1FE8L

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
DIAMTQTTSSLSASLGQKVTISCRASQDIGNYLNWYQQKPDGTVRLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLESEDIATYFCQNGGTNPWTFGGGTKLEVKRADAAPTTSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VON WILLEBRAND FACTOR
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2000-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8L01
1CGSH 4K7PY 1N5AA 5DMGC 2CLZA 1X5IA 4QO1A 1RULL 3SGDH 4PJ9B 4W6YB 5JOPE 1CICC 4JFFD 3BP4A 2WNGA 5D2LE 5DRWB 1CLZL 3L3KA 4HKZB 5E8NA 5MEND 1NCWL 4KV5F 2Q3ZA 4U1KA 2JB6A 3QWOA 1WIOA 3FB6A 3AGVA 1MREL 4TUJA 1I8LA 4XPBL 1SBSH 4HIHB 4MVBD 4MJID 5FHBH 3EFFA 4GMSL 1YNTA 3EOBB 5A3IC 1VFAB 4H1LG 3EO9H 3TLRA 2KKQA 4TNWK 2JJTA 4RDQG 1PAMA 5H37G 5LBSH 2X4QA 1B2WH 3HHRB 1CT8A 3O3EA 2BCKB 1ZLWK 3X14A 4EI6B 2F5AH 1FZOA 4U1IA 1IGCH 2XXCB 5E5UB 5FM5M 2CRYA 1MCFA 1NGPH 4XAWH 4Q9QH 2EKSA 4B53A 1CDCA 1B4JL 4KZDL 2CK0L 3CVHH 1I85A 3L6FB 5J7CC 3BP7B 2YOCA 2NY5C 1K4CA 3SDYH 2BC4A 5CILL 2CRZA 3QIBD 3VH8A 3OMZA 3HI5H 1BX2B 5MERA 1LE5B 3PHQB 5KS9A 3ILQD 3KPRD 4Z0XB 43C9B 8CGTA 4JO1H 4R3SA 3SJVB 1KG0A 2UVEA 1EV2E 1RUAL 3FFCD 4R7NB 1EJ6A 3SDCD 4DCQB 3BP6B 1IT9H 4P23C 5D72L 4PJEA 1ACZA 1A6VH 4H88H 5D7LA 5KSUA 1KJ3H 5DJZB 2FH6A 4DOHB 3ZHKA 1V8HA 4MJ2A 4RWYH 4XMPL 2OTWA 4OM1L 2J8UB 2CK2A 4K94L 1MVFA 1JMXA 3WLBA 1FLRH 4LEXL 1A1OA 5DWUH 3QXTA 4PLJC 1T0NA 1T3FB 5EU7E 4HWUA 2EKJA 4Y2DB 3UAJD 5DI8A 1NAMH 3QDJD 1F58L 1LO4L 2HFGL 4XNZC 3FTGB 1NJ9A 5D7IE 1AGEB 4NWTH 1TVBA 5DUPH 3RKDC 2C4FU 1NH6A 4UT7H 5GISH 4ODBD 3O6MH 1XIWC 4BSVB 5C08D 1OT1A 3ULSB 3I02A 4DFHA 1MFBL 5JW3H 4HFWB 4X80H 1MCSA 1DUYA 3RWEB 1T0MB 3F58H 3LEXB 3CMOH 5B3JE 1QFWH 4M5YH 4G9FD 3RWFB 4GRWE 2OL3H 3GSNB 5E8EB 5L6YL 5E00B 5HHVH 4LSQH 1UWXH 1I3RA 3KPQA 5I1LA 1ZHBB 2ADFH 4KTEL 5DJ2B 3T2QA 3HE6D 2VDNH 5HHPA 5F7HA 3LN5B 4ZXBC 1RJZB 1CXIA 1AXSB 3KPMA 4FABH 3TNNA 2FGZA 4O02H 3PP3H 1II4E 5K9OA 3L1OL 3HZKB 3LZFH 5CZVH 1KELL 3G6JA 5B39B 4FTVB 3FZUC 2X70A 3U36B 5J1AB 2GT9B 3MR9B 3MLYH 1YEJL 4LSRL 4GLRH 4YO0B 4AMKH 1C08B 2ARJB 2NTSP 3DRQA 4HJGB 5DQ9B 1AGFA 5DD0H 2MHAB 3RWHA 4J3SA 3HRZA 4TSCL 2EIZB 5CSZA 2F15A 5GPRA 1SJHA 4R90H 4LPYA 1QD0A 1XGYH 1OWWA 4QWWC 4GKZA 3FT2B 3CX2A 5F70A 3RDTC 1U8LB 3ZL4H 1ONQA 1FBIL 3JV5A 4OV6F 2BSRB 2Z31D 4ZAKC 3TJHD 2EYRB 3U7WH 2XQYK 1QR1A 1G7IA 2AABL 3BPLC 4O58L 5DEGB 4I5BA 1P4BH 3BXNA 4NJ9H 1Q9WB 3B6SB 4X8JB 3QZWG 1GOHA 3MRLA 4JZOB 3GIVB 4GG6E 4OZFA 4LAQL 2HT4D 3EGSA 4HC1H 4NZTL 1S7QB 2A74A 3P77B 2DLIA 3TBVB 4IOSD 1T2XA 2IPTL 3DX7B 1OP9A 4XT1C 4CGTA 1T7WA 1HK6A 3S3SA 3FQUA 4U6XA 5FYJU 5I8EB 4Y16D 1QACA 4JKMA 2A6JB 2GJZA 1JHTA 4H5SA 4MAYA 1Z2KA 1S78C 5EZJA 5DJ8A 1D6VL 1SBBA 4YXHH 2PYFA 5KG9B 1J05A 2XA8H 1R5IB 3IDNB 4JHZA 4UTAH 4X5WA 4OZHE 2C1PB 1X6NA 3D39E 1CG9A 3EHBC 3KHQA 5FKAB 3L5XH 1DQMH 5E1AA 3UMTA 2LQRA 3CPLA 3LEYL 4HMDA 4JM2D 1WT5A 4LKXA 1JPFB 2P5WD 3O6FC 3S34H 4UBDC 1AGDA 4M8VA 1B0GA 4LCUA 2BY2A 2EXYD 2OMNA 4UI2A 4MWFB 1M6OB 2OI9B 4MNGA 2DRUA 3EYSH 4F58L 3W0WB 1WFOA 2MOVA 2FIRT 3RVUC 4JGJA 2AV7B 2QQNL 1FYHB 5MP6L 3RKPA 2AEPL 2P48B 3EOAA 3QAZB 4NKDA 4OF5A 3X12A 4WWKA 1XF2A 3ZTNL 1OLLA 1U8JB 5F9OH 3KYKH 5F88A 4NOBA 3G5YB 2EYSB 4I0PB 3STBA 1R0AH 2QR0B 4PG9B 4NYLB 4PJ5D 5IVXA 3Q5OA 3EYUH 2LAGB 5FGBC 4C4KO 4FFWC 4L4TB 2E7HA 4ZTPH 1YY9C 2P7TB 4JFOA 2VH5L 3QXWA 4FG6C 4KRNA 4RA0C 3O8XC 4M3JA 1QG3A 5EU6E 4QHNB 3ZTJG 5TF0A 4I3GA 1A7PH 2CGRL 5CJOH 4LLUA 2X4NA 5TE7L 3SGJC 2VUYA 1MCKA 5DSCA 5IHLB 4NKIH 3BZEB 4YDLB 4U0RB 5IB2B 2Y6SC 2DKMA 1X4ZA 1KT2A 5AG8A 2XRAL 2YD3A 4EZMA 4ODUA 1ZLUH 3HE7D 3DI3B 4M48H 3GHBH 3M17B 1G9NL 3KJ4B 4E9LA 1ZVHA 4ZFFA 3JWOL 2OSLB 1ZMYA 4PD4J 5C0BB 2VC2H 3GRWL 1DSFL 4DW2H 4F7MB 5TE4H 3GI8L 4YHYC 1ZLVH 3V5DB 4PJFA 1DQJB 3BQUD 4M9OA 3PQYE 1CZ8H 1FNAA 1JTPA 1OT2A 1BBJB 3O3AA 3FKUS 1QPXA 1CWVA 3QG7L 4L8BA 2X5PA 4PRAA 1JGEB 2MPAH 1K8IA 5I0ZA 3QCUL 4XB7A 4N0FB 1IFHH 3QUXB 1N5YL 2Y9RT 1QSEE 2F8VA 4NC0B 2LU3A 4ZFOL 2AV1A 3WNNA 5DD6A 4NKOB 4KDTA 1N0LA 1R3IH 1A1NB 3MGAA 3I75A 1OF2B 3RAJL 3QISA 4QRPA 1CE6A 1KGCD 4QEGA 4BSWA 4UTBH 2Y7QB 2ZCLH 2IPUK 3DUSA 4LVOB 2D9CA 3D0VA 2GSGB 5GS0C 4J3WA 5BS0E 4X99A 4XHJC 4Y8AA 1UM5L 4ZFZA 1DVFB 4JM4H 4UQ2B 1S5HB 3O9WC 4KKBC 1VKXA 2IGFH 4U1NB 5DUMH 3TBTA 5IP4A 4PFEA 5F1NA 3KVQA 4O2EA 1NFDE 1Z9OA 5J6GB 1B90A 2GCYB 2NY0D 2WIIB 3KPSB 4JVWA 3ROLA 2AXFB 1YEFH 4NUGL 2H8PA 2J88L 5IBUB 2R2HA 1IZJA 1LD9A 2BSSB 3QHFL 4S1QH 4GG8B 3X11B 2QQKL 3ARFC 3RIAK 3O45B 1HIMH 4KXZI 4AEIH 3UEZA 4G9FB 3S6CA 3FQRB 3GMPA 1IEBA 1RAMA 3NCEB 3QCVH 5ADOL 5I75B 3PDOB 4HIHA 1IGIL 5DGRA 1WV7T 3L5HA 2HFEB 4BQCA 2VZTA 1PGRB 2G2RB 2N56A 1MQ8A 3GO1H 5I18H 3EW3B 1EEZB 3HE6B 4QHMB 2YWZA 1U95A 1MY5A 1LDPH 5KZCB 1U6AL 1OD9A 1HHIB 5IBTL 3NCJH 5E4EB 4EI6A 5DS8B 4UOW0 5ANME 3I6GB 2Q8BH 4RGNB 1HI6A 2B1AL 1X9QA 4LPTA 1NMCB 5DJ0B 2ED9A 3FB8B 1N2RA 1WCQA 4B5EA 2FL5A 2ZG3A 5GGVL 4RISL 4XCFH 4L9LB 3O4OB 4FXLA 1S5IH 3KWWB 4MXWL 2X89A 4AIOA 5DHYA 3H9HB 2BY3A 3HS0B 3OKKA 3PJSB 2FGWH 3KNBA 4MNQA 4PGEB 3NA4A 3PL6C 2BNQE 1DEEB 3BP6A 3ZDZE 1U8NA 2YEZB 3PHOA 2RFXA 1YMMB 1ORSB 1GC1L 4KHTH 