1FE8L

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
b'DIAMTQTTSSLSASLGQKVTISCRASQDIGNYLNWYQQKPDGTVRLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLESEDIATYFCQNGGTNPWTFGGGTKLEVKRADAAPTTSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
molecule tags Immune system
source organism Homo sapiens
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
total genus 56
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2000-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L01
3PWLA 1CE1H 3CH1A 4G8GA 4ZFFA 3GMOA 4J3XA 4RMVA 3MCLL 2X9YA 5DHVA 5K9QI 1IGCH 1KTRL 4KK6C 1ITCA 3MODL 3SY0B 5I30H 3VXMB 3C2SA 1MIEH 5KVGH 4Y16A 4JPVH 3QDJE 1MRCH 5D5MA 3WFBL 3KYOA 4Z77B 5JHLL 5EUOA 1JWMA 2DM2A 3MV9B 4FQIL 4V1DD 4GBXC 2IC2A 2Z35A 3IDXH 4LSPL 3ZKMD 1FPTH 2NXZD 3ZE1F 1VHPA 1FNLA 3KYKH 2JCCA 2J4WH 1A6TA 3OXSB 5DK3A 2VE6B 4NO2B 3UXFA 3QDMB 3L3IB 1HDMA 2GI7A 4UNVA 4C57C 5T1LB 3GNML 2Q8AH 3U48A 2ZJSH 4JJ5A 3LQAH 2FBJL 3IJYB 4TYUA 2ZSWA 4AEIL 4P9ML 5HPMA 1B4RA 1WF5A 1AFVL 4ZFGH 3OB0H 3LHPH 1S7WA 2VE6A 5IGXH 1X5JA 3X13B 2K1MA 1VENA 2IAMC 5DRWA 2YD9A 2QQLH 4NO0D 4JZOB 4GLRH 1UM6H 4EJ1C 4F8QA 5T1LA 3I75A 3MLXL 3V6FB 1E0OB 3S3JA 2HN7B 5J1SC 3GBLA 5E6IB 2HVJB 4K71B 5EDXA 2PNDA 3WXWH 3PABA 4EUPB 4Q2ZB 5GGQL 4Y7MA 1KPRB 3OKEA 4DOHE 5DJYB 2FGWH 3DX6B 4GRMB 2YUWA 4HPOL 2NXYB 2IQ9L 2HFGH 2O61B 5C0BE 2VDMH 1E28A 1OGTB 4KK9D 1JRHH 1WBYA 4P5KB 4GRLB 4AK1A 1OPGH 5CJBA 1YYMH 5E99H 1DQML 5EIIA 4UT9H 1NCCH 4NKDB 2YXFA 1I8MB 4EI5A 3GSXA 4PV8B 1ZE3C 3TH4T 3MFFA 5DRWB 4NKMA 3WFZA 4DN3H 3IU3A 4LDEB 4TRPL 2K7PA 5E8OA 1VFUA 5DC0A 1NFDA 5CLTA 3NMEA 2GT9B 3OKKA 5C0AA 3T04D 1AO7D 5ID0B 1AQDB 4G3YL 2HMID 2Y25A 5GS0D 1P7KB 2OTPA 3HNVL 1UH2A 5J6HB 4QT5B 2R23B 1AI1L 4IJ3B 3LV3A 5CKGA 5D1ZA 4ELKA 2O5YL 1IEAB 5GPRA 4QF1B 4PY7A 1QFWI 2JJTC 4MAYA 4HMDA 1VFBB 3GHEL 3JTSB 2ARJB 1KCLA 1KEML 3GJEB 3CFDA 2IBBA 3K0WA 4Z5RB 1CDIA 1FSKC 1NQBA 5L8KB 3ARBC 3Q48A 2IG2H 2NCMA 3LS4L 2BNQE 2DYPB 3GBNH 4HX1B 4K3EH 3BW9A 4Y16B 1YMME 1H3PH 1KB5B 4HJ0C 1UG9A 3GRWL 4JPWL 3INUH 3P0VH 1T5XB 4LKXA 4NYLB 1BWWA 4HLJA 35C8H 1N8ZA 1RMFL 2AV1A 1CF8H 3RDTD 2ZWLT 1YECH 1QSZA 2V5TA 4O02H 3C6LC 2RIKA 4KKBC 1C5BH 3V4VL 5FO8B 4JN2A 4XT1C 3C8KA 4IS6A 2DD8H 1ZWIA 3FQWB 3VXQA 3VE0A 2R2HB 2VDRH 5D6CB 4XCFL 2YEZA 3WDJA 5LAXA 3U0PB 5KG9B 2Z31C 5F97E 1OP3K 3JWDH 5CMAA 5MERB 4Q9QL 4PJGE 3VGGA 4P2YA 1VKXA 3NH7H 4DCQA 3IF1A 1E6JL 5EORL 4R26L 2HJLB 4LCWA 3RY5A 3ARFB 2F15A 1FYTD 4U31A 1ZTXL 4N9GA 3S34L 1WK0A 4I1NB 2WIIA 2A2QT 4PJAB 5KVDL 1CD9B 5C0GA 5CGTA 1R5VA 1YQVH 1NC2B 1J0ZA 5EOCJ 1RZFH 2EKSB 1BZ7B 4XNXH 3ALWA 1HN1A 3G5ZB 2I9TA 5CZXD 4ZTOL 1XIWC 5DJ2B 3L1OL 4HIHA 4G8IB 4W81A 5HHNA 4D8PA 3VXUB 5IW3A 2VDQH 2ZCHH 5ADOL 5CJ8A 3SDXE 3TBYA 4GG8B 4FZ8L 1JUFB 3C08H 5M95B 3KPSB 2JB6B 3HC3H 4XHJD 4FQQA 2Q7NA 2Y6SD 3Q6GL 4PRHD 1RVFH 4JREC 3MREB 4TVPH 4XPBL 4ZFOA 4RGOH 2VZUA 4KK6D 5FO7A 2RFXA 4UNTA 2EIEA 3RPIB 4HIJA 4X4MA 1KCKA 2H3NA 4PJ9C 5I16B 4POUB 4XVSL 3BDYH 2J88L 1TTUA 4U1MA 2B8OT 4N5EC 3JUZA 1A6PA 3MUHL 5C6TL 4X7TA 3TA3D 4MJIB 2JJVA 3TZVD 2X40A 3O0RL 3L3JB 5DR5L 1Y0LA 3DPBA 1UKQA 1Q9OB 2IQ9H 2M26A 4MA8L 2AKRB 5GGRA 1UGNA 3FO0H 1J5OH 3THMH 1JIBA 5CBAA 5DD5L 3OB0K 3KS0J 3BP6B 2OMNA 4RQQB 2CRMA 4H88H 2GY7B 4HZAA 4X7DC 1JGDB 1ZK9A 1K4DA 3VG9B 3SQOL 3O2WH 2KL6A 4G9DB 1KJ2B 4PJDA 2AEQL 1TVHA 1NBZB 2OL3L 4D0CA 5D7IB 1MAJA 3SDCD 3GJFA 4PJ7B 3LOWA 4DZBA 1KB9J 5HPOA 4LF3A 4NQCD 1IC4H 5F7DA 4TSAH 4K8RL 1MFBL 3ULUF 4AZ8A 2AK1H 5EO9A 3KPTA 4LMQI 3G5XB 3QXVA 3SDDB 5HGAA 4U1GB 2AXJA 1A7RH 2VLKE 4JRYE 4PTUB 3AREB 3DV4A 3RVTC 4J3TA 1PLGL 3AY4A 3B2VL 1PAMA 2C3VB 4L1HA 2BC4A 4PLJD 1O0VA 4M1GL 3IVKA 1MRDL 2HFFA 4MJ6B 3ZKSD 1UFUA 3P77B 3WS6C 2OP4H 5ISZB 2V17L 3IKCB 1W0VA 2R0LL 3BO8A 2EECA 1S78C 3K1DA 1P4IH 1OAQH 2XXCB 3HAEH 2EDJA 2R8SL 4CVZA 4QHLB 4GLRI 2IANB 1GZPB 2UY6A 3JBG7 3NA9L 5DFWH 1KPUB 5FDWB 3DX7B 4FQJH 4PJFF 4PJCF 4KKLD 3HPLA 3UCRA 5B38G 3KPPB 3WYRA 1ERNA 4DTGL 3CSPA 5ANMA 1J8HD 4MHHG 3TCLA 3F5WB 4F7EB 3VXSD 4YHML 4R0LA 1JHTB 2BDNH 2AJ3A 4UT7L 1YUHA 4EDWL 5BMFL 2I07A 5I75B 4CUCA 2FEEL 1FIGH 3N1FC 5IMKA 3NIGF 3RUGE 4XWOD 1A2YA 2X05A 4XP4L 1YNKH 2Y06H 1DDHA 4O5LH 3UDWA 4XCYA 1LP9B 1A6ZA 3B9EA 1S7VA 3DNKA 5LCVL 1QLRA 2PKDA 1MFNA 5CHNA 1UYWH 1ADQA 5T1DL 3ROOA 3RDTA 2X7LA 3WIFB 2CLZA 4H1LH 1CK0H 3NOIA 3UTTA 3I9GH 5I15H 5CJXC 3LKOB 5LBSH 4WWKD 3LIZL 1CFQA 4HKBB 3O41B 4HZLB 2VSDA 2L7JA 4XP5H 1ETZB 5FM5M 2N7AA 3PWPD 1MCRA 2AQ2A 1WBXB 3RDTB 5B22A 2D4FA 2X1WL 5D6DA 1Y18A 4J3SA 5TF0A 3PABB 4G8GD 4DK6A 4GAJH 3CSBA 4JCLA 4M8QA 1LMKA 2P5EA 2VXQL 4Z5RA 5TQ0H 1A2YB 1MIMH 3V2AR 4UQ2A 4FA8A 4PJ8B 1UH4A 5C0CA 3S96B 3SE8H 5IG7A 3BUYA 2ATPA 2VKXA 4P46A 1HYRC 1MCOH 3WUWG 3EYFA 4LCUA 3DYMA 3MRIB 2ADIB 4OCSH 3W5NA 3TYGH 2BRRL 4MX7A 3GKWH 3BVNB 2OTWA 1MF2H 4NOFA 1WAAF 1XGRB 2ICWI 2H2SC 3A67H 1WZMA 3E2HB 4WGVB 1TZIA 3MRPA 2DWEA 1GGCH 1INEL 1GHFL 4WV1A 3WNKA 3BEVA 4MD0B 5ACZB 1YEJH 3BO8B 3T1WA 1P1ZA 4KJPC 5HTSA 3NIFF 3DROB 3FKUS 5B39A 4LVNB 3V0VB 3FB8A 4LRNL 3IJSA 4P5TB 1VGEH 5FCUL 1T7YA 4LHQB 3FO0L 5ICYB 4HWEH 1IAKB 4YHIA 2VR5A 4NNYB 4K9EL 