4DKEH

Crystal structure of human interleukin-34 bound to fab1.1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSTWIHWVRQAPGKGLEWVARISPYYYYSDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGLGKGSKRGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/immune system
molecule keywords Interleukin-34
publication title Structural Basis for the Dual Recognition of Helical Cytokines IL-34 and CSF-1 by CSF-1R.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 220
sequence length 225
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkeH01
5I16A 3EJZD 1IAOA 3MCKA 1I4FB 3CC5A 3OKEB 2R1XA 3O8XA 2NTFB 4K8RD 3D39D 1NFIB 1OTSC 3QFDA 4ZDHA 2OJZH 2AKRB 5DQDL 1TQBC 3AVEA 1WBXB 4B53A 1UT9A 4JR9H 5EO0A 4C59B 1N59A 4K2UL 4Y4FD 1UB6A 4BQ6A 1DUYA 4K23H 4JO3H 5FK9A 4U31A 5E8DL 3KPRA 5GS3A 4CN4A 1BIHA 4YHOL 3RNQB 5EC1A 3UXFA 4UNUA 3QFJE 4Q9RH 2A6DA 2M8XA 3VD3A 4XX1G 3QEGL 4NQCE 3QUZB 3ECBA 5JDJA 3WO4C 5KVEL 1MAJA 1X3DA 4OI8A 4TUJB 1TPXC 4ZSOE 2DM3A 3QISA 4Q7DA 1IAIM 4MAYD 1ED3B 1CD9B 5KW9H 2R4SL 1OAUL 2VABA 4YAQB 3RUGB 4YC2C 3RIAK 2Y6SD 2EXWC 4GLRI 4PJ5D 3VXSE 3MTRA 5F96L 2A6KB 1D5MA 3CVIH 5HHOA 5LQBH 3ZDZF 1OGAE 5D7SL 5HGHB 2E7CA 3GMNB 4OFYA 4TTDD 2XN9B 4MXQC 2D9CA 4JHWL 1X6NA 3MLRH 3C60C 2OR9H 3GK8H 5K9KA 1LHZA 3Q6FB 2OL3B 4ORZC 1UEMA 1KG0A 1JYNA 1QFUH 2APBA 1DANT 2DLFL 2H32A 1QLRB 2DI9A 4NQEB 1XF5A 2EC9T 5FXCH 1FPTL 3UTZB 4ZUSB 1T89A 3TYFB 1GC1H 1WBZA 3BGFC 1OL0A 3E0GA 1MJUH 3GJFA 4XBGA 1GGBH 4ERSL 3GZKA 1XF4A 3O6LL 4PGEB 2GTWB 4HKZA 5F7EH 1XGUB 2VL5B 5FECA 1EA9C 1JVKA 3DV4B 1XCQB 3ZE1E 5IESL 1OAKH 1FCCA 4YHML 2AJVH 4LU5H 4U1KA 3WN5B 5IHBA 5TFSL 5F1SA 3L5WB 4M43H 3OKOA 2ADGB 2NX5B 4OLWH 3LQZB 5AG9A 1FE8H 5CLWA 1TJIL 4UTBH 2IC2A 1QYGH 2PKDA 3U7WH 3TBVB 1SBBA 4PP2A 4YPGB 4LVHB 4Y4KC 5D2NB 4I3GA 2JB5H 1K4DA 2PYFB 4PS4H 3MXVH 3MLZL 5JHDA 2WBJA 4L8SC 4PFEA 3B9AA 4J3SA 3U36B 2NR6D 3OMZA 5B3JF 1BOGA 1I3UA 5FYLL 4GXUN 4XRCB 3BKJH 4PRPD 1EBAA 3FO2A 2YRLA 3BSZH 4GRWB 4IHOB 4PR5A 1BZ9B 3QUZD 2A6IB 2NLJB 3TA3A 5J7CC 5J1SC 3DYMA 5C0DA 3SKUD 2MPAL 2VXUH 1DLFH 3IT8D 4F33A 1G0YR 1A3LL 4L1DA 4YFLI 4PTTB 5E8NB 3HMXH 3FRUA 3GRWL 4JRYA 2XXMB 4B0MM 2J8OA 5C2UB 3U9UB 4G8FB 1KJMB 2EEDA 1HH9B 4HF5H 5E2JA 1YEKH 2OX5A 3RWJA 4WO4A 3H42H 3WFDL 3FB5B 2A83A 3P0YH 3U0PB 1IGIH 3CK0H 4X4YA 2ZUSA 1C1EL 4MHHG 4BSVA 4MAUH 4PLJD 4JFHD 5T5NG 3RPIA 4R26L 3NZHH 2CO7B 4RMSA 3S37H 4Y19E 2R0WH 1XIWC 4OCXL 3NAAH 1DQQB 3MV9A 3HRPA 3DOSA 1MNUL 2CIIB 3QCUL 4KZEL 5F9JB 4IRJC 4K2UH 1NFDE 1KYOJ 4UTAL 3HNTL 5E8DH 5GISL 1HE7A 4HWZB 4YHOH 2PO6C 1TQCB 2F53A 1MJJA 2YD7A 5DD5L 3MBEA 2AXFA 1S7RA 3D3VB 2CLZA 2ESVA 1MCWW 4P5TD 3F62A 3LKQA 1Z9LA 1DN2A 3ZE0E 1ETZB 1NDGB 1YQ2A 3O6ML 1RZJL 3KPSD 4QEGA 4PG2A 3U0WH 3EDKA 2R4SH 3SGDI 3UPRB 2PF6A 4NQSB 3PDGA 1XR9A 4MS8C 5F96H 1Q0XL 5BS0B 2AV7B 3SKMA 2MHAA 1K5NA 4LCUB 2Z31D 1A8JH 3QEQB 4G80A 1OAXL 3P4OB 3QQ3B 2EIZA 5C0RH 2WIIA 2XA3A 4LPUA 3MODL 2Q7YA 3FO1A 4I9WD 4XH2A 2DLFH 2ITCB 3CCHB 4P2OC 2DTSA 3MRIA 5FYJD 1L0YA 5ISZA 1FPTH 2PETA 3NN8A 4RAHA 1FRGH 3GSRB 4DZ8B 2NXZB 3UAJD 2G5BA 1AO7B 1SJEB 2GQHA 1OQOA 1QFWI 3NTCH 5CEYA 1KB5B 4ERSH 2PTUA 1I9RH 3H2WA 5A2FA 1K6QL 3VWKA 2VDPL 2GTZA 1A7QL 1MCHA 4EDWL 1MAKA 4P9HC 4OIIL 5IESH 4QRUB 3GIVB 4YHMH 5HI3C 2A0LD 3F7VB 5TFSH 2HJLB 3H9YA 2W91A 5MERA 1OP5K 1Y0LA 4H0HB 4U7MA 5HXMA 3ULSA 1SMAA 3GMRA 3JTSA 4JM4L 5C0AB 2PUQT 4YR6B 3TFKD 4LOUD 3F8UB 1NMCB 1FNGB 4C56A 1EFXA 4N0UE 2FR4A 4W6YB 4WCYH 4JN1H 2D4DA 4OLEA 4UAOC 4XWGL 2BRRL 1C08A 1R3KA 3D3VD 3FQRB 3QXVA 4L9DA 1IAIH 3X13A 4PJDA 3OKLB 1U6AL 1DL7L 1MQ8A 3Q1SL 4PJXA 3OJ2C 1NAMB 3FQWA 4DN3L 1VADA 1FVCB 4ZUVB 4X4XB 3K2MC 3TYGH 4NQEE 4UUJA 1MCLA 1PFCA 3BOVA 3NFNA 4Z6AT 4FQXC 1QSFB 3UCRA 1Q1JL 2KH2B 4LEXL 3WFDH 2RJMA 5BS0D 3ILPB 5DYOB 5F1NA 1C1EH 2EDWA 1S7QA 2ZCHH 4Z7NE 2FEEI 3BUTA 4G6FB 3HC4H 3V6OA 5EBWB 1C5BL 2P43B 1IEBB 2AP2A 2X41A 3TNMA 2Y36H 2OTWA 1FNEA 2C26A 4LP5A 3VG0L 3WIFB 2IPUG 4UBDD 2NX5E 4CVXA 1QP1A 3QUXC 1IC5H 3QCUH 4KZEH 3BDYL 1MREL 2VISB 2NXZD 3W39B 3HNTH 2QL1A 2WAHA 4M1GH 4JFDE 1SEBA 1U8QB 1QRNB 2P7TA 4WUUA 5JPMA 4WDIA 4P23C 4QXUH 1CS6A 2RHEA 5DD5H 1OWRM 3J7HA 1JMZA 2E27L 5IGXL 3SQOL 1LP9F 1LEIB 1VEMA 3UTSE 2WQRA 2P5WA 1XF3A 1K8DB 3HG1E 2GJZB 3TO4A 3SGKC 2QR0B 1T3FA 3IVKA 3ELAT 2PNDA 1I9IL 5J13C 3EJZC 4LKXA 1Q0XH 4WUKL 2F54B 1KN2L 4QXGL 4K8RC 1W72A 4HPOL 3QO1A 3DSNA 1OAXH 1U2HA 5IVZB 4DVBA 4GRLB 5I1IL 2EYRA 2P44B 3MODH 1JPSL 1A4KB 4KK9D 4PV8A 3ZDZE 1S7XA 1NGWB 2A73B 3B2VL 1P84K 3DXAB 1VERA 4NUGL 3H7BA 4UI2A 1GCFA 1JZ4A 1L0QA 3KLDA 3W0WB 2JB6A 2PXYB 2CDFA 3GMMA 5FYKL 4TUOB 4ZNCD 4MAYC 4QHNB 4XB8A 1QFHA 1LD9A 3MLTA 4X6CA 1K6QH 5E9DE 4XXDB 4KQ4H 4AIXA 3T8XB 2FHFA 1A7QH 1K2DB 5EZLA 1B4RA 2Z35A 3BJ91 4OIIH 2VKXA 4NO3A 4RQQA 1NUNB 4BH8A 3ULVF 2EDEA 2IBBA 4PREA 4LLDB 4LLVA 4K71B 2BVEA 1E4XI 4G6FD 5AD0A 3ARGC 1QFOA 43C9B 1NGZA 3FFCA 4BH7B 3MV8B 3O41A 4YHPB 8FABA 3VJ6A 3NIFF 1A6TB 2OYPA 4Y5VA 4U6VH 5LCVH 5IEKA 5K93A 4S2SB 3L95A 5KSVB 4JM4H 4YDIL 3Q5OA 5EBGA 4FTVD 3MRFB 3BH8A 4WFFE 2DMCA 1QRND 2HTKD 1HHGA 2AK4E 2H1PL 3O2VL 5A43C 1I7TA 1ZT7A 4EN3D 4XWGH 4NNXA 