2NY6D

Hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
228
structure length
222
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120
publication title Structural definition of a conserved neutralization epitope on HIV-1 gp120.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 46
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny6D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ny6D01
4YK4B 4ZQKA 1S9WA 3UXFA 4O4YH 3OKDB 3D25B 2H8PA 5DK2A 2P5EB 5FCSH 3CLEH 4PP2B 3I75A 2W0KA 4U1JA 3U2SB 3KYKL 4WWKC 5I75C 1HDMA 3LB6C 3BAEH 1FL6B 2A83A 4UOW0 4FQQB 1EVTC 2HFEB 3GJFB 5D93C 5J0BA 5JIPA 5I1EL 1HE7A 3K0WA 1KENH 3KLHC 3PABB 3ULVH 4RA3A 2VXUH 3EYQC 1I8KA 3V6BR 4G9DA 4DJMA 2JJTA 5D4QA 1ZVYA 1QBAA 3FONB 4HQQL 3WYRA 3QFJA 1AJ7L 3JUYA 3S8WA 1X7QB 3RGVC 1MJJB 1QBBA 2OJZH 5GSRA 3JWDL 2HFTA 4HK0A 4PTUA 3VXNB 1XEDA 5IB3A 3ZT7A 3SOBL 4EUPA 1MHPH 3KR3H 4HIIA 3QWRA 3GBML 4O9HH 4KJYA 5BVPL 5JIHA 4BKLB 4UV7H 1E27A 1G7LB 3TBTB 3LZFL 5EO0B 4LLDA 1SVCP 4O58H 1A8JH 4LQFH 4P2QA 1YEFH 1YNLL 4TVPD 4PJEA 2D4DA 1YECL 2NY6B 2O5ZH 1UWGL 3ARFA 1LE9A 2VDML 4JRXA 4BM7A 5JOFA 5HGHA 5ADOH 3E6FA 2IALB 4NQXA 4MS8C 1OSZA 1XF3B 3ROLB 3T09A 1CT8A 3UTSA 1JPSL 4XVUC 3I85A 1BIHA 2XZAH 4M7ZB 4S1RL 1JTPA 3QJHB 1D9KA 4DN4H 2C3XA 2MQCA 4MLSA 2Z8SA 4JZNB 3U6RB 2VLJA 2X4SB 3IFNH 3NZ8B 2GY7B 1CWVA 3IU4L 1A0QH 4LARL 4J4PC 1RIVL 4EI5D 4JPKH 4YBQC 1OARL 2NY4C 3DETC 3VFMA 4OFYD 2J8UB 4PV8A 4WJ5A 4GXVL 1RVFH 2QQNL 1TQCC 4NZRH 2Z4QA 1BECA 1ZWIB 4OLYH 4WDIA 4C59B 1F4AA 3Q3GB 2HTLD 2M26A 2V7HB 3IDYC 5IMMB 5KBNC 3QXTA 3VJ6A 3DX7A 4ZTOH 2AV1B 3T2PA 1Z9OA 3BZFB 4XVSH 5D1QC 5SX4I 3EDJA 1A7RH 2EEDA 1NMBL 4K8RH 5FB8A 1KCRH 5L8JB 4JDZB 5JW4R 4DZ8A 4M8VA 5E8OA 2YEZA 4NKIL 5IMKB 1MSPA 2Z8VC 3D85A 4N8VG 5IW6A 1ZVHA 1O7VA 2O93L 2J5LB 2VTFA 4U2ZA 2HT3C 4JFDA 1QYGH 3OXSB 3DX9A 2FHFA 4N0FB 2OXGA 1YYMH 1ULVA 3WO4B 4EXKA 2EEAA 3QEGL 4XPHL 4XVTL 4EEEA 5C0IB 3ARBD 5E7BA 1LILA 3DVFA 1LQSR 4YHKL 3RWJB 4L4JA 3TO4C 1QRNB 1YA5A 4JFHE 1MI5B 3ARPA 1EFQA 1NLBH 2CIKB 4Z78B 2V5SA 4L3AA 3O2VH 1H8OA 1D5MA 2XNAA 2XKUA 4P99A 1AGBB 3U46B 1OAUH 3ALPA 1RV6X 1WTGT 2VL4A 3T1FA 2EE9A 4HKXB 3AXLA 3F12A 2PYEB 4N9GB 1FYTE 4XNYL 3SDCD 2NY1B 5I18L 4JJ5A 4OI9A 5DZLA 5I19H 3O4LA 4PJ7E 3RVVD 5C08D 4RDQG 1JNNL 5JW5A 4GRLC 3Q6GL 2BNQA 5A16A 1O0VA 4UDTA 4CBPA 1U93B 3GSNB 3GHBH 1JF6A 1LO0H 1WQVT 4OFDA 1B0RB 1UXSA 2CK0H 4L4TD 5C7XL 4EN3B 3T0EB 4PJBA 2XA8L 3DIFA 1TNNA 2ZUSA 1WIUA 5I1IL 3KLSA 5KAQF 2FGZA 1HHKB 3VXME 1IC7L 3LIZL 4WV1A 5HXMA 1KTKE 4AIZA 4ZFZA 1RD6A 5EH1A 3L6FB 5FUOH 3VGGA 4HBQA 4P57A 1N64H 4AH2A 1CFSA 5DYOB 2W9DH 3MV9A 1XGRB 1PEWA 5F97E 2APBA 5HI4C 2ATPA 4XHQA 4IRJB 2E27L 3QG6B 2OL3H 3V7AG 1I9IH 3KXFD 3QUXC 3HUJA 5T33H 3SJVE 2OM5A 15C8H 1RJCA 3NBNA 2FB4H 3MGAA 1MCDA 1YEKH 4IMKA 1X5AA 1SMOA 3OAYK 2UWEA 1XGUB 4NP4L 5H37G 1OPGH 4CN6A 4RFOH 4PJ9A 2VR9A 4UT9H 4PRPA 1OD7A 1I1AD 4ZD3L 1TZHA 1DBKH 1PG7X 3TN0A 2JJVA 2BMKA 2C7UB 3P77A 2HJLA 3OKLA 4X4YA 3BD4A 2F8OA 1N6VA 1T0MB 3NACL 5ALCH 1DN2A 3VXQB 1DVFC 3TCLA 2YK1H 5DHXB 5FOJA 5C2UB 2C5DC 4LRNH 3EO1B 4O4YL 4G6AC 2P46B 3H7LA 4UUJA 3WJLA 1C5BH 4J2XA 3CLEL 4GRWH 1AHWA 3V6ZB 3MGOA 3KJ4C 2EDHA 3W39A 1DSFH 3BAEL 4YDVB 5IBUB 3OB0K 5MEND 4JB9L 1CICC 1KENL 4LP5A 3ULVL 4PBVC 4RGMB 2GAZB 3S7GA 5HI5C 5K9QG 4M7ZC 4FQ2H 3LS4H 1JWMB 2VXUL 4J3UA 5E2TH 1T04B 4G80A 4QXUH 1UVQB 2P8LA 1CLCA 5HHME 3F62A 3ME0A 1OQOA 3MYZA 3ZL4L 4D9QE 1DE4A 2A6IB 3SE3C 4X6CB 3WN5B 4ZUTB 4H1LB 4MAYB 1H8SA 3UZQA 4P2RA 4NM8H 4JGUA 4DN3H 2UZXB 1FAKT 3HG1E 1IBGL 4NPYA 1B0WA 4MYWB 1LO4H 1U3YA 3OHXB 4QHUA 1LD9B 5IWLA 1MHPL 1R5IA 4ISVB 4PLKC 4R7NA 4LF3B 2W65A 4YBHA 3RA7H 3U7WL 4JG0L 4O9HL 5I8KH 4PG9A 4UV7L 2JB6A 5JHDA 1TTGA 5KZCB 3Q1SH 4LNVA 4CVWA 1U8QA 3ZZ1A 1B88A 1EIBA 4LQFL 5GS0L 2XYCA 1JN6A 2DWEB 1AC0A 1ACYH 1YEFL 2HKHH 4JM2F 3ILPB 1UCTA 5HYJA 2O5ZL 4MNGE 4MNQA 1CR9H 1A1NA 3PWLA 4R0LB 1YUHB 1H0DB 3QH3A 4UU9A 3ZKND 5ADOL 2G9HA 3REWA 4PRDB 2A77H 1CE6B 3DTXB 3MRRA 2VL5A 3W5NA 1G7MB 1X6NA 5IFHH 2FJFA 1YEHH 2VO5A 5H2BB 3UPRB 3OKDA 3D25A 1RUKH 2XZAL 2P5EA 4PP2A 3GHEH 4DN4L 3LCYA 1FL6A 4X4ME 3G08A 4FQQA 1I1YB 3SDXB 4E0RB 4P49A 2HFEA 2J8OA 3GJFA 4ZUVB 3PABA 5FM5M 3UAJC 3IFNL 4TPRH 5TE7L 1MRDH 5FAAA 1PG7W 4NGHH 4JPKL 4OLXH 3TIEB 1W0YT 4HS6A 5E8EA 2EKSB 3CSPA 1CYGA 5HGDB 3VH8B 5C9KA 1RUPL 2J3SA 1RVFL 4NZRL 1PDKA 3O0RL 1QA9B 1IQWL 1X7QA 3CU1A 1MJJA 3R1GH 4Y4FD 3RWEA 2ICWB 4KMQA 1NCBH 1Q8MA 3BWAB 4OLYL 4XVJL 3VXNA 1AO7E 2ESVB 4K94H 3RVUD 1EEZB 4TOYH 3P0VH 4ZTOL 3GBNH 1ORQA 1YZZA 4BKLA 4P9MH 4F9LC 3TBTA 4HHAB 4OB5L 1M7XA 1D5IH 4Z7WB 4KK6C 2EKJA 1KCRL 2YA0A 4HX1B 2KQNA 1W72H 5EOQL 2CUHA 2BK8A 5D7LB 4KKNA 3CFEA 4OZIA 5FYKU 2BVQB 4MNHB 3TPUA 1EAPB 1EAJA 4OD1H 1BF8A 1TZIB 1V5JA 2E6JA 2GJJA 2IALA 1DFBH 1DBMH 4HUMB 4O51A 4YFLI 4QXTA 1XF3A 1Z0MA 4HXBH 4QT5A 3ROLA 43C9B 2HTKD 1RIHH 1S78C 1YYML 3P0YH 1ZTXL 1QP1A 1E4XH 4IS6B 2N4IA 3QJHA 3JXAA 1AQDB 4XMPL 3VFPB 3S37H 4MQTB 1SEBA 4R6UA 4JZNA 4RAHA 3U6RA 2DQTH 3ARFD 3CH1B 2V7NB 2VR4A 3NZ8A 1J05B 2OZ4A 4F80A 2FH6A 4JFHD 1GAFL 4UOW1 4LOUC 1RZIB 2HN7A 2J8UA 