1ET5A

Crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 93
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A02
1AIZA 1AZUA 4AI7A 3FU7B 1T5KA 4G7SB 2GSMB 3AW5A 1OF0A 3D12B 1SFDA 2YAPA 1NIEA 4RH4A 4UAHA 3SQRA 1KDIA 5LDUA 4WTQA 1JVLA 3H56A 2PLTA 1PLCA 2XLLA 1XMEB 2B08A 2CUAA 3WG7B 3IE9A 3EH5B 7PCYA 4DP9X 2NRDA 2BWIA 4G71B 2XVBA 4DP6X 3ABLB 4E9TA 3QJQB 4Q8BA 1JZFA 1GS7A 4E9WA 1MZYA 1QLEB 1L9RA 3FU9A 4JHUA 3SBQA 1R1CA 3FT0A 4GP8B 1GS8A 3BVDB 2BWDA 1AZCA 2R7EA 1DZ0A 4W1TA 3JT2A 2FT7A 2OCCB 4HCGA 1KBVA 2GB2A 1NICA 5EHFA 1TEGA 4UANA 2HX8A 3GDCA 4EF3A 1F56A 3FYIB 2VSKB 3T6VA 4YSPA 2CALA 5B3SB 4AX3A 4NAJA 4DPAX 2W88A 3FU7A 4W9ZA 1WS8A 3X1FA 3ASNB 1AQ8A 1M57B 3PLYA 2FQEA 4JKNA 1EHKB 1OE3A 4YVUA 2ZWNA 5PCYA 5I26A 1OCZB 3X1EA 1RKRA 5B1AB 1KYAA 2JKWA 2W8CA 3UABA 3FQ1A 4BDVA 5I5IA 1SF5A 2J5WA 1FFTB 4HZ1A 2VMJA 1NDTA 4AZUA 1BQRA 3WNIA 1NIAA 4HAKA 3KW7A 4MFHA 2HX9A 1BQKA 3FYEB 4YSCA 2XV3A 5IY5B 2AZUA 3PPSA 1XB6A 1AOZA 3NSFA 3FS9A 4DP5X 3FPXA 3FQ2A 4YSSA 1AANA 2H3XC 2AVFA 2MRYA 4YSOA 2DYSB 4KNTA 1OE2A 1N68A 2RACA 3GYRA 1SJMA 3MBWB 4N4YB 3QJVB 4HCIA 5D4JA 2PPFA 4KO7A 5TK2A 4BXVA 1JXFA 1OCOB 2XXGA 4FA7B 3ZIYA 1WA0X 4DP2X 2QPDB 5B1JA 1ZIBA 2UXVA 3NYKA 4A2HA 1L9OA 1GR7A 2PPAA 2X87A 1AS6A 4ENZA 1BXVA 3WKPA 3V9EA 3WNJA 1YLBB 4N8UA 2MTAA 2J57A 4YSQA 3ZDWA 3QPKA 3JTBA 2QT6A 5I6MA 2GI0A 1J9RA 2BP0A 2LLNA 1ZPUA 4BWWA 3S3CB 2CBPA 4WKXA 1NTDA 4A2DA 3HEIB 1ZV2A 2UXTA 2J55A 2OV0A 2YAEA 2BHFA 2P80D 5ANHA 1SNRA 3IBOA 1A8ZA 3UADA 1SHXA 4F7KA 1IBZA 4M3HA 2IWFA 3AG2B 3PCYA 3NJFA 3X1NA 4E9XA 2AANA 3CVBA 2HLEB 2PPDA 1A4AA 5D4HA 3PAUA 1V10A 2VW4A 3NJJA 3TASA 4QKTA 2IDQA 1NPNA 3IEAA 2AZAA 4BDVB 1JZHA 1GSKA 1SDDB 4YSAA 2EIJB 3IN0A 2BO0A 3TBCA 4PCYA 2XYBA 4JHVA 3HB3B 1MG2C 1L9QA 1GYCA 1ZDQA 3TU6A 2HZHA 3FSZA 4AKQA 2PPCA 2DYRB 2BW4A 2X88A 2YAHA 5PAZA 4GP5B 1ETJA 2EIKB 5F7AA 5I6PA 1JVOA 1AS7A 1AG0A 3AZUA 4DP0X 3WIAA 1FWXA 4BK5C 3T6XA 2FWLB 1KGYE 5I6NA 1WA2X 1ILUA 1GS6X 1E5ZA 2FTAA 4A2FA 4DP4X 2HRHA 2YAMA 3NJKA 1ZDSA 2FQGA 3S8FB 2ZONA 1KCBA 3NJIA 5B7MA 1J5DA 2EIMB 3X2QB 3EH3B 3OMIB 3ASOB 2CCWA 2HX7A 3PAVA 4ZK8A 1NPJA 3NSCA 3OQRA 4DPCX 3S3BB 1W6LA 2WSDA 2UXGA 2BZCA 1W6WA 1BXAA 3CVCA 1PZBA 1A3ZA 5I5MA 2GBAA 2XX0A 1KDJA 1GY2A 3FPYA 1JOIA 4L0PB 4A68A 2ZOOA 2BP0B 2JXMA 4KO5A 3ERXA 1PZAA 2P80A 3OMAB 1MG3C 2JFCA 2YAFA 3FU8A 1AACA 1TKWA 1XB8A 1SDDA 2XU9A 3FQYA 2CAKA 2E86A 1KV7A 3ABMB 4DP8X 2FJSA 1A65A 1M9WA 1V55B 2Q5BA 3G5WA 3T9WA 4F2FA 2YAOA 1NIDA 5B7FA 1ADWA 1PNCA 1W8EA 4YSEA 2IDSA 1QHQA 2UX7A 9PCYA 1ASOA 4G70B 3UGEA 4A66A 4KNUA 2YAQA 5AKRA 1AZNA 2GC7C 3EF4A 1CUOA 4X4KA 4E9SA 3QQXA 2BZ7A 1IUZA 4GXFA 1JERA 4HCFA 3X1GA 1E67A 3AG3B 3V9CA 2EILB 3ZX1A 1PZCA 3NSDA 3ZBMA 2QDWA 3C75A 2XXFA 1AAJA 1X9RA 3BQVA 1XB3A 1AG6A 1B3IA 2ZXWB 4YVNA 1BYPA 2PP9A 1ID2A 4YSRA 1HFUA 2A3TA 5AFAA 2H5UA 3KW8A 3GXUB 2VSMB 3SBPA 4DPBX 2I85A 4G7QB 3S8GB 1CC3A 1CURA 6PAZA 2VN3A 3CDZA 5AZUA 5I5JA 3ABGA 1IBYA 1NIBA 2HRGA 4YSUA 2PCFA 1UATA 4KO9A 1HAUA 3NP3A 1PNDA 3OM3B 2VW7A 4HIPA 5A7EA 3NSYA 1PLBA 4G7RB 3CZUB 3NJNA 5FC9A 1EZLA 1J9SA 4G72B 4K9JA 4HALA 2WO2B 1BXUA 2FT6A 4GYBA 3T6WA 2XWZA 5B1KA 2TSAA 