1FE8L

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
DIAMTQTTSSLSASLGQKVTISCRASQDIGNYLNWYQQKPDGTVRLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLESEDIATYFCQNGGTNPWTFGGGTKLEVKRADAAPTTSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2000-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L01
2FJGA 5C9JB 1CN4A 3G9VA 1JP5A 4ODTH 1NEUA 4CADA 4FFYL 4XB7A 2DQFB 5KSBA 4U0RC 5LGHH 4KHXH 4OGZA 4WEBH 5BV7H 2R4SL 1I3RA 1F02I 3NMEA 3MRDB 1B3JA 4D9LL 4L9DA 4NWUH 1XF4A 3MCLL 4GRLB 5KJRL 2WIIA 5D7JC 2X1QA 3G04B 2GEEA 1IQDA 4KJQC 5C07E 1IGIL 3I6LE 3FKUS 3N1GC 4JZOA 5C08B 3C5SA 1AI1H 5FYJU 5IK3A 3SCMA 4KJYA 4YZFF 3VJ6B 5DMKA 5I1CH 1D9KB 2FX8L 1NAMA 1CIDA 4HFUH 4MCYA 2VH5H 4YDIH 5E56A 3BP4A 3HNSL 3PGDA 4YHNA 2P7TB 1DLHA 3BKMH 1PG7H 1ADQH 3W11D 2KQNA 1B0GB 5CGTA 2C3HA 2AAVA 3Q5OA 4FXLA 4JM2A 1A6PA 2AABH 3LQAH 4I5BB 2B4CH 4KGJA 4Z7NF 3O9WD 2Y72A 4EBQL 1EPFA 3AREA 4OKDA 4X9BA 1S9YA 3W2DH 3A6BL 2QR0A 4TUJA 3U2SB 3NOIA 4EDWL 3OR6B 2DAVA 5FGCB 2AXJA 5D7LA 2OS7A 1YEIL 4M1DH 5KSAA 1JFQL 3BT2H 4X7TA 3I02A 3P4NA 4Q6IA 2V5TA 2VL5A 5HGHA 4FXKA 3HN3A 5DJ8A 1Z6JT 5FGBC 4DGVL 3MRQA 1QKZH 5IVXE 3E2HB 4TTDC 1GAFH 1LEIB 3B2UC 4HPOL 1YQVH 4B41A 1IZJA 4MX7B 1JNLH 5B3NA 3KYNB 4RISL 2VITB 2NW2B 3H9HA 1BD2E 4WI2A 1J9CT 2FLBT 3OZ9H 3UP1A 2EDHA 3T1FB 4YC2C 3FT3B 4X99B 1P5UA 2X4TA 2R9HD 3L7FB 3W39A 4B7IA 2Z91A 2FATH 1XR9A 5GGUA 1GOHA 1QBLL 1G0YR 3MRRB 5IB5A 1I9EA 4Z77A 4QRRD 2AJSH 1BFOA 4NN6C 3D2UA 3U0WH 1OTTD 1FFQA 3CSYB 4XVJL 3TN0C 4OIIH 4PP2B 1FO0H 4I3SL 5IBLC 3O11B 4PJ8B 2IPTL 1XR8A 1KULA 1T83C 1MFDH 5EN2A 2VR5A 1IKNC 2WP3O 1MFAH 4H0GA 2AVGA 2BDNH 1UEMA 2ICWJ 1ZLUH 5J6GA 1GZPA 35C8L 4KROB 1U91A 2P43B 5IQ7H 3CDFA 5ACZA 3R06A 3G6DL 4MNGA 2BCKB 3MOQA 3X17A 4R26L 4CVXB 1W72H 1RZGB 3V4PH 4NZDA 4P4KB 3G5YB 3A67H 4M9OA 3WFEH 1QQDA 2HLFC 3QQ3B 4U0RB 4XH2B 4A6YL 4RSVA 2A77L 3I6KB 4JRXD 1CG9B 2R2CA 1N5AA 3X13B 5D7JB 1AFVL 5F1IB 4OZFG 1B2WL 1KIUA 4RAUA 2X4UB 4AM0B 4C56A 1GGBH 3BKJH 2GW5A 1J87A 1T1XA 4TPRH 1EHLH 4YFEA 1ZA3B 3AB0B 4LP4A 2EXYD 3NH7H 4FQXA 5I1JL 4K94L 5IV2A 2XWJA 1IAOA 4KTEH 2A74B 2IG2L 4G6FD 2WLZA 5DHVH 5AYUH 3VGAC 6FABH 4JR9L 1I9IL 4Y1AB 3BYYA 3TH3T 2BY0A 5E03A 2VLME 1AGBB 3KPOA 1LNUA 2XZAL 4ORGB 4LPTA 1AGFA 1E27B 3FOMA 5JUEL 4ZUWB 1UKSA 1VHPA 3FQNA 3LKPA 1VACA 4YJZL 4JFED 2HJKB 3HS0B 1A1NA 3TBYA 3MACL 1AY1L 5I1KH 4PJDF 1A7QL 1WZ1H 4PRPE 4NRXA 1H3GA 4XVTH 1S78D 1JTOA 4JFYB 1KLUB 5FA3A 1XCTB 2P1YA 1A6UH 1A7PL 4PD4J 1P5VA 5CHNB 1KC5H 2BHYA 3D3VA 4PTUA 4M6MH 4JQIH 2OTPA 4NHUA 1RZKH 3HAEG 4WUUA 2AGJH 3S5LA 4H26B 2BERA 1CFQA 1CFTB 3OKLA 2WV3A 3BRGC 4PG2C 4NUJB 4UDUB 4AY0A 2GJ6B 1LHZA 5F7DB 1D7FA 3SQOH 3CD4A 4AQ1B 3PHOA 5IB2A 4WW2C 4LU5H 1NGZA 4PJ5A 2R0ZL 3CSGA 4MS8D 1F3DJ 1FIEA 5FYJD 4OV5A 1CLYL 5GRVK 1MRCH 3PGCB 1ZHKA 2GKIA 1ZLWH 4YC2B 3BUTA 1ZLVK 1A8JH 2DYPA 4NN7C 1NBVL 4KI1A 4EUPG 5CWSB 3NN8B 5KZCD 1HDMA 3EFFA 4HAGA 2OZ4L 3O4LE 5EFIB 1B88A 3QEHA 4G7VL 1F00I 2QSQA 4PJAE 1IC1A 5HHOE 2DI9A 4NN6B 1S7QB 3RIFF 5DUPL 1NKRA 3MGTB 5GGSB 1U8PB 1MNUL 1MY7A 5SWSB 1GRWA 3GIZH 3PWVB 5EWIH 1JUFB 1EZVX 4GAJH 3SDAB 4Z8FL 4OZGA 4X8XA 2Z9TA 2IPKA 3RWIA 1BBJA 2LAGB 1FGNH 1VESA 1CT8A 3QIWD 1A6AA 3QIUA 4YIQB 3MLYL 4OCXL 4W81A 1BWMA 3U7YL 1EEYB 4Y5VA 1ZEAL 5IGXL 5DR5L 3QZWG 4Y4HC 4XP1H 3TZVA 1NLDL 3F8UB 3MV9A 1R3KA 2RB8A 1JGEB 4WJ5B 1YA5A 4XVSH 2NY7H 3HG1D 2EDLA 4RNRA 5KW9H 1XGRA 2R29L 5HGBB 2IQ9H 3VI3F 1N6QH 5EO0A 1AD0A 1DBKL 4BSJA 1T7ZA 1FVEA 3JWDC 4UV7L 4Y2OA 2Q7YB 5DJ0B 1QSFA 2GSGB 2ESVB 4N90D 1RUQL 3LB6D 1JNNL 1CIUA 3X11A 2D31B 2UWEB 4OF6A 4UDTA 4JO3L 5IMOA 2CLRA 1FL3B 4Z7VE 2LAAA 4G9DB 1I8KA 1NMAH 5ITFB 1ES0B 5JNYB 2E7MA 2MHAB 3QWOB 4D0CA 2R69L 3TA3B 4GG6A 2PW2B 3ZTJG 2DMBA 5C0CA 5EO1B 1ITBB 1HQRB 2VQ1A 4ODSL 2PR4L 5FOBA 3X3FH 1C5BH 3QI9A 5IB4B 5D7SL 3RKDD 4XVUC 1M6OB 3L9RA 3P9LA 3DV6A 4PJCB 5D8JH 4G6MH 5DUBA 3HZYB 5CS7A 2QKIB 3BW9A 4TQEL 1YN7A 3C6LA 2Y7QA 4LK4A 5DTFB 4HUMB 1CQKA 1YNLH 3KHOA 2XN9B 4KUZL 4KUCF 2CDGB 1IAIL 3NABL 4LBEB 5CIPA 1HQ4A 1HK6A 3V7AE 3W0WD 5L0QC 4N0UA 5A3ID 5JOFA 3PJSB 4Z7UA 4UQ2B 5IW6B 3K3QA 2WBKA 1QRNE 2C4XA 4ONOA 3WS6C 1JMZA 2AKRA 3I75B 3SE3C 3V6OC 1JZ6A 1SEQL 1T2QL 3JV6A 4JB9H 4UINH 4N8PA 2CR6A 4JM4H 2DQEL 1WWWX 2NX5E 4WI5A 1DSFH 3HMXA 4K3JH 1ND0B 1RVFH 3EJYD 4D9QD 4NNYA 3DUUB 4KTDL 3O6LH 5KAQG 1CQYA 3TBWB 3WHXB 2E7BA 4XPBH 4G8EB 4NN7B 3UEZA 4PV9B 1OAKH 4NO0B 1IGCL 3FONA 2F53A 3FO1A 5DQJA 4YHKL 1U8LB 3EYVA 4FQJL 3WIHL 4OF0A 4YFDB 1WICA 1MRDL 4KKBD 1N8ZB 4HCRL 5EUKA 1RZ8A 2J12B 5C2BH 1NC4D 2G75B 2ATKA 1V7NL 5ICYB 4U1SA 3S96A 4HEPG 4KI5D 1Z0NA 3MV7D 4XWOC 2GJZB 3X12A 1KLGA 1KEML 2C9AA 3EOTL 1HINL 4MGXA 3NCYP 4Y19A 5EU3B 5GS1C 1LE5B 3ILQC 3B9KD 1RIUL 5ICXA 5D2LB 1KCVH 4ZPTA 4NQEA 3TV3L 4FQ1H 5T3XE 4MQXD 1MAMH 5JW4R 2ZKHL 1I9RH 4NYLA 4JRYA 1LO0H 5IBTH 1HILA 3MOBH 4ZOCA 3ULVC 3GI9H 4XCFH 2OCFD 3IDIB 1EO5A 2IANE 2H1PL 4RFNC 1I1FB 4H25A 4LLVA 5I1LA 3HRZA 4F7PA 4KMTL 4N0CD 4O5LH 1RK0A 5LBSL 2FGZA 5F7HA 4F8TA 3DJ9A 4NCC2 3ARUA 4GH7B 5DRWA 1P7QA 5EPMA 1IKFH 4JKPH 3ARTA 3DURB 3H7BB 3S88L 3D48R 4M03A 2DQIH 4MJ5A 