1VPOH 3CNKA 2J6EA 4ONHB 1NLBL 2DICA 4UNUA 1CGXA 5DD5H 3O2VL 4A6YB 4U7MA 3EW3B 5F88B 2C9AA 4HCRL 2P24B 4Y1AE 5GGTH 4L8DB 1NDMB 4KRMB 4UI2A 5I71C 4OCSH 1OAUL 2V7HA 2I07B 5E1AB 4DW2H 4LGRB 4RAVA 3BKCH 5IMMA 5HYFA 5BZDB 4FZ8H 3OKNB 1FYTD 3ULUC 2AQ1A 2AV1A 2ZWLT 3BZFA 5ACLA 1RUQH 3RWFB 3MV7E 4U6TA 3QAZC 3FKUS 3HAEG 2V9QA 1UM4H 5I19L 3WJJA 1J1OL 2WZPD 1VFMA 5J1AA 3ZKXC 4JDZA 1PX3A 4I3RH 3LEVH 3QIBA 5H35B 3K7UA 3O45B 3SGJA 3GHBL 3GO1L 1CFNB 2WBJC 4WY7H 2HG5A 4DVBB 3BPLC 4Y4HA 3U0PA 4JGJA 1YJDC 3OXSA 4PJGE 5DUPH 2HH0L 4JQVC 2ARJQ 4D0DA 5JXED 4IM8A 3X13B 3BD3A 4GW1B 5FUOL 5HY9B 1DJSA 2VLKA 3F58L 5C0IA 3C09C 4NFDA 3EYVB 1J7VR 2Q87A 1I9IL 3TA3B 5T33L 3D2UB 15C8L 4JFDD 5DHYA 2XZCL 1UM6H 1QRNA 5L7XH 2EDFA 1MI5A 1ODAA 1CVRA 1AH1A 2CIKA 4Z78A 4WIQA 2X4OB 4RFOL 4PJHF 4MB4A 3AY4C 1KB9J 4HDIA 2XKNA 3MZGB 4L9LA 4XCYB 2G5RA 5JQ6H 4WWID 5BQ7B 2Z92B 5F7MC 3LMJH 3S88H 4E42A 3D48R 3NFNB 4MDIB 2YBRB 5ALCL 4N9GA 5EZLB 1EBPA 1FV1B 3C2SA 1FL3A 1GPOH 2LU7A 1YDPB 4LSDA 3D0VA 3NTCH 4F8TA 3SKOA 3E0GA 4LRNL 5DZOA 4NC1E 5D7JA 1I1FB 1KLUB 3IFLH 4ZFFB 4R0LC 5D72L 3C9NB 4K71B 1CDCA 1UB6A 3RZCC 1U93A 3PWPE 5D1ZD 1M7IB 1HI6B 4MQXD 2NXZD 4JY4A 3KLDA 1JUFB 1B0RA 1KBGH 1LK3L 4NOBA 4WFHE 3WFHB 5CBAB 4EN3A 4UTAH 3T0EA 4MMXC 5BV7B 4FQ2L 4HMDA 2KUTA 4M1CC 4UT7H 3RJDA 3MBEC 1HHKA 5E2TL 2Z31A 3K2UL 4QXUL 1CCZA 2FHBA 5HHMD 3L6FA 4ENED 1T4KA 4D9QD 1F3JA 3CU7A 4BJLA 3MLVL 2Y5TB 5DYOA 1MFBH 1XGRA 1PY9A 1F4HA 4DEPC 4K3EH 4IRJA 3QG6A 4NM8L 2GIYA 3HG1D 4U6VH 1WFUA 5KAQG 2R1WA 4E5XB 4ODBD 4MXVF 3BVNB 2Q8BL 5KSAD 2CO6B 3WFZA 3QDAA 4YNYA 1X44A 1XGUA 4MHHI 4NUGH 3BH8B 1HSBA 1ACYL 3KYNB 1XF2A 2HKHL 2C7UA 2ZUUA 4PRIE 3MV9D 2AK4B 1T0MA 5EO1B 5LXGH 1CR9L 1DBAL 4Y5YB 1UWXH 5LQBH 2IPKB 1CFQB 3H9HA 1CL7I 1AXTL 2A77L 1DBJH 4ZPVA 4H1LG 2NR6D 3CLFH 1JK8B 2X70B 4IMLB 2DJSA 1TVBA 1HOCB 4U1MA 3TBYB 1S9YB 3WDHA 4ACPA 3V6ZA 5D7KE 3GHEL 3PXHA 2F19H 2ADFL 4WTZA 3QXAA 5DVNA 5FA4B 4JKMA 3N1FC 3ZDZE 4LVOC 4FNLH 1LDPH 1MRDL 4Q74A 3HNSH 4RRPA 2HMID 3AB0B 4OLXL 4CJ0A 4HWEH 2MJWA 3NIGF 1FSKB 5C0FB 3BW9A 3VD5A 3SGEI 1HNGA 2VXTH 4RFNB 3DUSB 1O5DT 4Y5VB 3BYTA 5CSZB 1XIWC 4NKOA 1INEH 1PY4A 3WN5A 4DGIL 3QWQB 3R1GL 3ARRA 1MRFH 1AO7D 4N68A 4JM4L 1X5KA 4NCC2 1LD9A 4ISVA 4TOYL 4LF3A 3GB7B 3P0VL 1RIUH 3GBNL 3P4MB 3M45A 4K7PY 4P9ML 3AS0A 1D5IL 4AEFA 4Y16B 3DOSA 1RULH 2DWEA 2XKSA 5E03A 1G1YA 4XX1E 4KDTC 1B4JH 4C4KO 3WV0A 4PJFB 1W72L 4LNRB 3C60C 5JLZB 3ZKSD 1IM9D 1RZKH 3KAAA 4P2RD 2OCFD 3NGBC 1YUHA 5C0RH 1H0DA 1SY6L 2EDYA 3CFJB 2VYRE 2RIKA 2FBJH 2I9LB 1CE6A 1DFBL 1DBML 2YPLB 3VG9C 5IVZB 3DTXA 2MTPA 4HXBL 4KHXL 5DD3H 1G7MA 4I18B 4EDWL 1BOYA 5H2BA 1RIHL 2WW8A 1H3VA 2RB8A 3UPRA 3WS3B 1E4XL 4G8IB 1C1EL 3MRMA 1IM3B 5FYJU 1I1YA 3SDXA 2NZ9D 4E0RA 4ZUVA 3RVWD 3S37L 3T0XA 1ORSB 1KN2H 4KV5E 2CJUH 4LLAA 2DQTL 5I17A 1OOAA 4KI5F 1H3XA 5SWZB 3TIEA 5LVEA 4JO3H 2EKSA 4X9BA 1N0XH 1WWBX 5HGDA 3VH8A 2KZ1B 2AJ3A 1VPOL 3WLWC 5CINH 1IZKA 3TA3C 5DD5L 3V0VB 1VGEH 3U48A 2PXYD 4Y1AD 3MRJA 3M1BB 3RWGA 3VMOA 3MLWH 4EOWH 5IJKA 2ICWA 3BWAA 2VC2H 1JYNA 2ESVA 3BP6B 5GS1B 4XB8A 4R97C 3LQAH 4DW2L 3BKCL 3MXWH 4K23L 9CGTA 3MV7D 5L6YL 2AK1L 3HMXH 5BRZB 3VD3A 2I27N 3P9WB 4HHAA 2P48B 3B2UD 1UM4L 4Z7WA 4WHYH 3NCEB 4N5EC 4HX1A 5LCVH 4OZ4B 4I3RL 3QIWC 4OLEA 4MNHA 1BVLA 1EAPA 5MP6H 4RQQB 1TZIA 4ZOBA 4DKAA 4QF1A 4K71C 5GXBB 1II4E 5EBWA 4YO0B 5DUPL 4ZSOB 5HHPB 43C9A 4OAWA 4OM1H 4ODXA 2WV3A 4IS6A 3EDEA 4XWOD 2Z93A 2GJ6E 1AQDA 4WEUD 3G9AB 5AYQA 1D5XB 2FGWH 4U1NB 4XPGL 1GGUA 4FOMA 2NX5B 3ZDXE 3CH1A 4D9RE 12E8H 2HLFC 2GCYB 4ALAL 5KJRH 3KPLA 1OW0C 1J05A 1CE1L 1W0WB 2GYSA 2AJUL 1UM6L 1RZIA 4U1IB 5L7XL 4RFEB 3MLXH 4I2XE 4KU1A 3LN9A 4ONHA 2F54A 4MAUL 5JPNA 3FFCA 5HPOA 2OBGA 2P24A 1F4WH 4JLRB 1S7WA 3QXWA 4L8DA 1NDMA 4O2FB 2ADIA 1UB5B 5C70A 2QADC 3S88L 3LMJL 1F90H 2I07A 5E1AA 4I48B 1OTUC 5BZDA 3OKNA 2XFXB 1GPOL 3RWFA 4NDMB 4CDGC 2IAMB 2ITCB 3EHBD 4PJCE 3NTCL 2VLMD 5DEFA 1QFOA 5J57B 3IFLL 4L3CB 5IBLD 1MLCB 1WAAF 1P5UA 5GGVY 3PWPD 5H35A 1KPUB 3HI1B 3O45A 1BZ9B 1MCCA 1CFNA 4DVBA 4KJWD 1KBGL 3MLTB 4UTAL 1BD2B 5IKCA 4NBYB 1RZJC 4UT7L 4AK1A 3NFPA 4OI7A 2DOCA 2NNAB 2Y36H 4KXZI 3X13A 5IOPA 4ZAKD 4GW1A 4Y8AA 3QHFH 3NIFF 2R0ZL 1QHOA 1YQ2A 4N0UB 4OTXH 5HY9A 5C0CE 5FCUH 4YHZL 5E4EC 3C6LB 3T4AA 4XZUB 4BUGA 1JFQH 3QIBD 4PB0H 4PTTB 4K3EL 1DQLH 3EYVA 4WFEE 2OR7A 4N0YH 2APTA 2E7MA 4F9PC 3VW3H 4Y4HD 3FB5B 2OYPA 3VFNA 1S8DB 2DLTA 2R8SH 4CU8A 3LQMA 2UYLB 3T1WA 5E00B 4XCYA 4HKZA 4PRID 1IEHA 5BQ7A 1NANI 5SV3A 2VLKD 3NFNA 4MDIA 3C5ZC 2YBRA 5I8CA 4NN6C 5EZLA 1FV1A 5LXGL 3GSXB 2IFFH 4NQDB 5LQBL 3K1KC 1V7NH 2AKRB 1YDPA 1DBJL 3CLFL 1ZHKA 1IAOB 1KLUA 2Y4SA 4DZBB 4ZFFA 3RY5A 3C9NA 3H8NA 1CGWA 1Q9WA 3RX7A 4M03A 4XHJC 4IIQC 4Q9CA 3AS2A 4Y4KD 4J3VA 1LEIB 1M7IA 1HI6A 1A6WH 1MF2H 3TLRA 4CL7A 3R8BB 1QTYT 5K9JH 1JUFA 5CJQH 3WFHA 5CZXC 2H41A 4NKMB 4XNUH 4LP4A 5CBAA 1RI8A 4X7EC 4FNLL 1LDPL 1OGAB 3WIHA 5ABDE 5FGBA 3EUUA 1E4WL 4LHUA 4HWEL 3L5IA 4HWBH 4FFVD 5HJ3B 4YHIB 5D7JD 5FHAH 1CBVH 2EYTB 2Y5TA 1BVZA 3TO2A 2QL1A 3U7YH 1INEL 1N2RA 5IF0B 2BY0A 3TNMB 1V3KA 1NGYA 3KYOB 5GISH 1F2XK 4E5XA 5F9WB 