3BQUD 2BRRH 4XI5D 4AK1A 4POYA 5B3JE 3DX6B 5IVXB 3DUUB 3BZFB 3Q1SH 3V6ZB 3UJIL 2IAMA 3ZT6A 1XR8B 4L3ED 4HS3A 4RWHA 1JBJA 3AS1A 2YOCA 3KLAB 1OP5H 1KXVC 1MI5A 4FHBD 3FFDB 4HV8B 5TQ2L 4LEXH 1RIUL 2F54D 1Q38A 5F9WB 2D0FA 2IWGA 2VAAA 2R0ZL 1FYHB 4NQVA 1IEAA 1T1YA 3AXLB 1AKJB 4O4YH 1C5BH 3WXWL 4LAQL 4NT6B 1HSAB 3EO1B 4ODXB 1WIUA 3WFBL 5CZKA 4NJ9L 5L0QC 1OQXA 3CDCA 2YSSA 3BWAB 3BDYH 1MREH 2BOBB 4QRPB 2YD9A 5GJTH 2XQYG 3VXTB 4JZOB 3ZLQC 3W0WD 1T4KA 3RP1A 4KTEL 1KLUB 3HHRB 4NQXB 1R5WA 3JVGA 4KKBC 1I8MB 1QKZL 4MX7B 3FB7B 2G2RB 5C0AE 2E27H 3GMPB 4PJIB 3SQOH 5IGXH 1KGCD 3P0GB 1D9KD 4GG8B 4M8QA 5EN2B 4HIEA 2BOCA 4W81A 1UJTA 3UTOA 1S7SA 2DL9A 4Z9KB 3T3PF 5EU6D 3ARBB 1RUQL 2NY6D 2DTML 2FIRT 1RZFL 5E24E 1LO2H 3FQUB 4OF6A 4X7EC 3DYPA 1I9IH 2IH1A 2BJML 2X4RA 4RSVA 2ZJSH 2VDKH 4WUKH 1PYWA 1KN2H 4QXGH 3MREB 1I8KB 5KSUA 2EYSB 3AB0B 5AUMB 5GSVA 4I18C 4HPOH 5TQ0L 3VFPA 3SDDC 1UM4H 1Q9WB 1CICD 1T1XA 3IFOB 4R96B 2VLME 1UWEH 4G7VL 1JHLL 1CLYL 1JPSH 1P9MA 3H9SE 2XPGB 4RA0C 5GGUA 4MA8H 4U1NB 3P9MB 4XNQA 5ICZB 1UWGH 3B2VH 4Y16C 3MLVL 4HGWB 4CNIA 2O5YH 4P5KA 2GUOB 1H3UA 3LS5L 4PRAB 1JMXA 4P5TC 4XPFH 3PDDA 5F3BB 1AHWC 1ORQA 3SDCD 1ZGLB 4UIMA 3MBXL 3ARWA 3C6SB 4KMLB 4G8EB 4YXHL 3IRPX 1K4CA 2IF7A 3ROLA 5LVEA 1KPVB 4X99A 1S7WA 3M07A 3QA3A 3TNNB 3BDBA 3L3IA 4HUXB 4RNRB 2Z31C 1ZANL 5JOPE 4Z7VF 3IYLW 4KUCD 1ZHLB 4I77L 4YK4C 1E28A 2LABA 5GRXG 3BP6B 4MJID 5DJ0A 3P0VL 5FDWA 4M7LT 1XGRB 2EDKA 2YUXA 2VERN 2Z93A 3FOLB 4YDIH 4QRPD 4Y4HB 4HIJB 1YEIH 4NQDD 1U41A 3W9DB 3VCLA 4H5SB 2H1PH 3O2VH 1T7WA 4G5ZL 3LN4B 1EMTL 3HPLA 3IDJA 4DOHB 5K9QG 5CWSA 3FT2A 3G6DL 4HFUL 3IXAA 4O58L 3L3KB 1FYTE 4R97C 1OARL 4YDVA 2YBRB 3QIWB 5EA0L 5D5MB 4DQOL 3UJIH 2ZUUA 2A0LC 3ARBD 2CR6A 2IPTH 2HLAB 5MP6H 1RIHL 4PGJA 3HS0B 3GMQA 3X14B 5TQ2H 4XZUA 4HEME 1RIUH 3HTLX 3OTTA 5IBLD 4NRYB 4G43A 1AXTL 2BVOA 1CL7I 1TTFA 4E41D 4K8RL 4Z7WB 1MIMH 2ZCLL 5TE7L 3SO3C 4P2RB 3T4YA 5DVNA 1R0AL 3WXWH 4LAQH 1T20B 4WNQB 3EYOA 3L3GB 3WFBH 5DD6A 2VLJB 2XFXA 4LIQL 4NJ9H 4GBXC 1OOAA 3RGVB 5DDHA 3V0WH 1TZGH 3BP5A 4LBEA 1X44A 3PHOA 5C09B 4XP1L 4W70A 4CAGA 1RAMA 2L7JA 3PIQB 4KTEH 4LSQH 1AGEA 1OWWA 3ALXA 5DLML 3HE7D 4WWKD 4LCWA 4FQ2L 1J5OH 2W0LA 1N5AB 1UH2A 1VA9A 2X9XA 5J8OA 1WEJH 1KB9J 2BSED 3QUMB 4JN2A 1BM3L 3VH8A 4HMEA 3E3QC 2ARJB 3UDWC 5IB3B 1H0DA 3I6LD 3MJ8A 4TPRL 2NY3C 3JUYA 2QSTA 1J1OL 1RZFH 1UQSA 4O02L 2XA8L 3V4UL 4QT5A 1A6UL 5E56A 3PGCB 5I75B 5EU7C 1LP9E 5DJXA 5GS1A 1IL1A 2GW5A 1H5BA 5EOQH 1Y6MR 3KPLB 5T5FL 3MRKA 4G3YL 5TQ0H 3MNVB 1QR4A 5D1XC 2WW8A 3HUJA 5ETUB 3KYMA 1BZ7A 4GW5A 2GAZB 3ALWA 5H94A 5IWLC 2YPLB 5FV1L 1JHLH 1CLYH 2Y5EA 1ZKAA 5HJ3B 4LKCB 4KMQA 4N90D 4AENB 3ZKMD 5JR1H 4HEPG 3A0OA 5F7FA 1UA6H 1YY8B 4ENED 1CXEA 2AAVA 3S36H 2FBOJ 3QIWD 4Y2OA 1J12A 4OV5A 1T2XA 4X7TA 4MXWL 4J7RA 1CTNA 1G6RB 1MWAL 3K81A 1B90A 5DUML 3MBXH 3VWJC 2DQEL 1MRFL 3CFBB 4WTXA 3VXME 2XTJB 3VGAB 5DTFB 5FGCE 2J1KA 4JY4B 4WY7L 4E5XA 4JM2B 1CU4L 2QQNL 5HPMB 1X4YA 1FFNA 1ZANH 4P2RD 1LO5A 4I77H 4XCCL 2XIDA 4GG6F 3L9RB 3P0VH 5CP3A 3I3EA 5MHSE 2HT3D 3C5SA 4M5ZL 3ULVE 4KK9C 2J8UF 3CFJB 2ERJB 5KANI 1IGML 4L8CA 1NGPL 2V7HA 3MRLA 3RGVD 5JMOC 3OX8A 1FL5A 3K8KA 1QEWB 1XH3A 4RGOL 4WHYG 2AJZA 2VZTA 5DS8B 3NIFE 3WS6C 5T3XD 2BCKB 3TEUA 4OD2B 4IEFB 4WEUD 4F8TA 1FJ1B 5F7NC 3TVMC 2PYEA 2X89D 4OCWH 3G6DH 4HFUH 4O58H 4FXKA 1FQ9C 3LEYH 3OKDB 5EA0H 2AVGA 5HYQB 3QDJE 4DQOH 4KK6D 1C12B 1NUDA 2HWZL 3KGRA 2L4OA 2DWDA 4G8IA 1R3IL 1KJ2L 1M05B 1EUTA 4ZOEA 1RIHH 4OD1L 5AAMA 5J57B 4KC3B 2DKSA 3B43A 4M3JA 5KS9B 3SE4C 4J1UB 1AP2B 1G1YA 4Z95H 3TESA 4MLIA 3JWOL 1FL3B 3CH1B 4CW1A 3RVTD 1KJ3L 3RJQB 4JO2H 1KLGA 1YPZA 5C0ND 1R0AH 2KKQA 5GRUL 1JWSB 1I1YB 4FXGA 1I8LA 1MHPH 4LIQH 1ZVHA 3MNZB 5IMLB 3RWEB 1A9BA 2G75A 3QO0B 4JFFB 5GS0L 5F6HJ 4EN3C 3GGWA 4JLRB 4B7LA 3BQUC 4XI5C 1Z6JT 3VFRB 4WFED 4XP1H 4G7YH 1P4BL 4JPIA 5KJRH 1B9ZA 2HA1A 3MLXL 4WEMB 1CK0L 1CWVA 3IFPA 4ZNEA 2ADJB 4U7SA 1VFAB 3GM8A 5BMFH 1OTUD 3T1WA 3DO3A 4O51B 3MYZA 4JM2D 1BM3H 4MD0B 4QHUA 3MRMA 4QYOB 1U9KA 2VDRH 1BD2D 2XRAL 4TPRH 2I60L 1QFPA 4O02H 2XA8H 1A6UH 5J6GA 4M9PA 1JWUB 4Z78A 3GBML 1GZPA 5B8CC 2XTLA 1ND0B 5JZ7D 3T3PE 1HQ4A 2FO4A 4G3YH 3O9WC 5F6HI 2B4CC 1JN6B 3DECA 2OR7A 5BRZB 3C5ZB 3KYAA 5H35A 1WFUA 1C16A 2BNRB 3ARSA 2OK0H 1ZHNB 5DI8A 3T3MF 4DFHA 1UKTA 5DK0A 4JJ5A 2ICWA 2QTEA 3RY6A 4QOKA 4TVPL 2O5XL 1D9KC 4MXWH 2FD6L 3E2HB 5FUZH 4LSPL 5DUMH 1SJHA 2DQEH 1MRFH 1DQML 3WLWD 5J1AA 3TWCL 3MRNA 4NM4L 1JTTA 3LIZL 2H41A 3LPWA 1FIGH 4M7JL 1Q9KA 1D5XB 3H9ZA 3BDXA 4L4TB 1ZEAH 2UWEB 4EOWL 4U1GC 1HSBB 3HI6L 5EB9A 3SDXA 4P46B 4M1CC 2QQNH 2F8XC 4KRPD 1KCRL 5I1JL 5BVPL 2IBZX 1HCFX 1RK1A 4PV9B 3O45B 1UB5B 2R1YB 4IRZL 5I18L 1NSNH 1WT5C 4M5ZH 1EHLL 4BQBA 1IGMH 1F11A 1NH6A 4JFFD 1U8JB 3K4DA 2X42A 4RGOH 4Z7VE 2WQ8A 4UDUA 4HIHA 4YBHA 3QQNA 3WFEH 4F9LC 3QJFB 2EDRA 4JZJA 4IS6B 1UJ3A 5I1KH 3BMWA 4KXZI 3SDCC 1AD0B 4FMKA 2P5EA 1X4XA 1TXKA 2E6JA 4Q6IC 4XC3L 3V5DA 1JUFA 1FFPA 3FONB 3RY5A 2CDEB 3T0XA 1AXSB 3MX0A 2AEPL 3VXSD 3SE8L 3FHAA 3GSNL 2DQFB 2HWZH 1OGAD 2V2WA 5I73B 2XWTB 1YMMA 1R3IH 1KJ2H 1OB1B 3RDTA 3U7YL 2A9NH 5FHBL 2BFVL 5A2IH 3CMGA 4Y2DB 