1ET5A

Crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NITRITE REDUCTASE
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 93
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A02
3QPKA 3WG7B 4YSSA 1NZRA 2Y69B 2DYRB 1GY2A 5PCYA 2GSMB 3X2QB 3TBCA 1R1CA 3TU6A 1GYCA 3D12B 1A4CA 4NB7A 4QKTA 5AKRA 4A68A 1XB3A 4DP2X 2XUWA 7PAZA 1M9WA 1OV8A 3ERXA 2Y1AA 5IY5B 3T71A 4A2GA 1IC0A 1SJMA 3EH4B 2GC7C 1KCWA 1E5ZA 5B1JC 3G5WA 4G7SB 5I6PA 3X1GA 4AX3A 2BP8B 2BW4A 3NJJA 6PAZA 1JZJA 1RZPA 4E9QA 4YSRA 2BZCA 3JT2A 4N8UA 2IWKA 4YL4A 1OF0A 2HRHA 2PP7A 1PZCA 2FNWA 1GR7A 2FTAA 1AZBA 3X1BA 4TXVB 4P5SA 1N70A 1KBWA 2IDSA 2GB2A 1AG0A 2AZAA 4K9JA 2FQDA 2VSMB 3MBWB 1SDDB 2IAAC 4DP4X 3FYEB 1J9TA 3MX0B 1JZHA 2PPAA 3U25A 3ZBMA 3EH3B 3ZX1A 3C75A 2UXFA 2CBPA 2VM3A 5I6LA 4PAZA 1HAWA 1OCZB 2ZXWB 1T5KA 5TK4A 3AG1B 3S8GB 3UACA 1V54B 2W8CA 4YSTA 4DP8X 4GP8B 2CAKA 1OCCB 2VW6A 4DP6X 1AS8A 1MZZA 3H4FA 2J56A 3IE9A 3PXLA 1SFHA 1B3IA 1GW0A 2PLTA 4E9SA 2OCCB 4ZK8A 4E9XA 3T6XA 1IUZA 2DV6A 1GS6X 1J5DA 1KGYE 1NIBA 4BWUA 3WNIA 4HCIA 3N55A 3NT0A 2YAFA 3KW7A 4UF7C 4F2EA 3NJMA 1PZBA 4Q8BA 1BYOA 3AZUA 2DY2A 3ABKB 3ABGA 2FT7A 4W1TA 5I6OA 4KNUA 1E65A 3NYKA 1JXFA 1NPJA 6PCYA 3IEAA 2BW5A 2XVBA 9PCYA 3SQRA 1HFUA 3NJGA 1WAEA 1PLCA 2HRGA 1QNIA 1FFTB 3GYRA 1BYPA 4HALA 1X9UA 1AS6A 2J57A 2PPCA 1E67A 1E30A 4YSAA 4A2FA 2A3TA 1X9RA 3HEIB 3TASA 3ABLB 2R7EA 2AFNA 1RKRA 1A4AA 1XB6A 3UADA 4KO5A 1KCBA 4A2EA 1GSKA 1KDIA 4AZUA 3FU7A 1PNDA 1WS7A 4G71B 1W6LA 3NSYA 4N4YB 1OCOB 1PLBA 4DP5X 2GIMA 3SBQA 1CYWA 2H3XC 2BWDA 4YSDA 2B08A 2I7SA 3DKHA 5D4JA 2WO3B 2TSBA 5I6MA 4DP1X 1L9OA 3X1EA 4BK5C 4GP5B 3UGEA 3HB3B 2P80D 1KYAA 1J9RA 2IWEA 2GBAA 1AZNA 1V10A 4JHVA 2NRDA 4BWWA 4KO6A 4G72B 3X1FA 3PCYA 3AG4B 4HHWA 4KNTA 1KBVA 3ASOB 4KNSA 1AQ8A 4W9ZA 4DPAX 2J5WA 4HZ1A 3NJFA 1GS8A 2PPDA 3FPYA 2R7EB 3BVDB 1NICA 3FQ2A 4X4KA 1CUOA 1W6WA 1BXAA 4GP4B 2PPEA 2OV0A 1CYXA 3FU7B 4YSQA 2XV2A 5I6KA 3OMAB 4YSEA 3FSVA 1V55B 5E9NA 4AKQA 5I26A 1SHXA 1ET8A 1TEGA 1ASOA 3NJHA 4JKNA 3CVDA 1J5CA 3H56A 1JZEA 5B1AB 1AG6A 4NERA 2IH9A 1NIAA 4GYBA 4KOBA 2XYBA 5B7MA 1PAZA 3N2JA 5A7EA 1JXDA 3EHBB 1AZRA 2FQGA 1AANA 1L9QA 1RZQA 4DPCX 2HXAA 2B3IA 3FQYA 3FSZA 3FSWA 3CVCA 2EIJB 1AAJA 5B1BB 3DIVA 3NSFA 1BXVA 1UATA 5LDUA 2IDFA 3AG2B 2XWZA 4CSZA 4YVUA 1A3ZA 2HX7A 5D4HA 3WKQA 3QJUB 1FWXA 2GHZA 4AI7A 1JZGA 3ABMB 2YARA 3JTBA 3OMNB 4F2FA 2Q9OA 2XX0A 4YVNA 1XB8A 2E86A 3WKPA 4DP0X 1FA4A 2UXTA 1PY0A 1URIA 5PAZA 2GC4C 1ZIBA 1N68A 5AFAA 3RYMA 2BO0A 2FJSA 3AG3B 3IBOA 4FAAB 5FC9A 1GY1A 2PCYA 1JERA 4WTQA 3OM3B 5B1KA 2MTAA 4GXFA 1IBYA 2I7OA 1ASQA 2BP0A 1AZCA 2BHFA 4HAKA 3S3DB 2AZUA 4UAHA 2QPEB 5D4IA 2YAMA 1SFDA 2CUAA 1NIDA 3ZIYA 1BXUA 4BDVA 1OOWA 4HCGA 5B3SB 1ET5A 3V9CA 2ZWNA 1WA0X 4M4RB 1SF5A 2YXWA 4M3HA 3S3CB 4E9VA 1BQ5A 1PF3A 1M57B 1PCSA 1QLEB 3AY2A 4A2DA 3EH5B 3FT0A 3NJIA 1OE2A 4BWTA 1ZDQA 2BWIA 2FT8A 2YAHA 4JHUA 8PAZA 1W8EA 5AZUA 2XV3A 3QJVB 1WA1X 2VW4A 3S3BB 3KW8A 2FQFA 2YXVA 1WS8A 2WO2B 1L9SA 2EIMB 2PPFA 4A67A 1ET7A 2AANA 3TBBA 3NJLA 2QPDB 3T9WA 1JVOA 1SHWA 4GY4A 3NP3A 3S8FB 1TEFA 3T6WA 2QT6A 5EHFA 1EZLA 3CG8A 2QDWA 1ZPUA 1PLAA 2BP8A 2XXFA 1IKOP 3QJSB 1MG2C 1PZAA 4ENZA 2P80A 2PCFA 1NIFA 2CCWA 4KO7A 4A2HA 1F56A 4F7KA 5B7FA 5I5IA 1JOIA 1AZUA 4AKPA 2Q5BA 4YSUA 2J55A 1NWPA 2IDTA 2AVFA 3FS9A 1I53A 4E9WA 3IN2A 4E9YA 3FPXA 1TKWA 1AACA 3PAZA 3SBPA 1JVLA 1A8ZA 4BXVA 1SDDA 1NTDA 2XV0A 1KDJA 2ZONA 2IH8A 1ZDSA 3GDCA 2TSAA 3FYIB 2ZOOA 2W88A 1DZ0A 1ADWA 5B1JA 1IBZA 1XMEB 1SF3A 4WKXA 1CC3A 1L9PA 4G7RB 3WIAA 2HX9A 2YAPA 1L9RA 3QJRB 2WSDA 2FWLB 3WNJA 1OE1A 1KV7A 3AW5A 1AS7A 3EF4A 1PMYA 4KO9A 1VLXA 4YSCA 2CJ3A 2JKWA 4NAJA 5F7BA 4E9TA 4HCFA 2HZHA 2VN3A 3NJKA 3T6VA 3NSDA 2XLLA 4HHGA 1JZFA 3NJNA 2XU9A 1EHKB 2LLNA 3DTUB 3CDZA 3QJTB 2HX8A 1J9QA 2H5UA 2JXMA 2VW7A 3UABA 3FU9A 3ZDWA 1BQKA 2GI0A 3X1NA 1NIEA 2DYSB 5F7AA 4FA7B 3CVBA 1ILUA 1J9SA 1RCYA 3T6ZA 3FSAA 1A4BA 3WI9A 1MDAA 4L0PB 3SBRA 1HAUA 3OMIB 2IDQA 1OE3A 2YAOA 3PPSA 3IN0A 5I5JA 2PP9A 1ID2A 4AKOA 1NDTA 2EIKB 4YSOA 3PLYA 5TK2A 1E5YA 2XXGA 2X87A 1YLBB 2JFCA 5I28A 1NWOA 4A66A 5I6NA 1AOZA 2CALA 3FU8A 1BQRA 2DWSA 1ASPA 2VSKB 4G70B 1DYZA 2YQBA 4MFHA 2EILB 3OQRA 3QJQB 3CDZB 4EF3A 1M56B 4QLWA 4CSPA 1L9TA 2X88A 3BQVA 1BEXA 3H4HA 2DWTA 3PAUA 3OD3A 1ILSA 2I85A 2N0MA 4G7QB 4KOCA 1OCRB 3TA4D 2IDUA 4DPBX 7PCYA 1MZYA 3CZUB 3ASNB 2BZ7A 1TU2A 1NPNA 3NP4A 3UAEA 1QHQA 2EINB 2H47C 2IWFA 2OJ1A 2UX6A 4Q89A 2RACA 2HLEB 1JZIA 1MG3C 3UAAA 1WA2X 4HIPA 4DP7X 2PP8A 3PAVA 5I5MA 2BP0B 2YAQA 3NSCA 2UX7A 4BXSV 1ETJA 2UXVA 1AIZA 2FQEA 2YAEA 4RH4A 5ANHA 2FT6A 2QDVA 1ZV2A 1JXGA 1ZIAA 2VMJA 3V9EA 3GXUB 1AR1B 4BDVB 2VM4A 2UXGA 3L45A 4P5RA 4DP9X 1SNRA 1PNCA 1A65A 5B7EA 1NINA 4PCYA 4UANA 2XX1A 1BAWA 1GS7A 4E9RA 3QQXA 4YSPA 1CURA 2MRYA 3FQ1A
chains in the Genus database with same CATH superfamily