3NP4A 5I6LA 2DWSA 4KOBA 1BQ5A 1CYXA 1SF3A 4CSPA 4F2EA 4KO6A 1WAEA 1A4BA 4DP1X 1BAWA 1L9SA 2EINB 2XUWA 1OCRB 1AR1B 1E30A 1WS7A 2Y1AA 3T71A 2FQFA 1RZQA 2N0MA 4DP7X 3FSAA 1KBWA 2GIMA 2WO3B 1RCYA 1NIFA 2DWTA 2FQDA 4YSTA 5I6OA 2UX6A 4HHGA 4M4RB 3T6ZA 1E5YA 3MX0B 4CSZA 1AS8A 1E65A 1V54B 2VW6A 1TEFA 1PCSA 4UF7C 1ILSA 3DKHA 1HAWA 2GC4C 3RYMA 2AFNA 3ABKB 1JXDA 3WKQA 4A2GA 6PCYA 1JZEA 3AG1B 2PCYA 3NT0A 3DIVA 1JZJA 1OCCB 1RZPA 2IDUA 1WA1X 1N70A 3DTUB 3UAEA 4A2EA 3NJLA 2BW5A 3FSWA 3CDZB 1ZIAA 1PF3A 4YSDA 1SHWA 1DYZA 1PMYA 5E9NA 3QJRB 1I53A 3AY2A 1NINA 4GP4B 1CYWA 3U25A 4KNSA 5TK4A 1M56B 1X9UA 3OD3A 2XV0A 4E9QA 2B3IA 3NJHA 2YQBA 3H4HA 2BP8B 2GHZA 2J56A 4HHWA 3OMNB 1AZBA 3QJUB 2DY2A 4NERA 2PP8A 1GW0A 4P5RA 7PAZA 1FA4A 1IKOP 2FNWA 1PLAA 2QDVA 1OV8A 1L9TA 3WI9A 4NB7A 2IDFA 2IWEA 5I28A 1IC0A 4P5SA 2PPEA 3CVDA 2YXWA 1KCWA 3TBBA 1ASQA 3FSVA 2IDTA 3L45A 8PAZA 1PY0A 1JZGA 2IWKA 2UXFA 1OE1A 5I6KA 3NJMA 4GY4A 2IH8A 1OOWA 2YARA 3N2JA 1JXGA 2OJ1A 4A67A 1L9PA 1BEXA 1VLXA 2CJ3A 2Y69B 3QJTB 1MZZA 1GY1A 1J5CA 1TU2A 2HXAA 1ET7A 3CG8A 3X1BA 5B1BB 5B7EA 2YXVA 2QPEB 4BWTA 1MDAA 3EHBB 4AKOA 5B1JC 3AG4B 1NWOA 1AZRA 1QNIA 1J9TA 1ET5A 3UAAA 2FT8A 3S3DB 4E9YA 3N55A 2I7SA 4BWUA 2PP7A 1URIA 2VM3A 2VM4A 4Q89A 2BP8A 2XV2A 3UACA 1A4CA 1SFHA 4PAZA 3QJSB 4FAAB 1JZIA 2R7EB 3PXLA 2H47C 3NJGA 2DV6A 4KOCA 2Q9OA 4E9VA 3PAZA 3IN2A 1ASPA 2TSBA 4AKPA 1BYOA 2IH9A 4E9RA 1ET8A 3H4FA 2IAAC 3EH4B 3SBRA 1J9QA 4YL4A 5D4IA 2I7OA 2XX1A 5F7BA 4QLWA 1PAZA 4TXVB 3TA4D 1NZRA 4BXSV 1NWPA
chains in the Genus database with same CATH superfamily
1AIZA 5CEZH 5DVKA 5DZPA 3T0WA 1UB6A 4AGLA 4RRPA 5CD3A 3AW5A 2VE6B 3UYPA 1CI5A 4ZAKD 3ZDXE 3BP7B 4TVSa 5D1XA 4O51A 1RUKL 1FNGB 1KCKA 2FJHA 1FNEA 2X38A 3VDBA 1BQLL 4OVUA 5F7EL 5TF1H 1T5WB 4NUJA 2OP4L 4F7EB 2VH5L 2F7IA 3K2MC 1XMEB 3SJVA 2B08A 1R3LB 3EH5B 5G4OA 3FCTB 1G1KA 3DURA 5KSAB 2YC1A 3II2A 4P2RD 5F89A 2EDXA 1KIQB 2XVBA 4X9HA 5CEXB 2AXGB 5E2VL 1XO8A 3MRBB 2WBJA 3WIHA 4PJHB 3VRLE 1GS7A 4NZRL 4E41D 3Q06A 4XNUH 2JKRM 3DGCR 4BELD 1HVXA 4HMDA 1N0XH 3GIVB 3HBPA 1J1XL 3B9KC 4DZ8A 2GABA 3KBHE 5JYLA 3FOLA 3T8VA 2VR5A 4R83A 1VPOL 5DJDB 2BSBA 3C5JB 1Z9OA 3NJXA 4N2KA 1E90A 1HZLA 1PTZA 3U6XS 4HUUA 1N7ML 3AS3A 3BIAX 4WO4B 1SQ2N 4NPKA 3FUEA 1L9NA 2IG2L 2ID5A 1I8LC 2HJKB 3KS0H 4AX3A 2APVA 4Z7QE 5CN1A 5MEQA 3S5LG 3V6OC 1IC4H 4U7KA 5HHPA 4W9GC 1AJ7L 4NHCH 5CMAA 4W4NA 3BZEB 3PAYA 3U0TA 4TOYL 3X1EA 3FQRA 2R1XB 5DDHA 2GFBB 4MHHG 4UUJA 1DQTA 3MTXA 1EGJL 4NKIH 4RLDA 2AK4D 4JCWA 1JTOA 2NY0C 4MJ5A 4MSWB 3S98A 3ARWA 2Y2WA 1JTPA 4YAQB 5CXPA 3DI2B 1A1MA 3KYMB 1DJWA 3F85A 4ZX4A 1N0XL 5I18H 3C2AH 5DYOB 1QRNB 1R5WA 3SYAA 1AANA 3EO0A 4X7SL 5K9QG 4OM0L 5CP3A 5IMOA 3RZCA 3ZGHA 2AEWA 3QP3A 3PL6D 5IB3A 2W94A 2A74B 1N68A 5DRWB 3WNLA 4KTYA 1CZ8L 1JWUA 4YJZL 3HPJA 4GI9A 5L0QB 3GZOA 3UGXA 4Q4EA 5EOQL 4UQ2B 3UAJD 4XNMB 2Y2TA 3GJFA 4XOEA 2CH8A 2BINA 5HHXH 3ZYJA 1PZSA 2ZF9A 1QOKA 4J8RA 1IC4L 4JY6A 1OK0A 4TUJA 2FJGB 2GG1A 5F88B 4X4YA 1A1NA 4A55A 1T7WA 4Z7UE 5I1IH 5KBMA 3TBSB 1QFHA 3SDCA 1D7BA 1CO1A 3DETC 2J57A 3A4FA 1I9IL 1NGZA 2VGLM 2ZUUA 2EEFA 2NY6D 3MUZ1 3GSVA 3U6RB 5KSBE 3RDTC 3Q5TA 2J55A 