3PWVB 5JQ6L 1M7DA 1A6PA 1SJHA 3I75A 2BVEA 5EU6D 2IPTL 5C08D 2WBJA 4Q9CA 4QCIA 4RAVA 5DUPL 1NCNA 2CUIA 2CDGB 4G42B 4IDJL 4MJIA 5DVMA 1AC6A 4Z7UE 4OAWB 3RWDB 4POYA 2XWBB 5GRUL 3BPOC 4NRXB 1UM4H 1AH1A 3RBGA 3BW9B 4HZAA 5C07D 1G7HA 2NY5C 1SYVA 4GG6E 1EO7A 5ISZD 4U33A 5DJ0B 1JN6B 3V6OE 1VACA 4O00A 5KZCB 1L0QA 1AO7B 4JGUA 1JWSA 3WE6A 3UTSD 4L9LA 1W2KT 3SHSA 3FFDA 1B0RA 4DZ8A 4LNRB 3T04D 1PG7L 3QXVA 4WY7H 1A47A 4KRNA 1NAMA 3UMTA 2IBZX 1R3JA 1EO5A 3OJDB 2R2BA 2YSSB 1ZHBA 4LVEA 1GPOH 4AH2A 3VXUA 4Z0XA 1MAKA 2VIRB 1MCHA 2MFNA 5DJZB 3EJYC 4NQVB 2EKSB 5A3IC 4ZUTA 5FYKE 5JOPE 2AXHA 3GM8A 1JGDB 2F58L 4ERSL 1HKLL 4PJEB 3V6OC 3H3BC 3EFDH 3PGFH 4JKPL 3IETA 4HG4K 3OG6B 3QUZA 1QVOA 1C5BH 3ARDC 2O5XL 4LSRH 4O5LH 5DZOA 1ZHNA 3ZE0E 1IGMH 4ZXBB 2YK1H 2HH0H 3L3JB 4YIQB 4XP4L 2C1OA 2PO6D 1J05B 1Z9LA 3O6FC 2P5WE 1CDJA 1NDGA 1XGPB 2HT2D 5ILTH 1Q1JL 2B1AH 2XZCL 1PGRB 4XWOC 2QSQA 3FO1B 4NM4H 2JB6A 4G6AC 5DEFB 4GG8A 4PJAA 4X8JA 4PBXA 2PW1A 5CJQH 4PD4J 4QRPA 1T1YA 5AUMA 3VFGL 3ZL4L 4K94L 1T03L 1DBAH 2V9QA 2QSVA 3S36L 1QLFA 3IFOB 3MRHB 2Q8AH 1DQDL 2XFXA 3ARBA 5HHXL 3TN0B 3BJLA 2XNAA 3G04B 3STBA 4O58L 4QHMA 5SX5H 4CAGA 4RX4D 3LHPH 4NHCL 5FB8B 4WHTB 2WINB 3TESA 5EIVA 4GAYA 4U0RB 1FAIH 1BJMA 3SGJA 2H45A 4OZHB 4F15C 5I1AB 1EMTL 5I1DA 2HWZL 5J56B 3V6BR 3PNWA 3H0TB 1JV5B 4OD1L 3O4LB 5LCVH 3D0LB 4HV8A 2ICEA 5DC0A 3LKOB 2E9BA 4MXWL 4JM2D 5IROC 3KPOB 1LE9A 1QEWA 3EGSA 5L2KE 3FB6A 2R29L 5IW6B 1T22B 2GK0B 4RMVA 4XGZB 3UTPD 5C3LD 4U2ZA 2DQDL 1A7OL 3MREB 3ZT7A 2UZIH 1J8HD 5KN5B 3BKYL 3VFVA 4ZUSA 3MODL 1OOAA 5BXFB 4L3CA 3I2CH 1T2QL 5HYJE 5C0BD 3G5YA 5GGSB 1C5CH 5BW7C 2VH5H 3OTTA 3UBXA 3I02B 1S78D 3IS0X 4EVNB 1RY7B 3QEGL 1BWWA 1FO0B 5IESL 4Y5XC 2E6PA 4BSJA 1NFDB 2KDGA 1R3IL 3K0WA 1P53A 2IAMC 1I3RA 2NY6C 4UBDD 4LVOC 3VRLE 4L5FL 2FLBT 4XNXL 4X5WB 5ALBH 1D6EA 1FRGL 4XWGH 1UCTA 1S9YA 3DVNB 4HSQA 5JO5A 2GUOA 5I17A 1V3JA 3V5HB 2BY1A 3UYPA 1N2RB 3GHEL 2JB5H 1JGEB 1NKRA 3IAPA 3VXMB 1TQBC 2YBRA 3LS4H 3ZKSD 2XRAL 2AK4A 3WFHB 1NFIB 4XCNB 4Z7QF 4KKNA 5IMMA 5AYUH 3LAFA 3PWPD 4UOW1 2NY1B 1KN2H 1MNUH 4GKSB 1IC5H 3S3PA 2DQGL 5CLWA 2R56H 1EX0A 1N59B 4WTWA 4F7TA 4LIQE 2H26A 5CBEA 3Q6GH 3GKWH 4LAQH 4I0PD 4NBXB 5BRZD 3QCVL 2BRRL 4Q58C 3HC4H 1RV6X 3QT2A 5FUZH 1RZ7H 2R1YA 4D9RD 5SWQA 4Z7OE 1G0YR 1GHFH 5IMLA 3HS0A 3QYCA 5C0FA 5C0AA 3HC0A 4YXKH 5C09A 3T77B 2W07A 2ZPKL 4NQUA 1QSED 1T5XB 2ATPB 3ULUF 2F8VA 3FN3A 3CH8A 5T3ZD 3KYOB 5FK9B 3HNSL 2PTVA 4MJ6B 5F72S 4W4OA 1EGJH 3I6KA 1PG7X 4R3SA 2O61A 5GHWH 4MJ2A 1TVDA 5SWZB 1F4AA 1YQVL 5LGHH 4MAYB 2VXVH 1HNGA 2I07B 4O2FA 1H8NA 4KI1A 1D5XB 2VOTA 4PJ9A 1YJDC 2FBOJ 5F7YC 4ZDHA 1CFVL 5I1GL 3L3KB 2BOBA 3BZFB 4P46D 1AP2A 1U3HB 1Q9WB 1UYWH 3HE7B 1XEDA 3I85A 43CAA 4Y19A 4JFZH 4LSPH 2X5PA 4JFOB 3W5MA 4LGSB 1CICB 4OM1H 4WI4A 1T21B 4WO4D 4WFFE 4TVSa 1YEGL 5EO1A 3JZ7A 4XNMA 1B3JA 4I3SL 1XCTA 4P5TC 4UOJA 4QTHA 1LP9A 1FFOA 1CFQB 2H32H 1HXMA 1I8LC 3VFSA 4JZJC 2GTWA 1KULA 5D9SB 1FL6B 4KY1L 1DCLA 4S1SL 1IAMA 1O7VA 2XTJB 1XF1A 3S36X 1FDLL 3BHBB 5D5ME 4O4YL 4OFYA 4PLKC 1S5HA 1CD0A 4RIRA 4YDKL 3EJZC 3WIIL 4XP6H 1N6VA 2NQCA 2CIIA 3OXSA 5TDNA 1PQZB 2BVPA 3JWDL 4GAJL 1JTTA 1OPGL 5L2JA 1A7PH 2BSED 3OKNA 3SQBA 1YC8A 4XMLH 4PPTA 3MCKA 1I7RB 5JOEA 3FQXB 4M1DL 2F53D 1JGLH 1PAMA 2R9HC 1F4YL 3P9LB 2NTFA 3TYGH 2DD8L 3H9HB 1NEZA 3IFNL 3UPCA 4KK5C 1V7ML 4MQTB 3AREA 1KCKA 4NHUB 2VLJD 4FMKA 5DJCA 3T0BA 3MLTA 5EC1A 3CFJA 4C83A 1MJ7L 4CJ0A 1OCWL 3SKMA 3I6LE 3W82A 1KB5A 3D3VE 3L7FB 4JY6B 3WUWG 3VXRD 1Z9SA 4OD3H 1UXWA 1AE6L 3H3KA 5F7HA 1VPOH 3NZ8A 4BKLA 1VERA 4WJ5A 5E1HB 4U7MA 1BQLH 4PRPB 4RRPG 4J6RL 3ULSA 4BUHA 3FB7A 3GMLB 1YPZA 1G0XA 2OZ4L 1KLUA 4W6XB 3FQWA 4JR9L 2VLRD 1HWGB 1ZAGA 1UB6B 4Y5YB 3I6GA 1T20A 2ED9A 3O6ML 1D6VH 3UC0H 1BREA 3HRPA 1YNLL 5DEGA 3QIUB 3RGVC 1QUNA 3KNBA 3RX5A 4CUCA 1D5BA 5GSRA 1N7MH 2WIIB 3RFZC 1OP9A 3VD9A 1FO0L 4NGHL 1FVEB 5GXBB 2VAAA 3FOMB 1EFXA 2YS4A 1NCAH 1KIPB 3RUGF 5K9QI 3MGTB 1NCBH 4BFBD 1X4YA 5CJXA 4PGZA 4WWKD 5MI0C 2CPCA 1AQDB 3GMOA 1CI5A 2VZTA 3MRPA 4UNUA 1J0KA 3WEXA 5D2LF 3TCXA 3PABA 4NZTH 4Q74A 3GIVA 1RUML 1F6FB 4F7MA 1WWCA 3U0PA 1C5DB 2ZG3A 1X5AA 4P2QA 1T1XA 1OSPL 2Y06L 4R8WL 2W92A 4TYUA 1J11A 1CZ8H 1GC1L 3SGDI 5HHPA 3PHQB 5JW4N 3GZKA 4QXTA 4R96B 2AJXH 2IALA 3GNMH 4LHUA 1HSAB 1FG2B 3LVEA 5EO9A 5IB1A 4ONHB 2Z31D 4LEOA 5EO0A 2W9LA 3IGAA 1IC1A 2IFFH 4O02L 3SKJL 4L29A 3BZEB 4NUJA 5AG8A 3SDDC 4R4BB 3ZDZF 4TOYH 1O7SA 2BC4B 2NZIA 4K94C 3CPLA 2F19L 4O51B 1MHEA 2XN9B 2VITA 3TA3A 4N90E 3VXNA 1TNNA 4EBQL 3AAZA 3TBSB 5A16A 3BYYA 3MUY1 3KPMA 5IMOA 5FGBC 4E41B 2XT1B 