3OGOE 3BVNA 4ODHL 1HHGB 1RIUL 1RURH 2VN7A 2Z31D 1JPFA 3D39B 4PJAB 2QQQA 4XTRD 4ZXBD 3BH8A 2FIKB 3MJ8B 4XBGB 4OFIA 3KYNA 1B4JL 1YY9C 4LCWE 4LMQI 5EB9A 5DFVD 5F9AC 2AK4A 1T83A 3K81A 1RZKL 5EO1A 2VUOA 2V2WB 4Y5YA 5E5UB 3SKNB 2IPKA 1CFQA 1VB9A 2DWDA 4OZHE 5FOBB 1JK8A 2X70A 4IMLA 3O6LH 3I6KA 5F3HB 2HT4D 2RHEA 3E3QE 5JO5B 4QOKB 3TBYA 3SQBA 1S9YA 1IC5H 3W9EB 1VFOA 1RZFH 4UINH 2A6JA 2Y7QA 3KPOB 4MJIA 5FA4A 2CJUL 1ZK9A 4Y8DC 5LKNA 1JMZA 4X83A 2V2TB 1QZ1A 3P4LA 3PE9A 3WXVH 2CDEA 1YNTA 1G84A 5C0FA 3ULSB 1N0XL 4ZUWA 2LQRA 1BWMA 4EUPH 5CINL 1FZMB 3IDXH 3DUSA 3ARWA 1PD6A 3MOQA 3O6ML 4XI5D 4Z7OF 1CVSC 1PJ9A 1R6VA 3ARXA 1HCFX 3MLWL 4EOWL 2BC4B 2D03L 1T5WB 2VC2L 3MREB 4U3HA 3AAZB 2VWEC 3LQAL 4M7LT 3GB7A 3P4MA 3IS0X 1I7RB 5E5MB 3HMXL 1KJ3L 4LDOB 3MA7B 4DGVH 4X5XB 2HVKA 3VI3E 3BDBA 4JRYE 4Y16A 2VN4A 5JZ7C 1BGXH 3OZ9H 5LCVL 2FR4A 4Z0XB 3A0OA 4YHYC 4PJFA 4IRSC 5JLZA 3O3EB 4G8GB 3H9SE 3CMOL 5D6DC 4XAKD 3CFJA 2FCBA 2EDTA 5F21B 2I9LA 1T89A 5C0BE 3C6SB 2VUYA 1DUYB 4I18A 3P30H 5M94B 1S7UB 1NCDH 2VLRB 4G8IA 2GJ6D 3NH7H 2OI9B 4M8QA 4GG6F 3I9GL 2XQYK 4FQHB 4I3SH 2CSPA 4U2YA 4D9RD 1UH3A 1HHHB 1IKNC 3CCHB 3VA2C 5KJRL 5T3XD 3EKCA 1HXYB 4R8WL 4IBLT 3WIFB 4YE4L 2EC9U 4NZUH 5FEBA 4HKBB 4Z9KB 3ZYIA 5HHQB 2BVYA 3VXUA 3MLXL 3NA9H 4LLMB 3PWNB 5GJTL 3TP4A 5D2NE 1F4WL 3DWTA 5CGYC 5DJAB 3HI6H 3QQ9C 1EZVX 4OGXH 2LTQC 4IDJL 3BP6A 5GS1A 5FECA 3DI3B 5DK0A 1OL0A 5IBTL 2DQGH 1YMME 1IQDB 1WGOA 4OBSA 4POZD 1RSFA 2YC1B 3K3QA 1U3JA 4KROC 5BRZA 4ELMB 3GRWL 2X89A 4HIEB 1GIGL 3NCJH 1OTTD 1NLDL 3W11D 2ZJSH 4KVCH 3IFOA 3VWKB 4RGNB 4YX2H 1KG0A 2FD6L 3F7QA 2ERJB 3ILQC 5C0DB 5CIPA 1N7MH 5MERA 3BPCB 1F13A 4Z7VE 1MH5B 2AI0L 1KNOB 5TDPB 5L88H 3ZSSA 4WW2F 5FGCB 1H15B 3ZTNH 4CADA 4YO0A 5DJXB 4ZSOA 5HHPA 3MRGB 3HC0B 1S9KC 5I0ZA 2Y36L 1KIPB 4L3EB 4JFFB 5HGBB 4MXWH 1DLFH 2V6HA 5C0CD 4OTXL 3MUHL 1D5XA 1OF2B 1HKFA 1HH6B 1Q94A 5FCUL 4HS8H 2NX5A 2NW3B 4PB0L 3BEWB 3E8UH 4D0BA 2GCYA 3CAFA 4WFED 4KZEL 1DQLL 4HG4K 3CUPB 5EN2B 3T2NH 5D2LE 5FO9B 4AY0A 4U1IA 3V0AC 4RFEA 4YPJA 2EDKA 1MY7A 2R0WH 4ODWB 1TENA 4G6JH 2QSQA 3IFPB 2R8SL 5F7DB 3HN3A 4P3CH 3GMLB 4JLRA 3BE1H 1TJGH 1LP9F 1TTFA 2YKLL 4RBPH 1OAYH 5DMGC 3CFCH 3PUCA 4LLVA 1QVOA 4EBQH 4P2OB 1V3JA 4KDVA 3WLBA 2IFFL 1F97A 1V7NL 5B38B 2ITCA 3NN8A 2N1KA 1AIFB 1N26A 2CK2A 4L3CA 3TYGH 4I0KA 2F54D 5EU6B 1X5ZA 4N8VA 1MLCA 3FFCD 3FQNB 2FATH 4PGCB 5ACMA 4YBLB 3HI1A 2IF7A 3EOTH 3RI5K 1BZ9A 4UQ2A 1A6WL 5K9JL 4X6DB 3MLTA 5CJQL 2DLEA 4XNUL 1BD2A 4TSBH 1DANU 4EQ2A 4FS0A 4YQXH 1TCRB 3KPSE 2NNAA 2MHAA 4HWBL 4MHHG 5F8QC 3EYUH 4FQXB 4N0UA 5FHAL 2LAGB 2DQCH 2WNGA 4K7FB 3C6LA 4LIQE 4XZUA 5HGAA 5IW1B 1ES0B 4X6EB 3GMPB 1Z9MA 5F1OB 4Y5XC 3LV3B 3DRTA 3FB5A 2HA1A 3GNML 4LDLB 4NUJB 2R2EB 4YDKH 4BZ1H 2O61B 1S8DA 3MUJA 3N1QC 1RURL 3PL6B 3Q6FA 5SWSB 5KN5A 5LWYH 5E6IB 2NY3D 2UYLA 1IC4H 3RIAK 4UDUB 2EDDA 1QSFE 1MVUB 4YAQB 4M6AA 1D5ZA 5KG9B 1W2KT 2NY0C 4POUB 2NXYB 1ZAGA 2DQJH 3JTSA 4PJ7F 2CLRB 1HYSD 2NY5C 3GSXA 4NQDA 3CDFA 2AKRA 5TH2B 1C5CH 4XNZB 2IANE 5INDB 5DJDA 1KSRA 3H9YA 2GSGA 4XRCB 3V4PL 3O6LL 1IAOA 4DUXA 4QTIH 3SGKC 3SKJH 3TPKA 1IC5L 3HZYB 3HR5B 1LEIA 5HYSB 3WXWH 1YEDA 3KPNB 3I2CH 4E41A 3G6JE 1NBZB 2RR3A 3MPCA 5DTFB 2YA2A 1OGAA 5GQBA 5GSVA 4BZYA 3IJYA 2QJDA 3PDDA 4S2SB 4ZO7A 3WXVL 2C1PB 5E2VH 3D3VE 5HJ3A 3HCVB 4YHIA 3L7FB 2ZG1A 1PKQB 3MNVB 3U0WH 3IDXL 5FA3B 5E4IA 3MOAH 1I7ZB 3P3YA 1E28B 4MJ6A 5IF0A 1WFNA 5DGRA 5EULV 3TNMA 3VWJB 3KYOA 5DURB 3JWOH 4U05A 3MQIA 4BELD 1HHGA 4KWUA 1DL7H 4AG4H 3D39A 2B8OT 4G7YL 4LHUD 4RAUB 4DGVL 5ERWB 4OF6A 4PJAA 4KKAC 4JRYD 1CZ8H 2X09A 3PWJA 2YUZA 2FIKA 3MJ8A 1WUNT 1ROWA 3OZ9L 2F15A 3U0TB 3AGVA 3SDAB 3H9SD 1UA6H 5HHOA 3VWKC 3VXRB 4P2CG 3H6JA 3QQNA 3LY6A 3S4SA 4PGDA 3GJFH 4EXPX 5FOBA 3QWOB 5F3HA 3P30L 5C92A 1QLEL 1NCDL 5L2KA 3W9EA 4HW6A 3PV6B 3NH7L 1MFDH 4JO2H 3WNNA 3KPOA 4I3SL 2UY7A 2XRAH 5FUZH 1ZVSB 1GGIH 3VXSA 4LLYB 3O41B 5SX5H 3RTQC 2V2TA 4OZGE 4NZUL 1F2QA 4NN7C 1GZQB 3ULSA 1H3GA 1JHLL 3NA9L 5EBLA 2O26U 3FQUB 3QDJE 4TNWK 2XPGB 2OQJB 3JV6B 4TULL 5FYKE 2R4RH 2X4PA 5D7IE 2KQMA 5JMRA 4PJXB 3HI6L 1I85C 1T5WA 4MJID 1WBZB 3MREA 3QUMA 4PRNB 2DQGL 1YMMD 4I0PD 2XTJC 3B9KB 5E5MA 3WDIA 3QUZD 4ODSH 4PLNC 3MA7A 1FNGB 4X5XA 3NCJL 1CK0H 2ZJSL 4KVCL 5GZOD 3MRHB 1BF2A 5FGSA 1G9NL 5HD8C 3QUXA 1CD0A 1E4XI 4YX2L 3V7AE 2VDQH 3O3EA 3ROOB 3HA0A 4G8GA 4WW2C 1VFUA 5L88L 3FAXA 2F74B 3Q5OA 4AZ8A 4HF5H 3ZTNL 4JM2B 2HFFB 3C6SA 3ARGA 2PO6C 2HYMA 3OR7B 3QB7C 3PNWB 4XP1H 2HWZH 1UFUA 2YD3A 3WD5H 4WRLA 3ARDD 2VLRA 32C2B 1G7IA 2E8ZA 2OZ4H 4MXWL 2C3GA 3B9AA 4QTHA 1H3UA 4X8JA 1DVFA 2DN7A 3O6KL 3RY6C 4FQHA 1L6ZA 4KRNA 5D1XB 2J6EH 2YR3A 4OUUA 5HYIA 3E8UL 4Q7DA 5IUSA 1HHHA 2R29H 1F4XH 1HXYA 1OLZA 3T2NL 5JR1H 3WIFA 2EICA 2IGFL 3QNZB 4HKBA 4G9FB 2AW2A 2KH2B 5HHQA 1KCKA 2DLIA 1X5FA 2R0WL 4LLMA 4LSTH 3PWNA 1TVHA 1MELA 2FIRT 4P3CL 4W4NA 3EIFA 3BE1L 1TJGL 3U4EB 4LLUB 5DJAA 2ZUTA 1FE8H 4GMSH 3PL6C 3QZWB 1OAYL 1UJ3C 1NFKA 2DTSA 2DL2A 4EBQL 3HZVA 5B4MC 1IQDA 2MKLC 2Q20A 4HK3J 5DWUH 1U95A 2X4QB 2YC1A 1A4JB 1SVZA 4ELMA 1MCQA 4HIEA 4PJ8D 2NXYC 1FP5A 4TRPH 4HGWA 3RIFK 4P4RB 2BNUA 