2NY6D

Hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
228
structure length
222
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 46
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny6D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny6D01
1DQLL 3HE6C 3MRLB 2VZUA 4RFEA 1TJIH 1LDPL 2B5IB 1HN1A 5JOPE 2FJGA 3LHPL 4EN3A 3DUSA 1ACYL 2CKBL 2WBJB 3OSKA 5C0BE 2E27H 3FO1A 1Q9WA 3BIKB 4Q7DA 3D39A 4HJGA 4LNVA 1T22B 2E6PA 5ANME 2BCKA 3QDMA 2R0WL 4PLKD 1A2YB 4GRMB 1YJDL 5JIPA 1OAKL 4XTRC 1FIGL 2RQ8A 4U3XA 1IGIL 4I0CC 4JN2A 4K8RC 3DRQB 1OSPL 1C5DB 4M43H 5ID1B 5BMFL 5C0FB 3HMWH 2DLIA 1OTTD 5DMYA 1NKOA 1XF3A 4U6VL 2BSSA 1I8MA 1X5GA 4NRYB 3DO7B 4BQ6A 3WFCL 2YBRA 1NUGA 3CFCL 3X12B 1U6AH 5GZNC 5BO1L 5F7KC 1BIIA 1JL8A 4NHCH 1OAXL 1KTLB 5DK0B 1E4XI 4DUVA 1T21A 3TVMB 2QQLH 3TA3C 3C6LA 1A02N 3VFUA 3HR5A 2VE6A 4GRLD 4M8QA 1RFDH 4JO2L 4MWFA 1RAMA 5CZVL 1S7RA 2A74B 4G8IB 4JZOB 3HZVB 1U93B 1WAAA 3JV6A 3MRMB 4WFGD 3V95A 4QTHB 5IHBA 3ARDD 1K5NA 1PY4A 3ARFB 3HR6A 1T1WA 3BO8B 1NCWL 5D7IB 4X7DC 4LRIA 4PRIA 5C0AD 1JWMB 3BP4B 4N1EA 4MVBC 2IFFL 5DUPH 4MXQC 3LV3A 4ZTOH 3SDDC 4IRSD 4WO4D 2P48B 1F3JA 4MD4A 4I5BA 3VFNB 1P53A 2A83B 4B0MM 3QWRA 4FQQB 3U6RB 1WVZA 4X4ME 3SE3C 5I73C 4AEHL 1MIML 4JQVC 1F4YL 2H26A 3B9DA 1IGFH 5DEZA 1RSFA 3MA7A 5IESL 3QUZB 5F9OH 3IU3A 4KJYA 1OAUH 3E6FA 4YHKL 3ARQA 4EI5B 2E8ZA 4R0LA 3P11H 4L4VE 3F7YB 2IGFH 3DSFH 4I48A 4AG4L 2BNRA 3D48R 1YNTA 5JHDB 4O2FA 1HHKA 3WNOA 5C0JA 5KN5A 4MMXC 5EBLA 1NDMB 1S5HB 3WD5H 4JHAL 3B8SA 1HOCB 4HWBH 1ZXQA 5KS9E 1FP5A 1OGTB 2GTWA 1ZVYA 1MHHB 2DMCA 3O6LL 3RDTA 5E24E 1D7FA 4XNXL 3LEXB 3RAJL 1S9WA 3B9KA 3CFDA 4HH8A 3G6DH 5TE4H 4YNYB 4P23D 5IMLA 3T0WA 5AUMB 4I3SH 5I71B 1ZWIA 4JR9L 6CGTA 1FVCB 3H7BB 1IL1A 3LN4A 4UTBL 3U0PB 1FZJA 4RAHA 1SBBA 1HQRA 5FYJU 1VPOH 5HPOA 3SOBL 4Y19B 2CLZA 5CWSB 1YYLH 1JPSH 2F54A 2HVKA 1RVFH 3ETBF 4M6NH 4JJ5A 2OTUB 4LCWA 5HGHB 1BX2B 4UOJA 1NGPL 3RVXD 5JLZA 1F42A 2AERT 3VXMA 4Y4HB 1P7KA 3O4OB 5ELIA 2MCG1 3TH3T 4CUCA 2DL2A 4OFYD 5CP3A 5DTFB 1FYTB 1YQVL 4NYLB 2VDKL 1CK0H 1ORQA 4JPWL 1U8JB 2J4WL 1I9EA 2OL3A 2NY7L 1YEIL 3CFJA 4HIJB 1PX3A 1W2KT 4Z8FL 4JM4H 3HC4L 2BDNL 2ADFH 1Q0YL 2YKLH 1FZKB 4ODHH 3RP1A 4YE4L 5E7FA 4J3UA 1AGBB 2D7NA 4J2XA 3V0WH 2PYFA 2EO9A 4MJ6A 1F02I 1IC5H 3UZVB 2YHGA 3O9WD 2YPLA 1LP9F 1TVBB 3KWWB 2X1PA 1KLUB 4L8BB 1NANH 3OX8B 2KL6A 4LEOB 1MVFA 1YECH 3P77A 4BFIB 3EJYD 4XAKD 3UTZB 1T4KA 5KSAA 3RVTD 3FB5A 1QSFE 1M7IB 4XX1E 2CDEA 4JJHA 3PJSA 5C0GA 4FTVA 1EXUA 5IMMA 5HHNA 1F6AA 1MUJA 2XNAB 5TDPA 3LKSB 3MXVH 4M7JL 3RWJA 1MWAA 4PRPA 4ZAKC 2H6PA 1MCFA 4FABH 1HHJB 5FKAA 1CBVL 4F9PA 5ETUA 3WIIL 1OB1B 3WS6A 4R97B 4P3DB 4FQLL 5MEND 3GMPA 3MUGB 2DQGH 3PHSA 2DB8A 4Z7OF 3S9DB 4XP4L 3VRJB 4NSKB 4LRNH 2H2SC 5HYQB 4YHYC 2J6EH 1IJ9A 4KV5F 5C08E 2F53B 4Y5VC 1G6VK 3F65A 2N7AA 1DVFC 2HH0L 4GKSA 1J9CT 3BP7B 3OKYA 1BFOB 3I02A 4Y4FC 4HGMA 4JY4B 4FZ8L 5DD5L 5EIQA 2VABA 1BEYH 1MJJA 3V52H 2VZ1A 3IJSB 3MRDB 5GS0D 3G5ZB 1JHKH 2GT9A 5A2FA 5LGHL 3HKFA 4UT9H 3HUJB 4O5LH 3MGOB 5IVXE 5J13B 1UM6H 5DJ6B 3QDGB 5DJ2A 5IVZB 1INEH 4NP4L 4Z7QE 2VMFA 2R15A 4K71B 4ZTPL 4W70A 1S7TB 1YMHB 3OB0K 1ZSDA 4OCSL 5KVGL 1P69B 1FLRH 4G80A 2K9UA 4U1MB 4D3CL 4PJIB 1K6QL 3OAYH 1MHCA 1MJ7H 3U0WH 1CFVH 2FO4B 2YC1B 1KN2L 4TNWF 4X6FA 5D1QA 3U30B 1DEEB 4PG9A 3MBXL 3WXWH 4OI8A 1KIRA 4OAWB 4XCCL 4MXVF 2O61A 3JV4A 2CUMA 4M61B 1F2XK 5K59F 3ZL4H 5AAWA 3CCHB 5GJSH 3U36A 5F3BA 2ED8A 1GXEA 5AYUL 4NDMB 1MH5A 3LS4H 1MREL 1W0WA 1Y18B 1K8IA 4GSDH 3DX8A 3W0WD 4QRPE 4LSVH 2HYMA 4NFDA 3FT4B 3SPVA 2C7UA 4ONGH 2NW2A 5CBAB 2GCYB 5SX5H 5FEBA 5ICYB 4GXVH 3BQUB 5EIIA 2CKNA 2A73B 4X6CF 3V7MA 3GMMB 3IGAA 1NL0L 1L7IL 2V5MA 2IAMB 1BFVH 4E42A 5T3XD 3AROA 3MYJA 4ONFH 2NY6D 5JPNA 1PYWB 3DETD 5TE7H 1C7SA 3BPNC 4IRJC 4HS3A 3V0VB 3QNXA 4OQTL 2C4XA 2QHRH 1QSZA 5FO9B 4TNWK 4MA7H 1C12A 4NUGH 3TH4T 1T1ZB 2AJXL 3LEVL 3V2AR 1SMOA 2R29L 3LKRA 4HZLA 4I4WA 2NY0C 3ARGA 5C0DA 1TQCB 4ZUWB 5HVGB 1HEZA 2V2TB 1N59B 3OR6B 2CKBA 5CJQH 3WFBL 2IBBA 2RBLA 3VH8G 1UCTA 4PLJD 2FATL 4OD3L 1FFPB 3HHRB 4Z0BL 4NOBA 1TETL 3SKMB 4O2EA 4JRYA 3MV7B 4JDZA 4U1GC 4E5XB 1RUAL 1MFAH 1WF5A 4WUKH 2I9LB 1AXSB 3ET9F 3MJ7A 3QEHB 3IRPX 1JP5A 1HKLL 3T0ED 1I7RA 1CZ8L 4ZPTA 3TNNA 3W2DL 2B1AH 5A40E 1I1YB 4XCYB 2J5LB 4GW1B 1DLFL 3KPLA 4YIQA 1R3JA 4QEGA 5C07B 4QNPF 4BYHA 5C0RH 4ETQB 4ZUSB 5DD1H 4J3OC 1ZHLB 2A6KA 2QQQA 3HRZB 4IIQC 5CBEB 4YZFF 4UI2A 3GSVA 3HS0B 2X4TB 2FD6L 2NY1C 1QHPA 4GAYA 2NYYC 5EIVA 5DMIL 3KYMB 1S7QA 1KT2A 2O5ZH 2UUDH 4BH7A 1DUYA 1I1CA 1FBIH 3N06B 2YXMA 3QUMH 5FYKL 1Z0NA 5T33H 5HXMA 4A6YL 3ZYZA 4NNPL 3PL6A 5E2VL 4UTAH 3OAUL 2ZUXA 2WWKO 2ICEB 3VWKA 2WIMA 4C57C 4PJXB 2X4RB 4KDVA 3TBWA 5KTEL 2IMNA 2CR6A 2VOTA 4R2GC 1NH6A 4N8CH 2R39A 2VZ3A 1DANU 2AW2A 3HPLA 3QPXH 4HIIA 4PJ9B 3WL9B 5K9QI 5F1NB 4E41A 1BIHA 3AREB 3NCBB 1DCLA 4QCIB 1XR9A 2QBWA 4K3EH 4OIIL 1H5BA 1YY8A 4XCNA 1CVRA 2AJSL 5EUOE 1S5IL 2QSQA 3LQAL 4PR5B 5D7KD 4OLXL 4ALAL 3VFMA 4HBCL 5DJZA 3WLBB 5CIPH 2GJ6D 3MRLA 5DFTA 3NZ8B 1VENA 1X5IA 1QFOA 4LQFL 2AK4B 2WBJA 5JO5B 3BIKA 4KY1L 1I75A 