3KPPA 5SWZB 3BESR 4D0DB 3HC3L 3OG6B 3U48A 1LEKA 3JWOH 4IOIA 3W9EB 1I7RB 4XXCA 3MMEA 2R56H 3UBXI 1KJ3H 4WW1A 5I16B 4WI6A 1OD7A 1O5DT 3DTXA 4PBVC 3LKNA 3C5ZD 2XI9A 3OB0K 2R1XB 3O8XB 5BV7B 3P9LA 5GRUH 1KIRA 3QFDB 4ZDHB 3EYVA 2BNRD 3RVVC 5EO0B 3VXRE 1N59B 4QCIA 1UB6B 2VQ1B 1CGTA 3QIBD 5GS0H 5FK9B 3UZQA 5I1EH 1BP3B 4M6NL 4HQQL 4HS6A 4L4VB 4YXLH 4JVWA 4A6YL 3FN9A 5EC1B 3P4MB 2A6DB 4NHUA 2X9WA 1S7VA 1VCAA 3ECBB 3MLXH 1CK0H 3AUVA 4NFDA 5CSZA 1JI2A 2IFFL 4ZPTA 2DMBA 4HK3J 1LE9A 2YKLH 1BF2A 2HYMA 4L4TD 1NBYA 5IBLC 3NCJL 1RUPL 2HT4D 2XRAH 3QAZB 2I60H 2NY0B 2ZZUT 3CDFA 1D5MB 1HHHA 5HHOB 4PLNC 4DFIA 3EYFA 5BJTA 1GGCL 4JQIL 1UXSA 4KU1A 1RURL 3ARFC 5DK3A 3PGFL 3GBMH 4JJHA 4OBSA 4CMHC 4ETQB 4ZAKC 3E6FA 3QDHA 1UM5H 5GGVY 3QDGE 2OLDA 1A1MA 4GXVL 3RRQA 4TULL 3IDGA 5K9KB 2PCPA 3PABA 4PY7B 5KSAC 2H32B 3CXHJ 4MJ6A 3MZTA 4KZDL 1E27A 4ODTL 5D7JD 2EKJA 4WWKC 4GKZB 2IPKA 1WBZB 5MENA 3KPOA 3D2UA 1QR1A 3GJFB 4XBGB 4TVPH 4YDJA 4R8WL 2JLLA 3QUYA 4HKZB 1HDMB 2FD6H 4LDEB 3GRWA 4RRPA 2YD6A 1RHHA 5DR5L 5FECB 1WICA 3U4BH 5DEFB 3BVNA 4M00A 4Y2DD 1NGYA 4FQJL 2EIDA 4NM4H 4U1KB 1EO8L 3LIZH 1YECL 1QSEA 3KHQA 4MZ3A 4M7JH 2F9BT 3OKOB 4HC1A 1CGUA 1RZIA 5T1LA 2OSLA 4EOWH 1C8PA 5JA8B 3HI6H 5C8JA 1W0VA 1FAIH 4NBZB 5J06A 5I1JH 4PP2B 5BVPH 2FL5A 2IBGA 1IILE 1U3YA 3GSVA 4XTRC 2EH7L 5JHDB 2WBJB 4ZXBA 3BE1L 1EHLH 2PR4H 1CFNB 3QNYB 4LLQA 2VAJA 3ZKMC 3NIGF 3UMTA 1UYWH 2HFEB 5E4EC 4L4VD 3IJSA 5MEQB 4ENEC 4HKBB 1NQBA 4WW2C 5GRJH 2ZSWB 4GG6E 1JV5A 5C3TA 3U4EA 4Z5RA 5K9QI 3C9NA 2J8UE 3TA3B 1OY3B 3FQTB 4W68A 3WNPA 3ARTA 3OR7B 5C0DB 1L7IL 2VZSA 4XC3H 4GUPA 3RQ3A 4X7FC 3FRUB 4MJ2A 5E94A 4JRYB 4RFNB 2AEPH 4PJEA 3SE8H 5D1ZD 4W6WB 3GSNH 3HZVB 4FZ8L 3GBLA 4M3KB 1D3CA 2FB4L 4QRTB 1SM3H 3VA6A 4PD4K 3RWJB 4WO4B 5FHBH 5FHAL 2BFVH 1F97A 3U46A 1ES0B 3AFLA 2GJ6A 3G5YB 4R2GC 2HT3C 1UGNA 4BSVB 3RPIB 2Z8RA 5D71H 3HR5A 2DQGL 5HHPB 4OAWA 3HPJA 2B4CL 3EOAB 4JANA 3DUHA 3QPQC 3MV9B 5ECJE 4LLAA 3PDOB 2Q3ZA 5DJ2A 4X8XA 4OGXL 1CR9L 2GT9A 5A1AA 1GZQA 3L1OL 2FEDC 4XP4L 4HQQH 2OZ4L 3BEWA 4ZMAT 1WFTA 1WZ1L 1ZS8A 4Z7OF 4MQ7B 4A6YH 2X1PA 4D8PA 2LE9A 3LOWA 4P57B 5DVOA 4QRRA 2F53B 1MJJB 4KK6C 4XPTL 4P9ML 3MBEB 2AXFB 2YPKA 1S7RB 1FGNL 4PJDF 2CLZB 2ESVB 4PJXF 4JFEB 3LKQB 3C5JA 3DETC 3F7RA 2YS4A 1KC5L 2JELL 1Q9LB 1X5AA 3NCJH 1XR9B 4XNUH 1RUPH 4JGJA 3RVTC 4JRXA 2HFGH 2V17L 3C08L 5C0NC 3SKMB 1ZA3B 1RVFH 1RURH 3BKML 2MHAB 2M1KA 1K5NB 2HAZA 3FZUD 4DKFL 4G80B 3LSOB 5D7LB 1NCDL 2EIZB 1IM9A 1I1FA 1RJZA 4E9LA 4APQD 4GXVH 5CZXD 2Q7YB 3L3HB 5SWZE 4GAJL 1MY7A 3BIKA 1EGJA 1IFHL 2FSEA 4XH2B 5EUOA 3ULUD 4UIKL 4CVZB 4OFIA 4KZDH 5ISZB 4ODTH 1RD6A 2G5BB 3EOTL 3RVUD 3BIAX 2DICA 4JRYD 4Y5YC 5CEYB 4YUEL 3CVHL 1SY6A 4R8WH 1BQHB 5DF0A 1OTUC 3VWKB 3T3ME 5DR5H 2GTZB 4ODSL 3BD3A 4HBCL 4JFZL 3K4AA 3KPRE 3L5JA 4YXKL 3H6JA 1BVLA 1YECH 4HJ0D 3WIIH 5L2KA 3RL1B 4ODVL 3INUL 4FFYL 5FKAA 1JGUL 2ZUTA 5MERB 1Y0LB 4XMKL 1F02I 3ULSB 2XZQH 3JTSB 5ICYA 2OP4L 5GGQH 2WZPD 1EERB 3C60A 3TT1H 3BE1H 3MFFA 1FC1A 1TTGA 2P8MB 4N8PA 1T03L 2IADA 3MC0A 3NH7L 1OCWH 1ZHKA 4C56B 4MD5A 5K9JL 5DRZA 2FR4B 3LEXB 1FZMA 1N3NA 5BOPA 1C08B 5BCAA 1T5XB 1L7IH 3X13B 2DD8H 4K3EH 3MGTA 4JFED 1AC0A 4GKNA 1NEZA 1K3ZA 3FQWB 3TIDA 3WLWC 4LSSH 3X3GL 2EZ0D 1BQHG 2LQRA 2BDNL 4X6CF 3V0VA 3ZKXB 1D5IL 3NFNB 5IMMA 2RIKA 1GRWA 5FHAH 5H8DA 1HN1A 2IQ9H 4KRPC 5CD5D 4EDXA 1Q72L 1I8IA 4XAKE 1MJ8H 3PWNA 1H8NA 2O61A 1NC2D 1ADQA 1KNOA 4AYFA 4U3XA 2DM4A 5D7LD 5CUSL 1PVHA 1NUFA 4YHNB 2DQGH 4Y4KA 1EO5A 3NCEB 5C08A 1F6AA 2X4TB 5HHXL 1MIEL 2OTWB 4TNWK 1FNEB 3QIUB 3VXUA 4QTIL 1ZMYA 4GQ9L 2GHWB 3WBDA 4CVXB 2FGZA 4RGMC 2BVYA 4OGXH 4GRMA 4NWUH 1H8SA 3TBTA 3L1OH 4XP4H 4F7TB 4JEGB 1L9NA 1SEBB 1MLBA 1WZ1H 2EXYD 2P7TB 5D1QA 5EU4B 5JPMB 3DGGA 4WDIB 5JIKA 1J05A 4P9MH 4WTZA 5L9DL 2Q1EA 3FAXA 4KK8D 2P5WB 1XF3B 1KC5H 1QLEH 2C7UA 4ISVB 3TCLA 3PWPE 2B1HH 3IS0X 2LV4A 5D93B 4N0YH 5HDLA 1HKLL 4AEHH 1NDMB 1T3FB 1YQVH 3Q3GB 1NBZB 2CD0A 4F7CA 3QWOB 4ELMF 1SEQL 3C08H 4YE4L 1LK3L 1X5GA 2ZG1A 3EGSB 1W72B 4L8DA 5FYKU 3DSFL 3QO1B 3ORJA 1YEEH 2HKFL 4DKFH 2YA0A 4MA1B 1NCDH 1VHPA 2UYLB 4XVJL 4P2QA 3QIBC 2EYRB 4Y5XC 3SDAB 1A6AA 4KKLD 5C86A 4I1NB 4PV8B 4GAJH 4YZFF 4KQ3L 1OTTC 1IFHH 1M71A 3AROA 1S7XB 3PWUB 4UIKH 3QWRA 5GGSA 2JJUA 4G42A 5CILL 5CJOH 3AREC 1TZHA 3MFGB 4JQXC 3EOTH 4FQHA 1RJLB 2JB6B 3L6FA 1IAMA 4KJWD 3EYSL 1YNTA 4MGXA 2X70B 1AIFA 3NA9H 3I02A 5EZLB 4HBCH 2Z35B 5D7KD 1I85A 4JFZH 4DK3A 3D87B 4NO3B 4RQQB 2CIKA 3SJVE 4MNGB 4E42A 2XKNA 1MCOL 3FMGL 4PREB 5EORH 5IQ9A 2BNQA 1GH7A 1G7QB 3MRGA 4LLVB 1WQVT 1JPFB 2VH5H 5AD0B 3INUH 4FFYH 3NVQA 4KRNA 1LILA 1JGUH 1NGZB 4UU9A 3O41B 8FABB 4Y8AA 4V2BA 3VJ6B 5KSBB 5EOTB 3O4LA 3QIUD 1I3RA 3DUSA 4Y5VB 2OP4H 1A5FL 2H2SC 5IEKB 2EECA 4JFXA 1BLNA 4LCCB 5HYIA 1R5VA 5D7JC 2VSCA 2HTLC 3BH8B 1YY9D 2NZIA 5HHNA 5IB4A 4P2OA 2HH0H 1HHGB 3UTTE 1I7TB 4LF3A 1KV3A 1ZT7B 4NNXB 1U0QA 3NIGE 3TV3H 4UQ2A 4EIGB 4ESKA 2VITA 2IAMB 1H3VA 4NP4L 4X4ZA 3X3GH 5D7IA 4HS3B 2BDNH 4ODUB 4RA3A 1D5IH 4PJ8C 4GMSH 1MI5B 5EUKA 3OKKB 2VDML 3ARDC 3RIFK 1Q72H 1PDKA 3IFLH 4LFHG 4ORGA 5EFIA 4AQOA 4D9RE 2Q8AL 2VAAB 2PTVA 3NPSB 3QG7L 2X4SA 