2AXGA 5EUOB 5I16A 1IAOA 2Z31D 4PRIA 4K8RC 3C2AL 1LO2H 4UOW1 1K4CB 4MA1B 4B53A 3MRKB 4GSDL 2D7OA 3BRGC 3GSUA 3EJYD 3RY4A 3QXDA 1N4XH 2NX5D 3HG1D 5I1JH 2NR6C 2NY4D 1LD9B 4TPRH 3P4MB 3A6BL 4XP6H 1CS6A 1T22B 1FQ9C 2CLZB 4NO3B 2EDEA 4PGJA 1F3RB 3F5WA 4ESKA 1KTKE 1R3JB 3WXWL 4MJID 5SWQB 3TJHC 2X4RB 3BJLA 1IC5L 4WHYG 3C5SB 5JZ7C 3VXQB 4NDMB 4Y4HB 3BT2L 1X44A 3T0ED 1MIEL 3FRUB 1QBLL 3D0LB 4P46D 3FN9A 2Q3AA 3LMJH 2C1OA 4O2FA 3DTXA 4JAMA 4Y19B 2Q6WB 3WXVL 4ZAKA 2FJFB 3R0MA 5DJDA 4IRSA 1HE7A 3MC0A 4MDJA 4NN7B 1JBJA 3OKMA 4M7JH 2DI8A 4N0CD 1U8QB 4MAUH 2C3VA 2XWTA 3GSWA 1I9JH 5E8OB 3S5LB 4DTGH 4KKAD 2EE6A 3MRIA 3BE1L 1AP2B 2QKIB 4GW1B 3T2OA 1W0VB 4L8DA 2NQCA 1NCAH 3HZMB 5CP7A 4BH8B 2A6DA 3U2SB 2DL2A 2M8XA 5BJTB 3CX5J 4LP4A 3VWKA 1CU4H 1P5VA 3ARED 2GFBA 2GSIB 4EOWL 3VFTB 1WC7B 1D5XA 4M6OH 3REVA 4LASH 4N1CA 1PG7L 5T1DH 4U2YA 4ISVA 3RJQB 1AR1D 4A6YA 3O3BB 4JY6A 4M7LH 5HYJE 3H42H 1BQSA 2IEPA 4PJAE 4WRLA 5I15L 1FCCA 1QLEH 3BPLB 3CJJA 2DYPA 3G6AA 5JPMB 2VLMD 2QLVB 4APQC 3BISA 3B5HA 5HI5D 2C9AA 1HH6A 1S8DB 4NFBA 3QFDB 3WLBA 4YO0A 2QSCL 1RI8A 4HUXA 1CD1B 3EOTL 3O2VL 2YSSB 4RMQA 2CGRL 1FYHB 3CDYA 2NZIA 1UVQA 2NW3A 5AZ2H 2AEIT 1RUPL 3BHBA 1T03L 4AG4H 3GI8L 4UT9L 4AENB 5T3XH 1DR9A 3G08A 5C0EA 4XGZA 5JHDE 1KGCD 4M6NL 3VGDA 3OKKB 5IFJB 4M62L 1CFNB 1UWEL 1NGZA 4RIRB 4DN3L 2B1HH 4OCSL 5C6WH 1XFPA 4MVBD 3RVXD 3WNMA 3TYGL 2H1PH 1MWAH 1F90H 3GKWL 4OV6F 3MO1B 4MLIA 2DDQL 3TFKD 3W2DL 3EKCA 4CW1B 3QNZB 1P6FA 3QQ3B 5EA0H 4X83A 1XEDA 4R4ND 3P9WB 4OZIA 4MZ2A 2VITB 5DMGD 5LGJA 1LEIA 1P7QB 1IT9H 1CFTA 1GJIA 5MEQB 2HT4D 3TIDA 3QRGH 2DQGL 1UENA 2NY3C 1G7QB 5E95B 3V8CA 3QO1B 4L4TB 1A3LH 3E3QC 3U83A 3DRTA 4KMTH 3BHBB 3MA7B 3IYLW 1TLKA 4HIHB 2QHRH 1UQSB 2YPLE 4RNRA 4YBQC 3TNMB 4FQHB 3D2UB 3ZKMC 5EZIL 3FRUA 1WGOA 4HH9A 1CLZH 5F96L 4ELME 1FVEB 5C0GB 1NGQH 1GGUA 3GSRB 4JM4H 3AS3A 5BZWA 3D25B 1MJJB 3DHJA 2CK2A 1AGEB 4JCMA 3SEPA 3QCVL 5HHQB 3TVMC 1O7VA 4L9LC 4XNYH 5FOBA 3BKML 1BX2B 5GRJH 1ZA3B 5JW3L 3OHXA 5C0BA 3ARDB 5BOZG 4WO4A 4P49A 1RZGB 1NJ9A 3WD5H 4ZUTA 5I9QC 3MRKA 5ISZE 3ZDZE 1MRFH 1AE6L 2NXZC 1U36A 3BH9A 2MKWA 2UZIL 4NC0B 3ZTJG 1A6VL 4J12A 1CFSB 3LN5A 1XGTB 4D2NA 3PWPB 3MRRB 3IKKA 4UDUA 1EMTL 3SE3A 4HHAB 5IBTH 1K2DB 2W9EH 2ZG1A 3MRGA 4F58H 1NPUA 2FIRT 3ZYOA 1JYVA 3NIDE 1ZGLA 4HFWA 2FECI 4XC1L 5DA4A 4L8SC 3V0VA 4YZFE 4NQEE 4QF1A 1I3UA 5SWSA 5DQDH 5IB3A 3WSQL 5C0DB 5DEFA 5T3ZE 1PQZB 1DLHB 1HIML 1G9MC 3I02B 4OZGA 3M1BA 3REWB 3RWGA 3TCXA 3DUSA 5C07B 4Y16C 1YEDA 3BIBX 1A7RL 4I3RL 4OD2A 5I1LA 1BBJA 4L3EB 1WT5A 1J05B 1NDMB 4M6MH 1DCLA 4HFUH 3U2SA 3FFCE 3L5HA 2XN9D 5TFSH 1U58B 1X5XA 1JVKA 1L7IH 4HT1H 1UQSA 4M9PA 1NBYB 4MAYC 1MJUL 4F7TB 3RHWF 1Z3GH 2R8SH 2X4QB 3NA9H 3KPPA 5C0CE 5CD5C 4RZCA 3MUY1 4LCCC 3HE6D 4NUGL 2I27N 4F15B 3WHE0 3MV7B 5FUOL 3IFOA 1D9KC 2IH3A 2XZZA 3KPQB 3EDKA 1TZGL 3DTXB 3U9PH 1F4WL 2VWEE 4FQLL 3V6OE 4ZNCD 1JZ7A 4UT7H 1JL8A 4P5TA 1AHWC 5TH2A 5D96C 2XT1B 25C8L 3LH2L 5J6GA 1T7XA 1MWAB 3CSYA 3QUZB 3HMXA 3LQZA 2AJVL 1VFOA 4JPIA 2AJYH 3I3DA 1A1NA 4TTDC 4C55A 2VTFA 4PBXA 4OFKA 1IC4L 1JHTA 3L7EB 1DUZB 3I9GL 4HAGA 2AK1L 4PUBH 3L5XH 3WKNA 1F5WA 2DWDB 4NRYA 5LBSL 1B2WH 5GRVK 3QIWD 4XXCC 2OI9B 4H8WC 2ZOLA 1R5IA 3ZYZA 5L2KD 2WUBL 5DVMA 4LIQE 4RGNC 1A7OL 4ZFZB 4AIOA 5D1XC 1NBVH 4EEEA 1HNGA 5EUOE 1FPTL 4L8CB 4UZGA 1CR9H 3Q1SL 2IANA 1KYOJ 2Y36H 1AO7A 4NWUH 3KJ4B 5GZOC 3QO0B 1EBPA 3BPOC 4RCAA 4TOYL 4WHYH 1X9QA 4XCNB 1XGTA 3IVKB 5E2WL 4NRZA 5E9DD 3MROA 2GT9A 2X4UB 5C0AB 1WCBB 1P6AB 3I6GA 3R06B 1N5YL 3SKJL 3VWJD 1K6QL 2OL3A 4WUUA 4L4JA 1YPZF 3D0VA 3I50L 5GGTL 3CXHK 3O6ML 1HXYB 5IV2B 1EEYB 1U8OB 5L2JA 1X4XA 4KY1H 3K7UA 4F8TA 2YPKA 1J88A 1I1YB 1BOGA 1S7VB 4TULH 2QKIA 1MCBA 5KSAA 1HSBA 1YC8A 2JIXB 4R2GC 4OZFH 2ZCLH 5SX4I 4HUVB 3IRZA 2DQIH 4LQ1A 3MLRH 1WBZA 4NSKB 5J3HD 2N1KA 5B3JE 4YHKL 4BKLA 4NZRH 2NY5H 3VFNB 4WFGE 3D85A 3RVUC 1MCHA 1WAAE 3T0VA 5KSVA 4FFYH 4OUUB 4PJ5E 4BUHA 1W72L 3KAAA 4NKQB 4HIEA 1GIGL 3DO7A 3KPRE 4N1HB 3C09C 4Y5VA 1HH6B 3I3EA 2P8MA 4I3SH 4HZLA 1NGXA 5H37H 4ZXBC 2R1WA 1I1YA 1JP5A 4K9EC 5IHZA 3NCCB 5L2KA 3LEYH 1B0RB 5HHME 5IW6A 1WVZA 3RWIB 1S9KC 1NC2D 4KKCD 1IVLA 2YMXH 4FQ1H 4KRPB 4NQTA 1HI6B 5FYLD 2ZSVA 6CGTA 1PZ5A 4AT6B 1S7UA 3IFNH 3S4SB 4PJEE 2E9IA 3CX2A 4XGZB 1S5IH 4JB9L 2R69L 2X1XR 5IW6B 3MLWL 1LWRA 4IIQC 4A6YH 3ZYIA 2J3SA 1RIVL 1AD9A 1NCWH 5EO1B 3LDBC 3PGCB 4OD2B 2UVEA 4JVPA 4Y5VB 1CZ8L 2C3GA 4L3CB 4OCLC 5JXEA 3OKMB 1H3PL 4LL9A 4W68A 5DT1L 2YWZA 2BX5A 2GAZB 4L4VB 3L7FA 4ZPVA 1ORQA 3NPSB 3OKYA 1OTSD 2Z4QA 4Y88A 4QRSA 3MLVL 4P3DB 5F7EL 3RL2A 3E6FB 4PBWD 1EA9C 2C3WA 4YFLF 2IBGA 3P73B 5F3BA 1OAYL 5HVGB 3K8KA 1HQRA 2NY2D 2FECL 4JKPL 5FGBC 5FHAL 3E6HB 3ARDD 4DUVA 3LS5H 4URTB 4GKOA 4NUJB 3V0AC 2KBGA 2W9LA 2WWMD 4XVTH 5EOCL 2XPGA 4GQ9H 4DVBB 4PB0L 3VFUA 2B4CC 4ZAKC 5GRUL 5H94B 5JIKA 4LVEA 4PUBL 4Z7OE 1G7LB 1S78D 2R9HD 3HS0B 4PP1C 4WUKL 3V5HB 4Z7VF 4PJEF 3VFTA 1FC2D 1NGYA 2ATKA 2V5YA 2XTJD 1I8LC 3CFJA 4P23C 4Q74A 2F5AL 4WY7L 4YHZL 4GKNB 1PKOA 1T1XB 2HG5A 5IMLB 1MQKL 4OD1H 5CD5D 3C5ZA 1IC7H 1ZS8A 4DWHA 2DQUH 3X11B 4D3CH 5TF1H 1XF2A 3DVNB 1U58A 3IDMA 4NO5B 