4ZOEA 4TQEH 3HE7A 4P49A 5FKPB 2VDMH 1T22A 2Z31D 3QEGL 4XC1H 1AY1L 3DYMA 1E27B 5T3ZD 1A2YA 1BP3B 4GRMA 1FV1B 4G5ZH 1QVOB 4XWGL 4YJZL 2VXTL 2B7DT 3DRQA 4JY5L 1C5DA 2MKWA 3GSOB 4FG6C 5CAYB 1WICA 4WI5A 5ID1A 4LU5L 5I76B 5ENWB 1SQ2N 5C0FA 5H35B 1J0IA 1G0YR 4XVUD 1D5ZB 2DWDB 3BWUC 5CP3H 4UDUB 5MEQB 2C4FT 4WI9A 3ZKSD 5IJVA 3CXHJ 3Q48A 1XF5B 4X80H 5IBLC 1JGUL 4P46D 4NRYA 4YEFA 3DO7A 4UB0L 3X12A 1PAMA 1XGYH 2SEBA 2OP4L 4HS8H 3VMPA 5LKNA 1M71B 1NFDB 1QQDA 5DK0A 4KTDL 1W72B 4YDKL 4L8SC 4RISH 5GGVH 1T2QH 5FGBA 1A3RH 3MOAL 5SX4I 2A74A 3K0WA 4RBPK 5A2LH 4RA3A 2WNGA 5MP6L 4JZOA 3HZVA 1U93A 3NPSC 4QOKD 3TN0D 1UXSB 4KUZL 2HKHL 1CE1H 1Q8MA 4FS0A 4X7FC 1N0LA 1OARH 3DUUB 3EHBD 5TF0A 2ERJC 2OS7A 2Z8VC 3BO8A 4PJFB 4EBQL 5H8DA 3BP4A 1F4WH 4OGXL 3HZMB 1BZ7B 1H0DB 3EFDH 4F7TB 3TO4C 3QIUC 3RTQD 3ULVD 1MWAH 3QRGH 3AGVA 3ARTA 1NPUA 1MAML 3P0YH 1SJHB 1Q38A 2FEDD 3P0VH 2ZCLH 3VFNA 4Z77B 2A83A 3LKNA 4HCRL 5J6HB 3U6RA 2EEBA 3SDAD 4YBHA 4OCXH 1CLCA 4YHMH 1ZLUK 3NABH 3V6ZA 3DX6A 2GSGA 3BGFB 1FORL 4U3CA 3CX5K 5DR5L 2EE3A 2VSCA 2OQJB 1ZA6B 1GOFA 2XKSA 4X6EB 1F11B 5BV7H 2UYLB 5KOMC 1NC2D 1WBXB 3QFDB 2XWJB 4JVPA 1MY7A 3WJLC 5DD6B 1JI1A 5CLWA 5GS3A 3EDEA 2R0ZH 4LLMB 2ESVE 2RIKA 3B9VA 3TPKA 3GJEB 4AIZA 4CDGC 4P4KC 4WGWB 3VG0H 5JHDA 4X5LA 5GSRB 5C0CD 1ZT4B 4QHLA 3MRHB 1NBQA 4F57H 3MODH 4TUKH 1AO7D 4JDVA 1NDMA 1S5HA 2XRAH 3CIQA 4WV1C 1HOCA 1OGTA 1QLRB 3MRQB 1MHHA 5IG7B 4FQXC 4GMTH 3S88H 1EHXA 2YD9A 3RZCD 3LEXA 5J6GB 5C0AE 4YNYA 2DQUL 1AKJB 1RK0B 1YDPA 5ESVB 5DFVD 4FQ1H 5AUMA 4I9WE 3B5HA 1A9BB 1YYMH 4F9LA 4KRPB 3TT3H 4OD2B 4P5MB 1FVCA 3U0PA 4JG1H 2Z8SA 1IMHC 3HTLX 5TH2B 1EAJA 4CJ0A 2QSCH 1T20A 1SVCP 4D9LL 5GJTH 1OOAA 4Y19A 3WNPA 2HT4D 5HYFA 3QB7C 1CE6A 3VFGH 3S3PA 5HGHA 1BX2A 3UJIL 3PHOB 2ZSVB 1VSCA 4POYA 1AD9A 1GCFA 3VW3L 1OAQL 4Y4HA 1BGXH 5GHWH 4X8XA 1SM3L 2IF7A 1Z2KA 1OM3H 5FAAA 1HK6A 4JFYB 3RWHB 5DTFA 1FYTA 3OKDB 3SDCB 3PWNB 2F19L 2LAGB 1U8JA 3EOTH 4WRLA 4HIJA 4LPWA 2DMBA 2V2XA 4HJ0D 3RWIB 2B2XL 3PP3K 5D7JC 3AM8C 1AGBA 1P6AB 1TIUA 1WWAX 2DQIH 2YR3A 2W38A 3QJFA 4EUPB 5HTSA 1TVBA 1K4CB 1KLUA 4L8BA 2ITDB 3OX8A 5C0IB 3UYRL 2OK0L 4LEOA 3IXTB 2VL4A 4S1SH 2NY2D 4YBQC 1LK2A 3IAPA 2D3VA 2OZ4A 3UTZA 4G8EB 4EXPX 1M7IA 1KIPA 3RUGE 4JFFD 1ADQL 2VLRE 3NIDF 4L4TD 4M7ZC 2XNAA 4YXHL 4IJ3B 4NM4H 1YPZE 3LKSA 4DKAA 1INQB 4CVUA 2I5YL 1JNJA 4RIRB 4UILL 2CGRH 3VXSD 3QJHB 4Y7MA 4HQQL 4P3DA 4X4MA 3MUGA 4OLVH 1I1FB 4ZS6D 1IGIH 3BP5B 4OQTA 4OZFH 4NSKA 5E99L 5HYQA 1PSKL 3B2UC 4GAGL 3KLSA 4GH7B 5HI4D 3CMOL 2O5YL 1CFTA 3BP7A 3TT1L 1G9NC 1NLBL 3D3VE 4U6VH 3HRPA 4JY4A 1GSMA 2DQDH 3CH1B 3L7EB 4MD5B 3M07A 3CFCH 3QQ4B 3V4PH 3IJSA 4KH2A 3MRDA 3G5ZA 1YNLL 5GZOD 4XMLL 4GRLB 2QR0B 1OP3K 4OKVB 1EJOL 2GYSA 2RCSL 2FH6A 5DJ6A 3CDYA 3QDGA 5GS1A 5IVZA 3RBGA 2F74B 1S7XB 3ARDB 3ZTJG 4KROC 5C6TH 1S7TA 3QQ3B 3M45A 4MAUH 1UJ3B 3RKDC 4U1MA 1QBLL 4PJIA 5DEGB 2PUQT 3RWFB 1MHPL 2PTVA 5HGAA 5DK2A 3ZKMC 2FO4A 2YC1A 5LAXB 4WO4B 4OZIF 2P8LB 2PXYD 1DEEA 5D7SH 1IQWH 2EICA 4PGCB 3NH7H 1BJMA 5MENE 4ISVA 3D18B 3ULUC 5KSBB 4HX1B 3QZWB 1BD2B 4M61A 4Q9BA 1CIDA 2VERN 1J1OL 4NDMA 2C3HA 1M7DB 1D5BB 2DQTL 3E3QC 2NXZC 4LBEB 5CZXD 5LBSL 1L4IA 3RWEB 3I9GH 2VC2H 3FHAA 5E03A 3FT4A 4A6YA 4RX4D 3KPTA 5GGUB 4BKLB 3TYFB 4S1RL 4UUJB 5C9JA 4QRSB 2GCYA 3RNKB 4F3FB 5JA9A 2A73A 5AG9A 5K9QG 4LSDA 3L5JA 2QQKL 3GMMA 1ZTXL 5IW6A 3RKPA 2IAMA 5LVEA 4PY8J 4G6AC 2NY4C 1B0GB 5I1LB 1H3WM 4JHAH 1CF8H 1Q9KB 3RVVC 3V0VA 4OTXH 5F89B 3O6LH 5D1ZB 5J8OA 5FO9A 4XHJD 5GISL 4XNXH 1T1ZA 3V8CA 1FNGB 4P23B 3JUZA 4OGYL 2PKDA 4LCYB 4ZUWA 3D87B 5C09B 5FV2A 3O0RH 3VGAC 2V2TA 1N59A 3OR6A 3RRQA 5J3HD 5ILTL 2XA8L 1IE5A 2NZIA 4UTBH 2AJZB 3X17A 1J0JA 1O7SA 3O2VL 1G7MB 2WP3O 3PWPE 3LEYL 1FFPA 4OFDA 3UAJC 3SKMA 3MV7A 1NBVH 4E5XA 4PB9H 4EQ3A 4OLYL 3MLWH 3VDBA 1A9EB 5D70L 4G43B 4NOFA 2I9LA 1FFRA 1BQHB 2JKXA 2W0PA 3QEHA 1PX4A 3KJ4C 2XTJC 2V7NB 3ZKND 4PJCB 3LVEA 4XPTH 2IPUG 3WLWD 4XCYA 1YQVH 4DUWA 4HG4J 1NCCL 1UB6B 4BQBA 1AE6H 3BSZL 2J4WH 5HJ3A 2NY7H 4DW2H 2R4SL 5DC0A 5C07A 2B1HH 5JQ6H 1J5OL 3S36L 5E6IC 3S36X 4ZUSA 2EYRA 2VXVH 1ZHLA 4PRNB 4YE4H 5CBEA 3HRZA 5T3XE 3UYOD 4Z7VF 1D9KC 1B90A 3HS0A 2X4TA 4PJDE 5GRYA 5D93C 5DJYB 1EO8L 1BOYA 1U95A 4X6DE 4LSQL 2YN3A 4KRLB 4PGBB 2VR4A 3KYMA 1CGSL 4OZGF 5GIRA 1KCVL 2DQEL 4ZFOB 4HC1L 4Y0GA 3SDYH 2GJJA 2HRPH 4JB9L 3MRIB 4PRDB 4LSPH 4RAVA 4FQJH 4P2RD 2BX5A 5FGSA 2ICEA 4Y88A 2C26A 4JHZA 1MFBL 4R4BA 4KRMB 4PJXA 2X4RA 1PBYA 3OKMB 2FX9H 1CL7I 3DMMA 3KYKH 1IBGH 3WL9A 4PJ9A 2OR8A 5F1NA 5CMAB 3AREA 5E6ZA 5TPWH 3T0EE 2F5BH 2IANE 4W6YB 3S34L 3CZJA 4YHPB 4OCLC 4PPTA 3SE4C 2WUBH 4L1HA 4PR5A 3HAEB 1VEPA 2K1MA 3D0LB 1JPTL 1RULH 1DEDA 4KK5D 3FO2B 3WLBA 4DAGL 3FQUB 1OCWH 1HHHB 5DWUH 4MJ5A 5C9KA 4NKMB 1MNUL 1QBML 2AK4A 4HF5H 2IPTL 4PV9B 3F8UB 5A3IC 5JO5A 4P2OC 5MHSD 4NC1C 4QLRA 5GGRB 4XP1H 5J89A 1CDYA 1QPPA 5FKPA 1RZ7H 3QCTH 3UTOA 3SKJL 5HHMB 1E27A 2X40A 1FV1A 2Y9RT 1JWSB 5ADPL 4ZS7L 5HBBA 5L6YL 1IAII 1QVOA 2AK1L 4R26H 4ZTPH 5A2JH 3GSOA 3BKML 3HE6D 4LSUL 5KVGH 2B4CL 4UQ3B 1NDGB 4U6XB 5I76A 4ZUVB 5ENWA 4ERSH 3CDCA 5H35A 2YD4A 