3JV6B 5CUSH 1FSKB 3MRRB 2EO1A 4B5EA 1FH5L 3SDAD 4P48A 2JCCA 4OZHA 2H9GB 2VZVA 3U9PL 2GCYA 1MIEH 3C6LD 4DN4L 1RUAL 5FDYA 2YSSB 3LB6C 1N6UA 1F4WL 3QI9A 1DVFB 3HMWL 1BWWA 1T4KB 4DCQA 4GXUM 2AXGA 1QFWL 4GQPH 4ZFZB 1EGJH 4IDLA 1A47A 5L9DH 3OHXB 3F5WA 2I9LA 3REVA 4LSDA 5I71B 4M8QB 1JNLL 1S7SB 4OZGA 4JGMA 4RGND 1HKLH 1EPFA 3FAWA 1DQLH 4PJDE 2ENSA 4PJXE 4RAVA 4WJ5A 5GSRA 1SEQH 3EW3B 3L5IA 3VGBA 5JXED 1PYWB 3R4DA 3QBTB 4NO0D 1TIUA 5KTEL 1B2WH 5D9SA 3VFPB 3DSFH 4CVWA 1G7JA 2HKFH 3BP4A 4ZFOA 1QBBA 3H0TB 4X8JA 1HIML 4XVJH 4LSTL 2V2XA 3EHBC 1TJGL 3QUXA 1FYTD 1IAII 4KQ3H 1N7ML 2Y4SA 3MRCA 4KKAD 5EZJA 1S7UA 2F5AL 4XNQB 5CILH 5TF0A 1B6DA 2F19L 4CNIB 4P5KB 2IANB 1BZQK 2QBWA 3ARPA 2IAMD 4LAJH 1FIEA 4ODHL 3GDBA 4P23A 1P6FA 1ORQB 3EYSH 4UIMB 3SEPA 4IOFD 2OS7A 3WNMA 5LGKA 3FCTA 1U8MA 2J88L 3WMSA 1K4CB 3ROLB 5I30L 4X99B 4GSDL 1S7WB 5CD3B 3SGKA 3QA3B 5J1TC 1MCOH 3FMGH 3L3IB 4WUUE 4NBXB 2DQHL 4OZFH 4P4KB 1OF2B 5HYJE 2FEEL 4APQC 4G8GB 3VFNB 2ZCKH 5DJ0B 3D39A 5FDWB 4YJZL 1N0LA 5GGTL 1A5FH 1CVSC 2C4FT 2R4RL 3TBWA 2Z93B 1DVFD 3EFDL 3HUJF 1S5HB 1YNKL 3HZYA 3WSQL 3P9WB 3NGBB 3KJ6H 4YHLL 4K9EC 3RVUC 3VCLB 3GSQA 4L4JA 2RB8A 1MCEA 1VESA 4KJQD 1T04A 3BH9A 1WSST 3HPLB 3IDJB 3TLRA 4ONOA 5ADPH 5IM7A 2I07B 2ADIA 5FM5O 3FT2B 1MVUA 3IXAB 4MAYA 4NWTL 2G5RA 2NNAA 4I13B 4YDVB 2LAAA 2NZ9D 4NP4H 4NNYA 4NRXA 4X5XA 3IGAA 1NBQA 4PJ5A 4KTDH 3SGDH 4WI2A 3D69B 3GMQB 4I3RL 1RULH 4XZUB 3UO1L 3ARGA 4X6CE 4F9PA 2VOTA 2Q8AH 2BVOB 4R3SB 1ZSDB 4M48H 3QG7H 1PEZA 3B3IA 5SWQB 1JE6A 1M1SA 5IV2A 3DVGB 1FH5H 3U9PH 5DD6B 1NJ9A 4DN4H 5DMGD 2BY2A 3F12B 4ZUUA 1F4WH 5DDHB 1DFBL 2IAND 5TPWL 4LBEB 3FFCE 5DQ9A 3WE6A 3QQ9D 2W1NA 3MR9A 1CCZA 3V2AR 3CFCH 3BPOB 1AGEB 1Z0NA 2FJFA 3CSPA 2EO9A 2H3NA 2HP4A 1GJIA 4OT1L 1DR9A 4LCWB 5E5MA 1FFQA 1MWAA 5EC2A 5IB5B 2EIBA 1C5DB 1S9XA 3BPNB 5F7DA 1JNLH 4JN2B 5CD5C 5C0JA 1A2YA 3VH8B 5MHSD 3Q5TA 4P4KD 3MJ8B 2YK1L 5H37G 1E4XL 2X1XR 1WITA 4OLXL 4QT5B 2E8ZA 4G8GD 5GS1B 5DJXB 4DW2L 1H5BB 3S98A 1WBXA 3D85B 5DZNA 3MRKB 2CRIA 1F4YL 1MFBL 2GK0A 2HMIC 3MA7A 1MI5E 4G6KH 4HS8L 4PRPA 5F8QC 2P8PA 3HUJB 1HIMH 1NCUA 1BZ7B 3KYMB 4GW5B 4LSTH 5H94B 3RNQA 3W11D 4ZS7L 4ELME 3ZO0A 1CF8H 1TJGH 2A9ML 4N5ED 3QUZA 4KDWA 4M61B 4MJ4A 4V1DE 1R6VA 5EOCL 1CFBA 2F19H 5ELIA 5I15L 5E2WH 1F5WA 3WNLA 1QUNA 1TETL 4KK8C 4X7TB 4P49A 3ZKQD 4YZFE 3RUGA 1JZ5A 4CVUA 2R69L 2YZ1A 1IGTA 2J88H 1T7YA 1N64L 1JGVL 3VU2A 4Z8FL 3VH8G 1UCTA 4NN5C 1BJMA 4E5XB 1JGLH 4OJFL 1M6OB 1OSZB 1FFNB 1LO5B 3Q6FA 2OL3A 2ATKA 1W2KT 3IJHB 3O6FC 5GGTH 5GRWA 4JB9H 4ZUSA 2R4RH 4L8CB 2V7HB 3OX8B 1FL5B 3EFDH 3WNKA 3WSQH 4U05A 3QNZA 2GTWA 2VDLL 2OCFD 1QPXA 4I3SL 4UT6L 1A6ZA 4LIQE 3B6SB 5CMAA 5B3NA 3PWJB 4KJWC 5F6IB 3DV4A 1XCQA 3JXAA 2IMNA 4P5TA 2JTDA 2VLKD 1DBAL 2MWCA 1JHTB 4FXKB 4NOFA 3KPSA 4NWTH 3S8WA 4TQEL 4W4OA 5TGBA 2ADGA 1HYRC 1ACYH 3LQZA 4M1DH 2VLRE 2NY5H 4YPGA 3VFGL 9CGTA 1ULVA 5DVLA 4X80H 4HWEL 5D2NA 5ACMA 1EZVX 4P4RA 1JF1A 3D1MC 1VGEL 5ENWA 1DBBH 3BPLC 3D85D 2Z31A 3T09A 3UO1H 4F58L 1G7PA 2F58H 3MLSL 2WP3O 4H88L 2E9BA 3SOBH 1KLGB 1YPZB 1LO3H 1HYSD 4M6ML 4CU6A 1YY9C 1H15A 1T2QL 4RDQG 1XMWA 1GIGH 4G9FE 1INEL 2G75B 3ARUA 3V4PL 3JWDC 4PTTA 5E8NA 3HAEH 1VEOA 2YUVA 2QSCL 1CFQB 5ID0A 1MCJA 4KMTH 2COQA 4G8FA 1KJMA 3R1GH 3NABL 3ZTJH 4BZYA 1HH9A 4DKEH 4OD3H 5IIEA 4OT1H 3WNNA 2I5YL 3IXTA 1QTYT 3CDGA 3FB5A 1W8NA 5D96C 2D7TL 3U0PA 2BERA 4S1SH 3BEVB 2GI7A 1NGQL 1RZ8A 4PRID 5FYJU 3BGMA 4QHUB 3MRMB 3WJJC 1FL6B 2W92A 2WWKT 2YK1H 4N8VA 4ZYKA 4IRSD 1E4XH 4KI5D 4DW2H 1ZWIB 3MUJA 2CIIA 4MMZC 1LE5A 1RV6X 1GZPB 3TN0D 3C6LC 2FO4B 3WIHL 2ARJQ 4OLVL 2DQIL 1F4YH 1MFBH 5FB8B 5E2TL 4WHTA 4HWZA 3KJ4B 5H35B 1OSPL 4JKLA 4ZS7H 2QV2A 5IR1A 1DUZA 2QSVA 2MKWA 4PJGA 2A9MH 1UKQA 5DI8B 3T0WA 4K9EL 3D3VA 1T7VA 3DRQB 5EOCH 5DK0B 4ZUWA 3IDXL 3NOIA 4JJ5B 5I15H 2ICWB 3RX5A 1ETZA 1KCSL 4Z76A 3CDYA 1P1ZB 3G08A 3UPRA 1KOAA 1OP9A 2R2EA 1U92A 2R69H 2MQCA 5BS0A 3MRNB 1JZ2A 4EUPB 2XG4A 1N64H 3UDWA 4Z8FH 3GKWL 4LCUA 5CJ8A 3TO2A 4HKJA 3QQ3A 3SE3A 4OJFH 4HMCA 2B20A 4R90L 3SDXB 2DQTL 4K94C 4R9HA 1WJ3A 4OB5L 4GH7B 3VXRD 1CL7L 4YDKL 1RK1B 3N1QC 2ITCA 2QKIA 4OCYH 3RL2B 4N0CC 3OR6A 4HCRH 5D1XA 4DZ8A 4ACPA 4NNPL 4KKAC 2OM5A 4UDUB 4HIHB 1YDPA 4NN6C 3TZVB 4JZJB 2VDLH 1UJ3B 4I3SH 2IG2L 4UT6H 2E7MA 3WUZA 2P5EB 2DQUL 1ZVYA 3HN3A 1JUFB 5M7QA 1DBAH 3HUJE 4FA8A 1ONQA 3LDBC 1O7SA 4TQEH 3VWJA 4GW4B 5DD1H 1BQUA 2V2WB 1KB9K 2YD3A 1YMMB 3RDTB 5B4MD 1CIDA 1F4HA 4WWID 4N9OB 4EUPG 3GFUA 4HWEH 3KPPB 1R3LA 1FGVL 3QDGD 2VDNL 1B0RA 1VGEH 2CUIA 1B4JL 2AW2A 1LEKB 1SQ2N 4IOIB 3SGJA 2Q86A 4F58H 4KPHL 4X9FA 3HLAA 3MLSH 4H88H 1JNNL 4U1JB 3DTXB 4XNYH 3LKNB 4M6MH 3VFUA 1OLZA 1KIRB 4BFIB 2XV6B 1X5IA 4P3DA 1OP3K 5L8LB 4F57H 4N9GA 3FQRA 2SEBB 4QCIB 1Q9OA 4N8CL 3PXHA 3OKLA 3X12B 1INEH 4D2NA 1KFAL 3V4PH 5CEZL 3GSWA 5FAAA 1T66D 5D4QA 2QSCH 3VFMA 4NUJA 3DYOA 4X4XA 1JZ7A 1YEHL 1D6EA 3NABH 4NHUB 5HVHC 2I5YH 2VJXA 5CSZB 1WAAA 2PN5A 4BUGA 1CZ8H 5IBTH 2VDOL 1CI5A 4OGYH 1LE9B 1NGQH 5JQHC 1CLCA 4I2XB 3KVQA 5GGVH 1Z3GL 4GS7B 3SE4A 2PYEE 3EYFB 2G60L 2EDYA 3GHEL 1X5YA 1UXSB 5EH1A 4OSUH 3E6FB 3PHSA 1C7TA 3W39A 4S0SD 3WIHH 4OLVH 