3ETBF 3GNMH 2V5MA 3VFVB 4MXVF 3GSRB 3AS0A 4X4ME 4KZEL 2XI9A 5IWLA 3O2WH 4G8IA 1G7PB 4G8FA 3LEYL 4A6YA 3GMNB 2D9CA 3U36B 1F3RB 4LHJB 4P5TC 3EKCA 1KPVB 3SO3C 4KZDL 4OI7A 4GRLD 2VUOA 3BPLC 2W60B 4LSQH 4X6DF 4UAOC 1F11B 4MNQE 5C0RH 3FRPG 2HH0L 2ICEB 3PDOA 4L1DA 3N1PC 5EBMB 4JPKH 2EDFA 3BKYH 5J1AA 1OGAA 5FECA 1D9KD 1CR9L 3IKCA 1RK1A 4S0TD 4ODUA 4F7EB 4D9RD 5L0QB 5TPWL 1A0QH 1FH5L 3T8XA 3T4AA 5C0JA 1IC4H 4NQDE 1EZVY 5C2UB 4PR5A 4ZFZB 2ARJA 4GXVL 1E4XI 3FQXA 4EVNA 1S3KH 4G42B 5J89A 1T0NB 5JORB 3WIFA 4JKWA 4PJEE 3D85B 4RAVB 1Z3GL 1QR1B 4HKBA 2HKHL 1UCBH 1QSEB 1SYVA 2NLJB 2EDKA 4G8GB 4JKKA 1Q38A 4ZS7H 5FF6A 2B1HL 4LKXB 2FO1A 3MLUH 4FFVD 5F88A 3WIIL 4ZFFB 4FP8H 1EK3A 2XT1B 5KVDL 4L4VA 3RFZC 4IRZL 1UM5H 1EFXA 2ERJC 2GY5A 1A7BA 1G7JA 5IEHB 3THMH 3LEXB 3UTTB 5MENB 2ICWI 4L4TB 2DJSA 4PJIB 3N1MC 2DQUL 1ZLUK 1MLBA 3IDJA 4PB9L 5EOCL 2C3VA 4QTHB 3EYFB 1E4KC 2B5IC 5SWZB 1KB9K 2X05A 2AEPL 4XNQA 1JZ4A 3V8OA 4X6EB 1IVLA 4OQTA 3SY0B 4PB0H 3WLWC 1MSPA 2I9LA 2V7HB 1G7QB 4I0PA 4PJGE 4PRAB 5JMOC 4TNVF 1FC1A 5IOPB 3MRKA 3QO0B 1T5XA 1YEKH 5L88L 3KGRA 5A2FA 4MD0B 5TGBA 2QQLL 4BZ1L 2HVKA 3WJJC 4PRHA 4YH6A 4LLMB 12E8H 1JRHI 4YHZH 1VKXB 4LOUD 2L4OA 4NQCA 5AD0A 5ICZA 5LCVH 1H15B 4MD4A 4HT1H 3RA7L 1T6WA 2GTWB 3QB7C 5IVZA 2WM0A 3ZYZA 3LSOB 2YD2A 4LFHD 1AXTL 2ADGA 3KJ4C 3G6AB 3EIFA 1ZWIB 1I7RB 4WU7B 3S35X 2AJZA 4P5MA 4RFNB 3FT4B 4UBDC 1KB5L 3AS2A 2FSEB 3NA9H 5HGAB 3BHBA 3KPNB 3MLTA 3K4AA 3WNOA 1DN2A 2PF6A 4Y16D 1EHNA 4EN3A 2B1AL 4OM1H 4KROD 3VD4A 2OK0L 4KQ4H 1A47A 3LN5B 1JGUL 2ZUYA 4OLWH 1NMBH 1A3LH 2NW3B 1YNKL 3ROOB 1MRFH 5EBLA 5CLTA 1P4BL 4P4KD 1F6AB 5EC1B 4E0RB 4N8CL 4CMMB 4K23H 3VA2C 3HC4L 1WT5C 3TYGH 1FYTA 2V9QA 1JBJA 4JVPA 4UU9B 5HHME 4P5TB 4ELME 3SO3B 3OV6A 1PY9A 4KMLB 4YAQB 2ICCA 3BPLB 5D7JD 1CD0A 4UAOB 1CGTA 4JLRA 4QYOB 4KJQD 1MUJB 4X6CE 5ESAA 3BP7A 2DQJH 5E5MB 1Q72L 1K4DB 2Z4QA 5ETUA 2V9TA 1X5LA 2Q76A 4D3CH 2UZXB 4G7YH 4HUWA 4POUB 4OF8A 3RTQC 1SBSH 4OLYH 3NCJH 4PLJC 1FBIH 5I15L 3DROA 5KN5A 4HK0B 2ZCHL 4HS8H 3K46A 5TF1H 2D7QA 1BX2A 3HUJF 3B83A 3ECBB 4H1LG 4LCUB 4OZIF 1ZLWK 1A02N 1MWAL 4TVPD 4ALAL 1ZGLA 3RBGA 1T6VN 3KXFE 1J1OL 3DXAB 2P8LA 2YN3A 4LLUA 3VRLE 1C08A 3K8MA 4X0KB 1T03L 4MJ4A 4G6KH 4NOBA 2ZNWA 4I8DA 3W5MA 2F8VA 2DIJA 5D4QA 4NRZB 3RWHB 5B39A 5CEZL 4OIBA 5E9DE 3RDTB 1GPOL 2ERJB 4ZO8A 3QRGH 4KVNH 4PBWD 4OJFH 2A6IB 4XPGL 3VH8B 5I66A 3CAFA 4KFZC 4RMRA 3PWLB 4XPHH 4J12A 2JIXB 3GGWB 5E6IC 2V5SA 2QEJA 4O2EA 4X7SH 1S9XB 2QHLA 1UM4H 2B5IB 1Y6NR 4JFQB 3T77B 4RDQF 4ZFGL 2GJ6D 4MDJA 3DETC 4XNXH 4OAWA 2R1XB 3VDAA 1ORSA 1BLNA 4YPGB 5FCUL 1DBMH 1TJIL 2BX5A 3T04D 4PLNC 3SE8H 3PQYB 3BZ4B 2DWDB 1CGUA 4BUHA 5CLWA 3C5ZC 4XBPA 2H6PB 2PYEE 3HB3D 4QCIA 4XC3H 4PRNB 4QOKE 5GGSY 1JZ3A 5I1IH 1CFBA 5DA4A 4FFWC 3S36X 1FZMB 1MH5A 3V5DA 1SVZA 3MRLA 4L3CA 4JZNA 2Y06L 5TH2A 1WIPA 1WIUA 4GW1B 3KJ4B 3GHEH 4LF3B 1CWVA 2ZSWB 1OVZA 1GIGL 1K4CB 4HCRA 5F89B 1XH3B 4QHMA 5DJDA 4X9HA 2W91A 3NZHL 4WNQB 3TO2B 4DZBB 1MQKL 5IKCA 5LXGL 1G84A 1W0YT 3LEVL 4JFDB 3WNLA 3C60C 1GHFL 3SDAD 1MFCL 2XZCH 2BVYA 1XGUA 3VXQB 5T1MB 3JTSB 4ISVB 4J8RA 2GITA 1FL5A 3DO3A 2OTUB 4DN4H 3U9UB 2R0LL 3V52H 4DKFH 3DMMA 5I0DA 1KXTB 3CSPA 1FORH 4KK6D 4M4RA 5LQBH 4M93C 2HLAB 2FWOB 4LASL 5BV7C 3MLSH 4M02A 3TNMB 1KT2A 2O5YH 3BP6B 3I6GB 1DQLL 3JUZA 5MERA 5ANME 3HC0A 1ED3A 4UIKL 3AMLA 1AXSA 4O02H 1I8MA 1K3ZA 1X6LA 4HF5L 3VFRB 4ESKA 4ENEC 3D39A 1TMCB 4LCWE 2EDBA 3F62A 4POZC 1AXIB 1BJ1H 3P30H 5BOZG 4ODWB 1L9MA 1U58A 5CJXA 3BE1L 5DJAA 3TA3D 1NGQH 3K1KC 4XNUH 1H3WM 5FB8A 1JPGA 2DL2A 4GSDL 4M1CC 3RTQB 5ISZB 2V7NA 4HWZB 2AEQH 1I4FB 4OLEA 3MGOB 1K3IA 1MCCA 3MFFB 3L5WB 5ENWA 4HWEH 3CLEL 3G5XB 4X7EC 5AZ2H 4D0DB 4XI5C 3OAYH 2DQDL 2CDEA 3CVIH 5HI4C 1RHHB 4XNYH 2BSTA 3HRPA 4O4YL 1U8KB 1FFPA 3LQAC 4LLDB 5JPNA 2B4CC 1AIFA 2HFEB 5F71A 1IBGL 1X5YA 4EJ1C 1DQDH 1SY6L 2DM7A 1RULL 1B6DA 2VE6A 1DL7L 1IT9H 3KPSE 3KPTA 5GJTL 4WFHD 1ZVSB 4LRNH 4PRBB 2XN9D 2BXYA 4IIQC 4BKLA 5IFJB 4B53A 5I1EH 3DUSA 2BSSB 5I17A 1KFAL 4DFIA 2EKSA 5E8OB 2YMXH 3V6ZB 5E6IB 1N5YH 1F2QA 2JJTA 4KHTH 1GGCH 3ESVF 1L7TH 4X6BB 5B3JF 4KY1H 4YE4H 5E2TL 2P48B 3DX9A 3VGDA 2VZUA 1E6OH 3QQ9C 1KN4L 3EFDH 1L4IA 5GISL 1UH3A 2VXVH 1RURL 5FKPA 1KJ2H 3GSXB 3ARGA 2NYYC 1F3JA 1FG2B 1J1PH 4BK5A 4FQCL 4PLKC 2XACC 4QO1A 3GB7A 1DN0A 2ZPKL 5EZJB 3I9GL 3O3UN 3CDCA 5KBNC 4OCYL 3C5ZB 4PY7B 3B2VL 3BD3A 3FTGB 4MB3A 3F12B 3LRGA 5T1KB 4WO4D 1BM3L 3MRFB 3LZFL 4P5KB 4WY7L 4DQOL 2AQ1A 3JV4A 1J0HA 1H0DB 3E3QE 1VFBA 1GZQA 1IEHA 4OZHB 4UT6H 4L8SA 1DBAL 3SKUD 1J12A 4PJ9A 4LSUL 4CDGC 2XQYK 5E70A 1DQTA 4X5LA 1AO7B 3C60B 4DAGH 5LJYH 4TSCH 2E27H 2HA1A 4XPTL 5I16B 2OJEB 1UH4A 3LHPL 1OP3H 3CVHH 3ET9F 4HPYH 2X4NA 2P8PA 2ZUTA 3D0VA 4LSPH 2R8SH 2WWKT 3U4BH 4Z0BL 5DSCB 1NAMH 4GAYA 4P3CL 2NY0C 1S5HB 5CJ8A 1HH9A 3IFPA 3HE6C 3C6SA 5JZ7D 3RGHA 4HJJL 3V8CA 2I26N 4R90L 1R0AH 4M93B 4JHZA 3BESR 1KXQE 4DJMA 3AXLA 3AY4C 5DJYB 5BV7B 4IBLT 3VXNA 3SGJC 4M1GH 4PRIE 2F8XC 4BM7A 4JG0L 4XHQA 5BS0B 2EICA 4NM8H 3CX2A 4CNIA 1MCBA 3QUML 1A4JA 2VXQH 2J4WL 2ZCLL 1JL8A 4LKCB 5L9DL 3B43A 1CK0L 3TBVA 3TC9A 4HLJA 