1ET5A

Crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 93
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A02
1SF5A 2W88A 1JZGA 1KBVA 1WS8A 4M4RB 2BP0A 3AZUA 3ABGA 4AKPA 2FNWA 2IWFA 2FQEA 3FU7A 4YSDA 4CSPA 1VLXA 4A2FA 1FA4A 4KNUA 5I5MA 2TSBA 4A67A 3RYMA 2FQDA 3AG2B 1NIBA 5F7BA 4KOBA 3UACA 1RZQA 1DYZA 3H4FA 1NTDA 3QJUB 4GXFA 1AS6A 3UGEA 1L9SA 2PPDA 5B3SB 3JT2A 2YXVA 4QLWA 1JVOA 3X1FA 4HALA 3CDZA 1MG3C 1PNCA 2CAKA 1W8EA 1E5YA 3AG1B 2WSDA 2FT6A 1KBWA 4FAAB 3AY2A 4YSAA 4DP0X 3HB3B 3NSCA 2J57A 1A4AA 2BP8A 1GW0A 4UF7C 5B1AB 2RACA 1KGYE 2CBPA 2I7SA 1GY1A 2YXWA 1AR1B 1X9RA 1ILSA 3T6VA 1OCZB 1X9UA 1CYXA 1A8ZA 3EHBB 1ET7A 4TXVB 3CVDA 2IH8A 2GB2A 2YAQA 5B7EA 2B08A 1PZBA 4BDVA 3IN0A 2PPFA 2YQBA 3TASA 2TSAA 5E9NA 3TBBA 2XVBA 1CUOA 3NJLA 1NPNA 3NP4A 2BHFA 4M3HA 4YSUA 4BXVA 3QJQB 4G71B 1V10A 1GS8A 2PPCA 3S8FB 2UXFA 3FQ2A 3FYIB 3NJMA 1A4CA 3ABLB 3H56A 5B1KA 2VW6A 4A66A 1NZRA 1AAJA 2HX7A 1SJMA 2QDWA 5B1JA 2FQGA 3T9WA 4A2GA 5D4HA 1BQRA 1KCWA 5D4JA 1M57B 7PAZA 1BQKA 2DYSB 1AIZA 1QHQA 1XB3A 3IE9A 1XB6A 2BP0B 2UXGA 1JZFA 2H5UA 1AZUA 1BYOA 3DTUB 1M56B 1NIDA 1NINA 1E65A 5AZUA 3FU7B 3QJVB 1GR7A 4RH4A 1AS7A 1MG2C 1AG6A 4DP9X 4HCIA 1IKOP 5I6LA 1JZIA 3ZX1A 2W8CA 3SBQA 4YVUA 2NRDA 1BXUA 3ASNB 5A7EA 5AKRA 5FC9A 2XWZA 2VW7A 1PLCA 2BW4A 4EF3A 5B1JC 4A2HA 2XV3A 3EH5B 4G72B 2ZWNA 1EHKB 2EILB 1DZ0A 4AZUA 4YSTA 3SQRA 3AG4B 3TA4D 1PZAA 1AZCA 2XUWA 1JVLA 3CDZB 1PF3A 1OCOB 4YSEA 1SDDA 3ERXA 4HCGA 3BQVA 4KOCA 1AZRA 2UX6A 4BXSV 2JKWA 9PCYA 2BP8B 1R1CA 5EHFA 3FS9A 4E9XA 1BQ5A 3OMIB 4DP8X 3U25A 4DPCX 2A3TA 2VW4A 5I6MA 3FQYA 4NAJA 3CG8A 1GS7A 1NIFA 1PLAA 3ABKB 5ANHA 5LDUA 2XXGA 4JKNA 2X88A 3S3CB 4YSPA 3FSZA 3X1NA 1RZPA 1HAUA 3ABMB 4E9TA 4YSQA 3S8GB 1ZPUA 5PCYA 1AOZA 4BDVB 1A4BA 4PCYA 1L9RA 4HZ1A 2H47C 1KCBA 3OM3B 4Q89A 1NDTA 3MX0B 1T5KA 2UX7A 4ZK8A 4YSCA 1MZZA 3IEAA 3HEIB 3PLYA 2PLTA 2J56A 4HHGA 2AVFA 3T6ZA 3OQRA 4DP1X 1PZCA 3EH4B 4CSZA 3WKPA 4BWWA 4AX3A 1F56A 3PAVA 2AFNA 1JOIA 3GXUB 4YSRA 4YL4A 3CVBA 3PCYA 3FSWA 1OE2A 1KYAA 3KW7A 4QKTA 2FQFA 4KO5A 2I7OA 5B7MA 3TU6A 2P80A 4AI7A 2Y1AA 2MTAA 1XB8A 2CALA 4P5SA 1PNDA 3S3BB 1B3IA 1CYWA 1HAWA 1ZIBA 1V55B 4GP4B 3T6XA 5TK4A 2AZUA 3QQXA 3WKQA 4JHVA 1CC3A 1WAEA 4HCFA 1OE3A 2AZAA 1NPJA 2X87A 1WA1X 4X4KA 2HX9A 3UAAA 3G5WA 1MZYA 1N70A 2Q9OA 1TEFA 3QPKA 4E9YA 2YAMA 2YAPA 2YAEA 3CZUB 2XXFA 4P5RA 4DPAX 4BWUA 2JXMA 1J9SA 3V9CA 4FA7B 1AACA 4MFHA 3V9EA 3SBRA 1JXGA 4G7RB 2IWKA 1ASQA 2QT6A 1TU2A 3TBCA 4A2EA 1BXVA 2BO0A 4F2EA 5PAZA 3FQ1A 2XLLA 4E9SA 1J5CA 3GYRA 2ZOOA 1SFDA 2HZHA 2IDQA 3QJSB 3N55A 2FT8A 2FWLB 5I5IA 2FT7A 2IWEA 1ETJA 3T6WA 2FTAA 3NYKA 1WS7A 1JXFA 1AS8A 3PXLA 3X2QB 1E5ZA 1PAZA 5I5JA 1KDIA 1KV7A 1URIA 2IAAC 2YARA 2DY2A 1NICA 1PY0A 2LLNA 3T71A 2CUAA 1KDJA 3SBPA 2HXAA 4KO9A 6PCYA 1JZJA 1V54B 2CCWA 2Q5BA 2MRYA 4HHWA 3NP3A 3BVDB 5D4IA 1NWPA 4AKQA 2DWSA 2WO2B 1MDAA 4G70B 3D12B 2QPDB 1OF0A 4DP2X 2FJSA 4BWTA 1SFHA 4UANA 1NWOA 1L9OA 1OV8A 1OOWA 1GS6X 4F2FA 1BEXA 1JXDA 2GC4C 4NB7A 1ET5A 4A2DA 1AQ8A 1EZLA 3OMNB 4NERA 4GY4A 1PCSA 2EIKB 6PAZA 4JHUA 3PAUA 2GSMB 2XU9A 2I85A 2QDVA 3N2JA 1ZV2A 2YAFA 5F7AA 2PP8A 2VM4A 2HLEB 2DV6A 3NJHA 4G7QB 4HIPA 2ZONA 4DP7X 3FYEB 2EIMB 2EINB 2J55A 2P80D 2YAOA 1QNIA 2R7EA 5I28A 2PPEA 2GIMA 3WG7B 2DYRB 1W6LA 3L45A 2DWTA 2UXVA 3FPYA 3WNJA 4AKOA 2N0MA 4Q8BA 3NJIA 3ZIYA 2HRHA 4GP8B 1JZEA 4W1TA 5B1BB 3UABA 3FU8A 3ASOB 3NJKA 3AW5A 5I6KA 1FWXA 1SNRA 2VN3A 1RKRA 1J5DA 4KNTA 1L9TA 2IDFA 3MBWB 3WIAA 1JZHA 4HAKA 3ZDWA 1A3ZA 1NIEA 1IBZA 1E30A 3FPXA 3FSVA 1OCRB 3NJJA 1I53A 4YSSA 2B3IA 2EIJB 5IY5B 1WA2X 2GI0A 1GSKA 3WI9A 3GDCA 3DIVA 3QJRB 1N68A 5AFAA 2IDUA 3WNIA 1ID2A 2XX1A 5I26A 3X1EA 3IBOA 3KW8A 2Y69B 1ET8A 2BW5A 4DP6X 4DPBX 2PPAA 4WTQA 4E9VA 2H3XC 3QJTB 4E9WA 1BAWA 1J9TA 1XMEB 4L0PB 1YLBB 4DP5X 2IDTA 4KNSA 1OCCB 8PAZA 5B7FA 3X1BA 1ZDQA 4E9QA 3PPSA 4N4YB 2WO3B 4K9JA 4N8UA 1IUZA 5TK2A 3EH3B 2BWIA 2VM3A 3NJFA 2PCFA 3C75A 3X1GA 3NSFA 2UXTA 4E9RA 2IH9A 3JTBA 1UATA 2BWDA 1ZIAA 2XV2A 3CVCA 3H4HA 2XV0A 4GP5B 2AANA 1ADWA 2VMJA 4YVNA 2HX8A 4UAHA 2PP7A 7PCYA 2GC7C 1A65A 1SHWA 2YAHA 1SDDB 1FFTB 3NSDA 1TKWA 1SHXA 1W6WA 3FT0A 4A68A 1ASPA 2XX0A 3UADA 1E67A 2BZ7A 1AZBA 2BZCA 3OD3A 2OV0A 1AANA 3IN2A 4ENZA 2PP9A 2PCYA 1TEGA 1NIAA 1SF3A 1ASOA 1JERA 2IDSA 4KO6A 2R7EB 1GY2A 4KO7A 4F7KA 1ZDSA 2HRGA 1AZNA 3NT0A 3ZBMA 2J5WA 2GHZA 1L9QA 3S3DB 1PLBA 4W9ZA 3UAEA 4DP4X 3DKHA 1BXAA 2QPEB 1OE1A 4BK5C 1QLEB 1GYCA 1ILUA 3AG3B 1IBYA 3NSYA 2ZXWB 3FSAA 4WKXA 1PMYA 5I6NA 2OCCB 2JFCA 1J9QA 2VSMB 1WA0X 3OMAB 2OJ1A 3NJNA 3FU9A 1HFUA 1J9RA 1IC0A 2GBAA 2VSKB 4PAZA 2XYBA 1AG0A 4G7SB 4YSOA 3PAZA 4GYBA 1CURA 3EF4A 2CJ3A 3NJGA 1RCYA 1BYPA 5I6OA 1M9WA 5I6PA 2E86A 1L9PA
chains in the Genus database with same CATH superfamily