1PSKH 1JPTH 3TF7C 3N9GL 3MV7B 2E7MA 3QDME 3BEWA 2ARJB 4L1DA 4UV4L 4C56B 3BPLC 1ZGLB 1FNSL 1NKOA 4DKEL 1DE4B 3BKJL 4YJZL 3EYQD 1T7ZA 2GJZA 1S7RA 5F1SA 4U7SA 4Y7MA 2J2ZA 5KW9H 2YXFA 5DD3L 4U1NB 2QSTA 2VDKL 2QR0A 3MCLL 3RNQA 3KAAA 1LEGB 4OQTA 2EYRB 3QNYB 2BCKA 2WK2A 4PJ7B 2J8UF 1Z3GL 1RZGB 1PBYA 3C6LC 3LN5B 2YC1A 2OR9L 5ENWA 4CMHC 2A9NH 1B90A 4XXDA 4J3OC 2YXMA 3VWJD 2PYFA 3OJ2C 2I5YH 2B7DT 4UT6L 3Q3GB 2ZNXA 2DOCA 5DR5H 5I6XC 5KSUA 4ZPTA 4R2GB 2QADD 1JNHB 1A6UL 5JDSB 5FOBA 3VFOA 4UAOC 4LSTH 3QQ3A 5INDA 5GRVL 3ZDXE 3MLRH 2DJ4A 2IG2L 1SM3L 4MCZB 1RUQL 2MNUA 3MXVH 4PS4H 3CZFA 4HZLA 5IFJA 1BZ7A 3M8OH 3T0ED 1EHXA 3CLFH 3OKKA 4X80H 4L3AA 3MJ9L 5DJ8B 2YEZB 3HG1A 1NC2D 4PJXB 2AQ2A 2FJFA 2XOTA 4N8PA 3DX8A 2P8MA 5C6WH 3ES6A 3W39A 5ACLA 1CDIA 3Q1SL 2NR6D 4K8RL 4G9FA 3P0GB 5J4MA 1MIML 2GJ6E 1II4E 1I9IH 3KPSA 1XIWB 3N85L 4AEIL 3LOWA 1NMBH 4TTGA 3MYJB 4JRYB 1R5IB 4YXHL 1FZOB 5IWLA 1MHHB 3DUSB 4TSAL 1KB9K 5TFSH 2F8XC 3PIQA 3CXHK 1EEZA 4NWUH 1OP5K 4X7SL 4EI5B 3QCTL 1JNLL 2VLMD 1T4KB 1BVLB 1CDUA 1IBGL 3X3GL 5LBSH 5LGJB 5D1ZD 1YN6B 5EC2B 3MRLB 1HHJA 3HAEA 1AO7E 1A1OA 3RL1B 1ZTXL 3SDXF 2R23B 5F8QC 1CD1A 4RCAA 4G6JH 2Z4QA 3T2QA 4TULL 3DX7B 5DRNA 2CSPA 4E42A 3DETC 3KWWA 3VH8G 4J3TA 1A14L 5GGUB 1MFCH 2A73A 1A7BA 1A2YA 3P4MA 1T04A 1YDPB 4PJ8D 3DUUB 2CRYA 4AM0B 4MMXC 4PJEE 2UY7A 3HPJB 4NQDD 5DGRA 5C0IA 2J3SA 1BVKB 4HBQA 4PJ7F 3BP4A 4JKLA 4K71B 3D69A 1V7NH 5EFIA 4PTUA 3ALXA 2IBZY 4BH8B 3OGOE 5L7XH 5IB3A 4OQ1A 5FUCC 4KMTL 4RZCA 2JK5B 3UYRL 4PV8B 1OP3H 3QWQB 4XZUB 1Y18A 1JPGB 3MRBB 3K2UL 1N5AA 2XG4A 3RI5K 2OTUA 4PTTB 5DI8B 4LRIA 1RVFH 4OCSL 3BT2H 5E2UH 5IBLC 1CU4L 1DUZB 5IEHB 2GK2A 4XVTL 3QFJD 5DYOA 5T3ZH 1VKXB 1DQTA 2X42A 1ONQA 1YN7A 3H2WA 2Q76A 4ONFL 3QQ4A 1I9RH 3QDJA 4U05A 3F12B 4ZFFB 1A3RL 5K33A 2PR4H 5IJVA 2LAGB 1RIVH 5F7MC 3MA7A 3REVB 3ULUE 3RVVC 1A7QL 3B6SB 1WWAX 1WZ1H 4H20L 4Y2DD 4D9QD 5BS0A 4KROB 4K3JL 1QQDB 1N5YL 1F45A 1KJ2A 3GMRA 2AJUH 5GS0C 1ZHKB 4OZHE 2HJKA 4ZFOA 1RULH 1IAOB 1FVCB 4ZS7L 2HLAB 3VRIB 2VISA 4WW1B 4WUUB 5TPWH 3JV6A 4FQLH 1JFQL 2EO9A 3BD5A 3EYSL 1UVQB 3IDJB 4YHYC 1IGJB 3EFFB 4DTGL 4N0YH 3H9SB 1F5WA 3MLVH 3R0NA 4TQEL 3RWHB 3U7YH 4LSQH 5E2JA 5MEQB 3MLUH 1EHAA 2NLJA 3ULUC 1MLCA 5CIPH 3S5LA 2JTDA 3NZHL 5IQ9A 4Y4HC 1YEHL 1D5MB 4XAKE 4ZSOB 4K3EH 3BJ91 4LLWA 3T4YA 5TE7L 2A74B 4DKFL 2ZOKB 1UH4A 3MJGX 4XVUC 5D7KE 4CNIB 5KS9A 3EO1A 4YPGB 1NFDE 4NO2A 1F3DJ 2APVA 4G43B 4MQ7A 3ZTJH 4JFEB 1PY4A 1JP5A 4PJDF 2YUZA 4JCLA 4ODUB 4XC3H 4HKBA 2G5BB 2JCCF 4GXUN 2XICA 5BVJB 3A6BH 3FT2B 1L4IA 3DURB 5HYFA 4RMUA 2R0LH 3SDYL 2DB8A 4R4NC 2BDNH 1DVFD 3MNZB 4U1IA 5C0JB 1MCJA 4FXLA 4JB9H 1MCLA 3VXME 4CADA 1JBJA 4APQA 3MJ7A 3A67H 3PDOA 2JJUA 1JF5A 1S9WB 2Y25A 4HEME 3TCLA 5JHDD 1JPFB 3AM8A 4EIGB 4I1NB 1MCOL 5HHOA 3UXFA 1CQYA 5IW1B 3TBTB 4LMQI 3V4PH 5I15H 3BQUA 2OJEA 4EOWL 2AXFB 3QPXH 3QG7L 1EERB 3G5ZA 2D4FA 1LILA 4OGXL 4ZS6C 4ZAKD 1PYWB 4YX2L 2UVEA 4TUOA 4HJ0C 5KSAA 1UWXH 4NQCD 2ITCA 5ICXB 4EI6B 4MAUH 5D96C 4OV5A 3CFKA 3KGRA 3PL6D 1AD9B 5C0DA 3NA4A 1A9BA 4JHAH 4POUB 4WDIB 5GRXG 1A8JH 1RIHH 3GUTB 5DD6B 4OB5H 3WFZA 4GRWH 4PRID 2NNAB 4XRCB 1RZ8B 4YHML 4MZ2A 2HA1A 3MV11 4IRJD 1WZMA 4O2EB 5SWZE 3VRJA 3EOTL 5FO9B 3FB5B 1A22B 3CLEH 4X6DB 1MCPL 2AJYL 4D94A 4KZDH 4HF5H 4M6NL 2NY4B 1UGNA 1OT1A 1HH9A 1ZT7A 4JQIH 2EC9T 2D7MA 1BD2D 3JWNC 4LCCC 3OKEB 1LHZA 3H9ZA 4K3GA 4QY8B 3EDKA 1WWBX 2VDNH 3LDBB 5J6HA 4DGVH 3WO3B 4NQTA 1CLOH 3RUGE 3MXWH 1X5IA 3K7UA 1ED3B 2Q3AA 5IQ7L 2ITDB 2X70B 3P77B 2NXZC 5CJOL 4TNWF 1TVBA 2NX5B 4B5EA 5JIHA 1RUPH 1JHKL 2EYTA 1HI6B 2HT3C 5AD0A 3KJ6L 2VE6B 5D7IF 5JW4Q 3EO0B 3NAAL 3K3QA 4PJ5B 1BJ1J 3V7AE 1F3DH 2LFGA 1EV2E 1AGFA 4Y1AD 2E3VA 1RAMA 2C9AA 1F90L 1IGFH 2C3VA 4XVJL 2W65B 4LQFH 4LCWD 4WI5A 3C08H 3L3OA 3JTTA 1AD0A 1R5WA 1AKJA 1SVCP 4U49A 3L3IB 4P9HC 3HC3H 2X4SA 2A0LC 2FB4L 1KBGL 3S9DB 1U92A 2CRMA 5E95B 3IAGC 1C12B 4M8QA 5F3HB 1ZK9A 4H88L 1JWUA 4HHAA 3RWFA 3ZDZE 4Z77A 4LCIL 2VDPL 1I7TB 4HXBH 4NC1E 3IJHA 4BSVA 3BAEL 4MD5B 2WANA 1S7SB 5EU3A 3BX7C 3ZDYF 3QHTC 3KXFB 3V4VL 1KIRB 2OCFD 3BZ4B 4LHQB 4JN2B 4PGCA 4LSUH 3JUYA 3GJEB 3LD8C 2DLIA 5HHVH 1Q94B 3WN5C 3O4OB 1H5BA 2HLFD 3Q0HA 1HYSD 3U6RB 3OF6A 5DK2A 3NCCB 4MX7A 3I3EA 2ED8A 4FXGB 1S9VA 2ZUXA 4WEBL 4HKZB 1SHMA 4PRPE 4NO0B 2WQRA 2E27H 2PCPA 3O3EA 3CNKA 3MA9H 4YR6B 1KJ2H 4OF6A 3CGTA 3C60A 2J8UE 3CFCH 4I0CC 5DQ9A 5C92A 2YPKA 4OCLC 1T0NA 4H0HB 5DZNA 5I74C 1OF2B 1NBVL 3NCYP 3QUZD 3BWAB 1QKZL 4MGXA 3ARRA 2V17L 3TWCL 1T6WA 1BQUA 3MROB 5LKNA 3RY5A 4GG6A 1CLCA 3O3AB 3VG9C 4D8PA 1MELA 5FM4A 4O9HH 1OARH 3V6OA 1U8NA 