3VXUD 3FHAA 1UH4A 2BSTA 3TYGL 3U9PH 3WL9B 4OZFG 5FK9B 1X5YA 4ZOEA 1WBXB 3U79A 2FATL 4NZDA 5IHUL 5C0DA 3BPCA 3PQYB 3EOTL 1RJYA 4L8SC 1MH5A 1T66D 1KELH 3E2HB 5TDPA 1TVDA 3P11H 3V6FB 1L9NA 2NY7H 1MAKA 1H15A 4TSBL 3ULVC 4FFZH 3SKUD 4YQXL 5DJXA 2AEIT 3KPSD 1MNUH 2X7LB 1AI1H 2R69H 2XV6B 4S0SD 3HC0A 5JOPE 4H25A 5I6XC 2H45A 1KIPA 3EOYG 3QI9D 2GK0B 3EYUL 4MCZA 4L3EA 4JFFA 2DKMA 2X44D 2DQCL 1OF2A 5IT2H 3RDTB 5JQHC 3LEYH 2NW3A 3O8XC 2Q8AH 4LDEB 1I7TB 4GKZB 3IAGC 2EIEA 3AS3A 1R0AH 4TQEH 3QUYB 2ZKHH 3K4DA 2UY6A 4YDKL 3MRLB 4NKQB 1U8NB 4CW1A 4ODWA 1AXIB 3IFPA 5LWYL 5F7DA 5FYLE 5B3NA 2VAJA 4ERSH 2H6PB 1IC4L 1QSFD 3GMLA 5F9DC 1BPVA 4C56B 5ECJE 4P9HH 4K3JH 1OAKH 3AREB 3UBXB 2FYYA 4P2OA 1TQBB 4HS3B 5GRVL 5F7LB 1JMXA 1QQDA 5B38A 2IAND 4HV8B 5E2JA 3CDYA 2DDQL 1G7HA 1A7BA 3HC3H 4GRWB 4WWKD 2WLYA 4H5SA 3LB6D 5DJ6B 4LCIH 3TIDB 4QTIL 5EU6A 5ILTH 3QISA 4PGCA 3KLHD 3ZTJH 1CTOA 4P48A 5F6IB 4PJGF 3QDME 2VOTA 3EYQD 3HE7B 3TJEH 3MRFA 3WXWL 3CPLB 3TZVC 1IEBA 5E24E 3X11A 5K93A 5LGHH 5FF6B 4D9LH 1D6VH 4OIIL 4ZDHB 1TCRA 2R1XB 2CUMA 3PHQB 1WZMA 4IOFC 3D3VD 1VEOA 4LSRH 4FQXA 3RGVD 1ZT4B 3MFFB 3U0WL 3ZKMD 4K7FA 3P73B 4KMLB 5IW1A 1EHNA 3MOAL 1ES0A 3SN6N 3GMPA 5IROC 1MFCH 4M1DH 1INQB 3JWOL 4ZFGH 3LV3A 1BQHA 4JPWL 4X0KB 1QSEB 4NUJA 5HVWA 4OCWL 2R2EA 4OLZL 3P0GB 1BFSA 3VFVB 2ZUWA 3AU1B 4JHWH 4G6FB 1BX2B 5E6IA 5EIIB 5B21A 4IOSD 2DM4A 4UDUA 3TVMC 4M61B 1MVUA 4K8RC 4YAQA 3MRDB 5KG9A 5BW7C 3L3HA 4MS8D 3MJ9L 1K3IA 2CLRA 4PJHB 1UA6L 1J87A 1Z2KA 3IDNB 4MMZC 5EU3B 5HYQB 5DUBB 5TH2A 2E6QA 5DD0H 5INDA 1M7DA 1NMCB 5GGRB 5HHNA 4XRCA 5DC9B 1NCAH 1XH3B 3HZYA 1S5IH 1T1WA 1VKXB 4XBPB 5E70A 3HRZB 4JO2L 5HYSA 4J4PD 4PRAB 3KPNA 1NJ9B 4YBQD 1NBZA 5I1CL 4JPVH 2NY4D 4PJ5B 3DETD 2FLRT 2OJEB 5FUZL 5DEGB 5AG8A 4QRTA 5GIRB 2PF6A 4S2SA 4RBPK 1QFUL 5CKAA 2M2DA 4V1DE 3HCVA 1T22B 3L7FA 1PKQA 3NZHL 4ZO9A 3AS1A 3BPOC 3MNVA 3K8LA 2WBJA 5FA3A 4KZDH 4KMTH 5FYKD 5IVXE 1QSVA 1I7ZA 3T0DA 1E28A 1JNLH 3PG2A 4EJ1C 1FH5H 4NO2B 3FN9A 2Q86B 4E41D 1ZOXA 4OSUH 2W1NA 2VXQH 3OWEA 2PYEE 1DZBA 4ODSL 1W72B 4PRHB 4RAUA 5T3XH 2E9BA 4NZTL 5ERWA 3FN0H 4J7RA 1A64A 1MCFA 4AQOA 4Z6AT 4YEFA 3SY0B 2VDQL 5ESQB 1DQMH 3U0TA 3I3BA 4Q58C 3SDAA 4NN5B 1AY1H 5T1LA 3VXRA 1Q1JH 4AL8H 5MEQA 3HE6C 5F7WC 3QWOA 3S35L 3X14B 1CQKA 3WD5L 4R9HA 5J6GA 3ZDZF 1QFPA 5D8JL 3G5XA 1MQ8A 3K74B 3QULB 1FNFA 2YHGA 2IH1B 4D8PB 4YJZL 2J6EL 3UJJH 4P23B 3TO4D 1ZVSA 3QPXH 1OP3H 3KPMB 4TUJB 5HHOD 4NFBA 1CD1B 5T5FL 5JR1L 1GZQA 3GMMA 1KOAA 3FQUA 2W60B 5E9DA 2XPGA 3JV6A 4LSTL 5L2KD 2ORBH 2Q7YB 1EMTL 2ITDB 4PJXA 1JZ7A 3V6OC 2COQA 3ULUE 4LSSH 1YNKL 4GMSL 4RMVA 3UDWC 1WBZA 4WI3A 4OIAA 2DRUA 2QHLA 4PRNA 3S36X 3VXSD 3MRBB 2DF3A 1P69B 5T1MB 4HIHB 5EZOH 2EECA 2ZG2A 3V4UH 4ODVH 3B9KA 5DWUL 4LLQB 3CSYA 1JZ3A 2GTWB 3IXTB 4TRPL 3TBWB 3MRHA 1G9MH 4N0RA 3U9PL 5GRJH 1MFEH 1KJ2L 7CGTA 4HEME 4GW4B 1RHHA 3O6FB 1KXQE 2YSSB 3WBDA 3ROOA 1LNUB 5DEZA 2BSSB 5C2BL 1KELL 4KPHH 3VFGH 4LPCA 5C8JB 3DVNA 2F74A 2NY7L 3EFFB 2RAMA 1RJZB 4JM2A 2HFFA 4S1DC 5F6IC 2EO9A 3OR7A 1MNUL 3PNWA 1AI1L 1BFVH 2R69L 4YGVA 5JOPD 4G8EA 4KV5F 32C2A 4JVWA 2VABB 4KUCD 3WSQH 5HI4D 3A67H 2YOCA 3QUXD 5IT2L 1N0LA 4K3DH 5D1XA 2VQUA 3Q48A 1GZPA 3JSSA 5C0EB 4X6CE 3VXPB 3VD4A 1MQKH 4PJDB 4ZOCA 5IVOA 1QUNA 1VGKA 2C3HA 4HCRA 4TQEL 2EDRA 2ZKHL 3FCTB 4G9FA 3GIVB 3ARGD 3OJ2C 4LSVL 1G6VK 1YY8B 4RMRA 2B1AH 5FYLD 1FGVH 4ERSL 2HVJA 3U30C 3V79C 3WFEH 3SDDC 3U4EA 2DQEH 4LLUA 1TMCB 2BVPA 3GJFK 2VNCA 1DVFD 4N9OB 3QZWA 1B0GB 4P4KC 4K3JL 1OAKL 4P9HL 4B0MM 1VHPA 5TQ2H 1K4CA 5IV2A 3SBWA 3RPIA 2QKIB 2X4NB 1A6UH 1KTLA 2V5TA 3QEQE 4L5FH 1MCOL 5EA0H 3RNKB 3TFKC 3DYMA 1JJUA 5SX5K 3WL9A 1P4LB 4B7IA 1F8TH 1CICD 5ILTL 1WBXA 3W0WE 5HI5D 3QDMD 3TJEL 4KK8D 2C4FU 2X10A 1GGCH 5LGHL 4D9LL 4JZJB 1D6VL 1OM3L 4HFUH 4DTGH 3ZDXF 1WZLA 2AV7A 2ID5A 2F58H 4LSRL 2Q7NA 2J12B 2DBLH 1NCUA 2H26B 3RDTA 3O11B 1QACA 2FRGP 3BXNA 5DMIH 4NQTA 4PLKD 4RWYH 4YC2C 1MFCL 4RZCB 2BXZA 4CN1A 1I7TA 2HT2C 4M1DL 1CIUA 4M00A 4O5LH 4AENB 2JKXA 4K94C 3G04A 1U8NA 3FFDA 1C08A 5IB4B 3STLB 4GRMB 4XCEA 1QR1B 2BJMH 1KCSL 2H6PA 1I8LC 4QKXB 1MPAH 2VXVH 4ZS6C 3S98A 2IH3B 2YUVA 2VERN 1UZ8B 1CXEA 3AREA 3UBXA 1G9EA 4PJCF 4EIGB 4R26L 1WZ1L 2A0LC 3QO0B 3WEXB 4HS3A 1FL5A 5D7LE 1T7XA 1ZHNA 5DJ6A 2DQIL 5TDOB 5BV7H 1MWAA 3RBGA 3WIHH 4JFQB 3FO9A 5HYEA 1S5IL 3FL7A 1KIRB 4WHTA 2APXA 5I73B 3HE7A 1NCNA 2BHYA 4QCIA 3CPLA 4HUWB 1FNEB 3T3ME 4JPVL 3T0AA 5FF6A 3D1MC 1EZVY 4ZDHA 1T0NB 2R1XA 3MFGB 2X1OA 3PHQA 4KUZH 1HHIB 5EDXA 4V1DD 3VI4E 3SCMC 1REIA 1RK1B 4KY1H 3QIWA 1S3KL 1ZT4A 1MUJB 4LASH 2EDQA 1FHGA 1PGRB 1VFAB 3P73A 4NWTH 4XP4L 4C57C 3GJEA 4KZDL 3MV01 5GS2H 4KMTL 3RI5F 2AEQH 4CDHA 5ANMB 1JNLL 2XQBH 1INQA 4MJ4A 1QPPA 4J3OC 4OSUL 3Q5TA 4KK6D 4L4VE 4EI5B 2VXQL 3VFVA 3HFML 1I1RA 4U1HB 3AU1A 1CLOH 5T3XL 5FYJD 3FN0L 4N1HB 3FRPG 4YR6A 5D71L 3LDBC 4M61A 3SE9H 1T5XB 3F6LA 1R24B 4MJ2A 2ARJB 4J1UB 4M7LH 5MI0C 3QIUC 1DQML 5C07E 4KFZC 4PJHA 4LCCA 1AY1L 3UPAA 5HYQA 1S78D 3IDMA 1C8PA 1PBYA 2ED9A 4AL8L 4Z76B 4O2EA 2CDFA 4X7DC 3S35X 5T5NF 5GGRA 4S0TD 3R06A 4XCNA 3RIAF 2APFA 1NAKL 1XH3A 1HHJB 2DQFB 4D0CB 