4DKEH

Crystal structure of human interleukin-34 bound to fab1.1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
220
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSSTWIHWVRQAPGKGLEWVARISPYYYYSDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGLGKGSKRGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-34
publication title Structural Basis for the Dual Recognition of Helical Cytokines IL-34 and CSF-1 by CSF-1R.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 39
structure length 220
sequence length 225
chains with identical sequence I
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkeH01
5GGRB 3Q5YA 1MRDL 4OLXH 3DRTB 3F65A 2D7NA 4AIZB 3BFOA 3RZCB 3TJHC 5GS3A 4JQVC 1IAIL 1QG3A 2EEBA 2IPTH 4RWHA 1CL7H 1UYWH 3L1OH 3NA9H 4Q6IC 1OB1B 1A5FH 4K3EH 4JQXA 1FL5B 1FH5L 5F1NA 4YGVB 7CGTA 5IKCA 5IB5A 2Q8BL 4CMHC 4DVRL 1NH6A 1IE5A 1F4YL 4GKNB 4Z7NF 5KZCB 4BA8A 3PWVA 3BZFA 5IVNA 4Z7UA 4EQ2A 3E3QE 4L8CA 3RKPA 2QR0A 2BNRD 3C2AL 1YUHB 1QBML 3D0LB 4X4ME 3GO1H 5IVZB 3TO2A 1JPFB 1D5IL 1N64L 5DC0A 1RJYB 3KPSA 5J6HA 2A9NH 3UO1L 5L2KB 1U8QA 2PYFB 4R4FH 3VD4A 5EIQA 2YD1A 3BESR 5IQ7L 5ISZA 1DVFD 2J6EA 3MLWH 4XPTL 3GSUB 3EO9L 1NFIA 1T7ZA 4UDUB 5AD0A 2E5EA 5TF1L 1FSKC 4MJ4A 5IMKB 3HFML 5DJCA 4RAVA 2ED9A 3C6LA 3EFDL 1KG0A 1L6ZA 1QLRA 2BNQD 5MERA 1UJ3A 3MBEA 5J8OA 3LEXB 5IEKB 2DBLL 1MREL 4JPIB 3LRSB 4MJIE 5GGVL 3MROA 1PKQB 1MCRA 1BJMA 2ICWA 2J8UB 2VOTA 4OLWH 2AQ2A 3TA3D 4HJJL 1Q0YH 5BS0B 4NKMB 1LP9F 1HIML 3ARFB 4PBWD 3DO3A 4WTXA 1EEQA 2X4NB 3GIVA 3P0GB 4XZUA 3HI1A 5HXMA 1ORSA 2YBRB 3BN9D 3DV4B 4K7PX 4O51B 1ZGLM 2NTFA 2E9WA 4Y5VC 2Z35B 1QTYT 3CFKA 3G6JF 2AERT 3IU4L 5LGJB 1JNJA 2C3VB 2OJEB 5JORB 3T4YB 4JZOB 1YNTA 2OL3B 4LSPL 4P59L 1X5ZA 3WL9A 4Y1AA 4P23D 5CP3A 4OCXH 3L3JB 2FLRT 2E8YA 2HFGL 4P0DA 4JDTL 3QDHA 4KRPB 5F97E 3Q1SL 3SGEI 2XWTB 1V05A 5GS0H 4MS8C 1NC2D 1I1CA 4P2RD 2APWA 4K9EC 3MFGB 1JGUL 2WBJD 5GQBA 1ZEAH 1RZ8B 4P5MA 4G43B 4L29A 2CK2A 1Q72H 3HB3D 3JTSA 4HBCL 2ZPKL 3ARWA 5CJXC 2FHCA 4YQXL 4P5TD 1C12A 4CDHA 4C57C 5SWSE 3MV7B 1ZHBB 1E28B 4N0YH 4ZUTB 3QI9A 4DZ8A 2FWOB 3RY4A 3PP3H 3OZ9H 3BKYH 3B5HA 4M6ML 4Y7MA 3QR2A 3QO0A 2NNAA 5DO2D 1NDMB 1S7VA 3H42L 5JUEH 2R0WH 4E5XB 3VA6A 3U30B 1ITBB 1LO5B 1RI8A 4U0RC 4CU7A 2VDOL 3WJLC 2E6QA 5EC2A 3WIHH 5B8CB 1QFPA 5D2NB 1MCPL 2VMFA 1JHLH 1B0GA 3OPZL 4MYWB 1NLDH 5F88B 4KI5C 5EU6A 5INDA 2N1KA 3LEVH 1ZWIB 4LKXA 3V4VL 4DN3L 1FYTD 5GZOD 1A1NA 1H3UA 1HOCB 1Q94A 1GGUA 4XH2B 1XIWB 2VZSA 1BZ9A 2VLJE 3DO7B 2MCPL 4QTHA 4M48H 1G9MC 3QG6B 3WFZA 5IBLD 5KTEL 4M3KB 2DQTL 3FQWA 4PGJA 4ODXB 5E9DB 3W82A 3SY0B 4L4VA 1GGYA 1YEIL 4NNPL 4WI4A 1A8JH 2G5BB 1SVZA 5C0GA 4ZSOA 4O2CA 1AGFB 4JN2B 2YC1A 3L5IA 4GAYA 3VRLE 4PRPA 4CVUA 4PRHE 3RVTD 1SJEA 2XN9A 1WT5C 4YXKH 3D5OF 1IBGL 4Z8FH 4WUUA 5I18H 4ERSL 1LGVA 2VE6A 3FN9A 5ICXA 4OZIF 2NX5D 3FN0H 3VFMA 4Z7VA 5EFIB 3QCTL 1YPZE 5T33L 1YMHA 3REVA 1OM3L 2DQCH 3V6ZB 1OTSD 5JHDD 4I5BB 1UCTA 1RZIB 5E99H 2P8LB 4TSCL 2G2RB 2Q7NA 3CXHJ 3BO8B 1XF2A 5GZNC 3CFCH 4WI2A 5EUOE 2AV1A 4OFPA 1QFWL 3L7FB 1YNKH 1CGYA 4PG9A 4XAWH 5DRNB 3MV8B 4H26B 5C0CA 2AV7B 5C0JB 2CK0L 2NZIA 5C9KA 3D25A 4IDLA 1I85C 1CF8H 3DXAA 1L6XA 4YBHA 2BSSA 4RA0C 5E24E 3OKKB 2R4SH 2HVKB 1FFRA 2V2WB 4G6FB 4YEFA 4WO4D 3ZYOA 3CAFA 5BV7H 1L4IA 1DQJB 3IKKA 2NMSA 4FQIH 4QHNA 3UYRL 2QQLL 5DD3L 1U91B 4RNRA 3PGCB 4TSAL 1IAKA 3KJ6H 1CFTB 2W65A 4LGPB 5DJAB 5DHYA 1A4JB 1YYLH 1BVLB 1MUJA 3FTGA 4J7RA 5L6YL 1NGYA 5BO1L 3RHWK 1A6ZA 3B2VH 4ZUSA 3OGCB 4EVNB 3H6JA 1ZHLA 2ZCKL 3HR6A 2JIXB 4LDOB 2BVOB 1D5MA 4OD1L 1A22B 1KIPA 3QH3B 1I8IA 3M45A 4HS8L 3V8CA 1JHKL 3O6KL 4IDJL 4KVCL 3EZ8A 5BVPH 1MJUL 5I8CB 1V7MH 4P3WA 2AXFB 5CUSH 3QAZC 3EKCA 1MF2H 3GMNA 4JZJA 3RUGA 1IC4L 1MCJA 4OZHB 3U46A 3TBSA 4PR5B 5FM4A 4UIKL 1FL6A 1MCCA 4L4TD 4X6DE 5CSZB 5FCSH 1HHHB 1ACYL 3ZKSD 3TT3L 4XNXH 2CKBL 2LTQB 4JVUA 4ESKA 1T2XA 1DEEB 4LL9A 4WEUD 4E9LA 3TBYB 1IKNA 3U6RA 5HHNA 4I0PA 5IHZA 5SWQA 4Q2ZB 3VD3A 2IALB 2ZUQB 5DD5L 4GW5B 2IH3A 2YPKB 4JB9L 4D0BA 1JMXA 1RUPL 3VGGA 4KDTC 3L3HA 4XWOD 5EWIL 3LIZH 3QUKA 3FB5A 4Z95H 4JO1L 5F1OB 5EO1B 4YDKL 4OBRA 4R90H 4JPKH 3HZMB 5D6DC 1QSFD 3CUPA 4PRBB 3UAJC 2Z31D 1LWRA 4WI9A 3SKUD 5J1SC 3D87B 3TBWA 4XPBH 4YXLL 3HHRB 2VABB 2ZCLH 2D3VA 1FRGL 2GYSA 2HKFH 2EDXA 5T3XE 4U05A 1Q9KB 2ZJSL 3VGEA 1BQLH 5KW9L 2AAVA 3MLVL 4I48A 3O0RL 4JO4L 1YDPA 1MCOH 4G6AC 4N9GB 5DHVB 4Z7WB 3UBXI 4V1DB 4X83A 1T1YB 1I7TB 4ZFZA 4QHKJ 3HPLA 3VFTA 1J5OL 1U95B 4YDIH 1WVZA 1G9EA 1VACB 4UNTA 3U7YH 2XNAB 1QR1B 4Z7UE 1BIIB 3STZB 1B9ZA 3CMGA 1V3JA 1X5HA 2W9EL 3LY6A 5IIEB 4LNVA 4FXKA 4MD0B 5I66B 3RWJB 3SJVB 5F7NC 3OQ3B 3IJSB 3QPXL 3LKRB 5HI4C 2APTA 4DOHB 4KQ4H 3CMOL 3KPSE 4H5SB 4LCCC 5BQ7B 4I3RH 3N1QC 4TTDD 3FB8B 3VA2C 3V5HB 4AY0A 5ISZE 3QEUB 4FFVC 2IFFL 1CBVH 3L6FA 4PJFA 4MHHI 4N8VA 1CDBA 2YUWA 4OFVA 1RZGA 4YEEA 3WUWB 5D1QC 1TETL 5HYSB 1WFUA 4PJEB 1EEZA 1RURL 3KPSD 3BJ91 3LZFL 5BW7A 3UPRA 5CBAA 2FATH 3TEUA 1FNSH 1YMMB 3VWKA 4NKQB 1T0MB 4PGDA 3HC4H 1HQRA 1HYRC 2FHBA 1QLEH 2NY5L 1QRNA 2Y07H 2BVEA 2X4QA 3W2DL 5IR1A 2CDEB 3C6LD 5D1XC 5C8JA 3OKMB 5DT1H 2XG5A 3VI3F 1BFVH 1B2WL 3FO0H 