1SQ2N 2H4EA 2WZ6A 3FCUB 1WS8A 2VZOA 3TWYA 4M4RB 3ULSA 2YPLB 2AEPH 3VG9C 5BVJA 3RNKB 5GS2D 2Z31D 3MLRH 1DANU 2COQA 2XWEA 3QDAA 3KPNB 1TQBB 5JHLA 2IPUG 4AQ1C 1CFVH 2ZE0A 3X3FH 2QFRA 5JXED 4CA4A 1DDTA 1A7QH 4F7CA 2BDNH 3N42B 1XH0A 4M8RA 4HLEA 3H4FA 4KPHH 5A6MA 2Y7NA 3B9KA 2OYLA 5I2IB 3IS0X 2BS9A 2O5ZL 1LDPL 3IDNA 1AS6A 1R34A 3I84A 4NQDE 2P7TB 2Y0SA 2YA2A 2EEDA 3RUGB 5L2KB 4TVSa 4XMLL 5C6PB 4P2QE 3SGJC 2IQAA 1JVOA 3SPGA 3ULUE 4RFEB 4ACTA 3GMRA 2AQQA 2EKSA 3BYTA 4X4ZA 4XC1H 1U8IB 2C3HA 2K9FB 3ARDC 4J3OD 4YSAA 3JTTA 2V4LA 2AK1H 1LO4L 4TNVF 1N2RA 4PJ9C 1Q9LA 4BUHA 4FG6C 3BP7A 3P0VH 4IKJA 2I7SA 2OMTB 4BA0A 3T2NH 3QIBD 1LEIA 4YHIB 2PCXA 3O6LL 3VX0A 1CZ8L 5EZJB 1MLCB 4PJGB 3N1PC 2BZDA 2CBOA 1HOCB 5JPNC 1NBVL 4K2UH 3IDYC 4NKDA 3T0EE 5H4ZA 4GMSH 1DN0A 4Y2LA 5ECGA 1XF5A 2B59A 5FS5A 5JOFA 1NCGA 5FYJE 5F7WC 1G9NH 1M2OA 1K4CB 1YN6A 4KK8D 3VXSE 1MFBL 3KLDA 4QMEA 3JXAA 4P57B 2W81C 5IB4A 3EOTL 4EJ1C 4J2QA 4GW4A 1MLBB 2WW8A 4F5CE 4U6YA 4C4UA 2ZWSA 2MFNA 5DLMH 1HJCA 4F8OA 3VNZA 1D9KA 2BHFA 3G6JB 1FO0L 3KE0A 3SB3A 5EOQH 2DQDL 2AJYL 2B9BA 3UFIA 5D7IB 4MMXC 1XF2A 1PIFA 1QX1A 1DQML 5F7NC 5JLZB 1NCBL 4ZSOE 4HCRA 3ABLB 5KVDH 4YZFE 2YOCA 1SJHB 3TJEL 5DQDH 4ES8A 1G1KA 1NGQL 4ZAKB 4NQCD 2RBLA 4FKKA 2N0KA 2IPTH 5JTWA 3NCJL 2X3BA 1KNOA 5DRNA 4OIIL 1E6OH 5LGYA 2NY2C 3QIUA 1PSKL 1QFWI 3ZL1A 4U3HA 1KT2B 3U6XA 4FXGC 2BHUA 3HBGA 1C1EL 4TRPL 2VSDA 3IVKA 3VA2C 1CQYA 1BQKA 4JQIH 4PJ5D 4GAYB 1XVSA 4UV4H 4X0KA 5IROA 3DVGA 4AJYV 1FNEA 1Y18B 3BGMA 4F58L 3VXME 3IPEA 3WIIL 1M56B 5CLXA 2AK4A 4XWGH 5C92A 4JO4H 1AHMA 2Y25A 3QEHB 4P4KD 3H9HA 2YD5A 5DHYA 3UTZA 4JVWA 3CSGA 3ILEA 1SDYA 1Q72L 1K72A 3G5VB 3A23A 5TE7L 1X5MA 5ICXB 4XMKH 3F58L 3IK2A 4PBVC 4PJDB 5A7EA 1MQKL 3BW9A 2VW7A 1KEGL 3NK4A 3B9KD 3BHBB 4LLQB 1NOFA 1QRNA 1ZXKA 3CMOH 3PWJB 4P9MH 3RGVB 3P0GB 4RVBA 4OFIA 4PRDA 3DIDA 5C7ZA 2E27L 3V79C 5E5RB 2VDOB 4DN3H 4GMTH 4K3DH 1CB4A 3C6SA 3OHXC 3JWDL 4HGWA 3KLAA 3P9WB 1A9VA 2NY5H 3CHPA 1R1CA 5E2VH 2VUKA 3TO2B 2P46B 4Y5VC 4PD4J 4YPGA 4AQOA 4JG5A 3KLHD 3OLGA 4M5YH 3W1ZA 1UG9A 4CU8A 4KKZA 1K4DA 1MFDL 4E36A 1FL3B 2CHXA 1EHXA 3IMBA 4OI9A 2CGRL 1SEQH 4ANKA 1XR8B 4A2MA 2AW2A 2NPLX 1MCOH 3K72B 5CJQL 2F19L 1FIEA 2ADJB 3K4AA 3NRPA 1FFQA 1GPOL 2J72A 3WFBL 5IB5A 4LLWA 2FLMA 4LRIA 4NQUA 4JFEA 3IGAB 1D2PA 1MZZA 2BNRE 3HN3A 5CJ8A 1GH7A 2PLTA 2J56A 2VDKH 1CXEA 1YJDC 5F9AC 2Z92B 3CC5B 5DVMA 3T0AA 4BWWA 4R83A 1WUZA 4ISVB 3LRLA 4X6DB 2QHRH 3FO0L 3U48A 2YLHA 2R0ZH 4NYLA 3O3EA 2DZEA 4M7ZB 1AXSB 3MOBH 3RX5A 2CLZB 2R69L 1AGBB 1SXBA 3OC5A 1D5XA 5K9OA 3LV3B 3RWIA 3QIUD 1X7TA 5FM8A 5KANG 2ALWA 3IRPX 4LNRB 4LSVH 3QXVA 5CUSL 4ZPTB 4BFJA 4HCFA 4JG9A 4RA0C 5IROD 2F53E 2G3ZA 4HZLA 1I82A 2X87A 1QI5A 1AFVH 1JHKH 1QI4A 2MNUA 1DJIA 2V0AA 2VZSA 4L3EB 4XVTH 1XR9B 1CF1A 4XX5A 2R0WL 2AF2A 4ZUUB 4B7LA 1FIGH 5KN5A 5FB8A 3H53A 2AK4D 4H1LA 4PW9A 5CSGA 4G43A 3WDHA 2YAEA 3D87B 4KHXH 1EUUA 4G8FA 1QZNA 2XIDA 3E0GA 3V9CA 2XT1B 4G1EB 4MFHA 4R97B 4ICWA 3SBRA 2VQ4A 2F8OA 1TPXC 1ASQA 5ESQA 2K45A 4YFDB 3PIQA 1JK9A 3PWLA 1CE6B 3GLZA 4QXUH 4C57C 3O2DA 1QRND 3V0AC 3O3UN 3NSJA 4YGVA 1TFHA 3ZTNH 2ZUUA 5J4MA 1VACA 3S36H 4QRPA 2Q86B 3CXFA 3V0WH 2FCBA 4N9GA 3BUYB 3N41B 5JW4N 3IJSA 4A7TA 3L9RA 1SVCP 2F1BA 4G9DB 2AJUL 1FJ1A 3IMRA 4YMPA 3L7EB 1HI6A 2DEWX 1F97A 3SE3A 4MD5A 3BP6A 1PX3A 4WNSA 2R0KH 4BE6A 5D1ZI 1CGWA 2ZUVA 1X5HA 2NYZA 3RZCB 3T2OA 1BMGA 4OJCA 1LJMA 4TKWA 3PGFH 1PZ5B 3TBYB 5HDOA 4MQ7A 4XPHH 2CCWA 4ZX5A 3TO4A 4HP5A 4N2MA 2NSXA 3P0YH 3QQDA 5D4IA 4P2OB 1E9PB 1WIPA 4XCYB 1OTUC 4OB5L 4UV7L 3CPUA 2QPDB 5G5DA 5H35B 3HE7B 4EBQH 5KZCD 3QG6B 1FQ9C 4MMYB 4WHDA 4NM8H 4DAGL 1LP9E 1IO4C 4IMLB 3BIKA 5ANMA 3V6OA 3CDGB 4NQDB 2JKSA 2NY0D 2OL3B 2A6DA 3UTOA 4ZUSB 2HJLA 1FVEA 1G6RL 1OT4A 4P2QB 4Y5XC 3NCYS 4KKLD 4HKZA 4XVOA 4XNXH 4U1HA 3QEQA 4JHWH 4G7QB 5C0EA 2V5TA 2ZONA 4HGMA 4UQ2A 1NOLA 1OTSC 3KDMB 2R7EA 3HJEA 3GIZH 1N64L 3FQUB 3RIAF 3TT3H 2C34A 1G7PA 5A16A 5BS0E 2J6EA 1RJLB 4B9FA 1U3HA 4PJBF 3WUWA 2IOOA 4Q8BA 3NJIA 2Q2LA 1ERNA 1XV8A 4TNGA 2J1YA 5GZNA 4OCSL 4XC3H 5CCHE 2WLLA 3ZZLA 2DW5A 2HYMA 1HEZB 5DD1L 1YEJH 1BLNB 5AVSB 3DX3A 3QUZC 2IDFA 5T33H 1UQSA 4O02H 5FHBL 1S7TB 4XAKD 1ZLWK 4R3SA 3RKPA 4QHNA 1DJYA 3I02B 2XTJD 1C7SA 3T0BA 1E30A 1XEUA 4MA3B 4I1RA 5KYUA 5F9OL 3LRMA 2IV8A 5IP4A 4U2YA 3QFJE 3KWTA 2EIJB 5IY5B 1A3LH 1M9SA 4MJ5B 1XBDA 1OY3B 1FP5A 3OX8B 4BH7A 3RFZC 1FL5A 4ZSOB 3SQBB 2NT1A 5T1KA 4UOJA 2V37A 3BKJH 4ADIA 2D73A 1J0KA 3GGWA 2VLMD 2LVCA 4EZLA 1ET8A 3A0OA 4JCMA 3BZEA 3JWDC 3V4VA 3T77A 4WTQA 4XE5B 4NUGL 4E9WA 3QJTB 2H2SD 2JVUA 4XMPL 2GJJA 3VACA 2B4CH 2PNDA 4M9PA 1IGMH 3S36X 4Z76A 1Q1PA 1W72H 4PRAA 4DP5X 5J9PA 1SXCA 1HYSD 3NPSB 4KNSA 1D7DA 2DLEA 4AE1A 4A2LA 5GGUB 1OCCB 1JPFA 3TO4D 2DD8L 3ARGA 4ABVA 3VFMB 2HP4A 2XFXA 3QS3A 1KTBA 3KPRB 4ELMF 5TK2A 1KLGA 1OAQH 1JJUA 5I1GL 4OV5A 1D5ZA 3X13A 3STLA 3CHRA 5E9DB 5IEHA 5AZ2H 4EQ2A 1HHJA 3AMLA 4UT7L 1JN6A 1UATA 2BWDA 4NAMA 3AREA 3H4HA 2XV0A 1DANT 1U8JA 4JREC 1KB9K 7PCYA 2GC7C 1BD2A 1RUPH 3ZMRA 1EPFA 1I8IB 1F42A 2MHAB 5FYKE 1MVFA 1XF3A 5AG9A 3FT0A 4L0YA 4NZTH 4WFHE 1VESA 4HQQL 5MEPA 2Q76B 1N8ZB 4JHBA 2CJUL 3KPOB 1FZJA 1A6UH 3UBFA 3MROB 4LU5H 4NO3B 2BY1A 1NIAA 2QADD 3GUFA 5FUOH 3RWJB 5EUOF 3IFPA 1AJ7L 1O9VA 2A83B 3O2WH 3QVAA 2ZNWA 5AOMA 5HY9B 3VGBA 3ZT5A 3LZNA 3NT0A 4F15C 4HJGA 3X3GH 1U3HD 3FSOA 4PRHE 5E9AA 3RVXD 3EJPA 1JUFB 