5BO1H 1KB5A 1RJYA 5EORH 4TOYL 2Y5EA 5CCKL 1O7VA 4HBQA 4JRWA 4MAYC 1C7TA 4PG9A 1D5XB 4G80A 2G60L 2C7UB 4FQIL 4HIHB 4S1DD 4XP5H 1LWRA 3IAGC 2I9TB 4TSAH 3IU4H 2AK4E 4LCIH 2WW8A 1NMCC 3ARDA 1I75A 4JDVA 4BZYA 2J88H 1U42A 4FA8A 4YXLL 2V5RA 5KS9A 5DK0A 4ZNCD 1G9MH 3VXPA 5DJCA 2BNQB 2WQRA 5DK3A 1CL7I 5D7IE 3U0TA 4XVUD 3FQTA 4MA8H 3HC3H 2DDQH 4P57B 3MLXL 5EU6A 3VMNA 1UB6B 4HJGB 1BFVH 2A6KA 2J8UF 5GXBB 4L8DA 3K2MC 5E8NB 4G9FA 5C0BE 4ZDHB 4YDKL 5HBBA 4ZYKA 3P73B 2NY4B 2BJMH 1MFBL 3UTZB 4IIQB 2VXTL 3ALPA 4OGXL 5GGRA 5FEBA 4R7NA 4F9LA 2M26A 4PY8J 4S2SA 4PP1C 1ZXQA 1KGCE 4KMQA 4M3KB 1Z9MA 2J7LA 1LO3H 1QFPA 4PREB 1ZLSL 1RZKC 2UZIH 1I1AA 3FFDB 3MR9A 4YHPA 1MWAA 2Z31C 2OM5A 4L9LB 2WQ8A 2I5YL 5GRXG 2P5EB 4GBXC 4X6FB 4K2UL 4RZCA 4MJIA 1U6AL 3P4OA 1NGYA 3MUY1 1TJGH 1CDHA 2ENYA 5IMLA 1VDGA 3EBAA 1B0WA 3DX7A 3KYOB 4GMTH 1T0PB 4NKMA 5JPMA 4I0CC 3X14B 5I1GH 1R5VB 1UWEL 5DD0H 5D1ZC 3LY6A 4XP9L 3OAUL 3FB6A 5F70A 3IT8D 4FMKA 3PWUB 4S11A 5HGGS 3EDKA 2VDLH 4OGAD 5F1NB 3RVVC 4WWKC 1DEEA 2G9HB 3V0WL 1CGXA 5I2IB 1PFCA 1H8SA 5L7XH 1A22B 3H3PL 1YN6B 5SWZD 1IM3A 1IGFH 4UV4H 1FO0B 4WTZG 3BWAB 1KJ3L 5JHDE 5FYJL 3BN9C 3SJVE 4K55A 4XWOD 3QWRA 1IL1B 5HTSA 2Q8AH 2E7CA 3KLDA 4PPTA 2D4FA 2VDNL 2DS4A 5TQ0L 3S3JA 2V2TB 1CXEA 4NWTH 2DLTA 1YEEH 1NFDB 3PIQA 2ZUQC 4NQXA 5IEKB 2IAMA 1XGQB 4XBGA 4R8WH 1V05A 1Y0LA 5I6XB 2MPAH 2HYMA 3BXNB 2E9BA 4L8BA 4U6XA 4Y7MA 3GMLB 3F7YB 3IJSB 5KTEL 1W72B 3ZYIA 1U92B 4MQSB 3V6FA 3VE0A 4Q9CA 4MWFA 3W9DA 3DSFL 2LV4A 3RU8H 2CMRH 2IGFH 4AH2B 1KJMA 1MCEA 3RQ3A 3GSWB 5CBAA 1NCDL 1QBAA 4PJHE 5TQ2H 1KIQB 4Y4FB 5CSZB 4EI5B 2XIDA 3U6RB 2LQRA 4MAYB 4DVRH 1EV2E 1JPFB 5C07B 2X4QA 1U41A 5ID0B 1FPTH 1VSCA 4KI5F 1S7WB 3GIVA 4JANB 3UDWA 4P3WA 4M48L 4Z18A 4O58L 1NMCB 3QH3B 4MQ7B 2XRAL 5J06A 2VDQH 2MTPA 1FE8H 1YC8A 3MBEC 2YPLE 5L6YH 3MA9H 5C09E 2R56L 5KG9B 5SX5H 1BEYH 3BDYL 4MSWB 4X9GA 2P46B 3R1GL 2C5DC 1AHWA 2AK1L 2ID5A 3G6JE 4V2CB 5GGQH 1GYAA 5FK9A 3DGGA 2FZ3A 4WEMB 1UVQB 4M6NL 4J3OC 3HUJA 3SDDA 1ZGLP 4P2YA 4OZIA 2WANA 4QHLB 5BJTB 2VXSH 2WWMC 2VC2L 3LPFA 3QFJA 5DFVC 1YDPB 4BH8A 5DT1L 3D5OF 2OJZH 3TWCH 3MMEB 1A7NH 1X5HA 3GMQB 3NFNA 4XWGL 3DI2B 1RZIB 3I3DA 4ZODA 5CBEB 1DZBA 1UC6A 1AP2A 4ZOAA 5DFTA 3BO8B 3LN4A 2GHWB 2Z31B 3UYRH 1EX0A 3E1F1 4LDLB 3DXAD 2DRUA 1IGML 3PNWA 4JHAL 3WJLC 4GBXB 1CDIA 4HXBL 1CXLA 1VERA 1S8DB 3QXAB 1BD2B 1EEQA 5EOQL 3IYLW 2H26B 3RDTD 3O41B 3QDME 4PJ7E 3QUXC 3MLRL 5D1ZB 4K3EH 3WFBH 4BSWA 1BBDL 4OF7A 1BQSA 3FQRA 1ZT1B 3OHXB 5CFHA 1PG7X 4WWKB 1K2DA 2P24B 1UJTA 2C1OB 5F7NC 4TULL 5IJKA 1I7TB 2X89D 3WKML 3BIAX 1Y6MR 4MA3B 4PS4L 3V4UL 3WFCH 4J6RL 4O2FB 2OI9B 1SJEA 2YBRA 3M17A 4HFWB 4E42B 1P4IL 3MLZH 3U0PB 3ROLA 3FOLB 1MCOL 3HI6L 3ZLQC 3PQYD 4KK8C 4PGDA 4WW1B 3UJJL 2G5RA 4J2XA 4MMZC 1DQQA 2ZUQB 4OD3L 3C08L 2VNCA 2H32A 5TFSH 1T7YA 3EO0A 2VZOA 3L3IB 1MREL 2VN7A 1G7MA 3VXUE 5TE4L 2OQJB 5MEOA 4HIIB 3QDGE 4LNRB 2ARJQ 3ILPA 2ADFL 1LO4H 1Q9LA 1OY3B 4YZFE 1TJHL 4FFYH 4AK1A 1YMMD 4OB5L 5T5FL 3WSQL 1RFDL 4DWHA 2R4SH 3SGDH 4JFDD 1XCQA 1AD9A 1RUKL 3MCLH 3HI1A 5KJRH 1Q9KB 1CTOA 1IGYB 2GY7B 2IPUK 3OAYK 3MCKA 3ZDXF 5B22A 2W0KA 2F54A 1IGIH 3IU3B 5DDHA 3FB7A 1T21B 3FFCE 3QJFB 4M5YL 5CIPH 3IFOB 3QT2A 2COQA 2EE6A 3UC0L 1QVOB 4QRRA 1FZOB 4OCLC 2FX8H 2VDOL 2WBJA 3HNSH 3MBEB 5J57B 1MIEL 3BUYA 2R1WA 3RRQA 2BOCA 4M61A 2FH6A 1KEGL 1CICD 4TUOA 4MA1C 4YDVB 2W9EL 3CXHK 3QUMA 2YKLL 4ZSOE 3OGCB 5E2WL 1OL0A 2BOBA 3EHBC 3KDMB 1UQSA 3HPJA 3TP4A 4LSRL 3P4MA 4JPVL 4EBQH 5H94B 4W4OC 3SGEI 1I85C 1N7ML 4XC1L 4PRPB 4N9OB 3A6BH 2HMIC 1D6EB 5ISZD 1KN2L 2MQ0A 3BPCA 4JFFE 3P4LA 4EDWH 1YEIH 1SM3L 4NQSA 1JFQH 5EIIB 3D0LB 4RGMC 2Z35B 5DQ9A 5BRZD 4JRXA 4DGVH 2QQKH 2PW1B 5FDWB 4ZO6A 1M71A 5CUSL 1FFNB 5BZDA 4HPOH 4NDMB 5DD5L 1KJVB 3MYJB 1HE7A 1U8HA 4TYUA 3DVFA 1Q9OB 1IC7L 4LLYA 5DMYA 4FZEL 5I0ZA 1R3LA 3UAJD 4RISH 3ZHDA 4I3RL 2MFNA 2X2YA 4U31A 5CP7A 3QUXB 3UXFA 1TCRA 3EDFA 3SPVB 5GHWL 5I18L 3MRMA 1P7KB 4LAJH 1U8JB 3V2AR 3GJEA 3RWCA 2UYLA 2X4SB 3KPPA 4O9HL 1JK8A 5E6ID 5GGTA 1UB5A 3O4LB 1QBLH 4NN5C 4NT6B 3SDYL 4PJAB 3CFKA 4FRWA 3R8QA 5HHOB 2F19H 3LKOB 4X4YA 3VXSE 2EH7H 4XNZC 3VU2A 4JFEA 3DETD 3QDJE 4XVJH 1K8IB 3B8YA 4DOHE 1WFNA 4I3SH 5EU4A 1TCMA 1T04B 4JAMA 5GS2D 4M9PA 4P3DA 3QQNA 5I8EA 2XG4A 1X4ZA 1JHKL 5ITBL 3X3GL 3GJFA 4XP6H 35C8H 4NIKB 1IAKA 2HT4C 2P44B 2Q7NA 5J6HB 5T1KD 2HJFB 1JHLL 4WGVB 4MVBC 2Y23A 1CLZL 3G6DH 1LO5B 3HE7C 4OFIA 4R26H 2KPNA 4F3FA 1ZMYA 2MWCA 5FYLD 1D3CA 4JFPB 3E6FA 2Q6WA 1NDMB 1DUYA 5L8LB 4A6YH 1SHMA 1T80A 4DUXA 4YEFA 2A77H 3AM8C 4YGAB 3C60D 4AT6B 4OUUB 2X9XA 3ZT7A 1AFVH 5SX4I 2DTML 3BVNB 3CH1B 4NO5A 5C7XL 1FFOA 1TZIB 4M3JA 1B2WH 3QNXA 2AV1B 4HZLB 5FHBL 4U4BA 3L3HA 4R3SB 1A6ZA 3L3JB 1V7ML 3IF1A 1G7HA 3UPRB 3IXTB 3KWWA 4DZ8A 2FEEI 1N3NA 4P2RA 4BYHA 5I1JH 3VFMB 3MRNA 4PJDE 2WNGA 2EDTA 4MNHA 2YC1B 1BZQK 1KV3A 2IG2H 3DPBA 3MUGA 1U8IB 5C08E 3V7AG 4JR9H 1I9IH 4PY8I 5ALCL 5BS0D 5IHZB 1HHKA 1QEWA 2XZAH 4MA1B 2AJVH 1A7RL 1PKQA 1U8NB 4JDTL 1S5IL 3ZE0F 4KQ3L 2J2ZA 2FBJH 3D1MC 3QA3B 4M8VA 1ZK9A 4NKQB 3QIWA 3GSOB 3AFLA 1TTFA 3MACH 3QPQD 3UROR 1U8OA 1AY1H 4WHYH 