2ZSWB 4AEFA 3FZUC 2KUTA 5CS7A 4HUUA 1DBML 3I3EA 4M7KH 2Y23A 4NGHL 3ZKND 4KHTH 3FO2B 4ZUVB 3KDMB 3SE4C 3N1FC 3VD5A 1MHEA 1I9JH 1QSEA 2A0LC 4NZUH 4UILL 5TQ2L 3U36B 1KLGA 5HGBA 4IHOA 5ABDE 4GQ9H 4TUJB 3MA7A 2R69L 5A2KH 5C07B 1BWWA 1KXTB 5ID1B 5DXWA 5HGHB 2GSIA 2YWZA 4P5KA 5CIPB 1UXWA 3KYOB 4LEOB 3IF1A 3UYOD 3QUMH 3RX7A 3MJ7A 2VL4A 5K59E 3PWPD 1MCQA 4XGZB 3SKJH 4NNYB 1SBBA 3BP7A 1A0QL 1CI5A 4U6YB 1F6AB 4Y1AD 4C54A 4JFYB 1D6VL 1ZSDB 3NAAL 2ZKHL 1UWXH 1SYVA 3G9VA 1RUAL 4M61B 2P4AB 4HUXA 3CSYA 4J8RA 4ZUUB 2NY0C 3WNNA 4HS3B 5JHLH 4WDIB 2ESVB 1UB5A 3HKFA 2AK4D 1TCMA 5DRXB 5DRWB 4RFEB 3CXHK 4HH8A 4UIMB 1UKSA 2PKDA 1TJHH 3BE1H 5EO9A 1T2QL 5DQDL 3RY6C 2BERA 5I74C 2C3XA 1G7MA 5JO5B 3C5JA 3BP6B 3CH1A 2W9DH 3NABL 1K4DA 1NCNA 4GKSB 1HCVA 4JM2F 3ARDB 1ZANH 1DUYA 4QRSB 2FJGB 3ZTNL 1EUUA 5A40E 5T3XH 4CADB 3ZSSA 1V3KA 4JREC 1N2RB 3TM6A 5EU6E 3GI8H 1AO7B 1HH9B 4GAJL 5GRVL 3G5VB 4WW2C 4AEEA 5EBMA 1U58B 4BM7A 4OF0A 4KU1A 1KUMA 3BI9X 3GSQA 2A6IA 4HIXH 2OTWB 4M62L 5E08H 1U8OB 4XPHL 1OAKH 5CGTA 3C60C 4W4OA 1FG2B 5T5NF 3TZVC 2W59A 1L7IH 4OI9A 1NSNH 4U1KA 1J0IA 1NFDB 4MA1B 4WVRA 5GS2H 3N0PB 1KC5H 4F7PA 4L4VE 5GGUA 1QFHA 1OARL 3AUVA 4ZSOE 2VSCA 1H3GA 3RWHA 4JG1H 4F7CA 3OKEA 1E4KC 4PRPE 3DX6B 4UT9H 2XN9E 1GC1C 2VN4A 1L0QA 4L9LB 4WUUE 4L4VD 4Z7VE 1TJGH 1OOAA 3BZDA 2OXHA 4PJHF 5J12C 1K85A 1VENA 2A77H 2APXA 2J6EH 2VDKH 2AVGA 4PS4L 2PETA 1JV5A 4R96A 4X7FC 1QO3B 4P49A 5DURB 3O3DB 4LVOB 2DQIH 4G42A 4KK6C 3VXSB 4G7YH 3O6FC 3SDCA 1PQZA 1LQSR 4MAYB 1DDHA 5DUBB 5C0CE 3BRGC 4JY6A 4XC3H 5FDWA 3DXAE 1MI5A 1WIOA 4KROB 1RFDL 5LWYH 4G6KH 1I9IH 5A2IH 3F7VB 4PV9A 4F57H 4XP4H 4WFHE 4XCCH 1ZTXL 3HE6C 5HHVH 1A3QA 4U6HA 3U4AA 2YK1H 4N8CH 4H25B 2DLGA 4QRQB 5I76B 5C0CD 2QSVA 1WZLA 2DLIA 5DF0A 4Y2DD 1OP3K 1RHFA 5JXED 1XZ0B 3HE7C 5GGSB 3MR9A 4Q6IB 1IGFL 2DBJA 3NIGE 4D0DA 4MZ3A 3VG0H 1HN1A 5T1LA 1UWGH 4QRUA 2ZNXA 2VLRB 1GHFL 2BVQB 3GSRA 1MRCH 3CDGB 3JWOL 1MHPH 1IQDB 1KEGH 1T66D 4CMHB 5FOBA 1PG7W 2PN5A 2FHFA 1MAML 4EUPH 3P30H 3DOSA 4LK4A 3L5XL 1BBDH 5IW6A 3GJFK 2O5ZL 5F7KC 4EDXA 1A2YB 3O8XD 3RUGE 4K7PY 4PJ5D 2A83B 5EUKB 5KSAA 1X4XA 4XNMB 5ADOH 1MWAH 1J05B 1XGUA 4NQVB 5HYJE 1DQDH 4ETYA 4EI5C 2V7NA 1YN6A 4IJ3C 5C3LD 5L7XL 3WNOA 4Z0BL 3BISA 2VXVH 5ANMB 1NMAL 5DLMH 4IOSD 4JRYD 1YYML 4C59B 3PNWA 5C0EA 2F58H 3HAEG 4JDZA 4R8WH 5IQ9A 2JB5L 1IM3B 1ETZA 1FSKB 3IDNA 1JMZA 2WANA 1A1MA 4XVSL 1T6VN 4EN3D 3KLHC 3S37H 3QIWC 5EOCJ 5J1TC 4PJXA 2Z93B 2NR6C 4C4KT 4MNQD 4BQCA 3TV3L 1A7QH 1AC0A 2W0FA 5FV2A 3QJHB 5F3BA 5F7YC 2H3NB 3U7AA 3MRJA 2UYLB 3U9PH 4XVTL 4U1NA 4YGAB 3MO1B 1AXSB 3QEQA 2WUCH 4QWWD 3SDDD 4LHUB 3KR3L 4RFOH 5D7KE 4HIHB 4MQ7B 1CFNB 2OJZH 3CLEH 3ULVL 1IGMH 4DGYH 2A9ML 2GUOA 3CDYA 4TRPL 4BQ9A 4Y5VB 5TDNB 4HS6A 4ZFFA 4NKIH 5BZWB 3P4OA 2CUMA 1J1PL 3H9HA 3IDGB 1I7ZB 4JEGB 1U8MA 3CLFL 1Z0MA 4FQQA 2XXMB 4OF3A 1S9VA 1UZ8A 4J1UA 1Q38A 4HKBB 2BFVL 4QHLA 1GOHA 5FYJU 5KVGL 2FX9H 4X6FB 1N8ZB 1EFXA 3GMPB 4UDTB 4XCFL 5GRJH 5IG7B 2C1OB 5E8PA 3G08A 1NJ9B 1UACH 3BEVB 5BZDA 1RULL 1IZJA 1MJ8H 2QLVB 3AB0C 5INCB 4NM8H 4BZ2H 5DA0B 1RK0A 2E6PA 1PVHA 3UBXG 1CICD 5ALCL 1VADB 3OJDA 5DEGA 4GMTH 4DWHA 5SV4A 3VXQA 1N6QL 4IRJD 4PJFE 2Y36H 3U0WL 3H7BA 2JCCB 4FQ2L 3Q6GL 4A6YH 4IRSB 5IOPA 5C9JB 4WU7B 1A6PA 2FX7L 3V6FA 5E8OB 1KCSH 1SMAA 3MYZA 3UTZB 2RCSL 3NZHL 3RFZC 4QEGA 5DJXB 3JV6B 1DLFH 3BRDA 2D0FA 3S36X 1H3WM 4NO5A 5BXFA 3DV6A 1QRNE 3FQUB 1DQTA 2AS5M 1GOGA 3UJIL 1N4XH 3D3VA 3F58H 4C83A 1J8KA 5ESAB 2HLFD 1SJHB 3VWKD 2PCPB 1OSPH 2Z0BA 1TVHB 4QNPF 4Y19A 2CUIA 2WIIB 5T1KD 4MHHG 4YE4L 4OTXH 4JKWA 4LPVA 3MV9A 2Q6WA 3FCTA 1R3LA 5E8NB 4U0RB 1QSEE 3CZFB 3F7YB 5I15H 3T04D 5GJTL 4ODTH 5J7CC 1DVFC 3GRWA 5IB1B 4R4BA 4LLQB 5JOFB 3U48A 2JJTA 2FH8A 4U3CA 3TNMB 3EOTH 3MRLA 4JFDD 1AQKH 5ERWB 5IFJB 2YD9A 1J12A 3QRFM 1G7QB 2QL1A 2R1XA 2GITB 4NRXB 3WFEL 1AGEA 4LSRL 3IT8D 1JPST 1GGIL 2J8UF 5GISH 2PO6A 4JJ5B 3MV01 1CLCA 2VXSH 3TA3C 3NIFF 4YIQB 2CLVB 1EVUA 4QCIA 5I2IB 1MEXL 4OT1L 1X44A 4AMKL 1NC4B 5F9OL 4DAGH 1WBYA 2V2XA 1FZJA 3BN9C 5HHOD 4XNZC 1TVBB 5BMFH 3ZZ1A 5CKGA 4XI5D 3RWGA 2E27H 2YPVH 3QHZH 5FCUH 3DUSA 1V5JA 5F7DA 3SKMB 4Y5XB 2CJUL 2V5RA 3B9KA 5DK0B 2WWKO 3V7MA 5DVOA 4Y16D 3NTCL 3SDXA 3Q6FA 1FFPA 1D9KA 2R2BA 5DD1L 2WQ8A 2R1YA 5L0QC 1H5BC 5ESQA 1FP5A 3VFNA 5I1EH 3KGRA 4XRCB 2DJSA 1VFBB 1KEML 2VISB 1ORQB 2FNBA 4P23C 1T7XA 1P7QD 4XPGL 5BOZG 2FO4A 1KCUL 1EEUA 1KIUA 2X1WL 4FFYH 1PZ5B 2MOVA 3EOAB 2JJWA 2ZG3A 1NKRA 1JN6B 2JELL 4TSBL 3SDYL 3RVUD 2R1WA 3VXTB 4UQ3B 4NN5C 2WBJC 1L9MA 5CJOL 3WDHA 1B0WA 2W0LA 3IETA 2KZWA 7FABH 3HB3C 1VDGA 4DFHA 3ZDZE 2UWEA 5I73C 4G7VL 4P5TC 1NGZA 1HKFA 1YY9D 3D18A 3L5WA 5EN2B 4YWGH 25C8H 4K3DL 3LMJH 2RQ8A 1NCBH 4U1LB 4QY8B 1RIUH 2A6JA 5DO2C 1CN4A 3BQUD 3TVMC 4MA8H 1AGCB 4YNYB 3SGKA 4FXGB 3BRFA 3THML 4FQLH 2M1KA 3QAZB 4L8SC 3L3DA 1U8JA 4JR9H 1ZVYA 4HC1A 1N59B 4YHKL 4JN1H 4QRPA 4UI2A 3P0VH 2H9GA 3P9MA 5HGDB 3LKNA 1JWUA 4D0CA 4QRRA 3KG5A 4ZPVA 1KULA 3RY5A 5J4MA 4XTRD 2QQNH 3E1F1 5GZOC 4MNGB 3R0NA 3HNSL 5F1IA 5J6GA 5IBUB 3TO4D 2OBGA 3I6GB 5IBLC 4C4KO 5EIVA 1CGWA 1XGTA 5DFVD 4JHAH 1MHCB 1ZA3B 1HDMA 2VH5H 1F3JB 3IRZA 3AY4C 1D5ZB 