5A3IC 3Q5TA 3D39D 1CD1A 4XO9A 4NUPA 2I07B 3ULVL 3US9A 3JV4A 5FW7A 3VXUE 1NCAH 2P5WE 3CX5J 3MRNB 4F92B 3V55A 1KJ2A 1LMIA 2ZOLA 4L8BB 4M61A 1NJ9A 2BRRL 5FUZH 3T0WA 1HQ4A 4O58L 4AQAB 2HLAB 2J8UA 4MAUL 5L0QC 1WA0X 3Q01A 3I3DA 2Z3FA 4WW2C 4X6CB 1ONQA 3ZRCC 4F3FB 3FFCB 5DJ8A 3MA7B 4B9PA 4NO2B 2GBAA 4PAZA 5IVZA 1MCWW 4MNHB 4NKMA 2AEPL 2G3NA 3FCTA 4EKXA 3KWVA 4NC1E 1XAKA 1ADQA 5E94A 3SKOA 1T80A 1XHHA 1YPZA 3MCYA 2GK0A 1G7HA 2H41A 4JLRA 4LDLB 1QFHA 4LBEB 5I6PA 2W94A 4Q4IA 3BN3B 5ACZB 1NBYA 5I19H 2DMCA 4PIBA 2BDNL 2WSKA 4KPHL 1KC5H 4GG8A 4NDMB 4KI5D 2F53B 2WXNA 1KIQA 1UKSA 1ZK9A 2ZPKH 5GRUH 4B41A 1NMCB 1AMYA 1WYJA 3ARGD 3EYVA 3OL2A 3RDTD 1CPUA 2GUOA 5DO2C 1RZGA 4E41A 5GRXG 1R3JB 4S1SH 1W0WA 5INCB 3H8NA 4XC1L 1NTDA 3EYUH 3QJFB 1AIFA 4IRSC 3FOLB 4KQ4H 2AK1L 3ZE0E 3DXAD 2HG5A 1QBLH 1PIGA 2ZICA 3C5JA 1VAHA 3P0VL 5CKAA 3SGEI 1CXFA 4EIUA 3T2NL 4U1MA 3T4YA 1E28A 1HNYA 2F7QA 3ENEA 1EERB 1IL1A 4DIXA 2B77A 3AG1B 4ZXBB 1F1AA 3DVFA 5K9KB 3D0AA 1LEGB 1TMQA 3CSYA 3QZOA 1IT9L 3Q6FA 4K2UL 1A4AA 5C0BE 4UQ9A 5D1QD 3SOBH 4PGEA 3L6FA 3JWNH 1MCSA 1NBCA 1I7UB 4PLOB 2F8XC 4X2UA 4Z5RA 1G9NL 2KMWA 4V1DE 4WW1B 2W9EL 1AR1B 5ID0B 2DM7A 3F65A 3V6FB 1PD6A 2X4OB 3SDAA 1XFPA 3FCGA 4GQQA 4JS7A 2PETA 1K8IA 1FV1A 2GB2A 4FFZA 3LPFA 4N2DA 3T3ME 5EOQL 1TTRA 3DOSB 4CC4C 3HPLA 4L37A 4AM0Q 3OGCB 2O30A 1YEIH 2RFXB 4WK0B 1ZV9A 1RMFH 1KCRH 4FXKB 5ESAB 2XVBA 2WKOA 5DQDL 3R4RA 4AGQA 2CK2A 2XWCA 3MLVL 1BVKB 3HG5A 4KK6C 1WF5A 2IPTL 4DT2A 5C09A 3QUXD 2XNAB 1E6OL 2H2PC 1LP9B 2C9QA 3F83A 3S8FB 1KIRA 4RNRB 3UBXI 3FQ2A 5BZDB 1JV5B 4PJXF 5DJCB 4UV4L 2X9XA 4LSTL 5FV2A 4XB3A 1AAJA 4JFXB 3FRUA 3BZFA 4XWGL 4Z3TA 2A73A 4KROD 3LD8B 2ZKHH 3MCG1 4JO4L 4YR6B 1IFRA 4CC1A 2DWXA 5DD0H 2AK4E 3CZEA 3I6LD 3AUVA 4X7CC 1NEZA 5D2LB 5DI8B 3TLRA 2FZ3B 4AYDC 4HU8A 5AW3B 4DQOH 1AIZA 2FGZA 5D7SH 1MIMH 2WBJB 4PH8A 3SZ6A 4XMKL 1G7IB 2EYTB 1KY7A 2I60H 5BS0B 1DBAH 5AZEH 1KJ3L 3G6AA 3LRKA 1BWMA 1OP3K 4LSRH 2NW3B 3DRQB 5CEYA 1T20A 1BZEA 4Q9QH 1M7IB 3H6JA 1QRNE 4WV1C 1ZOXA 3AJ7A 4YUEH 1E8WA 3BLBA 3QNXA 4DN3L 1KJMA 4GMTL 4K3DL 3TPUA 3L7FB 5L4FA 3V0VA 3QI9D 4XCEB 4N28A 1TTFA 4LP5A 2NY5L 5E2VL 5EZIH 5EZPA 3RB7A 1MF2H 1QNZH 3T8MA 3LPWA 5KUKA 2P5PA 3S5ZA 4M5YL 3L3HB 1Y6NR 2E7CA 2EDTA 2XUWA 1R3KA 2PTUA 4NHUA 1UB6B 1PF3A 2ZCZA 4ZRGA 3IYLW 4YSEA 4ZMPA 3ERXA 2I69A 2Z7WA 4DO4A 3BQVA 2ZUYA 2W95A 1GGIH 5LCVA 1SEQL 1DBMH 2JKWA 4ZTEA 5EHFA 4W6WB 3MNWA 1EUTA 2WKGA 3BWUC 1MCOL 3FZUD 1K8DB 4YXHH 1JZ5A 1VFAA 4YOKA 1EANA 2IBBA 1IGJB 2XRAH 3IGUA 5D7EA 1PLAA 1F4YH 2DI9A 4J3XA 3C08H 2DLIA 3BWZA 5HHNB 3V7MA 5C8JB 4JDEB 3PV7A 4NQEE 5EFIA 3SDAD 4XBPA 3SHSA 4JG0H 3WAJA 5LNEA 1AOZA 4JFEE 4N24A 3OKOA 3VD5A 1ZLEA 1JHTB 5HVGB 2A9AA 3B7SA 3OXRA 2XQYK 3AY4C 3VFPA 1U8KA 1NDGB 3V7AG 3W9DA 3ULVC 2VXTH 4QRTA 2WINB 2QHRL 2R0ZL 2VN4A 3IEAA 1HH9A 4APQB 3CMGA 4W70A 2E0PA 4WAFA 2H0EA 3DV4A 2HJKB 5B3JE 1YA5A 5DYOB 2XWTA 1DE4B 3L95B 4L05A 1R46A 1X7QB 4LSVL 5SWQA 4ENED 2VDOH 3PABA 4IRJC 2FQFA 3BVWA 3IMSA 4E42A 4ODTH 1AFVL 1JHKL 2R4SL 4XVTL 2ARJA 2PTTA 4J3TA 1FIGL 3TN0B 2CXGA 3FB5B 1HAWA 4KHXL 3RIFF 1ZIBA 5F9WB 4MX7B 3WKQA 3BEWB 5KVFE 1MUJA 3P30H 3LKPB 4HLZH 5I74B 2RIKA 5DFWH 1YYMH 3O41B 2QL1A 5MENA 3V52L 4AW7A 1I1FA 2YAMA 2CPUA 3D4YA 3RWGA 4QXUL 1FFPA 3KM1A 1ULVA 4MMZC 4PRHB 5EB9A 3S37H 3MLYH 4PB9H 4WJ5A 1DO6A 4FA7B 3ZTNL 4U1SA 3ZTCC 5ID1B 2KUTA 3V0WL 4ZS7H 4OD1H 3VXUB 5FM5O 2P5WB 5GZOA 5F3BB 5IEKA 5M7QA 1BXVA 3MRJB 4QRPE 1IAMA 2G2PA 3AT0A 4DKDC 3O4OC 4OVUA 3W37A 4RETB 5D7LA 3AABA 3OF6D 1Z9MA 5JIKA 3V8OA 2EYRB 2LAGB 1Q0XH 5D70L 3T6WA 3PGFL 4ZOAA 4C4KO 2Z1KA 2V5YA 3AWEA 3DPBA 2IO5A 3AT9A 5D6DA 3X2QB 3P0YL 1E5ZA 2WC7A 1O6SB 5AD0B 2WCSA 5HHVH 4BK8A 1PY9A 3LIUA 4YDIL 2AXGA 8FABA 5EWIH 3CFQA 2J44A 1F4WL 5SWZA 2Q6WA 1G9NC 1C5DB 4EBQL 5M95B 2CCLA 3WTYA 2FJGB 3B2MA 1NCNA 1V54B 3SE4C 4NM8L 2EDKA 2WBKA 4WWKC 3RURA 3RVWC 2JB5L 3VRJA 1BF5A 2NY1B 1WE5A 3L1GA 2A6IA 5ANME 4HIJB 3GJFB 3IDNB 2RJMA 3MUZ1 1ETB1 2OPCA 4UINL 3W9EB 3I9AA 1NWOA 3O8XA 4F2FA 4XNXL 1EAJA 4JM4H 3Q43A 2EYSA 3H7BA 1IC5H 1B4RA 2UUDK 1IGYB 4JHWL 1Z0NA 5HYJA 3FQ4A 5FKAA 4X8GA 1EAPA 1D7BA 1CDUA 2J25A 1ED3A 3ZE0B 3QEQE 1HQRB 1I3VA 4MA8H 2VLLB 1IB5A 2NY4D 3LKSB 3TT3L 5J06A 5E24E 2F74A 3B8SA 3GINA 4JFQA 4M1GH 2YAFA 3KXFB 2PP8A 4OCNC 5HP5A 5F7UA 2C3VA 4GRMB 4HIPA 4R5XA 5FOJA 3FUJA 3OC8A 4YDNA 4XC3L 5C0BB 4JFUA 3KL3A 1EVTC 4AY0A 1QNIA 2YWYA 2A9NH 3DGGA 1YEJL 2L04A 2XICA 1ZAGA 4LO9A 4NCC2 4F37F 2MQCA 3KH4A 1JZDC 3MVSA 4O02L 4V1DB 4XXDB 2P47B 5T33L 3GEFA 5C0GA 3RL2A 4GLRI 3WNJA 5D1XE 2K6WA 5I30L 5MEND 1ML0A 2FJUB 1SYVA 4RISH 3VI4B 3QA3A 2XY1A 1A3LL 2UY6B 3HS9A 3MRKB 2AMGA 3UXFA 4JGUA 1JZHA 5AVYB 2Z35B 1E4WL 3SEPA 3K6OA 5A2IH 3TF7C 2K8QA 3DYMA 4XVSH 3U7AA 5GZOD 4N25A 3S5LG 2F0CA 4OCMC 1FNSL 3MMEB 3M1OA 4GQRA 4ZW3A 1VKXA 2EDMA 3LKQB 1PDKB 2NY5C 3OPZH 2VR3A 2OL3H 3VFSA 2B4CL 5DRNB 1TOXA 4Y4KC 1A7OH 1W72L 1GZHA 2Z4QB 1W0VB 3K6DA 3VXTA 1Z9SB 4PWKA 5J5EA 4HH9B 4HIHA 4X0KB 4HJSA 2I9LA 3V0JA 2FSEB 1ZVSB 3B2XA 3ZDYE 1FNEB 5DMGD 4K8RH 1OAQL 4HS3B 5SWZD 2WWNA 2H6PB 4Z7NE 5GHWH 