2AK4D 4Q6IB 3VXRA 3R1GH 1EHLL 2EIBA 5IKCA 2CO7B 2XWTB 3LN5B 4DKFL 2P8LA 3MJ9A 2VDQL 12E8L 1RJZA 4L29A 5ALCL 5F7LB 1MCLA 5KS9F 4X5WB 1U8HB 4X7EC 4OZGE 4Y19A 1CTOA 2BFVH 2JB5H 1K6QH 3BE1H 2EKJA 3TBWB 2DBLL 2GJ6E 4UU9A 5AAWA 4QRPE 5I8OH 3O3UN 2IAND 5FEBA 2NNAB 3I50H 4JO2H 3MQIA 3FOMA 1DBKL 3PL6C 5IJKC 3Q3GB 5EA0L 4OKVB 2C26A 4WU7B 3KPLA 4XNMB 4BQCA 3QWRA 3G9AB 5C8JA 2Z91A 2BSSA 2I5YH 2BVTA 4WEBH 4WNQB 3H3PH 8FABA 4M43L 3DUSB 5DSCA 3QUYC 2EC8A 2JLLA 4I9WE 3RTQD 3SGDI 1FNFA 5IKCB 1GZPA 5LKNA 4XRCB 2CIKA 2J8UB 4NKIL 1KIRA 2B7DT 3VD4A 1K8DA 1OW0A 2E27L 3Q5OA 4NM4L 1F42A 1NC4B 4LIQH 4RAVB 4H88L 2VLLB 4POYA 4JG0L 3O45B 2R0KL 2XQBL 2V9TA 3MRFA 4LLQB 1MCPL 4R4FL 1D5ZA 2QSCH 4PRDB 4WO4D 4ZUVB 4ZFGL 2JCCE 3UAJC 4MA3A 3ZDXF 4PP2B 2HFEA 4LMQE 5DZNA 1L9NA 4CMMA 1FH5H 2X89D 5F6IB 4K8RH 3AM8A 3B3IB 3ALPA 2E8YA 4IOIA 4LPTA 1VADA 3EOAA 1CICC 1V7ML 3WD5L 3S98A 4NIKB 1TFHA 1XF5A 5IQ7H 2J6EA 1G9EA 1JPGA 5HHXL 5KOVC 4QHUA 3QEUA 2J1KA 2DMKA 7FABL 2MPAH 4LPCA 2FGWL 3G08B 4N8PA 4O51B 4WW2B 2BXYA 1BX2A 3X3FL 3GMMA 2EDTA 2WNGA 4ZXBA 1VEMA 4OFYD 3L3KA 2UWEE 5ADPL 2BSTB 4NJ9H 5I74C 3RIFK 5T1KD 3MV7E 5T5NG 1I9EA 5E5UB 2XFXB 5C2UB 3QDJB 3OZ9L 2GFBB 2GSIA 2NXYC 1CGVA 3NFSL 4GMSH 3D69A 3RNQB 1MCWM 2OXGA 3MV9E 1Z2KA 3MRQA 5IEKB 5H2BA 5E03A 1YEIL 5SX5H 4CMMB 5F3HA 4XMKL 1CFTB 1N5AB 5EB9A 4GRLA 2AXHA 4K23L 3VH8A 1ZT1B 1RJYB 1G9NL 4FQ2H 4PY8J 1FZKB 4APQB 1JZ3A 3TESA 5IJVA 2VB5A 5F96H 4L3CA 3WL9A 5MEOA 4AEIH 1IGJB 1CGSL 1JPTH 3FJTA 2WBWB 5HYJA 3VWKC 4KZEL 4U6VH 2A9ML 1AGFA 1ZLSH 1F6LL 4D9RE 1HYSC 1S5HB 3G6JF 4TNWF 4Z0BH 3NZ8B 4PRBA 3RWIA 3U7AA 4RISH 1U8IA 1KT2B 4GOSA 1FVCB 4EKXA 1B6DA 1KBGH 3DBXB 4CAGA 3ARDA 3PGDB 1XR8B 1CD0A 4J3VA 3I6LD 3RGVC 3S36H 3QXTA 5E2TL 1VESA 1A9BA 1OD7A 4C83B 3EHBD 1DVFC 4NCC2 1ND0B 4Q9CA 3BPNB 2ARWA 5ESVB 4QTIL 2IFFH 1MWAA 3UROR 5IUSA 2F54B 5TGBA 3FQTA 5J6GB 4R90H 4UIKL 1D3CA 2RQ8A 3MUZ1 4FQCH 1KLGB 5JOFA 4CVXB 4PRAA 3MRGB 1XF3B 2OR9L 1XR9B 2NY1C 1N26A 4UB0H 4RFEA 3X11A 4A2MA 2VIRB 1TDQA 5JOEA 3JWDL 3V4UH 3CNKA 3WKMH 3VDBA 1XAUA 2EE9A 2DIAA 4M93B 3MXWH 5ELIA 5C2BH 5MHSD 4PFEA 1IEBB 3O4LE 3L5XL 4J4PD 1D5BA 4I77L 4MD4B 5FA3A 1ZANH 2R0ZL 2Z31B 2Q76A 4HV8B 3D39E 3H6JA 4O00A 4PGDB 4WEBL 1NUNB 5KTEH 2QR0B 2JELH 4JFDB 1I9IH 4K7PX 2AJUH 4OZ4A 4GW5A 5C3LD 2YA2A 1UJTA 1U8JB 3ARDC 4L4VD 3DURA 4K7PY 4P57A 4EI6A 2DI7A 1KLUB 1IGFH 4YGVA 4H8WL 4Q58C 2IG2L 4KROB 4R7NB 5E2WH 4FFWC 2CXKA 4EI5D 4UILL 2G75A 3VJ6A 5EZJA 4ELMF 1BFOA 1NBQA 1YMMB 1JWUB 2VKWA 2R23A 1V05A 4WW1A 2FIKA 3KYOB 1LO3L 1TENA 3QUXC 3L7FB 1EBAA 2Z8WC 4LHJB 1B0WA 4MZ3A 1LHZA 2KZWA 4KK5C 1WBXA 3SDCB 2E7HA 3O8XC 1GH7A 5IT2H 1RIUH 1IC1A 3EJYC 4FABL 2ENSA 1TCRA 1NCUA 4IDJL 4YAQA 5JA9A 4X6FA 1MCEA 7FABH 2CR6A 4F33B 1GSMA 5DD0L 1DN0B 2LABA 4I0PA 3RPIA 3QULA 5JLZB 4V1DA 2O26U 2V5SA 4PJ8A 5F9DC 1J5OL 3VFVA 3RBGA 3FB7B 3VFWB 1XF4A 1S7QA 3QXAA 4KROD 4NZRL 4JQIL 2VXTL 4R26H 2VABB 1KJMB 5F7HA 1G9NC 1OT1A 5HY9A 4FFYL 1EUUA 4OLUL 2LE9A 2ZOKA 3WIIH 1T2QL 3ARPA 4WU5A 3KYNB 1LP9F 5L9DH 4U1NB 3HC4L 3P0YL 2D0HA 1ZHNA 3JV6A 4LSUL 1VEPA 2FB4H 1A4JB 2R0WH 2QHLA 1KIRB 1T2XA 2PYFB 3CU7A 3RA7H 3VG9C 4J1UA 3LKQB 1G7HB 4OGXL 4ORGA 3O6FD 5FFLA 4MAYB 3S37H 4NBYB 4TUKL 4G6MH 2BHZA 1G7IB 3DROA 3L6FA 3VGHA 2AV7A 4U1HA 4LCCB 4RA0C 5HDBF 1R3LA 2IQAB 1ZT4B 4PJFB 1JF6A 2NY6C 3SDXB 4OCWL 1D9KB 4WI6A 1JHKL 4BZ1H 5I0DA 4E41D 4KGJA 5L88H 3SKMB 3O3BA 4ZODA 1SVCP 1U2HA 1SEQH 1BGXL 1X5AA 3DSNA 5J1TC 3BQUB 2IQAA 1B4JL 1CD8A 4Y2OA 4AL8H 1FLRL 3O3DA 2FLRT 3MZGB 4NQDE 5EUKA 2V2TA 2IFGA 5TE7H 1BIIB 4GAYA 5ALBL 1G7HA 1DEDA 1MI5A 2WUCH 4X6DE 4X98A 3EYQD 1QNZH 3WUZA 1K8IB 4WEUD 2CJUL 3T0WA 4HPYH 3LRSB 1HHJB 2HFTA 3B6SB 1H3WM 1Q72L 3ARTA 4OLZH 3WHXB 4I0PD 1BQLL 5CBEA 1GIGH 3RAJH 4FQCL 5J8OA 1D7FA 1WQVT 1OGAB 4U1JB 4G9FD 4Z7OF 2ZUUA 3PP4L 4O58L 2Z0BA 4PLKC 5I75C 3ZTNL 1X5KA 1QSEA 3BPOB 1FNSH 2XNAA 3ROLA 3KPSD 1UB6B 3L3JA 1MY7A 2HRPH 5E8NA 3RRQA 1I1CA 1T89A 3AXLA 3PDOA 4L3EA 1A6ZB 2BHYA 2OCFD 2H8PB 3WIHA 5CAYB 1P84K 4P4KD 5C09E 4TTGA 4LP5A 1ZOXA 1NKOA 5GJTH 5D4QA 4XPFH 3HRZA 3TO4A 4LVOB 4QHKI 4X0KA 2VLKB 3QUMB 4N1EA 4P2RB 1JGDA 4JRYB 1YJDC 4D0BA 2DQJH 4NFDA 1ACYH 3D6GA 5I1DA 5DMGC 2J4WL 1DUYA 2F54D 2ZCKH 3TJEL 1BREA 1AXSA 5T5FL 1BECA 3PP3H 1TNNA 5KSAB 2NY3D 4R2GB 4X7SH 4CBPA 1RJZB 1Z9OA 4YBLC 1BVLB 1QSEB 4KRNA 5D7SL 2XN9B 3ECBA 4L3AA 3I85A 2FH8A 3NCYP 3DVNA 2DKMA 1DN2A 3IDYC 3LN4A 2ORBL 3DIFA 1Q94A 4I3GA 1Q9LA 5BMFH 3JV4A 2IALB 3O2DH 4P2OD 5J1AB 4HWBL 4QXTB 4R8WL 3VI3F 4NRXB 3E8UH 1WUNT 2I24N 3NIFE 1VACB 1KTDB 3B2UC 5CEXA 5ILTL 4XRCA 1G7LA 3O81A 3IGAB 4GAGH 3O3DB 1YN7B 4HPOH 5FKPA 1S9VB 4BZ2L 2V2TB 1D5IH 1QPPA 4G8IA 4OCRH 3SGDH 3MCKA 1HCFX 3LIZH 4LIQL 1G0DA 4HKXB 4F58L 5C3TA 3DXAD 2YPVH 4U6YA 1QSED 3SE4C 1U8IB 2NPLX 1KIQB 1INQA 4IRZL 5K9QG 2I07B 4OD1L 2X42A 1FJ1B 5FYKH 2X09A 2BY1A 4EBQH 4GXUN 1RUAH 1X6NA 5D72L 4YJZL 2HFEB 5IB3B 3MA9L 3BKCL 2DLFL 1NDGB 4XP9H 2YD3A 4LK4A 4ONHA 3FT3A 1L7TL 3AMLA 3CLFL 5IW1B 4HGWB 4HLZH 4RDQG 2EDDA 3W11C 3HI1A 5TE6L 4JQVA 4XAKE 1OAKL 2JF1A 3BXNA 1DL7L 3FQWA 5EULV 1J0YA 4MDIA 2F53E 3TVMA 3X3FH 4JFOB 4BELD 