3I50L 1K6QH 1KFAL 1D5ZA 2APVA 2ZNWA 4XI5C 3CK0L 3GIZL 4RCAA 5DF0A 3IJYB 4UDUA 5MEQA 5IJKA 1KN2H 4DEPB 4XNZB 4YX2H 4RGOH 1LO2H 2VDNH 1O5DT 3H7LA 1A5FL 1GC1C 1X3DA 3VXNB 1M71A 1MI5E 1NFDA 5KANI 4XTRD 1U8OB 4K8RD 1W72A 1GL4B 1LO4H 1C5BL 2C1PB 1M05A 3CDGB 1VEOA 4GG6F 3W0WB 1MREH 5D7KE 4HWEH 2MNUA 4XBGB 2GJ6E 4QGTA 2OZ4H 3TBSA 5B8CC 3DUUA 1H3VA 2NY5H 4UIKL 5EPMB 3EYQD 1JHLL 2VDOH 3VE0B 4BSJA 5L7XL 3O6KL 5GZND 3ARWA 3HZMA 1BZ7A 1H0DA 4F7TA 2DQHH 2Z35A 3MZGB 1N0XL 2X42A 5E9DD 4M6MH 3QHFH 1VERA 4OI9A 1SJHA 2JB5L 2JJWA 1YMMD 2NY6B 1ORSA 5EU7E 5T3ZE 4Z77A 4PJDB 1MQKL 5J6HA 1A7PL 3I3BA 4X7SH 3FN0L 1ZAGA 3CDFA 1T6VN 5F7MC 3LB6C 1YEJH 5FIEA 1IM9D 2OQJA 1GZPB 1ZA6A 4D9RD 3BPCB 3EOBB 4X6EA 3TM6A 1F11A 4MVBD 4Q58C 4XVJL 2UYLA 1H3PL 4MXQD 1WBXA 4ZXBD 1ADQA 1TVHB 2XWJA 3QFDA 4ZYKB 4OM1L 5DD6A 4WFED 4NO0A 4LLMA 5GS0L 1WBZB 4F7PB 1UENA 3C60C 3GJEA 4YAQB 3ZT6A 1J8HE 3BVNB 5GSRA 1ZT4A 4KK6C 3MRHA 3SO5A 1TETH 1SVZA 1FAIH 4QHUB 35C8L 3F7RA 3N9GL 5I1EL 4N5EC 1B4JH 4XMKH 4QOKE 4FQIL 3HN3A 1P4IH 5D71H 4CNIB 3KS0H 2ZG3A 4QXUH 1QLRA 1S7WB 4LCCC 5IG7A 3ULUF 3AB0B 4OZGE 1IFHH 4HDIB 5J6GA 1MCHA 4LARH 1FGVL 1K3IA 5F7FA 2PNDA 3BDYH 1TMCB 1AKJA 1HSBB 1RK0A 5ESVA 1KTDA 1MHEB 1MCOH 2ATKB 2J8HA 1A9BA 4UIMB 2C1OB 3ULVE 4D2NA 3U7WL 3B6SB 4X98B 3C5SB 4OD2A 1NGZB 3CXDH 4P5MA 1A7NH 5D1XC 5TH2A 3LY6A 4UV4H 2ID5A 4FHBD 2E3VA 5DK3A 7FABL 1C16A 3BXNB 3N1FC 3NFSL 2IALB 5I15L 4WTWA 3ZE1F 1Q9OB 4H20L 4NQDE 4XPFL 4Y5YC 5DUMH 3PHOA 3RU8H 2ZSVA 1TVDA 1CFBA 1DQQB 5L2KB 3B8YA 2JJTC 4MS8C 4JFYA 5JW4Q 1OVZA 4JN1L 3RWHA 5E2VH 3OKDA 3SDCA 3OAUH 4Z7NF 3BN9C 3PWNA 1HYSC 2J8UF 5I18L 3L3JB 4X83A 4U1JB 5ICXB 4JQXC 5HDBF 5EU4B 4BJLA 5T3XL 2E7BA 2BC4B 1AO7E 4JKMA 2A9ML 4YGAB 1UWGH 3NCJL 4H5SB 3TJHC 1FYHB 3DGGB 3Q6GL 3VMOA 2MSPA 4EUPA 1K4CA 4CL7A 2ITDA 2PO6D 4OIIH 2V5TA 5C0IA 2NW3B 3IXTA 3PXJA 4ALAH 2NY5C 4XXDB 4PBVC 2VITB 3BDBA 4NJAH 3QA3B 4JGJA 4FQ2L 2EKJA 1TCMA 3ZE0E 1UWEH 4MJ4A 3QUYC 2NLJB 3ZDYF 1NMAL 1INQA 4RFOL 2DWEB 2Z31B 43CAB 4RIRA 1AJ7L 3HI5H 4ZFZB 3WFDH 3QJHA 4FFZL 5FGRA 5D5ME 3GSUB 1P2CB 2Y7QB 1CDHA 4TVSa 4ZO9A 1I1FA 3OR7B 1RZKC 2VDQL 4M6AA 4XWGH 2OR9L 2VXTH 3BP5A 1CLYH 1TJGH 5C2BL 1ZMYA 3WMSA 4XNQB 5HPMB 4M1CC 1KLGB 4IMLB 3ORJA 3GKZA 1A3QA 5DHYB 2B0SL 3QI9C 4P46B 3RJDA 4J4PC 3IDGB 3QPQC 5GGRY 3CH1A 3L7EA 1UA6L 4UB0H 2CIKB 3AMLA 4KHTL 4PGZA 4MD5A 1LD9B 4NQED 1BM3H 4JREB 4ZG1A 4APQB 2X1OA 4JPIA 4GRLA 2QR0A 4KTDH 4OKVA 3QH3B 3ZYOA 1KBGH 3MRCB 3QCVH 4ORGB 4TSCL 5AZ2L 2AJUL 4KMTL 3TN0B 4WWKC 2F74A 4WFHE 1S7XA 3ARDA 1FO0B 5F6HJ 4PRHD 1A4JA 3UBXG 5KBNC 3RWDB 2HKHH 4Y4FD 2EH8H 1UJ3A 4ZO8A 5AZEL 5DC4B 5C0AA 5DEGA 2V5SA 2PYEB 5H37G 3ARVA 3SY0A 2FIKA 3RWFA 2P49B 1QR4A 4DFIA 1FZMB 2J88H 2QSTA 3RTQB 1N3NA 4EIGB 4A2MA 2N56A 4PUBH 4IRSA 4WO4A 5LAXA 2ZSWA 4WVRA 2HFGL 2P8LA 4ETYA 4JFHD 3TFKC 1KENL 5IW3A 5B39B 4RDQG 1ZGLM 1GGBH 3T0BA 4GQ9L 3SDAB 1IT9L 4PGCA 1HQ4B 3D18A 5KSBA 4HX1A 1BD2A 5HDOA 5J11B 3QXTA 4BSVB 3O6ML 3JWOC 5DQDL 4YC2B 4U0RB 1D5BA 1RHFA 4LBEA 3GGWB 4HC1A 4GRWB 4JO1L 2R23B 3EO1B 4PRBA 2FSEB 3C8KB 1P7HL 4JM2D 2EYSB 4X9BA 1A6VL 3CFBB 5GGUA 4BKLA 4PJ5D 5CJOH 4UUJA 4UMGA 4QRSA 1R3HB 5C0CB 4HWUA 4FFVD 4R4NC 3RNKA 4F3FA 5HYJD 3NZHL 1GHFL 2WWKT 1UYWH 5EG6C 1FL5B 4BK5A 5T3ZL 4MNQD 4JHWL 2DM4A 5KJRL 1C5CL 3RX7A 2WUCH 4G7YL 4ZNCD 5I1LA 1FE8L 3BPLB 4MXWL 1BREA 2DM3A 2QEJA 4N8VB 3KXFE 1FNGA 4O2CB 4P23A 4YHOH 2DQUH 3UDWA 4LCYA 1T0MB 4M1GH 5C09A 1FGNH 1JTOA 4H1LB 2X6MA 4LIQL 4QGYA 4AIXA 2HMIC 3JWDH 4Z7NE 2J8UE 1O7VA 4K2UL 2AJZA 5CUSL 1IILE 5IKCA 3OKKB 3IB4A 4GXUN 1KXTB 3LD8B 2D03H 1G7MA 4EI6B 4IRJD 1W72H 1X5ZA 4HULB 1M6OB 4QHMA 1MRFH 3V6FB 4G43A 4HS6B 1CTNA 4G6KL 4BK4A 1FO0L 3VW3H 1OAQH 3IJHB 5C0EB 1JK8B 1LO5B 4OFYA 5T5FL 4UV7L 2V7NA 3FN9A 2HN7B 1LEGB 4GAFB 4PJCA 4HXAH 1PQZB 2AKRB 4GUPB 1D5MB 2DD8L 4R7DB 4AEIL 1UB6A 3ULVL 1MCSA 1X4ZA 1N6UA 5KANG 4G3YL 4MAYC 2YD8A 1CXFA 4PRNA 2D7TL 2ENYA 3VFSB 3NA9H 5I1IH 2ARJQ 3LMJH 3KYNB 4BQ8A 2O26U 5DJYA 4WFFD 4UU9B 5KZCD 1HNFA 4PGBA 4CVZB 1P5UA 2NY2B 1YY9C 4YK4B 2OK0H 3ESUF 3NGBC 2HWZH 5JR1L 5L2JB 4HKBB 1V7NH 4X8JA 3UPCA 2P5ED 4JFFB 2BRQA 4ZOAA 3MRIA 2ZOKB 4PRDA 4L4TB 4MHHI 3BUYB 4NNYA 1K8DB 2R0KH 4HT1H 2EE6A 3NPZB 1DN0A 3KPNA 3MV8D 5J12C 2Y5TB 3RIAF 3BOVA 3VXSB 4R90L 4HAFA 3ULSB 4PY8I 2E9JA 2NYYD 3OKMA 5MENA 5SWZB 4Z0XB 5IQ9B 3KLHC 4HQQH 1P9MA 1OP5K 1QOKA 2KQMA 3RHWF 1CU4H 4MDJB 4LOUC 5CMAA 1NGXB 1S7VB 3FQTB 2MMXA 4XAWH 5AD0A 4K9EH 4WHTB 3H42L 3M8OL 2QQNL 5J06A 5DVLA 4F58L 3D0LA 3HAEA 3TBVA 1FDLL 2HRLA 3FO2A 3K8LA 5LGJB 1BJ1H 3V6OE 4IDJL 3FQUA 1B2WL 3WNLA 1FL3B 1HHHA 1IGTB 3B83A 4HUNB 5J56B 2YEZB 4TULH 4NKMA 2UWEF 1CGYA 5HGDA 3MFGB 4R2GD 4RFNB 4PBWD 4L29B 3FZUC 4P9HC 4PV9A 3NACL 5JXEC 1J1PL 4KQ3L 4LLYB 2CLRB 1BBDH 3QWOB 3QIBB 5I6XC 1JIBA 1KPVB 2H2PC 5DZLA 5I8EB 1A6UL 1JWSA 1RURH 2WWMC 2Z91B 4V1DB 5D2NE 4EVNB 3HI6H 4UQ3A 1NDGA 3MOQA 4NN6B 4U6XA 4LLUB 4PGDA 2X9XA 4MJIE 3RHWK 2AQ1A 2JELL 2FLBT 3PIQB 5LQBL 5GXBB 2Y5EA 4PB0L 3VXNA 2AXFB 4AT6A 4Q6YA 4DOHE 5EA0H 1U8OA 2GW5A 5J9PB 1T89A 4J7RA 2G75B 5GGQH 3RL1B 4EUPH 2C1PA 