5DJZA 2Q1EA 5J12C 1SJVA 1YYMH 4J3OC 5HVGB 2RHEA 5GRJL 4PREA 1B0RB 1Q9KA 4JREC 3QJHA 5L8KB 5JA8B 2NR6C 4Y2DA 2I07B 2OCFD 4Z18A 1FC1A 1W0VB 4C57C 3FTGA 2VLMD 5FXCH 5MEPB 2DQHL 4G8EB 1FLTX 5D7IA 5JQHC 2DJSA 1DBBH 3SCMD 2PTVA 3LKQA 3MRNA 3FO1A 5JHDD 4LLMA 3CSPA 5E8DH 4C83A 5BRZE 4P4KB 3GKWH 1TENA 4XPGL 3IETB 4KK6C 4OCXL 1RK1B 3VFUA 1U8IB 2XN9A 3LEXA 4HQQL 4KDWA 4W81A 5A16B 3DUHA 1DLFL 2A73B 5AEAA 4RFNB 3VXMA 4U1SB 3QI9B 5I6XB 2NXZB 2XY2A 2AK1L 5E00A 3VMNA 1WK0A 1PG7L 3SDXF 1LO3H 1N6UA 1NMAH 1U93A 4NQSB 5DVLA 1MFAH 4CMHC 4XP9L 1ZHBA 4GRMA 5DJ2A 1K2DB 1BFOA 1KCUL 3FO0L 3LN5A 3C60A 1RI8A 3IYLW 1XCTA 4UILH 1DE4B 4IRJC 3LKOB 3AUVA 4X4MA 4TRPL 3RVTC 5KVMC 4OZGE 2ZUQB 3HZKA 1ZVYA 3MRIB 2WLYA 1RSFA 1M7DB 5I30L 1IGTA 1SEBB 3WIHH 1MCLA 3NCBB 1ACYH 1C08A 3U30C 4OF8A 1O0VA 4BQ8A 5C07B 3S37X 1QSVA 1GH7A 1RUQL 2WBJC 4AEHL 2X44D 3TN0C 3RGVB 3HC4L 1NUGA 3UTSB 4PRDB 3BKYH 3HMXL 1OVZA 1T5WA 1ADQL 4ODTL 1LEIA 4G9DB 4IMLB 1EHNA 1FDLL 3RIFK 3VFRB 4RZCB 1EERB 1VA9A 4YZFF 5HDQL 2PR4H 3CLEH 4HLZH 3VWKB 2FATL 4F9PA 3VXNA 1U8LA 3LCYA 1U3HC 5IVOA 2VQ1A 5F9WB 5DEFB 3ZKSD 5FEBA 3CCHA 4OUUB 2COQA 2CLVB 1KCSL 5DYOB 5DEGA 2JF1A 5F1SA 3S5LB 3C09C 1OARH 1Q9WA 3B6SA 2CD0A 1X5XA 4HIEB 4OZFH 2Y36L 4CBPA 4WFHE 3HG1D 3GIVA 5FF6A 3T1FA 4WI9A 3GBNH 5D93B 4GG6A 1EEYA 3FT3A 3D9AH 3THMH 3REWB 4N0UB 4OLWH 1RVFH 5EUOF 4WWKD 1E4WL 1FC2D 4V1DB 5EZIH 4R4BB 4P2OB 5D6CB 1GGBH 5D9SB 4FQIH 3V2AR 1JBJA 3DX8A 3ALXA 4YWGH 1U2CA 2WP3T 2DOCA 2IH1B 5L2JB 1FNGB 3EFDL 1XT5A 5D1QC 1UB5B 1ZK9A 4P5TD 1CI5A 1BQSA 5HDOA 4FQXD 3HPJB 4N5ED 1QRNE 4KPHL 3IDNA 3FO2B 3QBTB 1A02N 3MV8B 2C1PA 4XMLL 3LS5L 1H0DB 4Y4KC 1XGQB 5L8JB 4L29A 3QH3B 3PIQB 4QOKA 1KN2L 3MGOA 3D39A 1NGQH 2FLBT 1BVLB 4PGBA 2PO6B 2IG2L 6FABL 1KIQB 4LPXA 3N1FC 4RAUB 1BMGA 4EXKA 1UADC 2AI0H 1KB5A 4MWFA 4YHLH 1M6OA 3S37H 4U0QB 3W0WA 3RP1A 3MA7B 3C9NA 5HPMA 5J3HD 2ZSVB 3OGOE 4CKVX 1E4KA 4MA3B 1W0WB 4OKDA 4HIIB 5IR1B 1CTNA 1HQ4B 3V5KB 3T0EA 2IH3B 4NRYA 4JFPA 2B4CH 3VFSB 1YJDH 4C59B 2XIDA 3ARXA 1JGUL 4LSSL 1JGDB 1U8JA 3V0WL 2DBJA 3HZMB 4RFOL 1MFNA 4ZUUB 3G5YA 1HQRA 2HAZA 3CVIL 3NPZB 4PG9A 3DLQR 1EO7A 5FYLL 4B7IA 1MLCA 1HHKA 1F45A 4IMKC 1CL7I 4JG0L 5E56A 2VKXA 2ZPKL 4J6RL 3P9MB 3LHPH 2Y4SA 4BK5A 3N50A 1MWAL 1HEZB 1XR8B 5JORB 3CFKA 2LU7A 1TJIL 2P7TA 3BEWA 1BJ1H 5A2FA 4U6YA 3NPSC 1BQLH 4Q74A 5LGJB 1DR9A 3QPXH 4QHNA 1N6QL 5FDWB 5KS9F 4QRPD 5ESQB 4YHML 3G08A 4GRLB 5F1IB 1NEZB 1ZE3C 2L7JA 5GS3A 4PJEF 4RGOH 1J12A 5JPNB 4D3CL 5DQDL 3WXVH 4NHCL 2WUBH 5LXGL 4OCNC 5E2UH 3RBSA 4TN9A 1HXMA 4YBHA 4I2XE 2ZOKB 4CAGA 4P59H 4GW4A 1C12B 1RZ8B 3V5DA 1DQJA 3IF1A 1YECL 1TPXC 1GGIH 4DTGH 5D1XB 1QBAA 4U1JB 4HFUH 4HCRH 5CJXC 2YKLL 1UCTA 2J1KA 5HHXH 3S7GA 3G9VA 4NKOA 5GGSA 3U4BL 4R8WH 1RURL 1D5MB 4CVZA 3KXFB 3GM8A 4MVBC 5KSBF 4M03A 4U49A 2RIKA 3V8OA 1CF8H 3M45A 2VABB 1XCQB 3QA3A 2KZ1B 3MREA 4PRNB 5LJYH 3IFPB 1N4XL 2O5YL 2ID5A 2O5XL 2DDQL 2NXYB 4MA7H 3DXAE 1S5HA 3S98A 4F57H 4D0CA 3VFPA 5L88H 3SCMB 5L7XL 1GSMA 2K7PA 5JHDB 1C7SA 2A6KB 1N7MH 4UNTA 1P7HL 1I7TA 2GCYA 1NFDA 3KPSA 5DRNA 2EH8H 3WN5A 3QIBC 3VWJA 3VFNA 1A0QH 4G42A 2BSSA 4MNQD 3ILQC 1U8PB 1MJ8H 2VXSH 1ZHLB 3DGCR 2FO1A 2EDOA 1T4KB 5F1KC 3MRHA 1QFOA 4NM8H 2Z8RA 3QUXC 3SDCC 2AJYL 2HRPH 4OLZH 4AJ0A 4M5ZL 1TFHA 2CPCA 4TULH 5F1OB 3B2VL 2VL5B 5ESAA 5HY9B 5D7KE 3TH3T 1HILA 1HH6B 1MHCB 2YPLB 4QHMA 3RRQA 5JHLL 4GBXB 2HFTA 2QQQA 1EX0A 1HHIA 1AR1D 2EECA 2W1NA 3LKNB 2ZOLB 3QT2A 5JW4R 1NUNB 3I6GA 3P0YH 4LVOC 1FE8H 1TCMA 4Y1AE 3FB8A 3MYZA 3UAJC 3R8QA 4PS4L 5EU5B 4QGTA 3QDGA 5KW9H 2HVKB 5JA9A 4FFVD 3DSFL 3BE1L 4JANA 4F9LA 4AH2B 4KGJA 2P47B 2DQDH 3O6KH 5GGRA 4L9LA 4KZEL 2V7HA 5HYIA 1F13A 3KWWA 4JFYB 4LARL 3WLWD 3MUGB 1T1YA 4G6JL 3U0PB 1J1XH 4PP1D 4UT9L 3PJSA 2XN9D 2AEIT 3R1GH 1QHOA 3ABZA 3ZE0F 4NDMB 1VFMA 4MZ3A 1NCDH 1DEEA 3VXMD 2ZUSA 4HWNA 5J57B 4OF0A 4ISVA 2BNQA 5I1EL 4LLDB 3TNMB 2OJZH 3D0LA 4R96A 5J06A 1ORSA 5JR1H 3I2CH 4Y5VC 3C87A 3DV6A 3TBSB 4G3YH 1FNSL 2Z92B 5DFWH 4QCIB 3FAWA 4MJ6B 3C60D 1INEL 3BT2L 1VGEL 2VDRH 3HE6C 5C0FA 4EN3B 5FYLE 3VH8G 4WDIB 3IAPA 5I0DA 1SEQH 1MIEL 1WWAX 2I07A 5IQ7L 3E8UH 3HG1B 3O3UN 5E4EC 5F3BB 3G9AB 2ORBL 4PJXB 1W0VA 3G5VA 3WL9B 2B39A 1AFVH 4RGNC 1INDH 5HPOA 1NMCC 4MDJB 1JNLL 2JCCF 1MQKH 1A7QH 4YHKH 2OR9L 1NQBA 2H41A 4HHAB 2PTTB 4NZDA 4ONHB 1BFVL 3UYOD 4ZPTB 1QNZL 2VZ3A 3SOBL 3CK0H 4PJXF 2P49B 4TUOB 4AEFA 1RK1A 3OXSA 2X1OA 3QNYA 1U8IA 3LEVL 5A16A 2AEQL 4POZD 3IFLL 3RHWK 4PJ8B 4FQXB 4GRWH 5FUCE 4NHUB 4M6OH 3C5JA 4U1SA 5J56B 3QI9A 3RX7A 3QDMA 3ZDYF 2VZSA 3IU3B 3JV0A 3OB0H 4FS0A 5D2NC 5DHVB 5I66B 3MLWL 4P49A 4ONFH 4R4FL 2C3XA 2R29L 4U1GB 3ECBB 3WJJC 3UPRB 4K3EH 2Z31C 2KZWA 1R6VA 3TJHC 2YRPA 1DE4A 2K3TA 1JUFB 4I0CC 4X7SH 5TDPA 2XTJE 4P57A 3MRIA 4YR6A 4ZG1A 2Y23A 1YA5A 4WHTB 3IFOB 4LVEA 1KNOB 1QUNA 4I3RL 2HT4C 3LMJL 3EOTL 4DZBB 1G1CA 1QBML 5JUEL 1X5KA 4NSKA 4PRDA 1GL4B 2A9ML 5MEOB 4LCIH 3DX9A 4HWEL 4G9DA 4Y16C 2QBWA 1WIPA 4S10A 1BFTA 3VWKA 1JCKA 2GY5A 3WDHA 1XF3B 1I1AA 1TNMA 4KQ4H 5HYFA 4L3EA 3K7UA 1PKQA 2XZQL 1WICA 2FYYA 4QOKD 3N9GL 3MNVB 4ELMB 3D39D 2LAAA 4I3SL 1RULH 4X7DC 35C8L 