2FX9L 1HQRB 2I26N 5C86A 3QQ9C 4CMMB 3KYNB 5F88A 2DTMH 1NCUA 1U8LA 2RAMA 1DBKL 1W0YT 2EDFA 3ARDA 2EO1A 3AB0B 5GPRA 2IBBA 3MV9E 4WW2F 1R0AL 4HMEA 4I9WD 4JFDD 4UB0L 1LDPH 3QEHA 3S3JA 1MIEH 5AZ2H 5JPNB 2FRGP 5H35B 4TSBL 1XF2B 3WL9B 1IL1B 5IHZB 5E2WH 3D0VB 1Q0XH 3DV4B 5F9DC 4FZ8H 2PN5A 4U6TA 3C6SB 4W6WB 2YRZA 3WXVL 1D5ZA 4DQOH 4JREC 5ELIA 2EE9A 2QSCH 3FZUD 5IW3A 3MV01 3RJQB 4C59B 5I1EL 5C0CB 4G8IB 2E9JA 2P5ED 3ARFC 5FDWA 3QUXA 4FFYL 1DANU 4LMQE 1FLRH 1IILE 3MQIA 5E99H 1MVUB 2HMID 4JANB 4D0CB 4RAHA 3UJIL 2XA8H 4ODBD 2MWCA 2P5WA 1AJ7H 4YXLL 4JZOA 4MMZC 4PJFB 4PLNC 3ZYOA 1U8KB 2A6DB 5GS1B 4JGJA 1V8HA 4HCRL 3RX7A 4U1MA 2R0KH 3GSVB 4GS7B 3OQ3B 3OV6A 1E6OL 4GMSL 4HX1A 4XMPH 3U7WL 1HEZA 4LGRB 5D93C 3DVGB 2X4NB 1FBIH 2CUMA 2EDQA 2XN9E 4HWEH 2W0KA 1MQKH 3OAZH 3C5ZB 1ZHLB 2EDRA 5EOCL 4PG2A 1LEIB 4POZD 4XB8A 2WUCL 3W11D 4XHJC 3DSFH 1HHGA 1FV1A 4RAUB 5T1LB 3SDXE 3LS5L 4UDTB 5TE4H 3VFPB 1BBJB 1NUGA 4C56E 4TNWK 5CZXD 5HYSB 1INQB 4PP2B 1YEFH 3O8XB 4LSVL 2P8PB 4JAMB 1GOGA 2YUVA 3RU8L 2AJVH 1LQSR 1MFDH 5T33L 3BGAA 4NNPH 3S35H 4W68A 1ULVA 4HIIA 2XQBL 1QPXA 5KAQF 2IAMA 1ZVHA 1WJ3A 4FQ1H 4PJ7E 1C1EH 5IB4B 5L2KA 1F02I 2Y36L 4M61B 1K4CB 3EW3B 1F2QA 4IIQB 4ODVL 1DN0B 1KJ3L 4HULB 3S4SG 4JY5L 5D1XC 5D70L 2ZUWA 5FYJD 3HB3C 1KCUL 3MOQA 4MA8L 1YEEL 1A1MB 2L0DA 5HYJA 3E0GA 4FQ2H 4J4PC 4UIMB 3ULVD 1JHTB 3HZMA 3EHBC 4Z78A 5I9QC 2A6KA 5ESVB 3VGAC 1L9NA 2O26U 4XCCL 3DUHA 3W5NA 4KK9D 4LLMA 4X6BA 1JCKA 2LQRA 2OK0L 1KCLA 1JZ4A 3DARA 3RX8A 4A6YB 2CKBH 1U42A 3K81A 1S7UA 4QTIL 5HGGS 3OL2A 1WIOA 1BGXL 4OTXH 8CGTA 3NABL 1KXTB 3U4BH 3VDBA 1IVLA 3IU4L 3QNZB 1KTLB 5DJYA 4LQ1A 4N9OB 1Q9LB 2V2TA 1L7IL 4M9OA 4PJXE 3ESVF 3DIFA 4OD2B 3QP3A 4QWWD 5CP3H 5C8JA 1VHPA 1CQKA 4Q0XL 4LVHC 1J10A 2DMKA 3GB7B 4ZFZA 4PJHF 5JXED 3O2VL 5JZ7D 5KOMC 2X1WL 1NUDA 1RHFA 3FT3B 3P4NB 5LQBL 5FO7A 3VFRA 4C54A 4JRYE 4HIXL 5FA4A 5TF0A 4L4TB 5I16A 3U4AA 4FOMA 1TIUA 2FX7L 4N8CH 5J11B 4J8RA 3LKSB 4KVCL 1T3FB 5DA4A 4P57A 4Y4KD 1Z0NA 2OMNA 4U1GC 1VFMA 1WF5A 3SDAB 5SX4I 3RY6C 2V2XB 3KYMA 4GQ9L 2VLLA 2DYPD 3OSKA 1F4XL 3HI6H 3U9UB 2WBWB 1OD9A 3CSYA 3NH7L 5B38G 4OF8A 4DZBA 1BHGA 5I8KH 1OHQA 3TO2A 4JHZA 4KJQD 4TN9A 1TNMA 4LU5H 2D7OA 2V9RA 1MUJB 3EDFA 5FM5O 4U0QB 4LRNL 4XNYL 4EDWL 4PB0H 5BV7C 1I1AA 4PJDE 4HIHB 1FGVL 3VFNA 3HR5A 4OLZH 4XBPA 3HPLA 4TUJB 1QRNE 4XNQB 3SCMA 4NJAH 3CH1A 5JLZB 5F7DA 1GGBL 1HILB 4IOIB 3QIWC 1AXTH 3TVMC 1U2HA 4NT6B 2RIKA 1AGCB 4LKXA 3BGFB 3QI9D 5D1QB 1RUKL 5DURD 2I27N 2OSLA 1KJMA 3RQ3A 3FHAA 1FZJA 2JJWA 1BQHA 4JO1L 2A9ML 4NKIH 1GZPB 2OLDA 4OV6F 3RWGA 1OTTD 4C4KO 2P8LA 4NWTL 3BH8B 4MSWB 3FB8A 4LVNC 3PDGA 3IXAA 3EOAB 2PUQT 1F6AB 1ORQB 4G8FA 3T4AB 3IVKB 1S5IH 5EORH 4GBXB 1JZ7A 1UA6L 3WV0A 4IS6A 4YNYB 2BY2A 2NW2A 2PF6A 1J86A 3IDNA 1ETZA 3DXAD 1BM3H 3KDMA 4G9DB 4ODWA 4RNRA 2LTQB 5D5MA 5FYKH 5KSBB 5JUEL 1VESA 4R7NB 1CLZH 1UB5B 5DJDB 4GKZB 4BUGA 2ESVB 4J3UA 5AG9A 3WFDL 4BSWB 4Y16A 1FC1A 3WLBA 4Q2ZB 2VB5A 2CRZA 2EECA 4KC3B 3O11A 4MHHG 4XP5H 5DO2C 4KUZL 2EE3A 5SWSE 3EBAA 1FZKA 4N8VA 3GI8H 5FKAB 5FYKU 2PYEE 3RWEB 3VFTA 3LHPL 1IQDB 1EAJA 4HEPG 4WUUE 5GRJH 3C8HA 3B2VH 1U8IA 3IDXL 1IFHL 4YO0A 3TBWB 4F33B 2AJZB 3OAUL 3H9SE 3LN4B 3OKDB 4JFFD 4PY7A 2CDFA 3GSXB 4I13B 2NW3B 5DMGC 1N0XH 3G6JF 3PP4L 2XKNA 1NH6A 5MEOB 5LCVL 2I9TA 5AWNH 3MRIB 1QSFD 4OF3A 3D3VA 1K4DA 4ZSOE 5KVMC 2R4SH 1RJYA 3V6FA 5ALCH 4DGIH 2W9DL 5D8JH 4M5ZH 1BJ8A 4Z7NF 4DW2H 3QA3A 3WNMA 4NQEB 3HMWL 2VR5A 1MRFH 1OWWA 5TH2B 1RUAH 2AAVA 3VW3L 2X89D 4NKDA 1KIQA 3I2CL 4M93C 3CX2A 1AXSB 4LPXA 5ITFA 4ESKA 4JFEE 4LOUC 3S96A 2BNQB 1J0ZA 5ECJE 1JUFA 3HZKA 1K3ZA 4EIZC 5DJ6B 4B0MM 2DL9A 2PXYD 5D4QA 3TZVA 3DI3B 3WUWB 2QQKL 4KRLB 3QH3A 4IMLA 3ZYJA 3PGDB 2V6HA 5DD1H 5F7NC 4XWGL 4GXUM 5CLTA 3PWUB 4QRTB 5T1DH 3GSOB 4X5XA 1QYGH 1MRCH 4X4XB 1D9KA 5L0QC 5KVGL 1FN4B 4A6YL 5IEKA 4D0DB 2ENSA 5EU6B 3QHZL 5C08B 3OG4B 5IHBA 5DFTA 1JNNL 2YD3A 3ZDYE 4LP4A 3EZJB 4JKMA 5F1NB 4M00A 4S1RH 5SX5K 4KKBD 4FQQB 5AYUL 1VGKA 2FJHA 3GRWH 1KN2L 1TZGL 2HVKB 1MNUL 4RA3A 5DSCA 5C07B 1CFTA 2YN3A 3F58L 5D7JD 2DQIH 4HG4J 4GW4A 1T80A 5C9KA 3P9WB 4Z8FH 3UTSB 1NGWB 3ARGD 5IHUL 5KSBF 3RL2A 3GKWL 4LAQL 3QZWA 4U1HA 3OHXB 3JVGC 5GS2D 2M8XA 4UZGA 1RZ7L 4V1DB 4Y0GA 4P4KC 1FPTH 2HTKD 4K9EC 1YNKH 2ATKB 4YDVB 5J1AA 1GVIA 3PJSA 3X3FH 3EO9L 1IM3B 1GRWA 4YGAB 4PJAF 5BMFL 4Z0BL 4L8BA 2FL5B 5B39A 3RDTD 4F7EA 3MLWL 1A6TA 3SDCD 2CJUL 5HI4C 1RZJH 4PB9H 3UTZB 2NXYC 2I24N 3GJFH 4JFQB 2FO4A 1P2CA 5BO1H 5ADPL 1KNOB 5LGHL 1MJJA 1W72B 1JF1A 5DRZB 3C6LA 1YMHA 4NP4L 5ANME 3QXDA 1BIIB 3QDMA 1T2JA 1CCZA 2VL5B 4H1LB 1A6VL 