3RIAK 2JJTA 3HC0B 1YNTA 1LEGB 4LSQL 4OM1H 5LQBH 2X4PA 5D93B 5DDHB 1P2CA 4MCZB 1WITA 2IH1A 4JN1H 4C4KO 3FONB 1RIHH 4RAUB 1KUMA 4P9HH 3QBTB 1A7PH 4JZNB 5FOBB 5JNYB 2XPGB 1AGDB 4LF3B 5ALBH 4DVBA 3TH2T 4RFOL 4DQOL 4AIZB 3R8QA 3JZ7A 1R5WA 4NQSB 4POZD 4K3JL 1H5BC 1M05A 4TNVF 2EKSA 5BQ7B 1OLLA 3CDFA 4TNWK 2R0KH 2XQBH 2XI9A 3AVEA 4M00A 2FO4B 4C56E 4WFFD 3QNYA 1CBVH 2VAAB 5GRWA 2Z9TA 1T66D 4OF0A 5E4EC 2VC2H 4ZO9A 1C12B 1ZSDA 4E41B 2R29H 2CKBH 4I18A 4PJHF 3L3DB 5C0JA 4WVRA 3D39B 1T83A 2VZTA 3WCYA 1QBMH 4OQTA 3MRMA 4GRMA 2A0LD 4K3DL 3U46A 1ONQB 3KGRA 3SJVE 1QFUL 3GMLA 3REVB 5EFIB 4U49A 4JLRB 2R2HA 1T5WB 3U30B 5HHXH 1MFAH 4HUWB 5HI4C 4XPFL 4YDIL 4XP1L 1UM4L 5FUCE 4LCYB 2IADB 1A14L 3O2VH 4XVUD 1HHHB 4TVSa 2EDNA 2VLJD 5DURB 2FYYA 5DGQA 4P23D 3BESR 5D7IA 3BQUA 4FFVC 1R3HA 1QYGH 2ESVE 1LGVA 1MFDH 4LVHB 4U7KA 2ZSWB 3BSZL 5ICZB 5D2NA 4Y19E 2YN3A 3KYMB 3K46A 3OKNA 2AVGA 1A4KB 6FABL 1CFBA 4NN5B 4FFZL 5TQ2L 4RQQA 1TQBB 1G6RL 2ADGA 3RL2B 4EN3B 5F93C 3QR2A 1JCKA 2CIKB 2J6EH 4PG2A 4Z9KB 1MY5A 3CFKB 1S7RA 3MRQB 5IEKA 3SQBA 3STLB 3MNZA 3ARWA 4KY1L 3BP5B 4I77H 3QZWG 2Q7YB 4X6CB 2ICWJ 1ZGLM 1IT9L 4R8WH 4BZYA 3U7WH 4OGZA 3CFEA 3ILQD 5FV1L 4EN3A 4HJJL 4KZEH 4APQD 4XPAL 4LCWD 3BZEB 1FYTA 3NTCH 3O0RH 3VXMA 4ZFOB 5C70A 3PQYE 4GKZB 1OHQA 2NY2B 2R9HC 5HYSG 2QHRL 5HYJB 1S9XB 3T0EB 1E4JA 1E4WL 3HE7A 2NY3B 4R2GD 2YD6A 3B9VA 3CSYB 3QUZA 5EPMB 4H8WH 1FIEA 2BNQA 5T3XD 2MNUA 4KUCD 1SEBB 2CLVB 2VZ3A 2EXWC 4PG9A 2Q8AL 2VH5H 1ZGLB 2Z35B 3QCUL 2DLGA 3ULUD 2O5ZH 2AXFA 4LLWA 1MUJB 4PBVC 5KANG 2BVQB 4I3SL 1CXLA 4IRJB 1C12A 4X99A 3V6FA 4ETQA 1LO3H 5K9JH 1QUNA 3QQ9D 4TSCL 1BM3H 4OLYL 1YEFL 1URLA 1EHXA 5DJ8A 3IFLH 1YDPA 3QO0A 4WW2F 4Y5YA 5JMOC 1AE6H 5E24E 5A40E 3QFJD 5IMKB 2B1AH 5C0BB 3DVGA 5EC1A 5IROA 2P24A 2GUOB 4MD5B 4P2OC 5F89A 5AG9A 4S10A 4JB9H 5DC4B 4OSUH 2MHAB 5I30L 5IIEB 3ROOB 2W9DH 1CXIA 3QDGD 4NQDB 2DYPD 3B43A 1ZANL 2NXZB 3LY6A 4XWGL 4N68A 4OZFB 4X6DB 4P4KC 4YHOH 2W07A 2WBJD 3IDJA 4YHPA 5E8NB 5EU6E 3QI9A 3U6RA 4JVUA 3MXVH 3VWKB 3RWJA 1CLOH 5DYOA 5DUMH 1JRHI 1EEYA 3SJVA 4KDWA 3P4NB 1A7QL 2NY5C 2IH3B 2W65A 3ESUF 1RHFA 3GEWB 2FATL 2D7TH 3UBXB 1NFIB 4HC1H 4G6ML 3KYKL 2VDOL 3NACH 1IGTA 1OWWA 5F8QC 1ES0B 1F3JB 4F2MA 5E08L 4P2CG 1UC6A 4CL7A 1A6UL 3BPNC 4K94L 1C5CH 5A16A 4ONHB 2ED9A 4KAQL 4OB5H 5C0RL 1XZ0B 3MJ9L 3TO2A 5C6PB 4I2XB 2F8XC 2YHGA 3T0EA 3PXHA 3GBNL 3CGTA 4KI5D 4LSTH 1B0GB 4YK4B 3L3DA 1HKFA 2PYED 2HTKD 4M93C 4QHNB 1S3KH 5INDA 3UPCA 3VA6A 1QNZL 4RRPG 4PP1D 2DQUL 1T1WA 3GSRA 2DQCH 3QA3A 1OTTD 4LLYB 2W9EL 4JHWL 1T83C 3QIWC 5DJ6B 4F15C 5HVHB 2RCSL 3QISA 5LWYL 5CINL 2Y5EA 4CN1A 3BSZH 5K59E 1V7NH 4NO0B 3W9EB 3HLAB 2CK0H 4J1UB 5IOPB 4MJ5A 3G6JA 5E8EB 4AIZA 1R3KA 2BRRH 5D96B 1QD0A 1G6VK 2CQVA 3VGAB 4MGXA 3VRIA 4JRXE 1LO4L 4WTXA 4W4NA 2BJMH 5DK0A 4JG1L 2VLRD 5EORH 4NZDA 4CDGC 4M61B 1WWWX 1ZTXH 2G5BB 4Y4KA 1IGYA 1U6AL 3UO1H 2VSCA 3F6IA 3J8F7 3G6JB 4LQFL 4R9HA 1QSFD 5E8EA 4ZUSB 5C07E 3G04A 4OCWH 5HD8C 1QR1B 4W6WB 3CMGA 2NY4C 4JFED 1S9WA 2EC9T 2DI9A 3LKSA 4L3EE 2JJUA 4KVNH 2P1YA 2VZVA 3I84A 2LU7A 4FNLH 2ZPKH 3O8XB 3JWOC 4OT1H 3S5LA 3QUKB 1W2KT 5EFIA 3FFCB 1Z3GL 3H7BB 3BEVB 4JVWA 5I73B 3TBYB 1AD0A 3EYFB 4LCUB 1I3GL 5H94A 4U3HA 4MXVE 2DJ4A 4Y4FD 2ZZUT 1BBDH 1MELA 1YUHB 3KJ4C 4IRSB 2VLKA 4NHCH 1VFAB 1YJDL 5TDPB 1LO2L 1JGVL 2MSPA 2Q6WA 4WIQA 2NMSA 3GSOB 1CF8L 4KV5F 2FX8L 1FL3B 3QJHA 3Q6GH 4DUXA 4OBRA 4RGOL 2QQNH 4YDVB 1FVDA 5EWIL 5JPNB 5DJAA 3HE7D 2X70A 3UTPD 3RGHA 5FECB 1YMHB 1HHJA 2OQJB 3CCHA 3LRSA 3RVVC 2AERT 1QFWL 3B5GA 3ZT6A 1YEHH 5T33H 5BV7B 4RGMB 1N7MH 4MJ6A 5JR1L 4E42A 1UKTA 2SEBB 4Q9QH 1AJ7L 32C2A 4HS6A 4U4BA 4XCFH 1QRNE 4Q97A 3B9DA 2VL5B 2PTTB 4LAQH 3BMWA 2X41A 1L4IA 3K4AA 4P0DA 3G5XA 5GJTL 3MRMB 3U46B 3CVIH 3MSPA 1W72H 3LQAC 3QNXA 5SWSE 5D7IE 3RWFA 2VLRA 5EBMB 5GJSL 5HYFA 4PJ7E 1RD6A 1QKZH 3VXOB 4OZIF 2Y36L 3WEXA 5D6DC 3S34H 4NUJA 5CZXC 3HE7B 2E7LA 2Z91B 1KLGA 4PLNC 1Q1JL 1KIPA 1RUQH 1MFBH 4S1QH 1WEJH 3FT3B 2N56A 5DJDB 1RZ7H 1CU4L 1KPUA 5FDWA 3WUWB 1UVQB 3P9MB 3JV5A 4OF7A 3ARZA 2APXA 4WFHE 4XNZC 4V2CB 2ED8A 3SJVB 4QNPE 4F9LA 2A9MH 2HKHH 3ALXA 3NFPA 1A4KA 5DD1L 3ORJA 4Q6YA 4KQ3L 4XB7A 4BSJA 3HAEG 3LKRA 4WI8A 1ZA6A 3KHQA 2FX7L 2EIZB 1OAZH 2EEBA 1P7QA 2J12B 1I8KA 4D0DB 4FOMA 3KXFD 5E2JA 3WLWC 4PJIF 3W81A 4WI9A 1RJCA 5EIIB 1EJOH 4MA8H 4OIIL 5IHLB 4PJBA 1QR1A 4MA7H 2P5EB 2ZOKB 3BDYL 3NCFB 2C7UA 1CFVH 2Y6SC 3O6FC 2E6PA 3JWDC 4UIMB 1LDPH 1U3YA 3RUGB 2YD7A 4Z7VE 3ULSB 2XXMB 4R4NC 2UUDH 2PO6C 5L2JB 3P11H 5E5MA 2GCYA 3RGVD 1U8PA 1F8TL 4IM8A 3S97C 3OXRB 3QEQD 4LGRB 1WBYB 1XGUA 3MJ7A 4S1SL 1YMHA 2OQJA 3CCHB 4UBDC 4QGYA 3I6KB 1NGPL 5IB2B 4Z0XB 5SWZD 3STBA 2EDXA 4HUNB 4R3SA 5T5NF 1KN4H 4G9DA 3ULVE 2MCPH 2Z8VC 2NY7L 3ZE2E 2HTLD 1X4YA 3OX8A 3X3GH 1MRCL 5D1ZB 3WFBH 4ELKB 2KPNA 1JYXA 1T3FA 5C8JB 1U6AH 5I1EL 3ARQA 3QRGL 4HJ0D 5DZOA 1Q0YL 4L8BB 5E8PB 1NAMA 1GXEA 4NNXB 1S7TB 1XGRA 2AJUL 3X13A 3MREA 2VDLL 1KCRH 3VGEA 3O4LA 1NLDL 5LQBL 3RVWD 2A6KA 4NZTL 2W0KA 1J10A 2ERJB 5J1AA 4J6RL 2OMBA 4JN1L 4FMFA 2AJZA 5DXWA 4NWTL 3HE6B 1KSRA 4I18C 4CVWA 2G5RA 3P3YA 4WTZG 4HJGA 3V6BR 2GTWB 3UTSA 