3S5LA 2MNUA 2X4PB 2A1WL 4W4NA 3LPGA 4E0RB 1CLZH 4HIEA 2X42A 4L4VB 1NCWH 4PJHB 1WCBB 1S9YB 2EXYC 1SHMA 1KPVB 1DDHB 2VZVA 2ZUQC 5GGTA 1A8JH 2R2BA 4JRYE 4ELMF 5KSAA 1FAIL 1MREH 2DN7A 2ZSWB 4IOFD 3MCKA 4D0BA 2NTFB 4XPBH 3SE4C 4HLZG 1WAAF 4XB8A 4XNUL 5EOTA 5GSVA 4GMSH 3BVNB 4F33A 3KHOA 3VI4E 1L7TL 4Z7VB 3K8LA 2FX8L 4O51B 1FYTA 3GSUB 3L3JA 3GEWB 5L2JA 3IJHB 4J1UA 5DJDB 4MQTB 4PJBB 1MFCL 3P0GB 4K7FA 4XPHH 5FKPB 3HPJA 3WHE0 3H9YA 4YC2C 3X3FL 5D2LB 4HH9B 4ODXA 3MV8A 1NCNA 1I1FB 4OZFG 4FXKB 4P4RB 1B4JH 2CK0H 1H0DA 2ESVA 4WW2B 5CUSL 5F9WC 5ENWB 5TQ0L 1PYWB 3TBWA 2VLJE 2YN3A 1CDYA 2PO6A 1N3NB 4Q6YA 1KB5H 3TCXA 1KIQA 5I1HL 3IS0X 4N9GA 3MLTB 2MCPH 1VPOH 5D2LF 3AAZB 4CL7A 4A6YL 5E6YA 4WW2F 2JJSC 1RUAH 2GTWA 5A40E 5D72H 5ICXA 1I9EA 1EFQA 1KJ2B 5D93C 1N59B 4NFDA 1CCZA 3DIFB 2R23B 3VFSA 3HE7C 4XMPH 2ADJB 4OM1H 2EDRA 4DN3L 4K94H 5F7WC 1J8HB 1DUZB 1FIGL 1A21A 4LEXH 4P2OC 1GZPB 1EEUA 5KJRL 1CFNA 3AS3A 3WNOA 3O4LE 4PJ7E 1TZIB 4HS8L 2GITA 3BQUC 5LAXB 1F58H 1LO4H 2HFGH 3DURA 3JWDL 2W92A 3UBXA 2VJXA 1P7KB 2Z91B 1BLNA 1T7VA 5B22A 1FPTL 4PRPE 4MDIB 1UQSB 4WFEE 4IS6A 4ELKB 1XR8A 3ULUL 2F19L 2PYEE 2YK1L 1IKFL 4C56B 4BH8B 3G5ZB 5BVJA 1JN6B 3PWVA 3IB4A 5SWSE 4K8RD 5K9QI 3BUYA 2DWDB 1NEZA 4NZUL 1NGWB 1SJXA 2VKWA 4RGMB 4Y5YB 4JB9L 4QHLA 4L8CB 1EUUA 2IPKA 5CGMA 5E6ID 5HYJB 2JJTC 1U8MB 1YN6A 2W91A 4YBLB 5DFVD 5L6YH 5EBWB 4PRIB 4ZO7A 5F3HA 5BS0D 3VXUA 5JW4M 4Y4FB 2YA2A 2ICWB 4KTEH 3EIFA 5EU4B 2NY2D 2ZOKA 3HI6L 1I85C 4YDVA 1FL3A 4I2XA 1RZ8A 1RZKL 4Y19A 3L1OH 1J0ZA 1KELH 1IQDA 2A83B 2NY0C 5D1XA 2F5BL 1DQQB 1YEJH 4LSRH 3MV9E 5D7IF 3F7QA 3FB7B 3EYFA 1CLOL 3OJVC 3MMEB 2Y06L 3L95A 5EN2A 3BKML 3MBXL 1HSBB 2DQCL 2XKNA 2ZUTA 3BWAB 2VAAA 5CEYA 2FH8A 4K8RH 2C1OA 4XVJL 3TO2B 1GIGL 1KULA 3KXFA 3HMXA 4YGVB 2WBKA 3MOBL 4Z7UA 3WIFB 2VABA 1XCQA 5B3JF 3VFTB 3QUZB 3LRSB 2XXMB 3GBLA 1MJUL 4NPYB 4GRWF 1FBIH 1RIUL 3RWIA 3MRQA 3MBED 3EO0B 1M05B 1IC4L 3KLAA 3VFMB 4LLYA 2ARWA 25C8L 2HT3D 4HLJA 2DYPB 3QDGD 5ERWA 3HMWH 3FO9B 4PLKD 4LCWB 2PXYA 1BF2A 2AABH 4O58H 3MNZA 3S35X 2LTQB 4FFYL 3ZHDA 3OKNB 1KBGH 3P4MB 4OLVL 4HUUB 3SGEH 1QOKA 4X98A 4BFGA 3E2HC 2N7AA 5IT2H 4HKJA 4XWOD 2VDQL 4RAHA 4UT6L 4Z7WE 2IPTH 2BNQD 1R24B 4W68A 5E99L 5AG9A 5CEXB 4DUVA 5C8JA 4NFCA 2VDOH 1V3JA 2VL5A 3LKSB 3BPCA 1JPSL 3S9DB 1HH6A 3SBWA 1S7UA 5T1LD 1D6VH 2FX9H 5GRUL 1W72A 4YE4H 2ZOLA 1PZUB 1QFWI 5C0IB 3CFIC 2AAVA 5BZWB 2DBLL 1Z0NA 4K2UL 2DTML 4L4JA 1A6WH 1U91B 3TWCL 3LEYH 2HVKA 3WDIA 3BWUC 4LDOB 1F4WH 2GSIB 5BOZG 3SCMC 1UA6H 3P40A 3DVNB 3FMGH 1EO8L 3MJ7A 4LLQB 5D6DA 5BRZD 3W2DL 3QRFM 4F58H 2R0ZL 2EYTA 3WS6C 3DO7B 4BUGA 3MUGA 3C5ZA 5E2JA 2FHFA 4PP2B 2BHYA 4EOWL 4TPRL 5I1AB 5F7EL 1YEGL 1EHLL 2QQNH 2HLAA 3FHQA 1K4DA 1S7TA 5MP6H 2AEPH 3VRJB 3DYPA 3QDMD 1IGJA 2OJEA 5HHME 4YHPA 4M7KL 3P0VL 3F6LA 3MNWB 3ZTNH 1QBLL 3TNMA 1C1EL 4M8QA 3OXRB 4OZHB 4PV9B 5L2KE 2JJUA 3TBSA 4F15B 2FNBA 3ESVF 5K59E 2VXVL 5ISZA 2YD7A 1IBGL 3OKLA 1D3CA 2OLDA 1FV1A 1IGFH 1UB6B 2QHRL 4MCYA 4L5FH 4WDIA 3MROB 1MNUH 3AVEA 3N06B 4OZHF 2BVYA 4LCCB 2QL1A 4P2RE 2B2XL 1R3KA 3ULUE 4DGVL 2X1WL 2DKUA 4FQJH 1I1YB 5GS0L 2NNAB 1F97A 5D5ME 3V6ZB 2Z93A 2CGRH 3WUWA 1IL1B 4LLWA 5SX5H 4TUOA 4G80B 1UXSA 3ARBA 3U79A 3MPCA 3LKPB 2YR3A 1UGNA 1CBVL 4PJ8A 1HSAA 2W0PA 3OB8A 1I1AD 4IHOB 4S1SL 1YEHL 1I75A 2NX5B 1G9NH 2EZ0D 3CUPA 1TTFA 4L3ED 4PGZA 4RAVB 5I66A 1FAKT 2Q6WA 4BFEA 3JWOH 1CLCA 3GRWH 2VDPL 4OZIB 5D8JL 1YEIL 3N1QC 3BN3B 4DFIA 4HIJB 4KK5C 5EU6B 1WT5C 3QG7H 5CP3H 1JUFA 4N0CD 3EJZD 5HVHC 3QCUH 3W11D 2QLVB 1N5YH 4WTZG 2J2ZA 3GBMH 3IKCA 5KSAD 3NIFE 4PJGE 2UZXB 3OPZL 3S97C 3OJDA 4HWZA 3MTRA 1S7VB 2ZG1A 3Q0HA 3RAJH 3WFHB 2LVCA 1WGOA 2FBOJ 5GRZA 3NGBB 3CIQA 4ZUTA 4XBGB 4WWKC 4JPKL 3L7EB 5MEOA 4TVPL 3CLFL 1WEJL 1F3JB 2B4CC 3AREB 1YJDC 4KI5E 5EFIA 1FG9C 3PWUB 1R3JB 2BOBB 1KPUB 4GXVL 5CINL 3PQYB 3T2PA 1KTRL 1UM5H 4NCC2 2F53A 4P5TC 3MJ9A 4EI5A 4FQXC 4N5EC 1QRND 4UQ3A 3V6OE 2ESVD 1DN2A 1WWWX 1OP3K 3F6IA 1QSEB 4XXCA 4HUWA 4I18B 5IFHL 3O6LL 1T80A 2UV3A 2CR6A 1SVZA 4NUGH 2DIBA 4U1GC 2J88H 5KVFL 4PUBL 4FQLH 5GS1B 5JMOC 4LSUL 1KN4H 4L4VA 4YEEA 4PJHA 5AZ2L 2QQKH 1ERNA 1DDHA 1NBVH 2C3HA 3QHZL 3QO0B 2G5RA 1FFQA 1KJVA 1MIML 4DKEL 1A7BA 4M62L 2I9TA 3MSPA 4HKXB 4QXWA 1ED3B 2NTFA 5J3HC 5DC4B 5JNYB 2EE6A 4L3CB 5ADOH 1YY8B 5BS0B 2AGJL 3TZVB 5IJVA 4ZNEA 5I8OL 3C8KB 2HN7B 4XZUA 3VXOA 3QUYB 4JDTL 5EG6C 3L3DB 4MB4A 2BX5A 2B0SH 2NY2B 5EO9B 4Z7VA 4AK1A 4LSPL 3E6FB 4DQOH 1PG7X 5C6WH 2YRZA 1HCFX 4MQ7A 2FIKB 1ZVSA 5KN5A 3SE9L 5DJDA 4PJBA 5IVNA 3SGKA 4G6KH 1FZKA 2PW2A 1PQZB 4JFEE 4OCWH 4FQQB 3BKCL 3ZE1E 3SO5A 3K80A 5FK9A 3SN6N 1U41A 2XACC 3DI2B 1ULVA 5GGVH 1JNNL 4RISH 2OQJB 5HGBA 3MRPB 1FGVL 3OAUL 4HK3N 2J6EA 4G8FB 1KTLB 2MCG1 1NFDF 2E7BA 5F6IC 5MI0B 1VFBA 3ARTA 3FFDB 4MXWH 1N3NA 3MOAL 3ZDXE 4K3GA 2IQAB 2WK2A 2VLJA 2IQ9L 2EEDA 3KR3L 3ARGA 1Y0LB 2VQTA 3AAZA 3BGAA 1YEKH 4UV4L 1UT9A 2CKNA 2F54E 1G9ML 4Z7NE 1KJ2A 1DJSA 3U9PL 3A67L 3QDHA 1GC1H 1N59A 5GGSY 3VXUD 1S9XB 2R23A 3DIFA 5JOEA 2ADJA 1E6OL 4FP8L 1J8HA 1NMBH 5GRJH 2Y07L 3VE0B 1GZPA 3RWJA 4JFHD 3DV4B 4YIQB 4NN7B 1S8DB 5TGBB 4Y19D 1QBBA 