1D5BB 2APTA 4PJCB 1YEDA 4XBMA 3ZE2F 3C2AL 1SHXA 3FFCE 2BVUA 4RGNB 4LESA 1WICA 2RCSH 1JZDC 2O5YL 3QHZH 1FVCB 2V3DA 1T83A 3FB5B 1MFAL 2OSLA 4KUCF 4OF5A 5JHAA 3DNKA 3VX0A 3RVUD 4GRLA 5GISL 2FO1A 3Q05A 5D2LF 3K71A 2CRYA 2YBRA 4OU3A 2IH1B 1FJ1B 3ZTCC 1NAMA 3GTNA 3IDJA 3WLWD 2CJUH 3TVMB 3OHXA 1R5IB 4CADB 3CZKA 1UVQA 4MCMA 3SO3C 4YSAA 4M93B 4DGIH 1X7QA 4EDXA 1CLYH 5GGSB 2E9IA 4XNDA 2E8YA 4TVPH 5CWSA 5I1IL 2VSCA 4YBLC 1GXEA 3BAEH 3K46A 1JL8A 2DLHA 3LIUA 5C6TH 3TO2A 5IQ7L 1HEHC 2N0KA 5IHZB 3HE6C 3JV4A 4RISH 1NMBL 4G1MB 4B9JA 1UOVA 3ETSA 3KR3H 1P7KA 4Z3IA 4G8EB 5E1IA 2OXHA 4IBYA 5IR1B 1CGWA 1JNLL 4L3EE 4Q6IA 1KGYE 4WI2A 1ZSDB 3CFDB 3ECVA 5CD5C 2W92A 4TULL 4U6HA 4XXCA 3MV7D 3UPRB 3DHUA 2RCSL 5I8EA 2ZXEB 4K07A 3NJIA 3CC5A 3QHZL 4P2OB 4BK8A 2H6OA 2X2IA 1KFAH 4M7ZC 3MRJB 4NWUH 3Q8CA 3BT2L 3CD4A 1SOKA 2OMWA 3KPRA 3PY9A 3QZLA 2X9XA 1SDYA 4QWWD 1N12A 4NNXA 5KYYB 2NUPA 5ECGA 4ZFZA 3VGFA 5HPMA 2CJUL 3FPYA 4L0PB 4CC4C 2FLRT 3ZDYB 3QJOA 5E1AA 3U83A 1PZAA 1YECH 4OCNC 4EZKA 1PZ2A 1F3JB 3EGXA 2Z7ZA 1BBJA 4K3DH 2B2XL 5CBEB 4AYID 3TYGH 5I0VA 2IO5A 1TJGL 1TPXB 3BAEL 4FULA 5HSFA 4PB9H 5GGTA 2HRPH 4RISL 4GG8A 4TM9A 1V55B 5EZJA 3QDAA 5ABZA 4JJ5B 1U92A 1ADWA 5IVXF 1CFQA 3QFJB 2DL9A 1CDJA 1A7BA 1FZMB 2V7NA 2Z65C 4IIQB 4AJYV 4CKVX 4KV5E 3NSJA 5C0CB 1URLA 3KYOA 1AZNA 3B83A 2EZ0C 4BFFA 5KSAC 2G30A 2P49B 4HUNB 5DD5L 4UOJA 4F9LC 4I0KA 4Z7NF 2DJUA 2X6CA 4EI5A 2Q1EA 2XQBL 4LSUL 2NSMA 2R2CA 4TNGA 4WY7H 4ANVA 4NWUL 5IEHB 2Y1VA 4MD4A 2R83A 5DZ9A 1WQVT 2EH7L 1YYCA 2V0AA 2XPYA 3BFOA 5CU5A 2I9TB 4QRAA 3AM8A 5F7FA 5HI3C 4X9BA 5FM4A 5CLXA 2Q7YA 4W68A 5T1LA 3VO0A 4YXKH 5I5JA 1BQSA 2WUCH 4QRRD 3TYGL 3IMVA 2OTPA 2O26U 5LKNA 2ITCA 2JTDA 3D9AH 1JNNH 1F5WA 4PB9L 4FQIL 4WO4C 1NMCB 2R0KH 1A1OA 3QWRD 2VLRB 1HTYA 4PHXA 3NSYA 3RTLA 1I1FB 3KEHA 4G7RB 3TNMA 1GTFA 1P1ZB 3THMH 2J8UB 2ZAGA 2BJMH 4G8GD 3UJIH 3MJGX 5L2KB 3P4MA 4MLSA 1S7TA 3V7AG 4LKXB 2B1AH 4G7YH 4PG2C 2MKLC 1B0RA 3ZE2E 1M6OB 2RBLA 2Y5TA 3PIQA 4HALA 4XP6H 4JG0H 2R1WA 1E7VA 4HIHB 4HKZB 2XWZA 2JSFA 1KLUA 3NCWA 5C6PB 2UZXB 3RIFK 2FBJH 4OGXH 4PJDB 3EGDB 4KUZL 5HJGA 1L9SA 1WAPA 5DJ6A 3T0ED 5D2LE 2BNQE 3DRQB 4H1LH 3FT1A 4U7SA 1BVNT 2B3RA 1O9ZA 1RMFH 3QDGD 3SE3C 2XCMC 4Y4FB 2F61A 4NRYA 5DF0A 2ALAA 2ENJA 3MROA 2VXVL 2XJKA 4FJZA 1J7VR 3NMEA 4LSPL 1E6OH 4JFFE 2FECL 3C5SA 4S2SB 2VXTH 4YSTA 1CVRA 1LDPH 4MNHA 5INDB 2A74C 1RULH 1XR8A 2UX6A 4AUUA 1EO8H 3V4VA 3VXPB 5F9JB 5L0QC 3D9AL 2NMSA 1MCRA 5ADOL 7TAAA 5JIKA 3I6GB 4JPKL 3RPIB 1F6AB 3PWJB 4X5XA 3QPQC 3OPZH 4NX0A 1HDMB 4WW2A 2EYSB 4A2HA 5IFJA 3SPJA 2J1WA 2OR9H 2AXWA 2W1NA 3UJIL 3UZQB 1HAWA 4Q6YA 4CC0A 3FT4A 4KZDL 1ZHKB 4YDVA 4E0RA 2DQCH 4A2GA 1DCLA 2WAHA 4XP6L 1IC7L 2E75C 2AJYL 4ZMWA 4NCC2 1M42A 5FFOA 3NK4A 3NDYE 1ZT7B 3BWAA 3ZO0A 1E43A 1BVNP 1LP9B 2DICA 2FBJL 3DGGB 4ODUA 5C0FA 4CDHA 3K6NA 3QXWA 1WBXA 4LOUC 1HK6A 2ATAA 3IKCA 3M07A 4X4XB 3ZRFC 5HXMA 4NQDA 4MDIA 4ZX5A 2X1PA 2E7LA 1RMFL 3VAEA 4B9ZA 1FPTH 2BFVH 4RGNC 4S1QH 5EBMA 2P5EA 3O2DA 2AV7B 3GRWH 2V37A 2XV0A 4HG4K 1E6OL 2PXYA 5CM1A 5L2JA 4PLKC 4MNQE 4PRIA 2YHGA 1B6DA 4U1HB 1LDPL 1XR9A 4CUCA 4HXAH 4ZI8A 4QRQA 2QJDA 1EO8L 4H5SA 4L29A 2E8ZA 