5DC9B 1AR1C 3PHSA 4LU5L 4NO5A 3VGFA 1LD9A 2IH1B 3P30L 5KSUA 4JM4L 5AUMA 5MENB 5IHUL 4R97B 4O2EA 5F7EH 1HILA 2O61A 3GZKA 4FQJL 2Z93B 1X5IA 2QQNL 4PRPD 1OQXA 1OW0C 4W6XB 1IGMH 4J4PC 1QBBA 4Q0XH 5C0AD 1CBVL 3VD5A 2VN7A 3MGTB 4EQ2A 4ODTH 1II4E 1MLBA 1YN6B 4YE4H 2FNBA 4JFEB 5JW4Q 5ESAA 3EGSB 2BNQD 1YYLL 3ARFA 3WFHB 1QR4A 2E6JA 4DGVL 1RY7B 3D0LA 4I0PB 5HGHA 4RWYL 3LD8C 4CJ1A 4GG6B 1A6VH 1J05A 1EZVX 1UADC 2EO1A 5DMIL 3WE6A 4XCYB 1SY6H 3T3PE 2GTZA 5EN2A 2N4IA 3KJ6H 1JF1A 3SDAC 4JFFA 3RVXC 4Z6AT 4GS7B 3CVIL 3RFZC 4X6BA 3HC4H 3P0YH 3W9DB 5C9JB 3F7VB 1T7VA 3SO3C 4M7ZC 5TF1L 3CFIC 3NCJH 1UT9A 2GTZB 5EN2B 1C5DA 3MGOB 2FWOA 4F80A 3ARYA 1U9KA 3PIQB 4ONFH 2GYSA 1F6AA 4XXDB 2P46B 3IXAB 2W92A 4H26A 5ID1A 4S1RL 1JGLL 3MLYL 1QQDB 5EO1A 4I3RH 4Y5YB 3HG1A 1YPZE 5F6IC 4R7DA 2WBJA 1AGDA 3U1SH 2HVKA 2XWBA 2BY3A 3SGKC 1HXMB 3MRRA 3FHQA 3TFKC 3BT2H 1OM3L 3OWEA 4QRPB 1FZOB 3X12B 2V9RA 4JY4A 2CRYA 3B9KC 5HHVL 4NJ9L 3BRFA 3UTTD 2GK0B 3MUJA 4GXVL 5EU3A 4QTHB 2CRZA 4Y8AA 4OI9A 5F1NB 3BKJH 1NSNH 4UAOB 4FN0A 1CLOL 2XQYG 1BD2D 1GGCL 3UYRL 1QLRB 1NL0L 5CHNB 1N59B 2X9WA 1RMFH 5FM8A 3IU4H 1J8KA 5FK9A 1TVHB 3O9WC 4PRHE 3MV11 4ODWA 3VFMA 1KJ2A 1UACL 5ITFA 5KSBF 4YHLL 3UEZA 3LH2H 2H26B 3P11L 4JRXB 5HGDB 1F13A 5A2KH 3V6ZA 1X3DA 2ZNWA 1RK1A 5E7BA 3TBSA 4P5KA 1MLBB 1X6LA 3MRCA 3Q0HA 1XZ0A 1FH5L 1X5ZA 2FSEB 3S9DB 1RAMA 4GG6A 1H8SA 3ES6A 5FGCE 4YXKH 3KYNA 2VXVH 3NH7L 1FL3A 3BGFC 1E6JH 3AREA 2X4NA 3BIKA 3SHSA 3DYPA 5LGKA 1YY9C 1DBBH 3OAYK 2PF6A 5GGVL 4ODSL 4XMLL 3RTQA 5SWZA 4FQQB 5CS7A 4YC2C 2JE8A 4JZJA 4OFIA 4G42A 1L0XA 3TIEA 3AS2A 4J6RH 3O3EB 2CMRL 3RGVB 4OZHE 5C09A 5GS1B 3C60A 2K9UA 2C4FU 2RHEA 1J87A 1LDSA 4RFNC 5DRNA 5IFHL 1CQKA 3HB3D 4OGYL 3F7QA 3S35H 3HFML 3D3VD 3P9LA 1F4HA 3MCLH 2FO1A 4X7FC 3HC3L 1JPST 3T0EC 3K8MA 4FQ2L 3QNYB 3MFGB 2BJML 3VFGH 3WJJA 4AENA 4XCNA 4PJBF 1CGTA 2VDOH 3NACL 1PD6A 3FQNB 3IAGC 4TULL 5I18H 3IFPA 5HI4D 4S11A 3GDBA 4L4TE 2Y7QB 5DI8A 3VG0L 4LSVH 1A3LL 4KVNL 3MBXH 3HI6L 3WFDL 2AABH 3GB7A 1WIUA 4MSWB 1F58L 2XWBB 5KZCD 3QUKA 1T89C 1LEIB 1CL7H 4C4KT 4ELMB 3T1FB 2GY5A 1KCVH 2IADA 5D7KE 5IBLC 4GRLC 3ROLB 4U6XB 3PWJB 2P49B 4UILH 5TH2B 3MV8D 5CP3H 4UQ2B 5F9WC 3GM8A 1EO7A 5FYKL 1U92A 3C9NB 3TZVB 5DMKB 1CN4A 1MVUA 1IAMA 4FXGB 4LEOA 1F4XH 3EYSH 4N0CC 4ONFL 3MNWA 2FEDC 5GHWL 4NPYB 4H5SA 4W70A 4YHYB 2E7BA 5KVFL 1CE1L 1XGPA 5IROC 2ZP0T 4NQVB 3G5ZA 1FDLH 5TPWH 4H20L 5ITBH 1H15A 3WJJC 1ZT4A 3SDCC 3WIHH 2V7NB 1F90L 3PWPE 5CJOH 2DDQH 4IJ3C 4O9HL 5J12B 4YDVA 3GIVA 5HYSB 1AJ7H 2PXYC 3PIQA 5DJAB 5BVJB 3MMEA 4OUUA 1EMTH 4JPVL 2UWEF 1NBYA 4F7TA 4OUOA 2EDRA 2R0ZH 2PCPB 3D3VA 1BHGA 1NCWL 1YN6A 2ICEA 4OLUH 1IGCL 5BRZE 4QXUL 2PN5A 1T2QH 4OAWA 5HHOA 3MODH 3TA3A 3BKJL 4X6EA 5FGRA 1QRNA 4P4RA 4KFZC 3B5TA 3EDJA 4XBEH 1I75A 3H7BA 4JFDE 2BNRD 3HMWL 4MNQB 2VMFA 5HY9B 5GSVA 2UZYB 1IQDB 1FBIL 5F1OB 4OGAC 3EOAB 5A2IH 1HIMH 3W5MA 4U1LB 5ANME 3ULUC 3LQAL 1EEQA 2V7NA 3DHMA 4NHCL 4Q6IA 3MOAH 2CLRA 5BOPA 1UWXK 4KU1A 3V7AE 1FNHA 4UDTB 4ZD3L 1AKJB 2R29L 1TMCB 5DVNA 4IOFD 3RZCB 1UB5B 4Y4FB 5EWIH 2UUDK 4WJ5B 2V5RA 3QIWB 2BSRA 3KR3L 2X4QA 1FZJB 1UEMA 4S1DD 5DK2A 1A8JH 1A7NL 3VMPA 3VA2C 1GAFL 4HW6A 1GCFA 2BMKA 1P53A 2EYTB 3MLZH 1BD2B 5GZNC 1OY3B 3GRWH 3JVGC 2ICCA 3OJVC 3INUL 3TYFA 5DRXA 3OKLB 2HFGL 5IVZA 2OK0L 4HGMA 4MHHI 4KKCC 1YECL 3ZDYF 4LARH 4GAJL 3UPAA 1DJSA 1WIOA 2A6IB 5A2LH 2OZ4L 3PWNB 4LAQL 1HQRB 4GBXA 3DGGB 3MPCA 2DD8L 2KZ1B 3OAZH 4F37K 5J13B 4XC1H 3CC5B 2GJZA 5HJ3A 1B6UA 3O11B 5KS9E 1SQ2N 5HXMA 1ZT7B 1CIDA 4WUUB 5I8KL 4TN9A 4MCZA 1KTDA 4J8RB 2CO6B 4FFVD 2XZQL 2X5PA 3VFSB 4MQXC 5HHOD 1EO8H 1DLFL 1D5MB 4P5TD 3M07A 2XRAH 2YUXA 5KW9H 1U3HC 1EFXB 1K5NB 5BVPH 2BMKB 1F3JA 4F2MB 5FYKD 4ZO7A 4HDIA 3RL1A 3O9WD 4HC1A 4CN4A 1C7SA 1FFPB 1ZS8B 2YUZA 5C0ND 2P8PA 4UTBH 4ZO8A 5HYEA 1QZ1A 3SKOA 4G43A 4KQ3H 4P2QD 1BVKB 3KLSA 4QEGA 3MRJA 2AABL 1BPVA 5CEZL 1U91B 1S9XA 4ODUB 2E9BA 1L6XA 3O11A 4ODHL 3UTSB 3HUJE 4FFWD 2OSLA 3PP3K 2OJZL 3ULVL 2X4SA 1MCPH 4L8BA 3GHEH 3FTGB 4KMQA 5DSCB 3RI5K 1G7MB 2P47B 2C4XA 1TTGA 5FUOH 2IF7A 3C08L 5E56A 5F7YC 2I9TB 2EIZA 1L7IL 4K3GA 5E4IA 3P4OA 4ONGH 2L7UA 4TPRL 3ARFD 4JRWA 1IAIM 4IHOB 3UTQB 3W11D 4XI5D 3VCLB 1BLNB 4YBLB 1FCGA 4YFDB 3NZ8A 4PRBB 5L0QB 4ZYKA 4OLEA 2GIYA 2FR4B 3ARSA 2A83A 2YC1A 3WFHA 1X7QA 4MMZC 1HINL 3U9PL 1WZ1L 3HNTH 3GGWA 3WLWD 2F74B 1JTOA 2R39A 4KRLB 1T5XA 4LKXB 1HEZB 3GO1L 5D2NB 4A2LA 4JR9L 1KN4L 1VERA 1QSVA 3U7YH 2X6MA 1PSKL 1AO7E 1FV1A 1I9RH 3M17B 1JMXA 2J5LB 2NY5L 1CXFA 5BS0D 5GGUB 2Q87A 1HOCA 2G2RA 2WUBH 2ESVA 1RU9H 2AK4B 1A7OH 4JDTL 4R6UA 4GMSL 4NBZB 3RWJB 1DE4A 5C08E 5DUML 1K85A 2H41A 1B2WL 1FORH 4KTDH 5ESQA 5FUZL 5HHMB 1P1ZB 3UJTL 3BKCH 5EOTA 1ED3A 2QQQA 1PVHA 1NCAL 4KH2A 4LEXL 3MYZA 4K94C 3KNBA 4U6XA 1A1MA 1F4AA 2AJ3B 4S1RH 1D6VL 2ZCHL 3TA3B 3FOMB 3DECA 1MCNA 4X6FB 2WBJB 2APFA 1I1AC 2ED7A 1G7PA 4CRPA 3GHBH 3WFCL 4ZTOH 2H8PA 4M7KL 5JA8B 1XIWA 2ITCA 1HQ4B 3BN9D 4YEEA 3FCTB 5IB4A 1EDQA 2BNRA 3T09A 1MHEB 4P5MA 1ZEAH 1H5BA 2R69H 5ADOH 1K4DB 3ZHLA 3H42L 2XTJB 5B3JF 1IKNA 3CD4A 4QTHA 2BVQA 2MTPA 4Z77A 4XMPL 1H3TA 4DK3A 4ZPVB 3PWVB 1NSNL 5C86A 