5E99H 1I8MB 1VKXA 5CJXA 3UTQA 1I3VA 2NTSP 3HRZA 4PRAA 1U8LB 1G7QB 4XP9H 4PJ5A 4OFVA 3UJJL 4LOUD 5DEGA 2FSEA 4MA7H 5I76B 4TSCH 3F7RA 5INCB 5I16A 4NJAH 1JE6A 1KCVH 3WNOA 4FFWC 4PYHA 1GRWA 2WQRA 3O2DA 1I3RB 2ORBL 4PB9H 3LD8B 5DHVA 3KPRE 3IDIB 5D6CB 4WCYH 1ZLWH 3ULUD 1EGJA 3HRPA 4LSSL 3FT2B 3ARBB 4LU5H 1CGSH 3EO0B 3TT1L 3OR6A 3V4UL 1L7IH 3MJ7A 4NNPH 2Q1EA 4PRHA 4I5BB 5C0NC 5I30H 2K1MA 2PW1B 4YXKH 1U3HC 1SY6A 6FABH 2WBJD 4F9PA 1G9ML 4U31A 3MR9B 2YUWA 5GRJL 1MFEL 3ECBA 3SY0A 4OZHF 4JCMA 1JGLH 2KKQA 2FWOB 4KPHL 3B3IA 1YEEH 5ALBH 3SDCB 3EDKA 4L1DA 5IQ7H 3MODH 5CGTA 1QFHA 1XF1A 1C7SA 1FO0B 2FDBP 4MA3B 4Y2DC 3SO5A 4MVBC 4OV6F 5C08B 3BZEA 3H3PH 4KK9C 5AG9A 1WLHA 3CC5B 4WO4C 3F5WB 4K3DL 4D8PA 4ELKB 4CMHC 5I1HH 5T3ZD 1GYAA 1E4KA 2JK5B 3VGDA 3KPMA 1FFRA 2AABH 3FO0H 4L4TB 4TUJA 5T1LD 1MQKL 1CXHA 3VMNA 2AAVA 2MCPH 1CD1A 2GQHA 2YD8A 3MV8E 4XP6H 3PP4H 1MJ7L 3IAQA 2YXFA 4ZPTA 3JWNC 1HILA 4OD3L 3O4OC 1FGVL 1LO5B 1EJOH 1ZMYA 2Q7YA 3HNVH 4TUOA 2ITDA 4NJ9H 1D6EA 3MYJB 2RCSL 3U4BH 5KANI 4NCDA 1WT5C 4J8RA 4NNYB 3JV4B 1YPZB 3VI3F 3KXFB 2PR4H 1F00I 1RAMA 5KS9E 5T1MA 4HIHA 4P46C 3TESA 5C3LD 3DYOA 5CIPH 1A6UL 4LLQA 5EC1B 2FX9H 5E1HB 3QEQD 5HDLA 3IXTA 2B5IB 3RZCD 4TNWF 3ARYA 4L5FL 2OXHA 5GRXG 5EA0L 5FKPA 2CMRH 5E9DD 1F8TL 1I1AB 3W0WD 3G6DH 3O6FA 2YSSA 1A6VH 2V2XA 3QR2A 2BSSA 3MBED 4XX1G 1P2CB 5C8JA 3P2TA 3OAZH 1JF5A 4KI1A 4F37K 1ZSDB 3EFFA 1GGCL 1RJZA 4S1QH 3STZB 1ONQB 4Z95L 4URTB 2V9TA 3L9RB 1IGCL 2F58L 4OF0A 4XAWH 5DT1H 3HKFA 1NBYA 4OLVH 3X12B 3WNMA 5FO7B 3BUYB 3MLSH 5T1DL 1A7NH 1UKSA 2X4RB 1DLHB 5F89B 5C0EA 3VXPA 5MENB 3CXHK 4WEBL 1JZ6A 1K6QH 4QYOB 1J0JA 1NDGB 3V8OA 4ESKA 4Z7QE 3B8YA 4XWGH 1I9EA 3MLZH 1S7VB 3GIVA 2GHWB 1H5BB 1TPXC 2BJML 3S9DB 1P4IL 1RMFL 1VENA 2X1XR 1HSAB 3N85H 4AEIL 1P84J 3HC4H 2VXVL 4EZMA 1T20B 3CJJA 1T2XA 2FO4A 5KVFH 1DBBH 1TETL 1RZKC 2QKIA 5J13C 3ZE0E 2X4NA 4PY7B 4NRZB 5JUEH 2ZCKL 1B2WL 4JREC 2XQYG 4Z7VF 2YPLE 3LEXB 2CPCA 2YS4A 1OP3K 3S5LA 1CXFA 3IRZA 3IDUA 2AEPH 2X2YA 1P4LA 5ICXB 1OAZH 4X99B 5DJZB 5TFSL 1FZJB 3OG4B 5F7YC 3CFIC 4JKPL 2HFGH 2VXSL 4G6ML 3VU2A 4MB3A 4BSJA 4EQ3A 4JZJA 3PIQA 1QBML 2Q76B 3RIFF 5IM7A 4KUZL 3UZEA 5SWZE 1XIWD 5D5ME 3K2MC 4KY1L 1V7MH 4LASL 1WWAX 2H26A 2IBBA 4NWTL 3CZJA 5J11C 1C16B 2V5MA 3QDGE 5D2LF 5MEPA 1KB5B 3BP7B 2AEQL 3L3JB 2IWGA 4G3YH 4RZCA 4P5TC 1YMHA 2XQBL 3CZFB 1TITA 1MCIA 2ZUVA 2DM3A 3CFBB 4L4VD 3GDBA 5F7FA 2LABA 4G43B 4PYGA 1GHFH 4GRMA 1QR1A 1KTRL 1CLOL 3C60D 1K8DA 3T3PF 5DK2B 2K9UA 4LSQH 5FM4A 4NQVB 3I75B 3SE9L 1UZ8A 3UO1H 2AP2A 4PUBL 4Y4FB 5C07D 4M7LL 2KBGA 3QO0A 3LH2H 3RL2A 5F7UA 4P0DA 1XFPA 2M8XA 3GSUA 3SE4C 2E5EA 1P6AB 4JDVB 3DPBA 2B0SH 4G9DB 3L5XH 1ZGLP 3IKCB 4JO1H 3UEZA 5E99L 1T6WA 4HUWA 1FNEA 4XP9L 5GSRB 4JFYB 1WAAA 1T0NA 1T3FA 4RGOH 3V5KB 4KRPC 1GH7A 3D2UD 1HHIA 2VZUA 3TM6A 4OKVB 1KCVL 1MUJA 1VFAA 4FTVA 3LHPH 1ZHBB 3KPRD 3P4NB 3NABH 2VWEE 1OCWH 5ANMA 1PG7H 3K1DA 1GL4B 4AT6A 3MZTA 4GBXC 1RJLB 3ARFB 4LK4A 4LU5L 2R0LH 4FXGB 1MCWW 5C86A 3E6FB 4PJIE 4EI5A 1L7IL 4N5ED 1OSZB 4RMWA 4U1HA 4NNPL 3LPFA 4OFYA 3RPKA 5I30L 3QIWD 4YXKL 5E2WH 4OM0H 1T5XA 1NEZG 6FABL 2ARJA 2CKBL 4I0CC 4J1UA 3E3QC 3ES6B 5I1EH 1JGLL 3DHMA 2P5WE 4ZODA 2E7LC 5EWIL 5EC2B 3VFUB 1FYTB 1YEEL 4OJFH 5ALBL 1MHCA 4Z76A 5IQ7L 1IGYA 3MODL 2E7HA 4NO0A 1MAML 3DMMC 4PJ7B 1JGEB 1MCKA 2H3NB 5GGVL 4HQQH 1HHJA 2DQFA 1I3GH 4D0CA 2HLFD 3H3PL 5DSCB 1P1ZB 1I8MA 2Z4QB 3UC0H 3T4YA 1U8LA 1J1XH 2P8MB 3LRSB 5CEYB 5KSBE 3WHE0 5B8CC 1RHFA 5I1HL 1CFBA 4WI6A 3LOWA 3FO0L 1IGJA 5BS0A 3MV8D 3DX7B 2MCPL 4XP6L 3PP4L 5INCA 3ZT6A 1RU9L 3QUMH 1OHQA 4UAOB 2QADD 3OJDB 1JYXA 4DQOL 1R3KA 3GI9L 1EJOL 3BX7C 1OTUD 4NJ9L 1YNLH 4S1SH 3UYPA 5CEZE 5IB1B 5D6CA 4DZ8B 5FXCH 2UV3A 3FT2A 3ARBA 2FHCA 1KGCE 3ZDYE 3MMEB 3T0WA 5J06A 2PR4L 2JJSC 3EO0A 4JFDB 4G5ZL 1JPSH 4I5BA 3OPZH 3O9WA 3DV4B 2PW1A 4LVHC 2X1PA 3MRKA 4OCLC 4S1RH 2LU3A 3CFKB 3QPQC 2BRRH 3G6DL 4EIZC 1EEUA 3B6SB 4LGPB 2FWOA 2R2HB 2EXWC 3SDCA 4S1QL 3I50H 4HH8A 1UGNA 4JO4L 4JN1H 2BDNH 1SYVB 4MA3A 1FO0A 1T1YB 5C08A 2DJ4A 1FNSH 1K4DA 4A2MA 1S9VB 4XAWL 5DT1L 1U2HA 4OLVL 3MLSL 5D1ZB 2XNAB 4LPYA 4OZGF 3F5WA 4RDQF 3T08A 4DUWA 1N59B 2NXZB 2JK5A 3S96A 1XT5A 4WHDA 4L4TA 2AJSL 3AXLB 3RNQB 2UWEF 4J23A 3SQOH 3RP1A 3T8XB 4JJ5B 2I60H 1KULA 2D0FA 1T80A 5HHMB 5J1TC 3BZ4B 1QBLL 3N85L 3MYJA 1BLNB 3C5ZD 3W82A 2PW2B 4NNYA 3VGHA 3QRGH 3JV4A 4A2LA 1HWHB 1YPZA 3GRWA 4UB0H 3GGWB 3HG1B 3L1OL 4K7PX 1QG3A 1UXSB 1DBBL 1MRCH 2Z8RA 1BEYH 2D3VA 3DIFB 2MQ3A 5DJYB 5KSAB 2JLLA 5EC1A 4XHJD 5J7CC 5B39G 3B9VA 1FC1A 4AIZB 4F2MA 4ZFZB 3F7YA 1A5FH 2AEPL 4PY8J 1I1AA 4P57B 3QP3A 5CZXD 3QNYB 4XPHH 4FP8H 4QOKE 4PP1C 1EERB 3MV9B 1NC4D 3VGBA 4KRLB 1SQ2N 4MNGB 1P2CA 4NO5B 2HFGL 4FMKA 2JJTC 1U3ZA 1ZSDA 3D18A 2P42B 3EO9H 1FC2D 3STZA 4I3GA 4B7LA 4HC1L 1ONQA 5F72S 1ZLWK 3ZSTA 1HIML 4IOIB 1ZGLA 1V7ML 3X12A 5FO7A 4R90H 3A6CH 1EFXD 3QDGD 4OQTL 4JDTH 4OBRA 4NRYB 5F89A 4X4YB 2EH8H 4QYOA 3U9UA 1RFDL 4FMFA 3ZO0A 1TDQA 1V05A 4ODTL 4QXWA 5C0AE 3HAEH 3BPNB 1Z9SA 4HXAH 1H5BA 1YY9D 3RRQA 3VXOB 1YQVH 4KK5C 2Z8WC 1T20A 4DKFL 4LSQL 4CMMA 3O3UN 3UO1L 1BQLH 1AO7B 