1FZKA 1MI5D 3HZVB 3RVTC 1U8PB 3JWDC 5HGAB 3RAJH 5LBSL 3DUHA 1MPAL 1N5AA 1A7OL 2AQ3A 5ILTL 1OTSC 3LOWA 2RB8A 1W72A 3E2HC 3DGCR 4DK3A 3QWOB 3SE8L 4QHUA 3QXWA 1G6VK 4NUGL 3CDFA 1JPSL 5C0BA 1LO0H 4CJ0A 5DTFA 3V7AG 1F97A 1UB6B 2ADIB 4FOMA 3V6BR 2OR9H 4IMKC 1U0QA 5FYLE 1MJ7L 1QACA 4WHTA 4OZGE 1GAFH 4MB5A 3DI3B 4HMDA 3T65A 5FV1L 3S9DB 4F7MB 2ICWJ 1P84J 2H45A 4P9HH 4WO4C 1QFUH 2R29L 4EZMA 4YDJA 3NCYS 3QUZD 4POZD 2IANA 1W72L 2BVYA 3K4ZA 5FKAA 1R24A 4WI3A 3BP4A 3BT2L 5TDPB 4AEIH 4NT6A 1IGJB 4S1RH 4G8FB 4X99B 2HRLA 3GJFH 2IPUK 4ODBD 1U3HD 4L8BB 1NDGB 4LCCB 5HDLA 5IFHL 2P7TA 4Y4KD 3VFOA 3NCJH 5B4MD 5DVMA 4D9RD 1DQMH 4I2XA 1A3RL 2JK5B 1V3LA 3GIZL 5CWSB 2BY1A 5D1QB 2HT4D 4PJXE 4PTTB 3GK8H 1ERNA 5C2UB 1YEFH 4YPGB 3DGGA 3TH3T 3TPUA 4BFEA 5F89A 5FUCE 3WO4C 3K81A 2GK0B 1NEZG 1SY6H 5FO8B 3L3IB 3ULVD 8FABB 3CSPA 2D31A 2D0GA 3F7RA 4N0RA 3GSXB 4X9BA 5D1XB 3QFDB 4OZHF 2FGZA 3MRFB 4FA8A 1IL1B 3A6BL 3QEQE 5ITFB 3VFWB 2DI7A 4PUBL 2I9TA 3ZDYE 2XQBL 2HN7B 1UEMA 1J1OL 3KAAA 4LLMA 3FT2B 5DD6A 2DM4A 4NHUB 5AAMA 1JGLL 2NYYD 4G8EB 5GIRB 4A2LA 1T22B 5E5MB 2CH8A 4PGBA 1AP2B 3RL1B 3IDIA 3H3PL 4MX7B 3BW9A 5A2FA 1DBJH 1EO5A 3UBXA 5JIIA 4M1DH 4XWOC 1K4CA 1K2DA 4HXBH 4OF7A 3BEWB 3PIQA 3DX8A 4ZAKA 3S96A 5I1GL 2B2XL 5I1CH 4Z77A 5I1LB 2DOCA 1I1FA 3VH8B 3BXNB 3ZSTA 5DJZB 2ICEA 3FOLA 2Z31C 5I30H 2HJKB 2OTPA 1EFXD 2XRAH 3T4AA 4BZYA 4K3JH 5FUOL 2I26N 1X5KA 5GGQL 1LE9A 3CVHB 4AM0B 3CK0L 4JFHE 2P43B 4Z7WF 2R4RL 3P0YL 1TENA 2IG2H 4D9QE 4P2OA 5GXBB 1ND0B 3ARGA 3S4SG 3VD9A 3FN3A 2HRPH 2NY0B 4OV5B 3BVNB 3IS1X 3QFJB 3GMRA 1M7IA 3DETD 4JQXC 2EKSA 4FQXA 5FGBC 1J0HA 2EIDA 2Z91A 4N0CD 1E4XI 3D3VE 5IMLB 4DW2L 5IVXA 1SJXA 4M00A 1DQLH 3LKQB 4HSQA 1A6WH 1MIEL 1LO2H 4NKDB 1S3KH 4Y19E 3TH2T 2ZOLB 4JM4L 4EEEA 1F90H 3MV9E 3LKOB 3TT1H 1JJUA 5GS1A 3LS5L 1I1AA 1WC7B 2UZXB 4Y4HD 4TTDC 1IGCH 4CKVX 1V7NL 1I4FB 2I07A 1U8NB 2WP3O 3VXOB 4Z7QF 5BOPA 5MEND 1NBZA 1E6OL 4PJEF 4PJDA 2VKXA 3MV9D 4JG0L 3MX0A 1R3IH 1ADQL 2DLFL 1EAPB 4WW2B 1KB5H 3BZEB 4ZS7L 2Q76A 5MHSD 3FO9A 5D7IF 4OM1H 3T3PE 3C60B 4K3GA 2AJUH 3TWCH 5FYLH 1EZVX 3TZVB 4FFZH 1MCFA 3C6LC 5EU4A 3BIKA 2R0ZL 2C3WA 4O5LH 1UJ3C 1Z3GL 5CJBA 4FABH 3IKCA 3QT2A 4AQ1B 4NC1E 1YN7A 5E2JA 1S8DB 3IXAB 3CZJA 4NQSB 3MRMB 2ITCB 1I8MB 2VZVA 3WJJA 4NCC1 1QYGL 3ALWA 4YX2L 4RQQB 3GBNH 1EV2E 3NACH 3RPIA 1N7MH 5J12B 4GAFB 3SDXE 5EB9A 2XZQL 2VITA 1MCBA 2IQ9H 2QSQA 3QXUA 2G60L 3O6FB 2C9AA 1L0YA 5FB8B 3HPJB 1G1CA 1HHKA 3AS2A 3EDFA 3C87A 3OKDB 1JE6A 3QUYD 5EO0A 2AXJA 4HF5L 4Z76B 3WXWL 4OLVL 2FGWH 1Z5LB 5JIPA 4Q9BA 3V52H 3HE6B 1EHXA 2QADB 3K46A 4QT5A 3KPQB 2CDGA 4QO1A 3ULUH 1FVCB 5J1AA 3VXMD 1DP0A 4RGOH 5CGMA 4JPVL 5KOVC 35C8H 4TPRL 4XMLH 4M6OL 5L2JB 1JGVH 1NMBH 2Y7QA 4H20L 5DC4B 2Z4QB 3HE7B 3NCYP 5D8JH 4L3EB 1UH3A 1ZA6A 4PRAA 4C56D 1S5IL 2X1OA 3MXWL 1J1XH 1P6AB 2UWEE 1UCBH 4XP6L 3CFEB 5TJWK 3OKYA 3E8UL 2VDLL 1UZ6E 1FVDB 3UC0H 1ZVHA 1B3JA 2VAAA 4OLYH 2DQDL 1QRKA 3PGDA 4KMTH 3RZCD 3NCBB 3VXNA 4L5FH 1X5JA 2BOCB 2ED8A 2FZ3B 5DJ6A 2FCBA 2Z8RA 5ITBL 1UM4H 3O3UN 2DQUH 3RVXD 2E7CA 1P84K 1WEJL 4E42A 1LP9A 2MJWA 2XTJE 4S1SL 4QRPE 3NZ8B 4JHZA 2DI8A 5A16B 4O02H 1KJ2A 4QRRE 3QUXB 4EI5B 4IJ3B 5D7JD 3G6JA 3LV3A 1S7QB 3ARTA 3UJJH 4BFBD 3QNYB 5AZ2L 4GLRI 3V4UH 1T5XB 5CZVL 3L3GA 4HWZA 4JY5H 1NFDF 2WUBL 4R97C 1NLBH 2AEIT 2VQ1B 4U7SA 1AGDB 2VB5A 2F74A 4WU5B 1VGEH 3QIWB 4X7CC 4HKXB 2V5MA 3OX8A 3I3BA 1R3KB 1FGNH 4K94L 3DURA 3GSNL 2VLKD 5L2KD 3M07A 2WINA 3U0PB 1KPRA 2VQTA 2DTSA 4O2EA 4JKPH 5EBWA 5K9KA 4OI7A 3MLPA 3W39A 3HZYB 2DYPB 2GY5A 4PTUA 3HTLX 5F6HJ 2PXYA 3MRKB 3GSVA 4ZPTB 5EOCH 2YPLD 5CD3A 4IMLB 4MJ5A 1AY1L 1N5YL 5TGBB 5DA4A 3GRWH 3ZL4L 2ARJA 1K8DA 2WNGA 2B8OT 2O5XL 4Y88A 2XZAH 3EJZC 43CAB 3WHXB 3S35H 5JPNA 2XIDA 4PGEB 1IQWL 2B20A 4YUEL 4U33A 5C0BE 2VL5B 1N26A 2P5ED 5KVDH 3TIEB 5HYEA 2ZZUT 2X10A 3I75B 5IK3B 4GMSL 1BOGB 2YXFA 5B38G 1WBXA 1TZGH 3DSFL 4G8GB 5DWUL 3RWEA 4PJIB 5LG1A 1MLBB 5IEHB 1Q9OB 1XT5A 1BZ7A 1WQVT 4JZNA 5C0DB 2X4PB 3QZWG 3B5TA 5H37H 2IANE 4PJAA 4ODUA 4OAWB 5EU7E 3T3MF 1YEKL 2KQNA 2XWJA 1EJOH 1MHHA 3D9AL 4Y2DC 1RUML 4KRMB 5JXEC 3SGEH 1JZ2A 3MLYL 1I1YB 5D71L 3QDGD 2I9LB 1S7SB 2AI0H 1QBLH 1NEZA 2IAND 1VPOL 1JZ5A 1P7KB 5JW3H 1HINL 4YJZL 2EDFA 4I2XE 4DUWA 1PG7X 4TUOA 2B1HH 3Q3GA 3DARA 2K7PA 1BLNA 4IOIA 1F02I 1T66C 2CRYA 4R7DA 4KRPD 2VIRA 1WCQA 2N4IA 5TH2B 1FNLA 4LNRB 3V8OA 2JE8A 1HKLL 5FM8A 4Q9RL 3PE9A 4EI6B 2W0KA 4G6ML 3O8XC 4P46A 4LLVB 4UV7H 4F3FB 2BNRB 3FONA 4MAUH 3MA9H 5T5NG 1VFAA 2CGRH 1ED3A 4D9LH 3WFDL 1CFSA 1VERA 2XI9A 5SWZA 4H0IA 4JZJC 4KH2A 5EA0L 2I60L 1Z0NA 2OR7A 4MGXA 4P3DB 3AFLA 3BWAA 5E5RB 1KXQE 4BH7B 4EN3C 3UXFA 1IKNC 3VRJB 1MQ8A 1FVEA 1UQSA 1LDPH 1CFQA 4P4RA 4I77H 5IWLA 3C5ZD 4X6CA 5C09A 3WIIH 4G80A 3BDYH 1M7XA 3TA3B 12E8H 3DX9B 4HC1H 2ZUWA 4QWWC 1FO0A 3SDDC 4RGND 1DQQB 5JNYA 2UZIL 4MXVF 4I18A 4XNZB 4K8RL 4F7EA 3PWLA 5FA4B 2OSLA 4U1IA 5I6XB 5ESVA 3T0DA 1JBJA 2X4TA 4EJ1C 5DMIH 4JHWL 4OCYL 1YNLH 2Q7YB 4GKZA 5KSVA 5E9DD 3MRHB 2VR5A 4FZEH 4G3YH 4LPTA 4MQSB 4UU9A 4PY7A 5CSBA 3KYKH 2APVA 2YKLH 4P2OD 3SKNA 3ZT6A 5L0QB 3S3PA 1H5BB 1HXYB 1FO0L 3UTSA 1BQUA 3MLUH 4NWUH 1NBVH 2HAZA 