3F62A 3LTVA 2CO6A 5AZ2L 4J5VA 4BSVB 2ZXAA 5E4OA 1XH3A 4M8QB 4NQVA 3X1BA 5IVXB 4OD2A 2NMSA 2BVUA 1SOKA 2NSMA 4IIQC 2I26N 3CGTA 3ROOA 5E4AA 3TTYA 4WO4C 5AG8A 3H1ZA 1BD2E 4PRBA 4NZTL 2GQHA 1D6VL 4N2IA 5I1DB 2VXQA 2OCFD 1JF6A 4BKLA 2CHWA 2GCYA 4LU5L 4J3UA 1OLLA 2UWEF 3BKMH 5FUOL 3BH9A 3UBXG 1T3FA 2FO4A 3FN3A 3ZJAA 1M7XA 1QO3B 4EMZA 4KJYB 5IKCA 4U7MA 2B1HL 2O6CA 4K71C 3O2WL 4H8PA 1YUKB 1ZHKB 2N59A 4AL8H 2WXJA 4B7IA 4LKCA 5GGTA 3PDOB 4EKJA 2Q0ZX 1SMDA 3GJEA 1AKJA 4KO6A 3FH5A 5CKGA 5BJTA 3BN9C 3GSXA 1L9MA 1NCAL 1ZA3A 3WJMB 1RZJC 3WEOA 2P8MB 5DC9B 5DUBB 4GAGH 3OAUH 5I18H 4OV6F 1NCHA 5FUZL 5CP3H 4D9RD 3GS4A 3GI9H 2FWSA 5JXAH 3HE7D 1E4KC 2EADA 4NQEB 4WEUD 5IB1A 2QPEB 5IQ9B 2YPKB 5KJ4A 3DBSA 4ZQTA 1SDAB 2WP3T 4BHUI 1BX2B 4NM4H 4QRQA 3B56A 3HB3C 4TVPD 3GMLA 1GGBH 3D18A 4LCUB 4AEHH 3EZJB 1U8QA 1THCA 4KVNH 2BSTA 4X4MA 2W38A 5CGTA 3X14B 5BZWB 3KNBA 4GB9A 4ZO8A 1ZVNA 2EQDA 5DJ2B 3ML8A 5I19L 3VB9A 4A55A 1MELA 3GO1H 4G8IB 1ND0B 5K9OB 1D5XB 1KC5L 1JSYA 3CQPA 2Y5QA 2DWEA 1OZUA 3VD3A 2ZPKL 1T89A 5GRUL 4KXAA 2WXLA 5KAQG 2ITEA 1T4WA 5FV1L 5EZOH 1EHAA 3P3TA 5GS1C 1EV2E 4S1SL 4OJDH 1PZ2A 3OZKA 1ZJBA 5ENWB 1E6JH 4AKPA 2FNWA 4E41E 4G8FB 5B8CA 5BW7A 3L54A 4KQ4L 4ONHA 4BQ9A 3RX9A 4LOUC 5ESQB 4Q2ZB 1HHHA 1Z9NA 1RUMH 4D9LL 5C9JA 1WV7T 2AERT 3CBKB 3DYPA 3T2PA 1MCNA 2HCZX 4HWBL 3ESPA 1KF9B 1TVHA 1X5KA 4WY7H 3SOBL 1YEWA 1EAQA 3ZMEA 1F0LA 3RHWF 3FB7B 2WNKA 3UTTA 3EFFB 3KBFA 1XGPA 5K9JL 4I8DA 1HU8A 4YAQA 4AV0A 4L4JA 4H8VA 4BGLA 5DJYA 4Y8AA 4IGBB 4N0RA 3PL6C 4N90E 1KXHA 2YGOA 4C56A 3EF7A 1FFOA 1DBBH 2R1WA 4OLVH 1KGYE 3VFRB 1TQSA 4DUWA 3IDJA 1DBJL 1YEIL 2VLKA 2IXQA 1KCRL 1WBZA 3SD5A 3QQDB 5GGRB 4KKQA 1X9UA 5IF0A 1KLUA 4GKZB 2D03H 4JDTH 4XO4A 3KPRD 4C83B 5G5DB 5B7EA 3E8UH 5CFHA 1CYGA 4PG2C 3VWJC 3IGKA 2YQBA 5C09E 2TSAA 5E9DD 4GIPD 1EWHA 2NUPA 2QPUA 4G80B 5EBWB 1JRHI 1CUOA 2VJXA 1NPNA 1AHWC 1RPQA 1A8JH 4XHQA 3MX0A 5DFAA 2JJSA 3U83A 5LWYH 1GZQB 2X6CA 2QVKA 1PW3A 4ZOBA 3MLSL 3DIFB 1J48A 5SX4H 4OCXL 4UZUA 4FABH 3HRZA 5DD0L 2QELA 5EPMB 3D3VA 1H3PH 2O1AA 4WVRA 1BZQK 4DQOL 3TYFA 4PJCA 5D7SL 1MIML 5CF3A 3D69B 1GJWA 1JV2A 2J71A 2W60B 5ITFA 5EN2A 4ALAH 1HXMA 4DZBB 5B1CA 1DBAL 2RMNA 5AYTA 5AZEL 5B1JA 1LO2H 5HPMB 4LSRL 4XTRD 3UTSB 3GLAA 4Q9QL 2R1XB 2ARWA 3FCSB 1JGEA 2HSIA 4YUEL 5JDJA 2XCMC 1QSVA 2UXGA 2Z6FA 4HH8A 2IOMA 1EFXB 4XZUA 2OR9L 5F44A 3DHJA 2V7NB 1QD0A 2HPTA 2ENSA 1UHVA 1UXLA 4NHCH 1YMMA 3GBDA 1GR7A 5EZIL 5D1XB 4RWHA 2EECA 1MF2L 1QNZL 2HKAA 1R3IH 4HCIA 2TAAA 4K15A 2CNZA 3HAEG 1NA8A 4UT9H 3GSNB 2HKFH 2JKRM 2EIZB 5F88B 2JLPA 3FQXA 2J4WH 1TG8A 3L8QA 1GGIL 1YYLL 3B2UC 3FFCD 4UDUA 3CPLB 1DBML 3UAJC 5D2NC 3MBEC 1FNHA 2QR0A 3FO1A 4BH7B 4DUXA 4F8QA 1FL5B 1H15A 2JQMA 3P4MA 4YXHL 1HEJC 1VHPA 4AMWA 1SM3L 4M93B 4FA8A 3DURA 1F3JA 3GGWB 3ETBF 3OTTA 1F4YL 1WFTA 2QGEA 2OBGA 1OCOB 3C08L 3ILDA 4JO3L 1RSYA 3BJLA 4JG0L 2BERA 2B39A 1IV8A 3C6LC 4DP8X 1I7TA 4FQ1H 1T22A 1SJXA 3FQYA 3N04A 2LQRA 4EIZC 1VEPA 3G3LA 3WU1A 4NI6A 5IK3B 2VXTL 4M8UA 4YSPA 3ESVF 1S9YB 3I6SA 4HOZA 3CH8A 2VRAA 1A6VL 3L1EA 3O3AA 2ZWYA 3ZDXB 4RWYH 1SUHA 4P2RB 4QRSA 3C8DA 5E6IB 2ZOUA 1CMOA 2HB0A 1H19A 4PRPD 1JN6B 2J1WA 3AREB 3P2DA 4JN1H 1U8JB 2VDOL 4MAYA 2WN3A 2P8LB 2CR6A 1BD2B 2UX7A 3TBTB 4YSCA 4ODTL 4ODVH 4XCCH 3K71A 4HHGA 1XF3B 2IADA 3FUFA 4BFOA 3V6BR 2BIIA 1XIWB 1H5BC 5AL0A 4UU9A 5JHAA 5LAPA 4YHLH 3HZKB 1FZJB 4QOKA 2EDWA 5ACLA 43C9A 4M6MH 2O61A 1MJJB 3QISA 1DQLH 4GXUN 5L2JB 4Z7OE 4MBRA 1M1SA 2I7OA 1T1WB 1JGIA 2P80A 3RVUC 3AS1A 3PWVB 3CFEA 1PNDA 3E9UA 3S37L 4MD4B 1TVDA 2ID5A 3MLYL 3WIHA 4ORGA 4PB9L 2V9TA 4URKA 2JK5B 5BRZA 1C16B 2YGPA 4ZS7L 1WJ3A 1U8PB 3CHSA 4QR7A 2MCAA 1E9OA 2OMZB 3DX6B 3HZMA 1H9DA 3CXDL 1XGQA 3BQUD 3QQNA 3RJQB 4PWJA 4DPAX 3U46A 2EUWA 2LLGA 4XI5D 1WWAX 1Y0LA 5T1LB 3FJTA 2OSLB 1Q0XL 1QKZH 4HJ0D 5D7LE 4EDXA 2AQTA 2QVFB 1A6WH 1B0GB 1TU2A 2G4EA 1L5GA 2PUQT 4EUPH 3O9WC 4WU7B 2WQXA 4Y0GA 3FQ1A 4GPVA 1AXIB 4Y4HA 5D1ZA 1SFDA 2QSCL 3AROA 3QIWC 4WUUA 3JWNC 1I9IH 5EWIL 1ZA6A 2GTWB 2IWEA 4I0KA 3EYSH 4YHPA 4UTAA 2XVGA 3NH7H 4OGAD 1CT8A 5C0ND 1OW0C 1XGRB 2GY7B 3B7UX 4FCAA 4C47A 5DK0B 5JORA 1XGUA 5DDHA 4TNFA 5DFTA 3EO9H 4ZFZB 1IVLA 5BO1H 5DSCB 1NGWA 3RWHB 1G5GA 1VIWA 1I8MB 1UZ8B 1JZJA 2Q5BA 1B0RA 1UD4A 1IC5L 3WS3A 1BQHG 4MCZA 4DZ8B 1ZHNA 1OSZB 1GRWA 3PWNB 2XN9E 3W39A 3D12B 3WMQA 4BZ2H 5HYJE 1BCIA 2XPGA 1AIFB 3A21A 1OF0A 3LNGA 1UJTA 4FNPA 4DP2X 2JELH 1GW6A 1GGUA 1PX4A 4ZMTA 4BWTA 3OBAA 2A4EA 2Z93A 2EUZA 2IALB 2CU9A 4AG4H 3NFNB 4QHLA 1AQ8A 4U6VL 1NLDH 1XSJA 4N2NA 2A9NL 4PJ8A 3N40F 3PAUA 5F89A 4JM2F 3L6FB 1UGKA 4PP2A 4U1KA 2WXQA 4QXVA 4LMQE 4DTGH 4Z7WB 1LXMA 3UJIH 5CR8A 4ANWA 2VM4A 2OCJA 2WLZA 3LHPL 2J55A 2P80D 4R0LA 3Q8BA 5HDWA 4IIZA 4IRZL 4L9LC 4X4XA 2ZQKA 3NAAH 4N6QA 3BPNC 4E68A 3SGJA 2E7BA 2BOBB 5EN3A 3NIFE 2FBRA 2N0MA 2YUZA 4AKOA 3DPDA 4XVSL 4W1TA 4AQ8A 3KH3A 1FAKT 1UKQA 3FU8A 2J73A 5DFVC 3K6IA 1GXEA 4UM8B 1UA6H 1U91A 1V7NH 5ERWA 1PY4A 3U4AA 3UZEA 3A67L 2JXMB 4G7VH 4DHLA 4JHZA 1KIPA 2OL3L 4PJHF 2LLLA 4OR1A 5TDOA 4APQD 1A7BA 1PU0A 3U82B 1NIEA 3C8KA 4OKDA 1URLA 