4I0PA 4GEIA 3H3KA 5TDPB 5EFIA 4MB1A 1AZVA 2VLKD 1Z5LA 5PCYA 5EOTB 4EUPH 3VWJC 5ID0A 4JFYA 4LBEB 2J1WA 1KLUB 3MRHA 2EDOA 3H8NA 3LX9A 5FYLL 2VDMB 2CJUL 1VEPA 2V3FA 4MAUL 2V6HA 3KYKL 1CFNA 4R7DB 3MODL 4NNPH 3T71A 3E80A 1U2YA 3MKGA 4HWBL 5JHDB 1BF5A 4A2GA 5C08D 4LP8A 1CL7H 4OM1L 4P5TA 5DHYA 1A3RL 2EC9T 3REVB 3WTWA 1K5NA 2GBVA 2GITB 1JI1A 1E6JL 3O6FA 5H4YA 4LCWB 3LPPA 1XGRA 3Q7JA 5HDOA 4IKLA 2Q86A 3X13B 4W68A 3BX7C 4ODSL 4ODHH 3AAZB 2GJ6B 4OZHB 1R34A 1USZA 2FE0A 4HFUL 4BKLB 5K9KA 2HRHA 3IDMA 4KTDH 5T1MB 2CXGA 3H9HA 3QDGE 1GR7A 3JSSA 4NQQA 3TYGH 2EVFA 3SY0B 3WOVA 5KTEL 5AW7B 4YBHA 4P5KB 2NZ9D 1YEDB 4BFEA 2A83A 2EIDA 3FB8B 4JO2L 1JN6A 3Q1EA 5SWQA 3QI9D 2IXQB 3U25A 2CBPA 4KJQD 4CVUA 1D7FA 4LCUB 1PZUB 1OCZB 3AWGA 4QRPD 4UTAA 5HVFB 4JFQA 4W9DC 4X8XA 3S8GB 3TBVA 3V4PL 5C2BL 4JFDE 4OIBA 4OLUL 1CIUA 1X7TA 4JFOB 4YC2C 4M5YL 3MO1A 3TVMA 3LXBA 4OCRL 2J88L 5CHNA 5AUMB 2D7OA 4WJKB 3KM1A 1FE8L 5HVWA 3LAFA 1E3FA 2ZXCA 2PLTA 2WQXA 3HS0A 2OCCB 1FPTH 1MCOH 4PP1D 1KGYE 4NQDE 4HJ0D 5FO9B 1F86A 3CDFA 5F1NA 5E94A 1JDCA 4ZDHA 3N55A 1CYGA 1E4KA 3FONA 1BIIA 1FVEB 5EEZA 4XP5H 1HINH 1Z3RA 1AGCA 2IANB 4NO2A 4OCXL 4CSSA 4ELMB 3NYKA 1V7NL 1T03H 3MJ8B 3LYRA 1C8QA 2D7TH 3L9BA 2D7MA 3MR9A 4QHKI 2ZE0A 4YO0A 1Q9WA 3BD5A 5BV7B 3GIVA 2YEQA 3APNA 1RUAH 4MB4A 3CHOA 1QNIA 1FFTB 4L48A 5D96B 1T3FB 4P49A 4L8SC 1PL3A 1ZT4A 5DGQA 1AS6A 4M6OH 1LTXA 2EDFA 1E30A 1CXKA 2R0ZL 5HYJB 4NKMB 1JGDB 4MDRA 4HOWA 2H8PB 2V33A 1UM4L 4GFXA 4JDEA 4MMZC 4EO5A 1ZLSL 3HJ0A 1RJZA 3QT2A 4ZSOE 5EDSA 2VDML 5EBGA 4N2OA 4GW4B 4KX7A 2GIMA 2VLLB 3L2MA 3VG9C 2I7SA 2QGCA 4MCYB 4MXQC 3QJXA 1L4IA 2XPGA 2FHBA 3TH4T 3CLEH 2ZUUA 3CQPA 3II2A 4CKVX 4U6VH 3Q0HA 4X7SH 1CGWA 4OIIH 3CDGB 1B0GB 2OYMA 1MIEH 2B4CL 3HA0A 3AVEA 4H1LA 1OIOA 1OQOA 1I4FB 1EEYB 3O4LA 2I69A 5D4QA 1IGML 5I82A 4EOWH 4R4BB 2QVKA 5HHNB 1YN6B 3MLSH 4HHWA 3RUGA 1TJGH 4KNTA 4XXCA 4FXTA 2DEXX 2HCZX 3O4OB 4R90H 4FTVA 2RCSL 4MJ5B 4BFBD 3NJFA 4U6YB 2R0KL 4R6UA 2BY0A 3BFWA 2E8YA 3PP3H 3T04D 2AJ3B 3IJSA 1P4IH 2C1OB 1EHAA 4PTUB 3UZEA 3O3AA 3RDTA 1W6WA 3OXSA 5FFGA 1URLA 4KMLB 3ZDYB 2ZTBA 3I2CL 1ZGLM 3UBHA 1TLKA 4ZOCA 3IDNA 1AYOA 2L7UA 4XP9H 2CBMA 2YSTA 4PLKD 1QOKA 5I30H 1RZJL 3EOAB 5IQNA 7FABL 2AQPA 4XOAA 5IROD 1P1ZA 1Y6NR 2B59A 4G8AC 5ALCL 3WMPA 2EDTA 5E9DD 1A7OH 3SGKC 5CJQL 4LU5L 4WTZA 2NW3B 3QNXA 1MRFH 3TYFA 1BYNA 5FM8A 5DZOA 4DPCX 1T22B 2A74B 2K9FB 3LKNA 4G5ZH 1HXYA 2GTZA 2HUHA 1GZPA 3H0TA 3GIZL 4KC3B 5AB2A 2C9RA 4GQ9L 3GXFA 4FQ2L 5F3FA 4QWWD 5C0NC 1TCMA 4AM0B 4I5BB 4PJHB 2O6EA 3WFCL 3RVTD 5E8EB 3X3FL 2ZOTA 5CJ8A 1G5AA 4Y2OA 5A2FA 4OGYL 1QEWB 1HVXA 1MXGA 4CC0A 3Q8BA 5DHXB 5BV7L 3BRGC 3OB0K 1E4XH 3NN8B 4Y4FB 4LVNC 1IM9A 3UTZA 2R15A 3MI6A 4UT6H 4PBVC 3ZY7A 1QLFA 2DQFB 1WCQA 4K3DH 1FH5H 2R2BA 2PCYA 3FOLB 1DHKA 3IRZA 3OM3B 4X83A 1WD9A 4JY4A 4XE0A 5I1DA 3G5VB 3A4EA 1SRDA 4QRSB 3SE4A 1VPOL 2H2SD 3CFKB 2C9SA 3BLKA 1SXAA 2A77H 4NUPA 5L0QC 4C83B 4HD5A 3HMXA 3QG6B 4IJ3C 3D25B 4NRZB 5EZJB 3K80A 2ITDB 1V3LA 4J1UB 4EKXA 4DSYA 4HGKC 3TXAA 2F8VA 4GMTH 1A6TB 1A1MA 1II4E 3KDMB 5KANI 4EXPX 1P7QA 1JK9A 3DO4A 5DJDA 1OP3H 5KYWB 4OD3H 3SGJA 5IFJA 2Q76A 5C86A 2NTFA 4WK4B 3C5JA 3FQRA 4HKZA 5TD4A 4XO3A 1EFXA 3ARGD 3NEXA 3MXWH 1NAKL 4Y9GA 1ZLUK 1M53A 3KYOA 1WIUA 2BVPB 4GB9A 3KPSA 1SXBA 3DTDA 5JOPD 4XI5C 3CMOH 3BHBB 3O81A 1DDHA 4U1IB 3S3BB 4G42B 3KW8A 1A7PH 2FQFA 5MENB 1Q9LA 2GPZA 2VOTA 2X41A 3KPLB 4C54A 5TDOA 4JRXB 2AANA 1OAZH 4WI4A 4YBQD 1AJ7L 4JPIB 4Q6IA 1G9HA 4R2GC 4HS8H 3DSNB 1PEWA 4ADGA 2PO6B 2VDPL 5EH1A 4JKPL 4QEGA 3GLEA 1KTDA 2XQYA 3DVGB 4EI6A 4Y16B 1CD0A 5C8JA 4IOFD 1PLAA 2XXFA 1G7HB 4KGLA 3DI2B 4XPBL 4RWYL 3FCTB 2X1PA 4E68A 2BNRD 32C2B 1VCBC 4UB0L 4AV5A 1JNLL 4UQBA 4X6EB 4F7KA 4XTRD 4AGQA 1AZUA 1JWSA 3FUEA 4XNYL 4AKPA 3ZSTA 3VW3H 2J55A 2ZD0A 3EJSA 2P1YA 2BRQA 5BJTA 2IADB 3JV0A 4E9YA 4HH8A 1I9IL 4IIQA 1NKRA 3SDXB 4J3BA 5BQ7A 3EH2A 1XF2B 3WEOA 2IGFL 2VJ0A 3ASWA 3QIBD 1T5XA 5D7LB 1MHPL 1MWAB 4K15A 4N3TA 4XOBA 4JDVB 4GAAA 2IH8A 4X42A 1P84K 1U8CA 4RFEB 2GTQA 5ID1A 3OAYH 3BFOA 4KH2A 1NAMA 1QFWM 1UOLA 5AWNH 4H8QA 5SWSB 4Z78A 1WFNA 4HJGA 1ZVHA 4ZT1A 3NACL 4XP1L 2QV4A 4B9CA 1M7UA 5CMAA 2R1YB 4G8GB 4JFHE 5ESAB 1U58A 2BJMH 1T5WB 3WLWD 5DVLA 4H20L 2ZX8A 3WNJA 1KV7A 3CSYA 1NBQA 1C7TA 1OP4A 2CA4A 4F15C 1MFNA 4YEEA 1IE4A 3P2TA 4IOIB 5AVZB 4YSCA 1BFOB 4NQEB 2ZKXA 4OM0H 5C2UB 1U8JB 1GC1C 2F53D 2ADGB 4QRQB 3VNZA 5AVRB 4KKCD 4P2RD 3QDAA 3SB3A 1V3KA 2JJTC 1TETH 2JQZA 1E8WA 1A9BB 1AQDB 1NC4B 3OAZK 4PGDA 5KVFE 4UOJA 2QGDA 1FC1A 4RISH 3S3SA 4I88A 4S1DD 3IKCB 2J8OA 5D1XE 1J9QA 2DQDH 5GGQL 3M8OH 1ZWIB 4JPVL 5GGTL 3V10A 3RWHA 4QI3A 5DO2C 3ROLB 2CWRA 5F7AA 1OGAE 2VR9A 2G2RB 3O6LL 2OCJA 3PABB 4V1DB 4WO0A 1U30A 1J9SA 2FRGP 1T2QL 1NGPH 3ESPA 3S97C 3DX9B 3HAEG 3VA2C 2ALAA 3P9WB 3L4WA 3B5GA 2EZ0C 4WI9A 5GISH 1N19A 3WFEH 4AKOA 4MRCA 3QDJB 1HWHB 3D9AH 4EI5C 1B2YA 4L4JA 3WUZA 2DQHH 1LHZA 2OTUA 2AXFB 5D1QA 1PY4A 2ARJA 5GS2D 1KUMA 4JRYB 3G6AA 2XY2A 3JXAA 1R33A 4UM9D 3T2QA 3B2UC 4A1RA 1KWKA 2HPOA 3C2AL 1JPTH 3VDBA 4MFHA 4MAZA 3LS4L 1S7WA 3BCDA 2IH3B 3OKDB 4R96B 1NGXB 3HE6B 3SY6A 2NY6B 2A99A 1E8XA 4TTGA 4BHUA 3DDGA 2SODB 2Q2LA 5AZ2L 4IRSA 1IILE 3AXLB 4J6IA 2XQ0A 5D2NA 3NIGE 4DP7X 3WN5A 5FGSA 2UX7A 2JB6A 5HGAB 3MZGB 3FH7A 1JHKL 1K8IB 1DBBL 2C3XA 2CLVA 3EJCA 4HS6A 4IU2B 4NN7C 