5DMGC 4NKIL 4CU7A 4FTVA 5E2TH 1A1MB 2DB8A 1J0ZA 1DQTA 3DVNB 5KG9B 1NL0L 4HHAA 3PABB 1QRNA 3WKML 3TZVD 1IQWL 4H0GA 3QQ9C 1OSPH 1F90L 1OW0C 4EN3A 3BQUA 5ACLA 4PJAF 1KT2A 2IPUK 2IPKB 5MENB 3IDXH 3KPOB 1QZ1A 2A1WH 3D2UB 1MCWM 4L3EA 1XCTB 3QYCA 1KB5L 4YDJB 1N5YL 4JHAH 2AK1L 3QUYB 3B9KB 4JFQA 3JTTA 1S9VA 3ULVC 4M8VA 3BVNB 2FHCA 1NGYB 2F54A 1TVHB 1TITA 4XT1C 1QSEB 3ME0A 4IJ3B 5IJKA 3GKWH 1KCKA 1I3GL 1OM3L 5I76A 5T1LB 2OSLB 4OGZA 5IFHL 1W0VB 2EC8A 2DQTH 4BUHA 4JFYA 3BT2H 4OB5H 4LDLB 5INCA 4ZNEE 5HDQL 1KIQA 4U6YA 1A4KA 4YDLB 3CSYB 5B8CA 3W11C 2VUYA 2A73A 4ZXBB 1U8NB 4HW6A 4LLQB 4NNPH 1CXIA 4BYHA 1J0IA 3IJSB 4O5LL 2YA1A 1JV5B 1PKQA 3C8HA 4S11A 3U4EB 4Z5RB 4GRWH 4XXDA 2OZ4A 2IG2H 3C9NB 2RCSL 3MUGB 1MHEB 4OQ1A 4AIOA 1SYSA 3MJ7A 1D9KA 1AC6A 2VUOA 4LLDA 4PJEB 3MA9H 4RRPG 2R0LL 5EU6A 2C1OA 1JI1A 5LWYH 1CGWA 4J4PC 43C9A 1T1ZB 4BH7A 5FKPA 3SCMB 1DQJB 1T22A 5FO9A 4XCEA 4AT6A 1KTKE 4QOKE 1Z0MA 2OXHA 3VFVA 1B4JH 1OGTA 3U46B 5I1GH 2GJ6B 1TFHA 4RWYH 5I1AA 3V52H 1CICA 5DWUL 3P4NA 4KPHH 1NCTA 4KKCD 3MRFA 4OZIF 3S6CA 4OAWB 3HPJB 4GAGL 4R4FH 2CLRB 4JANB 2IBZY 3SO5A 15C8H 2PW1B 2DWEB 4WFHE 4FFVC 4N8CH 5DJ2B 3DUUA 3BZFA 5MEND 1KFAH 5CEZH 2GT9B 3D2UD 1AGFA 1GZQB 3QEHA 1GPOL 3CNKA 1DZBA 1YEFH 3BEWB 5JQ6H 3SDCA 1ZS8B 1J1PL 3MJ6A 4QRRB 4EIZC 3B9KD 5F7UA 4XMLL 2FHBA 1AGDA 1QPPA 3CVHA 1QOKA 5AZ2L 4Q9CA 1DN0B 2VDOH 3C5JB 5EO1B 2NY7H 3E8UL 2OTUB 1GGUA 2J5LB 4MD4A 1NAKL 2C3WA 3AXLA 3ETBF 4Y88A 1Z3GH 4NT6A 5CKGA 1HSAA 4JRXB 4MJIA 5F44A 1VFBA 4KJPD 4K94L 1HYSC 5IW6B 2HN7A 2G60H 3GHEH 1DCLA 1OP3H 4FRWA 2UVEA 5CLTA 3BWAA 5C0BE 5ABDE 2BOBA 3EJJX 4QRPA 4NKIH 1IM9B 2MFNA 4NQDA 1NL0H 5D2LA 1TQBB 5A40E 2AJXL 3VE0B 3WKMH 2YD8A 2BVUA 1IQWH 4MNQB 3BIKB 5HHQA 2FSEB 5EUOB 5EWIH 3C87A 3STBA 1MVFA 2R23A 3Q0HA 1KJVB 4PJIA 4PJCB 2HRPL 1KB5H 2XQYK 3FTGB 4QRQA 4R0LC 4BA8A 3QDAA 5ANMA 4BSWB 1RK0B 5I1HH 3WO4B 5KZCD 3P3YA 4XAKD 1TPXB 3FQUA 4LSUL 4JPKL 5CP7B 4N0RA 3HE6D 3SCMD 2OTPA 4TTGA 5BO1L 3CU7A 4IRSC 1AFVL 1J8HE 4NDMA 1BVLB 5AUMA 1DQDL 2GJ6D 4XPAL 4YC2B 1URLA 4J3UA 1VACB 5C7XL 1MFDH 5L2KB 1BJ1H 1I3GH 1WLHA 1IBGL 5T1MB 4E41A 4R96A 5FKAB 3TN0C 2AI0L 2W9LA 5HDQH 3K4ZA 3T0EE 1EXUB 4W6XB 2XPGA 3WS3B 3KPQA 3UPAA 2AJSL 2B1AL 3C60B 1CDGA 3OXSB 3AS0A 3MFFB 4Y89A 2H8PA 2VXSH 5KSAA 4PRAA 5E99H 2NPLX 1JTOA 4HKXB 2IADB 5E0QA 1ZHKB 3B9EA 4MD5B 2BSTA 4O5LH 4X7SL 5F3BA 5DRZB 2A6JB 1S8DA 1X7QB 1ZT4A 1FZMB 3HE7A 4WWKA 2RCSH 3RIFF 3BGFB 1N3NB 3R0MA 4G8EA 4JAMB 2D4FA 5CGYD 1KPVA 3MGTB 1PEWA 4GKNB 3WDIA 1NAMH 1NEZB 3TIDB 4Y8DC 5B22A 3PUCA 4OBRA 1ZLVK 3V0VB 2R0LH 4RNRA 4V2CB 3V95A 5IMMB 1TLKA 3DX9A 4X5WA 1ZHLA 4OLUH 3LMJH 3BP6A 1MAML 3QHFH 4CBPA 4Q2ZA 5L88L 35C8L 3KYOB 1I8IB 5DHYA 2FO1A 3PWNB 3NCBB 4PG9B 3FRPA 1KNOB 3FOLA 2DRUA 5DWUH 5CIPA 2CSPA 2MQ3A 4O2EA 1IZKA 4XNXL 4HIJA 4Y4KB 3L3OB 3BZEA 5C08B 1OTSD 5CBAA 2FX8H 4GAGH 1F6AB 3FO0H 3P77B 2ERJC 4L8SB 3WKNA 4H5SA 4MNQD 1GC1C 3VXUB 3MQIA 2R15A 2ZOLA 4L9LC 2FLRT 4WW2A 2YBRA 3U1SL 1E4WH 3TBTB 2VE6B 1GPOH 5FUOL 3SY0A 3O2WL 3JZ7A 5D1QB 2V5MA 4FQQA 4XMLH 2R1WB 4MWFA 3SJVD 4X6DA 1J05B 4XP5H 3MO1A 1ZXQA 3HS0A 1XF2A 1NEZG 5CJXA 5AZ2H 5B4MC 2VN7A 3EYQD 2IALA 1YUHB 3QSKB 5IFAL 2C7UB 3ULVL 2BVPB 2EXWD 5I8CA 4Z7WA 1MCQA 4P2RA 1K8IA 1T20A 3G04A 1GOFA 4WNQA 4FFZH 4F7CB 5I8OL 1PZ5B 5LKNA 2DLHA 4JG0L 2EDXA 5CGMA 5KOVC 4J8RA 4OM1H 4HXAH 1XIWB 1MEXL 3UTTD 2Y25A 3NACL 1A6AB 3PIQA 3P2TA 2AJXH 5IMKB 4IRJB 1EVTC 1M71B 1QBLL 3IJYA 5GGSB 4G42B 4LHUD 2X89A 2V5TA 5BW7A 1TZHB 5T1DH 2PO6B 1V3LA 4FQHB 3QUMA 4WI8A 2HRPH 2X1WL 4HGKC 4OIBA 3H7LA 4PJFF 3CX5K 2FJGA 5IB3A 2LFGA 1YNTB 2P45B 1FZKB 4LSUH 4WTZG 5D6CA 4CMMB 4PJAE 4D9RD 2HFTA 2JJVA 2XZCL 1HI6A 2CUMA 5BO1H 1AFVH 1IKNC 2CIKB 1DQDH 4E42B 2XKNB 4OZGF 5C7XH 5IQ9B 3MRGB 2EYTB 4PJHA 5ETUA 5C6TH 5C08D 4UU9B 5E8PA 5M95B 4CDGC 3O4LB 2VRAA 1I3RB 2MTPA 3U82B 5DJZA 4JFXB 2B1AH 3ZE1F 2WNGA 1R5VB 1CDYA 5DD3H 1S7TB 3P73B 5HHNB 5HGAB 4P2OB 4P0DA 3MLUL 5TDOB 3W82A 3O2DA 4LF3B 5FYKD 1CYGA 4JRWA 2ICWI 1Q94B 3JBG7 2VXQL 5K9OA 3MRBA 2GJJA 4Y5YA 12E8L 3DWTA 4UQ2B 5DTFA 5EG6C 2JKXA 4Z0BL 2VITB 1NKOA 5D7IB 3MSPA 1CLOL 4PJBF 5IB2A 4DUWA 1BD2A 5HPMA 5I8KL 4NKDA 3ZL4L 5EUKB 2JJWA 1DJSA 1MAMH 2LVEA 5JTWA 3RZCC 1YC8A 4ORGB 5EFIB 2FYYB 1IC1A 5GZOC 5C9JA 2X6MA 4ZODA 2X4SB 1KELL 1XIWD 3U79A 4NN7C 2GSGA 4XNXH 5DS8A 1JYWA 3O0RH 3CZJA 1EEQA 1LO0L 2JCCB 4OZHB 2ARWA 5GGRB 2BCKA 2GCYB 2E3VA 2OQJB 4IRJD 1RZKH 1KTDA 1INDL 1AGBB 3ALPA 2PO6D 1G7LA 5HYQA 1ZLVH 4DCQB 2AXGB 1HWHB 3I6GB 3RFZC 1Z9OA 1M05A 5E6ID 2QSQA 3BD4A 5KS9A 4OF3A 2I9LB 3REVB 1AP2A 4JDVA 4S1QL 5DFWH 5AYUL 3PHQA 5HYJD 2UV3A 4OF5A 3ULVH 5IFAH 5IK3A 1FL3A 4FQXB 3CH1A 1IQDA 5DC0A 4YLQT 4MS8D 3PWLA 2VL4A 2VTFA 3LRHA 2RQ8A 3OB8A 2ATPA 4KKCC 5DJCA 4RAVB 3KS0H 4QHMB 5I8OH 5GSRB 3BYYA 1J0KA 1BHGA 2AJYH 3MNZA 5C07B 3CUPA 4WENB 5D9SB 3QO0A 2C3XA 3BP4B 3CSBA 4QHKJ 4ZFOB 1MEXH 2W9EL 2FNBA 2WIMA 3NACH 2V2XB 4ZSOA 1RIVH 4OCMC 1WCQA 3QUXB 2N7AA 4EBQL 5JIPA 1QBLH 3MRCB 5EZJB 1S7UB 4TSAH 2ADJA 4UDTA 5JHLL 3VG9C 2R39A 5KW9L 1E0OB 1I9JL 4AL8H 2V5SA 4WGVB 3VXSA 4P23B 2HFFA 4O51A 4PD4J 1G6RL 4MD0A 4QYOA 5EU5A 1OGAA 1JPTH 3FCTB 