2MOVA 3FO2A 4AIZA 3W9EA 4RMUA 2K9UA 3ARFD 4F37K 1T1YA 1A7QH 1G6RL 1OTSC 2LU7A 4M1CD 3ZKMD 2J8UA 4J4PA 3BIBX 2H41A 4P4RA 1OTUC 4LVEA 3NIDF 1A7PH 3O0RL 3K8KA 2BMKA 2BNQD 1A6TA 3PL6A 4X80L 4LLAA 1AGCA 4L3EB 4PJFE 1E6JL 1EDQA 2IQAB 4QWWC 5A16B 4XI5D 1BF8A 2OSLB 5DC4B 4OLZH 5HI4D 4KJWD 1FZKB 1DQML 3GMOA 2UVFA 1PKOA 1OT1A 5I8CB 2NX5B 7CGTA 1YNTA 1YPZF 1KPUA 4NO3B 4HWUA 2F58L 5E8EA 1NBYA 1AQKL 2R0ZH 2NY4D 1S7RB 2P4AB 4C54A 4I4WB 4R4BA 1CLYH 4O51B 3OXRB 3MUHL 1LE9A 3MNVA 3SDCC 4DW2L 1CFSB 1V3MA 3HZKA 5KSVA 2ITDA 4TVPL 2A73B 2OR7A 1NBVH 4D0BA 2VLKE 2OZ4H 3FQWA 4NN5B 3T0EE 3DX6B 3CZFB 1OQXA 1BAFL 3QBTB 1OP9A 2G5BA 1NGWA 3QQ9D 4Q7DA 3TPUA 4X4XB 3W82A 3MV11 4XNZB 5DUPH 1AR1C 2X4RB 4C56D 1NCWL 5C0IA 1HSBB 3NZ8A 1H3UA 1P84K 2P5ED 3RHWK 2XZZA 1MNUH 4OFDA 4ZUTA 5EB9A 3T2OA 3NACL 4FNLL 3MV8A 1S9WA 4Z8FH 3ZKXC 2ZOLA 4FQXD 5TDNB 5B39G 2N4IA 2D7MA 3KS0J 2DQGL 3F58L 4JJHA 4ZXBC 3WUWA 1G7LB 3VXRE 3MLYH 4OCXH 5EU5B 3U7YH 3WXVL 3WE6B 1SBBA 5IGXH 1PZUB 3F7VA 5DR5H 3F5WB 2XYCA 1RJZB 4HKZA 2MKWA 1KXVC 1S7SB 3BP5B 1HHGA 1NLDH 4NFCA 1S9VA 3L3DA 3T1WA 5AZEL 2R29H 1OAQL 3VWKC 4WU5A 2IANB 1YUHB 2W0FB 1MHEB 2JJWA 4C4KO 4UV7H 2R23B 3A6CL 5FUCC 5CJQL 1RUQH 1XGYL 3L95A 1JNNH 2CRZA 3IB4A 4JO3H 5FM5M 5HHNB 2JB6A 2IBBA 1WK0A 5C0AE 3D3VD 4FQLL 4ZUUA 2R69H 2E7LA 1NFKA 3O6ML 2H2SC 1LK3L 1RUML 1OD9A 3WLBB 4Y8DC 2Y5TB 5MHSE 4ODSH 4L29B 2PR4H 1MHCA 1NC4A 1FV1B 4NM4L 3QFDB 1QD0A 4XMKL 3ME0A 5D7SH 3MV7A 2NR6C 5E2UL 1EHAA 5J9PB 4Y4KB 5LAXA 4Y4FD 4GUPB 3B9KA 4YHOL 4EI5D 5EUOF 2DYPD 4KPHL 4MAYD 4MNQB 3E6HB 2QL1A 5C07D 3UMTA 3I6LD 4TQEH 5IW1B 1CVRA 3NBNA 5KAQF 3B5GA 5HJ3A 2YS4A 4KUZH 3CX5J 4TSBL 1IAIH 3NABH 4ZNEE 4JFXB 5D1QC 5JW4Q 4NQDB 1CZ8L 1AGEA 4GG8B 5JXEC 4U2ZA 2DD8L 1ZVHA 3RIAK 5JMRA 1XGPB 2AV7A 1PJ9A 2VSDA 1SVCP 2YPKA 5HDBE 3KJ6L 3ZDZF 4JJ5B 3WEXA 1SEQH 1T2QH 4PJEB 5L8JB 1A1MB 1EVTC 2DQEH 4IS6B 4RFEA 3BKCL 3QIUD 4WWID 3QXDB 4F7CB 4CU8A 5KVEL 2BVQB 1SJXA 2RBLA 5JW3L 4KTDH 5E24E 3VFUB 3MNWB 1T66D 5DVNA 3TZVD 5C9JA 4FQQB 5TJWK 3SDCB 3AU1B 4HG4K 3KR3L 1HI6B 4PP1D 4GRWF 2DQFA 3BQUC 4XGZB 4ZD3L 5IQ9B 2ZP0T 1IGCH 1T20B 5DGQA 1DBBL 4HSQA 3MRDA 4YHKH 4FQJH 3WIHH 4GRLA 5A40E 3BOVA 2R0WL 4H0IA 2YWZA 3G04A 5D6CB 2CSPA 1V7NH 3IAPA 4PJGB 1WCBB 1BD2D 1KEMH 3EOTH 4QRQB 3VJ6A 3ZKXB 1J11A 5LG1A 1D9KA 15C8L 4KRPB 4PBVC 3W81A 3OX8B 1RIUH 4CVWA 4ZXBB 1IEBB 4OF5A 3TV3H 4LLQB 5D1ZD 1PQZB 2P7TA 2WUCH 4DFHA 2ZKHH 2OR9L 1B0GA 3RVVD 1QA9A 2P8MB 2AI0L 3EO9L 5FIEA 1N64L 3VFWB 1IC5L 3N50A 4I5BA 3VWKB 1MCRA 5E99L 2H1PH 1TVHB 1OARH 2IALB 2GK0A 5E0QA 3U2SA 4KMTH 5H37H 2BY2A 3H3KA 2YEZA 4N1EA 3OR6A 5LBSH 4QY8B 1CE6A 5EZLB 4X6DE 1RMFL 4AEEA 3S88H 2XXMB 3VXME 4JFZL 4POYA 1MF2L 2BNRE 1QFUL 1LEIA 4XTRD 2VZ3A 4MX7A 4RGOL 4KZEH 4KDTC 3JTTB 2HG5B 3KYNA 4DUVA 4JM2C 3LEYH 2VITA 5HHMB 2NW2A 5CZVH 4ELMB 4N68A 5F97E 2DM2A 1C1EL 5D7KE 1NKOA 4KZDH 3FO9B 1E4XL 3AREC 3T1FA 4Z7OF 3FT3A 2AERT 4X6CB 4X99A 3L7FA 2HH0H 3TJHD 3ZMRA 5HYJE 3VG9C 5JHLL 3DWTA 4JGMA 5KSAC 3MRRA 2OXGA 1CR9H 2CO7B 5D1QB 4Q9QL 5ABDE 4PGZA 3HNTL 1G9MC 5TPWH 2YSSB 1FH5H 2X70B 3AROA 2WP3T 2IH1B 2P42B 2PETA 3PGFL 2VLLB 3CSYA 1WCQA 2D3VA 4PP2A 1P1ZB 1A5FL 3GKZA 4GXVH 2R39A 3O11A 4PJ8A 2VLMD 4JKLA 3KXFB 2EZ0C 2VAAB 4RCAA 3GSUB 1Z3GH 3UJTL 4ERSL 4Y16A 4NQED 1VGEL 4ONGL 1WTGT 3KPRE 4V1DE 4QRTB 5JO5B 2B1HH 3LKQB 1PY4A 4RGNE 3WIIH 4MYWB 2WWMD 1L0XA 5KVDH 5E9DB 1JPSL 4PRPD 2BCKA 4IRZH 4CVXA 3VA6A 1RZGA 3BZEB 4P4KA 3DECA 3G5YA 2NY5L 3U46B 4RRPG 3S97C 2GJJA 3BQUB 3QQ3A 4XH2A 4E5XB 2DQUH 4Z95L 2DKSA 4C59B 4BFIB 1TQBC 3I6KA 1WBYB 2D4DA 1CG9A 5EOCH 1JRHL 3OKDB 4X9FA 5C6PB 3Q5YA 3X13A 5D7JA 5F1IA 1KJ2B 2NZ9C 2EDOA 1FP5A 2V2XB 2AEPH 4APQC 2X4UA 4AM0A 3LV3B 5DI8B 3S3SA 3P0VL 4GLRI 3T0BA 1ZA3A 4KDVA 4HUNB 1AH1A 3IDMB 4G3YL 3K74B 4HLZH 5L88H 2ATPB 2QQLH 2WUBL 4BZ1H 2PYEB 3NVQA 4QOKB 2A74A 5L2KE 4W6WB 4M4PA 4Y1AA 2D0HA 5C0DB 1AGBA 5EBGA 4ORGA 3E3QC 2VXUL 1E27A 3RA7H 3O6FC 3PHQB 4ZUWA 3PDDA 3BZDA 1YMHB 3KPMB 4YXHL 1D5BB 4YHYB 1AXTH 2VL4A 5GGVL 1HYRC 4LMQE 3DIFB 2HJKA 1YEGL 3HS0A 2RQ8A 4X7DC 2VABB 1RHFA 1UZ8A 1KB5H 4U33A 2AXHA 3LRSB 4JZOB 3VFSB 3FB5B 4NRYB 3CVHB 4JFYA 3UZEA 4X98B 1KLUA 2ICES 1XCTA 4TN9A 2B1AH 5CHNA 3OJVC 3OJMB 1NAMB 1JGUH 5DRXB 3IFNL 1YNKH 3QULB 2HT3C 3VI4F 2IADB 1DLHB 5IROC 4H26A 1CFTA 4GAFB 4NUJA 4HV8B 4UDUA 2GJ6A 2EIBA 1QZ1A 2NPLX 5F7DA 2CXKA 1LDPL 3CFCL 1RU9L 3HC4H 1CXFA 2AQ3A 3KLAB 3SBWA 1OF2B 1HNFA 5ANMB 3BYTA 4A2LA 1BOGB 1EFXD 4I48B 3PGCA 3HI5L 3FCTB 4L4JA 4X83A 5H35B 4C83B 2ADJB 3B6SB 4LCWB 5J13C 1N6UA 4G5ZL 3CZJA 1FQ9C 1QFWI 5CWSA 3MRBB 3NN8A 3VG9B 4C57C 1Q72H 2GSIA 4K3DL 5CZXD 3MXVL 3MJ8B 5EFIA 5EIQA 2VLRE 1X6NA 5I15H 1S7QA 2ZZUT 4JVWA 5GGSA 1SJVA 2J1KA 2ZCHH 5D1XC 1U8PA 1TVBB 4I0PD 5SWSA 2X44D 3PE9A 3PWVA 1MWAH 1MIML 1JUFA 3QPXH 1T83A 4BQ8A 1X5FA 4ALAH 3SDAA 3RPIB 3W5NA 1J1OH 3OKMB 1T03H 3U1SL 4YIQA 3MA7B 1T2JA 3KPSB 1S7XB 1REIA 3WV0A 1EEYA 3CU1A 1NPUA 5FXCH 5MP6L 4U05A 5CEZH 5L2JB 2HMID 1GPOH 4WJ5A 3OKOB 2XOTA 4NBXB 4XPGH 1QRND 3F65A 5HGBA 5F7UA 5DMJB 1N59B 1QO3B 4LGSB 5IT2L 2BVOB 1TQBB 2Q7YA 1N6VA 5DJ0A 1QACA 