2KQMA 1IMHC 3HHRB 3W2DL 1IZJA 3QK0A 3Q8FA 4DNLA 1RZ8B 3WYRA 1KGXA 2NX5A 3UPRA 3W3BA 4X7EC 2G60H 4JPVL 4UQIM 2GI0A 4NQXA 4P2YA 4K8RL 1N68A 1KIUA 4WUUD 2E7LA 5EIIG 4B9KC 4QGYA 1NFDF 1QWHA 5AYUH 3BPLB 2P4AB 2Y2WA 4HOXA 1ZT7A 2MCPH 3L2MA 1DVSA 2DQTH 1OT1A 1INEH 3TJHD 7CGTA 4MHHI 4N0UA 4QHMA 3HG4A 1NBQA 3WN5A 4F57L 3E80A 2PN5A 3R0NA 2NDGA 4L0PB 4MMXA 4P4RA 3BAJA 5FYJL 5EOCJ 5KS9F 5CEYB 3UROR 5IQMA 3FTVA 5IBLC 3MJGX 1D2OA 3EXLA 4JDZA 1EK3A 4MNGB 2VDPB 3BP4A 3K74B 2HFGL 3KAAA 1A0QH 3KEHA 2R1YB 3HG0A 3BKML 1IUZA 2LU4A 3EYOA 5JDSB 5DUML 3KYOB 3I3BA 1QR4A 5AOLA 3TPUB 3V0VB 3DMMA 5BOPA 1E3FA 2ZXGA 4L1TA 4ORZC 5E2JA 1XSKA 1U8NB 4JPWH 1G7MB 3NSFA 2PWHA 4PGBA 2VISA 1YC7A 5DJ6B 5MI0C 2Y1YA 3DX9B 4XHJC 3SO3B 2XZAH 1KTJA 5I1LB 4UAHA 3D0VA 4NO5B 3ATFA 3FQTA 4DGYL 4J3SA 4XRCA 4ZPVB 2CO1A 5ESVA 3VXQA 1M2VA 4PJ8D 1N0XH 2ITDA 2UV3A 1CICC 1UJ3A 4GAGL 5I18L 2AXJA 5CXPA 3WBDA 4CADB 3SDXB 3TZVB 3GI9L 2PWGA 2R2BB 5JXAL 2ERJC 2H45A 2W0PA 4LLDA 1SF3A 4OT1H 2UZYB 3VU1A 2WNGA 5AVZB 2V2TA 1U95A 3U0PA 5ABDE 1ROCA 3ZOAA 4H5SB 2QQNH 1FVCB 4NM4L 5BXFA 4TSAH 3QEUB 5F9JA 4Y2OB 4D0CA 3EAKA 2NY1D 2NNAB 1GGBL 1N0LA 1UH4A 1N8OE 4AEHL 3UX9B 1RH8A 1BQLH 2LABA 3MGOB 4KVNL 4RIRA 1BIIA 4BK5C 25C8H 3O45A 4K3EH 4APXA 2IAMC 1GYCA 1E8YA 3VGGA 1O7SA 4X4ME 4KX9A 4HC1L 3GBMH 3F04A 1HZHH 4JFFA 2EO9A 2C9XA 3LIZA 5DU7A 3SN6N 5D55A 5CEXA 1PGRB 1EGJA 5BQDA 3D8MA 2NX5D 1XF4B 5EZOL 3KXFD 1R3LA 2DTMH 1SLVA 2A6KB 3GMQA 1E6JL 3ZTEA 1J1XH 1MPAH 4PV8B 2Z8RA 4GKNA 4K9EH 4KHTH 2RHEA 5I6OA 3SPVA 4KKBD 2EC9U 4EN3B 2M2DA 1GMEA 4LRNH 2D0FA 4ODXA 1E2ZA 2VIRB 4JQVC 2W88A 1KBVA 1P6FA 2HT3D 1XL4A 4Q7DA 4EOWH 5I9QB 5AB1A 3VFWB 4MA7H 4R96B 3S5LA 1A4JA 1CBVH 5EEXA 5DC4B 4ONGH 4Z95H 5E8EB 2CGYA 4RGMC 2R9HC 3G08A 5KBDA 2BP3A 4QYOA 2PMZA 3GLEA 3CU1A 2O6FA 3UTTE 1WP6A 4JFWA 1M1XB 2EEAA 1NC4B 2F9BT 2HVKB 2ZSWA 3I6GA 4IHOA 4ZBJA 1XCQA 5D7LB 1Q9OB 2VERA 1YO4A 2AI0H 4UOW0 1L9SA 3B34A 3ARYA 2XG4A 4P5TC 1DBBL 4OLVL 3OPUA 3QJHA 1E2VA 3F7LA 4C56E 2ZT9C 1G4MA 4HALA 4W93A 3CDZA 2V9UA 1XCXA 4OZFA 3UTQA 1UC6A 1HDMB 1JGVL 1NGZB 4OAWA 2N7AA 2VLKE 4NRZA 4XP5L 3TH2T 3VW3H 3RZCC 3DV6B 4TLTA 4IU3B 4BQ8A 1QR1B 1TITA 4JDTL 3QUHA 1UT1A 2F15A 3LNDA 3DECA 4ODWA 2Z7YA 2YPVA 4KRPC 2EP6A 3ARFA 3GPEA 4HUUA 1VCBC 5GIRB 1YEEH 3QZMA 4JPKH 2JB6A 2YC1B 4K7PH 4H88H 1L3WA 1SLXA 3MCKB 1LGVA 1CFQA 2IH8A 3OKDA 5LWYL 5KVFH 4R7NB 2SODB 1TIUA 3PFUA 4RFNC 4CUCA 4FABL 4GG6F 3CZFA 1TDQA 2LOEA 3ELQA 4OF3A 3O8XB 3NMEA 1H3PL 4UQEA 2XN9B 2CLVA 2ZUWA 5HYJB 2WXGA 5B3JF 1E4JA 3D3VE 4WO0A 2LTQB 1H0DA 4S10A 5DTFB 2E47A 1LO2L 1PEWA 3ULUC 4JFFD 4K73A 2YEZA 2PPCA 1E3ZA 4I0PB 1AGFA 5E1AA 3RTQC 2J43A 3HHMA 4O2EA 1CR9L 4X99A 4WI2A 4NZUH 4AJWA 5IVNA 3KZ8A 5IHZA 3DGGB 2YS4A 4FHJA 3SDCA 1MI5E 1RK0B 2NYYC 4NHCL 2A9CA 2E9BA 4WFFE 4YHKH 4NS0A 4FNRA 4TSBH 3FK3A 1Z3RA 1QEWB 1R3IL 2RH0A 1YMME 4PV9B 4WCYL 1IFHH 4B0MM 3T0EC 2D7QA 4UT9L 1RULH 1SYVB 3Q7JA 2HKFL 3DRTA 3PP4L 2WZPD 2J4WL 4BZ1H 4GW5A 2XG5B 1NC2A 4YL9A 3QJVB 4ADJA 4HKBA 2KDYA 3ZKNC 4PD4K 1MW1A 2LR4A 2CDEA 2J21A 3GSUA 2XN0A 3QULA 5JPMB 4Z7UF 3MJ8A 1XTLA 3L5HA 1JF1B 3OKKA 4KAQH 2MQGA 2BVQB 5HDRA 1HTYA 1GC1H 4A2HA 3BYYA 2XV3A 1TQCC 4YFLF 4F33A 3E6HA 2GYSA 3S3PA 2JCCB 4GOSA 1UUSA 3BMVA 4G6MH 4GBXC 3WE6B 1AZCA 5C0IB 3L4TA 1RJCA 3N44F 2K6YA 3NCEB 2VKWA 1FGVL 4UIKH 4WWNA 4YXKH 3V5HB 4GIAA 5JNYB 4Y89A 4Y5YB 3WFHB 3VFOA 4RWYL 3FO2B 2NTFB 2NR6A 1HL9A 3NFSH 2J6EH 2K0RA 5JQ6H 3ARFD 5K39B 4JN1L 4NQVB 4XZ4A 4IJTA 3HBPA 3VWKA 1QWUA 4ODVL 1I7ZA 2W5PA 4YSQA 4XCCL 3U7YL 2FEDC 1G6VK 2HUHA 5AAMC 3PV6A 1M53A 2BCKA 2CRYA 3L5WB 2JE8A 3LNHA 5TFSH 4M6ML 1PFOA 4N0CC 5GRVL 3QUYA 1BBJA 1DQLL 4HSCX 5HVHC 1M3JA 3GSNH 1Q94B 1HCFX 4QOKE 5H37H 3BAXA 1NUFA 3FRPG 3B1UA 3L5JA 3LEVH 4YN3A 2YR3A 1JMXA 4OI7A 1S7UB 4R90H 1HWWA 4IGBD 3MRCA 4LLYA 3LH2H 1PPIA 5CZXD 3U4EA 4AYFB 4IOFD 3FSWA 5IWLA 3ISYA 5K9QI 4HXAH 4LLVB 2W91A 2BSRA 1AKJB 1J11A 4JPSA 1YSOA 4JL2A 3V4VH 4KH2A 5BRZE 1XB8A 2CALA 3QBTB 3SDCD 4AM0A 2I25N 3KJ4B 1ZA3B 4MHHG 3QXAA 2BY3A 3RWEA 5IMLA 1AGCB 4DK6A 1MFEH 3IETB 1FBIH 3EJYD 2OTUB 2WLIB 1N6UA 4BE5A 2FVNA 1S46A 1YAZA 1S9WB 2FX9H 4MTMA 4NJ9H 5HHME 3BSZH 2ZIDA 2ICEA 4E9YA 3MV8A 4KJPC 5F6HI 4S1QH 1MCQA 4XWOC 2YD2A 1K85A 4JZJC 3U30B 2FJHA 1I9IL 3IKCA 3D18B 2QHLA 1BM3H 4LVHB 4WUUE 3C12A 3HS0A 5EU7C 3NH7L 5FYKL 4PLKD 4BBWA 1MCWM 4FKEA 2ADYA 4E9SA 1AHKA 5GSRB 1CLYH 3MLUH 3HKFA 2WLMA 5M94B 3OJVC 1M71A 1XSIA 4L8SC 5BO1L 3VGAB 3VRLF 2J1XA 3D51A 4QCIB 1L6XA 1P5UA 2ESVA 2J2ZA 1AQDB 5E51A 1PAZA 5DVPA 3AC0A 3P54A 1LK2A 2ATKA 3BSGA 4HT1H 3VD1A 3QRLA 1N26A 3MGTA 1WCQA 3HAEA 4DWHA 1KPRA 1MHHB 5CLZA 3VGFA 2JELL 4ONHB 3VXRA 1FCCA 5BZXA 2WLNA 3SBPA 2HXAA 4I87A 4XNAA 5T5FA 3SJVA 3APNA 2HUEA 4AG4L 2X4RA 3VWKD 2CKBA 1DEEA 1Z7JA 5C9JB 2CNYA 2WO4A 1NLDL 4G70B 4PJAB 1NANI 3CFKA 2DMBA 1KJ2H 4U1NB 5E2WH 3B9VA 3RY5A 2ICWB 4TTDC 1VEMA 2BY0A 3AB0C 4MCYA 4W81A 4WI0B 3QCTH 4YLBA 1IAII 3MV7A 5HYSB 4DTGL 3F12A 1MIEH 3K81A 2VC2B 4IBLT 5DD6B 5KVEE 3OXSA 1NCWH 3QQ3B 4OZGA 3CDFA 1ZT4A 4G9FA 5I71B 3SQOH 1YN7A 1UOWA 1A6TB 2XQYG 