3CDGA 1J1OH 1MCJA 1G9MC 1LVEA 3MR9B 4ZODA 3W0WA 2EDJA 4NUJB 1AXTL 5LBSH 4UT7H 1VDGA 4XBGA 3VRLF 2VDPL 2YSSB 5EPMA 2PCPB 3LS5L 3BT2L 3VE0A 1INDH 4HLJA 2JTDA 5HHOD 1CT8B 4S1RH 3VFWA 1I7TB 5MHSE 3DVNB 1XIWC 3C6LD 1UJTA 4EN3C 1OW0A 4NBYB 3U7YL 4UAOC 1JE6A 1ZTXH 5E1HB 4P4RB 3ZDZF 2HG5B 4PJDA 1IGML 5E94B 1ULVA 5F71A 3RQ3A 5KVMC 3IDNB 3Q5OA 1RZFH 2YA1A 3RGVC 3TZVC 6FABL 1EEZB 1K4DB 5GISH 3UCRA 1EFXD 1VCAA 4KXZH 4L9DA 2V17H 3WCYA 1GZPA 1FH5H 3BPCA 4PTTA 3TO4D 4JFZL 3BH9A 4LMQI 1AGCB 3E8UH 2F8OA 3CLEL 4U1NB 4ZYKA 2BP3A 3H6JA 5ILTH 2Q86B 5ECJE 1PG7L 1WBZA 2A6JB 4F7PA 3DSNA 3ARSA 3QNYB 3I75B 4YAQA 1BVZA 3O2VH 5DHVB 2B8OT 2FEEL 4DFHA 3LEYH 5J1TC 4G6JH 5DUBB 4QHUA 3EYFB 2GSIB 1R5VB 4G9FD 3CPLB 2VXUL 4OLYH 4K3JL 4N9OB 2BNUB 4CNIA 3QG7H 4K9EC 3W11C 5AEAA 3MLXL 2XA3A 4L5FL 3NBNA 4HDIA 1AGFB 3CC5B 3O6FC 5FHAH 4DK3A 1U3JA 3H3KA 1HSBA 2EE9A 1MHEA 4UIMA 2C1OA 1NAKL 3B6SA 4RGNE 4X98A 2CIIB 3C5SA 4LRIC 1NGZA 4R6UA 4N0CD 2VJXA 4OKDA 5F97E 1FPTL 4LHQB 4MB3A 2Q76B 3BXNA 4P5TB 4DQOH 1UFUA 2IALA 3KPSB 2AV7B 1Q9OA 4TOYH 1R6VA 3WS3B 1NCBL 4AYFA 1S9XB 2DQEH 4Y1AE 4D9RE 1WWCA 2PTUA 5F96L 4JB9H 5I1AB 1DQQA 5L2KA 5B21A 1RZIB 3OL2A 2V7HB 4P2RB 4D0BB 4JO3L 4TVPH 2AJVH 3SBWA 1QYGL 1X5YA 4J1UB 1TNNA 3L3JA 1KJVA 4U1JA 3R8QA 4M00A 5ICXA 2IG2H 5EU4A 3QXAB 2XFXB 4PJAE 2BC4A 4LCWD 3AVEA 4PJ7F 5L9DH 4OT1H 2EXWC 5C92A 5DYOB 4WI8A 3DGGA 1CD8A 3D2UD 4O51B 2BXZA 2UZIL 3DOSA 5I2IB 4OCYL 3S34H 2P5WB 2NW3A 2X1QA 1RZJC 1NSNL 1JGLL 1TZIB 4NGHL 2GJ6A 3RDTC 3PWLB 1N2RB 3SGKC 4G8GD 4XXDA 1EO7A 1OTUC 5C71A 3B9KC 3QA3A 2GQHA 2GFBB 1KCLA 4LGRB 2CO6B 3MJ9A 4NWUL 3SE9H 3TJEL 1RU9L 3SKNB 3CD4A 1ZHNA 3L3KB 2NLJA 1MLBB 4XMPH 2DWEA 2Z31A 43CAA 3R0NA 5A43C 3GK8H 1GIGL 1QG3A 2KUTA 4ZFZA 2ZUQB 1NFKA 4HKZB 4L3AA 1RUML 1RMFL 1P2CA 4GO6B 4O9HL 3OR7A 5ADPH 4YBQD 3HE6B 4AJ0A 5KSAD 3X11B 3UTSB 3CXHK 3O3DB 2RJMA 4OIAA 4WU5B 3OXRB 2A6DB 1NMCC 4XNQA 3W9EA 3PG2A 2IQAB 4Z7WE 1KLGA 3BRFA 4IMLA 3MRPB 4K3DL 4ODTL 4P46A 5DHYA 3IDGA 4QRRD 1BLNB 4S1DC 3V5DB 2Q3ZA 5FYLH 5DVMA 4PJGF 1LD9A 1A5FH 4JRXD 2CDFA 1KYOJ 5ADOL 1F90H 4NWTH 3HLAB 1DSFH 4A2LA 2VLMD 3QH3A 2Y06H 2WP3T 3CMGA 3B3IB 3MRCA 4CADB 4Z7UE 3B2UD 3F7PC 4ELKB 3ZHLA 4ORGA 3ZHDA 1ZLWH 43C9B 3QQNA 1WIPA 1NEZB 4X6CB 3TN0A 3MRGB 5HHVH 1FO0A 3SE8L 4HFUL 1AR1C 3UP1A 1S3KL 4P9ML 4UIKH 5D6DA 1I1AC 4L3EB 3O6KH 1FZMA 5FV1L 1TITA 3RTQA 5K9OA 3TA3B 4XP6H 4GKOA 5E9DB 5T1KD 5C86A 3VXUD 2DDQL 4OZHF 1VGKB 1BECA 3T1FB 1YMMB 5B39A 3H3BC 3P9LB 4LCUB 2JB5H 3MRKB 2VAAA 3SDAA 2DLTA 1HQ4A 4DGVL 1MQKH 3BKCL 4IOFC 4F9PC 3G5XA 5JW5B 4TUJB 4BSVA 2YRLA 4HK3J 1XGUB 5DDHB 1I9RL 1C08B 1I9JH 3DI2B 2FBJL 4MHHG 3HAEH 3GGWA 2PW1B 3ZKMD 1NC2A 3SDDB 1ZLSL 2J7LA 1BWWA 2FSEA 4YHLH 2EYSA 3NCYP 3H9SD 4M62L 3CZFA 2EH7H 2AI0H 3OMZA 3CFBA 3OKLB 4F37F 1T0PB 4NQEE 4Y5XA 5C0CA 5I73B 2DTSA 1AQKL 1A7OH 4U1SB 2FLRT 1FL5A 4KJQC 1Q0XL 2CD0A 3S37X 5E8NB 4HK3N 4TNVF 5B3NA 4JPKL 5J1AB 2BRRH 3R1GL 5I1EH 3PWUA 4NN7C 2NXZD 2KZWA 4FQIH 4PRHE 3JV5A 5BQ7B 1RY7B 4FXLA 3RZCA 4N8VA 5D7LB 3VD7A 3IU4L 1UWXH 3RA7H 4O2CA 4QXTA 4KZEH 4KVNL 4IOIB 1T0MA 1UM5H 4H1LA 4JFHE 2R56L 1C1EL 1WCQA 3T3ME 2W9DH 2XQBH 2LE9A 5I17B 4BQ9A 5BVJB 4G6AD 3MCLL 1Q72H 2NY4D 5D1QC 2PF6A 3OKKA 4K8RL 5EORL 4HKXB 3WO4C 4FOMA 4PP1D 4CW1B 1M6OA 2BVYA 5EO1B 5F6HI 5HVHC 3G5YB 3V6FA 1QFHA 4HS6A 4HGWB 4OCWH 4XPFH 4Z76B 4F37K 2UVEA 1EMTH 3MBEC 5GGTL 2X2YA 2ZWLT 4NPYA 1MF2L 3WN5C 5C0EA 1JK8A 1WFNA 4WNQB 3FMGH 2HN7A 1LEGA 4I0PC 4PJ5E 4RMQA 3BKYL 1PQZA 2AKRA 4GUPA 3F12A 4JN1H 4TNVK 1MJUH 2HTLD 5I18H 1R5WB 5HYJE 2OMBA 4O02H 5F1SA 4JRYD 3UAJD 1KJ2B 1NGQH 4NBXB 3QEQE 4LP5A 1MPAL 3B2VL 3VFSA 3G6JF 5IEHB 1KCUH 5HVWA 3ARBD 3KYNA 3W5MA 2AAVA 1FNSH 2IPKB 3DYOA 3REVB 4UU9A 1DQDL 1TCRB 1CGXA 3L3DB 5EOQL 4KPHH 4CVZA 1DBKH 1FFQA 1SJVA 3DJ9A 1V3MA 2KZ1B 3I2CH 1QNZH 4JFFA 4MA8L 3L7FB 3P73B 1Q1JH 4NC0B 4L4TA 1CLZL 3IT8D 3WJJA 1N7ML 4EIZC 3CFEB 3BUYA 3D25B 5E6ID 1K8DA 2CDGA 1FFNB 4LP4A 3MLTB 1EO5A 4NKIL 5C3TA 2Y5TA 5SWSD 4RFOH 2I25N 3I84A 3VXSA 3ULSA 3RPIB 3QISA 5I1GL 5SWZA 4Z0XA 5T1DH 5IQ9A 4TRPL 1KSRA 3HB3C 3RY6A 4ELME 4MDJA 5E5RB 2LABA 1NGXA 1S7VA 2OR9H 3FQTA 4IHOA 2EZ0C 1YN6A 3VXPA 1YJDC 2QL1A 1JTPA 4C55A 3HG1B 1TZGH 1M4KA 4PS4L 4WHTA 4ODSH 2Y07H 3LCYA 4ZAKB 5DQJA 1T5WB 5LGJA 1K2DA 2HKFH 4LPCA 1FL3A 1IGTA 5E95B 4KKLD 2YEZA 2Y6SD 3IS1X 2OX5A 2W91A 5DMGC 1IGYB 1BAFL 3QSKB 4L29A 2ICWB 5FF6A 2H41A 3VXRD 2NX5D 5L8JB 4NQSB 4HK0B 4YHYB 4LLYA 4Y5VB 2CLRA 3QWOA 4KMQA 4DGIL 1KPVA 5IF0B 3SDXF 5I8EA 3EO0B 1TJIL 4Y4FB 2Z91A 4EVNA 3QDAA 3CFKB 1HH9B 2WBJD 4DKFL 2CRIA 1ZLVH 5A3ID 3SQOH 3ROOB 3ILPA 4P2OD 1UKQA 4TTGA 1QPXA 2WZPD 1XFPA 3PIQA 1VA9A 1QFWM 5FA3B 5HD8D 2AXFA 3VWKC 3FTGB 4M43L 2JJVA 4BH8B 3DV4B 4LSSH 3HMWL 2UVFA 5J9PA 2ZUUA 2ZUSA 2G75A 3VFVB 1DQJA 3RL1A 4KMLB 3V5KB 2EXYC 3IETB 4XI5D 3MR9A 4F33B 4NUJA 4JM2B 5IFHH 1U6AL 4RX4A 1IEBB 4LLDB 2YSSA 4NHCL 1DBBL 2PCPA 2MFNA 4G6ML 3WHE1 2QQLL 1CT8A 3MJ9H 5HYJB 2CPCA 1RFDL 3TVMD 1CS6A 1SEQH 4MNQB 1AHWC 2BOCB 5IM7B 5T1MB 4P4RA 2HG5A 3HE7C 2DKMA 4LL9A 5E2JA 3SKUD 3NAAH 3RIFF 3ARFD 5IIEB 4B53A 1EJ6A 