4ZOAA 3WJMB 4YE4L 4QRRB 5I75B 2Y72A 2DIJA 2O72A 3VXNB 1KGIA 3OPZH 5CJXA 4L8BB 3TBWA 3ARSA 2K9UA 4I77H 5L2JB 3S35H 1EXGA 5A3IC 1U93B 4UOZA 3JTTA 1GKOA 2GY7B 3BAYA 3QHFH 4FLQA 4IBVA 2ZG3A 1VFBA 4KTEL 2IFGA 2VDNH 3CC5B 1EFQA 2AXGA 5GGRA 1PIFA 1QQDA 3FQ1A 2IBGA 3RUGF 1D2OA 5DJ6A 3UTTE 5C0BA 5B38A 1DN2A 3HI1A 1E7UA 1GY2A 2BIPA 2JCCA 3JWOH 1D3CA 2OYPA 3W2DL 1UB6A 5GS1C 1GYCA 1JHTA 1A4CA 3RJQB 2RQEA 3H2WA 4G11A 4BUGA 5ABDE 5IHLB 4KZDH 1M7DA 3GMOA 2GSIA 2PUQT 4DQOL 3PU7A 4NNYB 4XCNB 4NGHL 4HJEA 2ADIA 1CMOA 1LK2B 2YIHA 3HE7C 4ZUUB 3MRMB 2J43A 1KB9K 1TZOA 2JJSC 1KGCE 4JFVA 5IIEB 5I6PA 3T0DA 5HVHB 5BS0B 4JZNA 1KWGA 2R0WH 1AC6A 2YEZB 3IRPX 4FCHA 2VITB 4YSRA 4E9QA 4WFEE 3MPCA 4Z7WA 4LSPH 1EIBA 1NCAH 4FXKC 5C70A 2MJWA 4YDKH 5BRZA 2WQRA 2ZXQA 2XI9A 5CBEB 4RGMC 1SDDB 4NP4L 3H6JA 3ARPA 3ULUH 3FN0H 2R2CA 1FZJB 2Y5TA 3FXIC 3HG5A 3JTSB 3L1OH 3NGBC 4JANB 4W9HC 1E27A 2J5LC 4ELKB 2R29H 5ADOH 2Y9RT 3WSQH 4UYQA 2P43B 1T5KA 4JL2A 4L37B 2GCYB 1IGCL 5IJCC 1AMXA 1MCHA 5EC1B 4AQZA 1HZLA 3RTQA 4FZEL 4Z23A 1OCCB 3N5AA 1AGEB 4PQXA 1RJLA 2H6UA 2FH8A 3IETA 2AITA 4KZ0A 3PWVA 1FJ1A 4HPYH 2KYIA 1QW9A 1AXIB 3SDAD 3CSGA 1IGIH 2QVMA 3PWNB 4HJIA 4MMXA 4PGCA 3VH8A 3P54A 2C9AA 1JUFA 1NIBA 3QYMA 3WNIA 4HUUB 3C6LB 2XDHA 4F2EA 3GBEA 3T09A 2GSGB 4KXBA 5D6CB 2C1PA 1MCRA 4U49A 1BYOA 4XN2A 5JQ6L 3ABGA 1Q38A 4B41A 1GVIA 2YKLL 4PJXA 4S1SL 1NPJA 4HU8A 4NIYE 4PS8A 3GKWL 2L0DA 3QYCA 4AQAA 4YGVB 2JMRA 3DURB 1SOKA 1J1XH 2GFBA 3GBNH 3P2BA 5G4OA 3ZTNL 5TDNA 4AENA 1ZV9A 3L5JA 1RK7A 3HBGA 1RHFA 4J2XA 3WMSA 4CVXA 3SGDH 4PJ7A 4XX5A 1EWHA 2K3HA 2HJFB 4WUUB 1AH1A 1FL6A 1L3WA 5ESVA 2OZ4A 2APXA 2QFPA 3OTTA 2NY5C 3K2MC 3JWDC 1CE1L 3KS0H 2H32A 3MRNB 2JNZA 4PUBH 3EFOA 3HZVA 4J3SA 4MJHA 2AEPL 5DLML 5T5NG 3TO4B 1DQDH 5C7ZA 3NABH 3BKYL 4LRNL 4TQEH 2WMPA 5F6HI 4P0DA 5J6GA 4XO4A 1GKEA 1U8IA 2MPAL 4FG6C 4FZ8H 5DS8A 4MX7A 4LLUA 2X2HA 4C4KO 5JYMA 5BUGA 1ODAA 5JPMA 1J0KA 5EN2A 4LCIH 3NJXA 2R9HD 4P5MB 1OSZA 5I8CB 1BEYL 3LRKA 2OA9A 4A6YH 2GBAA 1PY9A 1V10A 3K0WA 3U0PA 2K8QA 3LPFA 2EEAA 1WP6A 4BWWA 1WK0A 2FGZA 4KO6A 1RUMH 2X89A 3MRJB 4OZGB 3REWA 3P77B 3MV8B 4XB8A 5EIVA 1U3HB 2IBZX 1J5HA 3VI4E 4ZMWA 1LP9F 2OMBA 3LNGA 4Q4IA 4BA8A 5ISZA 4DERA 5JIDA 2VKWA 5CJBA 2JKXA 4X4KA 1HSBA 3K7UA 2ZYSA 5CP7B 4GKNB 2ICWA 1G4MA 3ULVH 1RZJC 3VFVB 1F58H 4NENB 3FOMB 1AI1H 1A7QL 4JJOA 1UT2A 5E2TL 3WU1A 2OMWA 4FA6A 1CGXA 1AO7A 3NJHA 3OX8B 4JZJC 1X5LA 1YZZA 5E2UL 1JYNA 1QSEE 1UXWA 2ALWA 2I32A 1J5CA 2YPLB 3BGMA 2ZUVA 4B7IA 2E6PA 2IH9A 3WJLC 1QW8A 4KOBA 5HJDA 3BP7B 1S5HA 4AW7A 1JXDA 1QD0A 2GHWB 4PY8J 5E99L 5FWRA 5M94B 2X4UA 2N0KA 3T2NH 1H0DA 4OJFH 4ONFL 3FQYA 4PYGA 1BD2D 5I17A 4UUJA 5B1BB 4BK4A 3ZKXB 3I6LD 3V0VA 1G9NL 5IB3B 4AVIA 4P46C 1KYDA 2EXYD 3NEOA 3EUDA 3VMOA 3QEHA 3DJ9A 1F1AA 5FGBC 2OXHB 5JQIB 2P7TA 1IBGL 1S8DB 3ENEA 5E8DL 5JNYA 1EUUA 3E1F1 2IV9A 2L3BA 4HJTA 5GS0L 2X4OB 4QXWA 1JPSL 3OKEA 2NY3D 4F9LA 4K9EC 2ITCA 1YMHA 3K2KA 4OQTA 1KEGH 3MUGA 5EU5B 3RBGA 5B1KA 4N0UE 4AC4A 1T6VN 3DTXA 4GAJL 4HIJB 5DFVD 1PZ5A 2BIHA 1T1WB 2ENQA 3FAWA 3IJ8A 4OD1L 4UM8A 5T1KD 3WY1A 2A0LC 1TCRA 4ORGA 5LLIC 1P4LA 1NCWL 1XSKA 4KHXH 3K71B 4JDZA 4AGNA 3ZIYA 1RIUL 4E42A 5C6WH 1R5WA 5C0RL 3UL4A 5L2KD 3V9CA 4F7CA 4WU7A 4OI9A 3WTTA 3WXVH 5FKPA 4B5ZA 2Q3XA 4LL4A 3T08A 3TL5A 4X4XB 4HWZA 3RWJB 1MCBA 1SYSA 4M1CC 1L6PA 1E8ZA 3VFUA 1AD0B 1PQZB 2X6CA 3B7YA 3SDCA 5C07E 3WHXA 4HK3N 4EMZA 1GGCH 3MBEA 4KI5C 1EGJL 1KCRH 1DQMH 4X9YA 1W8EA 5MP6H 1IJ9A 5E6IC 3S2AA 1MHEA 2V7NA 2RHEA 5LQBL 4GKLA 1OP3K 4AJWA 1KT2B 4OF7A 4PRPA 4F7MB 1NFDA 4HVBA 3QUGA 2B9BA 5F89A 1JK8B 1FSKB 3PP4L 3WHE0 1QFUL 4HULB 3CG8A 4N9OB 1R5IA 5ENWA 2Y1ZA 5AW6B 2P8PA 4X4ZA 3W9DA 2ENYA 4LHJB 1HH9A 4PRIA 1ZPUA 5AZEL 1KIPA 4NUGH 3QUML 3B1UA 4FP8L 4KK9C 1AKJA 4KV5E 1NIFA 2O1AA 2PCFA 4PJGB 2DMKA 2QKSA 4CN1A 4PTTA 1T7YA 4O2FA 2IGLA 2Y3AA 5JQHC 1MJJB 1WBZB 2E75C 3TH3T 3U4EA 2DD8H 3D3VE 3KLQA 4NZ8A 3OJMB 4IMLB 2CGZA 3E9TA 4XCEB 5IT2L 1A6ZB 4IRJA 4HGWA 3LD8B 1FFPA 1R3JB 1AACA 1TQWA 2PXYC 3NIDF 4O5LL 5E1QA 4UQ3A 5EIQA 1JZ3A 1CT8A 4MVBC 4BZ1A 5HYIA 5LXVA 4BXVA 1OAYH 5FAAA 4B95C 1BVOA 4LEOB 2X6BA 5BQDA 3JWNH 3DRTB 2P9RA 4DTGL 3RFZA 3QWRD 2C7UB 1OW0C 2UZIL 2HFGH 3FUNA 5T5FL 1Z3GH 1NUFA 3HHRB 4HSAC 2IAMA 4MWFB 5HGGS 1AR2A 5GJTH 1XMEB 4WKXA 5E1AA 3V0GA 2AV1A 4IGBC 2XTJD 3QP3A 2P4AB 1DO5A 2DBJA 3PREA 4YPJA 4Z7WF 4KHTL 1JI2A 4K7PY 2HVKB 2YPVL 3CDCA 3K8LA 4HWNA 4U2ZA 2OMVA 3QGVA 1E5BA 2E27H 4XHJD 4PB9H 4DO5A 1I3UA 1LILA 3A67L 1FNFA 1JD7A 4NAJA 3PL6C 2Z31A 4PJBA 4QOKB 4Y4HC 1R0AL 5C3LD 3KCPB 3OAYK 3FMGL 3NRFA 3TEXA 4HU2A 3ALPA 4JFEA 4KQ4L 3IDGB 4OJDH 4W9LC 5C0CE 4J39A 3S2CA 2BSEA 5I5RA 3KJ4B 3K8KA 5AW2B 3C8KA 3MLYH 1A8JH 3PGFH 1QUNA 2J8UE 3FO9A 3MU3A 3IJYB 5CIPB 1F3DJ 5DTFA 4FNLH 3FNKA 2F7RA 2QQNH 4OH2A 4UCFA 4M5ZH 4RGNB 4ZAKA 3FL7A 2UV3A 2PTTB 2H26A 3MLTA 4JO3L 5FFOA 3T6ZA 1JF1A 3INUL 4MDJB 4AUYA 4Y2NA 5KJ7E 2V7HA 3SBRA 2QV2A 2EYSB 4ATWA 2WQVA 5KANG 4AC2A 1Q0YH 1MFEL 3GBLA 1ZJBA 3D39E 5EF3A 1CLZL 3KCWA 1HH6A 1J5OH 4GBXB 4KY1H 4TVPL 2B7DT 1CFQA 3EDEA 3LRLA 1R3IL 4P23C 3JT0A 3O2WL 