3HG1A 4MS6A 5DJYB 1ZGLP 2KZ1B 2BJMH 3KPMA 3CCHB 1UADC 1J5OH 2ED7A 1FNAA 3NAAL 1DJHA 3OAWA 4XB7A 3EDDA 4ZO9A 2EAEA 3IDJB 1REIA 3V7AE 5KOVC 4C4BA 1AR1C 5JHLL 1G94A 1H9VA 2GFBB 2VDNB 4D0BA 1UA6L 3BUQA 4PGDB 3V4PB 1S2EA 1IBDA 2OXHB 4G7VL 5FDYA 3TCXA 4HUVA 4MJIA 4H25B 5GJSH 1N4XL 2C4FU 2NQ3A 3FPYA 4P2RD 3B9AA 5E6ID 5IM7B 1NGXA 5J6HB 3AVEA 1RD6A 4QTHB 4PLJC 2XWBA 1AGDB 1OB1B 2I24N 1RKRA 4ZX3A 3KGRA 3FXIC 2AQ1A 3ZHFA 1L6PA 4ZQKB 1N6VA 1UUNA 4NPKA 2WQRA 1QABA 3TONA 2CO4A 4O51B 3IDIA 1IQDB 2MCPL 5EU5A 2DQTL 3RGHA 1INEL 2Q3ZA 3TBVB 3UOAB 5SX5H 1H8NA 4A6YA 2ODIA 2Q7YB 1IM9A 4I18C 4Y2DB 3IDXH 3LD8C 2IBZX 2EZ0C 2Q1EA 5KSUA 4FP8H 4N0UE 4DH2A 1KGIA 1BQUA 1LLAA 1B2WH 3OR6B 3CVIH 3D9AH 3VFVA 1JGEB 2HVBA 5JZ7D 2DBJA 5DRXB 1MI5B 1A0QL 3KJ6H 1LWRA 4JPIB 1ZANL 2QTVA 1I31A 4Z7VB 1S7QA 4F9PA 2K3HA 2ZKXA 4PYHA 4ABUA 4QEGA 2ZXCA 1OAYH 1PJ9A 4NKOA 1YMMB 4H0IA 4DEPB 4JPWL 1HJBC 5C7XH 1PS3A 2AXFA 3HC4H 3OAZK 3X17A 5KSAC 2CA4A 3DX0A 4PWGA 3ZTJH 2DH3A 3HUJF 4L8DA 1TTUA 3TEZA 1G9MC 1Y6MR 2EC9T 5C2BH 5CLWA 1YZZA 5F7DB 3V0EA 1N0XL 2A74B 3DROB 1BJ1H 3MOAH 1ZIAA 2CG9X 3ZQ9A 1J86A 4W4OA 5JYLA 2Y6SD 2AANA 4N2FA 5CO1A 3KPSE 3O6FB 4UDTB 5I73C 3NA4A 5IQ7H 1CVSC 4P2AA 2YJQA 2XIIA 1A1OA 3ATEA 5D4QA 3TFKD 4OT1L 4MYPA 3OSVA 4OZHF 2K3TA 5EO0A 3CX5K 4P23B 1RJYB 2XX0A 5E4EC 2Z31C 3GNMH 4WTZG 5TGBA 1KZYA 3BAKA 4D7PA 1BQHA 4L4TA 1R5VB 3MLTA 2X3AA 1S8DA 1BQLL 1PZSA 4KX7A 4NNPH 4X8JB 4KXBA 3ZDYB 5JXEC 25C8L 3GXMA 2DKSA 4K3EL 4BHUA 5KSBE 4MXVE 2X40A 1UB5B 3B9EA 3VI3E 1I8AA 1GTFA 3CTTA 4CJ0A 1L9QA 3BD5A 4YIQB 5CBEA 3AXLB 4MS8C 2VDPH 4JFFE 3O3BA 3PREA 2B8OT 2XIBA 2DTML 4J3OC 1S7RA 3P3RA 1A02N 5TF1H 3HR6A 4UQ3A 5GGSA 2OR8A 2HFFA 4OFYA 4XPTH 3FAWA 5DURD 1J1PH 3K7UA 3QORB 4K9EL 1NM9A 3ZTDC 4BFEA 4KHTL 4MZ3A 5GRZA 3PXJA 1WT5A 3QIBC 5E1GA 3K0YA 1YNTB 2WIIB 1VZIA 4L5FE 2FWOA 4L1BA 1IM9D 1IAOA 1Z9OA 1IC0A 4YNYA 3VXPA 3CFEB 5HDQL 3IJ9A 4JZOB 3EHBC 4R7DB 3QO1A 5TD4A 3WIFA 1OARH 4PJBA 4BM7A 4EOWL 4Z3EA 2APVA 4JQXC 4MA7L 3WEXB 1RU9H 1TZGH 3GMOB 3OZLA 5AOIA 3RJOA 1CBVL 4KK8C 1U58B 4ONGL 4Z95L 4OZ4A 5EO9A 3LZOA 1JGLH 4IBZA 3WFZA 3PNWB 4GIOA 3LY6A 4HIIA 3NOIA 5E6YA 4LPTA 1XGTB 2VLJA 2V7HA 1YEKH 3U46B 2P1YA 4CVUA 4HOMA 5HHMB 1A7RH 2ITCA 3WENA 3A3YB 3P77A 4NN7C 4JRYA 2GABA 2WLHA 3T6QC 4EDXB 3MUHL 4HKJA 3OZ9H 1AD0A 5DJZA 3WKNA 1QFWM 2KLTA 2XZZA 2J20A 3R1GH 3RYMA 1UWGH 4RGNE 1RZIA 1RZQA 5EIIA 1DSWA 3QC6X 4N0YH 3QRBA 3VW3L 3RDJA 5CIPA 2N1KA 4ZTOH 2A9MH 1HCZA 1L7IH 1M6OA 4XCFH 4E0RA 1J8HA 2H8PB 4LIQH 5GJTL 3Q13A 4Z7QE 3TTSA 5L9DH 3X1FA 1BYNA 3HMXA 4GAAA 4U1GB 1MG3C 2VM9A 1IX2A 2DYPA 5K9QG 1W8EA 3I9IA 3J27A 4Y1AA 4FAAB 1E27A 4NC1C 5JORB 1IC7H 5DDHB 1DVZA 1PD1A 1R17A 4H88L 4K7PL 1ZHLB 5F0JB 4I1PA 4W6YB 2FX7L 1U2YA 5KVFL 4WNQA 3LX9A 1JVKA 4XP4H 4L4TD 2OI9C 4KFZC 1Q1JH 1RFDH 2CO7A 3CLFL 3D1MC 3HI5H 1MRCH 1ORQB 1U93B 3CVDA 1LTXA 4UNIA 1HH6A 3B9KC 4LFHG 2XYCA 2P5EA 5DK3A 3O2DL 2E6JA 3WL9A 3CVHA 1ZSDB 3P4OB 2WQVA 4H40A 2Z93B 3GMPB 1NUGA 3R19A 3BO8B 4KFMA 3U1QA 1KTDB 3VG9B 2ZWKA 4NZUL 4F93B 5K69A 2ETWA 5ISZA 3NIDF 1ZTXE 5CM1A 3UC2A 4OFYD 4G71B 2ZJSH 3GSOB 5F89B 5F9DC 3SE4A 1S5HB 2CLRA 3HPJB 3NZ8B 4WWKA 5EUKA 3TNNA 2UXFA 4AQ1B 3KLHC 2GJZB 1NGYA 5EUOA 3PY9A 1IFHL 4JFYA 1SJEA 3N6YA 2E9JA 3ZO0A 4DK3A 1RULL 2HX7A 1SJMA 4P06A 4OF5A 4ZMOA 4BZ1L 2D0GA 4LCCA 1QA9B 2X4SB 2WMPB 5I76B 1D5IL 3F84A 1PYWB 1S5IH 5ADOH 1UOLA 1TZHB 1OAJA 3Q6GH 3PF2A 3ARDB 2BP0B 2X2HA 3WXWL 4PJ9B 1D9KC 3GK8H 4KAQL 5GGRY 3EW3B 5AZUA 3ULAB 5KBLA 1GC1L 3UZQB 4AJ0A 1YEFL 5TDOB 4OJFH 4ZS6D 1AS7A 5CSZA 4LCWB 4ZUVA 4LHUG 4G6ML 1WZLA 4KZEH 5TDPA 3NIGE 5JPNB 5CMAB 1QSFB 1KLFA 1R75A 1UM6H 3IDYB 3SPCA 3UPRB 5CN3A 1UCTA 4UIKL 4EF3A 4JR9H 4YXKL 5ABZA 5FF6A 3NCBB 2ATPB 1E3XA 1F18A 2ZF8A 3QIUC 2OKMA 1DZ0A 3DUUA 5MERA 3RKDD 1YUHB 4WLCA 2HT2D 1MDTA 4X9YA 2J6EL 5JQ6L 5LGJA 4KKPA 5IROC 4EPSA 4FZ8H 1QVOB 1BA9A 2DYPD 4GFTB 5CEZE 2UX6A 1FRGH 4BXSV 4UQAA 3GM0A 3RVTD 4MMXB 5IJVA 4OFQA 2ALAA 4N5ED 4UT6A 1A6AB 4R6UA 4B27A 3LQZB 4X5WA 5KEZA 2G75A 3G5ZB 1MJ7H 3BP4B 4G8GA 4L4VA 5CFAA 3GSNL 4MNQE 1I9RH 1IBGL 5FO7B 2JNZA 3PAYA 3ABMB 3OJDA 5F72S 2NY2B 1R5WB 4P07A 3I6KB 4YDLC 3LEVL 1E50A 1A4BA 3CJJA 4M8VA 4FXGB 1NC4D 4RBPK 2MPVA 4WFED 4LBAA 4R90L 4NUJA 5C6TL 1JZ2A 3B1TA 4X9GA 2WVUA 3MFFA 1S7XB 3D0VB 4HXAL 3LMJH 4HF5H 4UAOC 4OTXH 4MDJB 3V4VL 3NVQA 5ISZD 4U33A 4KC3B 3KPSB 4CSZA 3L3DA 5E2UL 4AX3A 4K9EC 1JOIA 3FH7A 2Y7QA 4FQHA 3VD0A 2WZ5A 1C7TA 1T2QH 1MFEL 1UA3A 1FBIL 2YRBA 4LCYA 4QKTA 5I0XA 4YC2C 5E4IA 2FX9L 4NJ9L 1ZS8B 3BSZL 2Y1AA 2BRQA 1UWXK 2D31A 4HJTA 1UD2A 2Q7NA 5AYQA 5CJXA 3WNLA 2C9UA 4I48B 3EOYG 4GSXA 3MV8E 1V55B 5DD3L 4PJ7B 3MQIA 4XNYH 2Z1PA 3ROLA 3BKYL 3MJ9H 2MPAH 3V10A 4BYHA 1BM3L 1CC3A 1WAEA 5LGHH 1SPDA 1S7VA 3QXDB 5KSBB 3OHXB 3N3EA 4LRIC 4WI5A 4L48A 1N70A 3QPKA 3VI3B 4QUOA 3ZE1F 4Y5VB 2OZ4H 4KH9A 1CLYL 1OSPL 2XXFA 1J05A 1AACA 4I77H 5FO9A 4DESA 1JXGA 2ZG3A 3M1CA 4KKLC 4URTB 5AOJA 1FORL 2VXQH 4PJXA 2IBZY 2C4FT 5FK9B 3V2AR 3FCBA 4A2EA 1P69B 3LRHA 4D8PA 4FJ6A 2Q2EB 1RIUH 4BUGA 2ESVE 3QZWB 1YMHA 2KL6A 5L4IA 5MEOB 4XNQB 