3IDNA 3QAZC 2NZ9C 5FK9B 3L5WB 1DE4B 3FFCD 1EEZA 1K4DA 1QRND 2K3TA 5DUPL 4ZTOL 4KZDH 4DZ8A 3T08A 4PIRF 3AU1B 3D39E 3ELAT 1AGCA 5D4QA 4HIXH 1CR9L 2Q86A 5KSVB 3FL7A 2A6JA 1J88A 3QNYA 3MQIA 5CUSH 4IRJB 5GPRA 1IGFL 4WTXA 1G7QB 5DHVA 2XG5A 3GSRB 5CJ8A 4FQPA 4NKQB 4HUVB 3T04D 2LAAA 5F9OL 5F7UA 2EDDA 4K3HA 5KAQG 2GSIA 3QUZD 1R5VA 1JRHH 1OAUL 3CPLA 3LB6D 2BNUA 4CMMA 1DFBH 3P11L 1FO0H 5FGBC 2IGFL 4EI5D 3DSFL 3KLAA 2AXHA 1H8SA 4OZFG 5CSZB 4M48H 3TESA 1AGFA 3CC5A 3CVIH 5HHOE 4FFYH 1HHIB 3C60D 1A22B 3WD5L 2CIIA 3RIFK 2BSTB 4U1GB 3P9MB 1WZLA 4RWHA 1RI8A 5C1MB 1WAAE 5DD0L 4N5ED 1ZV5A 4DUXA 5E00B 2Q76A 4KKCC 1V3LA 4P5TA 1Y6KR 3G6DL 1I85A 4ZFGH 5TE4L 4KJPC 3LIZH 2FRGP 2AV7A 5I19H 3WS3A 4I3SL 4B7LA 2P5EB 1S9XA 3IDUA 4PTUA 4DVBB 5BS0B 1N64H 4GRWH 1JNNL 4PREB 5I1AA 1RZIA 2V7HA 2W59A 1L9NA 4P2RA 1JNHB 1XGRB 5I8OH 4IIQB 3MV8B 4D0BA 1VPOL 4JHBA 5D1XD 5I8CA 1N4XL 1JPSL 2NY1B 4J1UA 5DRWA 1QEWB 1RVFL 4M6NL 3WXVH 3QXAA 1EHLH 2XFXA 1YC7A 4LLAA 1QKZH 3TC9A 3GHEH 5ISZD 5F7YC 2F8VA 5EULV 4KI5C 4O51A 1NBZA 5LCVH 1CK0L 3KHOA 5I2IA 2P5WA 2V5YA 5HHQB 5ITBH 1ZA3B 5IGXH 5DJAB 1CDBA 3PWLA 4JM4L 3BN9D 3FHQA 2BNRE 3KR3H 1U8LB 2ADFL 2YKLL 4IDJH 1F5WA 2J8OA 2GFBA 3BIAX 1CIUA 3BKJH 3GSWB 4R2GB 4EDWH 4H1LH 5CZKA 3V0WL 5K9KB 4LQ1A 1IC5L 3CVHB 3SKNA 4YR6B 3OXSB 3L3KA 1MLBA 4M8VA 3IF1B 1L6ZA 1RUQH 2YD3A 1J1PH 3DLQR 5CINH 4KQ3H 4FQHA 2WSKA 4OZIB 4HKZA 3LKQB 1YNKH 4U31A 2F15A 1UZ6F 2H3NB 2GEEA 1L6XA 3HE6A 4U6TA 4KK9D 4M7LH 4LPTA 3X11A 1U8MB 1U58A 3UTSA 3O3DA 4WU7B 4WU5A 4K94H 5F9JB 3MUY1 3MXVL 5E1AA 4FABL 1B88A 3MRPA 3O4OC 4X7TA 4WJ5A 3WIFB 3FCTB 1BLNA 4NNXB 4ZUTA 4DKEH 3V5DA 4QHKJ 2DQGL 4PB0H 4LCWE 4Z78B 5M7QA 2GI7A 1DBAH 3HLAA 3HC0B 4KKAD 2J6EL 4JRWA 3VXME 4NFCA 3B3IA 2F53D 3WKML 2E7MA 1A6TA 2I27N 43C9A 4X6CA 1KXVC 1NEZA 3MRGA 4U7SA 4M1CD 3IFOB 1X7QB 4PGEB 5GGTA 1AXTH 1BEYL 1T80A 3QI9D 3RVWD 3V52L 1A6WH 4J4PD 1KCRL 5IV2A 5K93A 4WTZA 5TE6L 1JHKL 3LS5H 4I2XB 4UT9L 2X4PB 4L3EA 4S11A 4FQCH 3TA3A 4L8SB 1UM6L 5E9DA 3U7AA 1KELL 4OGAC 5FHBH 3DUHA 1VGKA 2YPLE 3UBXA 3T1FA 1YMMA 1INEL 5JA8B 1TPXC 3P9LA 4LCUA 1M7XA 3MRKA 4WWKD 1FLRL 3Q5YA 2V9TA 2BXYA 5JW5A 4TUJA 2ERJB 1MJ7L 3U0WL 1XGUA 4NQCD 3G6AB 4FTVE 1JYWA 1CFVL 1EFXB 1S78C 3LDBC 5DDHA 1C08A 3TO4B 3QIUB 4PJHB 4PRPE 4HUXB 2PW1A 3WXWL 5EBWB 4ZXBA 3SDDA 3E0GA 5GGSB 3TFKD 4K23H 3W9DB 2X9WA 2HVJB 2IFGA 3OKLA 3EDDA 4YPGA 4JRXE 4I18C 3ZL4L 3SE3A 1P84J 5GJSL 5D96C 2DLHA 2DQJH 3A0OA 3EDKA 4U1SA 1GGTA 4JQVA 2PTTA 1JGEB 2APWA 4PJAA 1QBBA 3L3IB 4G9FB 5E8NA 1J86A 4F8QA 1YEGH 3SEPA 5J1AA 4X9FA 3BE1H 4K3JH 3RJQB 3MV9D 4ONGL 4TSBH 5E8PB 5BQ7A 4Z7VB 1IAKA 1PKQB 5GS1C 2FX8H 5D7LA 2IBGA 3EYOB 1F4HA 5KVFH 4N0FA 4P3CH 1LEKB 4GXVL 1F4XH 3WIHL 3O4LD 1QFWH 3BQUD 4IOIA 4YXKH 5E08H 3G08B 1NAKH 4ONFL 4JY6B 5EOCH 3QYCA 5I17A 5BVJA 1MAJA 2FL5B 4MA7L 3FJTA 4NUGL 4HKXA 4PJBE 1I9IH 4ORZC 4CW1A 1IM3B 5EO1A 2Z9TA 5LXGH 2CRYA 4HGWA 4Z76A 3ZO0A 2A0LD 2BFVH 5CJQL 2DQFB 4Z7WA 4WNQA 2HMID 1IGCH 4IS6B 1VKXA 2YD7A 1ZANH 5INDB 4LFHD 4F2MB 2EECA 2YXFA 2X4OB 2NXYC 1A6AA 1R5WA 5KG9B 4JKLA 2MTPA 2I9TB 1MFAL 4WUKL 1KJ2A 1NUFA 4XVSL 1FCCA 5AYQA 4I3GA 5IEHA 1ETZB 3D2UB 2EEAA 2IPKA 4XCEB 5FDWB 3REVA 2VLJD 3LQZA 3VA2C 2VLKD 1TCRA 3L3DA 2P8MB 3DIFB 4G8GB 1JGLH 4NGHH 2EYTB 4OFKA 5C0RL 3D85D 5C07D 5CJ5A 5DD1L 3LQAC 3L7FA 1B0WA 3P73A 4MAYD 3CFEA 5D7JB 3D25A 5HY9B 3C2SA 1FFNA 1HDMB 3MLTA 3BMVA 1RU9H 2XOTA 2PN5A 1QSEB 3L1OH 4C83B 2OM5A 1WIUA 4U05A 5F7WC 2O5ZL 5F1OB 3W5NA 1R5IB 3RPIA 1FBIL 2Z93B 3QUML 1OAYH 3TEUA 2W0KA 3AS0A 5T33L 3HZYA 4KWUA 3G9VA 4LVOC 1QD0A 3GSNB 1F58H 3ILQC 3WDHA 3VU2A 4M7ZB 3IAGC 3WE6B 4QRRB 1OD9A 4ODTH 4GG6B 1TFHA 2Q8BL 3UO1H 4KVCL 4N8CL 3VRIA 4JRXB 1A1MB 3QPXL 4JRYE 1IGYA 3KLHD 3S4SB 2ICWA 3TNMB 4K3EL 4NQSA 4LOUD 1J1XH 4HK0A 3L3HB 3TIDB 3EW3B 4MA3B 2HT2C 1T1XB 1MFEH 1ONQB 2JB6B 2XT1B 4K7FA 4W4OA 1CFSB 3FFDA 4PRHA 1NCDH 5BOZG 3SE8H 4Y4FA 3NTCH 2BJMH 2JJUA 2AK4D 1HH9A 2HLFC 1KIQB 4TQEL 1Z0MA 4KI5F 4MZ3A 4HIEB 3DXAD 3PWJB 4QWWD 5T1KB 2VDML 3ZDXF 3VXUB 3ROOA 1T66C 4XC1L 5JXED 5F6IB 3IXAB 4U2YA 2JCCB 5EOTB 3C8HA 1OD7A 3NCEB 4G5ZL 1XH3B 2CK2A 4MLSA 5EZIL 5FA3A 3GFUA 3FTGA 4BH8A 3NVQA 4KROB 3DV4A 2MWCA 4I1NB 3BKCH 3FT2B 3VFVA 3REWB 2ZUWA 3V5KA 4N5UA 5HI3C 3DMMC 5TDOB 3IETA 2BHYA 4L9LC 1A64A 1I9RH 4X80L 1QA9B 2ARJB 2FBJH 3BJ91 4S2SB 3I6GB 4JM2A 3VFRB 1H8NA 3H9SB 5BRZB 3FQXB 3I6LD 1IEBA 1XGYL 4KTEH 4LLDA 4PRAA 4PJ5A 2DIBA 4FNLL 3HNTH 2XZZA 1HH6B 4D9QE 5HYJA 4RISL 5GGVL 4JPVH 2XWBB 1H3UA 1T2QL 4E41E 1KJ3L 3VXRE 1A3RL 2YD1A 4QXGH 4MNQA 4CMHC 2GHWB 2RFXB 1Q0XH 1DN2A 3LRGA 1XF1A 2BOCA 5T1MA 1XGQB 3S37H 5IM7A 1CE1L 1CGTA 2NXZB 1OARL 1JVKA 1I3RB 3UTPE 5IIEA 5FK9A 4R7NB 1F4WL 5GGSY 3L5WA 1DE4A 3EFDL 4LHUD 1YEHL 1A1OB 1MWAL 1ZS8B 3MFFB 3QRGL 3OAZK 2DJUA 3P0YL 4KGLA 3MMEB 4ZOBA 1XIWD 1KLFA 1X5XA 2ZCLL 3P0VL 4UNVA 3H3PL 5MI0C 2M26A 4XX1G 3FOLB 1BQLH 4OCXL 4BZYA 2NY4B 5KSVA 4YHML 5IJKC 3GBLA 3NABL 2BNQD 4JAMB 3RBSA 1EHNA 4RQQB 4IRJA 3GJFB 4K8RH 5DI8B 1G7QA 1VEMA 2HJLB 3GSRA 4CKVX 5MERB 1BMGA 3DBXB 4HUVA 4XXCC 3RGVD 5E8DH 3TZVD 4ELMA 5BV7L 3R06B 