3K46A 5I28A 4K3HA 2EYRA 2GJZB 4PJXF 1XF4A 4JE0A 3KL3A 3BSZH 1QRND 1I7ZB 3OR6B 4UQEA 2OMUA 4PGEB 1YEEH 4U1GC 4HJSA 1WFUA 2VSKB 4GI8A 3GTTA 3FQUA 1L7IH 3O2DA 3BP5A 1FN4B 4GI6A 4QY8A 3CDZB 5JPNA 2DJMA 4PJ5D 3IU3B 4CBZA 5GSVA 5K9JL 2VZTA 4L3EE 3IPEA 1MY5A 2N56A 4JG9A 3F01A 5E5MA 4U7KA 3MBWA 3QYNA 4PJ7F 4KJPD 2VDQB 2X10A 3QUYD 3BPNC 5TE7H 3DXAE 3RVXD 4DGYL 2UY7B 4JG0H 5JHAA 1MFVA 3DNKA 2EEXA 2WD0A 3BGAA 4XXWA 1JZ4A 4P3WA 1CLOL 2Z35B 3BVXA 2ENJA 2IWFA 2OJ1A 1OL0A 4G5AA 4E2OA 1SN5A 4PYHA 1FG9C 1KJMA 3S34H 1FNHA 5CSBA 5BW7A 1NCNA 2PW2A 1MH5B 4JY6A 3WUWG 1IJNA 3HKFA 4RSYA 2FQEA 4LOEA 3ZTEA 1UENA 1S7XB 2FT6A 2GJRA 2QQKL 3AM8C 5KYUA 1EAPA 2YC1A 4FLOA 4NN5C 4P2OC 4Y2DA 3IJEB 4IHBA 4WEBL 1QR1A 1S9VB 5CUSL 5DQ9B 1NGQH 4N85A 4PY8I 2J1YA 5GJSH 1BMZA 2CO4A 3D4GA 3VGEA 4MXVE 4EN3D 3LHAA 1KFGA 4XC3H 4ZUTA 3RL1A 4N9GA 1FZKB 4U6HA 2F8IA 3E9UA 5IUCA 2OMXA 4I0CC 1DBJH 3OXRB 3MRIB 4KRNA 3K91A 2JB5L 1JFQL 1SBBA 4LAQH 1IEHA 5DJ0A 4PREB 3MYJA 3RBSA 5HHOB 5IMKA 4YEFA 2OQJA 3B3IB 4L4TD 4YH6A 2OR9H 3VD3A 4DZBB 1OLLA 3H7BA 4LESA 5K93A 1F4XH 1R75A 4NQCE 3GSQA 1UB5B 4PJAA 3MLXH 2QZ5A 3IF1B 4M61A 1HSAB 5E08L 1I31A 2GC7C 2OMZB 4M62L 1C5DA 2WKGA 3H6AA 2ZKMX 1I8IB 1NBVL 1FFOB 5EU6A 4EZKA 3GT6A 4DN3H 1H6UA 3DYMA 1SJHB 4U3CA 5CGYD 4M8QB 3NZ8B 1SGKA 3IK2A 4PCKA 1OF0A 4RMQA 3FBKA 1E4WH 1A1OA 1XEUA 2N7SA 4KKAC 5CEXA 1TZAA 1KBWA 1OSYA 3VXQB 4I0PB 1BF2A 4GLRH 5HDBF 1Y7VA 5EFIB 3KR3H 2WUCL 3G5ZA 1Z5LB 4FQXD 5T1DL 5ID0B 2E47A 1UWXH 1JZHA 1TJMA 4WWKA 4PW4A 1VSCA 4OZIA 1O75A 2YD1A 3F8UB 1ZT1A 3QJZA 3U6XS 1ZLWH 1C5BH 1CFNB 2VM3A 5DUMH 4R5VA 5EU7C 3ES6A 2V2TA 2EXWD 3ZDZE 3D69A 1PG7X 3HE6C 5IMLA 2NY6C 1RU9H 1DQJB 1VDGA 2APTA 4MASA 1WWWX 4J3OG 4P5TB 4KQ3L 4TOYL 5B39B 1JRHH 2JTDA 2JKIS 1CE6A 2OMTA 1FZMB 5CILL 1DBKL 2XZCH 3AUWB 3GFUA 4G6MH 4G80A 5FA4A 1PZ3A 2HRPH 4JM4H 1XGRB 3DO7A 1SFHA 2F54A 4NNXB 3GMRB 1DE4B 1MVYA 4HQQH 1NCHA 2Y2WA 1IKFL 2VDOH 5K9KB 4HHAB 5F71A 3H9HB 3NEEA 3KW7A 4AVJA 5L8JB 3MLWL 2JXMB 1V27A 2R69L 4A63A 2BVTA 2EABA 2VN6A 3ZZSA 3RNKB 2A83B 1UURA 4GH7B 3PY9A 2ODIA 5IGXL 5DK3A 3DK0A 4XNMA 3R1GL 4J4PD 3C60C 1WZ1L 1JJUA 1IVLA 1HKLH 1XH3A 3C87A 2KPNA 1JPST 1MVFA 4QTHB 1CF8L 3DV4A 3NK3A 3RGVC 5K69A 5L6YH 4JQIA 3ARQA 4FDWA 2LU7A 4G6JL 4ODXA 3TBVB 3ZKSD 2EE3A 2VH5L 3L13A 2PYED 2ATPA 1CLVA 3MA9H 4QTIH 3T0EE 5IQ7L 4GIOA 1NFDF 3WEXA 4A38A 3QDGA 3TGXA 4P9HH 2X6AA 5DZVA 1A4AA 4FJZA 2VXUH 3VU2A 4ONOA 4DUWA 2YD3A 2GW5A 4LF3B 5FYJL 2BRRL 3GSUA 5FYKL 1SBSH 4JVPA 3BVUA 3UJJH 1HZHH 1U8HB 4ZX5A 4M93B 4PLOB 3PNRB 5F9AC 4ZDHB 2A4CA 3FUKA 2X4QA 3VFRA 4FADA 5AW0B 3ZTCC 1AE6L 2MEJB 3BESR 3CJJA 2CHWA 4N5ED 1HHIA 1N7MH 1RIHL 4NO2B 5F7HA 3AU1B 4S10A 3DRQA 2HWZL 3UGEA 3MR9B 4E5XG 4LIQH 1HOEA 1OAUL 3CPLA 4JFDA 4F8NA 1N5AA 1D5MB 4NN6B 2W65A 4U4BA 1G6RA 3VWJD 4ZOEA 2E7HA 2R1WB 5DEFA 4ZFOA 1EK3A 4Q9RL 4NBXB 1CK0H 2APFA 4G8EA 2OPCA 3A5VA 3CC1A 4TLKA 1UZ6F 2F74B 3FO2B 4TYUA 3NCMA 4AMWA 4DF9A 2W92A 3EHBC 5K39A 4F20A 4NQDA 4K8RL 2BSSA 2NQDA 4E0RA 1Z9PA 1BV8A 4JDEB 3QG7H 4WSJA 2HP4A 2FHFA 3ISYA 1XTLA 1J5IA 3OL2A 5I0DA 3M7FB 2J12B 2LABA 2R27A 4G59C 4JKKA 3OKYA 3E2HC 4NO3B 1ASOA 4PJBF 5D1ZA 3WXWL 5I23A 3N44B 4HOZA 3BZ4B 3GXDA 1K85A 3VUAA 5HYQA 2A73B 4M02A 2DI8A 3MNVB 3KWVA 1E2VA 1M3IA 2W60A 1IAII 1HQ4B 2AJYH 2X05A 5B8CC 1G7LB 5I0VA 2VN4A 3PWPE 4RESB 1X5XA 2QBWA 4NI3A 4POZC 4NOBA 3LQMA 4RNRB 3GS7A 4ZRGA 4Z3HA 1Q0XL 4H1LB 1G9NC 5DUPH 2F7IA 2NYYC 2E46A 2M26A 3MBXL 4JKLA 5IHUL 1CU4H 3RUGB 1I1AC 3FAXA 1UATA 2BNUB 1RZGA 3AG2B 5CWSB 3K6IA 3EG9A 1YY8A 4IOSA 4ZSOA 5EZIL 2C9UA 4M43L 4XBGA 4UINL 1GZHA 1N0XL 3CBJB 3C5ZB 1MF2H 3IJSB 3QO0A 4LCWE 1HS6A 3O3AB 6CGTA 1FFNA 2V2XB 3OXSB 4LASH 1PS3A 3FCGA 4OZHE 2GJ6E 2X6UA 4NJ9H 2NR6A 5GSRA 3TF7C 1NOAA 1N68A 1FIGL 3IDNB 3DPDA 5A6MA 4AYFA 3AG3B 1JIBA 4KTGA 5F6IB 1BMWA 1X5IA 3TCTA 3MLPA 1NANH 2OJEA 1DANU 5I9QC 1P1ZB 3QUXC 2A6DA 1JCVA 4GXFA 4GAFB 5D9SA 4IHOA 1OAKH 3GEWB 4FNSA 4HAKA 4IBQA 5JXEC 3BPOB 3QNXB 4ABUA 3SE3A 4BYHA 3F58H 3OKKB 5KSUA 1CDIA 2IOIA 3LKNB 1HXYB 4LQFL 4TULL 1GZPB 3HNTH 2R0LL 1Q72H 2P5WD 3H0TB 3HAEA 4AEHL 2N59A 4TLTA 2CHDA 4OBSA 5B3SB 4R7XA 1FGVH 3Q8EA 5EBMA 3S96A 2CPUA 1JNNH 1G43A 3BZEB 1JTTA 1GGUA 2WY3B 4JRFA 4I3RH 1CXEA 1TZ8A 1M57B 2PN5A 2Y07H 4WRLA 3EUUA 4GNKB 5CZXC 4YDNA 3GMQA 1TTBA 2FT8A 4JFFD 3UTZB 3LKOB 1DVYA 4IBUA 1DQQA 1BJ1H 2R2BB 2O5XH 4JY4B 5I1DB 2YUXA 5C97A 5E95B 1BAFH 1B3JA 1T1XA 4JG1H 3VWKD 4A67A 2IANE 4HIHA 1XMWA 4ELME 3LV3A 5IFHH 1PG7H 4NT6A 1F13A 1O7SA 4WDIA 3S8FB 3SOBH 4FF9A 3ZHKA 4KAQL 2ICCA 4MXQD 4Z7QF 2K3TA 4FFZA 4BZ1H 5GS3A 3SPJA 2YOCA 1L0YA 3HG1D 5FHBH 1N6UA 3RKPA 2NNCA 5DJDB 1YNLH 2OXGB 4L9DA 1F56A 5IFJB 1LE5A 4YUEH 2NTFB 3ZDXB 5FKAB 4UV4L 4AEIL 4C59B 2Y7MA 3UDWC 2GT9A 5HYJE 1BM3H 2LHAA 1FC2D 4ZD3H 1YJDL 1I3GL 2FECL 2ICEC 2J21A 5KS9E 3B8YA 5F93C 3BW9B 1TVBA 4PJAF 1SMOA 3KPSB 1K8DA 2MCG1 5AYUL 1DFBL 1DVXA 3A6BH 5I18H 1KULA 4KROB 3T77B 1O6SA 4Z7OB 2FUQA 3KVQA 1SJEA 2X6MA 4DN4L 3VFWA 1NPUA 4XCYB 1VGEH 2J1ZA 5LWYH 3Q05A 1F8TH 2A7BA 4EI6B 1RZFH 5I71C 1U4EA 3U30B 3GBDA 3FT3B 3EOTL 3NCBB 5E6RB 