3LH2L 2YD5A 5EU4B 5FYKL 1KPRB 1U8OA 3SO3C 1F02I 5E7FA 2IMNA 3AROA 4YGAB 4PY7A 3EGSB 1D9KC 4LPVA 5MEOB 4NRZA 4WNQB 1IKFH 4G80B 2B0SL 3LEXA 1QR4A 4HIXL 1I85A 4YDJB 3G6AB 2P8LB 5AWNH 1TZGL 3L5XL 3ZE1E 2WIIB 3CSGA 5ICXA 2W9LA 6CGTA 1EK3A 4JO1L 4X99A 2X1WL 3CSBA 3QHTC 4R4BB 5DJZA 4TTDC 5FYJH 1J0IA 1L0YA 3KWWB 1IM9B 3S3JA 2E27H 3R0MA 4P2RB 1CF8H 1BJ8A 3NCYS 1KPVA 4ZS7L 5AUMB 1QKZH 4QHUB 1R5IB 3S3SA 5DDHB 3GK8H 1P5VA 3MXVH 2JB6B 4NP4H 1CD9B 1JN6B 1KB5A 1T7YA 3VGAC 3FT3A 3L3JA 1OCWL 5L9DH 3CZFA 5L0QB 3NACH 4NQSB 1MCBA 4P59L 3CFBA 4NBZB 5JZ7D 4EI6B 4G43A 3MRRB 2VL5B 1IEAA 3NIDF 3MLRH 2FJFB 4IRSD 3U7AA 2FX8H 4EUPG 5E2WL 2PXYB 4C54A 1EEQA 4NQVA 4OM0L 4Y1AB 5BZWB 3X3FH 1KC5L 4YLQT 4Y4FA 3G08B 4PBXA 4NFCA 2IBZY 4JB9H 4YH6A 2P5WD 1N6UA 1V8HA 1XAUA 2ED8A 3KS0H 2NPLX 3KPPA 2YPKA 4OJFL 3V9FA 4GG6E 1F45A 2YWYA 3MV7B 5HVFB 4JDVA 4KTEH 4Y89A 4HS6B 5E8EB 2AJYL 5FUCC 3RUGE 1XF4A 1U8KA 3ZL4H 1I3GL 3IKCA 4FN0A 3FRUB 4TNVK 1A6ZB 3UC0L 1J1XL 2OP4H 3V7MA 3RWEB 1P7KB 4JFYA 4I9WD 5I1GH 4J3WA 1IBGH 5E08H 5JDSB 1DQDH 4Z7UE 2H32A 1YJDH 2IQ9L 2J8UF 3U7WH 3V5KA 3OL2A 4JG0H 4HZLA 1A2YB 1ORQB 5EBGA 5CGYD 3D69B 2NXZC 4OKVA 3QQ9D 5E8NB 2MKWA 3QUML 4C55A 5D70H 3W2DH 1SBSH 5GS0H 2ZUQC 1ZHBA 3P4NA 5BMFH 4S1SL 1XGYH 3RWDB 1IVLA 1ZV5A 3QBTB 2UZIH 1RJLA 2XTJE 1KGCD 5GZNC 4KROD 3CFEB 4MLIA 5GGSA 4OZIB 1JBJA 5GJSH 2UVFA 3TPUB 4FRWA 4FXGA 1AGEB 3TGXA 1QLFB 2A6KA 8CGTA 3DO7B 4YFDB 4O51B 4QXTB 4QT5B 5T3ZH 5AYUL 1JZ5A 3OPZL 3ILQD 1N5AB 3FO1B 1FDLH 4HAGA 2AQ2A 3I3EA 5FHBH 4FTVD 2BRRL 1SM3H 1Q38A 3ES6A 1KUMA 3EJJX 1SEBB 3D5OF 2DLFH 4WV1C 3KHQA 5EC2A 5TE7H 4P3DA 3VFUA 1FYTA 4J12A 4RNRB 4X6DE 3I50L 4OI8A 4JN1L 2W59A 2BDNL 4OQ1A 4PJ7A 1JGEA 5JHLH 2HN7B 1RUPH 2H3NA 2ICWI 2B1HH 5JPMB 4WGWB 4AIXA 1NAMA 1FNSL 3LKRB 1P1ZA 5DSCA 4GH7B 5KANG 2Q3ZA 3QJFB 3O0RH 3SEPA 3PWPB 1IQWH 2P8MA 3LRSA 5CEYA 4IMKC 5ACZB 1NQBA 3REWB 4XVJH 3MC0A 4Q6IB 4RAVB 4PJ9C 1ITBB 4TN9A 2M1KA 3BZDA 1LP9E 5IVXF 3VXMA 5TDNA 2F5BL 3TN0C 3LS5L 3SQOL 4OB5H 4NO0D 2I60L 5JXEA 4I77L 3OJDA 4ZAKB 5DMGD 5I1AA 3TZVA 5SWSE 1BMGA 3BGMB 5B22A 5IB1A 5J1AB 1GC1H 5EOQH 2HMIC 3QIBB 3QRGL 4JR9L 3MMEA 4UB0L 1FRGH 3SJVA 2HG5B 2X9WA 4Y4HB 4CRPA 3U0PB 5F93C 1MRCL 5BS0D 4O2CB 1BEYL 4HSQA 3WJLC 1EEYA 5F96H 1KJ2B 1AHWC 4ZNCD 2C4FT 4GAJL 1BQSA 3DV4A 4R7DB 1ZTXH 4TSAL 3X17A 4D0DB 3CFKA 1CFTB 1A5FL 4XMPH 3SDYL 1HH9B 5IFAH 4HZAA 4FP8L 4PRIB 3O3AB 3ULVE 1MIML 4X4XB 5DMKB 3B6SA 2VLKB 4R2GD 1F3RB 2VDPH 2R2HA 3EO9L 3TVMA 2BZDA 1FBIH 4HPOH 1G0XA 5DRZB 2EO1A 5DHYB 1GAFH 1SYVA 4CNIB 2ARWA 1PX4A 1T1YA 3O9WD 4HT1H 1S9VA 4HCRH 1A3LH 4HPYH 4R90L 2A1WH 3A6CL 4HDIB 4L9LB 2XKNB 5IWLC 5D1ZA 4Y4KB 4JDTL 1ADQH 2GT9B 1N59A 1T7WA 4E42B 2YN5A 2EH8L 1AD9B 2Y25A 4UT6L 5DUMH 3RNQA 1AXSB 1FL3B 4Q97A 3T8XA 5C0AD 3RVWC 3ULUF 3D0VB 3SKOB 1P53A 4HXAL 1J1OH 2NY0D 4LPXA 3NMEA 5D7JB 3KYAA 3BZ4A 1YQVL 3ZHDA 1BLNA 1M05B 1UB6B 2DMCA 2PW2A 5ELIA 4LKCB 4U4BA 4YK4C 3GO1H 3MUGB 3GGWA 3HG1A 4KC3B 4JY4B 1BQLL 4YDLB 5BOZG 1QPXA 1QEWB 2B4CC 5DJYA 5KSAA 2J4WL 3LKSA 2HH0H 1IKFL 1FAIH 1YYLH 2NCMA 4HAFA 2Z31B 3B2VH 1T4KB 5J4MA 4ZXBB 4GKNA 5AWNL 1F3JB 3OQ3B 3QNYA 2APVA 1HZHH 2EH7H 3F58H 1YC7A 5FYJL 3PWVB 3I02B 4MNGA 5GRWA 4NO5A 1JZ2A 2CDGB 1CF8L 2R1WB 4JFZH 1QKZL 3FZUC 1J11A 2XZCH 3UJIH 4NIKB 5TGBB 3GK8L 4F3FB 4YNYB 3MXVL 4IOIA 4X6CF 1Q9KA 1JIBA 1SMAA 3LQZB 5IEHB 4X4MA 1HSBB 4OV5B 4NRYA 2H1PL 2BCKB 1Z0NA 1XF2B 2AXFB 5CGMA 4MB5A 5L9DL 4XNMB 5ETUA 2ZSWA 3DECA 4NWUH 4KKAD 4JFOB 3H9HB 4U1SB 5DZNA 4ZPVB 2FLBT 2NY6C 3BT2L 3VFOB 3MLRL 1X3DA 3VXOA 1TVBB 1UM5H 3BIBX 2FX8L 2PYFB 4U1MB 5D72H 3J7HA 1Z3GH 2HLAB 3HZKB 2AJXH 4RMUA 3X3FL 5C09A 3UTTE 3QXAB 4G42B 1AO7A 2VE6B 1LK3H 1MWAH 5EU4A 1KPRA 4HLZH 3EGSA 5MEOA 1JNJA 3ULUL 3UP1A 4WNQA 3WE6B 5A2FA 2A74B 1HNFA 4JVPA 4KTEL 3DO3A 1FN4B 3FQRB 3K2UH 3LN5A 1Q9OA 4YDJA 3G6AA 3BW9B 4OCMC 4YHMH 2WIIA 3MLVH 2EXYC 2AXHA 1ZKAA 3RTQD 4R4BA 1S5HB 4NKOB 3KWWA 1IM9A 2OP4L 2DAVA 1FFPA 1X5JA 5H8DA 2L7JA 5I1GL 3B83A 1AKJD 4XPTL 5AUMA 5E08L 4WUUE 1DQDL 5IMLA 4R3SB 2Q8BH 1YJDL 2APWA 1BJ1J 5DDHA 3IAPA 3QNXA 3KS0J 3BIAX 4BQBA 5C71A 2R9HC 1A02N 2DLHA 4KJWC 2I24N 5D70L 3W2DL 2GJ6B 1SBSL 1NFDE 3BDYH 3IDJB 4WI7A 5BMFL 1XGYL 1JGVL 2UZIL 2XTJD 4QHLB 1EVUA 4NQSA 1DBAH 3WJJC 5GJSL 4GAYB 1RPQA 1OTSC 4ORGA 2C1OB 1AXTH 1EO5A 4EI6A 4Z7WF 2WBWB 2D7OA 2JCCE 2CH8A 5HD8D 1OAQH 5T3ZL 2F53E 3QIBC 4I2XB 4NQEE 5TF0A 3SGJC 3MJ9A 1FDLL 3HTLX 2J5LC 4Y4HC 2PXYA 3V5DB 5FHBL 4Y1AA 5BZWA 3MRMB 1U8JB 2ADFH 1SM3L 3IJHB 5B3JE 2DLFL 2PO6D 1ZHLA 4QRRE 3DSFL 4N1CA 2A73B 3PQYE 5CUSH 5I17B 4XPFL 3TH4T 3WO4C 4NSKA 3MV7A 3L3GB 4MQSB 4B5EA 3MNWB 4WEMB 4MX7B 4PJCB 3T3MF 5JHLL 2AJ3B 2B1HL 1WIOA 3H0TA 3MRJB 3FRUA 4DGIH 1A6ZA 3CX2A 3RWGB 2MNUA 3MOBH 2UUDH 5E56A 2LV4A 5C09E 5F9OH 3VI4F 1P7KA 3W5MA 1KYOJ 3O2DH 5EG6C 5DVOA 5DO2C 5ESAA 5JDSA 4JM4H 5DHVH 1EXUB 4PJGA 3GKWH 3OKKB 5C6WH 4L9LC 4IJ3B 1RZJH 3VD9A 1A2YA 1EGJH 3S34H 1M4KA 2VDRH 4F7PB 3D69A 5E8NA 1I8IB 3V6OE 5FDWB 5C0CB 4GQPH 4FABH 3RWDA 1GC1L 3OKMA 5J12B 3BKYH 4XPAH 4OUOA 2NY1C 5B4MD 4C56E 1AGFB 1TFHA 4JQIH 3IETB 1FPTH 4P9HC 1SY6H 1BVLB 1FRGL 