5GRJH 1GAFH 4JANB 4S0SD 2FDBP 1G9NL 4M5YH 1IKNC 2R0ZL 1MF2H 1FNLA 5CSZA 1TJHL 3PUCA 4EDXB 1AR2A 2VZOA 3VG0L 4QRUB 3PDOB 1LE5B 1XCTB 4F57L 3MODL 4C4KO 1X6NA 1SJEA 3L9RB 1VHPA 2BSTA 4W4NA 3P9MA 5SV4A 2J6EA 4GMTL 3S88L 5E00A 5H94B 4I0KA 5DT1H 5IB4B 1DUZB 2CSPA 2XTJB 1DQDH 5D7IE 4FQ1L 4S1QL 1YYML 2P5EA 3TT3L 3KNBB 3OB8A 4DVBA 5FECB 1DZBA 4WDIB 5BS0A 4L8DB 2R9HC 4JG1L 1L7TH 5EU6D 4K7PL 4K7PX 5E6IB 2QSCL 4B41A 5FO8B 1KNOB 5GJTL 5FFLA 1N7MH 4LPVA 1JNHA 1XGRA 2G5BB 3HFMH 3MV8A 4IIQA 1D9KB 5SWSB 4FMKA 5I74C 5D72L 5KS9F 4OBSA 5D93B 5FXCH 3VFGL 1QEWA 4W81A 1WBYB 1T0NB 1ZOXA 5F8RC 5CKAA 4PJIF 4O4YH 1BGXL 5GHWL 3WO3B 3NCYS 3OKOB 3GSQB 1FN4B 1EBPA 3WHXB 3V5HB 3U4EB 3MRBB 1P1ZB 1UADC 2X7LB 2X4QB 1EK3A 3WFEH 1Z3GH 4X5WA 5JHDE 1U8LA 5ICZB 3FKUS 1YN7B 2Q6WB 3GSWA 5K9KA 4UINH 4PFEA 3ZDXE 2NX5B 3EJJX 4YR6A 4TSAH 3OXSA 1FRGH 4BFGA 3IF1A 4CVWA 2EXWD 3C87A 1AP2B 4G42B 3MLUH 1D3CA 4S1SL 1WFTA 3LKQA 5JW3H 3LPWA 5EBMB 3V7AG 5EZJA 2H3NA 4Y4KD 4CN1A 2FX7H 4JZNB 4WCYL 1NCNA 2ADJB 4NM4L 1AIFB 1G84A 3WIHA 1HE7A 3H9ZA 4DKFH 4P2OB 3IFNH 2HTKD 5F1IA 2CGRL 1JV5B 3WIFA 3FCTA 4Y19E 4NNXA 1KG0B 1IZJA 2ZUYA 3DYPA 4OLVL 3MV11 1T3FB 5IWLC 1KJ2H 1JGDB 4RBPH 4Z78A 4OM0H 3OWEA 5D8JH 1F4AA 3HC0A 2A9NL 1IQDB 3O8XC 5ID0B 5E7BA 4LEXH 4F15B 1YEKH 4PP2B 3EYVA 1MEXH 1PDKA 4YHIB 1FYTE 1RUPL 2CK0H 3IFOA 2DQDL 1X7QA 3DROB 4PGEA 2C3GA 3M17B 3CH8A 3V4PL 2I07B 1OQOA 1DBBH 5HHOA 5JPMB 4G6MH 5EO0B 5EU5B 2HP4A 1OGAD 4YQXL 1A7QH 5HI5D 5EH1A 4L8SA 5JUEH 3UJTL 1ZLUH 1Y6NR 3IYLW 2VYRE 1X5FA 3U46B 5C6TL 2PW2B 4LVHC 1HXMA 4MAUL 4PJ8C 5CCKH 3C09C 2DF3A 4X5XB 5B8CB 1TZHB 3FFCB 2APFA 2XY1A 1QRNB 3GMQA 4K7PY 1EFXA 3F7VB 5T1LB 2WW8A 5FOBB 1I1AD 5DEFB 2A1WH 3PGCB 3TO4A 5D7SL 4PJHA 3LKOB 2EDNA 4HUXA 1IQWL 4OV5B 1OTTC 5EBWA 5TJWK 1WZ1H 5IVXF 3BZEB 3MLVH 5GGSA 3BRDA 1MJ8H 3NH7L 3W9DA 3DURB 4QT5A 2X4NB 3V4UH 2HVJA 1QR1B 5DD3L 2L7JA 4Z7QF 1CR9H 5CSBA 1G7HB 4XPHH 3IRZA 4M6OH 5LG1A 1BD2D 2R4RH 3QXVA 5IMKA 1S9YA 3BAEH 2AABL 4Z18A 2UY7A 1JGEA 1GOHA 1OWRM 3WNMA 3L3IA 4ONOA 4AY0A 4XPAH 2F53E 4G9FA 3QUMA 1I8IB 3I9GL 2DLFH 2VC2L 1EIBA 1KACB 4L4JA 5E8PA 4NRXA 4Z7VA 1PKQA 2GITB 3WJLA 3OHXB 4JFOB 3EYOA 4PJXF 4TVPD 5ERWB 5A1AA 1LEKA 4P2QD 1E4XH 5CGYC 3C60B 2W60B 2JLLA 5HDLA 1BF2A 2AEIT 4JFPB 1KN4H 4QHKI 3HUJE 3OJ2C 4LKCB 2GTZB 3JUYA 3QXUA 3G08A 3ME0A 4BZ2L 4KJQD 1JGVH 1FZOB 4JY6A 1CF8L 3QDGE 4EEEA 2EO1A 2Z8RA 4IRSC 4OTXL 5DD0H 5BXFB 5DA4A 4LCCB 3OV6A 3IDXH 4F8TA 5D1ZD 2Q7YB 1IM3A 4PJIE 4X4XB 5CIPA 4S0TD 3O0RL 3FO0H 5C09D 3FQWB 1JNNH 1UM4L 2EDKA 2KQNA 3EYSL 4PD4J 1DANT 3ZKQD 5L0QC 1RIHL 2WAHA 5D1XB 4YEEA 1AFVH 1QO3B 1GC1L 3K46A 4IS6A 4LPUA 5INDA 3PP3H 4F2MA 2X4OA 4HV8B 1N4XH 3AY4A 4JFED 1I3VA 1NBVL 4PB9L 3MLWL 4XVTH 2I9TA 4OQ1A 4Y5YB 5ISZB 3VFOB 4OD1H 2UWEB 1ETZA 3D2UA 3GBNL 2VUOA 5FYKE 3MBED 2YWZA 4MJ2A 4XCEA 5FDWA 4XPTL 4M93C 1MFCL 4OFIA 1AE6L 5BCAA 2P4AB 3OGOE 4EUPG 2P8MA 3DIFA 4I0PD 4DW2L 4G8GA 1NMBH 2EYTA 2B1HL 5JQ6L 5MEPB 5FYLD 4YH6A 1WT5C 2V2WA 2VXVL 1JPGA 5D7JA 2EDRA 4HUUB 5DLMH 5GRVL 1U8PA 2OJEB 4C83A 3P9WB 4Y16C 2Z4QB 3SO3C 3STBA 2XN9B 2YPKB 2Z93A 4WI3A 2KKQA 3SDYL 4UT6H 2HRPL 1JHTB 5DJDB 3P4LA 3MOBH 5CJBA 1JNLH 3AFLA 4LSPL 3ARUA 4CRPA 3RVXC 4OLEA 4FQJL 4IMKA 3E2HC 2JIXD 2D0FA 3OZ9L 4OF6A 4S10A 3QUYB 4D0CB 3WE6A 1X5HA 2B4CC 1NUNB 5JORB 4QRRA 5CILH 2FX9L 4GG6A 1XGPA 4JRXA 3KYKL 1FL6B 5IMOB 1A1MA 1IBGL 5M94B 2APBA 3MV7E 3AS2A 2F58H 1N5AB 2E7CA 3S4SA 3ARZA 3N85H 4D8PB 5TPWL 3TNMA 4O58L 1UH4A 2F5BL 5B3JF 3X3GH 3L3HA 3TIDA 2WUBL 2EZ0D 1T7WA 4MA3A 4WEBL 1XF2B 1RULL 1T1XA 1ONQA 4H8WH 3S5LB 1PG7W 3A67L 3WKMH 2JB6A 2VLKE 3O9WC 1CFSA 1OCWL 4NZUH 3QI9B 5DWUL 5I1HH 1BVLB 5EBGA 4KK8D 4ZPVB 4HF5L 1KCRH 5C07E 3BEWA 4WUUD 5TE6H 1CXLA 3EJYC 1JZ8A 3RVTC 5CJXC 1KIQA 4XP1L 4HIEA 3TBYA 5T1KA 1RZ7L 3QCTL 1BVKB 3VXUA 5E2WH 1MIEL 2VXSH 1KELH 3IXAA 5IBUB 5HHMD 2JCCA 5EUOF 5EOTA 1MCWW 1Y6MR 4WWKB 5F88B 4R26L 1XH3A 3B9AA 2VH5H 4PJBA 5E5MB 5ITFB 4ERSL 3FT2A 4NQCB 5ALCH 2Y25A 3REWA 2QTEA 3ROLB 4V2BA 1KPUA 1ZHKB 5TDOA 3QZWG 3E1F1 5I75C 2YPVH 1QA9A 1YEEH 4NZJA 4YX2L 2ARJA 5HHXH 4RGOL 3FONB 3BDXA 4S2SA 3I6GA 1LO2L 2VDNL 3UPRB 32C2B 3VFRA 4U2ZA 3H9SA 3FQXA 2AXGB 4PJXE 1MVUB 4NIKB 4GAJH 4U49A 3C5JA 2P46B 4CJ1A 1RHHA 3LN5B 3WFHB 3A6CH 5F21B 1HH6A 1MCPH 2VNCA 3QDJB 2XWBA 3CVHH 1LO4L 3U2SB 3QHZL 3UC0L 3BWAB 5GS0C 4M4RA 2EXYD 4HWEL 1XGQA 1A4KB 2OZ4L 3MV9B 3S35X 5GRZA 2NY5L 2VDOL 4U1KB 2YZ1A 1SHMA 4NZRH 4R7NA 1CGVA 3O4LB 3NFPB 4C59B 3HPJB 4EOWH 3KPRD 4KHXL 2DQHL 2AK4E 1A1OA 3WIHH 2QSVA 1JTTA 1P4BL 3ALWA 4HW6A 4M6ML 3B4NA 3MMEA 3QHFL 1YQ2A 3UTQB 2L7UA 4GLRH 1HCFX 2ILLA 1J05B 3V7AE 1CFNB 4JAMA 4RQQA 4X7SL 1RZKL 3GJFA 1VADB 3STLB 2HJLA 3VCLB 5MERA 3BZFB 3DBXA 1YEJL 1MCWM 2C3VB 1ITCA 4ZNEA 4Q0XH 3D6GA 2EC8A 3GMOB 4JANA 1G7JB 3IDJB 4PJ7B 4XBEH 1YEDB 3BW9B 3CJJA 1UG9A 3KVQA 1UGNA 4KJWC 3C2AH 3PDOA 4LPYA 1HXYB 1NFDE 1LE5A 1XCTA 2H45A 5JXAL 4WW1B 1FAIL 5FB8B 1JWUB 1B4JL 3L9RA 5GSVB 2LU7A 4XMKL 4XVSH 4LGSB 1P4IL 4N90E 1MCKA 5D71L 3SJVB 4OZFA 4QXUL 2EDQA 1MELA 3ARBA 1OW0C 5H94A 2VLJB 1Z9SA 4H8WC 1IFHL 2CUIA 