5D7HA 4BZ2L 2XKNB 4OZIF 3TJEH 2FEDD 4RGOH 3B9KD 4G6AC 4L29A 1YN7A 1BVKB 5HHVL 4MBOA 1FP5A 5HJ3A 1M71A 5C0ND 4L8CB 4BE5A 4XBMA 2FX7H 1T5XB 2XQBH 3SD2A 1SUHA 3ZDYE 5FHAL 3U1SH 2WB7A 1U8CB 1NIEA 3VRIA 5KYYA 1X7QA 1FF5A 1F3JA 1OXYA 4WTXA 3D0VA 2F08A 3VG0H 3BDBA 1XCWA 4LSSH 4M7LL 2Y36H 3S4SG 3QZLA 2OTPA 3H9ZA 1LP9B 5JORB 5GS2H 2QSVA 5DZPA 4FQLH 5I8KL 5CMAB 1QWNA 4PJDB 3WTXA 3BSHA 4WKZB 1P5UA 3EJYD 4BSWB 3CSYB 4ES8A 5AYQA 5IMMA 5J1SC 5C09D 3CHQA 4HF5H 2ZCKL 4HA1A 3TBYA 4XMVA 1UQSB 5D7JA 3QPXH 1VACA 2Z8SA 5JIMA 1UM6L 3S5LB 4Q9CA 4G70B 1D7DA 3EGXA 4PGDB 5C0DA 5MEOB 3DBXB 1OAJA 2BVOA 1MAMH 4O4YH 3ORJA 3HMXL 1F4WH 2I5YL 3DIFA 3X17A 2EADA 3SKJH 4Q56A 1QTYT 4DVBA 4G7QB 1ZA3A 4PD4J 1IFGA 4U7MA 1OCRB 2L7JA 3OR7A 3EW3B 3IDYC 3RWGA 1U41A 3RZCB 3ASNB 4BH8A 5IHZA 2VERA 2G30A 2YBRB 1P7BA 1WCBA 4KY2A 3ARZA 3BWSA 2W95A 3LD8C 5KZCB 3P0YH 3VD4A 2OK0H 5IK3A 2VO5A 4ANWA 4ABVA 1BLIA 4ZPVA 1K72A 3K6FA 2OSWA 1KXQE 4PMEA 1LEGA 4LLYB 3B2PA 3RURA 1H3XA 5LXGL 4RH4A 4R2GD 3Q06A 2NY2B 5DCCA 4JVWA 4XH2A 3EO9L 3MUY1 5D1XA 1JXGA 1ZIAA 3V9EA 4ONGL 2XN0A 3BMWA 3L54A 4CBPA 4M6MH 5JHLH 4JR9L 3JVGA 3HI6H 4JB9H 5AOZA 4HD9A 5SWZD 3QS3A 5DD1L 1OGAA 4M56A 1H3UA 1CQKA 1A65A 3ZYIA 1S7WB 4W4NA 1KENH 1H5BB 3KXFD 4E41E 4KRPB 1AXTL 1S78C 1A3LH 1KACB 1N3NB 3DUSA 3ML9A 5DVMA 5FV1L 5MI0B 3BT2L 4OCSL 5D72L 3DX6B 4PLJC 5FDWB 1IV8A 2ZX5A 4IRSB 4P9MH 1FORL 1XSOA 1R1CA 3EGSA 5DFTA 3D12B 3W39A 4JRXE 4PJ8C 5AKRA 3LQZB 1T80A 1UD5A 4JM0A 1OM3L 1XCTB 3NH7H 1IGJB 2MHAA 3IM1A 1GXEA 2JB6B 3UBXB 2P44B 2YMOA 2A9AA 4HS6B 4UT9H 1J9CT 3FO0H 1YHPA 4F8TA 4LNVA 4L1TA 1NAML 5C9JB 5L88L 1O7VA 3QCVL 4YBLC 2BZCA 1LDPH 2W9LA 1RL1A 1NCBL 5F1OB 4G6KH 2NNRA 4HK3J 4L9LC 3D50A 5GZOC 1VERA 3U6RA 1VFBB 3TF4A 3II3A 2IPKA 4KKQA 5JUEL 3RG1C 1DQIA 3SDXE 1H3TA 1JYXA 4PY7B 2AXGB 4X6FA 3TN0C 3X3GL 2X7LA 5TE4H 5DJ6B 1XH0A 2AZAA 4APQD 1D5BA 4RDQG 5D8JH 5KYNA 5B38B 3HI1B 1L0PA 1H19A 1LJMA 1XR9B 2OTWB 3FTSA 3SGEH 5I15L 1REIA 5JMOC 3ME0B 1KTLA 3T6QC 4NRXA 5SWSE 3VXSB 4ZMXA 4M7ZB 2TRYA 4PBDA 3ZBMA 5GXBB 4WENB 3QUKA 1J05A 3GJFK 5TGBA 1ECYA 1N0LB 4DAGH 2VJ8A 4G8GE 1PAMA 3NIDB 3GMOB 1EEQA 3ZL4L 4U3XA 1KEMH 3BDXA 4DGIL 2WVTA 2XA3A 2H6OA 1E0OB 1CDYA 1U8MA 4JHBA 3GRWH 4S0TD 4OGXL 1KIQB 4NQEE 4N0FB 4P59H 4XXDB 4JZNB 2EZ0D 1UFGA 1VIWA 2XC8A 4R7NA 4EDXB 2Z3FA 2ZCLH 1DLHA 3PXLA 1UWXK 3TO2B 1CVSC 4U1NB 4EI5D 1FI8C 3UTTA 1QWHA 4E9XA 1OQXA 1IUZA 4ZXBB 2QQLH 4Y9BA 1MPAH 1DVFB 4ES9A 1AQMA 3UO8B 2WWKT 4GG8A 5IF0B 2GEEA 2NCEA 2NYKA 3BKJH 5LB1A 2XZQH 3KPOB 4Y1SA 4KNUA 4V1DE 3ARDC 3RIFF 4CILA 4AMKH 2LR4A 3BQUC 1G7QA 3VTAA 2Y5TB 2CRIA 1N5YH 2WLHA 3QZWG 3SQRA 4CGTA 3GPSA 4YFLF 2ZUWA 4OLYH 3O0RH 4WEUD 3KPTA 1S7QB 2RJMA 2F58L 3NJVA 3I9PA 3HRZC 5KUMA 4OJCA 3WIHL 5LNEA 3BCFA 2WLJA 1XHHA 4H40A 2V17H 2R39A 1KXVA 2EDMA 3QDJE 4KKLC 1RJLB 3CBRA 2HVJA 3SHSA 3IETB 4R0LC 3V5KB 2NUTA 3L3OA 4L5FH 3PWVB 2BY3A 4P4RA 4LP5A 4P3CH 5E00B 5AOKA 2XWJB 5DHVB 4JRYE 3KMDA 3X11A 4KO5A 4DO4A 1ZCRA 4YPGA 4PGCB 3PWJB 5E2WL 5BZWA 3FU7A 5I73B 3E6HA 1XGTA 3Q3GA 2ZPKH 4GW5B 2WQ8A 1GW6A 4XT1C 5A3ID 1UD2A 1VKXA 1FFRA 4IBYA 3LEVH 2BWDA 2C1PB 3D4ZA 3GMNA 4M5TA 5IOPB 2FJFA 4XRCA 1OAQL 1PDKA 1U8KA 3Q13A 4PP2B 4HCRH 1SY6A 2CGYA 3HC4H 4PJXB 4WWPA 5DUJA 15C8L 4KDTC 4KVCL 5C9KA 1AFVL 4AYSA 1FBIL 1QHOA 1T04A 5CS7A 1ZHNA 1FIEA 2NY4C 4AQAB 4OAWA 1CXIA 1KJ2A 2WVVB 4MYPA 5ECGA 2BNQB 1KYAA 3IWUA 1NFIB 2WZ6A 3CZSA 4AENB 4AIZB 1JHLL 4TQPA 5FYLD 4NZUH 5LBSA 1B88A 2D3LA 4PRDA 4KJWC 3NFNA 2KBGA 3OZ9L 2AGJL 3RWIA 4J3XA 1Z1WA 4CVXB 3FQNB 4NQVB 3WJJA 1Q9KA 4K8RC 4QRRE 3V4VA 3CBKB 2JLPA 4J5VA 1XGYH 4BFGA 3F04A 3VFNA 2Z7YA 4JDTH 5F1IA 3HE7D 2G60H 2JJWA 4QXUH 4Y1AE 2O93L 2PPEA 1CYXA 4OFYA 5EWIL 3FSVA 1H8OA 1ZVYA 4KDWA 4ZS7L 2EIZA 4P5TC 2CQVA 2XHNA 2NDGA 1R24B 1SHXA 1U8NA 3BWAB 1J0JA 1U8IB 2MTPA 3ARFA 4DEWA 4MX7B 3O6FC 5AW1B 4LLUB 4YLQT 4EIZC 1MCPH 4URKA 3HNVL 1AMYA 1BGXH 1N2RB 4XN8A 5HPOA 3V79C 3B9EA 4Y19D 5TJWK 2XTLA 3LSOA 1PAZA 2I26N 3MNWA 2AEQH 1OSZB 2OX5B 4V33A 2C3WA 1F6AA 2FQGA 3U0PB 1RZQA 2PTUA 3WIIH 1WFIA 1WISA 3MOBL 1WPCA 1UXSB 4K55A 4XPFH 1UM5L 1A6UL 2EDDA 1BZQK 4O9HL 3BZFA 3WO4C 3V6FB 3QFJB 1GOHA 1MAJA 4NC0B 2OFQA 1X5ZA 5HGBA 3HUJB 4XOEA 4YWGL 4M9PA 2X1QA 5BS0E 5ISZB 5K1JA 3HZ3A 1LEKA 1HSBB 4ILDA 4PJFB 2VXVL 3EJZD 2ZUYA 4WHYG 2ICWB 1SXZA 4LCCA 2UXTA 1PY0A 4NKOA 1N64L 2H1PL 1QKZL 4HUMB 3RYMA 1XIWD 4OV6F 4GAYB 5DMIL 3MRLA 1WHPA 1AO7B 1QBAA 3TVMC 3PGCA 3D06A 1MQKH 1UXWB 4OY9A 3VFPA 4M8RA 4P4KD 3BGMB 4W9IC 4E36A 1ACYH 3HS0C 3R7QA 1S5HB 2VC2B 1D9KA 1NCDH 2AZUA 5I74C 4UAHA 5DGRA 3UJIL 5CKAA 1E4KC 5IM7B 3VI4A 3O6KH 2WO4A 3OKOA 2OR7A 2DW5A 3GSNA 5AAMA 1YEHL 3SZ6A 3DX2A 5FK9B 3L3JA 2WQAA 4Y5VC 1AHWA 5EZOH 4ZO8A 3AREA 3SQBA 2N01B 4EIGB 2P7TB 4U3SA 1OP5H 1LQSR 3WFDH 1BZ9A 4B3EA 4N6QA 3ZTDC 4NN6C 1OE2A 2FWOA 1UACL 4HIEB 1QSEA 2DBLH 3ZGHA 2W5PA 1GJWA 5SX5H 3J7HA 3MUGB 4HMEA 2VW4A 2B1AH 2JKRM 3CU1A 3RI5K 5DJ2A 4PIRF 5JHDD 4M8VA 1I7UB 4UM8B 1YRKA 2YXMA 3NJLA 3T9WA 5C0AB 3LH2L 2OZ4L 1S3RA 2OSLA 4ORGB 3N85L 1R5VA 1Y1DA 1S7RA 2QKIA 3WEAA 4JO1L 4F7TB 5CEZL 2HLAB 1U42A 