4YDIH 5E1AA 4NZJA 1BWMA 3FQNA 2NX5E 1XZ0A 1MFEH 3I50L 4MDIA 2X4PA 2ADFH 2YKLL 4LSPL 3QJHB 1I1FB 2FBJH 1QFUH 4PJ5E 1XGQA 3B4NA 3L5WB 3NFSL 4RFOL 1X5KA 4OZGB 1XGTB 2ICES 3MBXH 1OAYL 1JTOA 3WKMH 3PHOB 4WW2C 1QLEH 2A1WH 1RZFH 2X4TB 1JGVL 5JHLL 3B9VA 5DJXA 4PGBB 1TDQA 1K9TA 4FXKB 1S7XB 2JIXB 1SEQH 4A2MA 1QR1A 3BH9A 3BOVA 4E0RB 5L88L 1N8ZA 3QJFA 4GAFB 5FIEA 3UJJL 1JGUL 1OAKL 1TVHB 4XX1G 3INUL 4PRAA 4UV7L 1H8OA 3O4LD 4XP6L 4H8WH 2ICWJ 5EWIH 2DF3A 3QG6A 5GZND 3UO1L 1QO3B 2WW8A 3K4DA 5DK0A 4U1SB 4JM2B 1I7UB 1UJTA 2VWEE 3HMXH 3SOBH 5DGQA 1LGVA 1J5OH 2H3NA 2KZ1B 1LO0L 4F7PA 3T8XB 1A7PL 3KXFE 2C5DC 5KBNC 5D71L 1TPXB 2J12B 2NY3C 1IEAA 3PGCA 1J8HB 2RBLA 1MEXH 2WBKA 3B9DA 1R24A 2OI9B 1N4XL 4WFGE 3RVXC 2IADB 2MCPH 4RMSA 2R2HA 5I1IL 5ESAB 1R3KA 3KPPB 3WIHH 1FSKB 1UXSB 3C9NB 3BPNC 2GJ6A 2ZUQB 3PWVA 1JIBA 3QEQE 1CFBA 1CIDA 2VWEC 2VXQH 3LKNA 3QXUA 1P9MC 4KZEL 3TGXA 5DRWB 2CDGA 3KLHD 4G42A 3IRPX 3MYZA 4OAWA 4TRPH 4GRLC 4NRXA 5J7CC 1EHLL 5K93A 2Z93B 3QIBD 1XFPA 2IPTH 1F3JB 4R97B 5DUPH 4Y2OA 5C1MB 2I9LB 2LU4A 2J6EL 3HCVB 5DJ0A 3QPQC 1JN6A 1VEMA 4IDJH 3E6HB 3V5KB 1FZMB 5DMKB 1AO7A 1WC7B 3MRNB 3BP6A 3UC0L 5GRUH 3PWPB 2X4QB 1HN1A 3VDAA 3MO1B 4LNRA 2BXYA 1T0MB 3B9KD 2BNRE 2P24B 3OJDA 4BFEA 4EUPG 5MEND 3F7VB 3RKDC 2VIRA 3GSRB 5DJZA 1OTSD 4NQVA 2EKSA 3QUYC 1RK1B 4I0PB 5BRZB 4UIKH 2YA1A 3D1MC 5CBAA 3NFNB 2AV7B 1NCAL 2AI0H 1JGDA 4K23L 5E8PA 4ETYA 4LFHG 1XH3A 1G7MB 4KJWC 4PJEA 3PUCA 1SEBB 5DHYA 5C0CE 1MJUL 4JO2L 3NN8B 5T1KD 2M26A 5IR1B 4KK6D 4RMTA 4OCRL 4ZXBA 5C6TL 1A02N 4I18B 4R7DB 4NZTL 3L3JA 4HBCL 1QSEB 4YIQA 1TJHH 2F58H 1OLZA 1HKLH 5HGAB 1J05A 5LAXB 1XGPA 4PJFE 4JKPH 3VH8B 2VL4A 5I73B 1ITBB 2O5XH 2EXWD 2Y6SD 3MJ8B 2ZCHL 5DEFA 1KELL 4HUWB 1ZE3C 3IKKA 3O9WD 4XP4H 4FQJL 3F5WB 3UPRA 1Q1JH 3OWEA 4KDTC 2XZCH 1ZGLM 2EDWA 4WI2A 2JJTC 4LLYA 5K9OB 3MRHA 4LLQB 4GMTL 2QQLL 3TN0A 1T1ZB 1U3HD 3G04A 2HTLC 4L3ED 3ZL4H 1T03H 5FHAL 5FB8A 2BVUA 5E8EB 4WHTA 4ZOAA 2Z8RA 3S36H 3ROOB 4PRDA 4OCMC 2BY3A 4WO4B 1TETL 1CG9B 1DQDH 2VLKD 5HHXH 4Y4HA 4OZHA 4LP5A 3ZKND 5I1AA 1PSKL 43C9B 4O58H 3TO4C 4NHCH 1CGXA 4XNUL 5CIPB 1JV5A 3LKOA 2XTJD 3KPOA 1W72L 3QUKB 2OZ4A 3P4OB 1AR1C 5IW6A 5KW9L 2GK0A 1UKSA 1EMTH 3GSWB 4XGZA 1F42A 5A40E 2HWZH 1CDHA 2YMXH 4U31A 3MREA 4FQXB 3REWA 15C8L 5KN5A 4OD1H 3TBYA 3F8UB 3KPQB 3BP7A 5BXFA 4S1DC 5GGSA 1RHHB 1TFHA 1TTFA 4KDVA 5CILL 2R29H 3SE9H 4K07A 2B5IC 3OR6B 4HUUB 1AXIB 3RZWA 4H25A 2DQDH 1A7OH 1YQ2A 5FYLL 1NFDA 3BKYH 3OKMB 3MODH 1T2QH 2F53B 3K8KA 4LLVB 3HE6B 4V2CB 2GKIA 1UH3A 2PNDA 4X5WA 1MWAB 4OFKA 5HD8C 1NC4A 5CKGA 3B9AA 4JFHD 4NUGL 2N4IA 3VWKB 3QEGH 3S7GA 1PKQE 5IESH 4R0LC 5F7KC 1R3IH 1BIHA 1XR8B 3EIFA 4L1HA 1N2RA 3IFPB 2IPUG 3AUVA 1JGEA 4L5FH 3VXRB 4XNXH 3VXMA 3L5XL 3IJYB 3CFBA 3M8OL 2VXTL 1FRGH 4XI5C 1QTYT 1QHOA 4X0KB 3CUPB 5FGRA 3WFHA 1NFIA 3AMLA 4X80L 3N50A 2AEPL 3VGGA 5GZOD 4KGLA 1RZKL 4GKSA 3U79A 3GHEH 3FQRB 1N59A 2G60H 4JJHA 4OZFG 2VLRB 1RK0B 1WBZB 2XRAH 3QDGD 3MRQA 4RGMB 1MCWW 3V52H 2V7NA 3G6JE 1NMBL 2BJML 4UTAH 1X3DA 3TBVB 2J88L 4XP9H 3QULB 1AIFA 1IC7H 1A9EA 2DQGH 4RFEB 5TFSL 3V8OA 1WICA 1CL7L 5IGXL 1H9VA 1FLTX 3GBLA 3NCJL 3QCVH 2BRRH 4NO3A 5JORA 1FNEA 1T5XA 2X41A 4KI5D 3KYOA 5FK9A 1M7XA 2ZSVA 3L6FB 5HPOA 2YPVL 4MJ6A 1ADQA 5CZVH 3OZ9L 2CK0L 4WWKB 5HI5D 2R8SH 5SWZA 5F9OL 3V95A 2ZPKH 2UYLB 4MAYA 1KV3A 5CZKA 3SDAC 4EN3C 3E6FB 1Y0LB 2UWEF 2I07A 2EH7L 3HNSH 1P4BL 4OZFH 1BECA 3BD3A 2DBLL 5CMAB 3L3KA 1TJGL 1YQVH 1MFCL 4OIIH 1Q9WA 2KH2B 4KHXH 3HE7A 2WBJC 2QBWA 5FO8B 3RUGA 1CICA 2H1PL 3C8KB 3WFBL 3QB7C 2Z31B 1T21A 4KKAD 1CFVH 5I1GH 4CU8A 3FAWA 2C4XA 4X99B 1KGCE 2VRAA 3BI9X 5GS2H 3HTLX 3DMMD 5C2UB 3VMNA 5D2LA 1B4JL 1CFQA 1NFKA 1VENA 3T3ME 2ADJA 5D6DC 5EZJA 4L9LC 1RVFL 1WT5C 3ZLQC 5KSBE 2A77L 3FTGB 3ZHDA 4E41D 3V0AC 5T3ZL 1HQ4B 3IDMB 3MV7D 2V2WB 2ESVE 2Y5TB 3MRKB 5TDPB 4KY1H 2EEAA 3O0RL 2FEDC 1PQZA 1OGTB 3WN5A 2P1YA 1KLGB 2D31A 4O4YH 4OF7A 2PR4L 4HWNA 2HJLB 3ALWA 4K3HA 1NANI 1WZKA 2FDBP 4YDKH 4PY8I 4GBXC 4QRRD 1E4XL 3MLYL 3MRGB 1JF6A 1I7RA 5IV2B 3QO1B 3EJYD 1CL7I 3JWDH 4G6KL 4GAJH 3P9LA 5KVFL 4LCUB 1OPGH 3SGDH 3H9HA 2HFFB 4YDLC 3VWJB 3HAEG 4M1DH 5E70A 1X5FA 4HLZG 1JRHL 1BFTA 3L7FA 1F4YH 4ZO8A 2YD2A 2DD8H 2QADB 3U7YL 1J1OL 4X6FA 4ZPVB 5L8KB 2R1WB 1EEYB 3IFNH 3WO4C 2C4FU 4CVZB 4QO1A 2Z92B 3O6FD 1XR9B 2ZCLH 4RDQF 1V7MH 4MA7L 4PRPA 4XWOD 2N7BA 4P9ML 1MJ7H 1OCWH 5HDBE 4G6AD 3GMLA 2IJ0C 3VMPA 5JOFB 3H7BB 1KB9J 3LEXB 4PYGA 1UZ8B 2J8UA 4N5UA 2BNQE 4PLJC 1AE6H 1M7IB 3MGOB 1OP3K 4AENA 4OLWL 4PJCB 1DQLL 3QAZC 4J6RH 2W59A 1IZKA 3QIUA 1NC2B 1S7TB 4QGTA 4K7PL 2OZ4H 