1ZT4A 3NFPB 4NBYB 5LAXA 3TT1L 5H2BB 3O4LA 2Z91A 1GZQA 5EIQA 3FQWA 4LRNH 2NYYD 4RNRA 4OF6A 4WUKL 4PRPA 1V7ML 5D1ZA 4NO0B 3OV6A 3NTCL 1X5FA 1G7JB 3HPLA 1RK0A 4C56A 1E4JA 2VZOA 2NY7H 4HUXB 4XPGH 5JQ6L 5CIPH 4OCXH 1MLBA 5IMOB 1KB9K 3BMVA 5EOQL 5C9JB 4HQQH 5T1LB 1S7RB 1YPZE 1HYRC 5SWSA 4Y5YA 1D9KA 1OCWL 3UP1A 4U6VL 1J0HA 4XH2B 5ACZB 3VGFA 3RJQB 2AK1H 4RQQA 3QQ9D 3ZDZF 5EBWA 2JLLA 4PRIA 1DP0A 1PG7H 4MB3A 1N6VA 5LWYL 4Y4FA 4XP9H 3OR7A 1CXKA 3DXAD 1KCUH 5EU4A 2PXYD 4XMKL 3BPNB 3QIUB 4HGKC 5CKGA 2XQYG 3RY6A 4RMVA 4DVBB 5FGRA 4OFYA 4QRSB 3V0VA 1CR9L 2A83A 1RU9L 2P8MA 2VWEE 3W9EB 4D0DA 4ZPVA 2V5MA 5ID1B 3FB7A 3PWPB 3GSRA 4ZSOB 1UCBL 3NABL 1A6ZA 1TITA 1GJIA 4OGYH 4R9HA 4AEHH 1Q9OB 3RTQA 5GGRY 3BWAA 3HMXH 4ODTH 2YC1A 4TVPE 4P3DB 1JHKH 5J89A 5HDQH 1W8NA 5EUKB 1P69B 4OTXH 5D7KD 1K9TA 3WIFA 2I25N 3CFBB 3QUZA 3GMQB 3RWDB 2C4FT 4NPYA 1AR1C 3EDFA 4OZGB 3UJJH 4QRQB 2XPGA 1D5XB 4R97C 2X9WA 1EFXB 4X7CC 3IJYA 4YBLC 1ZGLA 2CUHA 4Y1AD 5FA4B 3BDYH 1M71A 3DROA 4YFLF 4TVSa 5IOPB 2Z0BA 3FO9A 2PETA 1KCSH 4K3DL 4ZFOB 1MVUA 2XFXB 2C7UA 4XBPA 5IB4B 3VW3L 2DMCA 1OGAE 1PKOA 2NQCA 5CBEA 4N0YL 2Y36H 4JQXA 4OZGF 2XOTA 3Q5TA 4C58B 4Y89A 3C5ZD 3IXTB 3QB7C 3KJ6L 5E9DA 3WLWC 3D3VB 2VR5A 4WU5B 3ARPA 2N4IA 4PP1C 4JO2L 4EUPB 1JWUA 4MQSB 4RRPA 3VFOA 4LLAA 4X9GA 5CEXA 4NNXA 4KUCD 1OB1A 2QADB 5ICYA 4PY8I 1OGTB 1OPGL 5ISZD 3NZ8A 1W72H 5EB9A 3EFDH 4JFXA 2RAMA 3EDEA 5DA4A 3RL1B 3T04D 4Q2ZB 3WO3B 4AZ8A 3IVKA 3C60C 5CWSA 3MGTB 4RBPK 2ICWJ 5DJXA 4KPHH 5C0IA 1C5CL 1KENL 5IBUG 3QXAA 2V9RA 3QFJA 2CDGB 5BZWA 2OM5A 4YHNB 5F9DC 1KN2H 4ZFGL 1AD9A 4Z77A 5FHBL 5BV7B 2IG2H 4PJIB 2Q3AA 5T1KA 4X0KB 1XGPB 1KLFA 1CS6A 4APQB 3DVNA 2GQHA 5LBSL 4ERSL 1T7XA 1B2WL 3D85A 1FSKC 5HHOE 3T09A 3BAEL 4IOIB 3ARBD 1IGCL 2AJSL 3DBXB 2PUQT 1A14L 1LO5A 3GSXB 1DLHA 4XAWL 4Q9QL 4WEBL 4QY8A 1X5AA 4POZC 5FO7A 3VRJA 4PGCB 1JF1A 4LSSH 3MNWA 4ENED 3OXRA 4PV9A 4X6DA 5F7NC 1J0YA 1S9KC 3V0WH 3ZKXC 3LD8C 2AQ3A 3ZYIA 3BD5A 4JY4B 3HI5L 4HMEA 3WEXA 5C09E 4UU9B 4N0RA 3CVIH 3FOLA 5FYLH 3RQ3A 3HNVH 1WBZB 3V5HB 3MROA 2P45B 4JG0H 4XNQA 2ERJC 2ZPKH 4J6RH 3DSNA 1QA9B 5CMAB 3V6FA 1MWAH 4BUHA 2XTJD 4JKWA 2CXKA 3CSBA 3BZFB 4LVNB 1JPST 4RWYL 4P2RA 5FOBA 4XNXL 3TVMB 4YX2H 1A7OL 4L8SA 4MD0B 4NQCB 3SY0B 4F3FA 1FLRL 3OX8B 1L9NA 1BOGB 3VRLE 4YHMH 1ZXQA 5D5MA 5CKAA 4ZUWA 1NLDL 4D3CH 2JJWA 3MYJB 5LGKA 4Z5RA 2Q87A 2GK0B 3DVGA 4PJCE 4NWTL 5LXGH 2F53D 1LP9A 5D70L 1AY1L 4EI5D 3B9AA 2WV3A 1QSFE 2FCBA 5DK2A 1FL5B 5JW3L 4OZIA 1D7FA 4N8VB 4Q7DA 3MUY1 2X4SB 3LRHA 3VGAB 3SKNB 3OJMB 5EDXA 1IGYB 3F58L 5J6HB 4HIJA 3ARDD 1QFWL 5JDJA 1XMWA 3GK8H 4IIQB 5DLMH 2YSSB 2Q76B 3T4YA 3JTSA 3ZSSA 2OL3L 4U2ZA 4TSBL 3ZE2E 1G1YA 4UMGA 1RZIA 4LSQL 4M9PA 4JRYD 4LCCC 4NUJB 4IOFC 5GGVY 4QF1A 1OSPH 3KLDA 4PJGA 3WFHA 1LK2B 3ZYOA 1RURH 1C16A 4O9HH 1J88A 2JIXA 3IT8D 5F7DA 3O2DA 2QV2A 5TH2A 4XBGA 3BDXA 4O02L 4HK0B 4JPVH 3RUGB 3WXWL 1F3JA 3AREA 3B9KA 4PB0H 1N4XH 4K94C 3PP4H 1KPUA 2O5YH 4JO3H 3MJ9H 3MLYL 4NO3A 1AC6A 2O5XH 5EA0H 4WO4B 1G7QB 4OSUH 2X4TA 2DDQH 1VSCA 1MCBA 1XGUB 5IVZB 3CFJA 1XF5A 5GIRA 2WQRA 3V6OA 1U8QB 2ZJSH 2FX7L 5SWZE 3TIEB 4BSJA 5F7MC 2EH7H 2VLKB 2ADIB 4WFFE 1QHPA 4JGUA 2VLJD 2P44B 1INQB 3INUL 3L5JA 1BGXL 3ARGD 3H6JA 2XT1B 5GS1A 4GS7C 4F2MA 2UUDH 3QEGL 1LK3H 3MFFB 3L3IA 5HYQA 2PCPA 1A6UL 5D96B 4H1LA 3TGXA 4L3CA 3J7HA 3OKDB 4M5ZH 3B2VH 2HLFC 3RL2B 3FN0H 2HN7A 4NZJA 5IROA 1KV3A 4NJ9L 2IADA 3B5GA 4IJ3C 5JHLH 2HVJB 4CU8A 1MAJA 3TPKA 3S5LG 1SMAA 2ITDB 2VQUA 4E41A 4MCZA 1U8OB 3O4LD 3LH2L 3PG2A 4FQQA 1MELA 2EDFA 3BP5B 4PS4H 5K9KA 1B3JA 1CDGA 5AYQA 5C0DB 3DSFH 3BE1H 4PRPD 3MRPA 5D1ZD 4WFED 2XKSA 1QVOB 4M7LL 5F9JB 2F8XC 2BVQA 4LARH 4PRBA 3QQNA 4DZ8A 1Y0LA 4G6JH 3ZHLA 4UT9H 3HUJE 2YD9A 2XA8L 1NCUA 1H5BB 4K8RC 5SWSD 4CADB 3F7YA 1D9KD 2CJUL 5JW5A 3T0AA 1AHWB 2X05A 3U46B 4G8IB 5DZNA 5I1EH 3SPVB 4K9EL 5E6IC 1WFUA 3VGGA 2F54A 1WZ1L 1L0XA 3OG6B 5DFVC 2X1XR 2AXGB 4Y1AB 3TZVC 5GJSL 1JE6A 2CKBA 5CP7B 1INEH 3BT2H 4G8GB 1VGEH 3VXQB 4RMWA 4JFQB 2NY2C 1AGBA 4YIQA 1S8DA 5TGBA 3V7AE 1MIEH 1VFUA 5IQ7H 2P5EA 1ND0A 4PG2A 2ORBH 5H2BA 2AW2A 4MJIE 3WN5C 2KQMA 1PG7W 2GYSA 5DEZA 3UDWA 1JNLH 3MV9D 1ODAA 2Q86A 4HZLB 1IZKA 2OR9H 2RB8A 3GHEL 3HC3L 3RTQD 2OK0L 1FVDA 1QP1A 4P5KA 1QNZH 3IDUA 2GK2A 1OM3H 1DQDH 1YMHA 1I1RA 1R0AL 5MEQB 2X7LB 3NN8B 1AGCB 3PUCA 4KXZH 3EYUL 1S7RA 4XRCB 2AEQH 4PV8A 3MV7A 5DD3L 2EDLA 2XNAB 3AROA 5E2TL 3VFVB 4XH2A 4WNQA 4FMFA 4KUCF 4ZTPL 3UBXG 1U8HA 2DQJL 3GJEA 5AZEL 3MLWH 3MBEC 1BQUA 3IGAB 3D2UD 3IU4L 4R4FH 3GMOA 1AXIB 1BVZA 2X2YA 2R29H 3KPRE 2HT3C 1A7PL 1MWAB 4Y5XB 5CJOL 4LRIA 3KPLB 3ARWA 4F9LC 4PLKC 3FFCE 3QIUA 4KY1L 1OW0A 4MD5A 3RZCD 5DRZB 1L0YA 4X6FA 1NEZG 2W0FA 5E9DD 4XCYB 2QEJA 1WBYB 5ID1A 4BYHA 5FUOL 4IBLT 4UIMA 4I3RH 3LMJH 3EOTH 5BW7A 5HI3C 4XWOC 1E0OB 3GSQB 5EIIB 4FZ8L 5TE4L 1T20B 5EU3A 5JUEH 4NBZB 2WWKT 4KTDL 2A9MH 2VR9A 3AC0A 1JK8A 4YAQB 4HWEH 5DC0A 3MRCB 5B38B 3VGEA 2ATPB 2HWZL 2Z35B 5B8CA 3JSSA 4G6FB 3DMMD 4KWUA 4PBWD 3BYTA 1MHHA 1H15B 5C0JA 4HAGA 4LFHD 2NY6D 3QFJD 3PWLB 4X6CB 1EFXA 3OF6D 2DM7A 4KRLB 2XI9A 5EC2B 4OCRH 3BISA 4NQVA 3VJ6B 3MRBB 