2UY7A 2GSGA 1R3HB 2ESVA 3MNZB 3QUKB 2YRLA 3BPOC 3ESUF 3ARQA 2V2WB 3PP3H 1YEHL 2UWEA 1QBBA 4GW4B 3LS4L 1XR8B 4EN3D 5E8PA 1FL3A 4APQB 4PGJA 3JSSA 5EN2B 2HJLB 4HKJB 2EDNA 1A7OL 4G9DA 5ITFA 5JNYA 4K9EH 1F97A 3QWOA 2MHAA 5EBWB 3TA3A 2PW2A 5FCUH 1TJIH 5EO1A 1CYGA 1EJ6A 1HQRA 1YY8B 1T3FB 3MLWL 5ACZB 5IB4A 3C8KB 3R06B 5MI0C 3WKNA 4LRIC 5JA8B 1M6OA 1X9QA 1QQDB 5F8QC 2NY6C 4LCCB 4PJCA 3O6FB 1A3RL 1I1CA 3HZYA 4ZUSA 1C16B 2Y06H 2QKIA 3Q6FB 1KYOJ 1GIGH 4IRSB 3RY6A 3NZHH 3P77B 1R3IL 5LXGH 5DTFA 4U6VL 1GHFH 4I0KA 2XN9A 1MFCH 2RR3A 1PGRB 1EIBA 3I3BA 5CINL 2CDGA 2I60L 1NCTA 4CJ0A 4R96B 3PJSA 4UQ2A 5IW6A 2PTUA 1EA9C 2HT4D 1BREA 5FO7B 1L7IL 5T3XD 4BQ6A 4HUVB 4AG4L 3I75A 4MVBD 4FTVE 1A9BB 2R0LH 2X1XR 4IRJC 4MA7L 3QNYB 4H20L 5ACLA 4PG2A 4UILH 1UKTA 5KSBF 1ND0A 4LASH 5BMFL 4PRIB 2IAND 3H8NA 2LE9A 3DUUA 4XAKE 2IC2A 1WSST 1DQLH 1CBVL 4GFTB 1JZ8A 4UIKH 3QO1B 1EH9A 3TBWA 1MCDA 2XQBL 4HF5H 3WHXA 3C6LC 5J13B 2PTTB 4JHWH 1T7VA 4G8EA 4XX1E 3EDDA 4N0YL 3AAZB 1U3HC 3FO0L 4PV9A 4CUCA 2E6JA 2JJSC 2CKBL 1AE6L 3BE1H 4NO0A 1TLKA 7FABL 1FZJB 2AK4B 4GSDH 1U8LA 1N8ZA 3RIFK 5EIVA 2G75A 3CLEH 5D7IB 5D1XB 4GKNB 5ICYA 3S5LB 1C12B 2GJZA 2DQDH 1WAAA 2H3NB 5EU3A 1KCRL 1T0MB 4J1UB 1LE5A 4Y4KD 2FCBA 4OZHF 1HYSD 4LEOB 2OL3L 4WHTB 5D2LA 5C0BB 5B3JE 1FLTX 1QLRB 4JPIB 1IBGH 1SY6H 3K0WA 2VWEE 1HHHB 1BIIB 1DL7H 3QDAA 5D96C 1JJUA 3Q2CA 1LD9B 4NZUL 4R0LC 2L7UA 5GJTH 1OTSD 1JV5B 4F7TB 1CF8L 3TT1L 4Z5RB 3CGTA 1KF9B 4YHML 1D6VL 1KFAH 1LP9E 1L6XA 4WHDA 5DO2C 2ZUUA 4QWWD 4U7SA 1I1FA 3BPOB 5E2TH 1FDLL 2A83B 2AXGB 1KN4H 5BCAA 5GISH 1B4RA 4YUEL 4JGUA 5JIHA 1RURH 4OZGB 1M7IB 3OPZL 5F44A 1Q8MA 3H0TB 4HXAL 4FQCH 3VW3L 4ZAKC 3CXDL 3DMMD 4N0FB 5C3LD 3DURA 3H7BA 4NC1E 4AENB 3I9GH 1CVSC 1X5IA 2H32H 4OCYH 1MHHB 3B2VH 3SDCD 2Y07L 3NFSH 5MI0B 3V95A 3VFVA 3GSRA 3CMOL 1HH6A 1NEZB 1UACL 1LO2L 1OT2A 4RMTA 2A6JB 3VWJC 3LZFH 4WY7H 4DQOH 1RZJL 3MJ6A 3GMNA 3U36A 4Q9BA 5D6DC 8CGTA 1MCJA 3D39D 1AGDB 4E41E 1AR1D 4QNPF 1F11A 3RY5A 5DWUL 5JHDB 3SJVB 4HK3J 4LSUH 2ICEA 3UJIH 1YYML 5EBMA 4JFOB 2PYFB 2JCCE 1GGYA 4XPTH 2XZQL 4KRPD 3K4ZA 4NJAH 4F7EA 5IIEA 3ELAT 2BSRB 4ZFZA 5AWNL 3WS6A 3RZWA 4IMLB 1GGIL 1VB9A 4Z0BH 4IRJB 1RD6A 4KV5E 5HDOA 4MD5B 3V6OA 4G42A 1T0NA 4U6TA 5JORA 4Z7QF 2XXCB 1P6AB 4IDJL 4P3CH 3LDBC 3FRPA 3D85A 4RAVA 1QR1A 1RY7B 4R90H 1QSEA 3VDBA 2NLJA 5A2KH 4G8GA 4M62L 4LKXA 3OF6D 4EQ2A 4ZFFA 4JG0H 3RY4A 4PJHB 5E2VL 2J4WH 2ZCLH 1CL7L 3JXAA 5L9DH 1KPRB 1CK0H 1MJ8L 3QUZC 3T0DA 4TOYH 2UV3A 1I3VA 3NFPB 5CCKH 5IEHA 1P9MC 3LEXA 1U3HB 1OWRM 3UTTA 5MENA 3OB0H 4FHBD 2G60H 1DANT 4L4TA 2VLJE 4PJIA 4FQIH 5FYLL 2HAZA 3HG1E 2H2SD 3PP4L 4LHUB 4QTHA 3EYFA 5SWZA 2W07A 4H5SB 3EOBB 5DURB 3ARGD 4N90E 3QIBC 4X6EA 2YPLB 3SY0A 1W0VA 3BGAA 5C09B 5GS0D 1F13A 5ERWB 2NR6D 5DRNB 2V7HA 1G7QA 4FXGB 5HHMD 4PRAA 2X9YA 5GZOC 5IOPA 3MLXH 3QO0A 4GAGL 3G6JB 3NCBB 2A1WH 3QDHA 4MD0A 3B5HA 1KENL 3PWNB 3SOBL 4LLMA 4YDKH 4ODTL 5D96B 1VKXA 3QHZL 3DV4B 1Z0MA 4R0LB 5JIIA 2WBWB 1MFBH 3GRWA 1UENA 5F7KC 2VXTH 2GTWA 5BV7L 4OGXH 5D1QD 3LSOA 1NFDF 2FIKB 3G6AA 3MRHB 1JZ7A 3MYZA 1ZWIA 1I7RA 3FT4A 3UBXB 4KGLA 4MDIB 1ZLSH 3OXSB 5C70A 2FSEA 5A2IH 3LCYA 5HGAA 2YD4A 2ZNXA 2LU4A 3KPNA 3KXFD 1AI1L 3EO1B 2X1PA 1YC7A 2EECA 4PIRF 2I5YH 2GIYA 1Z9LA 5DJZB 4ZAKB 4HBCL 2VH5L 1H9VA 2X42A 4K2UH 3W0WE 1U6AH 1DDHB 2NW3A 3SGDI 3ROOA 3GJFH 3WO4C 3QDMB 1ONQB 4PJ7B 3A0OA 1MLCB 2VKXA 2XY2A 1F6AA 5EULV 2CK2A 5EC1A 4E0RA 4CMMA 1UWEH 3HZMB 3GMRA 3IVKB 3VWJB 4CN6A 4XP9H 1NANI 3OAUH 2FEDC 2ITCB 4P59L 1QLEL 2Z92B 3QUYC 4P5TA 5CMAB 3V0WH 2NNAA 3K2UL 5EOTB 4YAQA 3H3PH 1F42A 4QYOA 2CUMA 3WBDA 3U30C 2VN4A 1MUJA 5FYJH 5E5MA 1K4DA 3N9GL 2K7PA 5HHVH 3L3KB 3O45B 4XPAL 4X7FC 2BVPB 4NZJA 2VDNH 3Q6GL 5TQ0H 1ACZA 5JDJA 3WS3B 4NO2B 2PYED 1BF2A 3OJDB 4QOKD 3WFZA 5F96L 2EH8H 4HK0A 2XA8L 3MZGB 3OG4B 4GKSB 3ECBA 4LCUA 5D9SB 4JO2L 2AXFB 3FN9A 3VXUB 5KTEH 1JNLL 5EU6D 1VFOA 4FG6C 3LDBB 4KVCL 3QDGB 5GSVB 3DXAA 5MEQB 5EU7E 1QTYT 4X0KA 5D93C 3OKYA 2ZG1A 1WC7B 3H9SE 4NRZA 3PDGA 1NCDH 3RWHA 5HI3C 5IVXF 2F8OA 3JBG7 3RDTA 3QUZB 1T1WB 5T1LB 3FB8B 4EQ3A 2A6IA 1BVLB 3TO4C 3VH8A 4Q6YA 4G6AC 2BFVL 3WUWG 3PWLA 3T4AB 2JIXA 3FFCB 3U0WL 3GGWA 1CD8A 4M48H 4E9LA 1S9XA 4QHUB 9CGTA 1FO0L 1AJ7L 3ARBC 1E4KA 1TZGL 5IG7B 2FYYB 2X89A 2EE9A 4JFQA 3T77A 3OKNB 2QHRL 3RUGE 3QIBB 3BGMB 2R1XA 4J3VA 4MJID 4HUXB 4CU6A 2R56H 4RA0C 3LN9A 1CGWA 4YPGA 3BDYH 4TNVK 3SGKC 3R1GH 4OI9A 3PQYA 3BZ4A 2DWDA 2AK1H 5EA0L 4ZSOB 2H6PA 3EZJB 4OCWL 3WJJA 3GSVB 4LCWD 1LVEA 4M6NH 4PRNA 4S1RH 5K9OB 2BRRL 3PP3K 3B4NA 1CDJA 1G7JB 4PJXE 5F9JB 2JJUA 3NPSB 2VC2H 4WUKH 1FZMA 5T3ZL 4JQVC 3MX0A 5DT1H 2DM3A 4JFFB 4Z7UF 4GW1A 1KBGL 4XWGH 2GK2A 1YMMA 2ZSWA 3ISWA 3HMWL 1K4CA 5F89A 1XH3A 3TO2A 4DZBA 4WNQA 5SWQB 1DUZB 5DJ6B 2VYRE 4JFDA 4ELKB 3BGFB 1E4WL 4HIXL 3VXQA 1CDYA 5T1MA 3JTSA 4JHAH 3BEWB 4LNVA 5IFAH 4NQUA 4HXBH 3CX5K 2OTUA 4I2XE 4D9RE 4UTAL 1VEOA 5TDPB 4EIGB 3U9UA 4F9PA 1EXUB 5EOQH 1JWUB 3VFPB 1MHPH 4OFYD 2UZYB 4F2MA 2IMMA 2O5ZL 1U8MB 3MLRH 2MQCA 5DEGB 2HLAA 4LVHC 2FWOA 1WT5A 3STLB 1BBDH 3TNMA 4ONHB 3T0EC 3BP6A 3I6GA 2JB5L 3QUYB 3T2QA 2ARWA 