4N0UA 3MLVL 3KPPB 1ZY9A 4AH2B 3PQYA 2KQNA 5E24E 2K6ZA 2W80C 3MC0A 1G1YA 1ZHBB 5IVXE 3TVMC 3U9WA 4QAWA 1HZHH 5I2IB 1P6AB 2XWTA 1OV8A 1L9TA 4M93C 5DRNA 3WI9A 3D0VA 3CSGA 2OL3H 1FNSH 3G5XA 4WKZB 3TWYA 1FF5A 1CGSH 3FB8B 1KCWA 4KQ3L 1NBZA 1AHKA 5F21B 3QJHB 4AQ1B 3MV9B 3QXTA 4E68A 3MJ8B 1KY6A 4AITA 4Z7NE 1U8OB 3CZFA 3EF7A 5DMYA 1KCRL 1UUSA 3RLSA 4M9PA 4GG6B 2YZ1A 1ACZA 5FYLD 3QQ9D 1B2WL 4CJ0A 1X5YA 5L7XL 3OKNA 3VXNA 1VLXA 3ASWA 3HC0B 4XNAA 5I6XB 4RSYA 2FUTA 1QLFB 5C7ZA 4G6FD 2DWEB 2LT9A 4TLSA 3REWA 1J5IA 1K2DA 3LKSA 4P2OC 3GRWL 4U0QB 2AI0H 2QPEB 1CICB 3A23A 3HPLA 4KFMA 1NEUA 4DESA 1WC7A 2R23A 4UTBH 2GSGA 3L54A 5KZCB 2ARJA 4HXAL 1J87A 2YQGA 2HT4C 2X5PA 2XG4B 2YUXA 5J13B 3NBNA 3F6JA 2B5IB 2WXIA 4UTAA 4NZTH 3QNXA 4PGDB 1FO0B 4M5YL 5DEFB 2HVBA 3SKNA 1UHVA 4WUUA 4IBTA 3LNDA 5D71H 1HZHL 3R7RA 2ATKB 3MREA 2OXGA 3GMNA 1FNSL 4PJAB 2BRRH 4PWHA 3HOGA 3OGOE 2G3NA 5D2NA 2QR0A 3QUML 1TPXC 4QI3A 1PZDA 1REIA 3K4AA 5HYSB 3PV6A 5DU7A 4EOWH 4GUPA 4P46B 3U30B 2HFEA 1COBA 4YXHL 4J7RA 3ZTNH 3ZTDC 1KMGA 3N41F 1FG2B 3O4LB 5D5MB 4M8RA 4M8UA 4IIQC 5IZ7A 5BW7C 1BBDH 2J7LA 5C09A 3O6FD 1MEXH 3H56A 5I8OH 3FN0L 4KTDL 4D9RE 5E5MB 1NC4B 2F5AL 2R69L 3F12B 2NY4B 4X80L 2N7SA 4G6KH 4JZNA 3CV5A 4NXKA 2WTRA 2NPLX 3ILDA 4PBVC 4J2XA 3FRPB 4UTBL 3MRLA 3SDAA 3ZZ1A 4AM0B 2X4PA 3MJ6A 4Y1AE 2P1YA 4WI5A 3KYAA 1BAFH 5LGHH 2PYFB 1FO0H 5IROD 4NQED 1H0DB 4F7PB 1QBLH 3MCKA 5D71L 2VDMH 2D03L 4GW4B 3CVHB 4KKNA 1GZPB 2BRRL 4CU7A 1JZFA 3Q2CA 3KXFB 3VXOA 3EHBC 4N8VB 1XCWA 5H4ZA 1I31A 3MRGA 1IBFA 1GS8A 1NMCC 5AVRB 4K15A 1RJYA 3OC5A 2EH8H 2OMXB 5FECB 4JO2L 2KUTA 1MCBA 5DD1H 4Q2ZB 5DZNA 3TT3H 2M2DA 2YEZA 4XHQA 5MERA 2Y3NA 2W0FB 3QUYB 2CDEA 1TEGA 4OFYA 2A9NH 1Q4NX 1CS6A 3DGDA 3MLTB 4QY8A 1AD9A 1G87A 2MOQA 5AZ2H 1HNGA 3NRFA 4MHHI 1WCQA 1VKXA 2XV6B 3FU7A 4JFYB 4W9ZA 2QQNL 3DBXB 3ASNB 3W11C 2LTQB 4LHQB 2BP3A 3V4LA 4AYSA 3DUSA 1BAFL 5LGHL 2XTLA 4Y4FC 3VNYA 1B0IA 1BWWA 3GB7A 3PWPA 1I1CA 4CSTA 3G5ZA 2BX5A 3CVHH 2J5WA 4BKLB 4RBPH 3HMXH 2MQCA 2V2WA 2VMJA 1MCPH 3BWZA 1S7RB 3ZPDA 1KBGH 1UD5A 2OMZB 4V2BA 3VUAA 4P06A 4HAKA 1MFDH 3EAKA 3VD5A 4AVKA 2WAQA 2C9SA 5T3XH 1VERA 5HBBA 3ZHKA 2AKRB 4IDJL 4QUOA 3ULVF 3L2LA 2KZKA 3FPXA 2EH8L 3CLFH 1T0NA 1XGPB 2AJZB 5BZWA 1S7SA 4MZIA 5TJWK 2EEBA 1PEZA 1TCRA 4AZ8B 5I1AB 3MRNB 5EIIA 2D2OA 4HC1H 4QF1B 4MQ7B 3AXLB 4F20A 4JQIH 3IK2A 1U8CB 3ARGA 3CDGB 2XFXB 3LZQA 4FNUA 3D25A 4NKOA 4OD1H 1A7OL 2DM3A 2D7MA 5E9DE 5AZ2L 3V55A 4WW1B 4P4RA 1K8IA 1DBKH 4JB9H 4M6OL 3RPBA 1NDMB 2JNZA 1BD2A 3ELAT 3CH1B 1H3WM 5CAYB 1KN4L 2WZPA 1K4DA 3SJVE 2Q76B 4QRFA 1UM5H 4TRPH 1P5VA 1YYLL 3CVHL 1HQRB 3KL5A 1X44A 5LNGA 1GZHA 3GMOB 2QGEA 4W9IC 3GSWB 3HJ0A 5ADPH 1B9KA 4KJWC 5IVZA 4LP4A 2IANB 4A2DA 4MYPA 5T3XL 4HPYL 2CE6A 1JXJA 1XCTA 3MO1A 3O3UN 4MXWH 2DEXX 5FO7A 2EDWA 4M3HA 4LLYB 5C0NC 5G4NA 1P5UB 5ISZA 4MNGA 3N1MC 1KCUH 1C12B 4FTDA 2WGXA 4HC1L 2CHNA 2BRQA 2V9UA 3MLYH 3SBWA 1I7RB 2GSIA 2HSIA 4L9DA 4BGLA 4AQ1C 3GUTA 5F0LB 4FFZL 2BXYA 4L5FE 1EXUB 4MCYB 1JZHA 3UBXB 1X5AA 1RZGB 1IO4C 3FTZA 3WU1A 2E9JA 2ZJSL 1DBKL 1F2QA 5BJTA 5I6XC 1U8KA 3ARSA 5DJCA 3GMLA 5L4JA 1DVXA 4N2EA 4QRPA 4ZO7A 4JDEB 4JN1L 2ESVD 