1X5LA 1J10A 3N42F 2K70A 4HT1L 3TIEB 2FT8A 3MRIA 3W0WD 3L4XA 1QPKA 1MFCL 3K1KC 4PHZA 5GGTH 1JZ4A 4ELMB 4DCQB 2D9QB 3FHEA 3PXLA 3VXRE 5GISH 3FFOA 3L3GB 4JDVB 2VR5A 3SJVE 1IRAY 1SYSA 2ADGA 2EDYA 1DFXA 4NRXA 3T71A 1KJ2L 4JGNA 2XTJC 3QCTL 3OVUB 4X50A 4I2XB 4QRRB 1CL7L 4IKIA 1X5IA 3NP3A 4G8GD 4L4VD 5H8DA 3MV7E 1LEKB 1T1YB 4FNLH 3QUKA 4K23H 4P46A 3M07A 1PVHA 3SQOL 4OZGE 3C2SA 4KTYA 2AJZA 4PJGF 2BJML 2Y72A 4G9FE 1EQWA 4FFTA 3RWDB 1J5OL 4UANA 1I3UA 2APFA 2BVPA 3HG1E 2AQ2A 2FYYA 1E0OB 3F64A 4X8CA 3KS0J 5GS1A 2YKLH 3ISRA 4JBSA 5CN2A 3PHAA 3TH4T 3AT8A 4A7GF 3LN5A 3GS0A 3EG9B 2B0SH 2H2SC 3SE3C 6PAZA 5F1NB 5JUEH 4H8QA 2VLRA 2AJSH 1TPXB 3VYPA 4M6OH 2AQRA 3G6JF 5I8CA 5GJSL 1ZV2A 3GMMA 3FUDA 2PXYA 1EJ8A 3TO4C 4MJIE 5D7IF 1FN4A 3AXHA 4JRWA 4M62H 4YQXH 5L8LB 2X9WA 1T7YA 2EDFA 2X4UB 4BELD 2ADFH 3KVDD 1OCWH 1VADB 3NZSA 4LCIH 4UWQB 1CFSA 2ZYHA 3MKKA 2DWTA 4PBXA 3UBXB 3C09C 3DVNB 3UTPE 3ZIYA 3FRPA 1I4FB 4LVNC 3AW5A 3V6OC 1SNRA 4BD4A 1GC1C 4WK4B 3V8CA 4NCC1 4BFIA 3FONA 3ECBA 3TA3A 3MRDA 3IDXL 4G3YH 5IG7B 3FT4A 3WHXA 4FP8L 3ZYJA 4YBLC 3SE9L 3BSHA 2DWDB 1B2WL 3CVIL 3BZDA 3D9AL 3U0TA 5HYQA 4LLUA 4O2EB 2QADC 2Y7SA 2VC2H 2HMIC 1LE9A 4MDIA 1U6AH 3KJ6L 2FR4A 3D25A 4ETYA 3DIVA 4PJDF 4MZIA 5IREA 4GT0A 1QTPA 1Y6KR 2GT9B 3GD1C 3MOQA 1D5MA 4R84A 1DQQA 3UO1H 3UJJL 3ZL4H 1U3HC 5C7XL 2YRPA 2UYLB 2G9HA 3HC4L 4LARH 4NP4H 2JJVA 1N9PA 2PPAA 5GZNC 4OD3H 2X6VA 5ETUA 2VDNH 4E9VA 3T1FB 2UZXA 4ZMWA 2X44D 5C2BL 4W9CC 4GKLA 4Y5XB 3V4PH 1DVFA 2X53A 1O7VA 3P2TA 3L3IB 5LDSA 4ZODA 3CSTA 3P4NA 1P5VB 1WC7A 5DGRA 5E2TH 5ABAA 4K94C 5IQ7L 5KTEH 2WO3B 4J1UB 3GRWH 1HHIA 2W07A 3MJ8B 1TF4A 2EC8A 2FL5A 5EBMA 1OP5K 4P46D 4ELKA 5C71A 3U1SH 5CILH 2PCFA 5BCAA 5F7KC 2JKXA 1RV6X 3J8F7 4E9RA 3WLWD 3BD4A 2X5PA 4UOZA 2NUTA 1QFWH 3GNML 3E6HB 2WTPA 3NIGB 4OJYA 4GP5B 3MRPA 5AUMB 1U8MB 5C1MB 2XTLA 2BCMA 5IB2B 5F7FA 4AEIL 1SHWA 1SVZA 1SJVA 4NNPL 3O6MH 3QUZB 4IBSA 1TKWA 2BVEA 3JZYA 3CZLA 43CAA 3IFNL 2LGNA 4F20A 2VLRD 4KY2A 3SYAA 2VJ0A 3ZRFC 2FHBA 2E4FA 2PXYD 3ARGC 3H0TA 2K4WA 5KG9B 5IMKB 3C60D 4X6DF 1K9TA 3ZKMC 3CFBA 4JVUA 3RFZB 1K3ZA 3X12B 1XTMA 4AH2B 3NK3A 1FPTH 1AZNA 5TF1L 3ZBMA 4XN1A 5F3HA 4K0OA 2EXWD 4XPTL 1EMTH 1J1PL 4UMGA 4MNQB 1HILA 4PJHB 1GA2A 1INQA 5CCKH 2APSA 4CU7A 1C9SA 2EE0A 2BOCA 4V2BA 2YQ3A 2YFOA 2WNXA 3SKMA 5D1QC 2ZKMX 4GS7C 4AIZB 3FUMA 5I6NA 2Z8VC 1FSKC 4MCMA 1MWAB 3VFUA 1X5FA 1QLRA 1TZGL 3H2PA 4PJBE 2YK1H 4JAMB 5C0DB 3H9SB 4GXVL 2DIEA 4NWTH 1CIUA 2QPFA 4DKFL 2XYBA 1J8KA 4B9YA 4RA3A 4JANB 3VFNB 4KGLA 4XOCA 3H85A 4M1CD 1CG9B 4JREB 3M1BB 5ELIA 2VLJE 2Y23A 3GRBA 3NN8A 3VM7A 4AE0A 2X05A 3ZT7A 4N0FB 4LAQH 1EO8H 3J07A 3N41F 3R1GL 3OHMB 3N1QC 4JRYE 5DJ0B 1GJIA 2BPBA 1UWGL 1JAEA 2WYZA 5CHNA 2W0FB 1K2DA 1E4XL 1DVFD 2HH0H 1KWKA 3Q8AA 2PW2A 4ZTOL 2A9ML 2ZAHA 3CLEL 3UZVB 2NW2A 1KEMH 1L7IL 3MRRA 4XCFL 4Q56A 5L9DL 3WDJA 3JVFC 1NIBA 1U3JA 3ETTA 1J8HE 3BFOA 3MUY1 4AYGA 2CIKA 1DVTA 1HINH 1FUNA 3LKOA 4WKZB 4F15B 5L8JB 3RL1B 2J12B 1IGTA 4MVBC 4CU6A 4Y1AE 1M71B 2OMWB 1GZPB 3M46A 1EZSA 5E56A 3JT2A 3HN5A 3LEXA 2J8OA 5TE6H 2YXVA 1P5UB 4YE4H 1OAUH 3KBPA 1Q1JL 4F1ZA 1RFDL 2E75C 2QKSA 3KGSA 1OF2A 2EEBA 3HI5L 1MRCL 4HJJH 3U9PH 1QSZA 2VQUA 4PREA 5MHSD 3HC3L 4E5XG 2WQWA 1WH0A 3FH8A 2BIPA 3EH1A 3GZQA 5L0QB 1WTGT 1YY8B 2CHZA 2R2HA 3VTTA 4WW2B 3TV3H 2P5EE 1OLZA 3MTXA 3FTUA 5IUSA 1V3LA 4RZKA 1TQUA 4B97A 3LQAL 2RALA 5DZAA 3D2UB 3LDBC 5HHQA 3CH1A 3DTXA 5ISZE 4IBWA 4DVRH 2UWEA 1QFUL 1FAIH 3OXSB 4OZGB 1CFTA 3IJYA 4F8PA 1ZT4B 3O3DA 3CN0A 2DAVA 2BS71 2OMUA 3NRQA 4WTZA 2OMVA 2GSIB 3FZUC 1ZTMA 1KTCA 2VH5L 4ERSL 3TYGH 4MJHA 2A0LC 5D71H 3GBEA 4P23D 3S2AA 1MCPL 3SCMA 4YDKH 5I16B 4NENA 1S5IL 2APTA 5ADOL 5EEVA 4OQTA 4UTAH 3F3HA 1DR9A 1VFUA 2VW6A 1N3NB 1ZLUH 4BEIA 3MNVB 3SDAC 4IRSB 1I8UA 3JTSB 2DQJH 1SQMA 5LUMA 3P11H 3GK8L 1UFUA 1RLWA 3CQQA 3DOIA 4KJQD 5D4HA 5TPWH 2DLFH 3ESOA 4X6BB 2DJ4A 4OJFL 3ILPA 5GSVA 1HT6A 3ZK0A 1Z66A 2HJFB 4YZFF 3LNEA 4M56A 3IJEA 4H26B 1VENA 4KZEL 5EORH 4I1NB 3SGDI 1UM6L 4F7PB 2XWBB 4B96A 1E65A 1G0YR 4Y4FA 3RNQA 1LNUB 3RWFB 2JJUA 3LKRB 3N91A 4RH4A 4WTWA 3FT2B 1Y1UA 4L3FA 1JZIA 2BC4B 3SBQA 4I7ZC 2Q8BH 5KYXB 1HHGB 2LU7A 1KG0A 3VJ6B 5DJDA 1ZRUA 3QORD 4FZ8L 4ANUA 1ECZA 3TWCL 1FRGL 4IW4C 1T4KA 1OHZA 2QGCA 2EEFA 3F6LA 1T1ZB 3MRFB 5CP7A 2WBWB 5KVEH 5HHOE 1YYCA 4EDWH 1WZ1H 5DJAB 2IQ9H 4QPEA 1MJ7L 4OF7A 3PWPE 4LGSB 2CDFA 1D6EA 1I9RL 1S7QB 2OW7A 9PCYA 2BP8B 4FQJH 4OCYH 1UOKA 4G8GE 1UYWH 2A6JB 4AIXA 2VO5A 4NKOB 4DPCX 4Q58C 3M88A 5I6MA 4QXGH 2GKIA 5ANHA 2V3EA 1F2XK 1ANUA 3CFJB 1I1CA 4XR8C 1AQMA 3L81A 4HHAA 1SEBA 4TUJB 5IFHL 1Z9PA 3LMJL 4HF5L 5C3LD 1B0IA 4OTXL 3QDJA 1T2XA 4H4NA 3S8GB 3CC1A 5PCYA 3QCVH 3KPTA 4HPYL 3IKKA 3ME0B 1K5WA 3C9NA 1KTLA 3EOBB 4PGCA 4XP1H 1JPEA 1SXAA 1NDTA 4D94A 4GO8A 3S4SG 3V6ZB 2H9GA 1MFVA 3ZR6A 3IXTA 1OP9A 3PWUB 5DEGA 5ITBH 3BVUA 4NKIL 4GAJH 1KPVA 4AGOA 4TQIA 2A2QT 5L88H 3T8XA 1MVYA 4EI5A 2WUCL 3EH4B 1F56A 4WV1B 4Y19B 3GXUB 1Q0YH 3FNKA 4XNYL 2YD7A 5IIEA 3MJ9L 4BH8A 2YSSB 1MHCA 4LEOA 1TR7A 5LGHL 5HTSA 4Q6KA 1CTOA 2WXIA 4OUOA 4AI7A 5B7MA 1AO7B 