4TULH 5KSUB 4KXZH 3VFRA 3VXSB 3WKMH 2CPCA 4F33A 4M7LL 3EGSB 3U30B 3QDJB 4PS4H 4APQD 4DOHB 5L8KB 4J6RH 4XVTL 4MMXC 4ODWA 3TIEB 5IR1B 1P4IH 3UPAA 3MRIB 3MLVL 3L1OL 1HOCB 2Q3AA 2V17H 3WNMA 1MCOH 3HI6H 4IJ3C 4XRCB 3RTQA 5ISZA 4HWZA 3UJJH 4ONFL 5CAYB 1I4FA 1YZZA 3MGOA 5ELIA 3MFFA 3L5WA 4UTBL 5CZKA 1HKLL 1HCFX 4XHJD 1MREH 3IXAB 1RHHA 5TE4H 2PUQT 5GPRA 5E00B 3O6FD 3U79A 1U8KA 3L5HA 5DVKA 2ADFH 4LLDA 2ZCKL 1TJHH 2HFEA 4UZGA 2HTLD 1MRCL 3BISA 4HGMA 3WSQH 4IRSD 3QFJD 4KKNA 4LCYB 1ZVSA 1VPOL 4PRBA 5INDB 3FRUA 2DQHL 5AYQA 5IFJA 3RWGB 3TO4B 4FABL 1I3UA 2CUIA 3ZKNC 4XCEB 3VD3A 1GXEA 2OMBA 1KTLB 2ILLA 1S7UB 3MGAA 5CGYC 3V6ZA 5E6IA 1HEZB 2A6DB 4M5YH 4X6BA 4JY6B 5JXAL 4HS6B 3ARBB 4U6YB 4P46C 1QR4A 3UC0H 4LAQL 1OAUH 4LEXL 4HWBA 4PJDB 2LABA 1DBJL 3GSXA 1MIEH 1ZA6B 2FR4B 1RZFL 1FG2A 4PRID 3C09C 3E0GA 3UTPE 5FO9B 1KEGH 2CRIA 3OAZH 5EZJA 4PJAF 2W9EH 4U0QB 4PY7A 3C5ZA 3VD5A 3FTGA 3F12A 3HLAB 5T1KA 3KYKH 4LSRH 3MRFA 2WLYA 4U1GC 4JPVH 4P5KA 3MTRA 1E28B 4XVSL 2PXYC 5KW9L 3LRHA 1N7MH 1BVZA 1H0DA 3HMXL 4XC1H 43CAB 1N6QL 2AK4D 2C4FT 4R9HA 4OZHA 1PAMA 1KN2H 4YNYB 2I25N 3RVWC 2HWZL 1ZT4B 1SM3H 1OHQA 5H8DA 4PJFB 4D2NA 1R5IB 4Q9RL 3PHSA 1A6VL 3INUL 3RL2B 1AO7A 3C60A 2X5PA 3OGOE 5I16A 4ZS6D 4U3XA 2OJEA 3MUZ1 3UX9B 5DD5H 3QISA 1NUFA 3U83A 5FHAL 3DTXA 5C0BD 4L5FH 3GMMB 5HD8C 1IC7H 5I1AB 4FZEH 1MI5E 4I3RH 2IMNA 3FJTA 1S5HA 3PXJA 2XFXB 4D94A 1MH5B 5GHWH 5I18H 2B2XL 2I27N 4LFHG 4LVHB 4Z7VF 4ZFOB 5DJYA 3N1QC 1QP1A 2WZPD 1KGCD 2VLKB 3LMJL 4OIAA 2DJ4A 4O9HH 5TH2B 3T0EB 5BS0A 4Y5XB 1XF5B 3RVUC 3SDYH 4PJ9C 4LKCA 1OPGL 1OQOA 5TDOA 2SEBB 2C3WA 5JIPA 1WEJL 4NOFA 1YNLL 2F54D 4NKIL 4YHIB 4MLSA 4NQVB 1D5XA 1T7WA 4YPJA 2C7UA 4U1JB 4HIHA 2APFA 3ARFA 5F7EL 2XG5A 2I9TA 1ZV5A 1JHKH 5ITBH 2WBJD 4OD2A 3KLHD 4GW5B 3X3GH 5H37G 4PV8B 1ZHBB 5ILTL 2G2RB 2BNQA 3VXRB 4JB9L 2A0LC 4U1HA 1JHLH 4KK5D 3RVXC 1BFTA 4FMFA 1S7VB 4IOFC 3S37L 1CLZH 4P57A 3HA0A 2KL6A 3DGCR 3OB0K 1UB6A 4HJGA 4XCCH 1AC0A 4OT1L 4DVBB 2QADD 4W4NA 5E8NA 3ZYOA 1MJJB 1A6WL 4HW6A 5F9WC 4ZDHA 5JHDD 4XXDB 3P73A 2XKNB 2FEEL 3RKPA 1IAIM 2YA2A 1VGKB 3QG7L 2FB4L 4IIQA 5H2BB 2DTMH 2XNAB 3O3AB 5F7LB 5C7XH 1JYXA 1KCKA 1FNLA 4HJ0C 5C0AB 4I9WE 1INEL 1WQVT 3MO1B 5FHBH 1CE1L 1UWXH 1V7MH 4PREA 3QEUB 4P46B 1II4E 3FFDA 4JKMA 3ULUE 1EMTL 4L9LA 5DC9B 4ZO9A 1EVUA 4N1CA 4GQPH 2P5EA 4X5XB 4X6FA 3NIDE 4XAWL 2YZ1A 4IDLA 5ALCH 1UZ6E 1WBZB 2APTA 1A7RH 2VE6B 4J3TA 4JDTH 1S5IH 1AQDB 4KQ3H 1F4XL 3KYOA 3ARSA 1TNNA 3IRPX 3X14A 4C58B 1R5VA 3ZL4L 1U3HD 2HRPL 4U1GB 5JW5B 3WMSA 3ALWA 2PXYB 3PWUA 5ESVB 1TIUA 1YPZE 4P23C 4XCFL 5F1NA 1PVHA 2E8YA 1G6RH 2G9HA 5I2IA 3TYFB 1JVKA 2CRMA 1FO0A 3GJFK 3BWAA 3O0RH 1IJ9A 1HZHL 5JA9A 4X80H 2JELL 5C09D 3DRQB 5IHBA 1ZSDB 4ODBD 3OTTA 1IL1A 2YD5A 3ZE2E 1DQMH 3V0AC 2V2TA 1FNGB 2RCSL 4QHNB 3SKMA 1NFDA 4MJ2A 4XXCC 2DLHA 5IEKA 1XGQA 4YWGL 5IESL 1ZANL 2F58H 3GNML 2DB8A 1AQKH 3BXNA 1A9EB 3F7QA 4RGNC 3GMLA 4EEEA 3F7YA 3IJSA 4OQTL 1U92A 2HT2D 3OKEB 4WTZA 3CDGB 3HKFA 4DW2H 1KCUL 5DK2B 5FUZH 1CGSL 1C5DB 3AY4A 4AH2A 5DO2D 2EIZB 2EDJA 1LMKA 4OQ1A 4OZFH 3SGJA 2O5XL 2ZSVB 4ZQKB 5I30L 4LSQL 3BI9X 3GSWA 1NC2B 3VRJB 1JN6B 1KIQA 4Y4FA 2FBOJ 1I8IB 5CSZA 4EI5A 4P49A 1OAZL 3BH9B 3U6RA 2W92A 4MAYA 4JREC 4QRUB 1JPFA 1NCWH 5C07A 4K9EC 5ID0A 5FGRA 1IQWL 4ZAKD 5BVJB 1S7WA 3HR6A 4JANA 3NACH 4FNLH 4UIMB 3QH3A 4P2RD 4MQ7A 3DHJA 3VFNB 4NNXA 1J05B 1QYGL 1S3KL 3TN0B 3O3BB 3F58H 4LPWA 3H6JA 2EIEA 2AJUL 3S98A 1UCBL 5KG9A 2IFGA 3WXVH 5D5ME 4RA3A 4MSWA 5A2LH 2B39A 4ZS7L 4HHAB 3L6FB 5AZEH 1UVQA 3QR2A 5F9WB 1OAQH 4CJ1A 3QG6B 1KB5B 3B9AA 3P9MB 4QHLA 5BJTA 1PG7W 4QHKJ 2BVEA 1L0YA 1PDKA 1VFUA 1XGYH 4J4PD 1YDPA 3N06B 4NHCL 2PNDA 2A9NL 3MMEA 3GMQA 3HAEH 3BX7C 2DICA 3PL6D 1F90L 1RZIA 2MCPL 1CGVA 4FQLH 4X6DB 5EUOE 2CRYA 5CBEA 4HZAA 3GMPB 3VXMB 5HHQB 3O6MH 2DOCA 4R7DB 3VXUD 5IVXA 5KVFL 4PB0L 2CXGA 3AS3A 4HGWB 2BNRB 1RUMH 3BO8A 2Z31A 5TF0A 1HHJB 5D2NE 4HKXB 4H0HB 1BQUA 2CGRL 1FG9C 4YX2L 4Y2DC 4NM4H 4XMKH 3ULUH 4X7CC 4GBXA 1PEWA 2A6KB 3C8HA 5KOMC 1S8DA 4L8DB 2Q86B 3QXAA 4UT9H 1BD2A 4EUPH 5E2UH 4UT7H 4YR6B 3SDDC 5C1MB 2F5BL 2APWA 1M4KA 2H9GB 2H26A 3D9AL 5T3XL 3O41A 4YHOH 3VGAB 5GJSL 1ROWA 3ZDZE 4KPHH 4BZ2L 2B8OT 1U8QB 5D1ZA 5ADPL 5HYJB 4KTYA 2QQNL 1ZT1A 3FFCD 4P23B 2EYTB 3OHXA 4WWKA 2P24A 4TSBH 1HSAB 1I7TA 5ID1B 2D9QB 3L3OB 1CZ8H 1YYLH 5I75C 1XF2B 4NKDB 2DD8H 2H8PB 1MWAB 1ZHNA 5M95B 2M2DA 4IHOA 4O2FA 3ARRA 4HFWA 4E42A 3MV8D 4U1MA 3KJ6H 3U0PA 5GZOD 4GRWE 2I24N 3FOLA 1I7UB 2QSTA 4RZCB 4WW1A 1NMBL 1KCSL 2QTEA 2X4PB 3KPRB 4V1DB 1MELA 3Q48A 2VDML 4L3EE 3J8F7 5C92A 5KVEH 1QBML 4RGNB 3L3IA 4F15C 2YUXA 2OQJA 3U7WL 4CVUA 1IFHL 4JFFD 3W11C 2QSVA 2LVEA 4X5WB 3TGXA 4WEUD 3LPWA 4WW2B 3BAEL 3RZCC 5B8CC 3KR3H 3EJZD 4GS7C 3UTQB 4ZD3H 2FO4B 1YJDH 4CW1B 2EYSB 1DBBH 3O9WC 3ES6B 1Q9KA 2FECL 3ZTJH 1M7DB 1IGYA 3GEWB 4IOSD 2R0WH 2HP4A 4JEGB 4JREB 4OLUH 4AIOA 4G7YL 5F93C 3IU3A 4OLYL 3GHBL 1T21A 4M5ZL 4W70A 3QJFA 3IFOA 4R97C 15C8H 1PZ5B 2CR3A 4K3HA 1QVOA 4P9ML 2Z8VC 1FZOA 2FH8A 5EZIL 3SKNB 3MBEA 5BOPA 5L2KB 3V6FB 4B50A 3FHQA 4LSVL 2C4FU 4MWFB 1IGJB 5DJ2B 3QUYD 1HCVA 