4PW9A 5EUKB 1MVUA 3TESA 1Q90A 4R5VA 4TRPL 1FP5A 1V7ML 1WWAX 3FK3A 1CICC 3GMMB 4M8QA 3CMOH 2AJUH 1TVBB 4X42A 2DIJA 2XBTA 3CFEB 5D7IA 3FB7B 1FFPA 2CSPA 5J13C 3X17A 3CBJB 2B5IC 4P57B 3UROR 4A2FA 1X7TA 2ZSWA 1UOLA 3GNMH 2YQ2A 4PJ6A 4YL9A 5AW9B 5SWSD 5AD0B 1FL6A 5CLZA 1BGXH 4MXWL 4CGUB 1UJ3A 2VN5A 4MJIB 3KM1A 4R4NC 4OFQA 2WANA 3X14B 2CLRB 3EH3B 3FQTA 4HEPG 1RVFH 2DQTH 4KX9A 4FQHA 5EOTA 1KGUA 4XC1H 2LFEA 4UNTA 4C83B 5TE6L 1XH3B 1L0XA 4OLEA 4PJ9D 2Z6FA 3UTTD 5BQDA 4P46C 1KIRB 3U30C 3WELA 5LGJA 1BHGA 2GBAA 4OUUB 3VQMA 2J3SA 3P73A 1A5FH 1HC1A 2NW3A 2G5RA 4L1LA 4MJ6B 3BCDA 4WV1B 3UZEC 3V6OA 1MUJB 3WN5B 4DKFL 4U1NA 2WQAA 4OV6F 3CFMA 1G9MH 3D05A 2NY4C 3N91A 3QO0A 3T9WA 1M9WA 1WCBA 1OSZB 4GKSB 4X6FB 4ZW6A 3U7YL 5IT2H 1MFCH 3MRFB 5FUCC 3CMOL 3SKMB 5IQ9B 3STZB 4HJSA 2XQYK 4DN4L 4V11A 2A9DA 3ZKNC 4U3CA 3ULVE 2IFFL 5DJ8A 3FU3A 4HEPA 2VDPH 3MXWH 4EXKA 2PN5A 3DSFH 3QQXA 2J1KA 4M6MH 3RGHA 4RZCB 1HOEA 2ERJB 2F6AA 3FKUS 1BOYA 1X3DA 2FIRT 4GW5B 4K23H 2WXNA 1DQJA 4XC1L 4XCYA 1S9XB 4ZQKA 5IB5B 3V4PH 3HR5B 2V8LA 5DVMA 2Y5EA 2CD0A 1P7QA 1TNNA 2GEEA 2VZUA 3BQVA 1XB3A 1ECYA 3DXAA 4YO0B 4YVNA 5DD6B 4KXZH 4GBXD 3V52H 2H1XA 3L4UA 4LU5H 1N6VA 1G7HA 2C8NA 3LN5B 3U36B 2BOBB 2WNKA 4XGZB 2GUOA 3GMPA 3QUYC 3W39A 4PWGA 4MA1B 5AZUA 3L7FB 3MOQA 2VQ1A 4JKKA 2X0VA 3VTAA 3DSNA 2Y7QA 3NGBC 1PYWA 3WTSA 5I66B 2ZQKA 5AZEH 2QPSA 1MFCL 5KW9H 3LKQB 1UA6H 2LAGB 5JO5A 2CDGA 4L8DB 3J27A 3TBTB 3O45A 2K7PA 4XMLL 4OD2A 2DJMA 3QXVA 4WW2F 2JB5L 5TQ2L 4I7ZC 1NH6A 4Y9GA 4XWOD 4XP9H 4ZFOB 3U0PA 3AXIA 2X44D 4M6ML 4NKMB 3UYRH 4PJFA 4AV5A 2XJLA 2HLFD 5HDBF 2XWXA 1NC2B 4R4FL 2P8LA 2YGNA 3CFJA 4LIQE 3UX9B 3IFLH 4IU2A 2Y7LA 4HFUL 1Y0LB 2A6JA 1WS7A 3QEQB 2QHLA 3HS0A 3NCXA 4MQTB 2I07B 4NEHB 3KPRE 4OJEH 3RIKA 1SEBB 4MD0B 3P3SA 5AVSB 1LYQA 4LLDB 3IS1X 5L4IA 2D0FA 4M1CC 1W8NA 3IMBA 2ED8A 3MRPA 3WXWH 3VSVA 5MHSE 4S10A 5DA0B 4Z76A 1EDQA 1XGYH 3GINA 4POYA 2CBMA 1YO4A 2B0SL 3L5XH 5AZEL 4H0IA 3TFBA 4PMEA 1OP5H 1XF4B 3WY1A 1A7RH 3HE6A 3WFDH 1KTDB 1X5HA 1WWWX 5KW9L 2FX9H 4ZZKA 5DZAA 2X1QA 3TPUA 3UTSB 4HWBA 3UGUA 4HJIA 1PLGL 1JUFB 2AFNA 3VWKA 3F83A 5FDYA 5I8CB 3HRZB 2FYYA 4XP9L 5J1AA 5C0AB 4FA8A 3RVWC 1XCXA 2XZQL 2CNYA 5D6DA 3OKLA 4JLRB 4Y4HD 3OJ2C 1WA1X 2A99A 2DM4A 5ICYA 1N70A 2KQMA 3UAEA 1AFVH 4HU8A 4F1SA 4OJAA 2OMYA 5HVWA 3IU4L 5FF6B 2O4EA 1EGJA 4TSBH 4YHLL 5G4MA 2EE0A 2PCFB 4P5TD 1Q9WA 5EZPA 4P3DB 5LAXB 4ZZFA 3MPCA 3EJQA 1X9UA 1P5UC 2NYZA 4A7TA 1A47A 1V8HA 4F92B 1H3PH 4TUOB 2DAVA 3VXQB 5TF0A 3WXWL 3MGTA 1IEAA 2BP8B 2Z9TA 3UMNA 1J86A 1XGYL 1W72H 1HQ4B 4RGOH 5F1IB 4HHWA 4MZRA 3VCLA 4JDTL 4FFVC 3WAJA 2PP8A 5EU4B 1IKOP 1I4FB 4H20L 1MKFA 3VFUB 3BP7A 2E0PA 1NCGA 3WFCL 5MEOB 1FNGA 5DEGA 1IM3D 2AXFB 2H2PD 4QXWA 5E99H 1FLRL 7CGTA 3RX5A 3NUKA 4F7EA 5B22A 3CVDA 4DEPB 4ZX6A 1BMGA 1XIWD 4ZFOL 1R3LA 3EZ8A 3FCTA 1S7XB 4XAKE 2MKWA 4KY1H 1A9EB 1G9MC 2Q2EB 1KIQA 4FG4A 4U1MB 5HJ3A 4F9LA 1A7NL 2AXGA 2YUVA 4GAJH 4G8IB 4TSBL 4MKMA 2GITB 4P07A 5KAQF 1D6VL 1QSEB 4IRZA 4NAQA 3RB7A 1L6PA 4N87A 5AKVA 1ET7A 3T65B 1FYTA 3GIVA 5CUSH 3FFCD 4BZ2H 1TR7A 2ZOLA 5D4QA 5AW1B 1P9MC 2OYLA 1QFOA 4D7BA 1BG9A 1T1XB 4E9YA 1NMAL 2A9ML 4DF9A 2DB8A 