5T5NF 4E42B 5DRWB 5IP4A 1H3WM 5D5ME 1R5WB 2P80A 2Z93B 3V6ZB 3VFOA 2GVYA 5J12B 5EDXA 3DSFH 4F7CB 3DVIA 3WUWA 1R3HB 1SLWA 4NO0B 1JOIA 1YJDC 3QWQB 5FKPB 2GTWA 3PG2A 4WUUE 5D7IB 1MAKA 4WK0B 4ZX3A 2VLRD 4HWZB 5DJXA 1VB9A 1NBZB 3L95A 4H4NA 4HUKB 1OK0A 4G1MB 2H3NA 4DOHB 2HLFC 3FRPA 3OHXB 3VFUB 1PU0A 2VR4A 4N0UA 4XP6H 2XBDA 3WHXB 2IMNA 5I1IH 3MBEB 4B53A 3GDCA 4I18A 4XXCC 1INDH 5MEPB 1S46A 4QHPA 4Z0XB 3W82A 5DZNA 3N43F 2V7NB 2I27N 1X9LA 5BO0D 3ATDA 1LWRA 3S0PA 3MAWA 1NFDB 3MACL 2O6CA 3LZNA 5J5EA 2MKLC 4RLDA 5F89B 1R9FA 1BZ7A 3RDTC 3BPCB 3W1ZA 4X4YA 1U92A 3FT4A 3GNML 4IK7A 5ENWB 3W9DB 4M48H 1HCFX 3LOWA 1HH9B 4PRIB 3VSTA 1KB5H 4GQZA 4AMXA 4HWEL 1YNTA 2X4SA 3GJFA 3CQFA 1AKJB 3H9SD 3MV9E 4WFGE 1ZHLB 2A6JA 3NIGF 1YMMB 4OZGE 4QHUB 3MV8E 4DFHA 4LKXB 4O2FB 2WP3T 1GYVA 5C07A 4ALAH 3AXHA 5I8OL 4Z18A 2H7WA 2TAAA 3APMA 1G9MH 3CCHB 4MA1C 2ZOLA 2ZXEB 1Z2KA 5E2VH 4Z8FL 3O8XB 3KWWA 2D2CC 3CSFA 1CT8B 3ZKMC 1KCLA 5J9PB 5K9OA 4DH2A 2NY7L 4CDHA 5FLVA 1NM9A 2A1WH 1JPEA 5I1JL 3VQ1C 5F97E 4AK1A 1ILUA 1AQHA 3ZE1E 2FNBA 2YGPA 3T4AA 3DX8B 1W91A 2AV1B 1GAFL 4WY7H 2YPLE 1OCWL 4GRMA 4HKJA 4NAQA 4W93A 3GHBL 2WSPA 3MGTB 3WDIA 1XCQA 4N1HB 2ED8A 3ESUF 5I5JA 2W9DH 1F42A 3QBTB 3D3VA 3GS0A 3PLYA 1B0WA 4OQTL 1CXFA 3HS8A 1JVKA 1CBJA 3QIUA 4W9CC 1A9VA 4PV9B 4HSQA 5GGSY 3ZHLA 4B9JA 5KVGE 4JFEB 4YDIL 2V9UA 3U6XA 4PV1C 3FF7A 3Q6FA 4QUOA 3IPBA 3C8KB 3LN4A 4QLWA 5HD8D 3LH9A 4ZQTA 3HLKA 5EZLA 2VUKA 2WWNA 4IRZH 1FL3A 2N0MA 2DDQH 2Q8AH 2ARJQ 4KOCA 1NLBH 3KJ6L 3SGJC 4ZAKB 5F0PB 2F7OA 4P2QB 2V8LA 2H26B 3MLTB 4BSVB 3PGDA 1TU2A 2WUBL 1A1NA 4NZDA 5IFAL 5KVDH 3K6SA 3BUYA 5DDHA 2IPTH 2UX6A 5E6ID 2RACA 4U0RB 2G3XA 3HLAB 4WVRA 3OSVA 4S2SB 4XMTA 4JFZL 3KPMA 3PDDA 2UXVA 2KERA 4TUUA 3QXUA 3F12A 1E43A 2CK0L 5C0CA 1CFQB 2GG1A 4N0YH 3V5HB 3H55A 2EYRB 3LTVA 2J8UA 1P2CA 4FQJH 2AXHA 4BDVB 3FB5A 4Q6IC 4ZPTB 1OGTA 4KK9D 1SQMA 3BP5B 1M4KA 3TNNA 4NRYA 5DQDH 5GZNA 1JZ5A 1CDBA 1EJOH 5CN2A 4OT1L 4MZRA 5E5MB 4TVPE 2AJVL 2Y23A 3MBWB 2EDEA 4CMMB 2FECI 3L2LA 4OLXL 1KMGA 2K45A 3RAJL 1JSYA 4ZMYA 3R4RA 3NVQA 3D39A 3MLVL 3MRBA 4MVBD 3O2VH 3TA3C 1XB3A 3MCLH 4IIQC 4OVUA 4UDUA 3F7YA 4YHLL 1HN1A 3PIQA 4N2CA 1FVCA 2K4AA 3BP4B 4O51A 4E5XA 2PW2B 2FJGB 2UUDH 3VFMA 1BPLB 4IGBD 4APXA 5DA4A 3HG2A 3P4LA 4QJ4B 2E8ZA 4JREC 2WB1A 2F1BA 3S5ZA 1Y6MR 4Y2DB 3I75A 1J8HB 2ETWA 1ZSDA 3JV6B 4PJGE 4FKEA 3BRFA 1QR1B 1OZTG 1R19A 4LNRA 4Y4FD 5JZ7D 4L3EA 4C8XA 1E4HA 4ZQKA 2BOBA 5KVEL 1HK6A 4Y4HD 3HIZA 3DXAA 1K2DA 1UOVA 2FSEB 4Z7QB 1PZCA 3KLKA 5ICZB 4NUMA 4ZUTB 3RL1B 3L9RB 1KCUH 1EVUA 2DIBA 3QJHB 4K23L 3IDUA 4LKCA 3PF2A 2OMXB 5EO9B 1LXMA 2DQEH 2F19H 5DJ0B 3PDOB 3MYJB 4FHKA 1F90L 3GGWA 2OQJB 4WNQA 3K8MA 2H2PC 1KIUB 3PWUA 4UIKH 3H7BB 1FDLL 3IMRA 5KBMA 3GSQB 5DF0A 2W0LA 5HHMB 2EH7L 1E3ZA 1A5FH 1YDPA 4GUPB 3US0A 3QDMD 3VGFA 3C2SA 3T65A 1AS8A 3H4FA 1UKSA 1IZKA 2V9TA 3RHWK 3K2UH 2R8SH 5MEND 4N0CD 4QHNB 1GS6X 3VI4F 4GS7B 2G0KA 2W59A 1MELA 3E0GA 3QPQC 3NJMA 2ERJB 2PO6D 4KMTH 4M00A 5D1QC 4LVOC 5ILTL 2VUOA 4RGNE 3G5ZB 1OSEA 5JIKA 5FFLA 5TPWL 2YGNA 4NQCA 1QFWH 2N1KA 3WEBA 1MWOA 3BD4A 3Q8FA 4JZOA 6PCYA 4OZIB 1P1VA 3IEAA 2BY2A 3H42H 2ZT9C 3L5XH 4P57A 2PR4H 5F1SA 2E6JA 2JJUA 3O2DL 3QEGH 3QRFM 4DGWC 1K4DA 1UWYA 1UZ8A 1V7ML 2Y22A 2YUVA 3HB3C 1H3VA 3A6CH 4G3YH 4Z7UF 5BZDA 4UILL 4IRSC 5D7LD 1V5JA 4XAKD 1SN0A 4ZTPH 3CK0H 3TASA 3DO7B 1VJSA 2E9GA 3VJ6A 2F54B 5D2NC 2VWEE 4JAMB 4MCZB 1H3PL 2DLGA 3WN5C 4P2OD 4NWUL 2ZICA 1COBA 1JMXA 3EFFB 3N9GL 2CPCA 3QUZA 3V6OE 3LVEA 2B20A 2H3XC 5T33L 2LTQB 4QJ3B 5CJXC 4B9ZA 1E28A 4I2XE 4RQQB 4XN5A 3PUUA 5DD0L 4BQ9A 5E6ZA 5JDSB 3GB7B 4GPVA 3M17A 4YHPB 5TQ2L 4XNMB 3GLZA 2UY6A 3HR5A 1KPRB 5LDSA 1QMUA 4TRPH 3WNNA 3PV6B 3DV4B 1CZ8H 1NC4D 3CFUA 1UJ3B 5AOLA 4LLDA 5J11B 1DBAL 3G9AB 4XPTL 4X7SL 2JWYA 2CBQA 3BPLB 1XTMA 5IEHB 5F9WB 1HQRA 1MI5B 3FTVA 4V1DD 1E50A 4U6XA 5CZVL 2HG5A 1AD9A 4X5XA 4KXZI 3EBHA 4HC1H 2WCPA 2V2WA 3MLSL 3TZVA 1DVTA 3VXUE 1YNTF 3FJTA 1J12A 5DD3H 1FYTD 1HHGB 3UP6A 3B2VL 4KKAD 2YPKA 2ZWZA 3COOA 3TCLA 3K72B 1CG9A 5HHOE 4MZ2A 3MXVH 3UXFA 4KK8D 5FYKE 2NMSA 2EYTA 3Q5OA 4JFDB 1NMAH 4GIPD 3GPEA 2ZNXA 5BVPH 3T0EA 1QSFE 2IOOA 43CAA 5DEFB 3O9WB 4ZFOB 4G8EB 5I30L 2EIJB 2E9BA 3HPJB 3AS1A 1EZVY 3E8UH 4FXGA 4DEPB 5F96L 1U3ZA 2ZIDA 2P8LA 4OGAC 5D2LE 2HKHH 4M4RA 1KELH 1KLFB 3D2UA 4NQDB 4R7VA 2NZ9C 5D4HA 5K39B 3HE6D 4Z3FA 2NY6D 3LNIA 4Y89A 2FATL 2D73A 1IBHA 3BVNB 4LAJH 4QYOA 5AVVB 4E0RB 4KV5F 1GYAA 4RZCA 3OMNB 4N8VB 3WDJA 2X4TB 2O26U 2DQMA 3SKNB 4OSUL 1QI5A 1UH3A 1XB8A 4AT6A 4F2FA 4IDJH 3A4AA 5DHEA 3GSRB 1QP1A 4J6RL 3LXCA 4NI6A 2PWEA 1USQA 5SV3A 3RTQC 3GSNH 1P4BL 5A7BA 3ARBB 3QULA 1WBYB 4NFBA 3UTQA 4F57L 2DYPA 4Z95H 4XBEL 5HYQB 1Z0NA 5C0EB 2OULB 4J3OF 1XF3B 3GM8A 3HI5H 1QFOA 2VTFA 2D7QA 1YAIA 1VZHA 2XXMB 3QWNA 4MMXC 3JV5A 1OB1A 3J2PA 4MSWA 1M2OA 5IV2A 1OTSD 2AQTA 3E6FA 2V5SA 3IFPA 2IG2L 3S4SA 4QRTA 5FEBA 3DIDA 2YAMA 1BP3B 4MD4A 4PWKA 4L1LA 3MRGA 4F8LA 3UAJA 1LK3H 3TWCL 1C1EL 5FUCE 3C60D 1MCFA 1WIPA 2A77L 2J44A 2CDGA 2EIBA 3IDXL 3LHPH 3RGVD 1XEDA 2OP4L 1UVQB 1QPXA 1EXHA 2NY0C 1FFNB 1R4XA 1LO2L 