5IB4A 1DUZA 1GVIA 2VLKB 3ZKXC 3HZKB 3F6LA 4LARL 3MLSL 3BDYL 3B5GA 2D2OA 4H88H 4PJFE 1MCOL 4XNYH 3DO3A 2H9GB 1J7VR 3D85B 1RJYB 3CXDL 3KNBA 3W39B 2HJFB 5FECA 1A7NL 2BVEA 4WDIA 4YFDB 4L8DA 2BSED 4MAYB 1QRKA 1U2HA 4UV4L 5E6IA 5FO8A 1KNOA 1A1NB 4LLVB 2G5BA 3S8WA 1G7PB 2D7MA 5F7LB 5SWSA 3IVKB 4D0DB 3D0VA 4PLJC 5DUML 1T0NA 3RU8L 3NGBB 1JUFB 15C8H 1E4WL 1UH2A 4PJGB 2G60H 5B3JE 1L0YA 1CQYA 1T7VA 2YN5A 4HEME 5D9SB 3OKOA 3GSQA 1FN4A 3EGSB 5L2KD 4X9IA 2F5AH 2O5XH 4N1CA 5FDYA 3WHXA 1LGVA 4Y89A 5HYSA 3V5HA 3T0EC 3U4EA 4CVXA 1CXEA 1P1ZA 3MRBA 4LLWB 2X4QA 3WBDA 5J12B 4TUOB 3MX0A 1FIEA 3TBTB 5ICZA 3HAEG 3SGJC 1YN7A 2Q8BH 2MQ0A 4HMEA 2Q6WA 1UWGL 4KVCH 3MYZA 4LVNC 4POZD 3VXRA 2NX5A 3S3JA 2FGZA 5L8LB 1EH9A 2VL5B 3EZJB 1AP2A 4G42A 3ZTJH 3ARPA 2R2HB 4HFWB 1AQDB 2X4SB 5FO7B 3RWGB 3CU7A 3FQNB 4OZHB 4NJAL 2R1YB 5E70A 2A38A 2VIRB 4LSRH 4JZNA 3EJZC 1UWEL 2ICWJ 3BD4A 2ADJA 4U1IB 1NAMB 1AIFA 3DXAB 1P7QB 4P2OA 5JOPD 3HI5L 3WFDL 1JV5A 2XICA 5C0BD 1D5XB 5AG8A 1KG0A 5I6XB 3BFOA 1T3FA 4FXGB 5I9QC 1JGDA 5TDNB 5EZIH 1CLYL 1TJGL 3H9HB 5C0ND 3GBMH 1IQDA 1OTSD 4Y2DC 3RUGF 4XP5H 4JGMA 4UBDC 2VAJA 4GJTB 3ALXA 2H1PH 4PP2A 1YPZF 3DROA 3TO2B 1AGDB 2FB4H 3LPFA 3M17A 3IDIB 2W92A 1BM3L 2I07A 4OIBA 5CEXB 2VRAA 4FNLH 4OUOA 1KTLA 5FUOH 5EU5A 3TVMA 4APQD 2IC2A 2WK2A 2BK8A 1EHAA 1KBGL 3QCVL 1FNHA 4BA8A 1FFOB 1KJ3H 4GBXC 2QLVB 1UVQB 4G8IA 2P47B 2DKSA 2GK0B 3ZTNH 3MRMA 1B4RA 2UV3A 4QTHA 3U46A 2DL9A 4PV8B 1JCKA 2EH8L 3ARFA 4PJCF 5EU7C 5B8CA 1R0AH 3U82B 5D7IA 1TZHA 4OLZH 3FFCA 1J0ZA 4LHUB 1QRNA 1WWWX 2J88L 2PYED 1JWMA 3GSNH 3F7VA 3R8BB 4PUBL 1YEHH 5FOBA 3NIFE 5DEFA 2LVCA 3PGCA 1XIWB 4OV5A 1GGBL 3BZEA 3K4ZA 1JYXA 3ZYIA 2DRUA 1KJMB 3DURA 3FO1B 2X4NA 3H3PH 4FQQA 4ZD3L 1QR1A 2BNQB 1N26A 4P46C 1G7HA 3ARRA 3MLZH 1JPFB 3QDMB 5IVOA 2QADC 3RGVB 1D6VH 3TZVB 3K2UH 2FHCA 3QUZA 2Q8AL 1S78D 1I8IA 3BH8B 4OCNC 3TWCH 3RNQB 4KAQH 4ZO6A 2XQYG 4EI5A 1G9NH 2XZAH 3G6JB 3F7YA 3K81A 2FEEI 5CJOL 2GITA 3F62A 3OHXA 4JFOA 5JDSB 4FRWA 4MNGE 1NAML 5ERWA 1TJHH 5IP4A 4MQSB 1UYWL 2ORBL 3C60A 2W60A 3INUH 3WNKA 2YBRB 4L4VD 1OGAE 4JFPA 2L0DA 4WI7A 3X14B 4LKCA 1BIIB 2GTZA 3KJ6L 2WUCL 4AMKH 4WFGE 3ULVC 1KB9J 2VUYA 3C8DA 3HR5B 2EDWA 3QIWC 5BXFA 2FEDC 3GKWH 4LCCA 4ZUUB 3JV6B 4UOW1 2Q7YA 1KB5H 4YHOL 4X4XA 3O6FB 1K5NB 5BW7C 4M1GL 1FGNL 4S1QH 5F70A 5EU6B 3VI3E 3FQWA 3H7BA 3JWDL 4PRIB 3VG9C 4K7PH 2VZTA 3LPGA 4KKBC 2VO5A 5D1XA 4MX7B 1QO3A 2D03L 3LV3B 1W72L 2CH8A 2ZOLB 5I1KH 5KSBE 5D72H 3DARA 4HV8A 5CWSA 3ULUH 1BD2E 2E5EA 3VXQB 2ZKHH 3G5VB 4B5EA 1MRFL 2VWEE 2P24B 2OTUA 4Y5XC 1G9ML 4DN4H 4PJEB 1UC6A 4OCRH 4Y5YA 5ISZA 5BZDB 2BZDA 3MPCA 1KULA 2UWEA 5EWIH 3I6KB 1BQSA 3NIGE 4XCFL 4HXAL 2JJTA 4WI6A 4NYLA 2ED7A 4JCLA 4TVPE 2DJ4A 2E7LC 5J7CC 3RZCC 4N0UB 2W07A 1IKFH 2G2RB 4JQXA 3SDXB 5MEPA 4QRTB 1FZKA 1G1YA 3LZFH 4ESKA 1IC7H 3NA9L 4X0KB 5I1IL 3SN6N 3LMJL 4HUUA 1N5YL 1DJSA 5C7XL 3KWWA 1LO3H 4QTIL 3GJFH 3D9AH 2Z4QA 2HWZL 3Q0HA 2XN9A 4BFIA 1V7NL 1M1SA 1R24B 3NN8B 2YPKA 4Y4KB 5JIIA 1JHTA 5DJDA 3TLRA 3BUTA 3JBG7 5C09E 4JO4H 2IBZX 2R0KL 4HT1L 4WCYH 1F13A 3MSPA 5IMLB 1V3JA 4YO0B 5EO9B 3QUYA 1ZT1B 1PEZA 2ZCKH 4NQTA 3SGDI 4D0CA 1HHJA 5JORA 4PJDF 5BVPL 1UWXK 2W1NA 1OB1A 4X6DF 5K9JH 1FL6A 1WFUA 5IMOA 1SEBB 5SWZD 1CU4L 1FSKC 5E2TH 1N5AA 3VRJA 4XAWL 2CLZB 4D8PA 4NJ9L 2F54B 4HJ0C 2A9NH 4J6RH 4CGTA 2ADGB 4K9EL 2A77H 2HVKB 1Z5LB 2F53A 5IUSA 4X7EC 1IAIM 3T8XB 1XF2A 1NMCB 1DBJH 3S5LA 4PJCE 3MZTA 1BFOA 2WBKA 1SY6H 3CAFA 3OKEB 1RUPH 3F58H 3QI9A 5EUKB 4J4PA 1BVLA 4TULL 4MNGB 3MJ8B 5FYLE 4ZPVA 3AXLB 2EDEA 4JDTH 2XZCH 4Q9QH 2KH2B 4LDLB 5GRUH 1A7RH 4KKNA 1RIVH 1LO0L 1OGAB 5IHUH 3HUJA 5ALBH 1BVKA 3MGOA 3T2NH 1BBDL 4YQXH 5FGCB 3IDYC 3UJTH 1KEMH 3QIBD 4C4KT 3PP4H 4BZ1H 2HT2D 4WWKA 1RURL 3OTTA 4MJ6B 2YUVA 5B39G 1YMHA 4XAKE 3HI6L 2DM2A 1N6QL 4PG2C 5ITFA 4V1DD 3PQYB 5BJTB 4NQCA 2XV6B 1ZGLB 2FGWH 3DVGB 3ROLA 1RV6X 3BJLA 1ZHKA 1I1AB 2BHUA 4QXWA 3MCG1 3FONA 5C0GB 1P84K 3UPRA 1T66D 5DVNA 5HI4C 1E4JA 2AXGA 7CGTA 3WSQH 4OAWA 5TDPB 5EA0L 2H6PB 3LN5A 3WFHA 3C5ZC 5DD3H 2OI9C 5GGQL 3QDJA 2W9LA 2FJHB 3U2SA 1A0QL 3CCHA 1A14L 3BWAA 4NO3B 2AABH 5HI3D 3UPAA 5ABDE 1Y18A 1I3GH 1A4KA 4MCYB 4UT7L 3MV9A 1FNFA 4LAQH 1EEYB 4U1KA 2IEPA 5JW4N 1C8PA 3T4AB 1INDL 1U41A 3MLRH 5CBAA 1B6DA 4P2QB 5I66B 1UH3A 3UTTD 4GKSB 3O4LA 4IBLT 1IAOB 3NFPA 4QRPD 5DO2D 3SCMD 3HPJA 5I1CL 5ICYA 3BQUA 3I02B 5FOJA 1U8HB 4N8VG 2DBLL 1MJJB 3UYPA 3UTQA 3WUWB 3HNVL 4BZ2H 5HHME 3VI4E 1PYWA 1CFNA 2PXYC 1AC0A 1F3RB 4NN7B 4H1LG 2VISB 1RZFL 1VADA 3LN9A 3STLA 4MA1C 4R8WH 4W6WB 3VCLA 4N68A 3DECA 4ODBD 5IB3B 2IBZY 1GGIH 2C3VA 2V17L 1K85A 1KGCD 1FH5L 1YEFH 3GMOA 4ODWB 1G7JA 1U2CA 2WM0A 3E8UL 4PJ7A 5EC1B 1YEDA 1UM4H 4JKPH 3SGEI 2LTQC 3EYSH 1RIHH 2FH8A 1GC1H 1EGJH 1HXYA 4JFEB 4MQXC 4G6JL 4G6FD 4WW1A 1ZLVK 2WINB 3WO4B 2AJYL 5GSVA 2IWGA 5HVHB 1AXSA 3SJVA 3QG7L 3KHQA 3W0WE 3U36B 3MBEB 1EDQA 4ZSOB 2VLJA 3GBNH 3WN5B 2K7QA 2VLKA 4X9GA 1I1YA 3HZKA 3UBXI 5FHAL 3DX8B 1MFCH 3K74B 3EBAA 4GW1A 4I0PB 3SPVB 2H9GA 3D85A 1RJYA 3W39A 2RGSA 5CLTA 1LMKA 2HJFA 3BZDA 3GRWH 3P2TA 4ETQA 4MAYA 2R2BB 1BHGA 4NQXB 