2FGWL 3CVIL 5LQBL 4YO0B 1U8MB 5HI3D 1O0VA 3PQYE 1JWUA 4LCYA 2QQLL 5DFVD 1RSFA 3MUZ1 2BNUA 4KJPC 4XC1L 2NY0C 2H6PB 5J13B 4QHKI 1JN6A 5FO8A 3GK8L 3RWIB 3ZDXF 4AMKH 1KENL 3C5ZA 1A1OA 5F7WC 5HGBB 2WINB 1NCBH 3H9HB 3MUY1 3TBSB 3D25A 2XNAA 2BNRA 4X4ME 4GMTH 3QIBA 3TBWB 4Y5XA 3HNSL 2AGJL 3HZYB 1GGBL 4MA3A 3VRIB 4KVNH 2UY7A 4U0RC 5CSBA 3VGGA 3MLUH 3GSQB 5E2VL 2OXGA 1IAKB 2VXQH 1CGSL 1CG9A 2GYSA 3QT2A 1HXYB 4JQVC 1OAKL 4LU5L 4NZRH 1MVUB 4P2QE 4MAYB 4YNYB 3HE6C 4X9GA 1D5XA 1WIPA 4L4TA 3RUGF 1FE8L 4FQXD 1AGCA 1J18A 3QNXB 5J3HC 4X5XB 3U7WL 3QRGL 3C2SA 2C5DC 4PJ5B 3VGEA 5I8KH 2APFA 3HCVA 3ZL4H 2JB5L 4PV9A 4PS4L 1UB5A 2X1OA 3DARA 4KUZL 4Y7MA 5C07D 3ARGB 1JFQL 1U8JA 5IQ7H 3WEXA 3B3IB 3QEUA 3KLHD 4V1DD 3CXDH 2X4QA 5IV2B 1U58B 4I0KA 3BSZL 3QJFA 4RMUA 4IS6A 4NM8L 3BRDA 3QUXD 5I2IB 1U8HB 1AD0A 1UM6L 1CDUA 4QXWA 2BNQE 3EZ8A 1A14L 3GM0A 5D7JA 1INDH 3L7FA 3QDME 2K9UA 2I9TA 4ZUUB 4HZLA 4KWUA 2NQCA 4HWBA 1JF6A 1FHGA 2CDEA 1T21A 2J6EA 4ONGL 1DEDA 5SWSE 3TA3C 3LHPH 2DQFA 4D9LH 1MCRA 4F7PA 2DDQL 2DLIA 5T3XH 2XWTA 1YEKL 2H3NB 1VFUA 5E5MB 1MWAB 3H42L 4POZC 3RTQD 3P0YL 3CK0L 4Y2DA 5EC2B 1B3JA 4S1QH 5AYUH 5F7DB 3QXDB 3QUMH 5GXBB 4YBLC 4PJ8A 1A2YB 2VDQL 4WO4C 5T5NF 3AS3A 2N56A 3NZHL 2EDNA 3S37L 4HUWA 2R0WL 3QG6B 5CKAA 1MFCL 1NFDA 2K3TA 2V9QA 3NAAL 3WFHA 1A0QL 1WBYB 3UYOD 4LPXA 1F45A 2C3GA 2VQ1A 1V3MA 2GK0B 3WLBA 4KDTA 1YZZA 2WBKA 3NCYS 4WV1C 1JTPA 2W9EH 3MA7B 4L4VA 5DC9B 4PRPB 2P8PB 1BAFL 5F7HA 4GRWF 3P4MA 4P99A 4WHYH 5L0QB 3KYNB 3BWUC 4EBQH 1A6WL 3UZEA 2UZYB 5I6XC 4JO4L 2YD5A 2VLRD 1A6VL 1OAZH 3QQ4A 1KIPB 5JHLH 4M02A 3I9GL 3U0WL 4Z7QF 1NBVL 1I9JH 2XKSA 2H26A 4JDTL 5D1ZA 5ESAA 3EYQC 1EEYB 1G6RH 1ZVSB 2FGWH 4KFZC 4MB3A 1S9YA 3EOBB 3EOYG 3O3UN 1IGTB 1HQRB 1RQ5A 4FFWD 2QQLH 4ETQA 1YN6A 5CS7A 5DK2A 1VKXB 3ARGD 4U1LA 4JE4B 4PJFE 4XC1H 5C0RL 2V5YA 3G5VB 2D31A 1KENH 5KVFL 4PY7A 2ATKB 1OT2A 2AJ3A 2ZUXA 4I18B 3SDDB 1CXKA 2DI7A 1FRGL 2X4UA 3KAAA 4OZGE 3DI3B 4GKZA 3VRLF 3HNSH 3GHBH 4PRNA 1YMHB 3NTCL 4FNLL 2AGJH 1I9RL 3QNZB 1N26A 4H26B 1P5UA 1HDMA 1U8OA 3TJEH 1A6ZB 4ELKA 5C0EA 4Y16B 5CMAB 3KXFB 5DEFA 5E2VH 4TVSa 1CGSH 4QRSA 4P5TB 4DEPC 3ZTNH 1AHWB 4FG6C 3KPSB 5IROA 2E6QA 3JWNC 5TGBB 1JWMA 1J0HA 4UNTA 5EO9A 3NFPB 3QRGH 3QRFM 5HYSA 4P4RB 2F5BH 4OLYL 2A74A 1JF1B 4M7ZC 5ENWB 1Z5LA 5GHWH 4KUZH 3VFSA 3LD8C 2Z31B 3ZSTA 1JFQH 4N0UA 1CFNA 3QNYA 4PJBE 1G7PB 3MRPA 4YK4B 1T2JA 2AERT 4APQA 2HFEA 3IB4A 5MEQA 1CDCA 4HKBA 2ZSWA 3LZFL 3WDJA 4WCYL 4JN1L 4NM8H 2C3VA 1H15B 1UM6H 3FQTA 5DRXB 3OR7A 1A14H 1IAIL 2CH8A 2QQKL 2D03H 1QNZH 4KKBD 4GO6B 4ONGH 2VIRA 3D39E 4RFOH 4RMWA 5ID0B 3TYGL 1TDQA 4ZS6C 3HZVA 5IB1A 2DDQH 1KACB 5CJ5A 3NPZB 2YUZA 4QRTA 1MUJB 2DF3A 5IIEB 3IXTB 1CGVA 3CDGB 4R97B 1WWWX 4YIQB 3KNBA 2P24A 4LHQB 4K7PY 1ES0A 3WD5H 2WMPA 3G5YA 5DRWA 2ZCHL 3GJFK 1RZ8B 4JREC 3BGMB 2VDQH 3HC4L 5HHPA 4HGMA 3U0TA 2HRLA 4PRHB 3VXNB 4N8VB 4ZYKB 1N0XL 3EOAA 3OXRB 1MFCH 2Y36L 3VGHA 2YEZA 2JIXB 2A77L 2EKSA 1A0QH 3SDDD 2DJUA 5LBSL 3PDOA 1LE5B 5CINH 5FUCE 1IC5L 4JFDA 5KVGL 3V4VL 3SO3B 3RI5K 4LLUB 1G7HB 1NGXA 4B7IA 4M1GL 4WHTB 5GS0D 1F00I 1BAFH 4MQ7A 4NBYB 4P57A 3PV7A 3IKCA 3KDMA 1DUZB 5E8OA 4PJGB 5IR1B 4QXUL 4Y16D 3KXFD 1A6WH 2EDTA 4JFEA 5GS2H 4JO4H 1GGYA 4ZUWB 5E6IC 3LPFA 1A6VH 2QADC 3A6BL 2VXVL 4KRLB 3CJJA 2NXYC 3I9GH 1JGEA 1FLRL 1NBVH 4Z76B 1SJXA 4JDTH 1Q9LA 3G08B 3TT3L 4XX1E 6CGTA 5HBBA 4QKXB 2R2EB 3GSNB 1U3HD 1U92B 2EE9A 4ZOBA 5IKCB 1ZA3A 3TO4C 1NFKA 1FG9C 4O9HH 1NC2A 4G6AD 5IF0B 2NY3B 3TO2B 4HKJB 3LSOA 5D7LA 1KPUA 5F7YC 1L6XA 2WV3A 3S35L 4KKNA 4KGLA 4N8VG 2D3VA 3L3HA 4UT9L 5KVFH 1FFRA 4LRNL 1NLBL 4CVZA 1I1CA 3NA4A 1PSKH 1QO3A 2Z8WC 4MA1C 2QKIB 1T0NB 3OR6B 5D1XB 1J86A 4LLWB 1RFDH 3ZDXE 2E9JA 2JK5B 4PRBB 4FNLH 1JPGA 1JRHH 1J11A 5I19H 1YDPB 2NY1C 3MRHA 1BQHA 5AEAA 2EEAA 4KQ4L 4TVPD 1HHKB 5F1KC 5HHMB 4I0PD 2M2DA 1ONQB 3DROB 2J12B 3VWJB 5DFVC 4X9IA 3RL1A 4Q58C 3NCFB 4P5MA 3WUWA 3I75A 4PRHD 4YX2L 3BKYH 2D7PA 2BHYA 2JIXD 1R3LB 4OLYH 1B0RB 3BP7B 3M45A 4U6VL 5LCVL 4OM0L 2VLLA 4PYGA 4RFEA 4OF0A 1MHHA 3UC0H 3RUGE 4UV7H 2Q86B 2P8MA 3HLAB 5AZEL 1MY5A 1M7DB 3LRSA 3VFUB 3LZFH 2ZSVB 3LEXA 4GBXD 5BV7H 2XN9E 2R2HA 4OI9A 4X83A 4P3DB 4JFHE 4N9GB 1T5XA 2R9HC 1Q9OB 2QQKH 1NUGA 3GSWB 5L8KB 4XBEL 3VFMB 4NUJB 3H3BC 1D6EB 2QQQA 3TVMB 3VFOB 3I2CH 2DQCL 4LDOB 4AEIH 3U7AA 5F70A 2FJHB 1AE6L 2NY3D 5DA4A 3TPUA 3SE9L 4J6RL 4YQXL 3MLYH 4YHNA 4O4YL 2RGSA 4LPWA 2Y06H 1SVZA 3MV01 4WI7A 5SX4H 2CGRL 1N0XH 2X4TA 5E1AA 1D5BA 2NYYC 3KLHC 1YNLL 3QIUA 2A77H 4QF1B 4JGUA 5F97E 5LBSH 2EDDA 3O81A 1V7NL 5KVGH 2DN7A 5D1XD 3V4VH 3V5HA 5GJTL 2Q6WA 4FTVB 2XG5A 3RHWK 5FM5M 4HHAB 3B5GA 5D2NE 4F7TA 5EU4A 1WTLA 5T33H 2H32H 3IDYC 1P7QB 5SV4A 4K3GA 4EN3B 3BQUB 5IVXF 1KT2B 5HHMD 2GITA 3GMLB 3RTQC 4BFEA 3JVGC 4KHTL 4MA7H 3A6BH 1DE4A 2VXVH 4L3EB 4ISVA 2DJ4A 3GJFH 1FLRH 4GRWE 3VWJD 3K2UH 4W4NA 1VGKA 4JFQB 3TT3H 5CBEB 1NDMA 1LO2L 3Q3GA 3JTTB 3O6KH 1S9VB 1NBZA 2Q3AA 3QWOA 5KAQF 3U83A 4LVOC 2ZJSL 2VDKL 1R24B 3IU4L 1F6FB 1N4XL 3WJJA 4Z7QE 4XPBH 3EGSA 2R2BA 4ONHA 1UM4L 3PL6D 1I7UA 5I76B 1CE6A 3CSGA 3S35H 2UYLA 2BY0A 1TMCB 1UWEL 4JFYB 3SDAA 5INCB 4N5UA 1KIQB 