2XZZA 5D7JC 1MHHA 1AGEA 2ADGB 1QLFA 3FQXB 4QF1B 3DO7A 5EBWB 4HWUA 4KHXH 1FLTX 3IRPX 3QEUA 2RGSA 4WW1A 5F96L 4EDWH 1IAKB 2FJGB 4FQPA 4OAWB 5FV1L 4ONOA 1N5AA 3FO1A 4ODXB 3T77B 2W07A 4GRWE 2Z93B 1C1EH 3T0EC 4EN3C 3WHXB 1F42A 3ULVD 5IFAL 3DNKA 5KVEH 1QNZH 4QRQA 3LKPB 2Z31C 3RWHA 4Z0BH 2VDPL 1OD9A 3TYFB 3KPLB 2G5BA 2ICEB 5KTEH 4JFPB 4RNRA 1MCRA 4HPOL 1FBIL 4OGZA 3OB8A 1RZGA 1JL8A 3ARZA 5I8OH 3QQ3B 5JPMA 4IRJC 3L3IB 3PP3H 1PZUB 3O8XD 3LKRA 2F54B 2HAZA 4HT1L 5JPNB 3FFCB 1A3LL 3QJFA 4HPYL 2A1WL 3PWPA 1S7WB 2GJZB 2DKSA 1J18A 5ACZA 2CXKA 3C5JB 1ADQL 2ADIB 4Q6IA 2DQHL 4DKEH 4YDIL 3LPWA 3BESR 5DUML 3DRQA 3SPVA 2ILLA 3OGCB 4K23H 2VDLL 1DTUA 5L6YH 2AK1H 2YUXA 1QSEE 4WTWA 1UACL 1A1MB 5LGJB 4ZAKA 4XC3H 5DEFB 4HJ0C 2VISB 4NQCE 5A2IH 3BGMA 4Q6YA 1G6RA 5GS3A 2AXGB 1S7XB 3FB6B 2DD8H 1C7TA 1FVCB 1U42A 4RA0C 1MJ8L 4Y2OA 2X4TA 3D9AL 4O2CA 4PD4J 5IKCB 4XI5C 1KJ2A 3AMKA 3VXMD 1FAIL 1YYLL 3NFPB 4R7DA 5J3HC 3B2VL 2NY3B 1CFTA 5IOPB 4PGEA 5I2IB 4RGMC 3TZVD 1KV3A 2HJFA 2J8HA 1HH9A 4XPGH 4PRIA 3O3AA 3T4AB 4X4XA 5DMKA 4JY5H 3G5ZB 3I84A 1HZHL 2EH7L 4GO6B 4KQ3H 4NM4L 5CCKL 1EUUA 4ALAH 1U2CA 5HDQH 5AZEH 3VD7A 4JFEE 3V95A 1CE1H 4IOFD 2NLJB 1OB1B 2IBGA 3SJVD 1XZ0B 5DRZA 1PW3A 2AJUH 4JFZL 3BQUA 2QEJA 4OZHB 3UJIL 1ERNA 3VFNB 4CNIA 3WN5C 4Q9RL 4MAYC 2D7TH 3MO1A 3QIUA 1A7OH 4MAUH 4U1GB 2XXCB 3ISWA 3OXRA 1FYHB 1T03L 2DI9A 5FKAA 4Y4KA 3ZTJG 1D5BB 5DQJA 3DXAE 3VRIB 4C83B 2GT9A 4U1LB 4HKZB 1RK0A 4GLRI 1WIPA 5J56B 1IRAY 2P8PB 1AD9A 1D7FA 1JHKH 4UOJA 3BN9C 5I8CB 2ZCLL 1AXSA 3MLPA 4NWUL 3OX8B 2GSIB 3P4OB 4NOFA 3TVMD 4LCUB 4K8RD 2NY2D 5DS8B 4CVXB 5A2JH 1FZOB 5CBEB 1ZHKB 4KKLC 3EYSH 1UM5L 3HPLB 5KS9F 1Q9WB 2EDEA 1M05A 1X6LA 1Z3GL 4KQ4L 2Z35B 4PLJC 1QSZA 1WEJL 1JZ8A 4LKCA 2AJXL 4N5UA 3UTTD 3MUGA 3QCTL 4FQLH 5J8OA 4GAGL 1MWAL 1QEWA 3U82B 3QEHB 3BP4B 2XY1A 3HLAB 3RU8L 1YEJL 4W6XB 3LKOB 5GGUB 4LHUB 2HKFL 1LVEA 4NHCH 4JRYB 4APQA 1UC6A 4U0RB 4ZXBA 2R0ZH 4YHML 1VFBB 5D96B 4YHZH 4FQCL 2QSCL 3AUVA 4MZ2A 1MLBB 3TO2B 1S9XB 3QXUA 3D0LB 4LHJB 3PWVA 3I02A 4YHOH 1KLGA 1N2RB 3H9SB 4UV4H 4UQ3B 2CDGA 1OTTC 1KN4H 1NGYB 5F6HI 4NT6B 4WUUD 5EZJB 4XC1H 4ZNEE 5TGBA 4F3FA 4O00A 4WTZG 5IBUG 2Q3AA 4BFBD 4D94A 1JPFB 2D2OA 5IJKC 4N8PA 2R2CA 4NC0B 4LBEB 1J8HE 4X8XA 3LQZA 3BDYL 4Z7QF 5IEHA 4RRPG 4OV5A 4IJ3C 2ADJB 2BCKA 2AXFA 4NRXB 5DRWB 1DQQB 1OQXA 4OD2B 2H2SC 4LCYB 1P7QD 4XNMA 3HR6A 4JFOA 3EJZC 2GTZB 4U1SA 2CR6A 2DWDB 4GOSA 2F53D 2BHZA 3ARQA 1OAQL 1J0HA 4NQED 3VFOA 4XNQB 4Q9QL 1M71B 4WI4A 3SGDH 3I6KB 3KDMB 4PJFF 3MRPB 2PYFA 5D2NB 2HLAA 3HZKA 3ZE0F 3RJQB 3NOIA 1EA9C 4WI8A 3HE6D 1ETZA 2AJZA 2A6JB 2Y7QB 4G42A 3BKJL 4NBXB 4MJIB 4W81A 2VE6A 3UTOA 3CVHL 4QRRD 5CUSL 1OY3B 4TVPH 1YMMB 2XI9A 4I0PB 4AEEA 3FB8A 1FCCA 3WE6A 1FFQA 2A74A 1E4WH 3QUZB 2CDEB 1FN4A 3FQRA 3QCVL 3WNKA 1YNTB 4YFLF 1A7PL 4ZUWB 4QHMB 2ATKB 1IJ9A 3RVTD 2D9CA 3UTZB 1U8IB 5DD1H 2JF1A 1S5HA 1FNAA 4EDXB 5IESL 5C09D 4Z7VB 1WJ3A 3MOBL 4GS7B 5MHSE 5F9OL 5D5MF 5ITFB 2A6DB 3O2DL 1CQYA 4GAFB 5J6HB 4ODHH 4R3SA 4X80L 3GKWL 4PJDE 1RZJL 1EGJL 4LL9A 3S34L 2ENSA 2VDRL 3ARDB 2HVKB 2B7DT 2GJ6A 3IDJA 5E2UH 2FR4B 1A4KB 4FABL 3BKYL 4XPAL 2EIDA 1KB9K 4QHLA 3VH8G 4JQIL 1FPTL 3T04D 3UJTH 4GAYA 3HB3D 2DMBA 2DI8A 4WGVB 2C1OA 2L7UA 3JVGA 5I9QB 4UMGA 4FG6C 2CKBB 4I2XA 4F7TB 2KDGA 3V5DA 4MA1B 4YHNB 5F71A 1FGNH 1U8JA 4M8QB 3K8MA 2C3WA 3WUWA 3IJHA 5KVEL 4S1DD 2OR9L 1QNZL 4Z0BL 1IGIH 3KJ6H 3WS6C 2A73A 4Z77B 2CRZA 5KTEL 4JFXA 3L3GA 4UILH 5JW3H 3MNWA 4MX7A 4PJCA 5EUKB 4UBDC 4PJ8B 1KXVC 1QFWH 5I8OL 3VXUB 1S7QA 3O6MH 5EU5B 1ZLUH 1S7SA 2P49B 2VKXA 1HWGB 2D03H 2FZ3B 3IS1X 5CZVH 4WI9A 2RBLA 3TT3H 5FECB 5DK0B 4DKEL 3R0NA 1EXUA 3OKKA 3ZYJA 3KPSB 2GFBB 1LWRA 3GSQA 4F7PA 3SDDD 1KJ3H 2XXMB 2XWTA 1I8IA 4JAMA 3QI9B 5FDWA 2CR3A 4XC3L 4P4KD 5K59E 1U36A 3IFOB 4NQCD 1JVKA 5C0CA 4TNVF 1MJUL 3QQ4B 4PJIF 1KG0B 2BERA 4OFPA 5MERB 2EDWA 2X05A 1AGFA 5CIPB 2VMFA 3B5TA 3IETA 2DD8L 3CMOH 4M93B 3QT2A 1MCPH 4IHOB 4MSWB 2ADGA 4YPGB 1JHTB 3FQXA 3TFKD 4CADB 4BH7A 5F7NC 1IAKA 2FJGA 1BOGB 3T77A 1KFAH 4PG2C 1GJIA 2YN3A 1MVFA 3WHXA 5F1SA 1DR9A 2E9JA 5BV7C 3TEUA 1Q94B 3D87B 1RZ7H 2Y07H 3I9GH 1FO0H 1X4XA 5FGBC 2VQ1B 3LKPA 4JY5L 4KQ3L 3IDGB 3WDJA 1JI1A 4BA8A 4D0BB 5HDQL 4JFED 5AZEL 3TYFA 2DS4A 1NUGA 4R8WH 4ZO6A 3OAYH 2ICEA 2DYPA 4JFPA 3ARUA 5A3IC 3V52L 3MTRA 2IANB 4YE4H 5KSBF 4WWKB 5I75B 2ZSVB 3QQ3A 1I3UA 2D7TL 3L3IA 5D93B 4U6XB 1A7OL 5GJTH 2HT2D 5ID0B 1NGQH 2GJZA 3DXAD 5HI3D 3C5JA 5IB5B 5DD6B 3G6JB 2XG4A 4IDJH 4LLVB 4AQ1B 4J3XA 1QVOB 1EUTA 4ZOAA 5IBTH 1JHKL 3NCYP 3WLBB 3OGCA 3QXVA 4LKXB 1NC2A 4ZS6D 3GRWH 3NN8B 2IPTH 1A1MA 1GIGH 3D3VB 1UXWA 2IJ0C 2QV2A 5LGJA 1NLDH 3ZDYF 1T83C 3RGVB 2VISA 3O3BB 1BZ7B 4Y5YC 3EYSL 5K9OA 1OP5H 2A0LD 4N8VB 2FD6H 2AXGA 2E9IA 2ZP0T 1S7XA 2FEDC 2WWMD 3FB6A 1DUZA 4XCFH 4UQ2B 2AI0H 4FQLL 1FVCA 3ZMRA 4WFHD 1VEMA 3BWUC 4BSVB 4WI5A 1UKTA 4Y0GA 4OCRL 3FJTA 2Y9RT 2MHAB 3I6LE 3LN4A 4BFEA 3K80A 4NHCL 3R4DA 5GHWL 5I2IA 5FFLA 3K4ZA 4U1KA 3CVIL 3GMQB 4D2NA 4LCWA 4OCXH 5HGAB 5DRXB 3AB0C 3G5ZA 3DSNA 5KSUA 4YHOL 4KZEH 1FSKC 4UV4L 1KN4L 1OB1A 2NLJA 3SCMD 1XZ0A 3DRTB 2GITB 4RFNC 4KGJA 