1WBXB 4BQBA 1MOEA 3O3EB 4YDVA 1BZ9B 4K8RH 2AI0H 3EO9H 3VXSD 1N64H 1BWWA 1IC5H 3OGCA 3GM0A 1NUDA 3KDMA 4AYFA 3CK0H 5E99H 1H8OA 1WWAX 4Y4HB 3GBML 1CXIA 2R9HC 4PRPA 1JYNA 1UM6L 1D6EA 3GSNB 1IILE 1ETZB 4M6OL 2D7OA 4XPFL 3OAZK 2MQ3A 3FT2A 4OBSA 5EIIA 3D0LA 2O93L 2Z35A 1FYHB 1RMFH 1Q94B 3HCVB 4CU7A 1OTTC 2PW1A 4M7KH 4JFZH 3VXTB 5FDWA 1FFNA 1MF2H 1QFUH 4NDMA 3QSKB 4Y2DB 4RGOH 1KJVA 1T1ZB 4PGCB 3MYJA 4U1NA 4NCC1 3WJLA 1TZHB 4LARL 1Q9OA 2E9JA 1ZOXA 4ZMAT 3WFHB 4AL8L 1X7QB 2ZUVA 5ALBL 4XC3L 3OSKA 5I1IL 2R0KL 1C1EH 1Z9OA 3C2AL 4CRPA 3QUXA 3MRJB 1H5BC 1E4XH 3UO1L 5CILL 3SPVA 1KTDA 5DEFB 3TO4D 1P7KA 4UOW1 1U8JA 4G6AD 3ARXA 2X4SA 3ZT6A 5JHLH 5DZLA 2V5YA 3MJGX 3O4LA 1JTTA 4NT6A 4PJAA 1ZTXH 2VLRB 1F8TL 5HHOA 1YECL 3V5HB 3LKOA 5KS9F 4HDIB 1C8PA 3WUZA 2UVEA 1BMGA 5I75B 4M8QB 4OV6F 3PWPE 3PGFH 1F4WH 1FHGA 1K8IA 1SMOA 5C08D 1A5FH 3L7EB 5HYEA 1INDL 1T04A 5HYFA 1J10A 3RWFB 2GI7A 3QEGL 1WV7T 5GSRB 4GRWH 1SYSB 1CLCA 1Y18B 5CSGA 4ERSH 3WCYA 1VGEH 1PYWB 4ONGH 3TCXA 2EXYC 5J6HA 5I1DB 1JF1B 4F15B 2VWEC 2HJFA 2W38A 2AJXL 4QEGA 2APVA 5ESQB 3WD5H 4F58L 2W59A 3V4VL 1JPSH 1LO5A 2A9ML 2W65B 4FN0A 5GS0L 4JFPA 2NY5H 3RZCB 2W1NA 1NDMA 5B8CB 4JPWL 4GS7B 3RPKA 4Z95H 5FFLA 1FNEB 4LVOC 4UNTA 1OB1B 3O9WB 4AT6A 4GMSL 4OUUA 1JRHH 3I50L 1ERNA 4XBEL 2F74B 2DBLH 1OOAA 3VMOA 4DN3L 4XNUL 3BVNA 1WTLA 1P4LB 1KTKE 3CH1A 1TZIA 4Z7VA 5FYKU 2EXWC 3JVGC 3ZT5A 1S78C 4HZLA 3P0VH 4ZOEA 4R3SA 1R6VA 3L3JA 3O6KL 1RZ7H 4HWEL 3UPRA 3IXTA 4R97B 4NC1C 4IM8A 5HVFB 4G3YH 5AZ2L 3IJHB 5GZND 1O0VA 4M7JL 2P47B 3VFMA 2MCG1 2D7TL 4Z7WE 2WINB 2YC1A 1U8IA 5B38G 4QXTB 3T0ED 5GS1B 5IHZA 1NSNL 2VXUH 4KH2A 25C8L 4BFEA 1U8NA 5HHXL 5ACMA 4MS8C 1UWXK 5IBUB 4YXHH 3QA3A 1QSVA 1XCQB 5BZWB 1J8HE 3GSOA 4KRMB 5GGVH 3OQ3B 1TVDA 1YEGH 1NAKL 3IS1X 1RJLB 1EERB 2J5LC 4W4OA 3Q1SL 3WHE1 3DI3B 5HDQL 1H3PH 1WZLA 5B38B 1UGNA 1EBPA 1QRNA 3VXRD 5FUCE 2IQAA 4PJ8D 4FTVB 5A16A 2VXVL 3IFNH 2OSLA 1KSRA 1QFWL 1FZKA 1J1PL 2C3GA 3QXVA 4YEEA 1ZT7B 5INCB 5JW4N 5I8CA 2BHZA 1KNOB 2NX5A 4Y8AA 3AVEA 1LDPH 3CFCH 1OAYH 4JQXC 1F3DH 1RU9H 4OKVB 4WI8A 2YXFA 1S7RA 4WIQA 1UQSB 4I4WA 4O51A 3OXRA 1VFMA 3TBTB 3HI5H 4P2QE 1H5BB 1FFRA 2V6HA 1V3JA 5AUMB 2X1WL 5BQ7B 1CFSA 3C8DA 3ZKND 4YBLC 4G5ZH 2X6MA 1RQ5A 2A73A 5C0AD 5CGYD 3VMPA 4K3DH 4U1KB 4G43B 3SDXE 3DX6A 2YD7A 3CZFA 3MXVH 2VR4A 3RX8A 1W2KT 5C9KA 4ETQB 4P46D 5MHSD 3WFDH 4ZPVB 4X4XA 3SE4C 1MCNA 2X4RA 3CC5B 4M43L 3LB6C 4TSCL 4KUCD 1HSBA 4DTGH 1MJ7L 4DKEL 4CN4A 5HPMB 1KTRL 3D87B 1MIMH 2DLFH 3CVHL 2R2BB 1I1YB 2EC9T 1UEYA 3JWNC 5TDNA 2P5WE 4JDZB 4UI2A 3TBSB 2F15A 4QRPE 1DE4B 3U1SH 5EO9B 1G7LA 4Y1AD 4GQ9L 5EU5A 3VH8G 3C9NB 2PXYD 3QEQE 4G6FB 4NZRH 1QFHA 4K07A 4JHBA 3WE6A 1F4HA 2OYPA 3F5WA 1GSMA 1DP0A 1RJZA 3RKDC 4DEPC 3BEVB 2YD9A 4C4KT 1S7SA 3RWEB 1LP9B 3D18B 1VCAA 1WFUA 2IANA 5IT2H 1YUHA 2W0FA 1MHEA 2R23A 1SMAA 1QOKA 1I1RA 1R5WB 2E6QA 1YEHH 5EU4B 4NBYB 3LS4H 2YN5A 1CXHA 4TSAL 1NQBA 1GOFA 3D25B 4LCIL 5HHNA 4WI3A 5F3BB 1A7OH 1CFVL 4Z76B 2YPVL 2MJWA 4NFDA 2FD6L 5A3IC 3B9EA 4FQHB 4TTDD 3B2UD 3CIQA 3H42H 4NBZB 3ZTNL 3WLBA 2Y5TA 3QRFM 3MLWH 3TH4T 5T33L 4QHKI 5BRZE 4L29A 2DDQL 2EO1A 4X4MA 1FV1A 3FQUB 3QFDA 4PRDB 4RBPK 1OSZB 1U2HA 1A4KB 4PJBE 2PCPB 5IP4A 3E6FB 1OW0C 1BZ7B 4QTIL 2Y9RT 3G5VB 5DUML 3RVUD 1U0QA 1WFOA 1A2YB 4K7PL 5J9PA 2WK2A 4Y4KA 1A3RH 3UTSE 5DZOA 4E41B 4GUPA 1KB9J 1C7SA 2IEPA 4TRPL 4MNQA 3BH8B 3KNBB 3E6HA 2GT9B 5IW1A 2J5LB 1HIML 5IB3B 1PSKL 1R3IH 5GRJL 3MREB 2JCCB 4H1LH 5KSBE 4U6VH 3V0VB 5A43C 2I60H 1TENA 3IF1B 4JFXA 4NQDA 3LKSB 3TN0D 4GG8A 32C2B 5LGJB 1XGPA 4PGBB 5SWSD 1L7IH 5IBLD 2A0LD 4KKBC 5F72S 4AG4H 3RVXD 2R2EB 4MA7H 2J8HA 2NXYC 4JJ5A 4H20H 4KI5C 4PJEA 3DX8B 3ZE1E 3VG0L 1A1MA 3MJ7B 4IS6A 4Q2ZB 4UUJB 5EU7C 1ZE3C 1W0WB 3DRTB 3QXDA 4F7CA 1XZ0B 5BMFH 5FYKD 2IH3B 5J12C 2BVQA 1LDSA 5I1GL 1CBVH 1ACYL 3VFUA 3MNWA 4RIRB 5JLZB 4YBQC 3QCUL 2XQBH 4FQQA 2D7PA 4U2YA 2HLFD 3SDCA 3AU1A 3BD4A 4BK4A 1CXKA 5IF0B 4YBLB 1YEFL 1RIHH 3GDBA 1T22B 1HI6A 4N0YH 3FO0H 2VLJB 4XGZA 1CLOL 5IQ9A 4JO4L 2CKBH 1AE6H 4WFFE 1GGUA 2OR8A 3HG1B 3P0YL 4U7KA 5HY9B 2ESVD 1T20A 2ZJSL 7FABH 2Q8BH 1A6TB 4YDJB 2BNRD 4P9HL 3GO1L 1D5IL 4GKZB 5D6CA 2Y25A 2LVCA 3H9YA 1P6FA 4MJ6B 4KDWA 3BWUC 1YY9C 4XCNB 4OD1L 3VFOB 5D7LE 2GAZB 4N0CC 4PJGA 3BIKA 4HS3B 1FAIL 4BUGA 1WCBA 3M1BB 1KPUB 4HUUB 5D7KD 1JZ2A 1KCRH 1CI5A 2OL3H 3OX8A 4K7FB 3GUTB 3ZHLA 4ZXBA 1IEBA 4Q97A 2AW2A 3LKNB 4LLQA 1PQZA 5HYJD 2DF3A 1UXSB 3PUCA 3HZKB 2CMRL 3B8SA 5B4MC 4NZUH 4P23D 4DEPB 1CF8H 2P8MA 4QLRA 5K59E 3VFWA 4YHMH 5F9AC 5IVNA 4OSUL 1D6VH 1VADB 1NGWB 3T4YB 1KIRB 3OF6A 1TVHA 3RGVC 2ORBH 2IALA 1BVKB 3K8LA 1FDLH 1RUAL 3N0PB 4NC0B 3UZVB 4YUEH 2JTDA 4QY8A 3O8XC 5IW3A 3KPRD 4V1DD 3OPZH 2GTZB 2PO6C 4ODXB 2VRAA 5EZLA 4HXAH 3HR5B 3W0WB 3VW3H 4RGND 1V3KA 1FE8L 1OCWL 1CDCA 2L7JA 3U82B 3PV6B 4OCSL 5IFHL 1RI8A 3M45A 5C71A 2Y07H 3CMOH 2IFFL 1UACH 2CDFB 3EW3B 5DZNA 8FABB 5GGQL 1ZHLB 2XTLA 2HG5A 5DS8B 2EDYA 1FN4B 1RZJH 5AG8A 4ELMA 4WTXA 3H7LA 3FO9A 4Z0XB 1IEAB 1JF5A 4MNGE 4Z7QE 2EKJA 5DWUH 2VKWA 4X6CA 3NAAL 4OUOA 3TWCL 2R2HB 1P2CB 4NO0D 1YYMH 2JK5B 1ZS8B 1QUNA 