4U6YB 1CE1L 4Z18A 4UT9H 5B8CB 4LPVA 2N4IA 4LRNH 3C6LA 3PWUA 1NLBH 3GO1H 4M4RA 4MA8L 3VI3F 1FBIL 1UWGL 5F1IA 5E5UB 2O5YL 1P9MC 5FGBA 4XPFL 1RJLA 2LTQC 1X5JA 1HXMB 2L0DA 2JJTC 4RMTA 1PKQB 1GOGA 5EOCJ 3TVMD 2B2XH 2B39A 2X70A 5JW5A 2R0KL 4PJIF 4HJGA 5CEZE 3SPVB 1WFNA 3BN9C 3BUYA 3VRLE 3A6CL 1SYSB 3MJ7B 1D9KB 3S3PA 4N1CA 3MNWA 4FQPA 3WJLA 4MNGA 5DJ6A 3S7GA 4FFWC 1H3TA 2KZWA 4OF8A 5EU6B 1G7QA 1CT8A 2C1OB 3MGOB 1JPFA 2OI9C 2NY6B 4IIQC 2NY2C 3D3VE 1EIBA 1HOCA 5FKPB 4YX2H 3VD9A 2KQMA 2W07A 3JV4A 4PGDA 1T22B 5C0BD 5FO9B 5KSBA 5EOTA 1BVKB 3BZDA 4XCEB 5JXEA 4AT6B 2UZXB 4OCRL 4U1GB 4OM0H 1OGTB 4NO0A 5ALBH 3VFVB 1I7ZB 3CIQA 3K74B 5I1AB 2Z9TA 1CICB 3P4NB 4BZ1H 4LCCA 5GRZA 5DMKA 1YEIL 4IMKC 5AZEH 5C0CB 2B5IC 2X4NA 5BS0E 3L5HA 1FYTA 4WFGD 1D7FA 2UY6A 1P7QD 1JGDB 3QEQE 2NW3A 3G9VA 4D3CH 1MH5A 1KN4L 1JIBA 1ZLSL 1RY7B 3VW3L 3O4OC 5L2JA 1AGFB 4NJAH 2P8LA 3QEHB 4XBEH 1NKRA 4ODUA 1U91A 3FT4A 3SDCB 2N1KA 3T65A 2IPTL 4Q6IB 4LLYA 1ZOXA 1AGDB 1J8HD 2DQCH 3DURA 3CVHB 5MP6L 4QHLA 4EQ2A 3OKKA 1UH4A 6FABH 1AO7E 2DL2A 2DYPD 1V7MH 1DSFH 1HHJA 1BIIA 2VQUA 4Y1AB 1AE6H 3T0ED 1G9NH 3SE9H 4J6RH 3JV6A 4YQXH 4MD4B 1MIML 4UMGA 3MRRA 3RKDC 4H1LA 5ID1A 2H9GA 2NMSA 2CGRH 4MJIB 1U95A 1VFBB 1YNLH 2HN7B 3NZ8B 3O9WD 1JYXA 1W72L 5T1KD 1U8IA 2KPNA 1V7NH 1DVFA 3V0WL 1TZGL 3CMOH 1QA9B 2DQJL 2CKBA 5FFLA 4NQDB 1R5IA 1O7VA 4LSQL 5D2LB 1EAPA 1Q0YL 4UB0H 4ZFZA 5HHQB 1FN4B 1PX3A 5C1MB 1ZK9A 2E9WA 1J5OL 2EDBA 2R23B 2Q76A 3AMLA 4BK4A 3OHXA 1NANH 3CLFH 1MJ7L 3IDNA 5D5MF 1WEJL 1QBAA 4KHTH 3K1DA 5DRNA 3TJHC 4QRQB 5ANMB 1LP9A 3IF1A 3WO3B 3OJVC 3LV3B 3TH2T 1P7KA 5KAQG 3JWOC 1KIUA 4ZTPL 5EOQL 3IU4H 1N4XH 4NDMB 3V0AC 4M1CD 1FO0A 5LXGL 2AXHA 4Z7WF 4E41B 3IDIA 4HAGA 1QSFE 3H0TA 5C0CD 3ARFB 5LGJA 1CE1H 4CMHB 4EI6B 4ZAKB 5GS0C 3F7PC 3KPQB 5JR1L 4KDVA 3M17A 1FBIH 4PGZA 1UA6L 5HYEA 4POUB 2IANA 3SDYH 4LSRL 3S36L 2H8PB 4NPYA 5KSAB 5DT1L 1OW0A 2BSTB 3ROOA 2Z91A 3MOAH 1S8DB 4ONFH 1ZT4B 2C3HA 2NY4C 2EH8H 3HE7B 4WWKB 4NKMA 2WUBL 5IW1A 3PG2A 5EZIH 4CJ0A 2R0KH 4XB7A 4FTVE 4KI1A 3A6CH 1U3HC 5CD3A 2WLZA 1QRNE 4C4KT 4Y1AD 1BFTA 4NOBA 1A7RH 4P4KA 4G6AC 1OF2A 3K8MA 4R6UA 1MFAL 3DX9B 4NCC2 4X5WB 4O2CA 1FZOA 1X5LA 1B0GA 4G8GA 3VFNA 1EHNA 5C70A 4Q2ZB 4OCRH 5DHYB 2EE3A 3UYRL 4YFEA 4GKSB 4IMLA 3OQ3B 1EFQA 5CIPB 4O2EB 1S5HA 3T4AA 3RWFB 3TP4A 3BZEB 5CBAB 2YC1A 2F54E 3RVVD 4YHZL 3QDJA 2JJSC 4C57C 2ZOLB 5E4EB 2I07A 4OCWL 5F72S 1KN4H 3BX7C 1ZLSH 4WW2B 1JNJA 3VW3H 3LEYL 5FOBA 3SY0B 4I0PC 4Z77A 4FQQB 4PGCA 4F15C 2XZAH 3KYKH 4MWFB 3DXAE 4X6DB 3MO1B 3D69A 1E6JH 4M93C 1XF2B 3W0WE 4Z95L 3P4LA 3BGAA 3VDCA 4MHHI 2IALB 2Z4QA 4JM2F 1GYAA 3B9VA 2VN4A 1WVZA 4R3SA 1ZSDA 4JO2L 5I8CB 1CD0A 5SWQA 1MCKA 4WIQA 1K8IB 3DVGA 1KGCE 3ARFD 2RR3A 3G04B 3RU8L 4BM7A 1W0YT 1FNFA 4R2GB 4ZAKD 3DIFA 3L5XL 2HJKB 1MHPL 2X7LB 3I50H 3FRPG 5FA3B 1W72H 4O2FA 2CJUH 3F12A 2FDBP 4J8RB 3LKPA 2DQJH 2ED7A 3MV8E 5KSAD 5DHVA 4G7YL 5KJRL 1Q0YH 4UNVA 2BXZA 4M6OL 3IJYB 2MCPH 4CADA 5IB5A 5FF6B 4EXKA 2VLKA 1NCNA 1MJ7H 5BMFL 3OZ9H 1C5DA 1T5WA 2Q7NA 4EI5D 4C55A 2BMKA 2FJGB 5A3IC 2VDRL 5GGSY 5EBLB 5D6CB 5IVXE 5KS9F 1LNUB 4ZTPH 1HI6B 1JK8A 2NTSP 4OQTA 3HRZA 3P30H 3D85A 3OJDB 1SJVA 4F7EB 5LXGH 5ESVB 4F3FA 4PJHB 2Z92A 4XTRD 5E8PB 3BAEL 3GSUB 3TCXA 4M6AA 2R8SL 3GIZL 2OK0L 4M61A 1N8ZB 5DJZB 4PLKC 3MYJA 4JY6B 1OPGL 4X6FB 3PP4H 4LSRH 5K33A 4L29A 5DT1H 3MV7B 5FUZL 1G7IB 1ITBB 4Z7UB 5E03A 4U2YA 5C9KA 1RZ7L 3VI3E 2WUBH 3IDUA 3MACH 4QRPE 5K9OB 3MRBB 3C8KA 4P59L 5IG7B 4Y5YB 5HDBF 4R0LA 4YHIA 1FIGL 5A2LH 3OWEA 4PJ7B 4PRIA 5IUSA 1ZEAL 3G5XB 1M6OA 5IB2B 2QJDA 3W2DL 1BD2B 1OSZA 3PL6C 2VR5A 3G6JB 4NKDB 4PTUA 1MFAH 4IRSA 5HTSA 4PJIE 1KCUH 1NSNL 3IJHA 1MELA 4R2GD 1BJ1J 3CFDB 2OBGA 2XYCA 4Z7VA 1SHMA 2Y07H 5J11C 3BO8A 3R8QA 4NCC1 3UYRH 4U6TA 1WUNT 3TN0A 4HULB 1CDBA 4ZFGL 5C9JB 5C3LD 2FECL 3UP1A 3VMNA 2X10A 2GSGB 3WFEL 3QPQD 1MPAH 2NW2A 5I1KL 3B6SA 4K7FA 1VFOA 4YHZH 3PWJA 1YEGL 3WFZA 1KTDB 1JPST 3VFWA 2FEDD 3T2OA 5IHZB 2KQNA 2FIKA 1M7XA 1JHTA 2ZUQC 4QTHA 1G7LB 3SKNB 1G9MH 1T1WA 2LAGB 1BFSA 5GGRY 5JO5A 5C0GA 3PQYD 5E7BA 1CLZL 3U30C 1WIOA 2A9NL 3DETD 2F8OA 3BYTA 1CFSA 4XVUD 4JDVB 1S78D 3WFCH 3PHQB 4R4ND 2UWEF 5IK3B 2ITDA 1F4XL 2R56L 1IQDB 1XGTB 1KF9B 5LGHH 3PWLB 4KRPB 1CDHA 3VXRA 3N0PB 1WC7B 3QUKA 2YUWA 2ATPB 5DJCB 1FFOB 3RU8H 4XMPL 3W5NA 1P53A 3L5XH 3CUPB 3I6LE 3QFJB 3DI2B 4ZG1A 1EEUA 5I1EL 1ZAGA 4NQCB 4YXLL 4F80A 1CFQA 2HVKA 4UQ3A 1KBGL 3PE9A 4ZSOB 3MV7D 3QPXH 3AM8C 4L9LA 1PD6A 4ZO6A 5E70A 4M6OH 3S4SA 2J4WL 4U3CA 3QULA 5EU3B 1A02N 5MEOA 1EAJA 3PGDA 4UDTB 3BEVA 3QB7C 2YKLL 3VXSB 1G0XA 2HFFB 2P46B 3EJYD 4NCDA 4N90E 5EU5B 1OGAB 3D0VB 5J56B 1FL6A 3OAYK 4DOHE 1N6QL 3T0EC 2CK2A 4GKOA 1CXLA 3QDGA 5D5ME 4D0BA 4LCYB 1OT1A 1ZWIA 1H3PL 2BNUB 4GS7C 2FBJL 1JP5A 1UM5L 2HJFB 4LGSB 2IEPA 5FB8A 5FO8B 4WVRA 3KR3L 3EDJA 4NZDA 2XQBL 1A1OB 3QDMD 3BAEH 3K46A 4MVBD 3RAJL 3D25B 2XNAB 2R8SH 3GIZH 3ZT5A 3N85L 5E8EA 3DRQA 2XOTA 1OD9A 3QIBB 3FQNA 4Y5XB 4Z7WE 1OPGH 4P2RE 1HINL 4MA3B 2X4PA 3ZZ1A 3HMXA 1P1ZA 3GEWB 2VLJE 2CLVA 3U4BL 3AREB 1RZ7H 1YJDH 3MJ9A 1CG9B 3GNML 4P59H 3BISA 5C09E 4EUPA 1V3KA 3V5KA 5ALCL 5T3XE 4DWHA 