1VFMA 1XEDA 1KTLB 2R0KH 2FX8L 1R0AH 1TQCC 4P23B 3KXFE 5M94B 4HFWA 4FQXD 1KT2A 2C4FU 1MFBL 1OAXL 4YK4C 1JIBA 3QDMA 5IJVA 1RJZA 2IGFH 1CICC 1MOEA 5DQJB 1MSPA 4LSVH 3G6AA 1MCNA 1NC2B 3STLA 5EZJA 2JCCF 4P2RB 4PJCA 4BSVB 1Y6MR 2DM3A 4HMEA 1Q9LB 2DKMA 4PJDE 4NN5B 4NUJB 2WBJB 2NY5C 1KJ3L 4XVJL 3UDWA 3HNVL 1P4IH 2IFGA 3W5MA 3LHPH 4WWKB 2UZYB 3T08A 3LH2L 5HDQH 1CE6B 4KDWA 4LFHG 4G6FD 1MCEA 4MDJA 3SE3C 3V95A 1QBBA 1OGAD 5I73B 4MD4A 4P5TB 3I50H 1VEPA 2P5WA 1BZQK 2OXGA 1XGYL 4L3CA 4K7PH 3JVGA 5J06A 3FO1A 1FV1B 4WI6A 2Q86B 5BW7C 2HLFC 3HAEH 3VWKC 2HJFA 4ODVH 3T77B 5I8KH 2AABH 4X5WB 3TVMB 4EOWL 2HG5A 1CG9A 4YR6B 2FL5A 5KVFL 5CEXA 3KNBB 2B7DT 1RZ7L 2JIXD 4L8SB 3UTTA 4M6NL 3OKNA 2DIJA 4KJPD 2WZPD 5I1KH 2EIBA 1SMOA 4KI5F 2VDML 1XCQB 1T5WA 5BVJB 4PG2A 3RHWF 3N1MC 2XY2A 4KAQH 2JTDA 3BH9A 4UV4H 3S5LB 3P9LA 2D0HA 2BHYA 4QF1B 5T5FH 2YRPA 3MGTA 3CFDA 4LAQL 4WTWA 1U8LA 4H1LA 3X3GH 4ZQKB 1MVUA 4LU5H 1KELH 4HWBA 4NZRL 2CLZA 3L3OA 3WE6A 3MRGA 5CJ5A 1DSFL 1BGXL 4TNWF 5FHAH 5GGRY 1WFTA 3FQNB 4L8DB 5EZIL 4E41A 5MI0B 4QOKA 4X0KA 1A6UH 5MEQB 1FNGA 1RHHB 3AU1A 1DANT 3PV6B 4FQJH 4KK5D 4XI5C 3OF6A 5DHXB 3GI9H 1S9XB 3TYGL 5KN5A 3NFPA 3WS3A 4N0UA 1EEYA 1MNUL 2L7JA 2MCG1 1KJMA 2AP2A 1UVQA 4HWBL 3VRIA 3I6KA 1U8KB 4WV1C 5DD0L 1QP1A 4PLJD 1JF5A 5JHDB 2Y1VA 3MLRH 3E2HB 3GSOB 1A64A 4QGTA 1YEEL 3I3DA 2AKRB 1XGRA 4OM0H 2DIBA 3TNNB 3DIFB 4RGMC 3TBTB 4Q0XL 4Z7OF 1QNZH 4ZFOB 1WCBA 3TN0D 4XP5H 1LP9E 3L3KB 1P9MA 2YUZA 5ETUB 5HVWA 5CCKH 3VCLA 2IMNA 1OSZA 4V1DD 3VG9C 3RVUC 4ZO7A 1OY3B 1QVOB 1NAMB 4X7SH 4OCSL 3G6JE 1TJIH 1I8LA 1P7HL 4WHYG 2FECI 2C3HA 5DK2B 5DR5L 3DVGA 4BFGA 5I1AB 2ZUXA 3LN5B 4LSTL 4J3TA 4YFLF 4Y8DC 4Y5YC 3OL2A 4AH2A 2DTML 1YY9C 2D9CA 3VFUB 2RBLA 1GXEA 2JJVA 3SJVD 3EFFB 4LLUA 5L9DL 3NFSH 3O11A 1OGTA 4KZDL 1S9WA 4KVNH 3FQTA 4NHCL 5MP6L 3BQUC 4U7MA 3ZHLA 1CDHA 3WO4B 4U1MB 1HQ4B 5T1DL 3MJ9H 2I5YH 4HUWA 1FORL 3V7AE 2N7AA 4TYUA 3O2VL 3KJ4C 3RWIB 2QTEA 1NBQA 3QISA 2RIKA 1PLGL 5B38A 5F6IB 1RZKL 4R2GB 1QKZH 1NBYB 3U83A 2DL9A 1OAUH 3V9FA 1LNUB 2GSGA 3MRNB 3LKSA 2PXYD 2X70B 4YAQA 1S7TA 4LBEA 3EGSB 3EHBD 3QZWA 4XTRC 3PHOB 4GW4B 4PV8A 4KKLD 5J9PA 5JDSB 3JZ7A 3M1BA 1NPUA 3T2NH 1SBSH 3ECBA 3TO4C 4PB9H 4LASH 1ZGLA 1LO4H 5HTSA 3O2DH 2R56H 1JNLL 4MDIB 1DLHB 3N9GH 5GRVK 5JPMA 2X89A 3NVQA 3WXVH 3VXRD 1K6QL 4KY1H 3FT4B 2BRRH 1Y18B 1F58L 1UT9A 2KL6A 2EDEA 1QSFB 3MNVA 2Z31B 1YQVH 5J11C 5K9OB 5E8EB 3O41B 4AJ0A 4JM2A 3N50A 1NAKL 1KCRL 4JAMB 2P49B 4XAKE 1E4JA 1T6WA 3JWOC 4S1QL 1MH5B 1CIUA 4ZMAT 3VGBA 3MUHL 1FL3A 4W6WB 1VEMA 1EZVY 2HFEA 4XAKD 1IGYB 1WZ1H 5AWNH 4OLEA 1IC7H 4GXVL 1KENL 2CO6B 3AS1A 3TESA 3W9EA 4BJLA 3IDUA 5CHNA 4UUJA 1AKJA 4LQFL 4ZOEA 1WV7T 4TOYL 4DKAA 5IB5B 3I9GH 1G7LA 4F58H 3UTPD 5E7FA 3M8OL 4YFEA 3QUZC 4POZC 2H32B 4LEXL 4LLAA 1IEAB 3PWVB 5FKPA 4GRMA 4Z7UB 1E6JH 5SWZE 1KSRA 1U3HC 3QA3A 1OP5H 4L8CB 2QR0B 4P46D 3EYVA 1AHWC 1NANI 5F96H 2MHAA 4Y4KC 1NKOA 4WJ5B 3QCUH 5B4MC 2ADFL 2DQJL 5I19H 3WD5H 3H9ZA 4OCWL 1EHLL 3TO2B 1HZHL 4ODHH 4OKVB 1NCAL 5SWZD 3KPSB 4UT7L 5J6HB 3S88L 4NBYB 1U8QB 4PRIA 2FJFA 4FQPA 5HI5D 3LS4L 4RAHA 4H8WL 1KLUA 1EAJA 3U7WL 4IIQA 4P3CH 4CVXB 4X6CE 5C09E 3B3IA 5TE7L 3ULVC 5DJCB 4K8RD 3C6LB 1QLRB 5MERB 1FC2D 1UJ3B 3EO1B 4E0RB 1UWEL 1FFNA 3SE9L 2P8PA 4U6XA 2Z92A 1OAZL 1A6VL 1YA5A 1A21A 1F8TH 2F5BH 1JFQL 4IM8A 1U93A 3MROB 5FUCC 4NQXA 2ICWB 1KJ2H 5C09D 3I6LD 4F9LA 2WQRA 4HV8B 5C2BH 5E8DL 3CCHA 4ZUWB 1WBZA 4BELD 3MLTA 3VGDA 5DS8A 4JFOB 2X7LA 4H88L 4NQCA 1CT8A 4XZUB 4DGVL 3RU8H 2X9YA 1EFQA 1RIHH 1CXIA 2XYCA 2VDQL 2VC2H 4OI8A 5DUML 1MJUH 3CFKB 3UZQA 3UTSE 1QSVA 3PDOA 1EO8L 3IJYA 5I1IH 1KN4H 2D9QB 5D7SH 4ONFL 4RISL 1ZHNA 2NLJA 1RMFL 2FYYA 4DFIA 1NL0H 3U4EB 3D0VB 1MFCH 1VEOA 5GGTL 3QDME 4M7LL 3NH7L 1VGKA 5IGXH 2EEAA 4M5ZH 4PJCE 4Y1AB 1ZHKA 4LCYA 3MLZL 1J18A 1OPGL 2Z8VC 4BQ6A 1RZJH 4MAYD 4NJAL 1U3YA 4KJQD 3QDMD 4EDWL 1G1YA 4WCYL 1X9QA 3HG1D 2C7UB 1C08A 4JFPA 1AQDA 4W68A 2R8SL 3T0AA 2FIKB 2P5WE 5DVNA 2AK4B 1WITA 2DQEL 3DECA 3G6DL 4N0CC 4P5MB 3VI4F 3H3KA 4LARH 4AK1A 1AD0A 4NC2B 1U8IA 5F1KC 5HHPB 5C70A 1U92B 1R3JA 1EHNA 1C12B 5F9JA 1T03L 2EEDA 2AEWA 3UTTE 4DZ8B 1JGDA 4KHXL 4Y4HC 2GK2A 1RIVH 1CK0L 4Z0XA 2F53E 5FK9A 2NNAB 2KKQA 1S7VB 4GOSA 5M95B 3MOAL 1LEGA 3P40A 4WW2F 5DDHA 3MQIA 3ZKQD 4OZFA 1CZ8H 3GBMH 1CS6A 1B90A 4QRTA 5EC2B 3WMSA 4NKOA 3FB7A 3C08H 5TE6H 1BREA 4WUKL 1ULVA 3VWJA 5ICZA 4NO0A 4Q9CA 3OXSA 2JJTC 4OF5A 3MUZ1 2PW2A 4R97B 3DNKA 2K1MA 4ZO9A 5EU6B 5INDB 4WY7L 5F7HA 1Q94B 3ILQD 4U6VH 5TF0A 5HY9A 4NM4H 2X4SA 1LEKA 3IDXH 1BZ9B 3BUTA 1YECL 1UA6L 4E41E 4AIZA 4QTHB 3OAUL 4QOKE 3FQWB 5FGRA 5FHBL 4C55A 1FE8L 3EYUH 4RIRA 4F80A 1ZOXA 2SEBA 2YUVA 4N0UE 1HEZA 4L4VB 4EIZC 1JCKA 5C0GB 3MLSH 4O2CB 5DK3A 4NC1C 2YC1B 3HZKB 4E41D 2CD0A 1I3UA 1PEZA 4YGVA 1SJEB 4NO3A 2X1PA 2Y25A 3MCLH 1CGXA 4KMLB 2XWBA 1JHTB 5FGCE 4Z7VB 3K2MC 4JFEA 3AM8A 3QUYC 4MD5B 4LHUD 5HYIA 1K9TA 2EO1A 3VI3E 3GMQA 3V79C 2AJ3A 1XF2B 4NQDA 3D69B 2AV1B 3T2OA 3D0LA 4HWEH 3LB6D 4RA3A 4CRPA 4PG9B 5AYUL 2OZ4H 4YHNB 3REWA 2FRGP 1JPFA 5C0CB 2GJ6D 4JFZH 1RD6A 4OFYA 1CU4H 1E4WH 2BSSB 4Y2DB 5ECJE 4PJ9A 1FDLH 4HDIA 4ZODA 4HLJA 3GSUA 