2IAMB 35C8H 3L3OA 1QQDB 5T1KD 2A1WH 1UKQA 2H6PA 4UTBL 2V9TA 1BZ7B 4JPIA 5BQ7B 5L9DH 5E94A 3D85D 3WNKA 4OB5L 3BH8B 3IXTA 1T5XB 1KLGA 1RJCA 3BPOB 3SDDA 4P2QA 1MPAL 1OTSD 3I3EA 4O5LH 2M8XA 1S7XA 2IMMA 1FFRA 4XNUH 4MAUL 1T04B 2Q8AL 1MCOH 2NY3D 2VLRE 1NGZB 3OKMB 3U4AA 5HHMD 4JZJB 1E27B 2FX8H 2R2EB 2VB5A 1OGTA 3GMNB 1SYVB 1T2JA 3QXDA 1G9NC 4G6AD 1U92A 3JWOC 5HI5D 1X3DA 2D7NA 2NY4D 3ARDB 4WTWA 3X3FH 1HIML 4AEIL 4PJDE 2GTZA 2B20A 2WP3O 1ZT1A 5IQ9B 2IBZX 3T4AB 2HH0H 5E70A 3EUUA 5TQ0H 2UWEE 4P2RD 3UTZB 3HI1B 2K9UA 3CDGB 3ULUD 2HJLB 4PJIA 3RWCB 4DK6A 1Q1JL 4APQA 1ETZB 3PXHA 5IEKA 4JFDB 1JV5B 4X4YB 3H7BA 4A6YH 2WLZA 3NCJL 1UZ8A 4KK9D 1FO0B 3I6LE 5I8KL 4D9QD 1V05A 4IOIA 1KEMH 1WFTA 1DEDA 1LO0L 4R0LA 1JRHL 3QUKA 4GW5B 1Z5LB 4JLRA 4DN3H 1HXYB 4PRHA 1FIGH 4CVXB 2EZ0C 4BKLB 1AO7E 4G6ML 2BNRE 4NN6B 4AT6B 2CLRB 5KJRH 4UU9A 4HS8H 2VIRA 1IC5L 3GMLA 3JWDH 3ZKMD 1MJ7L 3GMMA 3UZQA 2DJUA 1FPTH 4R7DA 2GI7A 4JHWH 4N0CC 5DR5L 1QA9A 2MKWA 3EJZC 1SY6L 3W11C 5FGCE 1MCWW 5EBMA 3ULUH 2F19H 1IEAA 3BZFA 3T0WA 5KSAC 1SQ2N 2YK1H 3WNLA 1FNEB 1UM6H 2QQLL 3T8XA 4XC1L 1BOGA 2BJMH 3T65A 4AEEA 5HGHB 4FN0A 4Z6AT 1CU4L 1YDPB 1WWBX 4R6UA 5JXED 3F7VA 4JB9H 1P5VA 3ES6B 1TZHA 2N1KA 4OFVA 5D7JB 1F90H 4J3TA 3CXDH 4KI5D 5INDB 2AJ3B 3GDBA 4PJ7B 2OBGA 1UZ6E 1CFTB 4QTIL 4YDIL 1KB9J 4PJCA 2LABA 3W9DA 1MFDL 1HOCB 2GFBA 3U0WH 2V2WA 5E8DL 4HS6A 3HI6H 3BI9X 5EZOL 4P2YA 3F12B 4K71B 3BJ91 1MHEA 1A9EB 1RZKH 2PYEB 1BQHB 4PJ7F 4OIAA 4D94A 2F5BH 3MRRB 3WUWG 4HS3B 1HHHB 1I3UA 1NDGB 3O3BB 3TA3A 4B41A 1NC4B 1CLOH 4P99A 2FJHA 3KYNB 2Y06H 3BKMH 3MBXH 1LGVA 4NQDB 4RFEB 4MXVE 3KPNA 1MFAL 1BIHA 5LKNA 1CICB 15C8L 3BH9B 3PGCB 4PJ5E 4XVJH 1LK2A 5CD5D 4BQBA 1GIGH 4UILL 4V2CB 3RNQB 1WF5A 1PW3A 4RX4A 5C0EB 4YK4C 3MOBH 2EDJA 4MJ5B 2BVOA 1EVTC 3PV7A 4QT5A 1GC1C 2R0LL 1NKRA 3RUGA 4P9HH 3T3ME 3DRTA 1MJUH 2BOCA 1RIUH 4HEPG 4E41D 1IC4H 4WO4A 1RHHB 1G7QA 2YZ8A 2R0WL 1ACYL 4U1LB 3KS0J 4ORGA 1TCRA 2B1HH 4JDZB 1U8QA 4WI5A 3BKYL 5AUMB 4LDLB 4E5XB 3BO8B 4P3WA 1LEKB 2ADIA 2Q7YA 3FCTA 3QQ4B 4FFYH 4NCDA 3VGAC 2WW8A 1OSZB 2PR4L 3CLEL 4TNVK 3DTXA 5I19H 1FL6A 2HT2D 4H1LH 4BH7B 4IIQC 4UT6H 4UB0L 2DLFL 3E3QE 4XXDA 5H37H 1EK3A 1KUMA 3BEVB 2AXHA 2F54D 3OKDA 4QXTA 4X5XA 4ZMAT 3RL2A 1VEOA 3AY4C 1ZGLP 5I2IA 4KFZC 3H9SA 1H3PL 1ZEAL 4MNHB 5BXFA 4X6BB 5GRUH 2R4SL 3HNSL 1I7ZA 4P23B 2MQ3A 3L5WA 3UJTL 5F7LB 5TF1L 1KLUA 4F7TB 3GBNL 1FZMA 1CGXA 2V9QA 3B3IB 2DBLH 1EBAA 5GZND 4QRRB 2DTMH 3THML 1KGCE 1VCAA 1I7RA 4HUMB 1I9RH 5J1TC 2I9LA 4OLWL 1XZ0A 1CFQA 2NYYC 1UEYA 2HFFB 3QO1B 5F9JA 4Z7WB 4YWGL 4X4XB 1A9BA 1VENA 1EO8H 3QIWA 2FEDD 5E2WL 4QGYA 3W2DH 1NKOA 1JWMB 3VMPA 3QXVA 5CJ5A 4XPTL 4ESKA 2MTPA 4OCLC 4EOWH 3FB5B 5E5MB 1F42A 3MV7D 1YEGH 5F7EH 3SKMB 1EHLH 1AHWA 4TUKL 3BHBB 1XIWB 3VG9C 4Z7WF 4G8IA 3K1DA 4P46A 3BOVA 5AYUL 3SPVA 4PR5B 4M7KH 3P0VH 1QBLH 4TYUA 1C1EH 3TEUA 3QQ9C 1FQ9C 1A2YA 2AXGA 5AAWA 3LPFA 2VLLB 2VXVH 1IBGH 4NQEA 5CP7A 2AI0L 4QYOB 3SDAA 2PXYC 5CZKA 3S37L 2ICES 1FORL 2X4OB 5D7LE 1EPFA 1FZJA 1GGYA 1IAII 1TVDA 1KYOK 1VERA 1HNFA 4A6YB 2B2XH 2LU4A 2V5SA 3LKRB 1YJDL 1UVQB 1S7WB 4ZXBB 3HNTL 2VDKH 1FN4A 4IRSA 2GJ6E 1HHGA 5CD3A 4B7LA 4CJ1A 5F21B 4E42B 3IDGB 1KSRA 3K8MA 1A4KB 5L2KB 3NN8A 3U2SB 3R06B 1CBVH 1V7NL 3EKCA 3CJJA 3CFEA 3A6CL 3VFVA 2FR4B 3K4ZA 2V2XB 3MLZL 4KROD 1GRWA 3DECA 5E5RB 4LHUB 7FABL 1A3LL 4NC2B 2AKRA 2VDPH 2H1PH 6CGTA 3QPXL 5K59F 4EJ1C 4CMMB 1YEIH 4OJFL 4Y5XA 3KPLA 5ESVA 4CUCA 4P3CL 1VFOA 2CIIA 1IM9A 1MEXH 3PWNB 1OGAD 5DMIL 3UPCA 4B50A 2VSDA 3S3JA 1WBYA 3DX6B 4P2QD 2WUBL 3C5ZC 1MY7A 3SDDD 3WXVL 4ZAKB 1TMCB 3P9WB 5JLZB 3OPZH 2V6HA 3ULUF 3C5SB 2NMSA 1Y6NR 3BPLB 5HI4D 5HBBA 2JE8A 5EIIA 2RBLA 3R4DA 2ADGA 5D5MF 1OAUL 5DMJB 3LQZA 4JPKH 2X6MA 5ACMA 4WUUE 4JQVC 1KXVC 4YAQA 1UXWB 3CLFH 1QTYT 2JKXA 2UYLA 3MRCA 2IANA 5I1KL 1OTTC 2WWMD 3RA7L 5CINH 1ES0A 5HHQB 3H3KA 1ZLSL 1H15A 1X7QA 4WJ5B 3HAEB 1JGLL 1CYGA 2QSTA 1JZ4A 2D31B 3VI3E 3BMWA 3KLHD 5E8PA 4X6CA 3P4OB 1XGRB 1ZT7B 2ZNWA 5IFHH 1QQDA 1T83A 3IFNH 1RUMH 3NBNA 5DQJB 1BZ7A 2ENSA 5BQ7A 2N7BA 3KPPB 4XX1G 5AZ2H 3NOIA 3BH8A 3QHZH 5TJWK 3B9DA 1T5XA 1MIMH 1YQVL 3FT4A 4DKEH 5HHOD 4M62H 5JDSB 3ARBC 1S9WA 2DB8A 4F57L 3NIFF 4PJGF 2AEWA 5INCB 3O6FB 3STZA 5L88L 2B5IB 5I8OH 1T04A 5IKCB 5B21A 5FAAA 4JDTH 3G5XA 1Z9MA 4PRHD 1B88A 1NGZA 3MOQA 3UTPE 5FUCC 4JZJA 1E27A 2VLRA 4M43L 3QEQB 4ENEC 4LSPH 1JNHB 3MRDB 5DRXB 4L9DA 3I9GH 3O3DB 1IRAY 4Y88A 9CGTA 2W60A 3HCVB 3CU1A 5ID0B 5C09D 4Z7OE 1NBZB 1U58B 3BKCH 2AJZB 2NW3A 2VXSL 4AM0B 5I15H 1CDHA 2HG5B 4PJDA 1JNNH 2DQIL 4WV1C 4OGXL 4OLZL 3V95A 1FGVH 3P73A 3NVQA 1G7MB 2XTJC 4RRPG 1BZ9A 1P4LB 2UWEA 3MOAH 3PGDA 3CDGA 2HJLA 2IQ9H 3RWCA 2VXUL 3KR3H 3W39A 5EZLB 5I74C 3Q6GH 1T22B 2OP4H 4JFDA 4X4YA 2IBZY 3TIDA 4UV4H 3P0YL 1J9CT 4ZO9A 1MJJB 4LOUD 3JV4A 2LE9A 1MCDA 1G9MH 3ROOA 3O8XB 1V3LA 3L3HB 2CRMA 3A67H 1Z5LA 3O11B 5LG1A 4LFHG 3U4EA 4JFEB 3ALWA 1CD9B 1E6OH 4FP8H 4OT1H 4YHOH 4BZYA 4EI5C 2UY6A 4AIZA 2FDBP 2Y07H 4MNGE 1V3MA 4Q6IA 3FAXA 2FJGB 1VACA 2BHZA 2IALB 1AO7A 5FA3A 1H3UA 5I1CL 2VUOA 4NWUL 3TT1H 3ZTJH 4M6NL 3FONA 3ZE1F 5KSVB 3ARDC 1W8OA 2O61B 