1AGCB 1P7HL 3QXUA 4LEOB 1FAIL 3W2DH 3N1GC 4JVUA 3HCVB 4MXVF 1BX2A 5H37H 5E6YA 3CFIC 3TPKA 1UWXK 3RL2A 4K07A 1JJUA 2PR4L 3EKCA 4RAUA 3QFJD 5MI0C 3IU3B 3R06B 1UYWL 4ZFGH 1OLLA 5FGRA 3WEXB 5GRVK 2J8UA 4NQCD 1MCFA 3LKOB 3NCCB 5KN5B 3QEUB 3DMMD 2APVA 2X4QB 5GRJL 1AJ7L 3TZVA 4ZXBC 5IHLB 1AQDB 4KROC 1CFTA 1RHFA 5D7JB 1YEGH 3L7FB 2I9TB 5JXAL 4HZLB 2MQ0A 5I1CL 4K7PL 2YPLE 1T21B 2F74A 2DOCA 4GW4A 4F7PB 1UVQB 1F3JA 1PX4A 1CLZH 1SM3L 1Y18A 4J12A 3HI1A 4U1IB 3WYRA 1T83A 4WFEE 1MFNA 2X9YA 3OKYA 2PW2A 4Y19B 3RI5F 4PJ8B 2BP3A 1F4XH 1LDSA 5D71L 3VXQA 1MLCB 4OTXH 5IHUH 4U1JA 3RPKA 4HUWB 4OKDA 2XTJE 5J12C 1NFDB 3V6FA 3WFHB 4HUUA 4XMPH 3WV0A 4BFIA 4KK5D 4BQ9A 2SEBA 1UH3A 2WWKO 4YHYC 1B6UA 3X12A 3WLBB 4JFOA 2OR8A 1OTTD 4LCIH 4XVTH 1KBGH 3ULUF 5L8JB 4XCYA 3PWVA 3NCMA 4PP1D 5JIHA 1EX0A 3CPLB 3ARED 32C2A 1ZLWK 2J4WH 3OKNB 1KCLA 5DMIH 3QQ4B 1IC4L 1LEGA 4HUMB 1AD9B 2VZ1A 5EPMA 2H26B 5D1ZB 5ESAB 4I2XA 5CJQH 4KJYA 2J3SA 4PBWD 4XNUL 2B8OT 1N6QH 2HFGL 1S9YB 2P47B 1RVFL 1QD0A 1F3DJ 2HVJA 1H3PH 1YN6B 4B50A 5DK2B 4U1LB 1W0WA 2YR3A 2FBJH 3EDDA 4Q6YA 3KS0J 5KG9A 3KR3H 3DVNA 2D31B 5F89B 3ARRA 5KS9E 2XQBH 3EFFA 4IDJH 1K9TA 2H2SD 3ZDYF 1IC7L 1XGPB 3FN0H 2AJ3B 5CP3H 3RAJH 3ARYA 3ISWA 2X4UB 3N85H 2QHLA 3SBWA 2HTLD 5TE4L 4PRNB 1XCTA 3RVXC 1HINH 5AAWA 2BVQA 3B9KA 2KBGA 4LQFL 1U8OB 4MMXC 3OAYH 4EI5C 4ELKB 4LK4A 5C0EB 2EDLA 4EKXA 4JFFE 1U2CA 5GIRA 3WNOA 1J9CT 4ZQKA 1HWGB 4QRSB 4Q74A 3GNMH 1TVHA 1I1AC 4LSVL 4MCYA 3ZSSA 4PJ9D 5ALCH 4Y19D 3WIIL 4PJ8D 1JWMB 3G5ZA 3UJJL 4YGVA 3ARDD 4DGYL 1EH9A 5EO9B 1IRAY 2EEBA 2XZQL 5HYSB 5HDBE 3CSYA 4H20H 1EV2E 2A74B 3EYUH 4UV4H 4FQIH 5GGQL 1Z5LB 2JF1A 3TT1L 3VFSB 1U8NA 3B2UC 4N0UB 1TNNA 1AQKH 3MRPB 4APQB 3MOBH 1OCWL 1FDLL 3FB6B 1AJ7H 4TOYL 1KUMA 3LB6D 4KY1L 2C3VB 4NZUH 4OCSH 4RX4D 3MUGA 1MHEA 1OHQA 2DD8L 4K3EL 5BRZE 5JXAH 3CX5J 4KAQL 5I1CH 1HH6A 4LSSL 1U8KA 4K7PH 2VIRB 5GQBA 2BNRE 5IB1B 2XWJB 3F6IA 4JQVA 3HB3C 1T1ZA 1FVEA 3HE6A 3SCMA 2B0SH 1DQJA 4GAFB 2IQ9L 1FC2D 4J23A 3KNBB 2P24B 1UWXH 1MJ8L 5JORB 5DRWB 1NMBL 3RHWF 4AG4H 4L3AA 3SHSA 1F13A 1N2RB 3U0TB 5HYSG 5F7MC 2VSDA 2CLRA 1UCBH 2YEZB 3LQMA 2EKSB 3BPCA 2PW1A 4HUKB 4ZD3H 5LAXB 2DWEA 4L4TE 4HIIA 4JFDB 2UWEE 5EBMB 4S0TD 4OZ4A 4NWUL 3EHBD 1NGXB 5DO2D 2MOVA 5HI5C 5ITFA 3IKCB 3KDMB 5E8OB 2G9HA 3SQBA 3MCG1 3UTSB 4R7NB 2ZKHL 4LPYA 3PWPA 3HG1B 3VFTA 4WRLA 4AEEA 1LO4L 5D1QC 1DN0A 3T0AA 3SGEH 1IC4H 5ACZA 1QLEL 5EO1A 3RKPA 1JGEB 2OTUA 2B1HL 1X4ZA 4PIRF 4XVUC 1G0DA 1S78C 4EZMA 4N0YL 4R4NC 5A2JH 4AEHL 1KEML 1YQVL 2EE2A 1XAUA 3MJ9H 4DZBA 3RBSA 5BVJB 1QG3A 5IW6A 4X7DC 4EUPH 4G6JL 1MCNA 3X17A 4YBQD 4EQ3A 1NC2B 2DKUA 3MXWL 1YEEL 4HC1L 2F8VA 3DX8B 1KPUB 1I1RA 2A2QT 2XN9D 3HZKA 4ZPVB 3AY4C 4MQXD 3VE0A 1A21A 3EBAA 1IC7H 4K3DL 4MNQA 3OAZK 1QO3B 5IT2L 1ZLWH 4U33A 5CJOL 4WV1A 3UZVB 1KJVA 4AZ8A 5DQDH 4NQED 4PJCA 5E9DB 3K0WA 5TE4H 5B21A 1JPGB 3FTGA 4CL7A 3N06B 8CGTA 1DEEB 2X4OB 4JPVL 4BSWA 1RK0A 3MRHB 1S3KL 2FZ3A 4LQFH 3EJYC 3SJVA 3NA9L 2V7NA 5CP7A 2LU7A 3QEGH 3TGXA 4L4VE 4YPJA 2ZG3A 5KVEH 4LSVH 5D72L 4QGYA 5EORL 2UVFA 1VACA 3IDMA 1L9MA 4XP9L 2VH5L 5T1MA 4P5MB 1I85C 3UJJH 3WUWB 4P3CL 3I75B 4DGYH 1BBJA 1OAUH 2NX5D 1Q8MA 4LVNC 3ARQA 1EXUA 4NN5B 4M7LL 4U4BA 3WS3A 5FA4A 4OIAA 5I17A 2VLLB 4RFEB 4JFDD 1MHHB 3OXSA 4MVBC 5D7SH 3MCLL 2AK4B 5DJ8A 1V3JA 3BD5A 3UTTA 1QBML 1FNLA 3NBNA 4HKXA 5HHOE 3GB7A 3TF7C 4JHWH 3O6FB 1FDLH 3LRSB 1IGYA 2HH0L 4MXVE 2A6JA 3U6RA 1X7QA 4TOYH 1U8LA 3UTSD 4KY1H 1FVDB 2R2HB 1EDQA 3WHE1 1WWCA 4JAMA 4LHUA 3HG1D 3TV3L 4LNRA 5F8RC 3F7YB 1GVIA 4KAQH 4FS0A 4XNZC 1PY4A 4WU7B 1QLFA 3N1MC 4R7DA 1SYVA 4X98B 1IVLA 1PKOA 4GMSL 2ICEA 4DAGL 3O6LH 4OCLC 3GSXA 3HA0A 4NYLB 3UTPE 2FATL 1J10A 3KYOA 4PG9A 5IJVA 2WK2A 3IFLL 3K1KC 2IQAB 3TPUB 2GKIA 3EAKA 3WUWG 43CAB 1NMBH 4X6EA 1XF1A 1E6OL 3L3OA 4K3HA 4HLZG 3CH8A 5KSBF 3T1FB 3P77A 5E1AB 1D5BB 4L8SA 4E0RB 3A6OA 3BPLB 1TJIH 3DMMC 1GOHA 2CXGA 1WWBX 2HLFD 2HMID 3J8F7 3V5HB 3LEVL 3MLZH 4WHCA 3C8DA 2Q6WB 5E9DD 5F93C 3LKSB 2VE6A 1UACL 5KANG 5CEZD 5FYLH 3TBYA 1EGJL 3QI9C 5JHDE 5IFJA 2R1WA 3H3KA 5F71A 3DGCR 2ZKHH 2GITB 1LO4H 4UOW0 5MEPB 1DE4B 1YUHA 2MPAH 5DURB 3REWA 2BVPA 2E9IA 1A3LH 2NY5C 1M7IA 1SY6L 3ULUE 3BRGC 2OJEA 1VGKB 3GRWH 1KEMH 5D96B 1DQLL 3RVWD 2FH8A 2Z8VC 4NC2B 1PZ5A 3MRDB 4JRYE 3ET9F 4G6JH 2BZDA 4WFFD 2R2BB 1B2WL 4ONHB 3MXWH 5I1LA 3H9SB 2AK4D 4HC1H 4KK5C 4XPGL 1I7UB 1CE6B 3OV6A 1XIWA 3QEQD 3Q6GL 3O6FD 4R26H 5JLZA 5IMKA 4IRJA 4K3DH 3BJLA 3C6LB 4YEEA 3WL9A 3RWGA 5IT2H 1ZHBA 4OCXH 5F1IB 1XT5A 1D5ZA 4PP1C 2IH3A 1MNUH 1GGTA 2PO6A 3S3SA 1BECA 4OUOA 3GJEA 1CQYA 3ZDYE 4UTAH 3TH4T 1AO7D 3MV9E 4JPVH 5FIEA 4J3XA 1S3KH 1PBYA 5GISH 1FZKA 5E6IA 3OBAA 4CMMA 1HCVA 1ZA6A 1R3JB 5JW5B 1KLFA 4HJGB 3BUYB 1FORL 3CZFA 5HDOA 5HYJA 3MNWB 5D72H 4MDIA 5DJ6B 2F53E 1CT8B 3O3BA 4XP9H 1HEZB 2EYTA 3O6MH 3LH2L 1RZJH 4RGNB 4LGRB 2ESVE 4P3CH 5T3ZL 1HOCB 2HT2C 2BVTA 4JFEE 1X9QA 2ZCKL 4KVCL 3JV4B 4PGDB 5JW4R 3OAZH 4M7LH 3SKOA 1WF5A 1MCBA 4KH2A 4YEFA 3QXTA 4NO0B 2BSRB 1ADQL 2J2ZA 3Q2CA 3VD7A 3BZ4A 1I75A 3MCLH 4RMQA 5FO7A 3ARXA 5DMKB 1QBMH 2O93L 1S7TA 3KJ6L 3P73A 4LPTA 5C0AD 2X4NB 2VNCA 4H0IA 5HGAA 4Y4FC