3ZKQD 2HJKA 3GK8L 2WWMD 2XA3A 5FW8A 5E99L 1PDKB 1PKOA 1XH2A 3QE5A 1JFQL 3GHBH 4JANA 4WV1C 4XMVA 4ZMVA 3WN5C 3BZEA 1UCBL 4NKDB 3D39E 4U1JA 5FGSA 3QEHB 4Y2NA 3SPHA 1TTBA 3P4NB 1GZQA 2CRZA 5HDBE 1CFNA 5KEZA 3IVKA 4ZTPL 4U05A 4NQXA 1DBML 2XX1A 3SIKA 4L3ED 1NPUA 3FH8A 3MNWB 1FFNB 3RUGA 4AVIA 1MJ7L 4YAQA 1AQDA 4AI7A 2MPAH 2WBXA 3KYMA 4I3RL 1MNUH 1R6VA 5CUSL 4AC2A 2P9RA 3SE3A 5B8CB 1HOCB 4NQDE 5DYOA 5F96L 4BZ2L 3QDJA 2YOCA 1OP3H 1FL5A 1QNZH 1G1OA 4Z7AA 2P5EE 1KTCA 1YEHH 5D7LB 2C4XA 4ZMYA 1JZ6A 2W9DL 5FKAB 1V05A 4PRIE 3V5KB 2A74A 5B39B 3ZE0F 4ZJ9A 3IGKA 5J56B 2DQDL 2UY7A 1BZEA 3D4CA 4N0UE 1DBBL 3GMQB 4BK5A 1JZ8A 5GS0H 3PQYE 4JO4H 1TZGL 4YR6B 3LZLA 4X99B 3Q9QA 1JIBA 3VXRB 4PRBB 3UEQA 7FABH 2ZWZA 1R1CA 5FGBA 3TBSA 4GP8B 3M1BB 2H0FA 1I8AA 3P3RA 5IBUB 1RZFL 3EDFA 3GSOB 4N6QA 4PJGA 4CRPA 4MCZB 1LO0H 3QA3B 3HVNA 3GI9L 2OCCB 1JDCA 15C8L 2A9CA 3DECA 4OB5L 2D3JA 3U6RA 1YQVL 5FUZL 3GDCA 2EECA 2MPAL 3P3UA 1D5BA 3E2HB 4BH8A 4DAGH 3IYLW 4PJCA 2X0WA 1E40A 2H3NB 4NAMA 4LSTL 5I76B 1QNZL 4YH6A 1KCLA 5B3SB 1OP5K 1J88A 1FVCA 1C5BL 1D5MB 1A6ZB 2AQTA 1O7DE 3FB5A 4EIGB 4IOSA 4X4YB 3B5HA 3S4SA 4OLUL 1GC1H 1VGKB 2O5NA 2ARWA 3FB6B 1N3NB 4N2DA 1OE3A 3V79C 4OZIB 1QTYT 1IAMA 4JRLA 5B3NA 5ID1A 2LFGA 2IH1A 5AW8B 1FJ1A 3TVMA 2WVVB 1R5IA 1YEKH 3C60D 2NY1D 4GAYB 4D0BB 4EJ1C 1S9WA 4WUUE 1A0QH 3BDYH 3GXPA 1DHKA 3LRKA 4HGWA 2BSDA 5HHME 1LE5A 1JDAA 5D5ME 1CGTA 2AZUA 5D2NE 1ZHLB 1FV1B 5LLIC 3FDWA 2KS0A 5DMJB 3HLKA 3HNVL 4L0YA 2AK4B 3ZQXA 4KAQL 1FVEB 4U6YA 1ZKAA 5IR1A 1R75A 5K9KB 2WOYA 3QUKB 2AEIT 3CFDA 1OTSC 3HRZC 4CU8A 3AAZB 4XAWH 3JWNE 3FH5A 4NO2B 1XTLA 3ELQA 5C09E 5ENWB 2G4EA 3UPRA 2OSXA 3HLAB 3M86A 5JA9A 1JXKA 4P2OA 4KUCD 5IFHH 2WWOA 3DV4B 4AV0A 1RZIB 1WA0X 4GAGL 1I8MA 1GC1L 5IMLB 4WFGE 3PG2A 2KH2B 4AEIH 4JPSA 4EZJA 2D31B 1UTDA 1D6EB 1I1YA 1PJWA 2A4ZA 2J5LB 4NQUA 5BV7B 3CAFA 4LVEA 5IQMA 1CD9B 3QPKA 4PG9A 4QRUB 5JPNC 1JZ4A 1GL4B 1ORSB 1RXLA 1F3JA 4DVBB 4Z8FL 1LXMA 4HJ0C 5CBEA 3U7WH 4B9FA 4IBUA 1IE5A 4MS8D 3CSTA 4X9YA 3D5OF 4ZS7L 5HHOE 2YFNA 2J43A 4KVCL 4IU3B 3EUUA 4NFBA 3LEYL 5BO0D 4MA7H 3GGWA 5ESAA 2NY6B 3QFJA 4HIIB 2L7EA 4DEPC 2L04A 2PPDA 1U30A 2K8MA 5C0CA 3RU8H 1NPNA 1QFPA 2AZAA 5F1KC 1NBYB 3V2AR 1CD1A 4JFDB 3VI4A 1H9DA 1DJGA 4Z78A 4K4KA 5IFHL 3MYJB 1LEKB 4JMNA 1XXFC 2R4SL 2XYBA 5IJCC 5DHYB 3HB3B 4GRWF 5EC1A 4LGRB 4RWYH 1F4HA 4PLNC 1WHOA 3H9HA 2YAHA 4KRNA 1HIMH 3F84A 5FM5O 2I9TA 1W0VB 1ETJA 3IJ9A 1W0WB 3TLRA 4HW6A 1JVOA 2YGPA 3QG6B 3KVDD 1CR9H 3PWPE 3AWGA 3BVNA 3MRIB 5K93A 5I82A 1T66C 3BAJA 5AW3B 3BSHA 3UXFA 1LO2H 3T2PA 1EO7A 2V2XB 4NUGL 5CZVL 4UINH 4JK0D 1SDAB 2ZCLH 4N2BA 3FRUB 5IB2B 1YAZA 3WUWB 1I1FA 5LHDA 4MA7L 3X2QB 5GGVH 1P1ZA 2VZTA 2J8UA 4NQQA 1Z1WA 5IB1A 3TH3T 3N04A 3VXSA 1MELA 2E3VA 3N9GH 4MXQC 3BH4A 3O4OC 4N0CD 3BN9D 1AC0A 4ZK8A 2VDRB 3RBSA 1M6OA 5CP7A 1A3ZA 5C9JA 4HKZA 1R33A 3LHAA 2FBOJ 3BISA 3CSYB 2IEPA 2EYRA 1HKFA 3U48A 3U4AA 5DMKB 5EF1A 5DJZA 2UZXA 2BVQB 4JCLA 3UG5A 5IBLC 2WINB 3EGDA 5ALCH 4G6JL 4RWYL 5BV7L 3AT9A 3BW9B 2QQLL 5E1QA 2QTEA 5B8CC 1HIML 1BD2E 2FJSA 4XMKH 4G5ZH 2XTJC 3RI5K 1K6QL 4LLVB 2LLLA 2IDSA 2NYYC 4JGMA 4S2SA 3GBNL 2XYCA 1J05A 3PP3H 