1JYVA 1SEQL 2A2QT 5HDBF 3U79A 1YEHL 4QHNB 5KOMC 5ID0B 5IMKA 1UKQA 4RNRB 1YJDL 2DWEB 2W65B 3MUGA 2BY2A 3KPMB 1FAKT 1H3XA 4HH9A 5DHYB 3O45A 5IEKA 5F7MC 1MUJB 4AEHL 4JPIA 1PKQA 2J8UA 1CLZH 3CVIH 3RZCC 2B4CH 5LCVH 4JHBA 3T0XA 3WUWG 5HYSG 1I8KA 3RVXC 5BS0A 4NKMA 1KIPB 5JDJA 1I8IB 2CKBB 1GVIA 4LP5A 1BVZA 4FQ1H 2H6PA 3O8XB 4IRSD 2Q8AL 3DV4A 2YBRA 3UZEA 2DM2A 4O51A 3SOBL 1BAFH 2R15A 3O2WL 4KTEL 5FYJE 5C08D 4EBQL 4HPYH 2Z35A 5D7JC 1IAIM 2EH7L 2C3VA 3GHEH 2HH0H 3GMNB 3EOYG 3HMXA 4JZJB 3PXHA 4XNYH 1C1EH 4UZGA 2DKUA 5JORA 1PSKH 4JRYB 1FL6B 2M2DA 3T4YA 4UINH 5EDXA 4HPOL 4DGIH 4GW1B 1WWBX 4GBXD 1KBGL 5HHNB 3U6RB 1CE1L 3OSKA 5IHZB 4LSQH 4M43H 1I7RA 3QHFL 3L3JA 2HWZH 4MNQB 4ONGL 5IHUH 1CXHA 2IH3B 5TFSL 4D0BB 4KRNA 3L3HB 2X1XR 3QUKB 4TULL 2ZCHL 1GZPA 3DVFA 4ODSL 1PX4A 4NN6C 5FO7A 3BYTA 1RZ8A 4QTIL 2GTZA 1CFVH 2DMKA 2CR3A 1ODAA 1OQOA 2Y06L 3LQAH 3MBXH 3TBWB 3T1WA 1IFHH 3WKML 4X80L 5AG8A 4Z5RB 1CLOH 1ZS8A 5A2JH 2QQQA 1IEHA 4XXDA 4XCYB 4ALAL 1ZHBA 5D9SA 4ZUTA 4PJIF 3VGFA 1FPTH 3KPPA 1OAYL 3ZYJA 3W81A 1NDMA 3HPLB 2DQGH 1KN2H 4OFDA 4PBVC 3OR7A 1T21B 2HT3D 1HI6A 5CZXD 1TQCB 5C0ND 4HIJA 5EG6C 5B8CA 4HW6A 1TPXC 4YK4B 2AEPH 5CZKA 5D2NA 1AKJD 2FJHA 1Q1JL 1CICB 2RFXB 5CMAA 2YD3A 4FXKB 5AEAA 4FHBD 1INDH 4I3GA 1DBKH 5CKAA 1IM9A 4WFFE 1ZWIA 5D70H 4YFLI 3OTTA 4MA7L 5H8DA 3WUZA 1IC5H 4OLXL 1BOYA 1Y6NR 3W11D 1QR4A 4XP9H 1CXLA 3QG6A 3PDDA 3RDTD 2IPTL 2HFTA 1CL7L 1UYWL 3NA9L 3ALXA 4KRPC 4ELMB 3L6FB 1A5FL 4N8VB 1PX3A 4K3EL 1RZGB 5I16A 1EEZB 2EICA 5K9QI 5I1JH 2WMPA 2LU4A 4PRID 1DBBH 3ABZA 5E2WH 5E70A 2R2EA 3UPRB 3VWKB 5IBTL 5KVEH 2C1PA 3MRIA 4PGDB 1HQRB 5T1KB 1QRNB 2X4QB 1WSST 5EFIA 4ONOA 3LRGA 3EOBB 2QSCH 4BZ1H 4I5BA 2OK0H 4NQCE 1ITCA 4G9FA 3SBWA 3BO8A 4YDLC 5H35A 4TTGA 1MJJB 1EH9A 3L7FA 5E4IA 3QQ4A 3WEXA 5DRNA 1MHEB 3GO1L 4H26A 2AV7A 5KBNC 1F2XK 3ETBF 2L7UA 3QULB 1QSEB 4JFDB 2A9NL 4R4FL 5DFWH 4OQTA 1KLGB 5HGBB 3ARBD 4IHOB 3MLWL 4R26H 4HXAH 3C5ZC 3MZGB 4OSUH 5E6IA 1MFEH 1U91A 3RJQB 3PGCA 1G7HA 5KSBA 4X4YA 3MTRA 2GSIB 5DJAA 4P5KB 1REIA 4RGNC 5FUZH 2R2CA 4PRNA 3IAPA 5E2TH 5C0AA 4PPTA 3FHAA 3MFFA 5HHXH 4NQUA 3S36H 5GGSY 5C86A 3OGCA 1JL8A 3MJ6A 4OLWL 3BP7B 3WS6A 3LPFA 3U0TA 2EDRA 2YA1A 1Q0YL 1G9NH 4WV1B 3FRUB 3VXPA 2J3SA 5HBBA 1QQDA 4TUKH 4P2OC 1SYVB 4S10A 4NQED 4J8RB 4YDVA 3QB7C 2AXFA 1KNOA 1JI1A 4LCWA 2LVEA 3UX9B 1UB5B 1P7QB 4FQXC 4AENB 1RVFH 4PR5A 2V9QA 5EIIB 3O3BA 3MCG1 5CSZA 5EO9B 4ENED 3SDAD 3IDJA 4HT1H 2CQVA 3VG9B 2DD8H 1BJ1H 1CGSL 5D7LD 1MIMH 2KPNA 3C5JB 1BEYH 4OCXL 5GS1C 4MXQD 2OMBA 2NW3B 4NP4H 4R3SB 1K4DB 4Q2ZA 1X5LA 5JOPE 1NCCH 4P9MH 4J3VA 5GS0L 1RJCA 5T1MA 4CDGC 1NEUA 5HHMD 2Y4SA 2UUDH 2YUXA 4Y5YB 2VZUA 3OGOE 3O81A 4WFGE 1QFWM 5EBMB 1MY7A 5E2VH 1S7XB 4YZFF 2A6IB 1G6RA 2VZ1A 1Q72L 3QQ9D 5C7XH 1HE7A 2QBWA 3BWUC 3K8KA 3WIHA 2VABA 1NCWH 2OLDA 3EYQD 5EZLB 3IVKB 4WFGD 4F7PB 2DQFA 3HS0B 4Z9KB 2YRLA 4N5ED 3KJ4B 4N0YL 1T7VA 5E6ZA 5DJ0B 5AZEH 3RWHB 4KJPC 3OZ9L 3BKYL 3FQRA 3QXVA 1T1YA 3WJJC 1RZFH 2C4FT 5JUEL 2R0WL 3I2CH 2AJXH 5L88H 1VACA 1LK3H 1AR1D 2R0LH 4JFEE 4JRXD 1QR1A 3O6LH 3WIHL 3LEYH 3STZA 3TO4B 4R96B 1AXTH 1JHLL 1NLDL 4M7JH 4PJ8D 2BSRB 4MD0A 4G42B 1F11A 4NQDE 5DMKA 3SDCB 4QNPE 2XQYG 3LEVL 3LKRA 2H1PH 2LQRA 3E0GA 4XNUL 3EO0B 4JFED 1D5XA 1DDHB 3V0WL 4LHQB 3MRBA 5AUMB 4H5SA 1BJ8A 1MI5B 4M48L 5C6WH 3FB8A 3V5HA 2YHGA 4KK5C 3IJHB 3QEUA 3QXDA 4DJMA 5J11B 1FGVH 2ZUQC 4PV9B 3GSWB 3FB6A 3PABA 2ZP0T 4L9DA 4PJBA 2AXGB 4LF3A 1PYWA 3IDMB 3H3BC 3MLXH 3AXLB 3HN3A 4PLJC 4RDQF 3MODH 4LSRH 1YMMA 4PJ9D 4MCYA 4MMZC 1T0MA 4W6XB 4MJIA 4YXKL 1MAJA 5D7IA 1PKQE 5E94A 1JRHI 4Z8FL 1J87A 3MR9B 1ZMYA 5ALBH 2J8UE 3UTQA 3CPLB 3BKMH 3IYLW 3RGVD 3FN0L 5L8KB 2CDEA 4D0DB 4K23H 3VDBA 2DQCL 1T2JA 3NIFE 5BS0E 5C0IB 1E4XH 3TN0C 1NCDH 5KJRH 5E99L 5IT2H 2F54D 3A67H 1T20A 2OP4H 3CFCL 4OCNC 4WTZG 2EYTA 5FOBB 4ZUVA 1KFAH 1YNKL 4XAWL 4FP8H 5IHLB 4WFEE 5C71A 5EH1A 5ACZA 5IW6B 1CF8L 1I3RA 4GRWB 3QFJD 4EDXB 2UY6A 1U3HB 4XBEH 5F7EH 2R4SL 4TUJA 1AHWB 2X40A 3WNLA 5BV7L 5KSAB 4Y4KB 5C07A 4FQIL 2GJJA 4HGKC 4LDEB 4K94C 1BQHA 2D03H 5HGHA 5E1HB 3SKOB 1XGUB 3DSNA 1HHGB 4QHKI 4WFED 3KJ6L 2YD8A 3QCVH 3Q5TA 3KYOA 1TVDA 2YD7A 1GIGH 1CXKA 1YYLL 5CAYB 1AE6H 2EDDA 3NIDF 1QHPA 2X42A 1JYWA 1ES0A 3PWNA 5C0EB 4JDZB 1OD9A 3B2VL 3C2SA 2CMRH 1ETZB 3I84A 4M1GH 3IDNB 1VKXB 1CXFA 2CO7B 4JFYA 3V6OA 4V2BA 1NGWB 4PJXB 4ZXBD 2W0FB 3AROA 5F3BB 4GAGH 3PHQB 3E6HB 2F15A 4GSDH 5BVPL 3MRJB 4XPAH 3K80A 4DQOH 2PXYC 1V7ML 4OCRH 2VQUA 1PY4A 5EOTA 4KKLC 4WDIA 1F3DJ 2DL2A 5CUSL 3HMWH 1MF2L 1TCRA 3MV7E 5DRWA 4UIMA 3QIUD 2A1WH 2X4UB 1NGPH 1CWVA 2GQHA 3X13B 4BK5A 2GUOB 4XNXL 3RIAK 4G5ZH 3VXUA 2AJZA 1CCZA 3D39A 4HS6B 2CUHA 4ZFFB 3L95B 4WWID 3P4OB 1HXMB 3B9VA 3H9HB 3RVWD 4KUCD 4FQQB 1F4WH 1H15B 1OCWL 4J1UB 3ARDA 4U1SA 2FJGA 5D2NE 1EFXB 3FKUS 3ZE1F 3GJEB 5MEOB 3LIZL 1JPTL 5E8PB 1GRWA 1HH9A 4Z95L 3G08B 3LKPA 2CLRA 5BZDB 5FYKH 4R90L 3TCLA 1U58A 4JPKL 4L1HA 4RWYH 4PIRF 4NFDA 3RBSA 1RK0B 2OTWA 4QHMB 4JQIH 2X2YA 2FIRT 3N06B 4XPBL 2F19H 1FG2A 4J4PD 3OJDB 5DEGB 2ZCLL 1NFDA 2HKFL 3H7BB 1ZGLP 2Y5TA 2QADD 1BQLL 4OKDA 2BOBB 5IOPB 3CFJA 3W0WD 1MCOL 2WBWB 2O5YH 3D1MC 