3JTSB 5FHBL 2AQ1A 2ZCKL 4RSVA 4J7RA 3VA6A 1HDMA 5F71A 3O6MH 3MV9A 3VD7A 2R0LL 1NGZB 1YNLH 4F2MB 3FOMA 5IMKB 4HLZH 2BDNL 1KIPA 4PUBH 1KPUA 4HXAL 5EU6E 5E5MB 1AC0A 5C08E 5ICYA 4OZIB 4JB9L 1YNTB 1Z6JT 1HIML 1MWAL 4P23D 1Q8MA 3A67L 3FONA 1AQDA 1FO0H 1LNUB 4NGHH 2VSCA 1E28B 2O5YL 3RWCB 5IBTL 5C07E 4AY0A 5E00B 3TH4T 5ISZE 1C5DA 2BERA 2DQEL 2IQ9L 4JPVL 3PHQA 3UTSE 4ODTH 1L9MA 4R96A 3FL7A 2NY0C 2H9GB 4P59L 3BKCL 5F9WC 4U1JB 1FGNL 4WFED 1LMKA 2FGWL 1HSAA 1FG2A 1CXKA 4MAUL 3C5SB 1OSPH 2Y06H 3ECBB 1GC1H 3BZEA 4GUPB 1A0QL 4R4BA 4GOSA 4PJ8B 2QKIB 2NY6D 3SY0B 4OB5L 4FFVD 4O51A 2XN9A 4NQDB 3AVEA 1CE6B 5B21A 1JRHI 2DLHA 3TIEB 4F3FA 3MTRA 4QLRA 4O02H 3SKJH 1JI1A 2E6QA 1F6LL 1KC5L 1WEJH 3CLEL 3S97C 3SDXA 32C2B 3VCLB 4KZDL 3K4AA 2ARJA 2DLGA 2I60H 4JRXB 4C56A 4HF5L 1ZGLA 1R5VB 5D7SL 2KUTA 4J4PA 4ELMF 2H41A 2XACC 3A6CL 5CSBA 1OSZB 3VFMB 3M17B 4XH2B 1JPSL 1EIBA 4U1NA 1YEKL 3NFPB 2DWDB 4UV4H 1LEGA 2OBGA 1FNSH 4DKEH 4PJ7A 5F93C 3T0VA 4OZGE 3LN5A 4YHIA 1KJVA 1ITCA 3H7LA 3PWNA 2PO6C 3PWLB 1YYML 5DD3H 2HT2C 2VDKH 3MCLH 5KVDL 3D39D 2CLZB 5TGBA 5T5FH 5IBUG 1SJEA 3EOYG 1Z3GH 2N56A 4V2BA 3C08L 1S8DA 1QLRB 2OR9H 1JNHA 2YHGA 2Z9TA 5JDSA 4MNQB 5F3BB 1KT2B 3DX9B 5KS9F 2X7LB 1H3PL 2Y9RT 5H37H 1YMMD 5CHNB 5AZEL 5D6CB 2FZ3B 4XMKL 4OZIF 4BFIB 4UT6H 5IVXB 4DOHB 4YE4L 4YC2B 4PV9B 2MKLC 3MBEB 3UTPE 1AY1L 4C4KT 5GGQL 4OLEA 3ZYIA 1J8HE 3RNKB 2Q7NA 1PX4A 1SM3H 2YEZA 3X12A 4PJXA 5C0BE 5IVOA 5BZDB 4JLRB 1GGIH 4Z6AT 1SMOA 2FHCA 3SKOB 2DMBA 2EDBA 2BSSB 5M7QA 5J1SC 1XIWA 3MJ9H 5I75C 2PETA 3MYJA 2EDHA 4YEEA 2DWEA 4JRYA 1FNFA 4ELKB 1FZOA 1X5YA 4ZYKB 4P5TD 4YAQB 2FSEB 1MFNA 1M6OB 3PV7A 2VNCA 5F89B 2P48B 3Q1SH 4EI5A 1FCCA 1I4FA 4K8RH 4HJJL 3DVFA 4AEIH 3N85H 3LKPA 1DVFB 1BVLA 2BSRB 4WHDA 5E6IB 1G9ML 4PLKD 4YXHH 1BFOB 5LGJA 1UM5L 4TSAH 2B4CL 5E8OB 4Y88A 2GT9B 1YN6A 4WU7B 2ZKHL 3MRLA 3QO0B 4X7SH 4K7PX 3TVMA 5JHDB 1OGAD 1JNLH 4AK1A 2ZUQC 3PWPE 2R23A 4MJ5B 4U6XB 3EYVB 4NDMB 1IBGH 3VFWB 3X3GH 4TVPD 1ZSDA 1RJLA 4HK0A 4PJDA 5GGUA 3VXSB 3WXWH 1B9ZA 4ZAKB 4ETQB 5BRZE 3MR9A 1UCBL 1YDPA 1LDPL 4JG0L 4L8SB 5EU5B 1T7XA 2R9HD 2XIDA 3DUUA 5LVEA 4NQCB 1QRNA 4R97C 4AM0A 4WV1B 3EYFB 3HPJA 4TULH 1P7HL 4QOKB 1BVKA 3SE3A 4KK5D 2DLEA 1A14H 4LASL 1Q0XL 5T3XD 3VE0B 5HJ3A 2J8OA 4FZ8L 4WHCA 1KPVA 2JK5A 3RHWF 4PV8A 4JM4L 3U46A 1QSEE 4IOFD 3G6AA 5T3ZE 4PRIB 3UAJD 1EAPA 1OLLA 3VD4A 4XZUA 1KYOK 3OJMB 4MVBD 5DRXB 1FLRL 4PTTA 5DI8A 4KMLB 4KMTH 4N5EC 3C87A 1DUZA 1EFQA 5IEHA 3H42L 2K7PA 1FJ1A 1AJ7L 2AW2A 1FH5L 4XP1L 4P2OB 2BVTA 5IVXF 3K2UH 4U6VL 3RPIB 3K1DA 4KTYA 4ZO7A 2R0KL 4DAGL 4WI3A 4RBPH 3F12A 4OCSH 4BH7B 1BD2B 4ZFFA 2Q86B 1CU4H 3RGVD 3K8LA 4QF1A 2VZ3A 4HWEL 4MNHA 3REVA 4CRPA 1K2DA 3B6SA 1AHWC 4G8GD 1TCRA 2Y5EA 1IAIL 4L8DB 1BZ9A 3N1QC 4OLUL 4WNQB 5FXCH 5SWSA 3DSFL 2YUXA 1A3RH 1IGTA 1IAOA 1QBLL 2PYEA 1FVCA 3TPUB 5HVFB 2HLAA 3VRIA 5TE4L 5EN2B 2UWEE 4WW1A 1T0PB 4WU5B 4WUUA 1A7QH 1Z0MA 3GSUB 4H20H 1YEFL 4X9IA 4Y1AB 3IDJA 1UVQA 4K3JH 4P46C 4H5SB 1N5YH 4FQHA 3H9SA 2AJVL 1UM6L 1Z9MA 1Y6NR 5MEQA 1TTGA 1NAKH 4XPBL 1W0WB 4ZS7H 1ZXQA 2MMXA 4BFGA 1R3HA 5FA3A 1XMWA 4WO4C 5DT1L 3OMZA 1JFQH 1CGUA 2VABB 2DM2A 3EYSH 1D5MA 1QD0A 1SJHB 3NPSB 4ZSOA 3LKQA 5LXGL 4QCIB 2A74A 3TA3C 2GSGB 4MJIB 4CNIA 4YPGA 4YHNB 5DFVD 3SDDD 2F53E 1IEHA 2BFVH 4JFEA 1YEHH 2MJWA 4Z7UF 1G7HB 5I76A 4HD9A 3UX9B 5TE7H 1P5VA 1EEQA 3WBDA 4DKFH 5BVJA 3FT2A 3WE6B 2VLJE 3VFUA 5DLML 4ENED 3MNZA 1K8IA 5C0JA 3VXRE 2C1PB 1NAMB 2DKUA 2YN5A 1X5GA 3U4BL 4UNVA 1ZHBB 1S9WA 1QA9A 1JPFA 1ZT1A 4Z0XB 3NIDF 1BEYH 1HCFX 1NQBA 2DQFB 3JVGA 3OAZK 3U2SA 3SDYH 4QRQB 4ZUTB 4M6ML 5IW1A 3TBTA 5JW3L 5BVPL 4YDJA 4HLJA 2EDEA 2AXFA 2P44B 5FCUL 1J1PL 2VLRE 1CR9L 3OAYK 1WUNT 3QUZB 1IM9A 1QVOB 5TQ2L 1PYWA 4JFYB 1MCOH 1J9CT 3FCTA 3I9GL 4M6AA 5J9PA 4HWBH 4EOWH 2C1OB 1B0GB 3MOBH 3QG7H 1NDGB 4LDLB 5B4MD 1AGDA 1AD9A 4I2XB 2FD6L 4OGXH 4P2CG 4WDIA 4HMDA 4KH2A 2JB6B 4QRUA 4JFDB 1FORL 4YX2H 5DD6A 3AFLA 1NGYB 2PW1B 5EU7C 5GIRB 1T1YB 5AUMB 1DQQA 5SV3A 4XRCA 1RZ8A 1BMGA 1HWHB 1QLFB 3ARWA 3U36A 4O2EA 2EYSB 3CIQA 5FO9A 3FB5A 3VJ6B 2C3XA 4LU5L 5E5RB 1JYVA 4R9HA 2P5EB 2GYSA 4YHMH 4DVRL 1UKTA 4GAYB 3JV0A 1J1XL 2AV1B 4L4VD 5ANMA 1XGYL 3EOTH 4DUXA 3OKEA 4QY8A 5E2VL 5JQHC 4WW2A 5DHVB 5IWLC 4PLOB 3DRQA 2AJYH 2DICA 2AQ3A 1ED3A 5J06A 1HCVA 2ITDA 3P77A 4M6NH 2NX5A 4OKDA 1QEWB 2HT4D 3EGSB 2VE6A 3EO0A 3U30C 3FT4A 3QXWA 4PJ5A 5IQ7H 5CJOH 3VFVB 5JW4R 4ZUSB 4R4FH 4L3CB 2VR4A 1BAFL 2W65A 1JHKH 5ACZB 3KHOA 3MRMB 4KJPD 3KJ6H 4AIOA 5T1LD 3UBXB 3KVQA 5EORL 2Z31C 5D7LD 2VDOL 3L3IA 1PJ9A 1Y6MR 2D7PA 5F6IC 1I3RB 1HHHB 1F90H 