4X6CF 4AZ8A 1N5YH 1OGPA 2BSDA 4IJ3C 5L7XH 1W8OA 3P9MA 4BV1A 1BP3B 2OZ4L 3SYPA 3L4ZA 3DUHA 3IU3A 5LHDA 1FL6A 4NQQA 2EH7H 4WEEA 5DRWB 2VXQL 1CDJA 1DQVA 1M7DB 1IIIA 3S2CA 1V8HA 3OWEA 4L23A 4PJXE 3R4DA 1RIUL 2FB4H 5LBSA 4Y4FD 1BOYA 1XD0A 2NY4C 2AQ3A 2HFFB 2AXWA 2KQNA 3O11B 4JVPA 4N3UA 1YQ2A 5EC2B 3PHOA 5GGTL 1CJYA 5C0AA 5AW5B 4N8VG 2H1PL 2AJXL 4KXZH 1KPUA 3KCPA 5GISL 4JJ5A 3GYRA 1X5GA 3RGBA 3VXPB 4UQDA 4LEEA 1KCSH 3KHQA 4DGIL 1GJUA 4AC4A 1TJGH 5KOMC 3WXVL 2J6WA 5JR1H 4RDBA 1H3XA 3MKGA 1URZA 4JUTA 4C4KT 3VTAA 2RCSH 5B3NA 4HIIB 2YARA 2DY2A 4FNLL 4K23L 1P4BH 3PJNA 1NICA 4CL7A 4LHUA 1NCCH 1RURH 3VG0H 2EO1A 3ZR5A 4PJ9D 4S2SB 1U3ZA 4IRJB 4L1DA 1AP2B 3PQYD 3J2PA 2XZQL 4POZC 5GZOC 3U36B 2XQBH 2YKLL 3WNMA 2YEVB 1COBA 1QQDA 2OX5B 1NWPA 4X6FB 3QDJD 4NOBA 3LQAC 3LJ3A 4TLSA 5EU6E 3VD2A 1R47A 2AJSL 4M6OL 1NCOA 1M6OB 4E0RB 2PCPB 2VLRE 2W65A 2BXZA 3U9UA 1EGJH 3KWWB 1EVUA 2PO6A 5D6DC 2A9BA 2WLJA 1A2YA 4MMZB 1NCDH 4M62L 1DUZB 1GGTA 2PW1B 3EGSA 5DMGC 4IEFA 1ETZB 4JO2H 4P05A 5IT2H 4BFRA 2XWJA 2ADFL 1OCWL 4I9WE 1IARB 3INUH 5F6HJ 4LCIL 1FC1A 2IWGA 4AXWA 5HHXH 2H0JA 4HDIB 1LP9F 4L5FH 1R3HA 5K59F 2FHCA 4WSJA 2YRLA 4LFHD 3T2QA 2ZG2A 3FTZA 4EXKA 5DK2B 1YJDH 3KCWA 1EXUB 4QDGA 3WKMH 1BZDA 3H42L 1ZGLB 4PG9B 1VJSA 3TNMA 4PJ6A 4JB9L 3IFOB 3GIVA 4G6AD 1JNLL 4G3YL 2Y22A 3F05A 2VTFA 4FKHA 5FOBA 3EDJA 3WL9B 4LL4A 2ZP8A 3BGFC 1TSHA 2C1OB 2FBOJ 1P1VA 3MODL 5D2LF 3SGEH 4NO0A 2VC2L 2WTRA 4LGPB 2EDDA 1P4LA 3INOA 1U6AL 3HCVB 4UNTA 2Y5TA 3A6OA 4PIRF 4G7YH 1U8LA 4GSUA 1PG7W 1QSEA 4AT6B 3UO1L 4FMVA 2WOYA 4WWKB 5DHVB 3VRIB 4YHOL 5C0AD 1NGYB 4FQIH 2QLVB 1RJZB 4LARL 1SJEB 4NP4L 3EFOA 1Z32X 4OD3L 4RRPM 2VDNL 4LSSH 1GSKA 4YO0B 5CZVH 2H26A 4PRIB 4ACPA 3V4PL 4LCCB 1ID2A 5GGQH 3MJ7B 5FO8A 1BFOA 1B4JL 3X11A 5E2TL 3KW8A 2C7UA 2VL5A 4MKTA 1T7XA 1JPGA 4L3CA 3REVB 2CCVA 2YPVH 7FABH 5IR1A 5EEUA 3I75A 1G7JA 3AFLA 1GOGA 2O5ZH 1CBJA 2H3XC 4JRXA 4QTFA 3PP3H 5KTEL 3GRWL 4KBPA 3WTWA 3BGAA 1KYFA 5DZJA 5SV3A 4RX4A 2DPKA 3U1SL 4XO3A 1YLBB 1QLFA 2AKRB 4GQ9H 1UZ6F 3HNSH 4JFPA 1G4RA 1QFWL 4ZUVB 5MP6H 5F0MB 3EO1A 3L5XH 3MI6A 1S7WA 4DGWC 4Z78B 3ETBJ 4R26L 1MHPH 3O6ML 5E03A 3GJFK 1QPPA 4G6KH 4O2CB 1NDMA 2Q8AL 1GZHC 3MRLB 2FBJL 4MB1A 4R7XA 3CVCA 3O6LH 1CZ8H 3GB7A 1XSOA 3FL7A 2IANA 4IS6A 1NBVH 2X12A 2PO6D 2Y2YA 4J3WA 5T3ZE 3APDA 4LOFA 1ZTXH 1NBZB 3NSDA 4N9OB 4YDVA 3EDEA 2RAMA 3TOPA 4UM9B 1FO0A 2A38A 3JZ7A 3UADA 5HHOB 1FPTL 3MUJA 5FYLH 4AVKA 4XXCA 1KTRL 3IN2A 1FI8C 1KJVA 1DEDA 5JYMA 3BDXA 3PWPB 2JJTA 1EMTL 4F7MB 1G7LB 1JERA 2G75B 4YZWA 1MH5A 4FTVA 3OKLB 5D93C 2AJYH 4QRRD 4Y4KB 4PI2A 4WUKL 1U42A 4G42A 4MZ2A 3WDIA 5E8OB 1JHLL 4LKXA 4W9ZA 1ZHBA 1UOVA 4YDMA 4H13C 4JO1H 2MSPA 2YK1L 4NO0D 2OSYA 2R51A 1VCAA 2R59A 1Q9WA 3MRMA 4NWTL 4JM2A 4TRPH 4WKXA 5CZRA 2LVEA 1QFPA 1U8CB 3F2LA 2F58H 3OMAB 4IIQB 4NFCA 2OJ1A 1IGFL 4HG4J 4X0NA 3MLZH 5IFAH 4WO4B 1J0JA 1KXVA 2E9IA 1EO8L 2WVTA 3P4LA 3RE0A 1QUNB 4GKSB 4XN4A 4GNKB 5EC1B 2OYKA 1CGVA 1D5RA 3LZQA 5T3XE 2HH0L 4ZNCD 2EDQA 3LSOA 4GYBA 4ZUTB 4U6TA 3ROLB 3F58H 4GUPA 1ZGLM 4I4WB 1KEGH 1KEML 1M9WA 3MBXH 4YHZL 3RY6A 5CEZH 2E86A 4K71B 2I32A 3QZLA 3ASWA 3STZB 1RSFA 4RX4D 3D4GA 3SY6A 3Q3GA 5EIVA 1HINL 4JE4B 2E27H 3UDWA 4MSWB 3HUJB 4D0DA 1Z5LB 1J05B 1A3QA 1VSCA 5I1CH 4PBDA 1DUYB 4Q6YA 2CHDA 4ZO6A 2GJ6A 3JWDH 5TE6L 4A67A 1JK8B 1OAUL 1JBJA 3AG2B 4RMSA 3MLXH 4KOBA 3MV9B 5IQLA 5C0FA 3U9PL 2ZZUT 3F7YB 3O4LA 1X6NA 4N1CA 1NFDA 1TTGA 3B8YA 4XTRC 5LAXA 3DOHA 4EZMA 2VABA 1T89C 1K6QH 1ZVHA 2CGRH 3TV3L 4XPFH 3U7WL 1MWAH 2IAND 3SPJA 5HDBE 4I85A 5HJ3B 4K5PA 3PU7A 4HETA 2YMOA 5CJQH 1NUDA 2FGWH 3IDGA 3GXPA 3QPQC 4GI8A 3HB3B 5KS9A 1WLHA 1LL1A 3ZE0F 5B8CC 3QFGA 5BW7C 2PF6A 5DZNA 3MRGB 3CFIC 2M83A 3ESMA 4XNMB 3MN8A 3G04B 2X9ZA 1X9RA 3U2SB 1FAIL 3RPBA 3T6VA 1I1AA 2UWEE 4FQXA 3QNZB 2QV2A 3ZE2B 1NKRA 2L8AA 5CBAB 1JNNL 4GRLA 4WHTB 3GXTA 2PYED 1PZBA 3TYGL 2OLDA 1QG3A 5D71L 5IHLB 1FLTX 3FFDA 4YDKL 1XD1A 5EU6B 5GS1B 4UTAL 3ZN6A 1WCBB 4U7KA 1UM5L 1B4TA 1AYRA 1FYTA 5EBLA 2F5AH 2ZTBA 1JE6A 3PYCA 3NP4A 1J8RA 3D0LA 2DQJL 3VI4F 5H2BB 3P11L 3HMWL 4KMLB 1CO1A 5TPWL 2DLFL 2I9TA 1P6WA 3IJ8A 1EAOA 5LG6A 1CD0A 4XP6L 1FGNH 2XY2A 4HIEB 4U6XA 1KXTA 1R24A 4HJIA 3S35H 5IMMB 5EORL 2OXGA 1CFBA 5AKTA 1DP0A 2FQGA 4IU2B 2W80C 1KCWA 3II3A 2GEEA 3UMNA 5D7HA 4J4PA 3UYPA 4ZZKA 2Q8BL 3FRPB 5T5FH 4B3VA 5BNXD 4MJ6B 3WELA 4N6RB 1XB6A 4HS8H 3HS8A 1YCSA 2NT0A 2JJSC 1NINA 5LG1A 2FO8A 4BFIB 1T5XA 4ILDA 3PRZA 1JCKA 3TA3B 4EVNA 3HRZC 1FFRA 4TQHA 5KVEL 1VB9A 4R7LA 1T21A 2GJ6D 3K1DA 4EDWL 1WZ1L 4YVUA 2IQ9L 3O6KH 5A2CA 4ESKA 1D5BA 3HE6A 3MLWH 4YX2H 5C97A 2X7LB 3MPCA 3H9SD 5EDXA 1J1OH 4UIMA 2J88H 1XZ0A 3QWOA 4FQJL 4IOSA 3MREA 4OCYL 4P5MA 5B1JC 3VWJB 4F7TA 1UYWL 4MLSA 4QI3A 1X44A 1Y1DA 4XNUL 2HVJB 3AG4B 4QXGL 4GLRH 2FYVA 4FOMA 1JVLA 1AHWB 3P02A 4H0HB 3O0LA 5I17B 2BSSA 3ALWA 4ZFOB 2FX8H 3IBEA 1AZRA 2NZ1A 1B88A 4BFBD 2AEOA 2H32A 3I85A 4CGUB 3QQ4A 1A1MB 3QCVL 4XI5C 2VOTA 3QDGD 4LF3B 1WC7B 6FABH 2XWRA 4Z77B 4XP1L 1HXYB 4WHYG 3R8BB 1E90A 1IC4L 5BQ7A 1I1AD 4Z9KB 2A4CA 4FQXD 5ITBL 3BAWA 4Y1SA 4GAJL 5FKPB