2E6PA 5CSBA 5D72L 2J3SA 5AAMA 5D1QA 3G6JF 4WI6A 2YSSA 5JXEA 2X70A 3IFLL 1AKJB 2IH1A 5L2KD 2VLLA 2HFGL 1P1ZA 1MCSA 3GKWL 4JY5L 5IVOA 2NXYB 4C56E 1HHIB 5GIRB 3KPLB 2VTFA 4IDJH 1EO8L 3KXFA 2AJYL 2VAAA 3GSUA 3ULSA 2R15A 3VFGL 5GS2H 5LGKA 1EFQA 5F21B 1MCLA 4YQXL 2X4OB 4QRTA 5JO5A 3B9VA 5J12B 4M62H 3LKQA 2KQMA 3H9SB 4CVZB 4YLQT 2Y6SC 2D0FA 4HMDA 4Y4HD 5E2VH 1Q1JL 1HWHB 1CL7H 5E9DA 3MZTA 3OR7B 5E1HB 3Q5TA 3BZEA 1MJ8H 3U46A 4LSSL 5J3HC 5HJ3B 5TE7L 3IS0X 3BQUA 4MB5A 5CEYB 3NCFB 4V2BA 2EE2A 4E5XA 5IJVB 3REWB 4BFIA 4XP4H 1ZKAA 1WBYA 3WFCL 5A2JH 3PP4H 3OKDA 2WSKA 1KELL 1KJ2A 4PJ7F 5CP3A 3RUGB 4NFBA 2V2XA 5M94B 2VDRL 4OTXL 5DJXB 3LV3A 3EYOA 4H8WL 5DI8A 4RFEB 4Y16C 5FKAA 1NDGB 3D3VE 4GAGH 4RRPA 3IDMA 4DGIL 2ATPA 4D8PB 2PYEA 3MPCA 1KENH 4QOKA 1BOYA 3SOBH 5K93A 1A1OB 4WUUE 1NCBL 1J1XL 3QP3A 5F6HI 3A6OA 3L5JA 3FN0L 4PJXB 1LO4L 3FMGH 3QHZH 4P4KC 2IJ0C 5C0DA 2CJUL 43C9B 2ZUSA 5T3ZE 4PJ5E 4QXGL 4JVUA 4P2OC 2VLRD 2BVTA 3PHQA 3WN5C 1RIVH 2CO6B 2P45B 1YMHA 4N8VG 3KPMA 4S10A 4X8JB 3U9PL 5C0EA 5I76B 1X5XA 1D5BA 2W0PA 3DIFA 3GI8L 4Y88A 1XF3B 3T0VA 1NFIB 1BECA 3RGVB 3RL1B 2VABA 1MCQA 3LRSA 3VFSA 3FB5A 4NRYA 5I8OL 3CVHA 3N85L 5GGTL 4X98A 3O8XB 3J7HA 4LPUA 4OFPA 3AB0C 2PO6B 4I2XB 1U95B 5MEPB 5JIKA 4HBCH 1VFAB 4R4FL 5DRXA 1K8DB 4N8VB 3QULA 3D85D 2IADA 1T5WB 4KRNA 1BQLH 1QSED 2ENSA 4OZGE 3RZCD 2X1OA 4HV8A 4IMKC 5TE6L 4G8GD 4KDTA 1QA9B 1QHPA 4HH9B 5CD5C 1I8LA 4GRMB 1NGXB 3S8WA 4PD4K 4L8CB 3KLAA 4P59H 1QLEH 1OF2A 3G5ZA 5ANMA 4EI6B 4N9GB 1BOGA 1BPVA 3K2UH 4I48A 3FCTA 3LS5L 5H35A 4QF1A 4C83A 2ADJA 3B6SA 4LCWA 4OLXH 2EDWA 2FX7L 3O3DB 3UTTD 5MEND 1FVCB 2GK0B 4L4TD 3MV9E 1CFNB 4J3UA 3MRBA 2EC9U 3DARA 2M1KA 2YEZB 3N9GH 1CE6B 4NCDA 3MJ8A 4GXUN 4XPAH 3DO7B 1JGVH 3Q6GH 2E8ZA 1QSFE 3IETB 2QQKL 3JWOL 1QFOA 2C26A 5F96H 2XA8H 3GM8A 1TVBA 1AR2A 4JO2H 2FDBP 1WGOA 3ILQD 4KVCH 5AG9A 3RPIA 4GG6E 1JWSB 4GO6B 1ZAGA 1XMWA 3OKMA 1OAXL 6CGTA 5C0CE 3SBWC 1D5MB 3OJ2C 3KG5A 1V5JA 3VDCA 3MA7A 3KPSA 5DD6B 1S7XA 5FA4B 4NPYB 3EJJX 3HB3C 2NY0B 1NCUA 3I84A 1GC1H 3HE6B 1K5NB 5L2JA 1EUTA 2MNUA 4OFYA 4ODHH 4TUKL 3ULVD 1NCAL 2N7BA 3OKOA 4DGYL 5DQDH 2F19L 1N59A 1QO3A 5CKAA 2BFVH 3QHTC 2BVOA 1UWGH 2RFXB 2EH7L 4DKAA 4FTVD 1JI1A 2F5AL 4C55A 4Y5YC 1R3HA 3BJ91 3MNZA 3QUKA 1AJ7H 3TIDB 3G9AB 1IM9B 2V2WA 1TZGH 1S9KC 4GW4A 4XT1C 4AMKL 3ULUC 2N7AA 2QHRH 2DWEB 3I2CL 1MVFA 4APQA 3SDAC 3MCG1 3TNNB 2HJLA 4HKJA 2VQUA 3DYPA 4N0UE 1MCHA 5GQBA 4Z7UE 4XAKD 4Y16B 5EBWA 4XP6L 4Y89A 3BRFA 3T3ME 5CEXB 5DHVB 3STZB 1YY8A 1T3FA 3MROB 5EA0H 2XKUA 5HPOA 4OCWH 5J56B 3PABB 3C8KA 3RWJB 1B0RB 2BRRH 4U1LB 3V6BR 4AEFA 1LK2B 1ORQB 4KK6C 4P5TD 1G6RB 4LCCA 4P2OB 4UQ3B 5T3ZH 3O6FA 3WN5B 3Q3GB 1FNSH 5C0GB 1C16A 1KBGH 2VZ1A 3Q6FA 2ZWLT 4BFGA 3LIZL 3HMWH 4IRSA 1M05B 3P77A 5DRZB 5HVWA 1E4WH 4HIXH 4JN2B 1G7IB 5IMMB 1CU4L 2E7HA 2F53E 2YD8A 5BXFB 3TA3C 3WL9B 4PGEB 4R96A 1HNGA 5FO7A 5E1AB 4I18C 4HUVA 4UTAH 4RX4D 1MI5B 1A9BA 3QAZC 4HAFA 2WIMA 3QNYA 4XMPL 5IROA 4Q74A 2YUZA 4Y19E 2BY1A 3K1DA 2O5ZH 4OZFB 2AJVL 3KVQA 2HKFL 3L3GB 2FBJL 4PRIA 1YJDC 4HD9A 4NQEE 2JB5H 2E9IA 4NKOB 3QO1A 4EDXB 3RY6C 1UZ8B 4WFED 4JRYE 2PTTA 2HFFB 4M7LH 2EXWD 1FNHA 3AAZA 2W9DL 2BK8A 4LGRB 2DQTL 3T65B 2JIXD 3CFDB 4OLVL 3MLVH 3L1OH 3ZDYE 1D5ZA 1LQSR 1FZJA 2AK4A 3FHAA 4ONFH 4MCZB 4NUGL 4OLZL 3KYMB 1NGPL 4UTBH 5T1DL 5D7IA 3WLWD 5D1XA 4GKNA 1HKLH 1C12A 3EOYG 3P3YA 4LPXA 2H3NA 1C5CH 4K8RC 1T0MA 1MCPL 4J1UA 4I77L 5CJ5A 5CJOL 4LEOA 4E41D 3O2VL 2ZCKH 4WHTA 5C0BA 1QLRA 4JPIA 1A14L 1DVFC 5FV1L 1HHHA 4PJFF 1BIIA 1LD9A 2DIBA 4GOSA 4RWYL 4WO4C 1VPOH 1JV5A 4F7TA 2GSIB 3HAEB 4Z5RA 4W6XB 3U4EB 2DQHH 2BNUB 4FABH 3EYSL 4UBDD 4IOIB 3VCLB 2JF1A 4J3WA 4D9LH 4DCQB 1J7VR 4Y5YB 4KJPC 4YHLL 1IGTB 5JXAH 2XV6B 3EDJA 1JGDA 4LAQH 2A83A 2AXGA 2VERN 4LEXH 5D2NC 1OGAE 1DBJH 3SGEH 2YD6A 3ZSTA 3DBXB 5C0FB 1M7IA 1RZFH 2OMNA 5T5NF 1OGTB 4EUPB 3H0TA 4Z7NE 1TTGA 4N0FA 4AENA 4RFOL 4O2CB 2RHEA 1MHHA 2Z93B 4QXUL 1BQHG 4BQCA 1NEZA 1XAUA 4LRIA 1WISA 2A6JA 2VLJD 5JZ7C 3MSPA 3LKRB 1T2XA 2YUVA 3O2DL 1YPZB 2VUYA 3HMXH 1JNJA 3VXOB 1AGDA 2FIRT 4L4VE 3SKOB 2HWZH 2CIIB 5JHDA 3SJVA 1MEXL 2QLVB 1IRAY 3S4SG 1YEDB 2QBWA 4Q9RH 1A6VH 5GRUL 3INUH 5E8PB 4YXKL 4JFOA 1NCCL 2EDRA 2AEIT 2PYFA 3RTQD 3QZWB 1BQHB 4PLJD 4S1DC 3HPLB 3KPQB 1CDGA 5FHAH 3REVB 2BSRA 3CFBB 4IMLA 1Z5LB 4I18B 3GBLA 2EYRB 5IUSA 3QAZB 4IRJA 4MD5A 1TFHA 2APBA 4RMWA 1X5AA 1F58L 2NY5C 4P2CG 5E4IA 5J1SC 1DEDA 3WDJA 3S4SB 2B2XH 3SE9L 4BH7B 2XWTB 1UYWL 4U3HA 5FUOL 4ZUSB 3LMJH 4WDIB 2CD0A 4PRHE 4BQ9A 1GGTA 4PJHA 1DLFL 1FJ1B 1T89C 5JDSB 4NQCE 1KPRA 1OPGH 2XWBB 4LPYA 3VRIA 3G08B 3VGHA 1WEJH 1MVUB 3NFPA 1MCKA 4NKIH 1U3HA 5K9KB 2JJSA 3IDNB 1P7HL 5F7EH 1NCNA 4OGYL 4LHUA 1JPST 2GCYB 4HGKC 5F1SA 5IB1B 4H5SA 3EOBA 1RAMA 5ILTH 2YPLA 5C09A 5E94B 3IDGB 5SX4H 5ERWA 2IPTH 4HK3N 5DRNA 1KG0B 4FXGA 4KK9C 5D5MB 1R3JB 3S37H 1VEPA 3C5ZD 5DHYA 3G6JA 4WV1C 4OT1H 3PWNA 1F4AA 5F3HB 1A6WH 1DVFB 3TVMC 3ZKSD 3FL7A 1PX3A 2J6EL 1G9NL 3DV4A 4FFWD 2JE8A 3CNKA 4RQQB 1G9EA 4R0LA 5HDBF 5D71L 4PUBL 4WO4B 1FYTE 3LPGA 2XQYG 3QG7H 2FB4H 4TVSa 4ZFOL 2EEBA 1JIBA 4TNWF 4OGAC 4R2GC