3TA3D 3WD5L 2E3VA 1SJEB 4LL9A 1UM4L 4WUKH 1V7MH 5GGUB 4HAFA 4YHYB 1KTDA 3U83A 1G6VK 1J0KA 3NTCH 3LDBC 3I2CL 3T0BA 4IDLA 1HHJA 1IARB 2D0HA 2DM3A 1CVSC 2F58L 4JAMB 1F6AB 4LAJH 3ZDXF 5IVXE 5JQ6H 1WTLA 1K3ZA 3RU8L 3TC9A 4RX4D 3MXWL 3TT3L 4G7VL 2HJFB 5EOQH 4OI9A 2VDLL 1SEQL 4EQ2A 3ES6A 4OLUL 3E8UL 5IFAL 3QUMA 1CN4A 1AFVL 1INDL 2W0LA 1YEDB 1IC7H 5EPMB 4Z7NF 5ITFB 3SGKC 5LWYH 1LO2H 2YA1A 3MRKB 3KYOA 4XMKH 2A6DA 3VRIB 4AENA 2JELH 1EJOL 4KRPD 5SWZD 3U1SL 1L6XA 2V2TB 1JJUA 1G7HA 3NCFB 3ARRA 1DN0B 1X4XA 2V7NA 1H9VA 1RU9H 1UH4A 4XCNA 4NRZA 3O9WB 1HHHA 3ARGC 2VISB 2JTDA 1NDGA 2DD8H 3O3BA 5IESL 1NC4A 1UCBH 3OKEA 4YHZL 4PJAB 1CGVA 1YPZB 1LNUA 2H32A 4MHHG 1P9MC 4PJFE 4WENB 2YZ1A 4ONFL 4RFEA 3RI5F 5C3LD 1NGYB 1X5LA 4ODHH 3BH9A 1BECA 2BVTA 4K3EL 4HPOL 4NGHH 3H9SD 5C0EA 4KJPD 2DM4A 5SWQA 1SM3H 3TH4T 2R1XB 4NQXB 1YPZF 3D18B 5HGDB 1PX3A 3G6DL 1UFUA 5EWIL 3KAAA 1RHHA 3F8UB 2AS5M 1A7RL 2DMBA 3JTTB 2FZ3B 1VADB 3CSYB 5JIPA 2BVPB 4K3DH 2ITCB 1UENA 4W6XB 3PDGA 1I8MA 3I6KB 5D1ZC 2NY1D 1LEKA 4ODWA 3QIWD 1HDMA 4JJ5A 1XR9B 3LIZL 3UBXI 2VITA 4UOJA 3BSZL 4NKQB 5E6ZA 3DYOA 4EBQH 3VXSB 4KV5E 4JO2H 1G0XA 4H0GA 4QRTB 1D9KC 1UJ3A 4P46D 2D0FA 4XCEA 3BEVA 4NT6B 3UYRH 4PGDB 4G43B 1OPGH 3AXLB 3QZWB 2A0LD 4DKFL 4NQED 3M1BB 3PL6B 3SDAD 3N1MC 4ZUSA 4BFIB 4OV5B 3EO1B 1C5CH 1KENH 3DUUA 4YXLL 2ZUYA 3B3IA 1FG2B 2QTEA 1MI5B 4HMCA 4XP4L 3QQ3B 5J12B 3GJFA 3RNKB 4ZFGH 5ICZB 5FDYA 2XWTB 4OKVA 4TQEL 4HGWB 1CGYA 5FECB 2EC9U 4JREB 1OAYH 1P5UA 1LILA 3ILPA 4D9RD 4IRSD 4CW1B 4F8TA 3EDJA 4ERSH 4X4XA 2XZAH 3F7PC 3WFEL 5TPWL 1XH3B 2C3VB 1G6RB 3BAEH 5T5NG 4XPHL 4GQPH 2AJSH 4J23A 4JY5L 4ACPA 1A14H 3MLSH 4WEBH 3BHBA 1XIWA 3IDJA 3NFNA 3KGRA 4PR5A 5EO1B 1OAQL 3UC0L 3F65A 1NC2D 1IM3A 1KB5L 5GZOD 1EMTH 3L9RA 2BK8A 3L7FA 4MNQE 5E7BA 1XGTA 2MCPL 1VPOL 5E4IA 3SJVE 2R2CA 4LPVA 2DICA 1IM9D 3TPUB 4JQXC 3RZCC 1QYGH 1NSNL 4CMHB 2J8UE 2AK4B 4JJHA 4ZOEA 1DQTA 1SY6A 5IIEB 4XNXH 1A7OH 4P9ML 4PY7A 5JMRA 4IRJB 2CO7B 1I3GH 4NM4L 2GJ6A 5SX4H 1KC5L 1VEPA 3SQOL 5TE6L 1LWRA 2QKIB 1NLDH 1MCEA 1HINL 2IAND 4IDJH 1TJHL 3U30B 5C09B 2V17L 4ONGH 5IJKC 3DMMC 1BJ8A 2WBJB 1AY1H 5D70H 3G04B 3TN0B 5IWLC 4EVNB 3LSOB 3CC5B 4KGLA 3OHXA 4GH7B 1QFHA 3O81A 1P7QA 2NY6C 2ICCA 4DWHA 4XP5L 3WHXB 3D69A 2XN9E 5CHNB 5C0AA 1QKZL 1NL0H 2GAZB 3RDTA 1U8KB 5F7FA 3VXME 2A6IA 8FABA 5E24E 1U3HB 1P2CB 1MAKA 3LN4A 2CIKB 5C6TH 1O7VA 4KMTH 2ATKA 4TSBH 1U9KA 2YPKA 1GCFA 2PN5A 4YPGB 4X7EC 1T89C 1OTSC 4HDIA 5DD1H 4X7TA 5I9QB 4RMQA 3C09B 4QHUB 4X4ME 5HJ3B 5IK3B 1YNKH 3VRLF 3TO4A 5F6HI 2NY3C 4JY6B 1QSFB 2VLRD 4FTVE 1QO3B 3WXWH 5J1SC 3BW9B 1C7TA 4WEMB 3C6LD 4WUUA 3U6RB 1YN7A 4Y4HD 3N1GC 4G6AC 2GHWB 3ET9F 5HI5C 4NN5C 2G5BB 3IRZA 4PJCF 5HHQA 1BIIA 2KDGA 2CDFA 3IDIB 5DJ6A 3TJEH 4LCYB 2IBGA 2D31A 3JWDC 3HZVB 4C54A 1LE9B 2FX7H 1XGRA 4K8RL 4S0TD 3R8BB 3GNML 2OX5A 5D1QB 3ISWA 3INUH 1BGXH 4I4WB 4L8SC 3ULUC 4JZNA 2Y5TB 3QEGH 1IAIL 5IM7B 1R3LB 3HR5A 5IG7A 5I1GL 3OR6B 4Y4KB 1YYLL 5I16B 2HJKB 3NFSH 3I6LD 3ZE2F 1A6UH 5JDSA 4YUEL 4RSVA 1I8IA 1P4IL 1PLGH 3VXTB 1OQXA 1TXKA 3HMWL 3O6FA 4KUZH 4HV8B 4U6HB 4EDWL 4XPAL 3QG6B 3IJSA 3OAYH 5IW6A 1CDIA 1N8ZA 1KBGL 2Z8SA 2APVA 1W2KT 1AO7D 2YBRB 5C6PB 5F96H 2BNRD 1A4JB 3HCVA 5IT2L 1U58A 3LH2H 4Q9RH 2AJZA 2E5EA 1EVUA 3ZKMC 1RZKC 3MJ8B 4DUXA 3G6AA 5DMKA 3VXRB 2EXWD 3UTTB 5BOPA 3NIDF 3SHSA 4M7LH 2VDOL 3GM0A 1QLEL 2A77L 1K5NB 4C55A 2AJXH 1C5DA 3GSWB 2MQCA 2FX9L 4YE4L 2WAHA 1QFWM 5IW1A 2CJUH 3I84A 5JXEC 4QOKE 1T21A 3MRFA 1TETH 2PNDA 3BJLA 1BD2A 1U42A 4K9EH 1Y18B 2Z4QA 1A6WL 3NPSB 5E03A 1WZ1H 4OQ1A 2RGSA 2VYRE 4KI5C 4P9HC 5IMKB 4FQHA 3VCLA 1F4WL 2R1WB 2EO1A 4KHXL 1ZKAA 1UA6L 5GJSH 2B5IC 5AD0B 1YUHB 4KDVA 3W0WE 1UWXK 3K4AA 3FOMB 3FMGL 4LQ1A 1K8DB 3V6OC 3EAKA 4FQ2L 2EEAA 3U48A 1AKJA 4ZDHA 2VDML 1ZA3B 1MRCL 3T0EE 3T3PE 3PP3K 4DKAA 2O61A 4JQIH 1RZFL 3HUJB 2WINA 1DBML 1IQWL 1LEGA 5JO5B 4TOYH 5CFHA 5DDHA 3GHEH 3HC3H 5EIVA 1QLRB 2GUOA 2OK0H 1WQVT 4NQTA 1TPXB 1OAZL 3CVHB 1KYOJ 3ARSA 4N90E 1WBXB 4ZD3L 1P6AB 4JFFB 1EHXA 1IGFL 3MUJA 4HKBA 5CD5C 2HJFA 3HUJF 1A6AB 3QUMH 4L5FL 4HX1A 1MNUL 4HBCL 2CUIA 5MENB 4NRXB 5DD3H 3TCLB 5E2TH 32C2A 1U0QA 1KJMA 3S35L 5IMMA 2DQJH 2FJFA 5F93C 5AZEH 5C0CA 2D3VA 4FQJL 2E8ZA 4JRXA 3IU4H 4MJIB 5H94B 3MRKA 3PV6B 2VL4A 1T1WB 1CFSA 3W5MA 5H35B 4KY1H 3UTQA 3MA9H 5C92A 4N68A 4WI2A 4Z76A 5DJAA 3O9WA 3D25B 4M02A 5FUOH 2H32H 1FJ1A 5E7FA 3WO4C 1NAMB 5C0BE 4PJAA 2HT2C 4FZ8H 5EBLA 1NGYA 4KTDH 3FQNB 4Z78A 4OIIH 3QIBB 1D5BB 2CMRH 1PZ5B 4ZS6D 5TDNA 2HWZH 3ARFA 2J4WH 2D4FA 3KPRB 4GUPA 1I8KB 3FFCB 3SDCB 3GBML 5CZXD 5GJTH 4OZ4A 4PG2C 4HXBL 1JFQL 2OL3B 2FZ3A 2EEBA 1EZVX 5GZNC 3AU1B 1HH9B 2BVPA 3LS4H 1NCAL 1PY4A 4HD9A 3MRJA 1ZANL 5T1MB 3ARZA 4WFGE 3K2UL 4CN6A 4UDTA 3QNXA 1XR9A 4OB5H 1KF9B 2FEDC 1BVKB 3QDJB 3KPOB 4I0KA 3GMRB 1MPAH 3RWGB 5IHZA 3LVEA 2G9HA 2OTUB 4MAUH 4XNYH 2EIBA 5DJYB 2Q8AH 4P5MB 4NT6A 3KPSE 4OD2B 5C08B 4G43A 3OKYA 4PJ9A 1F4YL 5DRWA 3SE3C 4FQLL 4YHIB 5GGTL 1KN4L 4HKZA 3IXAB 3TBYB 4GKSB 5F8RC 4LRIC 1NBVL 4BFIA 4HG4J 4OV5A 5J8OA 3GJFH 1ORQB 4YH6A 2HKHL 5D7LD 4Y5VB 1MFEH 1S9VB 1QEWB 5D7SL 5ICZA 4LIQL 1OWRM 