4Y5VC 4XC1L 4OZHA 1FQ9C 1LDSA 1K5NB 5DXWA 3Q6FB 1K2DA 3QO1A 1R5VB 5KN5B 1J8HD 2VIRB 1INDH 4C83A 1D5BA 3NPZB 3VRIA 1D5ZB 2YKLH 4U1LA 3I6GA 4LHUG 1KTDB 2P8PA 2NY4B 2V9RA 2VB5A 2ZUYA 4Q2ZB 3JTSB 5C0JB 3MCLL 4Y16C 3OX8A 3ARTA 2GSIA 3P4OA 3KG5A 4LCUA 4D3CH 4OZGB 3BQUD 5DS8A 4CVXA 3VFRB 1TQCB 1CU4H 5DJDB 3VXTB 1FZOA 5CBEA 1MY5A 2GSGB 3QIUD 3DLQR 3HPLA 4C58B 5DRNB 3ALWA 3IDYB 2Z35A 1LO2L 5D7IB 5D7KD 4OZFH 1T89C 1A9BB 4I18C 1YEDB 3T65B 4E41B 1OAXL 2EEBA 2IG2L 5F7KC 4TVPL 3QEHA 3BP4A 3HLAA 4YHPB 1SJVA 5GSVB 3IJYB 3LKOA 5EIQA 5GGUA 1U8PB 2EZ0D 4JRYA 2X5PA 3QRFM 4RCAA 1VFBA 5IMOB 1MLBA 1PZ5A 1UYWH 2JJSA 5DD1L 5F1NA 3V8CA 1S9XA 4FQIH 3D0LA 1AP2A 4JE4B 4MJ6B 2BVTA 5ISZE 1RY7B 3H9SA 1MCNA 4UQ3A 1GOGA 5MHSD 2EYRA 1TXKA 4HWZB 3ZKQD 4M5YH 2PUQT 4JJHA 4OGAC 4NT6A 4F33A 3GNMH 1KB5H 4FFWD 4LAJH 5EUOE 5EZJA 5C0BA 5IFJA 4AJ0A 3IT8D 3CK0L 1T66C 3GMOB 2ZCHL 4LBEA 3WNLA 5GS1C 4QRPE 4APQD 3PWJB 3THML 5E2UL 2ADJA 3BMVA 4NRXA 5DRWA 2A9NH 3E6HB 1DQQA 2GUOB 4OD2A 4LCYA 3TO4B 4PREB 5DJ8A 2VSDA 3UJTL 1LHZA 5C0ND 5HHOB 2BOCB 2GTZA 2YXMA 3KXFE 1U3HD 1NEUA 3S4SB 4PGDB 1CN4A 1VADB 4XNQA 4Y19E 1M71A 3V4PH 1UEYA 2N7BA 2VZSA 2WUBL 3KDMA 3LRGA 3MRPA 2GY5A 2YD4A 1CTNA 5L2KB 3DBXA 5D2NA 2QQLH 4N1EA 2P7TB 1FGNL 3BO8A 4CU7A 3HZMB 1BAFL 2Y6SC 2BNRE 1SEQH 4UIMB 5T1KA 1I7UB 1IGIL 3KJ6L 3VXSB 4Y2DD 3RBSA 3ZE1F 1YMMA 1Q72H 4I0PA 3VFSB 4UILL 3U1SH 5JW3L 3QUZA 3EOAB 2XN9E 4KK9D 4QHMA 2ATKA 1QFWL 4WO4D 5EBLB 2H32H 3UTZA 1U8IA 1U8MB 1MCEA 2X4PB 3A6BL 4EDXA 4XXDB 4F15B 4Z7VA 2AJVL 4JEGB 1OGTA 5DGQA 5DK3A 2A6DA 3WKMH 5ITFA 1AD0B 3VE0A 3QUMB 5CZVL 3TT3L 3D6GA 5J6HA 5MENE 1CDJA 2YRPA 1W8OA 1NSNH 2YD7A 2XA3A 3IYLW 4H8WH 4G7YH 3CH8A 3ARDA 4NNXB 1K8IB 1KJMB 4GMTH 5F7HA 4YWGL 1TCMA 3QUXB 1K85A 1A4KA 3QCUH 2IAMC 4P46D 5TPWH 5CWSB 3UCRA 4GKSA 4OT1H 2VITB 4ELMF 1MCPL 3ZKMC 5D2LA 2RJMA 3CDCA 4OGYH 2CKBA 1BFOB 3ARGB 4F7TA 4F58H 4U33A 1KFAL 1QLEH 3CFDA 1QD0A 4JY6A 4OLUH 3V5HB 1G7IB 4YHNA 4QTHB 4X8JB 1DVFB 4XXCA 1RZ7L 2Y07L 1FO0L 4GKOA 4HIJA 4JVUA 1JGUL 4OUUB 3RUGF 4Z77A 1NAMH 3OSKA 2NY5L 3HI5L 3BISA 3C6LC 5EUKA 4MXQD 1LEKB 3EZ8A 4LRIA 3UPCA 4PJ8A 1U8HB 5HVGB 1JHLH 3KJ4B 1B6UA 1EO8H 3HS0B 4TULH 1UWXK 5EU5A 1CICB 1TVHB 2RQ8A 4LSUH 4Z7UF 3QDMB 1NGQL 5CJOH 1JV5B 3V4VL 2FZ3A 1MIEH 5D9SB 1L0QA 3IB4A 2G75A 5M95B 3HZVB 3KPSA 2GFBA 4DVRH 1U95B 5JXAL 2IPTL 3QI9A 4HGWB 2BNUB 2BOBB 1HN1A 1G9NH 1FNLA 2BSTB 3QQ4A 1S7TA 2NMSA 1NKOA 3HHRB 2G2RB 1G0DA 2WLZA 3WO3B 4XCFL 1RJYB 2EE2A 3TNNB 3L7EB 1T1ZB 5KOMC 1ACZA 4IHOA 4MSWA 4YPGA 1JHTA 1QFWM 2H9GB 2FX7H 2NTFB 1BOGA 4TYUA 4JHZA 5EZIH 3I6LD 4H25B 1QSFA 5CSGA 3KPTA 5ICYA 2X6MA 1WTLA 4MCZB 4M02A 1JP5A 4QGTA 3REVA 3O6KH 3AM8A 4F7EB 2R23A 4X6DF 2X9XA 1PSKH 5CSBA 1ZANH 4OCXL 2VQ1A 3IDGA 3STBA 2QR0B 3WFBL 3QFJE 3DX8B 2DQUL 4P5MA 3RZWA 1GGYA 1A22B 1AR2A 2IANA 2IGFH 3GSRB 1DDHB 5J1SC 4WWKA 2ZSVA 4CW1B 3LKNB 4RMTA 4M7KH 4U6XA 2W9EH 4X7TB 4P5TD 2LAAA 5BO1L 5ID0A 5F9WC 1INDL 5IB5A 1ZXQA 5DD6A 1GGTA 3G6JA 4P2QE 5AEAA 2OSLB 3KLAB 5LJYH 2FYYB 2JIXA 4PJEE 5F7EL 3HAEB 5HHXL 4GUPB 1YN7B 3T3PE 3M17A 3BKMH 3IKKA 3S36H 2DYPD 4JRXE 1QQDB 4LKXA 4LLWB 4M6MH 3VGFA 4D3CL 3ZLQC 1G7HB 1CU4L 3D3VA 4V1DB 2V5YA 4H5SB 3RGVA 3MRCB 3O3BA 1X5IA 1BZ7A 3UTSE 1CLZH 3TJHC 5CD5D 5IVXB 1IC1A 2D7NA 5IHUH 1F3DH 5GRUH 2AVGA 2IPUK 3MRFB 1IEBB 4BZ2H 4BSVA 3X11B 3DV6A 3PDGA 1ZLUK 3FOLB 4F8QA 3MACL 5EU7C 2VLJE 4OKDA 1CGTA 5AAWA 4X5WB 1Q9LB 3ULVF 1NC2D 3GSOA 2PTTA 1J10A 2X41A 3GMQA 4UIKL 1UYWL 2LVCA 4M7JH 5DRXA 2B39A 4HC1A 4FQIL 3GMRB 5ISZD 3MJ6A 3BMWA 4KRPD 1HCVA 2A2QT 3JWDC 4M5YL 1EV2E 1IGTB 1BQHB 2GITA 1KB5L 5EORH 1XR9A 5AZ2L 4MWFB 4OQTA 1K5NA 1A3QA 4F15C 1R5VA 3UBXI 2F9BT 2VIRA 4QRPD 3ZE2E 3RAJH 2AQ3A 4GBXD 4XGZB 2WK2A 4ZFOB 5TQ0H 3DHJA 4J4PA 4LCWD 1KTDA 2A9NL 3L3HB 1WBYB 4Q2ZA 2X42A 5C0JA 5F3BB 4OZGA 2DDQH 4JG1H 3GUTA 1AQKH 3VFRA 1M7DB 3VXTA 2YRZA 4JFDE 4Y19D 5HHNB 2YMXL 3W81A 5I71B 3CIQA 3QDJA 4ZO8A 5DRNA 4PGZA 3RVXD 5SWQB 1ZGLM 5M7QA 2QQLL 4KKCC 5D7IA 4TUKH 3MGTB 1T1WB 3LRHA 1A9BA 5D1QA 3ARGC 3T65A 2ZOKB 1NGWA 2BNRD 3QAZB 1SEQL 3EYFA 3DMMD 2DBJA 5JW4Q 5FUCE 2H2PC 4OIIH 1Q72L 2OI9C 4QRTB 1NCCH 4YHPA 5DFTA 5EFIB 3U1SL 3ZKXB 2XN9D 4Z5RB 4GXUM 1U8PA 2MOVA 5HVHB 5IMOA 4U49A 2WBJB 3BPLB 3S4SG 4M5ZH 2EDBA 4HWZA 3GEWB 4BQ8A 2J7LA 3WKML 4JPWH 5GRYA 1AE6H 1OP5K 4OCWH 4OLZH 1NSNL 4JKKA 4G6KH 5E95B 3TH3T 4H8WL 3BH9B 3GMOA 4HD9A 4KK8C 4PJXF 4GMTL 3C09B 2EDNA 1P7HL 1GOFA 3O4LE 3NCFB 5L8LB 2E6PA 3O2WH 3EJYC 3QCUL 1JPGA 3E6HA 2GUOA 3MJ9H 5TPWL 4L8CB 3TO4A 1KEGH 2BNQE 4PREA 4OT1L 4I8DA 5T1LB 5I15H 5IG7A 2BOCA 2OJZL 3G5VB 3JV5A 5MEQB 2QHRH 4RGNC 5C0BD 3QPQD 5IIEB 4OGYL 1VADA 2ERJC 4PJBE 3KR3L 4F58L 3ALXA 3BFOA 2P7TA 4OLUL 5C0GB 5J6GB 1JGDA 5C9JA 3DUHA 1FIEA 1R3LA 1ZLSH 2EXWD 3G5XB 4O58L 3HZMA 5I1CH 4GSDH 4UIMA 3MCG1 4BQCA 1I7UA 3MV9E 1AR1C 1NAML 5FV2A 3BYYA 3VFSA 4GRLA 1QFUH 3EOAA 3HUJE 1TJIH 3QEQB 3RZCB 3RX5A 3GMMB 3NZHH 2DIJA 3WKNA 1EO8L 3IGAB 4K9EH 5HPMB 5E9DB 4NCC1 1EHXA 4M48H 4NC2B 1U8MA 4LSUL 2UWEE 3RX8A 3W0WB 5CJOL 4XXDA 3U2SA 4PRPE 3MBEB 5CS7A 1MIEL 1AD0A 4BQ9A 1WVZA 5T1KD 2A38A 3C08H 5DVKA