1GC1C 4N1CA 5BZDB 1G7PB 4A66A 1N5YL 1LO2L 5F9JA 3VXPA 2H7WA 4UINL 4X4KA 3VWJB 4PS4H 2BM3A 3EBIA 1C16B 2ZX5A 4G9DA 4QLRA 1F6AA 5GGVL 1HDMA 1P7BA 1Y1UA 2EYSA 4RAUB 4UM9B 1UXSB 3PHAA 3QPXH 4U49A 5F6IB 2VLLA 2VDRH 1ZHKA 4XPGL 4MNGE 2M8XA 2QDWA 2LU3A 5ISZE 4WF7A 5IESH 4L1HA 2CO2A 2X70A 2DBLH 3QUMA 4PJ8B 5JQ6H 4GI8A 1SXBA 2W07B 2X1WL 5JTWA 4Y5VA 3OF6A 4CVUA 1E9QB 5DJYB 3DGGA 4V2CB 4WU5B 4ADIA 5IG7B 4LEXL 5LXGH 3C5ZA 1FNAA 1HKLL 3ABGA 3WXVH 1CL7H 5HI5D 3CHRA 5I30L 4WJ5B 5C07B 2JK5B 1WBZA 4D9RD 2H3KA 4MDJB 3MMEB 5JNYB 3UL4A 2FR4B 4QRPE 1T20B 4JRXA 2AV7A 2R69A 3MNZB 3EXLA 4HUVB 5EU6B 1MAML 5I1JL 3CZEA 5HGDB 5A16B 2JJVA 2XWBB 3UTZB 4NO3B 4Y1AD 2BOCB 2HT3C 1CGXA 2L7UA 5D7IE 5BRQA 3SPIA 1QEWA 4DFIA 2R0WH 3KPPA 2A83A 4AH2A 1DFBH 1KIUA 4UQEA 3TCTA 4FQLH 3JV6B 1CYXA 4K5MA 2IH3B 4G8GB 2VDRL 4WKZA 5GGSY 4RA3A 1KGCE 5DC9B 3TV3L 2A6IA 1ZV5A 3VA2C 3T71A 2DBLL 3SGJA 3QJHA 3MV9A 5JQ6L 2WKGA 3AREB 3KPMB 1VEOA 1BZ7A 1U8OA 1QFUH 5BNXD 2WKLA 5EBWB 4OFVA 5HYSG 4GG6A 3Q8FA 2AITA 1MFEL 1LWHA 2VTFA 4DSYA 4WEBH 4GRWE 4GKNA 2DYPA 3ZW3A 2XQYG 1TUPA 4PYHA 5CJOH 3QDGB 1OTUC 3V6OE 3G5YA 1T7XA 3FF8A 4B9GA 4MAUH 4P2AA 5HYEA 2F7RA 4PSPA 2O6DA 3BQUD 4DUVA 4FQCL 4OZFB 2V6HA 2XG4A 4LBAA 2J5LC 5KYUB 4YHPB 4FZEH 2R0WL 4FCAA 5KVFE 3FRPG 5BV7C 1CD8A 4FQLL 2ATPA 4HMEA 4OI7A 1HHKA 3NJLA 2ATKA 1WO2A 3T2LA 3VGDA 3IGUA 4C4KO 4AXWB 1ORQB 2Q8AH 3NA9H 5GSVB 1H6UA 4QT5A 2UY6B 4GO9A 4O2EB 4EAEA 5F97E 1CYWA 4PJHF 2VR9A 4Q56A 1U91A 2EO1A 1GGUA 3BMVA 4N8VG 4UZGA 3DXAE 3MAWA 2NY6C 1FG2A 3IDGB 3WGUB 3O4LA 2XQYA 1JF1A 2WNGA 1CQYA 3ZKMC 3N44B 4HD9A 2YD9A 3FTXA 1CBVH 4N1EA 1A4KA 2CDFB 3BWSA 4LFHD 2VXSH 1URZA 3QULB 1C5DB 4P5RA 1OARL 3F12A 5DUPL 4NM8L 4R2GD 5D1QD 4BSWB 3VD0A 1JVKA 3NCEB 4MAUL 2YA0A 2C9QA 3RVUC 1TYJA 2R4RH 3LXBA 4AC4A 3ETBJ 5ID0A 3HB3C 4OZFH 5JW5B 3FRPA 3KL0A 4WTWA 4DT2A 5ITBH 3TP4A 2WXFA 2KI6A 4AM0A 4Z3EA 2IFGA 1ASQA 3LQZB 5LVEA 4FZEL 2HTLC 8PAZA 1WVZA 1PY0A 1ZE3H 4UB0H 4WK0B 1WD9A 3SJVD 1AKPA 2DI8A 4YDJB 4KKPA 1MH5B 3K2KA 3N50A 4IHBA 1ZV9A 2X4RB 2CIKB 4PP1D 1OM9A 4TSCH 3CZNA 3MACH 3O81A 1ZT1A 4PJFE 3JWOH 4HWEH 3Q9PA 4CVXA 5IHUH 1M1XB 3MUGB 4N8VA 1V7NH 4URKA 4FHJA 3DX7B 4M3JA 1VACB 1X6LA 4BSVB 4IRSA 5FECA 4FLHA 3VRJA 2CWRA 1MHCB 2GW5A 2QHRH 4Q2ZA 5GSRB 1NWOA 3BKMH 3WJLC 2MIZA 2J2ZB 3LXCA 1KENH 1JGEA 3M88A 1X9LA 1WBYA 3VFRA 1EFQA 4KKBD 3MLTA 2PP7A 3MV8D 5J1SC 4P2CG 4FFZA 1HHHA 3P0YL 3VFGL 2MQ3A 2WLKA 5KOMC 4HS6A 1ZLDA 2H47C 4JFYA 4LSVH 5ITBL 3RB5A 4KOCA 1UD6A 1ASPA 2YKKA 3K6DA 1H8NA 1WF5A 4KGJA 4EN3B 3N0AA 1AGEB 4UMGA 1S9YB 4YNYB 4A7SA 1K3ZA 4KJPD 4FJYA 3NCJH 4L2YA 4TSCL 4BKLA 1LWJA 3SGKA 3DVGB 4N90E 3PWUB 5HDRA 1S7RA 1A22B 2ZYHA 1QUPA 5KN5A 1O75A 3CGTA 5AW6B 3DMMB 4AG4H 5IHUL 5IJVB 1AZUA 4Y8AA 1V7NL 3VWJC 4ZMZA 1EXGA 2V4LA 4YHKL 3EYSL 4Z0XB 2VUKA 2X9WA 1E4KC 1QI3A 3LHPL 4KRPB 3SDYL 2QHRL 1XGPA 5J6HB 5F6IC 4PJCF 1JVLA 4LZKA 3IJHB 3WHE1 5I1AA 4QF1A 4MQ7A 3AXLA 3O6FB 4PWIA 1U8CA 4JFSA 1A6AB 4PJ8C 3RZCD 2H1LM 4KZ0A 2CQVA 4PRAA 3QB7C 4DQOH 2D3LA 4WW1A 3D4GA 3H6JA 3GTTA 4UNUA 1QYGH 2VR6A 4L4TA 1GYWA 4W9HC 4XO8A 2HKFL 4LSVL 5SWZB 4PLJD 3UBXG 1JPEA 3I85A 1NDMA 4HH9A 4NDMB 1OM3L 3J7HA 