4LSTL 2BP3A 5DD3H 5ICZA 5DWUL 1OTUD 5E94A 5T1KA 5IBUG 4Z8FH 2HLFC 1ZLWH 1JF1B 4HCRH 2W59A 4PGDA 1OB1B 3RDTC 3TH3T 3E0GA 1UWXH 2YD2A 1F00I 1P4LA 3TN0C 4Y8DC 5D1ZC 2VLRB 4GW5B 5I6XB 1K9TA 2IFFL 3FZUC 3W0WD 5DR5H 5FO7B 4QRRE 4WWKB 1QFWM 3LEVH 1FAIH 4ELMA 2VC2L 4TUOB 1FE8L 1OB1A 4LSSH 5D72H 3B8YA 1BMGA 4XVTL 4N90E 2GJ6A 4TQEH 3B9KA 1DBJL 2FSEA 3SQOH 4OZHF 3F12A 5D5ME 3HMXH 5J11B 5I76A 1CICD 3JWOL 4G7VH 1SJEB 3RWCA 3V6ZB 5JOFB 3H9SD 4LFHD 4ZYKB 3WN5A 5IVXF 1PY9A 1S5IL 1U3JA 1KIQA 3BAEL 5D7JA 1MRDH 4U1SA 4LVNC 4E0RA 3LV3B 5ESVA 4X5XB 4OI8A 2OP4L 2A77L 1ORSB 4OM1L 3V95A 1S7SB 1PLGH 1BOGB 3ELAT 4WHDA 4MS8C 5CSGA 3TWCL 1S9YB 3OR6A 4RBPH 5DRNB 3KPNB 4DGIH 1ZVSA 1WFNA 3D85D 4DFIA 3KNBB 3MLWH 3TN0A 4NZUH 2YRZA 5J57B 3LD8B 4UIMA 5BO1H 4WFED 3PGCA 4YQXL 3LZFH 2WBKA 5SX4H 5I8OL 3DWTA 3LQZB 3MUGA 3VXRD 5IWLA 5CSZB 3QHFL 4NN5C 5JW3H 2DN7A 5C0IA 4BSVA 4D9QD 4M02A 2CKBA 4KGLA 1Y6NR 5FO8A 3H9SB 5DA0B 3FFDA 3RZWA 3U7WL 2JJSC 4MQXD 4FABH 1HHIA 1QFWH 4J4PA 4XTRC 5T33L 1NFKA 4J3UA 4N0RA 1Z5LB 1KJ2H 1ZHLA 4AJ0A 3QAZB 4JZJC 2YPLA 1PW3A 1OTSC 1AXSB 1NKRA 1B0RA 2ZOLB 2ITCB 4C54A 3DOSA 1OL0A 1BAFH 5F71A 4JPKL 5IOPA 4KPHL 1QQDA 4TVPE 2E7CA 2G60L 4Y5YC 5SV3A 2F5AH 3M8OH 5C1MB 3DO7B 2NY2C 1YEEH 4LDOB 5F1IB 1XCTA 3TP4A 4PB9L 1A14H 2LAAA 5GJSH 4NN7C 4YNYB 5GRVL 1QKZL 2NTFA 3IDNB 4Q9RL 2F53A 2IAMB 4NQXA 5E7FA 4ZPTA 4XP5L 3H9SA 4ZUWB 4OGXH 4ZS7H 3ARVA 3DARA 4MMXC 5DTFA 2X4SB 12E8H 4OLYH 4HAFA 5F1NA 5IV2A 3VFRB 3C8KB 4IS6B 4D3CL 3S4SA 5FYJL 4LPYA 3P9MA 2FDBP 1U8MB 3C5JB 1HHGA 1WC7A 5L2KE 2DKSA 2L0DA 4OCYL 5KANI 2DIBA 4ORGB 3VXSE 3SDXF 3VMNA 2VISB 4OQTL 1QEWB 1BP3B 5ESAB 4ZOBA 4MQ7A 1CG9B 4I8DA 3MR9B 2BVOA 4YHOL 2D7PA 3CPLA 2GSGB 4ZSOB 2I5YL 3A67L 3EW3B 5L7XH 4X6CE 5F3HB 1JYNA 2EDYA 2LVEA 3HMWH 5KSVB 1MI5E 4X6DA 4JM2F 1ND0A 4QY8B 4LHUB 4FQLH 1T4KA 4U1IA 2DWDA 1TZIB 3OKOB 4E42B 2E6QA 2C1PA 4GO6B 4Z78A 5I1CH 4RMSA 5I1IH 4AQ1B 1QP1A 5F7NC 5ICXA 1U42A 2HYMA 3FB6B 4KHXH 2AJVH 5DHVH 2VJXA 3U36A 4NKOB 3C2AH 3LKSB 3FO2B 2CPCA 3IGAA 5I1AB 5ERWB 5J3HC 4P46C 3HMXL 3ULUL 3ARBB 1BZ9B 3P2TA 3QG6B 2PW1B 2HRLA 5DUPL 1IAOB 5A1AA 5IBUB 4EVNB 3CSGA 1A7NH 2G5BA 3MBEB 1UZ8A 4NYLA 3C5ZB 1NCDH 2X10A 3N06B 4MJ2A 1Y6KR 3OGCA 4MNHB 4PG9B 4XPTH 1C16A 2VXSH 4M1DH 1HH9B 2W9DL 2X4OA 3Q1SH 4M3KB 2F74A 1F11B 5ADPH 1JWMB 2FBOJ 3ZE2F 1NEZA 2JK5A 3MACL 1T1ZA 3W0WB 4ENEC 1IC5H 4QXUH 5HJ3B 3TWCH 3OZ9H 3TBTB 5JW5B 5CINH 3HE6A 3E3QE 3CZFA 4NT6B 1N0LA 2CDEB 5EU6B 1TCMA 1UJ3A 3CFEB 5AYUL 1S7WB 5I8KH 2XFXA 5CUSL 1MLCA 3OKDB 4UINH 4X5XA 5K33A 1IBGL 1NBZA 3V7AG 1MEXH 5DHYA 4LLUA 4LLDA 3AXLB 4OKVA 5I71B 5SV4A 5GRXG 4P4RB 4JM2C 3ZO0A 1ZA3A 1NUDA 2R2EA 4UT6H 1P7HL 2WMPA 5I0ZA 5I8CA 4HG4K 2RAMA 4RGNE 4CVXA 1AO7B 4OZFA 1P2CB 4YE4L 1ZV5A 2EDLA 3NN8B 1CT8B 4KJPD 4HKJA 3SCMB 1KG0B 3HG1E 1I1FB 3PNWA 4KKBD 4U0RC 4W6YB 4M7LL 5HGHB 5F9JA 1T04A 1KCSH 4V1DE 2VZSA 1XIWB 3TO4D 3L3HB 1DQTA 1SM3L 2Q3ZA 4HS8H 2NY0B 5J89A 1DBMH 3OXRA 1A22B 1XF2B 3OG4B 1NMBH 2FL5A 3QQ4B 4I2XE 1OTTC 2DQEL 4ZUVA 1G9MH 1NAKH 1MJ8L 4DGYH 1PGRB 1SYSA 1NH6A 4XVJH 4OFDA 5DUBA 3MNVB 3DSFL 3EOTH 3OKEB 4OCNC 4G42B 4L8SB 4WHTB 4KVCH 5I73C 4WDIB 4JREB 2FHCA 5D6CA 2DQCL 1VGKA 3NCJL 5E1HB 2OZ4H 1PEZA 3T4AA 4G8GB 2LU4A 3ZDYE 1S7QB 3QXAB 4IRSC 5F1SA 1G7JB 4PJ9B 3D39A 3ULVC 2F9BT 2RJMA 3QXUA 3WO3B 3PHOA 3SCMD 3FHAA 4FZEL 4S2SB 2W1NA 1YC7A 1J1OL 4GFTB 5JOPE 4L8SA 1SBBA 2PXYA 2XTJE 3TT1L 2QV2A 1PBYA 3MOBL 2X70B 4PJHA 3L5WA 3NFPB 5HI3C 3GRWA 1AR2A 4AEFA 4P3DA 5CILH 4JFXA 4A6YL 3NABL 1BF8A 5EBLA 4OCXH 3WNLA 3RHWK 1X7QB 2HKFH 3DI2B 1VA9A 1EEZA 4YFLI 1FJ1A 1BVKA 1E27A 1YPZA 2JELL 3U0TA 1IM9B 5KVGL 3S36X 4WTWA 1UKSA 1QA9A 3T65A 1TVBA 3LKQA 3UC0L 4I5BB 4PJ9D 1TTFA 2YUVA 5I19L 3PHOB 1G7MA 1V3MA 3QNXB 3RWFB 4OZ4B 4OF3A 1RFDH 1KTLB 1UEYA 2A1WH 1AGBB 4QYOB 1HNFA 1JPSL 4C59B 4KV5E 2H2PD 4ODUA 4Y4KB 5DJCB 4JKLA 1VADB 4QXTA 5DD6B 1EO5A 4PGBA 1JHKH 4BZ1L 1K4CA 3O6FA 5EOCH 4N0UB 1ZEAL 1WICA 4XNYL 5JUEL 2Q20A 5BJTA 2XA8L 1NAMB 1FYTB 2EIDA 2P5WA 4CDHA 4RX4D 1QBML 2H6PB 15C8L 5I8EA 4HIXH 4XNZB 4YHPB 4PJGA 2CDFB 5TFSL 3GMQB 1YY8A 1AHWA 5K9KA 4DJMA 2R1WB 2Y07L 1T3FB 1WTGT 2Q7YA 4XMPH 2QL1A 1SJHB 1J11A 1MHPL 4HBCH 5B39B 4X7TB 1CT8A 1R3KB 4LHUD 4NQEA 3F7YB 4UNUA 3N0PB 1YMMD 2PW1A 1S7XB 4CGTA 1QYGL 1I4FA 5CBAB 1JTTA 1CLYL 1MFDL 1DQMH 4G80A 2IPKB 1NCCL 4MWFB 4HUXB 1BQLH 3LEVL 4PJAF 4WNQA 5EIQA 3O6FB 1CICA 2VXTH 1IL1A 3WNPA 1JRHL 3GSNH 2A9NH 1Q9KA 4IMKC 4TNVK 3ZTNH 4HWUA 3I2CH 4G7YH 4P59H 5GZOD 1V3JA 1Q9LB 3FZUD 2MCPL 1HXYA 5CP3A 5E6ID 5TDNA 1U8OA 3TBTA 5JW5A 3N1PC 1CGUA 1H0DA 2B5IC 2OTUA 2CRIA 2J2ZA 2VL5A 3IKCA 1GL4B 3QJFB 3H3PL 1PZUB 2O5YH 3VG0H 5IJVB 1FN4A 4LSVL 3QEHB 3V0WL 1FG2A 3T0BA 2ZUVA 4NC2B 2OTUB 5F44A 4I5BA 1DBML 3MRBB 3UZVB 5FGSA 3T2QA 4MLSA 1NFDE 2FR4A 1WT5C 2VLJA 3U4EA 5L88L 3HKFA 4L8CA 1NFIA 3QCTL 1EERB 5D2NC 3HB3C 4HCRL 1CE6A 2HWZH 4Y0GA 1UXWA 1BBJB 2AJSH 1P4BL 4NQUA 1TZGH 3LS4H 5L6YL 2J5LC 5H35B 4MXWH 3KLHD 2HT2D 1QLFA 5A43C 5EU7C 4ZXBB 4D9RD 4OLZL 4BUGA 1AQDA 5F7KC 2O93L 4Z7WE 4Z7VB 1GZQA 5CEXB 3RAJL 3DV6A 2CJUH 4NQED 4YR6B 4Y1AA 5TPWL 4O02L 4S1SH 4H20H 4HSQA 