2B2XH 1B90A 2EUVA 5GSRB 2FX9L 2I9LB 3GHPA 1OARL 4HJJH 5E8NB 3SBWA 5EOTA 4AYFB 5AZUA 1IM3B 3GRBA 4LBEA 3D85D 3PWPA 4OKVB 1T6WA 4JKWA 2OJEB 3OLEA 4JQIL 4TPRL 2BDNH 4AUUA 5I0XA 2A6DB 1ET7A 3LCYA 4GSDH 3JUYA 3P0VL 2GY5A 3JZYA 3ZSSA 3UBXI 3WNOA 2GJJA 1TVDA 5KSUB 1OP5K 3F6LA 3REVA 2GITA 4AK2A 1QZ1A 1AP2B 1YYLH 3HAEB 1WTLA 4H8PA 4FNTA 5TE6L 5JOEA 2AAAA 4LCWA 3U36A 1KCVH 1BZEA 3I3BA 3S96B 5FYJU 1X6NA 4XCCH 3B5HA 5JPMC 4OZHA 2GJ6A 1P5VB 4M6NH 3NDYE 2P47B 3L5WA 3L3IA 4HS8L 5T1MA 3LPOA 5E56A 4N26A 3UBFA 5T1LB 1FLRH 5GRJL 1HHJB 4V2CB 4GSQA 2VT0A 4R4NC 4KXCA 3EHBD 4MQTB 4ZTOH 3GMQB 5FUOL 3D48R 4P5KA 4WV1B 3FK3A 4FQ1L 1G6RL 2YMXL 4MKMA 2TSAA 4WF7A 1NCCL 4ZFOL 1IIKA 2IXQA 3C08H 4N28A 4BRJA 2HKFH 5TF1L 2MQ3A 2YZ8A 3LZPA 4GXVL 4LCUA 1YQVH 1T0NB 5I1AB 4HV8A 3VQ2C 2BM3A 5DYFA 1UYWL 3LV3B 3LKRB 4CN4A 5FCUL 1FH2A 2H0FA 2WSDA 4M1DL 3D7PA 4ZFQA 4Z0BH 4DGVH 4PI2A 2XNAB 2YD7A 4JFOA 5KBLA 1VLXA 5AUMA 1S9WB 1S4IA 1C12B 4ERSH 1U2HA 4POZD 1G1OA 2PCPB 5TQ0L 1LE5B 1A0QH 3C6LD 5IROC 3NSDA 3OF6D 4DKEL 1ZEAH 2FX8H 2VDNB 4TNEA 5FO9A 4EI0A 2WTPA 1I1AD 2CR3A 1RZ7H 3V0WL 1B4JL 2XRAH 3V52H 1TVBB 1KYOJ 2VW7A 5FB8A 5GS0D 2GI0A 2IANA 4U7SA 4ELMA 4WGVB 5JR1L 2A6IA 3MJ8A 3QQ9C 5IVXE 2A6KA 3SKUD 1Q1PA 4MXVF 4X0NA 4MQSB 3OC5A 3WMQA 4RX4D 3C12A 3I50H 4QWWC 1ORSB 2MH4A 1O6SB 3BKMH 2UZPA 3FKUS 4TNVF 4YXLL 2CLRB 4P2YA 4LPUA 3VFWB 2CGRH 1ONQB 4NKIL 4S1RH 4WUUD 1T3FA 4F9LC 3QUXD 3WL9B 4DWHA 1ID2A 3OGOE 1L6XA 3K6DA 4X5LA 3RP1A 5HYJA 3II1A 1N67A 4NKMA 1JGDA 2EACA 2XXGA 3CZJA 1LD9B 3LIZA 2H8PA 4Y9EA 3TO4D 4FEIA 5KS9A 1UOKA 1DYZA 5ALBL 3RI5F 5M7QA 1RURL 2VLLA 2NY1B 1MRDH 3WFEL 5GGVH 4EF3A 2VMDA 2QR0B 4GMSL 1MFAL 5JMRA 4MCYA 4PG9A 3RVVC 4G6FB 3DMMB 3MFFB 2LAAA 5KYYB 2Z65C 1X7QB 3RX8A 1F3JB 3FQTB 4O02H 9CGTA 3CDGA 1B0GA 1BBDH 2EDRA 3BWUF 2CMRH 1ES0A 1EEYA 2KZKA 4NKQB 3ISWA 1JGUL 4R4BA 4Z3EA 3SDCC 3WO3B 5M95B 1BZDA 1IKNC 3MBEC 3QZWA 4TKWA 1BQSA 1BXXA 5IMMB 1KNOA 4MJ5A 4HOMA 4QIRA 4U6YA 1KTKE 2AJ3A 4N1EA 5B4MD 4GO6B 5KAQG 3ZDZF 1HE8A 5FO7B 2EDWA 3QR2A 3EJTA 4G7YH 3P11L 5F44A 4JCWA 3VFSB 4KQ0A 1DBMH 3DIFB 4AW4A 3Q6GH 4LHUG 4CC4A 2G3MA 4PCYA 3EOAA 5CNHA 1UA7A 2WQWA 1EXUB 2NT1A 3DYPA 4FFZL 4IBTA 3C5SA 4IOFC 4Z3IA 2JKNA 1D5IL 2LQRA 1XBDA 3S35L 2RD0A 4BH8B 2JELH 2NNAA 3SYAA 2R56L 5B39G 4XTRC 2A74A 3IS1X 4QKTA 1BG1A 1WCBB 4BELD 4IRJC 1S7VA 2CE6A 4CU7A 2MOVA 3NPZB 4KWUA 4D9LL 4NZTH 2B1HL 4WNJA 5FWQA 3HPLB 3SCMB 3BC9A 4ANKA 4PS7A 5CM1A 3FO1A 4MJ6B 4AM0A 3QCTL 4I5BA 1MFBL 1GC1H 1I9RL 2CD0A 2WBJB 4AQ1C 4F27A 3RFZC 5F70A 1GH7A 3EH4B 4YK4B 5E8EA 1TZGH 1XF1A 2IAMC 2K70A 3B7UX 1HCVA 5DR5H 4XH2B 1NGZA 5D1XB 2NQCA 3MVSA 4ZMTA 4BFJA 3ZDXE 2C8NA 5E1GA 4D9RD 3QRLA 3NN8A 4Y4FA 5F7KC 1OGAB 1A3QA 4HXAL 4YL4A 2DQFA 4ODTH 1TZIB 3WKMH 2PP7A 3FHQA 4GQRA 3IPFA 4G6AD 3APDA 3CFKA 2UUDK 3EF7A 2Z31C 2RB8A 3N06B 4G9FB 4C83A 3QIWA 2R0WL 1QBMH 3D25A 4LSUL 4NRZA 1ZOXA 1SMDA 5FXCH 2ITDA 2AK1L 1KXQA 3MX0B 2FLRT 4J1UA 5GGTA 2EVIA 3STZA 1EJ6A 1HI6B 5CN1A 3UYOD 1A6TA 1BZ8A 1B6UA 4YHOL 3VXTA 4B97A 1I7RB 4Z7OE 4JY5H 2JH2A 2QSCL 3AITA 3KDMA 3RX9A 3UO1L 5KYWA 4JM2B 4BFIA 4ZO7A 5C3IA 1IAOB 3TONA 4NQXB 3D4YA 4Z3GA 3ROOB 1RIVH 1TFHA 4ZAKC 1NUNB 3WFHB 4WWID 4B9IA 1I8MB 5CJOL 3MUHL 3SDYH 1CGYA 2BCMA 4I7ZC 2VW6A 3ZR6A 4E41A 1L0XA 3SDDA 5K59E 4KMQA 1KXHA 4R5TA 4U0RC 1T1ZB 2BVPA 4D3CL 4X7CC 5DT1H 1UD3A 3BHBA 4U1IA 1J5DA 3U6RB 3K6OA 2IPKB 3KPLA 3SPCA 4JRXA 3PFUA 4FXLA 4Q8BA 4GI9A 3GXTA 4JPIA 4CC1A 5E03A 2DQTL 3DSNA 5I6OA 5C0FB 2PO6A 5DWUH 3R19A 3VX0A 4C58B 2FIKA 3MLUH 1L5GB 3TIEB 4Y16A 3QUKB 1SOXA 3Q2NA 2JI3A 2XVBA 1LP9E 1XAKA 5TGBB 4K3EH 1F6FB 1G7HA 5JPNC 3EYSL 4N68A 5GHWL 4PJDE 2WLYA 5F3HA 4AITA 4X6EA 1MCQA 1U36A 4RFOH 3GHEH 1Z9SB 2IADA 2N1TE 4FJYA 4K2UH 4XXWC 2JTYA 2B15A 4XO9A 1UCTA 3SDXA 4RMRA 3UTSD 3CXDH 1SVBA 3OAWA 4R7NB 3MV7D 1MWAA 3OZKA 2RMNA 4KKNA 3UTTB 5BW7C 4CMHC 3VGBA 1CIDA 3CVHB 1SZNA 2WYIA 3KBPA 4N2MA 1LO3L 1QPPA 2VRQA 4U1KB 2YGQA 3WLBB 3P3UA 4N6RA 4MNQB 5SWSA 4L1BA 2A38A 1E9OB 5FYLH 4YSDA 1N6VA 2CJUH 4Y2DC 4MAUH 2QL1A 3KYKH 5I1HL 5I2IB 3MODH 4HWBH 5I6MA 2WGXA 2R1YA 4OZHF 4G8GA 1FL5B 5ESAA 5KVFL 5IJKA 1S78D 1U21A 1U3NA 3W56A 4OM1H 5CBAA 1UKTA 4ZTEA 1A3RH 5LAXB 5E5UB 5EO1A 2NX5E 4QOKD 4PLJD 4HBQA 5JIQA 1E6JH 2IWEA 3T1WA 5A2JH 1BFOA 4NQEA 1NFKA 3KM2A 2ADGA 4QRQA 4PJ8D 3GTVA 1PCXA 4ODSH 1MOEA 2VL5B 1A9BA 1AQDA 4HFUH 3HTLX 4P4RB 3IKCA 1GS8A 5KTEH 1RY7B 3QORA 3X11B 4B96A 1AQKL 1T0PB 4XC1L 4YPGB 4PCTA 3FU7B 5BZWB 3E6HB 3DYOA 3ROLA 1UC6A 4KI5E 4QT5A 3Q3GB 4QR7A 3PABA 2G2RA 4JO2H 1X4YA 4V1DA 3SJVB 5J0BA 1V55B 2Z34A 3ZJAA 3GMNB 1ET8A 1HCYA 4TUKL 1NC2D 2J1XA 1ZK5A 2YK1L 5E4AA 5GZOD 4QPEA 2WKOA 4GBXD 1KYUA 4GRLB 3POCA 4OLVL 4OI8A 2B39A 1ZHNB 3V4PH 5B3JE 5C2BH 1KJ2B 1U8OB 5A7EA 1Q1JL 4OLUH 2B8OT 4JFWA 3QDJA 3DX3A 4X7DC 4M5YH 4N90D 3E7JA 4OCRH 2J88H 2B16A 3FSWA 1FE8H 4R97B 2AXFA 3PHQB 3KLAA 4PRDB 3NFNB 3RHWF 4ELMF 2ERJC 3BUBA 4JRYA 1WVZA 3Q9QA 3DIVA 2XVLA 3KHQA 4C56D 1BXVA 2IDFA 3GSOB 1QBLL 3WIFB 5A2IH 3B7TA 4WWKC 3V4VB 4B0MM 3BIBX 4RDQF 4I1PA 2IH3A 4UNTA 2YARA 1BVNP 3FFCB 3PXJA 1NGXA 4LARL 