5F9JA 4XVJH 3DSNA 1C12A 2RFXB 5F3HA 2CGRL 1S9YB 2P43B 1SYSB 2UVFA 2GUOB 4MD5A 4Y8DC 3VRLF 3W9EA 1QACA 2FB4H 1P4IL 4ODSL 4QRSA 1S7SA 3BXNB 4I77L 1P9MA 1HH6B 5E8NB 3KXFA 1KIRA 4JN2A 2YBRB 4JDTL 4AG4L 4H88H 2VDPH 1TMCB 4GRLA 3GJEA 2DRUA 3BAEH 5EOCJ 9CGTA 1Q94A 4AZ8A 3N1PC 1WV7T 1I1YA 3U9PL 3V4VH 4ELME 1N0XL 4QHUA 2R0ZL 3HZYB 2D03L 3K46A 4FXGA 4F7TB 4HKZA 1UWGL 4NO0A 3QEQA 1A3LL 1NLBL 1KG0B 1NBZB 5IBLD 4YR6A 5SWQB 1NMCC 4PGEB 4DGIL 3T0EE 5C0FB 2HJFB 3SKNB 5BCAA 3HC0B 3VWJC 2LU3A 1OF2A 4PJCE 4WEBH 2BNUB 3BWAA 2AEIT 3BE1H 5EG6C 4Z7OF 3G08B 2AKRB 3MROA 1JYWA 4F7CA 4Q7DA 3ESUF 3KYNA 2O61B 3RVVD 5DVKA 1XT5A 4OZ4B 1DJSA 2D7TL 1NBVH 2VKWA 1QKZH 2EDLA 2V17H 1RMFL 4U6HB 3TWCH 4CJ1A 4PREB 5GS0D 2BNRA 4L4TD 5JPNA 2AJ3A 2AXGA 3T0EC 5H35A 4OZIE 1GJIA 2FX9H 4PJ9B 3J8F7 1IL1A 4UQ3B 4Y4KB 5IHZA 1DBKH 3UPAA 3D0VA 3DV4A 1QYGL 2VLME 3RBSA 1R0AH 3KR3L 2BOBB 2XZZA 3CX5K 4UB0H 2FECL 5C0ND 1HINL 2MQCA 1DDHA 1XF4B 3NIGE 1NAML 4G8IA 1YUHB 5C0CA 4TSBH 3ULUD 4HUNB 4KDTA 2JJTA 1MVUA 5JW5B 3W9DB 4JANA 1SJVA 5INCB 5EOQL 5EO1B 4XNMB 3WXVH 4NPYB 4N8VG 1EHNA 3B2UC 5I1EH 2B0SL 1FFOB 4CDHA 4EUPB 4PJFA 5F96H 1KUMA 3BP5A 1U8KA 2A6DA 4OCYL 5GS1A 4FFYH 5E4EC 2EEDA 3GSVA 4NYLA 5ID1B 4ODHL 1OAQL 5ID0B 4MS8D 4P3DA 5D1ZC 2DIJA 3UJIH 3DVGA 4YXLH 2X4NA 2X44D 4NQDE 4TVPH 4APQC 3F7QA 3C5ZA 1MRDH 1T89A 1SY6L 2X10A 1LEIA 4HCRH 3AM8C 5IB5B 3LPGA 3QI9B 5D1QD 3OXSB 5DURB 3H8NA 5TDNB 1CGYA 1E6OH 4GMSH 3U7WH 5L2JB 2FCBA 4UDTA 1PZ5A 1DR9A 4IMKC 3ULVF 3OKNB 3E8UL 3VFPA 2W1NA 4Z18A 1INQA 4PP2A 3O8XA 5BO1L 2WUCH 4RFNB 4JN1L 1UH2A 3QBTB 1JZ2A 2JELL 2OTPA 3ZTNL 3RWIA 5KSAC 2W9EL 2AP2A 2ZP0T 3QFJE 3MPCA 1LD9B 4MHHI 2B8OT 3LS5H 3BIAX 5SX4H 4YDIL 1F11B 4U7KA 4RQQB 5DJCB 4LSVH 4WUKL 1QBAA 5IB4A 4MXQC 3DXAB 3SKMB 1MFEL 4FQIL 4M61A 3RU8H 1KB5B 1K4CA 3DOSA 4HJ0D 1YECL 4IIQA 2FBJL 5T33H 3WIFA 2OTWB 2F9BT 1L7TL 2D3VA 1A6WL 4WJ5B 1A1MA 4HFWA 3QWRA 2ZJSL 1M1SA 4UIMA 4D9QE 3LRSB 4BZ2L 3T2NH 3FB7B 3MBXL 1CFNA 5DTFB 5HVWA 2Y36H 1YPZB 1QLEL 3FQTB 4ODVH 4KVNL 1KJ3H 3FQWB 5D70H 1KCVL 2FECI 1FFPB 5CEYB 2FIKA 4MA8H 2GIYA 1YEEH 1A4JB 3KHQA 4QHNB 4NZRL 3V6ZB 5IVXE 2QLVB 1J87A 4JFFB 5FFLA 2WUBL 3KNBB 3PXJA 1CXLA 3IFLL 4XCCH 4X7TA 1D5BB 5GSRB 1ACZA 1PKQA 1QBBA 1P69B 1KTLA 2OK0H 4Y2DC 1U3ZA 2VAAB 4PRHD 1EFXB 3O3UN 5KJRH 4JPIB 3HMXL 4QTIH 3BISA 4OD2A 2BX5A 2MKWA 3NABH 4M48L 5B3JE 4NQED 3JWOL 3GMOB 3IU4H 2NXZD 3GJFK 1L7IH 4P3WA 3WEXB 3P4NA 2HT3D 4MA1C 3NPZB 5H94A 3WIHL 3LKSA 4P2QB 4M03A 1T3FA 2UY6A 3ARYA 5FYJL 4S2SA 1FNGB 3F7PC 5HHPB 3G6JA 3RGHA 5ETUA 2PXYB 3SDAA 3ULVL 5IKCB 4RISL 4FFWD 5LQBH 3RTQD 4HIXH 2EDKA 4XXCC 2FX7H 4KTDL 1VADB 4FNLL 3U9UA 5FEBA 5GJSL 5IB1B 3ARTA 4LEOB 5EO0B 5JHDE 4XC1L 5LWYL 4L29B 3SGKC 4YHPB 2A0LD 2V9TA 4NUJB 4JDVB 4NM8L 1CXIA 5D72L 4GQ9H 1RSFA 2DI8A 4OZFB 4P2YA 1MUJA 3U0TA 1F4XH 4N0UB 1Q9OA 1FE8L 3NH7H 1IGIL 3OKLA 4K7PY 3UTTD 1H5BC 2DLTA 3KJ4C 3KPMB 5IMOB 4TUJA 3P9MB 4NQCE 4XNQA 5D7JB 1OAUL 4IOIA 3BEWB 1G1CA 5D6DA 1DZBA 2GFBB 4LRNH 4D0BB 4MD4B 4XNYH 4EDWH 4NT6A 3ARGB 1AGCA 4LL9A 1FGVH 4UIKL 4NN7B 1WT5A 4Z7WB 3NCYS 4YBQC 2AI0L 2GJZB 4R6UA 4JQVC 4V1DD 3NIDE 2H32A 3JV5A 4PRIE 1GGBH 3C60C 5A43C 5HVHB 1ZWIB 3DI2B 5C0EB 2GAZA 1VEOA 3BH8A 2GSIB 3RDTB 4L8SC 1NCWL 1RUKH 1VFUA 3QISA 3SDCB 3EOAA 1TJHL 1F6AA 1ORQA 4DN3L 3T4AA 2VZOA 1HOCB 3BRDA 5ENWB 3MMEA 4JO1H 2A9MH 4GBXA 3PL6C 1CFSA 5IG7A 2CR6A 1S3KH 2X9WA 4YNYA 3WDHA 2PYFB 1RQ5A 4NWTH 3B83A 4G9DA 4UMGA 1BD2E 3CSBA 3F62A 5KSBA 1VSCA 4URTB 1UB5A 4K2UL 3ARQA 3CMGA 5DJDA 4GKZA 4NC0B 3ZHLA 2P49B 2ESVA 4NKOA 1JMZA 1WCBB 3QQ9D 1UA6H 4Q2ZA 2Q8BL 2E8ZA 4IRJC 3CAFA 1QNZL 5HYSG 2NTSP 4WRLA 5EIQA 3T3PE 1OQOA 3E1F1 3QNXB 1X5ZA 5JUEH 5L9DL 3CZFB 5FKAA 5MEPB 3RWEA 3ZDXF 5IFJB 1BZ7B 2ADGB 3CFEB 1IQDA 3LRHA 4M7KL 3WFDH 4HPYL 1DEDA 3QUXC 5FYLD 1ORSB 5DC4B 5BZWB 4Y1AE 3DROA 4KUZH 4NC2B 5F9AC 4BQ6A 3OKDA 3DX8B 3G6DL 4LCWE 1H15B 4YFDB 4PG9B 3FFCD 1U3YA 3D85D 2NW3A 2XG5A 3BWUC 1FYTD 3ARFD 3PE9A 5MEOA 1H0DB 3MV9D 5HGDB 3KYAA 5CAYB 3IDXH 2JIXD 1IFHH 3P30L 3OAUH 2J6EA 4KQ4L 2YMXL 3P4LA 3PP4H 5HGBB 5IM7A 4KRPC 2J4WL 3GK8L 4PG2C 3MCG1 2X1QA 3VXTA 3HLAA 5J6GA 1QBML 2LABA 1KB5L 2NYYC 3SE9L 2BNQA 2QQNL 3WHXA 4DWHA 2W9DH 2X9XA 4RMQA 5CINL 3HMWH 3HAEB 4RGND 1P7QD 5F7EL 3VW3H 3PQYD 2OP4L 2CLVB 4DK3A 3NPSC 3PGDA 4W70A 2OL3B 8FABA 4D9LL 3GMMB 4YWGL 3EDJA 5DRNB 3PWUA 4N0CC 4E9LA 4RRPA 1U95B 1UJ3B 3MRRA 4X4XA 4HWUA 1NCDH 3Q5YA 1FN4A 2FR4A 5EU6A 5C08A 2QQKH 1P5UA 3L3GA 5IK3A 4LCYB 2EIEA 4KFZC 3M1BB 4MZ3A 5F1NA 4NFCA 2BVQB 1GH7A 4FQQA 5J13C 4PJEF 1QFOA 5IB3B 2HVKA 5KVGH 3QIBB 4HWZB 