1CE6B 1C5BL 3V4VH 4BFIB 1DBAL 4P5TC 4P9HC 1ZHLB 2I60H 2YPKB 3GI9L 4XBGB 4LRIC 5EBWA 2ADJB 2VO5A 4P3CL 3OBAA 4PGCA 3PL6A 5IJKA 1ES0A 4ODBD 2OYPA 1A6WL 4P2RD 1I7TB 3KPQA 2Y1VA 1LO0H 4PV9A 1TETH 3G6AB 4E5XB 1IGJA 2DLEA 1ZHNB 3QB7C 3CDGA 2HJFA 3IS1X 1V3KA 3CK0L 3B8SA 2P7TA 1OF2A 4BH7A 1RUAL 1K2DA 1A7QH 3FL7A 1FFRA 3NCMA 2BZDA 3Q6FB 4BQBA 3NPSC 1GZQB 3CVHH 4X8JB 5EZJB 4U1LA 4UQ3A 3VU2A 2DQJL 4O51A 2CKNA 3TPUB 4BFIA 3QDJD 5HSFA 3MUGB 3LRGA 3F7PC 4NQCE 5DF0A 5E2VL 2F53B 4X4ZA 3GB7B 4K2UH 3ETBF 4X4YA 5GGTH 4MYWB 3HHRB 4G9FA 1MCKA 3M1BB 3DX9A 4Z0BL 4K94H 5I6XC 3BZFA 4F7EA 2AW2A 1D6EA 15C8H 3FOLA 3O2DL 4ZAKB 5HHVH 3QFJA 4PTTA 4HWBH 1N5YH 1J0IA 1M71A 4I0CC 2XG5A 2P8MB 4PP2A 4GXVH 1ZHKB 2WINA 3EYOA 5FYJE 3EYVB 3AGVA 3NFNB 2NTSP 1MCJA 1LNUA 2P7TB 1RIHL 1FL5A 3QDGA 3VFOB 3PHQA 4DZ8A 5I2IB 3JV4B 1HK6A 3L5WB 4NCDA 4P23B 3VXUD 1REIA 5L8LB 4BZ2H 5DO2D 4OFYA 5E2TH 4ACPA 3ZZ1A 1FGNL 3P9LB 3HZKA 4FXLA 4MQ7B 5JQHC 1CLCA 1YY8B 3U4AA 4TSBH 2YPVL 3KYMA 4KZDH 2RCSH 1XCQB 3MLRL 1LE9A 4KXZH 2P44B 2YOCA 3FT2B 4IRZH 4R90L 2XZAL 3RWEA 4HUWA 2APBA 4Z7UB 4FTVE 3CH8A 2D31B 3O9WB 2EYSA 5EO0A 3RVWC 2OR9H 3F6LA 2A9NL 4JKWA 1T21B 1CCZA 3MYJB 5HGAB 1ONQA 3VFRA 2E9JA 3ARBA 3I2CL 4G7YL 5CIPA 1JZ8A 4ZNEA 1LO4H 1KTLA 3PGDA 4X6EB 1I8KB 3NIGE 3SE9H 1U95A 1S9YA 3OR6B 2BVEA 5CCKH 2Y5TB 5DZLA 4ORZC 5GSVB 1IKFL 2ARJA 1BVLA 2EYRB 4WCYH 2YSSA 1P9MC 3FB8B 4PPTA 4Z7VA 1UM4H 5JIIA 1U93A 3BGFB 4GXUM 4OV5A 2BY0A 3P73A 5DJZA 1A3RL 1UA6H 4GW4A 2FIKB 1AXTL 1TZHA 4MD0A 4OT1L 1IARB 1U91A 1BVZA 3MRPB 4G8FB 2WANA 4JFFD 2Y4SA 4JFHD 1JZ4A 1ITBB 1KIPB 1J8HB 4OLWL 4G8GE 2FD6H 2LTQB 2FJGB 3DRQA 1YEKL 2JB6A 3QAZC 3B6SA 4JZJB 1RIVH 3KDMB 3DUUB 1X4ZA 3RKDC 1BJ8A 1U95B 5D1QC 4OIAA 3QPQC 4HIJB 1YNLL 5CIPH 1DANU 3MNWB 3N9GH 1FIGL 4ZTPL 4L8DB 1EHAA 2DOCA 3TV3H 1MNUL 5I18L 4XP4H 2XWJB 1CGYA 4Y4HD 3MRLA 3KDMA 1SYVB 2E3VA 5JIPA 1SJXA 1KF9B 4PRID 4GKZA 4QOKE 2I60L 1HEZA 1OAYH 4XH2B 5D5MF 4WW2A 4P3CH 1FO0H 4JAMB 4G6KL 5FGCB 2H32B 2NX5A 3CU1A 4XX1G 5DJ8B 5FM4A 4U1SB 5TE4L 3QI9D 1W0WB 1DFBL 4JZOA 4NGHH 3SDCA 1KJ3L 1S8DA 1RK1B 4L9LB 2WLYA 1F4XL 3MBED 4PD4J 1V8HA 1FNGB 5F9WB 3SKNA 2EDHA 5GZND 3KPSE 5H8DA 3BUTA 3QIWA 4UMGA 1EAPA 1FO0A 2WV3A 2R1XA 2IBZY 3TZVC 2NX5E 3EIFA 4PJIE 3FONA 4OZHB 4FZEH 5DHYB 1M6OB 5IFHH 3SN6N 1FYTE 3ZTJH 5D70L 4P57B 4U33A 4MQSB 1NMAL 4WHTA 3BOVA 4HXAH 4JQXC 4LCIL 2L4OA 3WN5C 4DKFH 5A16B 1RUKL 4JFZL 4XPHH 4F7MA 3PGFL 1A5FH 2NY1D 2VDKL 3D0VB 3KWWB 3T3PF 1GHFH 4ENED 5FO9A 5GGSA 3KPSA 4MA3B 2DBLH 2A6KB 4NCC1 3GSVA 4MXQC 5HGBB 1QFPA 5DURD 3AS0A 3HUJA 1IM9A 2H9GA 1J8HA 1GVIA 3QH3B 5KBNC 3MGOA 1DVFA 4OIIH 3CFCH 4O4YH 4K23H 1FGNH 3L3OA 5J6HA 4PTTB 3QG6A 4N8CL 3IF1B 5H2BB 5JLZA 1Y0LB 1MAMH 1LO5A 1MJ7H 3WLBB 4MNGA 5JPNA 2F54A 4PY8I 5D7IF 5FYLL 5D1XD 5TGBB 3VFOA 3ZKQD 2NLJB 5I2IA 4PJGF 3D2UD 2AS5M 2FLBT 5ACLA 1DQQB 1DEEB 1N64L 1RZIB 4LSSL 3ARXA 1T7ZA 1G6RA 4HF5L 4OF6A 5I8EB 2XA3A 2BOBB 4R4FH 3K74B 4DUWA 1J12A 4ONOA 5HHQA 3KR3H 1TXKA 2YK1H 3PQYA 2OJEA 3JWOH 2B20A 4BQ6A 4F57H 1T0NB 1FDLL 1MREL 2D31A 4Z7UF 5EU6A 1JHLL 3MZTA 5K9JL 4Z7NE 4WJ5A 3MRFB 1FNAA 3WHXA 2VLME 2P5ED 2PR4L 2IANE 3QEGH 4HFWB 3F58H 3A6OA 2GHWB 3BW9B 3GK8L 4EXKA 1QFOA 3WS3B 4Z7QF 1NLDH 5D1QD 4XWGH 1AHWB 3GBMH 2DS4A 5K9KB 4NZTH 3VXMD 4R4BB 5DQ9B 3GSWB 1IZJA 3EJZD 1U8PB 4NQCA 3T65B 3I75B 2ENYA 4PRNB 5FB8B 1QBLH 3SCMC 3BI9X 3SY0A 3JUYA 1I1FA 3EO9L 4Q2ZA 2VNCA 3QJHB 5F7MC 4XAKD 2VOTA 5CJXA 1U8LB 4JRYD 3UC0H 2Y72A 4KI5F 1PEWA 5IHUH 1AGBA 4MNQE 4XZUB 2NY0C 4XX1E 3W9DA 5DYOB 3MXVL 1BFTA 4JHAH 1A47A 5DVKA 4JZNA 1XR8A 2XV6B 4JO3H 1XR9A 5ANMB 5BZWB 3LPWA 1A6TB 5GGTA 3HZVA 4GRWB 1YEDB 4XHQA 3NBNA 4HBQA 4N0FB 4NKMB 5I1GL 3TPUA 2ZG3A 1OLZA 1DE4B 1WFTA 1JNNH 1KCUH 3VWJC 4PJCB 4OB5L 1CGSH 4FMKA 5DMIH 1RSFA 3QUXA 4HWNA 1JPTL 1FO0L 4Y4KD 5MEPA 4I4WB 5E08H 5GISH 2DQTL 1GAFH 1FZOA 2G60H 5IW1A 2F58H 4G43B 4JO4H 4X80H 1TNMA 1VB9A 1BBDL 1IEBA 1BJ1J 1QHPA 4G5ZL 2FX9L 1TIUA 1H15B 3K2UL 1W0YT 5D71H 1BIHA 1RUPH 3JTSA 4OCMC 5T1MB 3BN9C 4AG4L 3QPQD 1INDH 3LEXB 3DX6A 2CGRH 2VN4A 1LEKB 2BNUB 4GRWH 5I66B 3GSOA 3B2UD 1CDCA 1GGIH 1KFAL 4BM7A 5IR1B 2R2EB 1HWHB 1QRNB 1XGYL 4ZQKA 2EDFA 1N3NB 2CUHA 2DTSA 3SKMA 4WO4C 4AMKH 3KPNA 4Y1AE 3RZCD 4YFEA 5ISZD 1TCRB 4KHTL 4CJ0A 4V2BA 3MCG1 3KVQA 3IU3B 4HMEA 5GS3A 4KJYA 1BEYH 3BQUC 3KPLB 4XNMA 3HPLB 5KTEL 4ERSH 4DN4H 4Y19D 4P9HL 3U9UB 5E2UH 3HI5L 5CEZD 4KTDL 3GSQA 2BSTA 3N1MC 4O4YL 4Z7UE 4FTVB 4HUUA 1IZKA 2DKUA 3CVHL 3FN3A 3IDGB 5EZIH 3FT4B 2VXUH 3ISWA 2Z93A 3O3EA 4LLUB 3HUJB 3G6DL 4RAVA 1HXMA 4J23A 3EO1A 1F4YH 2D7QA 3RU8L 1ZT1A 1DZBA 1LEGA 1HSBB 3ET9F 4HDIB 1MVFA 5IGXL 2CKBL 2MCG1 3SDDA 2MQ3A 5DD1H 4JDVA 3V5KB 2WBJC 4I48A 1UM6L 4HD9A 4GUPA 4P9MH 3HCVB 4YXKL 4MCYA 5E0QA 3L95A 2VXVL 5DJ6A 1AFVH 3VXTA 1R5IB 3RBSA 1EJ6A 3IDNA 1WZ1H 3HR6A 1I8IB 1IL1B 2R2CA 1JFQH 5FA4B 5GRJL 3ZHDA 2WIMA 5CGYC 1M7IB 5B4MC 3VRIB 1GYAA 2P5WE 4WW1B 3BKYL 2VDML 3O4LD 2NW3B 1NAMH 3OJDB 5FCSH 2HT2C 4DW2L 3AU1B 4IBLT 5GGQH 3IS0X 2J8UF 2B5IB 2EH8L 3VXPB 3F62A 1IQWH 3QIUA 3PHQB 1JMZA 3UTZA 5KVEL 1F8TH 3UTSD 4M5YH 4QHKJ 3RZCA 4LSUH 3HPJB 3BWAB 1FORL 1FE8H 