4R96A 1CICB 1N8ZA 1ESOA 3M45A 4K71C 4OCXH 3HMWL 3MQIA 1V7NH 4KI1A 2EIZB 2FJSA 4L05A 4X80L 4NCC2 2EH8L 2NLJB 4X9FA 3AXLA 3D0LB 5KS9F 2GK2A 4DKFL 1SDAB 3LNDA 3MJGX 2DMGA 3VXSE 3LSOB 2BHFA 5HGAA 4OV5B 1K8IA 1ADQA 1F6AB 3WJMA 1FZOB 2ZJSL 4JO4L 2R0ZH 4QRRA 5BOPA 2SEBA 3ARDD 3CVHL 3VXNA 4R3SA 1T2XA 4L8BA 2NTSP 2LTQC 3BQUD 5L2JA 2Q8BL 1UM4H 1OOWA 1U93A 2VN5A 1ZLSH 3BZFB 4F93B 4Y1AA 1I3RB 2VDMH 3DC0A 5CR1A 5ERWA 4K94L 3IGKA 3JZ7A 1S5IH 3ZGIA 2GJPA 1IQWL 3K1KC 2WXLA 5F7NC 1QLEB 3CC5A 5CCKL 2Z4TA 1LEKB 4KKLD 3VXMB 2MCAA 1VESA 2KC0A 1SM3L 2F5BL 4K73A 3QFDA 5FYJD 4NKOB 1YEWA 2WOBA 2X42A 4TSBL 4G7VL 5DC2A 1IC7L 4XP4L 5FS5A 3U1PA 3ZLQC 2B4CH 3MRLB 3LZQA 1KN2L 4AE1A 5J11C 3W0WB 1E9PA 4WO4B 1WS8A 3WFZA 3PGCB 2A4EA 1IGMH 1SHMA 3ZDYF 1CFSA 2FK9A 5T3ZE 1QATA 2FEEI 4NNYA 2HFEB 3FFOA 2VQUA 5BRPA 3S88L 1LK2A 4ZUUA 1NDGB 3CN1A 5HDQL 1ZJAA 2R0KH 2DMBA 4OZFG 4B6ZA 3VI4B 1MLBB 1R3LB 3CLFL 2CO7B 5BS0A 1SEQL 5DHMC 2VITA 1PTZA 4XVTL 1U95A 3JBG7 2Q6WB 1ZANL 1FCGA 3FZUD 4GO8A 3I2CH 4JGMA 5I5IA 1K5WA 1KCKA 3AREB 2FEJA 4KJWD 1H15A 4OCNC 4YDLC 1SY6L 3FS9A 3GQFA 4OFVA 4I0PD 3EJQA 1BZ9B 1RZJH 3CUPB 3FPXA 7FABH 2DQGH 2FWOB 2KZBA 3BDYL 4K8RD 5ALCH 1KJ2L 5CBEA 3TV3L 4F9PA 2B3RA 2H4EA 3NFPA 1SDDA 2XV0A 5CJQH 2J4WH 2XG4B 4LU5H 1UA6L 4JMXA 5LBSL 3CFIC 2AV7B 3OG4B 4Z7UB 3QH3A 4PHZA 4RMVA 5B1JA 3JTSA 4JANA 2A9MH 1SN2A 2DKMA 2CNZA 1L9PA 1KGJA 3GIZH 1YQ2A 4P5TD 5AW3B 3V4VL 4ELKA 5FM5O 2OSLB 2YSSB 4GQ9H 4L37A 4FQ2H 1R5VB 1H8SA 4U3HA 5CD3B 3O6FD 5EC1A 1OE1A 2BNQE 3S5LG 5L7XL 1Z7JA 2KQMA 3WFCH 1AGEA 1DO6A 3X3FH 4NZJA 1HYSC 1JL8A 5D1ZC 4AXWB 1E7VA 4OGYH 1SDYA 3KBFA 3EDFA 2KH2B 3RIAK 3VFOB 1TF4A 5LCVA 3WUWB 2D0HA 2AK4E 4IYKA 5BV7H 4KJYA 2GTWB 1VA9A 2IALB 2A9CA 3L95B 3NJNA 5CLXA 4HUUA 2EDKA 3B7SA 2H3NB 1OPOA 5AG8A 4N0UB 1BWMA 1VPOH 3L4CA 5C08B 4BA0A 3ETTA 5DVKA 1AHMA 4JE4B 4LLVA 1X4ZA 2DYSB 4I18B 1RJCA 4ANUA 1HEJC 4HZAA 4PD4K 3OKNA 1GZHC 3B2XA 1PX3A 1XL6A 2YO3A 2P8MB 1U92B 5F7FA 5C0JB 5D5MA 1OGSA 3FT4B 4Y9FA 3TVMD 2P45B 1QLEL 3PPSA 2NR6C 5EUOB 2HJKB 2PP9A 3QHZL 5JW5B 4WUUA 3EJRA 4CN6A 1BFSA 1DSFL 1NCJA 4FQIL 4GRWE 3GJFB 4YSOA 4O2EA 4NJAL 3C09C 1NAKH 3MRNA 3TTYA 4M7JL 1E4XI 3GM0A 2UYLA 4N2HA 3QI9B 3KL5A 3QFJE 1NUDA 3T3ME 5DFVC 1UXLA 3HUJE 1X5FA 3SE3C 2Q87A 2IBBA 5AALA 3KWWB 4QRPB 4PJFE 2WTOA 3H54A 3UYPB 1AJ7H 4XX1E 1SMAA 3VGHA 5FCSH 5G2NA 2VDPH 3NPSC 2BLFA 3BSZL 4JKPH 5TH2B 3UBXG 4HISA 4UI2A 3T4AB 2B9AA 5I8CA 4H2CA 3BXNB 4Y4KA 5F0MB 2P42B 4GRMB 4XPBH 4RWYH 2X70B 3MV9A 3UAAA 4UB0H 1JNLH 4GT0A 4AV4A 4OZGA 1HZKA 3PAVA 3P77A 3MV8A 2BP0B 4XNYH 1U3HA 1B4RA 5BOZG 1ETZB 3NMEA 3D3VB 2X9YA 4PRHE 2XIBA 1I9IH 3MJ7A 4HXBL 1QWUA 2IGFH 4BUQA 2BVUA 4JUSA 3QIUB 2YOAA 1MHPH 3MOQA 4U1MB 5CP7A 2PWHA 4XMZA 5D71L 2KQNA 4YLBA 4PWGA 5SV4A 3G5XA 4NDMA 3VFVA 4NENA 4NM4L 3U82B 3FOMA 3WFBL 2LU4A 4YS4A 1BPVA 3QQNA 3OX8A 4JMNA 5EZLB 3NACH 1GGYA 4XP1H 2YPLA 4X0KB 5JLZB 1MCWM 4A7UA 1Y18A 1XVSA 5D93B 2A4ZA 2HLFD 3BP7A 3UMNA 3VU1A 3HG3A 4H20H 1NZRA 3O4LD 1AZZC 4UDTB 25C8L 3NSXA 2DWEB 5DRNB 1TU2B 2M1KA 5CZRA 2XXCB 3PRZA 4ZW3A 3K6SB 2ZKYA 3BUYB 5HXMA 3A21A 4QJ5B 4Z7AA 5C0AE 1J1PL 3LDBC 2Y1AA 1R17A 3LRHA 4FTVD 5T5FA 1UUSA 2BIMA 2D3JA 3KPMB 4RRPG 4WFFE 2E7MA 4PS3A 1TITA 4G43A 3C5ZD 2ID5A 5C0CB 3RDTD 2OXHA 4LAQL 5DVPA 1S8DA 3G5WA 1SLVA 2YPVA 3P0GB 2WKOF 1RZPA 5GGQH 5GGTH 4JPVH 2RFXB 3LZFL 2WBXA 1MCWW 5D7IE 3ZZQA 3O6LH 3U9WA 5LKNA 4LOUC 2OSYA 1J87A 2X2YA 4NRYB 4DOHE 1T2QH 3F6JA 2FNWA 5JW4Q 3X1BA 2XY1A 3NG5A 4B27A 3KS0J 1KLGA 1T1WA 4K9JA 1WT5A 2AJSL 1U9KA 3K81A 3QZNA 5IBUB 4UAOB 2VLJE 3S48A 2D3VA 3M07A 2VQ4A 2ED6A 3MRBB 3MTRA 3TPKA 2PPAA 3L7EB 4UTCA 4MNHB 5GRVK 2H6PB 4UDUB 3F7YB 3LY6A 3P4NA 4WW1B 3PIQB 3S36L 1FVCB 1TPXC 4O51B 5I6LA 4HZLB 4YDJB 3EYUL 2HG0A 3C2AH 4APXB 4KGJA 4OR1A 1V54B 3L4YA 1XFPA 3V0FA 4GP8B 2CAKA 3LS4H 4DHLA 4X4XA 3RWJA 4LXFA 3I75B 5T3XD 2JQMA 4YZWA 2BIOA 5F9JB 3I3EA 4ALAC 1YMME 4CUCA 1AD0A 1PQZA 5IR1B 4YHZL 1IM9D 1QG3A 1VFUA 3DGCR 4L3EB 5HYEA 1LQBC 1G9MC 4ZQKB 3ZTJG 1GW0A 2BOBB 3VXOB 2X4NA 1P5UC 4IMKC 5AZ2H 3DXAB 1F11A 1NA8A 3SYCA 4I89A 5KEZA 4ETQB 2CO1A 1KC5L 1KT2A 3QISA 1EEZB 3JV4B 4F7MA 5I1CL 5D7JC 2WXOA 2M8XA 2KLRA 2FT7A 1E65A 3EBAA 2HFFA 4P99A 1JHKH 1P7QD 1DBBH 2K0RA 4BKTC 1E90A 5KVEE 4YE4H 4WNQB 4KPHL 1WH0A 3UZVA 1WAEA 1FUNA 3M1OA 4PJGA 2VLME 3U4BL 3BAKA 1EFXD 3BMVA 1GTFA 1MW2A 1YDPB 1RFDL 4Y1TA 2X3CA 2J57A 4IMLA 2GIYA 4XCEA 4KTEH 1E67A 3KPSD 1JNJA 2XN2A 1X9RA 1ZS8A 1R3JA 5INCA 2R7EA 1YEFL 1XB6A 4PSPA 4XN9A 1YSOA 3UZQB 1GSKA 4LEOA 1WS7A 3EFDL 3DRTA 1WTGT 2OBGA 3W2DH 3OB8A 2C7UA 35C8L 5J13C 1Q9OB 4LP4A 4DESA 1AGDA 2B08A 2HT4C 2Z0UA 4RAUB 1W72A 2IFFL 4GW1B 4DP1X 4PM1A 4DQOH 3WNMA 3JVGC 4P2QE 1PFCA 4NGHH 1QPKA 4X6DE 3VACA 2RBLA 2WXRA 4GFTB 1FNLA 4EN3C 3K6NA 2DEYX 2GI7A 1K4DB 2BS8A 1UZ8B 3RGBA 1G5GA 1MCLA 4WHTA 3TV8A 4W9KC 1WWAX 3IDGA 5LGJB 4XX1G 1ZLDA 1KBVA 5FA3B 3TLRA 3S3PA 1JPFA 1KN4L 2WZAA 2QMJA 3L3DA 5C3TA 5C92A 1MDTA 1TQCC 5AOJA 5DD5L 4DCQB 5A40E 3CHPA 5CIPA 1CS6A 1IMHC 3BVDB 1TQTA 2XG5B 1NMCC 1KBGL 2WWMD 4XNZC 3SGKA 4HYTB 4JHWL 2KKQA 3FW6A 3UFIA