1R5VB 1A1MB 4MA8L 4H25B 2VWEC 5IV2B 3EOBA 1VFAA 4GKOA 2B0SL 1Q1JH 3H42L 3WSQH 3L5IA 4CW1A 4JHAH 4DQOL 2Z8VC 5IB5B 2GJ6D 1BWWA 3T0VA 5I8KH 1XH3A 2BCKA 3S36X 2C3VA 4G6KL 1MCIA 4Y4HB 1JL8A 4OCWL 3QDGE 1LO0H 3TESA 1JRHH 3L6FA 3BP7A 5EO1A 4S1RL 1MH5B 3MV01 1ZLUK 4G6MH 4HEME 2AJUL 4KROC 1P7QD 4JDVB 3B83A 1BX2A 3QULB 1LE5A 3PHQA 3MO1B 5GRVK 3T77B 4Z0XA 5T1DH 3P9LB 43C9A 5I76B 1IC5H 1MJ7H 1ZLVK 3SJVA 3T0XA 1YEKL 4R7NA 1MCPH 5D2NB 4DCQA 4PJDF 5DR5H 1YMME 1HWHB 1SY6H 5FCSH 5DXWA 5GS2D 3PE9A 3S4SB 5KOVC 5FHAH 2UWEF 3B5TA 3SDDC 5HTSA 4Q0XL 2CH8A 2Z31B 2J8UA 4J8RB 2DLEA 2QQLH 2KQNA 1NMBL 5HI4C 1JIBA 4XC1H 5DURD 1CU4H 1LDSA 3TO4D 5IEHB 2AP2A 1T3FA 1P1ZB 4W4OC 1KCVL 3QEHB 4WUUD 4U4BA 3RVWD 5F72S 4HULB 3P4NB 3QWRA 3MODL 3C8HA 3GGWB 4YJZL 1AGEA 4LRNL 3TF7C 1WLHA 2WBJA 4QTIH 4YDIH 3G04A 3B8SA 3TN0A 3V7AG 5E08H 3HC0B 3LSOA 5F89B 1MFDH 2DI9A 3V9FA 4BSVA 3AS0A 3ULSA 4HXAL 3B8YA 4Y16B 3SDXB 3KLHC 5EZOH 4HFWA 2NY7L 4R2GD 2VXQL 2DAVA 2XZCL 3RWEA 1T0MA 1F3DJ 3VD3A 5HXMA 4WTZA 2DI7A 2E7CA 1U3HA 2FWOB 3QDME 1P2CA 3MFGB 2WUCH 5GS2H 3RWFA 4WI3A 3LQMA 4PTUB 5F8QC 3GSNA 5J13C 5E8EA 4LEOB 1TQCC 2APTA 2BFVL 4XPFH 2FBJL 2H26B 4JEGB 4Q9BA 1CIUA 15C8H 2OS7A 4Y2OA 4JM2B 4R0LC 1AQKL 2P5WB 1G9MC 1RJZA 2NZIA 5ETUB 5MHSE 1AXSA 4JY6A 1F4XH 2R0LH 3Q6FB 2F74B 3UTPD 5B39A 4FTVA 3U6RA 5FO8B 1Q0XL 5DJCB 4YZFE 3U36A 5J1AA 2GT9A 3MR9A 3FQTB 5C07E 4JM2F 4YO0A 2R0WH 4JN1L 2ARJA 4HJGA 3IDIA 1UZ6F 5DQ9A 5DTFB 2IEPA 1A3RL 2HTLD 4OGYL 2MHAA 1FVEB 3H3BC 5FB8B 2EIZA 2RQ8A 3BFOA 1RJLB 4MAYD 5D1QA 3DOSA 3Q3GB 1JHKL 4OTXL 3FT2A 4PJ5B 4YC2B 1QLFB 4GKNB 5TFSL 4L3EE 1JI1A 3IDXL 1EIBA 1PKQE 1R3LA 1FRGL 1DBKL 4OBSA 2HJKA 4UB0H 3UJJL 2DLFH 2BSRA 4Z8FL 2P24B 4LOUC 1PD6A 4MMXC 3CFDB 3BDYL 4MXVF 1ZHKB 4WHCA 4M6MH 2EYRA 3GB7B 4MZ2A 5I9QC 1H3PH 3QEUB 1ZEAH 3VG0L 5EUOB 4X8JA 2C9AA 5EBGA 1GPOL 5IB3B 3VDAA 1HCVA 2R4SH 3T3MF 3HNSH 2Y6SD 4JZOA 4JPWL 3UJTH 1MUJB 1AKJD 5TF1H 2NLJB 1S7QA 3P77A 3HE7B 3TBVA 1RZGB 4V1DE 1KXTB 1S7SB 3DX7A 4LIQE 3VXRA 3HZYB 1H8SA 2F8OA 1FYTE 4Q9CA 5I8EA 4ORZC 2A6JA 5E2WH 2CXGA 1W72L 3BQUB 5EC1B 4LVHB 4XPTH 4J3XA 2ZNXA 3HRPA 5KG9A 3MV8E 3WMSA 2X41A 1R5IA 2ESVE 1GGTA 4TUKH 2J12B 4U1KB 4YPJA 3QWOB 3FB6B 5FKAA 5AYUH 1J11A 4TUJB 1Y18A 4S2SB 4K55A 4WHYG 1F3RB 4BQ6A 4GW1B 4JRXD 1JPFA 5FCUL 1BBDL 3QRGH 2BMKB 1YNTB 1K6QL 3MXVL 1YUHA 4XCCL 3VXPB 3DWTA 4URTB 1K8DA 1FCCA 4KMQA 1FORH 4HWBA 2VSCA 1CT8B 4KRPC 3X14B 5E0QA 4U1IB 2AV7A 4XVTH 4J7RA 2EKSB 3HNTH 5HD8D 2XY1A 1K4CB 1BP3B 3MZGB 2BC4B 3S8WA 3NAAH 3WDJA 2YUWA 4I13B 2EYSA 4I0PA 2NY0B 4JFFA 3AS2A 2QR0A 4NYLA 4LHJB 4M4RA 3HNVL 5KS9B 3QR2A 1A6AA 5CJXA 4ODSL 1V7NH 4KJPC 4NRXA 2J5LC 4R3SB 1KG0B 3A6CH 4M1GL 4L4TA 5IBLD 4PJEB 3MLZH 1PJ9A 5KSUB 1J1OL 7FABH 1A3LH 3D48R 4J12A 4YX2L 4UNVA 3HFMH 1DQLL 3CD4A 2OTWB 5K9JL 4OJFH 1TVHB 1T6VN 3WLBB 4P3CH 4FNLL 1G0YR 3BZEA 4RIRB 2DTSA 1T0NB 4X5LA 5IB2A 1QSZA 5DMIH 3DO3A 3QIWC 3VXUE 5DI8B 1U3JA 3DJ9A 5K33A 4YXKL 4BQ9A 1NJ9B 5H8DA 1OL0A 3M17A 5LCVH 1TVBB 2MWCA 4WI6A 3BZ4B 2X10A 2OSLA 5C0BA 4F7MA 4JFHE 3V4PL 4Y19E 1OAUH 1MCJA 4P46C 5F97E 3I02B 3FQXB 4PJ9D 3QIBA 2E9IA 4H8WH 3E2HB 4UAOC 5J11C 2XICA 1BBJA 1PZ5A 3F5WB 1DUYB 5I1KH 3RA7H 2A0LC 1JGEA 5KSBB 4K23L 4GSDH 3GK8L 2KL6A 5DLML 1I8KA 5DVOA 2PTUA 4N0FA 3SDAC 1ZLSH 3QUXA 2WWKO 1JGLH 4HSQA 2AJVL 2A38A 4XBEL 1A1NA 3KXFE 1OF2A 1OSPL 2J8HA 4G5ZL 5GHWL 5I1LB 3AU1A 4O9HL 4Z7UE 5HHPB 2AXJA 3V8CA 4JPVL 3WFDL 2Y7QA 4IRSC 3K3QA 3KPMB 3TNNB 4LSVH 4PB0L 2E7LA 5KOMC 5K9OB 3PP4L 3T08A 2GSGA 4JO3L 3G6JB 3RPIB 3MJ9L 5ALCH 3WE6B 1EZVY 1YQVH 5EA0L 1KCRL 4OSUL 3DNKA 1DVFA 4UQ2A 2IMNA 2YD6A 3JZ7A 1MSPA 2CO6B 4U1NA 2VNCA 3DRQB 5DJYA 2R4RH 3RX8A 2ZJSL 1CGWA 4OD2A 2EH7L 5C08A 2Y5EA 3RWHB 4M43H 4MJ4A 1WISA 2WIIA 3G6JF 3HRZB 5CSZB 5J6GA 2X89D 2AXFA 3ORJA 1SJHB 3H0TB 4GKZB 4GG8A 1LK3L 4GKSA 3X11A 4MQXD 3SJVD 3O45A 4OD3L 4G9FA 3LQAL 2P4AB 5T3ZL 2CUMA 1ONQB 3FQRA 2DQIH 4OGXH 2YD8A 5FM5O 3OAZH 3VI3F 3PDOA 1GGUA 2P8LB 2HFEA 2J7LA 3FN0L 4H25A 2G2RA 2YPLE 3HE6A 1EEZA 1QR1B 1G7IB 2VXUH 4J2XA 4I5BB 4DEPC 3BXNB 1QRKA 5T33H 1GOFA 3PGFL 1JYWA 4Y2DD 5DS8A 1WTGT 5DJ0A 2OTPA 4OZFB 2YD2A 3QWRD 3EGSB 5KAQG 2ZP0T 2DQUH 2A74B 2J6EL 3UZEA 3MACL 5I73C 5IHBA 2X09A 2W65B 4OM0L 1MH5A 3FN9A 2Z8WC 4U6XB 3F62A 2GJZB 3N0PB 2EICA 4H5SB 5I1CH 3H9HA 2FHCA 3T77A 3HS0A 5C7XH 4NWUH 5I76A 2FECL 1JPTH 4PYHA 4PGEA 1T83C 4M6NH 2BNUB 2PYFB 4Z7OF 5C0ND 1KJ2L 1J05B 1OP5H 3WD5H 1NCCL 1UM4H 2X4RB 2YEZA 1WJ3A 4XI5D 1GVIA 1CG9B 1YMMA 1KEGL 4LMQI 4ZS7L 3S4SA 5ISZE 5E1AB 3WJJA 3K1KC 2Z31A 2L4OA 1OQOA 3CPLB 1BM3L 2F58H 1GAFH 5AAMA 2JCCB 3RU8H 5BO1L 1FFNB 1B0RA 1P84K 2I26N 3MXWH 3TT3H 4G7VH 4LCUB 5HVHB 3FRUB 3BN9D 2VDLH 4KQ3L 4MNGB 3IDYC 4OLUH 1F2XK 1ZAGA 3E0GA 4FTVD 5IFAH 4WY7L 3C6LC 4Y4HC 2FD6H 5C0GB 5MEPA 4TTGA 4JG1H 4G8EA 2EDXA 4XP6L 4JKPH 3QJFB 4WWKB 5CJBA 1XF2B 3GZKA 4P4KA 3U7AA 1OM3L 1RV6X 3SDXA 4FQ1L 1DQDL 1EJOH 3IETA 4QXUH 4RMUA 3U1SH 4N1EA 3UX9B 1MHPL 4QKXB 4WRLA 1HE7A 4P5TB 2A73A 4WIQA 3I3DA 3SKOB 4B0MM 2R69H 5IESH 4JHBA 1SMOA 5TQ2L 5GQBA 3BD4A 4BA8A 4YHZH 3I50L 1EA9C 4F7EB 1EGJL 4AIXA 4NQSA 1IC1A 