5IBTH 1A1NA 4LLVA 5KVEH 1G7PA 3MNZB 4DQOL 1OP5H 4P99A 5J3HC 3IVKA 2EIDA 4P5TD 5L88H 4E42B 4TOYL 1CXIA 3KPSD 5E6YA 5JPNB 2X09A 1PEWA 1MFDH 3EFFB 4HS3B 1JUFA 1IGJB 4XPBH 3QUXC 1YZZA 4LDEB 4FXKB 3Q3GB 2GUOB 1LWRA 3ULVF 1UT9A 3ESVF 2JIXB 4MQ7B 5DZNA 2R9HD 4TVPL 2AJVL 3OZ9H 2C3WA 2R69H 4LLWA 3S7GA 1HEZB 2IG2L 4TUOA 3TF7C 2DYPD 3TBTA 3BHBB 3WLWC 3RGHA 4B50A 2DI8A 3V6OC 2Q20A 5L9DL 4OT1L 4CU8A 4BM7A 2EDBA 2VL5A 4QCIA 4O2EB 4L1DA 3T3PE 4O58H 1BPVA 3B43A 1G6RB 2R2HA 4HFWA 4KFZC 5TF1H 4WEBH 1AQDA 2X4SA 3PF2A 5FO7A 3MA9L 2P5WD 3RWGA 3FQNA 3VGEA 1RJZB 3WHE0 3A67H 5DMKB 2CXKA 2Y23A 3BI9X 5IQ7H 1HIMH 5H37H 1FHGA 3NZ8A 2R1YA 2JK5B 1I85C 2VIRA 4M7LT 3LH2L 1HI6B 3MRFB 4WUUB 1OAZH 3SE9L 4ENEC 4U1IA 1NAMA 3OPZL 5D2NC 3DXAA 3KPLB 4XMPL 1P7QA 3GK8L 4M3JA 5JXEA 1TDQA 3ISWA 1AI1H 4F80A 3RFZC 1MIEH 2A6KB 4FXGA 4GQPH 5TDNA 3H9HA 1LDSA 5FA4B 3UTSD 1HSAB 3GSXB 3HNSH 3QXDB 3QEUB 5TQ0L 4M7KH 3MV01 3T2QA 3ZE0F 5L2KE 3FN3A 2DWDA 2HFEB 3NCCB 1NLDH 1XF5A 3JTSB 1TXKA 2C5DC 2RHEA 3TO2A 5FYLL 1AGDA 3IDIA 1U92B 3O3UN 1F90L 4NWTL 5CEXA 5D5MF 1DSFL 2VN4A 3VWKB 1D5IH 4AK1A 4MZ2A 2Y06L 3TBWB 1CI5A 4J3WA 5FUCE 2IQ9H 2VQUA 3O8XD 1FFOA 3PXHA 3QHZH 3UC0H 3U4BL 1UVQA 2GK0A 4HIIB 5HHVL 1GZQB 1XCQB 4JLRB 1UXSA 2ARWA 2FWOB 4PV8A 4ZFOL 4KDTA 3S35H 1EBAA 3DV6B 4HD9A 1MCCA 4POUB 4DJMA 4OLWH 4PJFA 5GQBA 3KPRB 4LHUA 2F8XC 5IEKB 4L3ED 1MCRA 4XP6L 3UEZA 4KHXH 5TQ2H 4I77H 4JZJC 5DGQA 3TA3D 1XIWA 1P4BH 1RZ8B 5F72S 1AHWB 2Q1EA 1VB9A 1KJMA 4HWNA 2BNQA 1IAIH 3HE7B 4Q2ZB 1JPFA 4PJ8D 1ZGLP 1RZKH 2YA0A 3QAZB 1JZ6A 3NCMA 3P3YA 1I9JL 3RGVA 3TZVA 4HJJH 1G6RL 2Q3AA 5FCUH 5FYJH 3MGAA 4JFDB 3BH8A 4YHLL 3RNQA 2ICWI 3SDDD 2AQ3A 2EH7L 2AI0L 3G6JA 4LIQE 5DVOA 3A6OA 5JDSA 1RZGB 4Y2OA 4AEFA 5IJVB 1A7OL 2GY5A 2J3SA 4NM8L 3EYQC 1DQMH 2WMPA 3ZT7A 5BOPA 5JXAH 2SEBB 4G7VH 3X14A 2ESVD 1BF8A 4YLQT 1KPRB 2BRRL 1QQDB 5JMRA 1E6JH 4RGNC 1EX0A 3QG6B 1VFAB 3MRQA 2AQ2A 2M1KA 2FNBA 1E6OL 4ZUUA 1T7XA 3RA7L 1G0DA 5D7LD 1MCIA 2EDXA 1FQ9C 3P4NB 4KZEL 3MLSH 2IPUK 2PYEE 2YK1H 3O6FA 5IW1B 4XP9H 1X5JA 5CGYD 1UM5L 1FNAA 5B38B 4P48A 1U3HC 5EU6A 2W9DL 2XQBL 5JW4M 1Q72L 1QACA 3GI8H 5IFAH 4I9WD 4MX7A 4XZUB 4ZXBC 4IRZH 3GB7B 2ZOLA 1W8OA 1L9MA 2CRMA 3TYGH 1KOAA 2CJUH 1CFQB 4GG8B 4Q6IC 3G5VA 2DQCH 3LKNB 3VXQA 1AC6A 2X89D 3JWOH 4ZFFB 2P24A 4OCWL 1T7ZA 1Z6JT 1EMTL 4PJEA 4HWZB 3V6ZB 2JJSC 2GSGB 3DX6B 2ZUVA 1E4WH 5BZDA 8CGTA 2BVOB 3T0AA 4GRWE 3I6KA 1H3TA 3FMGL 5IROC 4F7MB 1U3YA 5IR1B 1MJUL 3MRJB 4O02L 5F7DB 5C0CE 4N0UA 1NGQL 1A6ZB 2G2RA 3SDXA 4QRTA 3RWIA 3ZLQC 4AIZB 4X0KA 5F8QC 1KCUL 1XMWA 4ODXB 3QFJB 1FNSL 4GFTB 4QHLB 4WW2B 1A8JH 4JDVB 5D2LB 2R0LH 4KPHL 1MCQA 4RMTA 1DBKL 3CLFH 3MXWH 4HKJB 1R24A 3NN8A 4Y4KA 3I2CL 1QNZL 3DI3B 4JVUA 4G8EA 3SGKA 4YBLC 1Q1JL 1J12A 4GW5B 1NANI 4WIQA 4C56B 2W0FB 5EB9A 1F97A 1YDPB 4TPRH 4XPGH 5I0ZA 4YO0A 5EO9A 1ZT1A 1PFCA 2VLRD 5F93C 5C0BB 1NFIB 4HPYH 5T1DL 3N1MC 1T20B 4YHZL 4TN9A 1SEBA 5DZOA 4OI7A 4Y16D 3CSYB 5ANMB 1PY9A 2M8XA 3WV0A 4E0RB 4QY8B 1CE6B 2VDRH 1GGCH 1TZGL 2ADGA 3Q6FB 1Z5LA 4ODSL 2Y07L 1IEHA 3T8XA 3HG1D 3BEVB 5JOEA 1AD9B 2FR4B 2HKFL 1O0VA 2X5PA 1OY3B 3BP6B 4ONHB 4ZAKD 2MPAH 4QRQB 3OKEA 5EUKA 1GYAA 2PO6C 1G7IB 1S9KC 4MNGA 1NEZG 4NZTH 3QQ4A 3K1KC 3MJ8A 2M2DA 3AXLA 3D5OF 3D3VD 1OGAA 1ACZA 4WTZG 4Q9RH 2V2XB 3VWJC 2H2SD 3FB7B 3WNNA 4OGZA 2XZQL 1NC4D 4AL8H 3GZKA 3O45B 1DVFD 1N6VA 3QJFB 3QQ3A 4LASH 1I8LA 3ALPA 3PQYA 4HHAB 5BJTA 4H26B 4JFFE 1ZGLA 3DVGA 5FM4A 4L4TE 1I1AA 1LK2B 1XEDA 2PR4H 1RK1B 3SQOL 4U3HA 5HDQH 4RMVA 1KIPB 3WFZA 3FAWA 4U6HB 1RJCA 5E8OB 1JFQL 1G9EA 3VXSE 1TPXB 1OPGH 3MRRB 5SWZE 4LSSL 3U9PH 4ZD3H 4ODVL 3T2PA 3QZWA 4RWYL 3RVUC 1CICC 2FJHA 2H8PB 5DXWA 5C6PB 5FYKU 1TQBC 4NO3A 2XI9A 1M7DA 3LDBB 5CEZH 1GRWA 5HGBB 5IHZB 4MCYA 2Q8AH 5JIHA 5IFHL 3GMLB 3RWEA 3K80A 1EEYA 3P4OB 4M9PA 3T4AA 4W4OC 3TYFA 4P2QA 3MJ9L 5I66A 1CFTB 3W81A 1IAOA 2EC9U 2ZCHH 1NAMH 4OLUH 1FVDB 4I18B 4L4VB 1SEQL 3X3FH 1U8HA 5D96B 4P9HH 2ORBH 1DLHB 3UZEA 4OCMC 5EZLB 5IK3B 2VXQL 4LCIH 3FQRB 3WUWA 4PLNC 2I60H 3C6SB 4YUEH 3KJ6H 1B0GA 5DGRA 3NAAL 1Q9KA 2XYCA 1ZHBB 4H0GA 4J3TA 5E0QA 1GPOH 5F89A 2VISA 4LKXB 5D1ZA 4GLRI 4V1DE 2BOBB 5GS1B 5KS9B 5IB3A 4KZDL 3TV3L 1DBMH 4PD4K 1CDIA 1LK3H 4ODWA 4DN3L 3HCVB 2ZZUT 2XACC 4HIXL 5EC1A 5HGAB 1V7MH 25C8H 3MUZ1 2J2ZA 5DK2B 1LE9B 1WTGT 2OXGA 4JM2C 2Y1VA 4JFEA 1WUNT 3G04B 2WINA 4DGYH 1RIUH 2DI7A 1UQSB 4ISVB 1JRHL 4FFVC 2D7PA 1T5XB 1A9EA 4M1DH 3PWPD 1DFBL 1G9MH 3JTTB 1OF2B 2NY0D 1BQHA 3V0AC 3A6BL 3MBEA 5E2UH 4ZSOA 5E5UB 1E4KC 4M48L 3WN5A 3HMXA 3OF6D 4XCFH 3CVIL 3UTTE 4I0PA 1NCAH 3MUJA 4FFYL 4KJWD 2YRPA 4A6YB 2NXYB 4LSTH 2VDLL 3QRFM 2R2BA 5C9JB 4NQXA 2FCBA 2BSRB 3MNZA 1N5YH 3MLYH 5C7XH 4ZFGL 5IW6B 2NMSA 3LIZL 3ZZ1A 4QTIH 5I19L 1WISA 4OB5H 3EFFA 3GHBL 2BHZA 1KGCE 4ZFOA 1IGJA 1N64L 4FXKA 1ZEAH 4QHNB 3MACH 3Q3GA 2GUOA 5BS0D 5I8OL 2JIXA 4HGKC 4MQ7A 4FZEH 1QSFB 2MJWA 1FLTX 3WXVL 4UNTA 2NY1D 1K9TA 1EHLL 5BVPH 3GNMH 4H25B 3BHBA 4FP8H 1QKZL 3GHEL 3EUUA 4RDQF 3MUHL 5JQHC 1WEJH 4LVOB 4NJ9H 5LCVL 5DFWH 1XR8B 2ATPB 5IB1B 2MCPH 3NA4A 1T83C 4YHPA 1G6RA 5ITBL 4U6YB 5IGXL 3O3EB