3DX6A 1A6AA 4CMMB 2P47B 3ISWA 4P2QA 3V5DA 4ONHB 4YDIL 5BXFB 3DV6B 1OF2B 4Z7UF 3ROLA 4XVUD 3U7YL 4Z6AT 3D3VB 3H9SD 5KANI 5IJKA 4LAJH 4P46C 3K4DA 4Y4HB 3F5WA 4G9FE 1OT1A 3O3DA 4ORGB 1XF5B 5MENB 3BYYA 4BK4A 4M6AA 1AGBA 4FQCH 4C58B 3MV9B 3P73A 2Q6WB 3FCTB 1R3LB 5DUBA 1UGNA 4KQ4L 5K9QG 4AYFA 3OG6B 4GLRH 1C5DA 5HI5C 4RBPK 1I9RL 2VLLA 4I3RL 4LIQE 4R4BB 1CBVL 3RVVD 2VZ3A 4H25A 3ES6A 4K8RC 3K2UH 3SO5A 5KSBE 4XC1L 1B0RB 3MRLB 1WZMA 3QUXD 5ACMA 5EU5A 2F5AH 5IBUG 1YEGH 4LPUA 5C0AE 2FATL 1FNSL 2GI7A 5F71A 3HC4L 3SQOH 1G7IA 2ERJC 5GGSA 5IWLC 4Q6IA 4LP4A 1QLEL 4D3CH 1DE4A 2Y07L 4FMKA 1F45A 1DJSA 1HHJA 2AGJH 1T80A 5D5MF 3HMXH 3QPQD 4QCIB 5DT1L 2VLRA 1BFVL 5C0AD 3FO0L 2FLBT 1WBYB 5DJDB 4ZDHB 3O6MH 1IQDA 2OL3H 4M7KL 4KHTL 3DUSB 5F7DB 3MV11 4HHAA 1G0YR 1I9JL 3DROA 3PQYA 4LCWE 3SDXB 1XGPB 3QUYB 4NZUL 1A2YA 1OD7A 4NFBA 2A83A 3OR6A 4GQ9L 2R1YB 6FABH 4D94A 2YSSA 5ESQB 3H0TA 4XNMA 3SHSA 3VFNB 2P42B 1TIUA 2B1AH 4NQVA 2IPKB 4LCWD 5GS0D 2VAJA 3VXMB 3C5SB 5K59F 4JCLA 5E1AB 3RTQD 5ANMA 4MAYC 1ZT4A 3QUML 4KJQC 3VJ6A 4G8GD 4DUXA 2EIZA 3CGTA 3SKJL 3R8QA 5AYQA 4C56B 1AXIB 1PJ9A 3ROOA 2QHRH 1WFOA 3QRGH 4P2YA 2R1WB 4IRZH 3NFNB 3O9WA 3UDWC 3A0OA 3IETB 1LEIB 3WLWD 3QJHA 3HRZB 1KGCE 2JB6A 2UYLA 2NZ9D 2Z8WC 2OMNA 1LK2A 4YHIA 2UWEB 1IGTA 1U3JA 5JHLL 1NGZB 5IB2B 4JKKA 1X4ZA 4HZLA 2ADGA 4HJ0D 4LPWA 3KLAB 4HIHA 3VGHA 1Z2KA 3J7HA 1TJHL 2P8MB 2A6JB 3BE1L 3VFSB 5TE4H 5SX5K 4Y5VA 5TDNA 2BY3A 3UJTH 2UY7A 3BKJH 3AS3A 2XFXA 2WSKA 3IDGA 4U1HB 5D7JB 4NOBA 4NSKA 3WN5A 2WLYA 1U8JB 3G04B 2W9DL 4NBXB 1MCKA 4QRPB 3EBAA 2H9GB 2CPCA 5FM5M 5C0FA 1ZANL 1N8ZA 1FFOA 3LKNB 4UDTA 5T3XL 2J88H 4UOW1 1JWUB 1XR9B 4ZD3H 4ZPVB 3GI8L 4X4XA 5CEZH 3BEVA 3ILQC 1KCVH 5GRUH 5INCA 5F1IB 3D48R 2VLKB 4HIXL 5JZ7D 5E08L 4ORZC 1J86A 1OAKL 4HIIA 1XGTB 1VADA 3DPBA 3WFBH 5HGGS 1S9KC 3WHE1 1L7IL 1G7JB 1NSNL 1N0XH 1KC5L 4PJBE 4Z7QE 4WGVB 2YPLB 1J0KA 2DLHA 3IXTA 3VH8G 4NN6B 3WO3B 5C9JA 4JLRB 5E8OA 4WNQB 4AZ8A 3HI6H 1FZKB 1J8HA 3UTZA 5GRZA 1YMME 4UT9L 4WTZA 5DJXA 5D7IE 4GUPA 2V17H 2LU7A 1W0WB 1N5AB 2P5EB 2RJMA 3GNMH 3K8LA 1TJGL 3MJ8B 4OQTH 4LIQH 2GIYA 2A77L 4RRPG 2J6EL 1W72B 1NGQH 2VDKL 4LPXA 5ESAA 2Q1EA 2EC9U 2PCPA 3D2UD 4NBZB 4CGTA 5KSUB 4MJID 4KC3B 2B39A 2DQIL 4G7YL 4D2NA 5DTFB 4DKFH 3LB6C 4ETQA 3VMPA 2XZCH 1DFBH 5E8NA 4U7KA 4WHTB 4XC3L 4J6RH 1TPXB 5B39B 5LWYL 4LLQA 1P9MC 1I9IL 4G6KL 5JOFA 1KYOJ 4F57L 4XP4L 5FOJA 3QDGB 3MRCA 1U2CA 4XCCL 1C16B 5C07E 4YDJB 5HHVL 4N8CL 3TNMA 2IANB 1AH1A 5FKAB 1P2CB 1RK1B 3BP4B 5E5UB 2ENYA 2HJLA 3EJYD 4EUPA 4NRXA 1CTOA 3MSPA 4JJHA 3TFKD 1EGJA 1DUZA 3NIGF 2P7TB 3VFOB 3OAZH 1RZKC 4FRWA 1CQYA 4YIQA 4RFNC 3VG0L 4I2XB 1FIGH 1MWAA 3VFVA 1UWGL 3V6OE 5E00B 3GFUA 4IRSC 1AD9B 1MRCL 5EORH 1TVBA 3AMLA 1IEBA 1WT5A 1MHPL 1WIUA 1KEGL 3DGGB 3TPUB 4WWKD 5IV2A 1NCUA 3F62A 3MXWH 3V4PH 3P30L 2D31B 4FZ8H 4X6EB 4G6JH 1BBDL 2X9XA 2ESVE 4QXTA 5FECB 1H8SA 3CX2A 3ZE2F 3MCKB 2I9TB 1X4YA 3MRDB 2ATKA 2DQDH 4YDLB 5ADOL 5DD6B 4I1NB 1MWAL 3IAGC 3ARED 5DYOA 3VXUE 1DQDL 3TVMD 1VFBA 4XBGB 3D39E 4GBXC 4ACPA 1CQKA 2E7HA 3LSOA 5HVHC 1ORQA 2R2HA 2EE6A 1OW0C 1I85A 5CP7A 1MFAH 4PGBB 5SWSD 1G6RH 2DAVA 3QEGH 3IDIB 5DLML 1T3FA 4S2SB 5FXCH 3BW9B 2F58L 3UBXB 4R8WL 3C5ZB 2XQYK 2YD6A 3VXUD 1K2DB 3D39D 3BAEH 1PG7H 3JWNC 3I85A 3PIQB 3S37L 3OKOB 4FQHB 3VFPB 4DCQB 4CVZB 1QLFA 4Z77B 4RGNB 4RCAA 5DHVH 2RAMA 1I1FB 1H3TA 1A7QL 1L9NA 2ICEB 1CVRA 3FOLB 3CFIC 1X5FA 2NPLX 3U9PL 4P48A 2VXTH 1NFDE 2BCKB 1CLYH 3RX8A 2WUCL 4MCZA 4LRNH 4JGJA 5E6YA 2QQKH 4RFOL 2QV2A 2VLJD 2OJZL 3CLEL 4U3XA 4P2OB 1IGML 4DGYL 1FIEA 3KYNA 3ARGB 1DBAH 1AGCA 4YNYA 3GUTA 2P44B 1C5BH 4NKIL 4P2QE 2KQMA 3B8SA 2HT3C 4Y5XC 5CZXC 1T0NB 3GMRB 1M7IB 5C0NC 4FQXB 3PGFH 1JTPA 2YR3A 4A6YA 2FX9L 4PRDA 5I75B 5IVXB 4PRHD 5GRJL 2LVCA 5HVFB 3E6FA 4UB0H 3JV4A 3VXSE 4KI1A 3WYRA 1RJLA 4H8WC 1UACL 4YPJA 4MNGA 3RL2A 1MJ8L 1EIBA 3P77B 1XH3B 5GS1B 4CN6A 3OAYK 4NM8L 3W11C 4BZ2L 3I6GA 1I1AB 1H0DA 3RDTC 1BFSA 4ELMF 4GMTL 4NPYA 4YHPA 4KDTA 5DSCB 3R06A 2Y36L 1OGAB 4PJDB 4A6YL 1OLLA 4I4WB 4OGYH 1YEJH 2Q76B 5KANG 1KCSL 5D6DA 3T3ME 4DN4H 3HZVA 4KGJA 3FO9B 2VWEE 1FJ1A 5LJYH 5HGAA 4IIQC 1C5CH 1DLFL 2PTVA 3RA7H 3BIKB 4PD4J 5GJSL 1N4XL 2VLRE 3F58L 3RNKA 3IKCB 2XICA 1YN7B 5J56B 1OSPL 1XF1A 3QIBA 4LMQI 3TCXA 1PGRB 4HX1B 4OTXL 2ADIA 4TNWK 4LGRB 1IAII 3GMMB 3RPIB 5ADPH 1KIQA 1BVKB 4GO6B 3PQYE 5I15L 4MSWB 3ARBC 3B5GA 3CXDH 4QXUH 4B50A 4R2GD 2VITB 3BUYB 3UTOA 4HKJA 3P4LA 4FMFA 2H26B 4MWFB 2BC4A 5DJ8A 1WISA 3ARRA 3AAZA 3EOTL 4JPWH 4KQ3H 3VE0B 5HYJA 3G5XB 1HHKB 3PQYD 1AQKL 4X99A 1S5HB 3WDIA 4AT6A 5ANME 4XCNB 4LCCA 5GISL 5JXAH 2FEEL 1ZK9A 4WENB 3ESVF 2HTKD 2VXSL 2JK5A 2CDGB 5D1QA 5J1AB 3EYOA 2DJUA 1JPGA 5TPWH 1U6AH 4DAGL 5BMFL 2Y7QB 3RGHA 2E27L 1L7TH 2YPVL 3QHZL 3T0WA 2D4DA 5FO8A 1ZA6B 3L3IA 2FR4A 5D1XA 5HDOA 3QFDA 3O9WD 3TN0B 1BX2A 2HN7A 5F1SA 1FNHA 4XMKH 2VAAB 3PGDB 1DL7H 4ENEC 3SDAC 4MXVE 5I1EL 4NHUA 2EDJA 3IFLH 4GRLA 4OGXH 5GIRA 5DJ6B 5T3XD 1T22A 3MRQA 4OZ4A 2IQAA 5E5MA 4NJ9H 4MXQC 2A73A 1AP2A 5M7QA 4BH8A 5ENWA 2OYPA 3B83A 4HFUH 1NANH 4MX7A 1KYOK 2W60A 5IROA 1ONQA 3CNKA 1T04B 3GSNB 2HLAB 1FAIH 3S34H 3PWJA 1VB9A 5DJZA 