3MR9A 4MJIE 4NQVA 1AIFA 1I7UB 3OJDA 1NGPH 1N2RA 2VLKD 4QKXB 3IRPX 5IB5B 1FZJA 4TQEL 1PKQB 2EEDA 4HIIB 2NY7H 3ULSA 4BA8A 3GFUA 4ISVB 4KTEH 1NGYB 2ATKB 3CFJB 4ZUSA 3TIDB 4PGBB 3LAFA 1KJMA 1ZAGA 2AGJL 3S88H 5E2VH 1MFEH 3QG7L 3WNNA 4QRUB 3WL9B 4UQ3B 4XPAH 2W0PA 2Y23A 3RQ3A 4D8PB 3C6SB 3HNVH 2RB8A 4ZO6A 1FL6A 3HI6H 1HSAA 5AYQA 2AXGB 1ZSDB 1EH9A 2ZCKL 1BQHB 2ILLA 2MJWA 2BHUA 2FJGA 4RBPK 5TJWK 2F58L 1NAKL 4KRMB 3RIFF 5MENE 3OF6A 3VFSA 1R3IH 1DUYB 2AP2A 3EYOB 1NLBL 2ZG2A 5C0DA 1OAZL 5C0BD 3PL6B 4HXBL 4NO0A 1VFBA 4Z76A 2V6HA 3DMMD 1C08A 1T20B 2BOCA 5FB8A 25C8H 4F3FA 3CLEH 3BD5A 3AB0B 35C8L 1FRGL 3H8NA 4K7FA 2YKLH 4QRRB 1F4WH 4QWWC 5CWSB 3MJ8B 2APVA 5D2LA 3F7VA 1FL6B 2CDFA 1JN6B 5JW4N 4FQXA 4JKMA 4DFHA 3PWPA 4OGAD 2CKBB 3D48R 1JGUH 4XH2A 4Z76B 3BDBA 3TEUA 3BH8A 4OCRL 4NNPL 2AAVA 3TCLB 1VACA 4YLQT 5IM7A 1Q0XH 4KK9C 3S3PA 3MGTA 4QXGL 5GQBA 2IPUG 2CXGA 1GPOL 1UJ3B 1GGBL 3ZE0F 3VI4F 3V52H 1BFVH 5D7LD 2MQCA 5JHDD 2P48B 3AAZB 1QACA 5AD0B 5BCAA 4H25A 2I26N 2W0FA 2VDLH 3KXFA 4LLVB 3BEWA 5FYKU 4NWUL 4HMCA 1TQCB 3TNNB 1W8NA 1FBIH 3DETD 4WENB 2JKXA 4GKSA 3QDMD 5DJZB 4X7SL 4HC1L 1RFDL 1J1XL 4NDMA 1JGLH 1LNUB 3QDGB 4NQDD 4NZUL 3AM8C 3ZDXE 4DZ8B 5A3ID 2WIIB 3FN0H 4OLVH 2DLHA 2JCCF 3OAUL 4RNRB 3TNMA 3RU8H 4JY5H 3TJEH 3H2WA 4WW2C 3GSQB 2XZCL 3VFPB 4TVPL 5FV2A 5ID0A 1DUZA 3L7EA 3IDIB 1INQB 4TTDD 1OSZA 4XAWL 4HUVA 1RUMH 3OF6D 1FZMB 3A0OA 3L5JA 1HWGB 2YR3A 5DEZA 3G5VA 3GSVB 3DYOA 1I1RA 2Z31A 1ACZA 3O6MH 1KPVB 5DEGA 1JFQL 4LBEA 4BK5A 1N3NA 3UJIH 4Z0XA 3RI5F 3JVGA 3EDDA 3CPLB 4LHUG 4Y89A 5A2JH 1NAML 4NQEB 3OJMB 5DD5H 4UUJA 3HI1B 1YYLH 4YDKH 1CVSC 1PDKA 3AC0A 5E5MB 5C09D 3C8HA 1T1XA 2HG5B 2SEBA 4NOBA 3DIFB 4GAFB 4M1CD 4JM2D 4M5YL 2CK0L 1FNGA 4EBQL 2GITA 4EUPA 4GT7A 4H1LA 5JO5A 3CFDB 1TQBC 3VRJB 1EO8L 1DLFH 3LEYL 4DEPB 4GRWE 5BW7C 4LGSB 4GBXB 5IF0A 2YK1L 4FRWA 2UYLA 2AJZB 5DEGB 3T3MF 4X4YB 3FB6A 4PRPA 2IGFL 1OGAD 3C6LD 3S88L 1OVZA 1UWGH 4PJXF 5B8CC 5DRZB 4IRSD 3R0NA 2R1XB 2XKUA 3OAYH 4ZOEA 3FRPG 3VRLE 2BOBA 3CMOH 5C0CB 4LLMA 9CGTA 2NNAA 3SBWC 43CAB 3MBEC 4HK0B 2R0LH 2XKSA 5T3ZD 4X9IA 1J1PH 1LK3L 1ORQB 3WV0A 3B2VH 1IE5A 3S4SG 4OI7A 1R5VB 3MLTB 4WUUD 3LRHA 2NY1B 1NL0H 4LSQH 4XZUA 1IEHA 3CFCL 5KSBA 4HWZA 1NLBH 2HJLA 4LCWB 3PXJA 1B90A 1IBGH 5LGJB 1HSAB 2J6EL 5I76B 5IMOA 1CDUA 2W91A 1UXSB 1MI5B 3SE4A 4IRJC 1EX0A 3C60D 3VFGL 4LLQA 4YPJA 1G7QA 4PD4K 5B4MD 5IB1A 4AH2B 2VLLA 3S3SA 2GJ6D 4DKEL 2RGSA 2R4SL 1CDYA 3F7RA 2QJDA 2FYYB 4HS3B 1D5XB 4S2SA 4Y1AB 3P4LA 1O5DT 5D2LE 3S8WA 4EI5C 1GGTA 3CVHB 3PWLB 1CFSA 1HKLH 2IPTH 5JR1H 5CLWA 1U2CA 5EBWB 5F6HJ 2X4TB 3QQ9C 1RJLA 3D5OF 4ZPTB 3LS5L 1E4WH 1CL7L 1TVDA 5EOQL 4U0RB 2DQTH 4OZHA 4JE4B 4EUPG 4HIEB 1S7TA 1GRWA 4P4KB 4JO4L 4X80L 4OM0L 2HH0H 3PWVA 2ZKHH 3QEGL 2PR4H 3HAEA 4CN6A 1DQDL 5FHBH 3PWUA 3WDHA 2Z4QB 3QUXB 5FECA 1MCIA 1RK0B 3QIBB 4BFEA 4G8EB 3FQRA 3QRFM 2DLTA 3DXAB 1RUQL 2QADB 3QEHA 4PGZA 4MJIA 4P4KA 1IAIH 2YS4A 1IEAA 5KVFH 3ME0A 2GSGA 4ZSOA 3RX8A 2IAMD 2QQKH 5KN5B 1U92B 4N9OB 4NNYA 3ZMRA 4MB3A 2B1AL 5HDLA 3ARGC 5DQJA 4Z95L 1ED3B 2VRAA 2QSVA 4OGYH 1M7XA 1U8LA 1BJ1H 4O2CA 3GMRA 4P2QB 3LVEA 3QXDB 2YPLD 1ZHKA 4D0CB 4TUJA 4KUZL 3HZYA 3IETB 2LFGA 4WI7A 4U1KB 5JHDB 4LOUC 4PJXB 1A9EB 2APTA 5F7DB 4PJ5B 1J0HA 3WFDH 4OZIE 5KSBB 1Z9LA 3F7YA 2IPUK 3DRQB 3SDDD 5D7JB 3U0TB 4E0RB 5I1KH 4HCRA 3LPFA 4Y4HA 2WSKA 4MD5A 4WGWB 2FWOB 2IPKA 2EYTA 2DQDL 4YBQD 4B0MM 1L0QA 3CAFA 4EVNA 5TDOA 5DVLA 4M8VA 4UOW0 3GMNA 4MJ5B 1MH5A 1JNLL 4DCQB 1BFOB 1A9BB 4C83A 3V8OA 3EYSL 2VH5L 1C5CL 2AJXL 3CFBB 4PJEB 4XCEB 5EC2A 3CDGB 5IR1A 5FXCH 2DTMH 1YEFH 3X3GL 5CCKL 4BJLA 4MS8D 2IGFH 2W60B 2VUOA 2VABA 1CGWA 1UWGL 5DRXB 3RTQB 3LEXA 4LLWB 2H6PA 1PYWB 1XGYH 4D94A 5GS0H 1BOYA 2AK4A 1S9WB 1S3KL 5HHNB 4JGMA 1FGVL 2ADFL 1W8OA 2MFNA 1NC4D 5I66A 1UM5H 4DW2H 2FGZA 1QO3B 4YEFA 1WIPA 4JHWH 1KC5L 3ZE0E 1JUFA 5CBEB 4NWTH 5KS9B 3KLHC 4RMUA 4JGUA 5J7CC 1FZKA 2V2WB 3H9HB 2KKQA 1QSFB 4OJFH 4LU5H 1H3XA 4HK3J 3LMJL 5C0FA 1AIFB 3VWJB 2VITA 1KACB 4PJCA 4JQXA 1BZ9A 1K5NA 4P59L 3IXTA 4MSWA 2NZ9C 5IESL 2H26A 3QHFH 2GAZA 4ZFZA 1FL5B 1KIUA 4KTEL 4HUMB 2A1WL 2FRGP 4ZS6C 3K1KC 1Q9KB 4G8EA 4LGPB 3BD4A 2CIIB 4BFBD 1JF5A 4LVOC 1QBAA 3N85L 3NGBB 5HI5C 4NRYB 4X7CC 5JXED 4NSKA 4M9OA 4CVUA 4FP8H 3ZT7A 3SE3C 1I3RA 4JANB 4Y5XB 1XGQB 3VCLA 4YIQB 4N0UE 3KHOA 4FNLL 1VGKB 3QJFA 4PRPB 4QY8A 1YNTB 1ZLSL 3DJ9A 3M8OL 1ZVYA 3DVFA 3QNZA 3H3BC 5CIPB 5GS1A 2HVKB 5EBGA 4PRIB 4LPXA 2PYFA 4I0KA 3VH8B 1KENL 3IDYB 3QDGE 4B7LA 4POZC 1MCWW 4F9PC 3I6GB 4H5SB 4CU8A 2YZ8A 1H3VA 3MLTA 3S36L 2NYYC 5EU6D 1Z9SA 3EYUH 1KG0A 3GGWB 1NGWB 1GOFA 2ID5A 4LPWA 4YXLL 4ZUUB 1UWEH 1OP3H 1LE5A 3CDCA 4XCCH 4YIQA 1KJVA 5IK3A 4X9HA 4JQVC 5LWYH 3GI9H 5D1QA 1I8LA 4P23A 1BLNA 4X0KB 5BV7H 4NNPH 5AG8A 4EIZC 5F8RC 2X4RA 2VDKH 1Q0XL 1JNJA 2AK4E 1NANH 2VDNL 2J8UE 1C1EL 1HYSD 3OMZA 2W38A 4FG6C 5EC2B 5IF0B 4KJQD 5E9DE 1PQZA 1FAKT 3HRZB 3TO4B 3IT8D 4KK8C 3RP1A 3VDAA 2C1OB 3QYCA 3BVNA 4LQFH 3STZB 1YMMA 4ZDHB 3MJ6A 1SJVA 4HLZG 1J1XH 1LVEA 4NRZB 2EDBA 1EVTC 2LAGB 2FBJH 1J0JA 2AEPH 4LNVA 2DQDH 5MEQA 2ZPKL 1R3IL 4UDTA 4HHAA 4AQOA 2A38A 1K8IA 3KXFB