4A6YH 1TQCB 1MAJA 5C07A 2HLFC 2ICWI 4GLRI 3QHZH 3MRJB 5ISZA 5LJYH 3LN9A 2IFGA 2G60L 3DRTA 3LIZL 3GMNB 1JNNH 4ZOEA 5D1XD 3UTSA 4I2XE 1A64A 1N5AB 2QHRL 2OTUB 3V52L 5I19H 2CD0A 3BVNA 4UTAL 1TZGH 4I9WE 4JFDE 3EHBD 4XP9L 4U1KB 1PKOA 1IC7L 3B9KB 5C7XL 3F58H 4YDVA 3CDCA 1YN7B 5MENB 5E9DD 3ZSSA 1CT8B 1S9KC 4JKWA 5I66A 5IHUH 3BYTA 1S9XA 1U8MB 5ACMA 3UTZA 3TNNB 4XNZC 5CZVL 4I3GA 2P5EE 3IU3B 3UZQA 3MA7B 4IM8A 2R8SL 5T1KB 3EO9H 5BMFH 3AU1B 3D2UD 1KNOA 4Z0BH 2VZSA 1W72A 5BS0B 1HXYA 4P99A 5B8CB 5DRZA 2JJVA 5DK3A 3MLWH 1I8IB 2CJUH 1RZJC 4JG1L 4X7DC 2HJKB 4KKLC 4ZFOB 2PO6A 4CVXA 2EE6A 1BIIA 2VL5A 1VFAA 1CK0L 3AS1A 4NN6C 1B4RA 5GSVA 4NFBA 4OZHF 5D2NB 3M07A 5ADPH 4HIEB 2J5LB 4OIIL 5DMIL 3NIFE 2VO5A 4NP4H 4KHXL 3MZTA 3O9WB 1I1FA 3ZT6A 1QFWL 2DQUL 1X5LA 5EIIB 5ADOL 4XAWL 1A6VH 1I3UA 3X11B 1ZS8A 3NGBB 3S5LB 3L5WA 1LO5A 5J0BA 1CDBA 2XYCA 4LKCA 3I50H 3PHOA 1YC7A 4L3EB 4LARL 3U82B 2YKLH 4RX4A 4M4PA 4PRNB 2X4TA 3T1WA 1I1AC 3KLAB 3NFSH 4FXKA 4OQTL 2BMKB 1S7XA 4NO2B 4RFOH 4ACPA 2VLKB 4NQXB 1RI8A 5I71C 4E0RA 4NZDA 2VN4A 1OAYH 5LGKA 3SCMC 1TVHA 3KPNB 1ZT4B 1NFDF 1JGVH 5JHLH 4YUEL 4CGTA 3P2TA 4POZC 5FOJA 3W11C 4JM2A 1I7UA 3RIAK 5L88H 5DQJB 3UJJH 3T8XA 1JGUH 1OAKH 4HAFA 3INUH 5FF6B 4UV7H 5FYJE 2IPUK 4H8WC 3QIWD 4FQXD 4M02A 1Q72L 1J8HA 5IOPB 5CZXC 5HYEA 4GXVL 5IBUB 1GZQA 1G9NH 5C0BA 3UO1H 3ULVE 1BBDH 3LCYA 5I8OL 4OGYL 3N0PB 4YHLL 4P2RD 3WMSA 1V3LA 4LHJB 2A6IB 1LO0H 4JO4L 1RPQA 3KPPA 4XX1E 2IF7A 5D71H 1UXSA 5ABDE 3C9NA 5E6ZA 3SE4C 1P7KB 1IEBB 1N4XH 3HE6D 3OGCB 5I1IH 2BOCB 1U2CA 3SO3B 5C71A 2ZCLL 3VWKD 2DS4A 3CD4A 4Y16C 4BJLA 4XCEB 2OX5A 1FAKT 4HDIA 1WFUA 1F3JA 3LV3B 4KZEH 4MA3B 2VDQH 3HCVA 3MRFB 1DLHB 4PJBB 2R39A 3P73A 2YA2A 3E6HA 3V5KA 4DGYH 4KK9C 1FZMA 3SQOL 3K4ZA 3ALPA 1WC7A 4YBLB 3MRNA 2AGJL 3VGFA 3PWPA 1EHLH 3IDYB 3VRJB 1AGEB 4M6OL 5DO2D 2ERJC 5GRWA 4XPFL 2J6EH 1H3WM 3QDGB 3F7VA 2Z8SA 3JXAA 3GSRA 4OCWL 5ITBL 1RK1A 3S8WA 5BRZA 5B3NA 1HH9B 3NFNA 2AV7A 3BPCA 4PUBL 3LQAL 4QWWC 2AEQL 2FH8A 2EIZB 4ZD3L 2OL3L 5DMGD 3GSQB 3NN8A 5KSVA 1UC6A 4JCMA 4MD0B 5CKAA 5JXEC 1IAIM 3THML 1TVBB 3H9YA 5I18L 4I18A 4R7DA 4GH7B 1QSEA 4K23H 2CO7B 5AD0B 5HGAA 3B8SA 5LAXA 1INEL 3TJEL 2VQUA 5KTEL 1MJUH 4JO2H 1AHWA 1MAML 4UT9H 1U8PB 3VGDA 4ODTL 3NVQA 4OCRH 1AGFB 5C6TH 4HUWA 4XTRC 4IRSD 3TZVC 2ZG1A 4HBCH 3H3PL 5ESQB 4LOUD 3F5WA 4Z5RB 4Y5VC 2Z35B 1F58L 4TTDC 5K9OA 4HS8H 1D9KC 5MP6L 4P46A 4LSSH 2ZCHH 1DSFH 1KELH 2ZNWA 1U92B 1T1ZA 1C8PA 4PY8J 3MLZL 1F97A 1NGQL 1XGRA 4FQJH 4JVUA 1IARB 5E8EA 1GIGL 1JWUB 4J23A 3RWFB 3ROOA 4H1LG 2HFGH 4WO4A 1Q9KA 3WFCL 3L9RA 4XBGB 5DJ2A 3RI5F 2GHWB 1WEJL 4GMTH 2QQLH 3DMMB 2D7QA 1NGPL 5EU3B 1KTDB 2NY2C 1E4KC 43C9A 3TP4A 3NACL 4TPRH 3L3HB 3SPVB 5FHAH 2UWEA 2C7UA 5CIPA 1OM3L 4AT6B 2I60L 2VC2L 1HSBB 4G5ZH 4L8CA 3BPOB 1TETH 2D0GA 1FNLA 1A6ZB 5EOTB 3DXAE 1X6NA 2Y07L 4UT7L 2W0PA 3GSWA 1MY7A 5DK2B 4ZFOL 2CRIA 1CDCA 1I9JL 7CGTA 5HPMB 4XNUH 4I4WA 3KPQA 2M1KA 4GKNB 1DFBL 3VI4E 1W72H 2MOVA 4HK3N 2GW5A 4P4KD 4GW1A 5DUML 3OR6A 5HHNB 4HUUA 5DQ9B 2YPKB 4W4NA 4M43L 4QRRB 4H1LH 15C8H 3OKMA 5T5FL 3TV3L 1O5DT 1IM9D 3WHE1 4X98B 1H3VA 2F53A 2VN7A 4LLVA 4FA8A 3E2HC 2IAND 2R1XA 5CILH 3MX0A 3FAXA 2YD7A 4GG6B 1U3JA 4QXUL 1MWAA 5HI4D 4JFFE 2CLRB 2DDQL 1U8NB 2VDLL 3LB6C 5IVZB 5FYLH 2IGFL 2VLJA 25C8L 3ARDB 4ZTOL 1XR8A 1JHLL 2CXGA 3MGAA 3L7EA 3VXQA 3X17A 1QSFE 3IFPA 1OB1B 3LPWA 2Z91B 4EXKA 4EJ1C 3VXRA 1A5FL 3IJYA 2FATL 2LVCA 5E2TL 5I1HL 3O6FB 2P45B 4NUGH 2H2SD 3CUPA 1VCAA 3U83A 4ISVB 2IH1A 4KI5F 1DLFL 1WAAE 4G8EB 1MI5D 4JJ5B 4WGWB 4DCQA 4NN5C 3FQRA 4S11A 3L5XH 1GGIL 4WI6A 2XQYG 2VXTH 4D3CL 4BK5A 1VEPA 1WBZA 1KTRL 4GKOA 2VXSL 1NGXB 4QEGA 2AEPH 2R2CA 4UOW0 1ODAA 1RZKH 3TBVA 1NSNL 3UZEA 3QULA 2PKDA 1HHIA 4RFEA 3SO5A 2XTLA 1I75A 2EDJA 3FO2B 5CD3B 3D87B 4U1MB 4A2LA 1NANH 2DQJL 2BJMH 2J88H 3V0WL 1HEZB 4P23B 1FFNB 3MOAL 1BOGA 4LLUB 4WWKA 1CL7H 4N0UE 4YFLF 3LMJL 5IGXH 2FWOB 3HA0A 4DVBB 2F5BL 4PFEA 2UYLA 3MFFB 3S37L 2PXYC 2CQVA 3NCJH 4G6ML 3BUTA 3E6FA 4MNGB 3VGHA 3RKPA 1IJ9A 1FV1B 4LLDB 2YPVH 3OZ9H 4XBEL 1OY3B 2CK0H 5J57B 1KEGL 2NY3D 2MQ3A 3U48A 1I1CA 2PTTB 5F9OH 3WXWL 5CSZB 2MPAL 4Z7WE 3FRUB 3RY4A 2EH7H 5C3TA 1IQWL 1OD7A 5FO8A 1B6UA 1REIA 3L1OH 3DO7B 1YA5A 1P4BH 1KLFA 3C8KA 4OGAC 2Z31A 2F54D 5GGRB 2DBLH 3RVTC 4Y5XB 5EPMB 4WTZG 1TJGH 2IAMB 4R26L 1IMHC 1TJIH 3GGWA 2NY6B 2GJJA 5IUSA 4LVOB 5GRVK 2G9HB 2G75A 4QT5B 5BQ7B 4NKMB 2YPLD 4P4RB 3WLWC 2H1PH 2XZQL 3WFBH 2VDML 4LEXL 5JNYB 3ARGC 2E9IA 3HZMB 4Z78B 3FTGA 2DN7A 2NZ9C 2WWKT 1TQBB 1B4JH 3U1SL 1X44A 1XCQB 2Y5TA 2R4RL 4JRXD 5TDPA 4WWID 2YD1A 2V5TA 5I30L 