5GS2D 5EU3A 3ZDZF 7FABL 2E3VA 3QQ9C 3VWJC 2ICWI 3L3GB 1GGBH 4HWZB 4ZOAA 3B4NA 5ICYA 1XMWA 1IMHC 4X8XA 1HSAB 1P1ZA 3EYQC 2CIIB 2YOCA 2Y5EA 4YWGL 2F74B 1K3IA 4MVBD 25C8L 4N5EC 3LMJL 5IB4A 3OX8B 1NCBL 4UQ2A 4PYGA 1RIUL 3BJLA 2WINB 1J8HE 1ND0A 1KPRB 1TITA 1M05A 3R1GH 5EBWB 4I9WE 4O2EB 1NUGA 4MA8L 4O9HH 3W39B 3EDKA 5ISZD 4PTUB 2IBZX 2PXYB 4OV5A 2NY4D 4OQ1A 3DVNB 1AR1C 3GEWB 4JR9L 4JN1L 1Y0LA 1W8OA 3MBED 2N7BA 4HKZA 5DJ2B 1WTGT 2X1QA 1JZ3A 3P0VL 1J8HD 4I9WD 5TDOA 3RWFA 2O61A 4PJ8C 3LKQA 1T83A 4YC2C 2QKIB 3RY6A 3WFCH 1FC1A 2QQNL 5DUPH 3AM8C 3VXRB 4TVSa 3W9DA 1WBXB 3NCMA 3QQ3A 1YJDC 3RWEB 2VTFA 4M02A 4X8JA 1I4FA 2GCYA 4JHAL 4UTBH 1BZ7B 1F5WA 4JZNB 4CW1B 4KI5E 1S7UA 2EXYD 2R39A 4PJAB 4WW2A 4HGWA 1MHHB 4KKAD 2VH5L 2EYSA 1MLCA 1GGTA 4PJ9C 3L7EB 2X44D 2J4WH 3TZVA 3RAJL 2G9HA 3RGVC 2C26A 3BMWA 4PB0H 1A14H 2XTLA 4NDMA 1CDGA 4TUOB 3O4OC 3Q3GB 1XR8B 1E4KA 2ZG2A 4OLUH 3GJFA 1LO0L 4R7DB 3U4BH 3KPNA 2CRZA 3X14A 2VIRB 4RQQA 2OR9L 4KZEH 4GRWF 3R0MA 1GAFL 1ZT1A 5IESH 4ELKB 3C8KA 3GMLB 4NWTH 4P9HL 4X9FA 5F7UA 4YHZH 4P46B 1CD1A 3QEHA 5HYQB 1QFUL 2UVFA 3FONB 1I7UA 1VFAB 5FB8A 3HPJA 1QD0A 1CFSB 4AEIL 3KS0J 4S1RL 5SWZB 1SY6A 4Z76A 4P4KA 4X7EC 4K2UH 4WW1B 3T1FB 4Z7OE 4KWUA 4PJ7A 2LE9A 3NPZB 3KPRA 3QI9D 3KHOA 5BRZA 3NCJL 2IPUG 3ULVF 4X7DC 3HE6A 2OQJB 3VGAB 1DQML 3MACH 1KPVB 4W81A 1FVCA 4I3SH 4PJXF 3S5LG 1FVEB 1UQSB 1QFWI 2X6MA 5DMYA 5JA9A 4GXUN 4ZXBC 5L2JA 3GK8L 4LSUH 1YEFL 3QO1A 3ZHKA 2YN3A 2Z4QA 3HE7A 2ERJB 4GG8A 1S78D 4X6CB 4L3EA 5C09B 3BPCB 1SY6L 4G80B 2GW5A 1KPUB 4PD4K 4G9DA 3MRPA 5EU6D 1E27A 3KPLB 1M7DB 1FO0B 1BWMA 3NCCB 4HBQA 2G5RA 3EDEA 2IADB 3QIUC 3SGDI 5JNYB 4PJGB 4S1DD 4UBDD 2YMXH 2VXUH 1P4LA 4U1IB 4JANB 5ESVB 4KV5E 5DZNA 4F8TA 2BOCA 2X4TB 2FZ3A 1MCSA 5EPMA 5KSVB 3RVWC 4BFIB 3MNWA 1A7PH 3ZT5A 1PLGH 1UM5L 4RDQG 1RSFA 3TIDB 3KWWA 1DBJL 3SKNB 2X4RA 4PRPD 2GT9B 1QEWA 2XN9D 4M1DL 5JW4M 4HXBL 3EJZD 1JWSA 4K9EH 5FFLA 2WWKT 4ZYKB 4WUUD 4EI5A 4M1CD 5I1CL 4MNGE 43C9B 4OB5H 1IT9H 3QDMB 5IJVB 1T5XA 1RJZB 3CFBB 5I30L 3WNMA 5LXGH 2E9JA 2XRAL 5IMMB 4J4PC 3DBXB 3HG1B 4K3JL 1DTUA 4V2CB 3STLB 5EZJB 3DJ9A 4PJCB 4WU5A 2H2PD 3QIWA 2DQHH 2QADC 1RU9H 3CD4A 2IG2L 3OV6A 5E56A 3OAYH 2ORBH 2BNUA 5EULV 3DXAD 1WWWX 2VDRH 2HRPL 4MDJB 4WFHD 3MRKA 4M03A 1ZAGA 4XVUC 1BF2A 4L3CB 3L9RA 4KKNA 1DZBA 1JF1A 1KB5A 2HJFB 3Q5OA 1DQLL 1A6WL 1LO2L 1S3KL 2GJZA 2HG5B 2V6HA 2EYRB 1F90L 5CEXB 4MZ2A 3TIEA 2VJXA 2L0DA 3TT1L 3I75A 5IK3A 4OZGA 1UXSB 1G9MH 1ZLVK 1EGJH 1IGCL 2IAMA 1W0YT 3BHBA 1Q9OA 3QIBD 4LSDA 2MNUA 3DYMA 4MA3A 3RVVC 3MRRA 1T5WB 5C0DA 2X4PA 1R3IL 4OAWA 4LKCA 3BH9B 3QUXC 1KB5L 3P9LB 5LGHL 3MGTB 2V9TA 1U8LB 1HILB 4H1LB 1TNMA 4JDVB 3T3PF 1MVUB 4OM1L 1IKFH 1I1YA 3WE6B 1H8NA 3QNXA 2AJUL 1S7WB 3TWCL 5FYLL 1DN2A 1S7SA 4FFZL 4OGAD 2ADFH 2GAZA 5HYJD 5KG9A 4O5LL 3QPQC 3F7PC 4DTGL 1PY9A 2XKNA 3JUYA 5E0QA 4FABL 2D7TH 4I0PD 4E41B 5JQHC 1QHOA 4MNHB 3LRHA 4ZO8A 3EYSH 4QOKB 4X0KB 4S0SD 2FD6H 1FNGB 4JKMA 3AU1B 2WWMD 1EXUA 3LPWA 3MJGX 5KN5B 3NFPB 3WS3B 1ZVSA 4N0UB 5JOEA 3GBNL 1EEYB 5TH2A 3SDXF 3NACL 4R9HA 5C0RH 2H41A 3VRIB 2HFFA 1N7ML 3I6KB 4EI6A 3DUUA 2A6KB 4OBSA 1XGRB 2IQ9L 1PW3A 3T8XA 1EJ6A 5FGCB 4AG4H 1FQ9C 4ZTPL 5GS0C 4FTVA 4M4RA 5F6HI 1J10A 1JTTA 2GJ6B 2W38A 3VMNA 4X98A 3RTQC 5HPMA 3FMGH 5FM5O 1WCBB 3TJEH 5FA3A 1F2QA 4O58H 2X09A 2FGWL 1DVFA 3HNTH 5D7KD 3RQ3A 4ZTOL 5ACLA 3BKCH 4BH7A 3VCLB 3INUH 4U31A 1OSZB 3V52L 1ZKAA 5GGVY 4KMQA 3HCVB 3ULUL 5IB3A 2BNQA 4RGOL 1W8NA 35C8L 4XMLL 3WLWC 5A3ID 4HJGB 1JGVL 1NMBL 4XHJD 3ZKMD 1B4JH 2NZ9C 3DVGB 5D8JL 2UWEF 4KJYB 3QYCA 3TA3A 2H8PA 1J1XL 2NY6D 2B5IB 3DX9A 4JFQA 4RFNB 1UCBL 5IP4A 3RNQB 1UZ6F 2ADJA 3TYFA 4HJ0C 1DQQA 3CU7A 4LLUB 3UC0L 3HA0A 4LCIH 1OGTB 1S9WB 4OLYL 1MAKA 5FA4A 4KMTL 4B7LA 5C08B 2FBJH 4L5FL 3WLBA 2Q7YA 4HUWB 2EH8H 1UM4L 2DQUL 1UJTA 1HNGA 4F9PC 3I02A 4XBPA 2A74A 4Q9QH 3QJFB 4HUMB 3O3AB 1K8IA 3B9AA 3VI4E 2GSGB 4O02L 2VZOA 3LKSB 3R8BB 4YAQB 2A6DA 1S7TB 2XKSA 2X9WA 5J9PB 2BP3A 4GBXB 2BMKA 4OF6A 5C6TH 5HVHB 1QRND 4P23A 3UJJL 3FFCA 3HI5H 3E3QC 1N6VA 5JZ7C 3PJSB 3V4UL 2EDYA 3WV0A 2X4OB 2MPAH 4JY5L 1NLBL 2XPGA 4P2RA 1G0XA 4JO2H 2GY7B 1JNNH 3ARUA 3M17B 2VDPH 4BSVA 1Q9LA 1VGEL 3IFPA 4RAUB 1MRFH 4PP2A 1RUKH 4HWNA 4RX4A 1FGNL 1QSED 3DLQR 4JGUA 3UYPA 3MNVB 1WTLA 4JKPL 4A2MA 3MXVH 5F9DC 1TZIA 4KPHH 1A9EA 2QEJA 3KLSA 5E2UH 5EOCL 2CIKA 1TXKA 15C8H 3RIFF 4FNLH 3WIFA 2Q86A 1TMCB 3GRWL 3VW3H 4DVBA 2M26A 5JMRA 2XZAL 3T77A 4S11A 3S35L 2IH1A 5CINH 1NUDA 2HFEB 4QKXB 1ZXQA 5I6XC 5KVDL 5BV7C 5IFAH 4L8SA 3UROR 1TZGL 2EECA 3MGOB 3W9EB 5CHNB 4TVPE 2V9RA 1AKJB 1G7LB 5F70A 4OD3H 1FYTA 4JFFA 5FAAA 3P3YA 1X5AA 1EJOL 3S5LA 4QF1A 3EJYC 3C8DA 3CC5B 4MXWH 3QA3B 1HH6A 4ZQKA 5C1MB 2Y6SD 3TFKC 3RDTB 1LO3L 4PJ7E 2YEZA 2QSTA 2MHAB 3KPRE 3EDDA 5BRZE 4J3WA 4LCUB 2AI0L 1QBLL 3U2SA 5JW3L 3HC3L 5CJQH 2JJSC 4LQ1A 1A7RH 5J0BA 4YHOH 4L8DA 5DQ9B 3AY4A 2B1HL 4P4KD 4PRIB 3O3EA 2FJFB 5MEQA 4LLDA 1H3PH 1RHHA 5DRZA 1JVKA 1KLUB 2WP3T 4IIQB 2P48B 4WWKC 1S9XA 1T89A 4WHDA 4L3EE 2NX5A 4POYA 5HDBE 4MLSA 3P11H 3QDJA 1PDKA 3V6OC 3MZTA 4IOFD 5JHDA 1V3MA 1KB9J 2ZUTA 1CTNA 2P8PB 3GSOA 4UV7L 4HQQH 5I17A 1U93B 2VLME 