2C3GA 4JKLA 1K2DA 4HPOH 4LHUG 5EOCL 5IVXF 1ZLWH 4K9EC 4OCYL 5KVEH 3LKOA 4LLUB 1XF4B 2KPNA 2F74A 5DSCB 1T1ZB 2APWA 1MF2L 4Q6IC 2V5YA 4I48B 1OY3B 3G6DH 1M7DA 3FQTA 5EWIH 1SEBA 3RVVD 4ODUB 3RY5A 2H2SD 1A7RH 5C07A 1NBQA 4U31A 2ARJQ 1UWEL 2G75B 4NJAH 3RGVA 1CD0A 3UTSA 2EXWC 4GJTB 3NZHH 1OAXL 1RJLA 4IMLA 3VFRA 4PJFB 4RZCA 4RWHA 1TQBC 3LIZH 3O3AB 2F53E 4WI7A 4GKNA 3BSZH 4L8BB 3ZT6A 3SQBA 1K8IB 3B2UD 1FNFA 2EDKA 5DEFA 4ZOBA 5F6IB 2AV1B 4PJFF 5DD6B 4JVUA 1TDQA 4OCRL 4OUUA 2CLVA 3I75B 3E6HB 1T7ZA 2LFGA 5DYOA 4JM2C 4QRPB 4DKFH 1CE6B 4L4VE 4QNPE 4PJHE 5EUOA 3VFWB 4BSWB 5IB3A 3I3BA 1GYAA 5L9DL 4HZAA 3W0WD 3Q2CA 3DUSB 4P0DA 2NLJA 4YXLH 3D0VB 3VDCA 5E8OB 2R56L 4XP4H 5T3ZE 4X99B 4O5LL 4ZNEE 3OJ2C 3REWA 4N0UA 2EDHA 4ZFZB 3T0ED 4OLXL 4TQEH 3HN3A 1VKXB 3HZYA 1MCOL 4Z7VE 4V1DA 4R4BA 3TBTB 4P2OA 5D6CA 5D9SA 5F1NB 4O2EB 1B6DA 4GO6B 2IH1A 4PJBE 5EC1A 3BQUA 1FNGA 4S0SD 4I0PD 3WFEH 3WIIH 5TPWH 3WFZA 1HYSD 3ROLB 4LP5A 1UB5A 2H8PB 4N90D 2B7DT 2R2HB 4JY5H 1LD9B 1VESA 1MAML 3RGHA 3FO2A 1NLBL 4L4TD 3ULVL 1XGQA 2HH0L 3QH3A 1OAQH 3PIQA 4S2SA 3UC0H 3GMPB 3O2VH 1IEBB 1BVLA 2DL2A 3FHAA 4ZUVB 4GW1A 1IKNC 1R5WB 4RAUA 3OB0K 2BMKA 4UIKL 4CVWA 3VXPA 2R9HD 4HWBH 1U95B 3MA7A 2ZSVA 1KEML 4AG4L 1HI6B 4MA3A 1W0WA 1NSNH 4HIIA 4OFPA 2EDTA 5IR1A 1HQ4A 3V5KA 1N2RB 2IH3A 1J8HE 3GSOB 5CSGA 5JPMB 2FL5B 4P9MH 1JGDA 5C0BD 4S1DD 3HZMA 1A7NH 1UJ3C 3K74B 4NM4H 3BIAX 4ZUUA 1BZQK 5KTEL 1KC5H 3E3QC 4XVSL 1OLZA 3SQOH 5TE6H 1RQ5A 4LU5H 5DHYB 1HINH 1TJHH 3OKKB 3KNBB 4OGAD 4LVHC 4ZS6C 4MNQB 4F7PB 2V17H 4JHWL 3P9MA 3QUXD 1HEZA 3LB6D 5JORA 1U8NB 4C56E 3PHOB 1M1SA 2RFXB 5CZXC 1IE5A 1VB9A 1UM6L 5LGJA 1I8LC 2P1YA 3UTOA 4XP5H 5FDWA 5ESQA 1QKZH 2BJML 5CLWA 1TVHA 4GRLA 5F1IA 1T0PB 4PREB 1Q9KB 3QJHB 4CDGC 1F4AA 1A5FL 5HYJE 4RIRA 4LQFL 4WFGD 3DVIA 4PRIE 5JPNA 1KFAL 4LHQB 1F90L 4HUKB 3CXDL 4R97B 2WSKA 3NCMA 4U05A 1DVFD 1F2QA 2J8UF 1CDBA 2DIAA 5D7IB 3U0WL 3BZ4A 1UACH 3LKQB 3MRNB 1GHFL 3FO1B 4J3UA 5ALBH 4LLMB 4EIZC 4C83B 1C12A 2XG4A 3FQXA 3KPSD 4N8CH 1RUKL 5LVEA 3VWJD 3F5WA 3VFUB 3Q1SL 2XN9B 5KSBA 4U1JA 4K3JL 5ADPL 2DJ4A 2JB5L 4ZO8A 3VXMB 3P30H 1I4FB 3HB3D 4GRWB 1HN1A 3O2DL 4XX1E 5E1HB 1U93B 2X1QA 1D5MA 4GRMB 4IM8A 3GNMH 5JXAH 1BFOB 3C60B 2LVEA 1XCTB 4MS8D 4HW6A 4P9HL 4PRNA 5KZCD 2D03L 1IAIH 3IFPA 2D7TH 5I1GH 3SO3C 2E6QA 3RPIA 1YYLH 4RGND 3WE6A 4YUEH 4GAYB 2D2OA 1IGTB 1P4IH 4LCWE 4UZGA 3V4UL 3SCMA 1N64L 4XVUD 1CE1L 4EDWH 4XPAH 4TNWF 3WIHA 2VRAA 5JHDA 2B1HL 2GW5A 2A6KA 1FSKB 3WS6A 1T5WB 2D9QB 5E9DE 1LEIB 4LGRB 5SX4I 3H0TA 4L3AA 1U3ZA 1NANH 5I19L 1U8PA 3VXNB 1ZHLA 1T4KA 2VQ1B 1KTKE 3PNWB 3ZKXB 3LD8B 1YMMD 1QLEH 2A77H 2P8LA 3CCHB 2DL9A 5HY9A 3EYVB 1MHCA 4YBQD 2HYMA 2YPLA 4DGYL 4GBXA 3VU2A 2ERJB 4YDJB 3LKNA 3QFJE 3TO4C 3MV11 4M1DL 5ILTL 5FF6B 3T1FB 3ULVE 3RVWC 4CU6A 4GG6B 3O41B 1EEYB 2B8OT 2EIEA 3DETD 4KJWD 5EU5A 3FT3B 1I9RL 4PY8J 1J7VR 4AH2A 2W65A 4KHXH 2A2QT 3TV3H 4P4KD 4JFYA 3DX8B 5C0RH 2APXA 4FQ2H 1UJTA 4R2GC 3U0PA 2WIMA 1AIFB 4GG6F 5FUZL 3CH8A 3MJGX 2VDMH 1MRCH 2BNUA 3OL2A 4NDMA 5BVPL 4QHKI 3EDDA 3PWJB 1RZFH 3QI9D 4X6DE 4YGAB 2NXZD 1HZHL 2X4RA 1DBMH 4LLDA 1IQWH 3PHSA 4L29B 2CKBL 4GMTL 4QOKB 3MGOB 3D39B 2BXZA 1NDMB 3S88H 1OAZH 2Z92A 4PGBB 4QCIA 4LNVA 4MJ6A 4ZD3H 4MX7B 1I1CA 4HF5H 4L1DA 2JCCA 2DQEH 4QRUB 1FFNA 4EN3A 2GIYA 2D7OA 2VXTL 3FRUA 2O5ZH 1KB5B 4HBCH 3P11L 5MHSD 1IAIM 3WFCL 2DLHA 3HG1A 5F3BA 4PJXA 3MZTA 3C9NB 3WL9A 3S35H 5I1IL 5HPMB 5C0GA 3AFLA 4MDJA 3NCYP 3SE8L 1JHLL 5C07D 3T0EB 2VDKL 4NRYB 3QJFA 4JFPB 4HHAA 2PTTA 4ONHA 4ZPTA 3RGVD 2HTLC 4D9QE 3UTSD 3EJYD 1SYSB 3OG4B 4L8DB 1KIRB 5FIEA 1HQRB 5FOJA 2RCSL 5DF0A 4MAYC 3VWKD 1MLCB 4P5TA 4ZQKB 1LP9E 4GXUN 1G0DA 2NX5E 1HHKB 3AS1A 4FQXA 3T3PF 3MLPA 4NHUA 3SKOA 5DZLA 5HDBE 3IU3A 5DHVA 3VD5A 5J9PB 4OZIE 4F7EA 3CFKB 3OBAA 3BEWB 2H1PL 2W0KA 2OZ4A 3W82A 4U6YB 4J4PA 3ECBA 3UPRA 3GIZH 4GS7B 3G08B 1XF4A 2XZZA 1MEXL 4BZ1L 1T1ZA 5FYKL 4MLSA 4I48A 4WHTA 3IFOA 4H20L 5IHUL 1KNOA 5C86A 1CLYL 4HXBH 1JFQH 4DZBA 4FQCL 4EEEA 1NCAH 2DF3A 2G75A 4V1DD 4IJ3B 4P2OD 1HXMB 1ZANH 1MCHA 4D8PB 1FYTD 2W9EH 3K2UH 4GW4B 1CQYA 2W9LA 3IF1B 1UG9A 4D9LL 3RFZC 3AB0C 4HPYL 3R0MA 1XF3A 4BM7A 4K3HA 5B39G 3UPAA 3MV8D 4U7MA 3WYRA 4HCRA 3MNVA 4ELMA 4UV7H 4AL8L 5GGSB 4PYGA 2PO6D 3E6HA 1WAAA 3RPKA 1ZHNB 3IFNL 4CVZB 1RUML 1F4YH 2X4PA 5GGTH 1PY9A 3VFWA 1JYNA 4E0RA 3LAFA 2HTKD 1E28B 1WCBA 1S9YA 1FNHA 3QA3B 3MREB 1KPVA 3GI9L 5E6IB 4LLVB 4QTHB 2HKHH 5E8OA 2ZSWA 3BDBA 1TLKA 1X5JA 1RIHH 5D7SH 1IAKB 4LIQH 1NEUA 3H3PL 4MA8H 4RA3A 1BAFL 3BVNA 4D0CB 3VFPB 2VOTA 2K1MA 3H42H 4O51A 5HD8C 3GSUA 3K2MC 2APFA 3IJHA 3I9GL 1I7TB 1H3XA 1NFDB 5DRNB 4E41E 3WN5B 4YDKL 3VWJB 5FKPA 3VFNB 4F7CB 4G42B 1AXTH 2ZZUT 5D2LA 1S3KL 4HH9A 4NZRL 5I15L 5SX5K 4H8WC 1I1FA 4PTTB 4FXKA 2BSED 1BJ1J 4P4RA 4WW2A 5BV7L 5ENWA 3MRHB 4S1RH 5FM4A 1PYWA 1I9JL 4MMZC 5IBLC 3HA0A 5I71B 2AJUH 4ZUVA 1C5BL 3KG5A 3B5HA 1R5WA 1DZBA 4KDTC 5ESAB 3U9UB 5CCKL 3MLTA 1HILB 3Q6GL 4GRLD 2OP4L 1K85A 2CDEB 3MBEB 4XC3H 5K9QG 5ANMB 2FEEL 4ONOA 3GSOA 1BF8A 5JPMA 3UXFA 4Q0XH 3QDGB 2CR3A 4YHOL 1L0QA 4OT1L 1DUZA 4JANB 5GGRB 2V7HB 4TSAL 1WWCA 2P5EE <