3WFEL 1OGTA 1KLGA 1S7UB 2A77H 2AVGA 2YWZA 3ARUA 4UU9B 3O3DA 5HTSA 1J88A 2GCYA 1P4LA 3EDEA 3MRGA 3RKDD 5IV2A 4E5XB 3O0RH 3QO1A 5JMRA 3QUYD 4ZXBC 4QKXB 4ZFGL 4LCUA 2RCSL 3P0VL 2BK8A 3ARSA 3ETBF 3CVHB 3BIBX 2HFFA 4Y4FD 4PP1C 3D39B 1EH9A 2EICA 4PJXF 1E4XH 3MLYH 3VWJA 4ZFZB 2F74B 3GBML 3VGBA 2EEBA 2Q6WB 3JWDC 1MCDA 4G6KH 3CK0L 5KVFH 2DJSA 3VFRB 3LEVL 3MRCB 4ELMA 2R1WA 1EEYA 5I16B 1NAKL 4MNQD 3DX6B 3FOLB 2Z92A 1XR9A 1YMMB 3C8DA 5MERB 3O4LE 1NCTA 1U8JB 4FTVD 4Q9RL 4JFPB 5I2IA 3OXRB 1JRHH 4LPCA 4AL8L 5JOFA 3TN0C 2AERT 3LEXA 2UUDK 1UZ8A 2NY5L 1J1OH 3T0EA 2VLLB 3MBED 1M7IA 3MGOA 4PJCA 3HN3A 4MA7H 4LF3A 4U0RC 3D5OF 3IJSA 4P9MH 1NC2A 2BFVL 1I8MB 1IGCL 3BD4A 2ZSWA 4GFTB 3JTSA 3TO2B 2HTLD 1ZA3A 1EZVX 4YPJA 1U93B 4HUVB 4OLWH 1DQLH 5KG9B 4F2MA 1CLYL 5IMKA 3VFNB 3B5GA 1HK6A 1DQML 3LRGA 2IC2A 4G80B 2X4RB 1WK0A 5E5MA 4AIZA 4K7PH 5EULV 4PRBB 4OZIA 4RBPK 3ZE1F 4P5TB 4XBPB 5FHBH 1OAZL 3WD5L 2ZCKH 3CH1B 5F7DB 5K9JL 3TO4D 1U58B 3MV8D 4JZJB 3ZYZA 1IC4L 1LNUA 1BEYL 1E28A 4Z9KB 3RWCA 3TYFA 1QOKA 5E6ID 4M7LT 4HXAH 5D1ZA 2L7JA 3W0WD 1HIMH 1MWAH 3ZO0A 1FZJB 4YHKL 1OGAB 4LSDA 2OXGA 1LEKB 2P8LB 5FM5M 2O5YH 2H9GA 3FB8B 3SEPA 5IBTH 5C70A 4N9GB 1BOYA 4HJGA 2IQAB 4HWBL 3KYKL 4G8FB 1KYOJ 3KLHC 1A7NH 3MOBL 4IMKA 2DQEH 2IQ9H 4HUMB 1KN4L 1VB9A 3ECBA 4Z7VB 3TJHD 3MZGB 5MENE 3S6CA 1T83A 4JPWL 4JPVH 3VXSD 3CDGB 5K59E 4PJ8A 3QIBC 2QKIA 1F13A 2NPLX 4ODWB 3KDMB 4P59H 3BKCH 5D5MB 1ROWA 3O2WL 1FGNH 3E3QE 5EZOL 3S37X 3QRGL 3AGVA 4NQDA 2FGWH 3GI9L 4QOKD 1CE6A 4YBHA 3BIKB 1XF3A 4YFLI 3UDWC 1GC1C 2ILLA 3WLBB 1A0QH 2NY1C 3FN0L 2QEJA 1INDL 3SJVA 2IMNA 4N8VB 1A4KB 3VCLA 4XI5D 4TUKL 2XY1A 5D2NE 3H6JA 1UFUA 3PWJB 1KC5H 3RZCD 3VFMA 3E3QC 5HGHB 1RIUL 2IWGA 1YZZA 3QFJA 4U3XA 3KPRD 4PY7B 4XH2A 2OQJB 1G7JB 2C4FT 3NFPA 4P2OD 1C08A 4DKAA 5CD5D 2JLLA 4LLAA 1YY9C 5D7SH 3BN9D 5B8CC 3A6CH 1WFNA 3RGVB 1B6DA 4L3EE 1MCCA 1MHPL 1RJYB 3PWLA 1JPSH 1YEKH 4GO6B 1NCCL 2CLZA 3DO3A 4G8GB 1ZA6A 4Q97A 4U6YA 1N64H 4Y2DA 4R4FL 2CKBA 4N0FA 4NKDB 2Y6SC 1U8QA 3JV4B 1KIQB 4MAYC 2VLKE 1AR2A 3T1FB 5F3BA 3O9WC 3GBNL 4U3HA 4PJGB 4DK6A 1RZIA 1KT2A 3DX9A 1YYMH 1JUFB 4HQQL 4JDZB 2GITA 3HZKB 5KVDH 5MI0B 3V79C 4KQ3H 5D6CA 2FZ3A 5I1CL 2FJGB 2FLRT 4JZNB 3VXPB 5IVXA 2XTJE 5MHSD 2RR3A 4N1HB 4EN3D 1U3HC 5CP3A 3HE7C 4PV9A 2D4DA 4M3KB 3S4SA 3IDGB 1CICC 1MCIA 1H3PH 1B2WL 3RNKA 5AZEH 1KCRL 4XMKH 3QWOA 1K6QH 3O41B 1EK3A 4YE4H 5IEKB 5BZDA 1PVHA 1JL8A 4LAJH 1HKFA 2WBJD 4XXCA 3PV6B 1AY1H 4MJID 3SKOA 5EUOB 5GGQH 5JIIA 2BSSA 3GO1L 5DS8B 2DBJA 3HI5L 3SGKA 3A6OA 2XTJC 3SDDB 4I3RL 4ELKA 4Z7VF 5DSCB 3MNWB 4ZYKA 2V5YA 1BFVL 1L6XA 4YAQA 5EBWA 1CFTB 4NRZA 2FSEA 4WIQA 1TZHB 1M6OA 1MFBL 4JFHE 3CVHL 3GIZL 5F89A 4GW4B 1CIUA 4XCYB 2EDTA 3LSOA 3NCEB 1S7VA 1DVFA 2BSRA 1NJ9B 4K3DL 2FO1A 3EYOB 1BFOA 3OB8A 3BESR 5IVNA 4PJBE 5E8OA 2GT9A 2WP3O 1G7QB 4WU7A 3N1FC 4K8RC 3PJSB 3L3DA 3BPLB 4NC1C 5JHDA 4GRMB 3VXUD 5GGTL 4LIQL 5I1KL 2VERN 3BE1L 4HJJH 5I8CB 4MJ5A 2FEDD 2VSDA 3O3BB 4PYHA 4U6XA 3EYVA 1D7FA 1A6TB 1G9MH 4JQVA 2VXUL 3VFWA 4FG6C 3PHSA 1UM5H 5EZLA 2B4CH 3UJTH 5TE6L 3OR7B 4Z7UA 4ZO6A 2ZKHH 4NZUL 3QDGE 3RA7L 4X6DF 2HVJB 4ZAKA 3T0DA 2XV6B 5I1JL 1MJJB 1TZIB 1DBJL 4L8SA 2AXJA 5EU5A 3C6LB 3BRFA 4NQCA 4WV1A 4F80A 3EYFA 3ROLB 4BELD 1WFOA 1I7ZA 5TDOB 4CMHB 5L6YL 1EJOL 3QDMB 3PL6A 3OKYA 5DJAB 3TC9A 5B38A 1LE5B 3IDYC 2KQMA 3HKFA 3QUMB 1UCBH 3BDYL 4JG0H 2D0HA 5EBGA 5IT2L 2XY2A 4HC1L 4KI5E 4PRIA 1AGBB 1HZHH 4QRPD 1NMAL 4CW1B 5HI3C 4UAOB 2RJMA 4Y5YC 4NJ9L 4JVWA 4IRJA 4ORGB 4LASH 3D25A 3LKRB 3QCUL 1T1WA 1WCQA 4PJGF 3QIUC 1UT9A 3ARBD 3G9VA 1GGYA 4JM4H 1WIPA 3QHFL 4PLJD 5F96L 1F2XK 3RPIA 2GTZB 5DJXB 4L4VB 4N0RA 5CJ8A 1BD2A 5CFHA 2R2EA 2Q86A 1NLDL 5J8OA 4KI5C 2IH3B 3H42H 3QJFB 3WDJA 1NEUA 3BGMB 4TVPL 1FH5H 5I0DA 4NQSB 4XP1H 5HI5C 1MRDL 5IB2A 4U6VH 5J3HD 2X05A 3RRQA 4DAGH 4L8DA 3QG6B 4W81A 4WNQA 2EE2A 5DK0B 5JR1L 1CE1L 3TPUA 1XF5B 5EN2A 4AEHL 4WU5A 3PGCB 3WS3B 4DUWA 3GSUA 4Y1AA 4BQCA 1IAIH 4OLUH 5T3XL 4OCXL 3KLSA 4M5YH 3TFKD 4LCWA 1QBLH 4E41E 1JYXA 4NRYA 3OAYH 3MV7E 3CSPA 5D7LB 4FP8L 1ACYL 1FHGA 4KK8C 3MRDB 3DVIA 2VABA 1LVEA 1N0LA 2B2XL 2FYYA 3DMMC 1J12A 3LKNB 1F00I 2B39A 3NA9L 1UM6H 3R8BB 3ILQC 4XPBH 3IYLW 4U1LA 4X4ZA 2GSGA 4X6CB 3TT3L 5HXMA 3FHQA 4QRRE 1Z5LA 2E6JA 4YHNA 5DT1H 1HHKB 3T2NL 2QV2A 1KENL 2DQCL 5KANI 5LXGH 3FQUB 1RURL 4MXVE 1WBXB 4OFIA 4AQOA 1YEJL 2AK4D 3K8MA 1I3GL 2DM7A 3BP6B 1NL0L 4MQXD 5F8RC 1T5WB 2C1PA 3HI1B 1A21A 3CCHB 1I85C 1QZ1A 3OX8B 3GRWA 1CS6A 5DLMH 2DQFA 1IKFL 3OKOB 1ND0A 4TSCL 5CBAB 3F7YB 4QRQA 5KJRL 5E8PB 1RU9L 1XH3B 1EXUB 1VDGA 5H2BB 5DHYB