2K9UA 4NQXB 3TNNA 3AREC 4MAUL 3MA9L 1HHIB 1GGCH 2CGRL 4KJWD 4D9LL 1WBZB 1H3VA 4IMKA 2LAGB 3MLTB 5DS8B 2X7LB 5IW1A 1CT8B 3ARBB 3L3KA 4WO4A 5ETUA 3P4NA 1P6FA 3CVHH 5B3JF 1QVOA 3PDOB 1NAMA 2K3TA 2EH7H 3IJYB 1LDPL 2VYRE 5F93C 1BHGA 5DK2A 1T1WB 2FYYB 4I77L 4RMSA 3F12B 2DMCA 2AEQH 3GB7B 3WIIL 1K3ZA 1VGKB 4O2FB 3BDYL 12E8L 5LQBL 3SDCD 4HC1L 1QUNA 3EFFA 3LPGA 3N1PC 1JUFA 1T1ZB 4OUUA 32C2B 5MI0C 1BMGA 1JRHH 2AK1H 3BGFC 4NQEB 3BPLC 4GG6B 2AJYH 4BKLA 4NZTH 5DMIL 1AQDB 3ET9F 3VD7A 4FZEL 2E8ZA 4YXHH 2GFBA 5JQ6H 2PTTA 5K9JH 1NBYA 3KYKL 5IVXF 1K5NB 4KK8D 1D5BB 2YKLL 3BGMA 2MWCA 4L4TA 1AD0B 5T3ZE 3WSQL 1OAQH 1OP3H 1KACB 2IBZY 3MLUL 3SDAB 4NWUL 2XKUA 1NBVL 4LLWB 3PHOA 2R0KL 4GW4A 1R0AL 5D7LB 1CD0A 4XWGH 5F9JB 5T1LD 4I0KA 3GMOA 1SHMA 1GL4B 2YRZA 4N9OB 5FYKU 2G75B 2IGFL 3T0EA 1LILA 4Z0XB 4F33A 4LSVL 2CDFB 3HUJA 4MDIA 5HHMB 3HAEA 1DLHA 1JK8A 1JNHA 5I1DB 1LEGB 2DM7A 4OZFB 4J3XA 2CXKA 5FYLD 3GGWA 1QSFA 1P4IL 3FJTA 4QRTB 1BF8A 3IFNH 4NKOB 1GC1H 2IAMD 3LHPL 3O41A 3VWJB 2VZTA 5HDQL 5ICZB 4NO0B 3SCMA 2PW2B 5KSAD 1QSZA 5J3HD 3FT3A 1JYNA 1A1OA 1UEYA 4OF8A 1P5VA 3I50L 2F8VA 4LVHC 1MCLA 2OS7A 3EUUA 4K7PL 4TVPH 5HY9B 2X4SB 1DR9A 1LEKB 3B6SA 4O4YH 2VWEC 1VFOA 1AJ7H 4M7ZC 4LLYA 2R23A 4ODVL 5I8KL 2AABL 3CJJA 3ZDXE 5K93A 4RIRB 1INQA 5E7BA 1IGYA 2SEBB 1HEZB 1Q9WB 3IFOB 3TC9A 1J9CT 3BSZH 5FF6B 4JRXB 5FGBA 1YY8A 1CDCA 5F6IC 3ULUE 4R2GC 1KLFA 5IBTH 5I1KL 1QA9B 4NO3B 1T4KB 4PJ8B 2J2ZA 1HSBB 5HHQA 2BNRE 4YC2B 2LABA 2H32A 2BSTA 2XWBB 1IEAA 4N5UA 4KAQL 3V0VA 4JFEB 4UV4L 4FTVE 5T5FL 3EAKA 3LQZA 1EHAA 2VDNH 3QEQD 3X3GL 2NY7H 3ULUD 4LU5L 1KELL 4UTAH 5DMGD 1MCIA 3GMQB 1M6OB 2AJ3B 1BFOA 3Q2CA 4NQDB 2FDBP 3ARPA 4WJ5A 2HTKC 5FHAL 4FTVD 3REWB 2OX5A 2NXYD 4OKVA 1PEWA 2BNQE 4KUZH 5IMOA 4K71C 3QG7H 3EYFA 1A6UL 4PJ9B 4HDIB 4FQJL 1AFVH 2LFGA 4OLZH 4CVXA 5I1HH 3GI9L 3K7UA 4I13B 3RGVB 4LHJB 3RIAF 5E03A 1FZOA 3EO1A 3QBTB 5IF0B 3MUGB 4KTDH 3O9WC 3ZYIA 4E0RA 4ODWA 4HH9B 4ZS6D 1A6TA 3FAWA 3O45B 3MLRL 3O4OB 3DRQB 2F54B 5CD5D 3KPOB 1YC7A 5HI3D 3WDJA 4XMPH 4OM0L 4N8VG 3RKDD 4CNIB 4UT6H 4HV8A 4ZUWA 5D1ZA 4JCMA 1I8KB 1QNZL 4JFOA 5D5MA 2AJVH 4JFHD 5A43C 4XP5L 2H6PB 4XP1H 2DDQH 3CSBA 5FO9A 5C92A 4D9QD 5GSRA 5CCKL 4UNUA 4RSVA 4HLZG 1PZUB 3U9UA 1RQ5A 1CIDA 1SM3H 4X7SL 3ARVA 2PTUA 2PW1A 3A6CL 3WN5C 1YEDA 1TJIL 5HPOA 3MJ9A 1TQBC 3KXFA 3VFRA 3FFCE 1P4BL 4N0FA 3U4EA 3D0VA 3LN4A 3PWPA 3D3VD 5B21A 3HLAB 4YLQT 5EOQH 4Y19D 4P2RE 4TQEH 1CGSH 3KS0H 4MVBC 4YO0B 1UM6H 3FFCD 1I7RB 5D2LA 1UWXK 3FHQA 3NFSL 5T3ZH 3G5YB 3FOMA 4ZXBB 3X11A 1EMTH 4MJ6A 4KVNL 2XA8H 3FQXA 1KXVC 1BD2A 4OJFH 3K74B 3SO3C 4RMVA 2C7UA 3FFDB 3MJ9L 5H2BA 2I5YL 2NY4C 1N3NA 4HK0A 4ISVA 1GZPB 3O2DA 1KB9K 2FIKA 3KYMA 2ZOKB 3BH8A 3SQBA 5FO7B 5GSVA 4RX4D 2AK4A 3MBEC 4YFDB 1QKZL 2GTZB 3PWUA 4UMGA 3QIUB 1OAUL 4NRZB 4RMQA 4HCRH 4M5YH 4YZFE 5HHPA 2PO6D 1MCWW 1A7NH 1H8OA 1U92A 5JW5A 2EDQA 1ZS8B 4XXDB 1X7QB 1Z6JT 4S0TD 3T2NL 5D9SB 1SBSL 5F21B 4YH6A 3KPPB 4PB9L 5B3NA 4LASL 4AIOA 3T0BA 2EC8A 3ALPA 1LO4L 4YHLH 3O2DL 1PKOA 4NYLA 2R56L 4PJAF 3N9GL 3WFHA 2EXYC 3WXVL 3S3SA 3OR7B 5D72H 1HI6B 1FYTE 4JFFE 3B9KD 4KKAC 4KY1L 2BRRL 4X6BB 4HIJB 1D9KD 1JWMA 5FIEA 6CGTA 1YQVL 2FJHB 5CMAB 5F7FA 1R5WA 3N85H 1IM9B 4DKEH 1IILE 4JFFD 4XNUH 5KS9B 2V2TB 1IVLA 2KH2B 1I3GH 1MCWM 3V0WH 1M71A 4APQA 3W0WB 2B0SH 3QHTC 4X5LA 2ATPA 4JFXA 3Q0HA 5IVOA 1BECA 3CDCA 1WZ1L 2NX5E 5I16B 1FFQA 5AWNL 3QDJE 4W4NA 1IC7L 4JY4A 3HZKA 5JHDE 3H9SB 1A4KA 2R2EB 3OG4B 2C1PB 3MRIB 2YXMA 3I9GL 4F58L 1D6EA 4XPFH 1JHTA 1AI1H 4KK9D 2FB4H 2XZZA 3QDJD 4NCC2 4D8PB 5KAQF 4HUVB 4MD5A 4WEBH 1E6JL 1YC8A 3U1SH 4BUHA 4KKCD 4G9FB 1BQSA 3QI9C 5F96L 5H35B 3NA4A 3D69A 4GKOA 4KDVA 3QCUL 5EZOH 3K8MA 1R5IA 3QQ4B 3WEXB 5I19L 4YHNA 3WD5L 1NGXA 2BDNH 4ODHL 1UFUA 3BZ4B 4QXGH 1A9BA 1FNAA 4Y2DA 5JXEA 2HA1A 3DX7A 4X6CF 2XTJD 4QRPD 5DEFB 4P3CL 1S78C 3BD4A 5CBEA 2WIMA 5E6IB 5MEPB 5ID0A 4ZFGH 1G7HB 5KSBB 4X4YB 4QRRD 1GZQB 1T1XB 3KPMA 2DWEA 3RWDA 1TNNA 4PRNB 5C0AB 4PJGF 2IEPA 3MFFB 2F5BL 1F8TL 1FLRH 4S1DC 4UBDC 4MJ2A 1KJ2L 4OIIH 3NIDE 5DI8A 5C2BL 3P4MA 5AAWA 3HR5A 3U0TB 3QXTA 2CKBA 2AJSH 1A7BA 3LN9A 3O8XA 3VXPB 1QQDB 2MKWA 3RU8L 4PJ5A 2CRIA 5JR1H 1RIHL 2FO1A 3WBDA 2VC2L 4L4TE 2Q3AA 4NRYA 4IS6A 1C8PA 2PYEA 4OIAA 4YDVB 4M1CC 2D7QA 3UPAA 1KNOB 1AIFA 5I1IL 4LCWB 1KN4L 2HKHH 5D7SL 1INEH 3RTQB 1NL0L 1RUQH 1I3VA 2VXQH 4JRYA 1MFCL 3O3BB 3PDGA 3T0EE 4PJCF 4B53A 3IDJB 4LMQE 4ZG1A 5JTWA 5IGXL 3HUJE 4GW1A 4M5ZL 2H2PC 1OTTD 5C0BD 4EN3A 3MYJB 2IF7A 4K3HA 5SV3A 4ZNCD 4MNQA 1RZJL 1CR9H 1S7RB 4R0LA 1OCWH 1QSFE 3JTTA 1SYSB 3T0ED 3RI5K 4RZCB 3IGAB 3WCYA 5T1MB 1GJIA 1GPOH 3H7LA 1JPTH 2NTSP 4Q97A 1FBIL 3ZE1E 2EZ0D 5DGRA 3SDDA 2N56A 1XCTA 1BPVA 2BHUA 4LARL 1A3LH 1G6RB 5CEYB 1XGQA 5IM7B 1FNFA 3SCMD 5F7LB 2V7HB 1N6UA 1U9KA 2V5YA 4Z5RA 5HVGB 2VR4A 3MNZB 4XCYA 3VFGH 2Q20A 2DQFB 4X7TA 4N1HB 1MQKH 2A38A 1NMCC 2EDHA 3DMMA 4OIBA 1RIVL 1LD9B 3X12A 3FQRB 3QIBC 1VSCA 1T21A 1CZ8L 3GBML 4OUOA 3ULSA 4OZIA 1S9YA 5I8OH 5TE6L 3C08L 3C6SB 3JWDH 2JJUA 1CICA 2RFXA 2I27N 1IAOA 5J89A 2GTWA 1F11B 5DMKB 4OGAC 4IRJA 2CKNA 1D5XB 2GHWB 4U6VL 3LD8B 4NM4L 3ZTJG 3IDXL 4I0PC 3MRBB 4LVNC 1ZT7A