3CH1A 1WITA 4JQVC 4EIUA 2UVEA 1WT5A 4XHJC 1OTTD 3NCJL 4QXUH 1EZSA 3ZO9A 4WK2B 4Z7IA 3QNYA 3GMOA 3SDCD 3O41B 2FT7A 1U41A 3GSWA 1K4CB 2IXQB 4CMMA 5T1JA 3QRGL 4UAOB 2OW7A 3LRSA 4AG4L 2JH2A 1ZWIB 1NCHA 3MYZA 5KVDL 1T22B 4OCXH 1ZK5A 2WC7A 3KH4A 3C6EA 1G6RB 4FD0A 1SHMA 4W9DC 3ULVD 2YD7A 3FT2B 2ORBH 3DUUA 4K0OA 2P45B 2H9GB 4M62H 2X0UA 4LLYA 4BCXA 1R47A 1FYTE 3ARUA 2NXZD 3NAAL 1C12A 5KJRH 1U93A 1JRHL 3I6KA 1CDGA 1EDYA 1WPCA 4JKNA 3QISA 5B38A 4DH2A 1JV2B 2FWUA 3AREC 3QVAA 1M3IA 1U6AL 2V3EA 2JKWA 1KYAA 1EXUA 3NQKA 3QI9A 4GRLD 3I50H 1PW3A 1SF5A 4HV8A 4GQRA 4MCYA 4K2UL 4QYAA 5KJ7E 3MLWL 2VR3A 4IOFC 1QYGL 1E42A 3BRGC 1CK0L 1CDUA 4YXLL 3T0EC 1MVYA 2R56H 4MFHA 5BRZB 1OY3B 1MWAH 2ZTBA 5JYMA 3JUZA 5IY5B 4JDEA 3TEWA 3ZDYF 4KI5C 1RFDH 2WXRA 1AXTL 3VM7A 2UZIH 3BGMB 4Y2OA 3UTQA 3GMMA 3VACA 5DSCB 1TVBA 1V3KA 3VH8G 3NH7H 2FSDA 1RK0A 3RAJH 3CFEA 2DYSB 3WMPA 4OCXL 2DMBA 2VR8A 4P57A 1MW1A 2OMBA 1I7UB 2A4CA 1FH5H 3RUGE 5JZ7C 2VAJA 1CGVA 1ZE3C 3V6FA 2MCAA 4M62L 3EJRA 5DUML 2XBZA 3LYRA 3X14A 2CLRA 4M5ZH 2ISDA 3RL1B 1EAPB 3QDJE 1CVSC 5D72L 2OZNA 1DJHA 2UVFA 1G7IA 3MBEB 3NYKA 5DWUH 4C83A 1XH3A 3F6IA 3GHEH 3S48A 3WKPA 5I1GH 1OSEA 3V6ZA 2BHUA 3GZQA 4QHLA 2DL2A 2CGRL 3KPRD 4LF3B 1ZT4B 4MDRA 4BZ1A 2GI0A 2IOMA 1UD4A 2LLNA 2V17L 1NL0H 2F53A 3HFMH 1IIIA 4NRZB 2Q2LA 3B4NA 5MHSD 2OV0A 2P5WD 4MJ6A 4XH2A 1E9OB 5EULV 1FVDB 3TL5A 1EEUA 3T4YB 5CCKH 2UZIL 4PJXB 1QG3A 4B5ZA 4F7KA 4ZUUB 1OSZA 2COQA 2ZKYA 4X6FA 4IMLB 2YZ8A 3KLAB 3MRFA 2E47A 3HE7A 4KJQC 1SY6L 3GLAA 4MB3A 3NH7L 4PJGE 4F37K 4Z7VB 5I73B 3KPLB 1AQMA 4L37A 1A4AA 1G6RL 3IDNB 3NJJA 4ODTL 2JXMB 4TF4A 2IDQA 1O0VA 4ZFGL 2J8UF 3P3TA 1FH5L 1U8HB 3K6SB 1NA8A 4FNLH 2YPLA 2VQTA 4OQ1A 4PJCE 1JPSH 1RK1B 4M5ZL 1VFAA 4FRWA 1FGNL 1F4XL 4M29A 3F58H 1YEEL 1UWXH 4LAQH 4IBLT 5IB5A 4EI5D 3LN4B 3GHEL 4WI0B 3GJEB 1UB5B 2DYRB 2BW4A 3UO1H 1KCSL 5DHVA 5DD6A 2EIKB 1M7IB 4XT1C 5I6PA 3UP6A 5C3TA 3JTTA 3WFBL 1LEIB 1WZLA 3LN5A 4QHNB 4OSUL 2L7QA 4XBPB 1N67A 1FWXA 1NL0L 1TZIA 5L4FA 3HFML 5HVGB 5I6NA 3L7FA 4DP4X 3CJJA 2YAMA 2MQ0A 2PWFA 1TITA 2FQGA 1EAOA 5HVHB 1KCBA 3OAUH 5AVYB 4F93B 4N2AA 5GZOA 3B2MA 3LKQA 5J9PB 4PM1A 4CAGA 1QP1A 4IBSA 1O6SA 3NIGB 2EAEA 5EO0B 3TBTA 3ZMNA 4K3EH 2NY2D 4FFYH 3L1OL 4LCCA 4F58H 2YMTA 1C8PA 4NM4L 4OKVB 3ZL1A 2XKUA 2CKBB 1OAQL 4AMXA 4EN3C 2AJVH 4ZFOA 4XAKD 4NKMA 5C08B 2BHZA 4R9HA 2K7QA 1Z9PA 3KEDA 1RD6A 1J5OH 3DMMC 3F58L 3MLZH 4LAQL 4EPSA 4YFDB 4IHOA 5GGQL 3VFMB 5T5FA 3TFKD 1LP9F 2EQDA 1KV7A 2HCZX 3QEQA 1H3XA 3UO1L 4AYGA 4FEIA 1MLCA 2I07A 5ICZB 4S1DC 2WXMA 4M5TA 3VH8B 3D85A 5CBAB 4NXSA 1VFBA 1JGLH 3DROA 4APQB 4LSRH 1XCQA 2EDMA 5IFAL 3O6FC 3BZDA 5GS1B 3ZDYE 1QR4A 4AQZA 3OKDA 4XN2A 2ITDA 4JKPL 1XF4A 1T5XA 3IDXL 3FF7A 4MWFA 4B27A 1HYSC 1NGYA 1FZJB 1YSOA 1WRFA 3PXJA 4K3EL 3UTSA 2CKBH 3ZBMA 2NY3D 2XXFA 1VCBC 3QFJE 4ZOEA 5IROC 1SQMA 5I8CA 4N6RB 3NCCB 1B3IA 2ZXWB 2Q3AA 1BF2A 3D39D 5C0AA 3DO7B 3QDMA 1TO5A 4JLRA 5C0CE 2J1YA 3W9DA 1UGKA 2AQ3A 3K74B 4G7QB 1U4EA 4UAOC 3VYPA 5FF6A 3VI4E 1NSNH 4B9YA 2VN3A 1IBYA 3F65A 3ZR6A 4YSUA 2PCFA 4GG6F 3WNNA 1PS3A 4P3DA 5LAXA 4NJ9L 3WIFB 3GSRB 4NQDD 3BZFB 2Q3ZA 5F7NC 5FC9A 1OSPH 5FHAH 2VLJB 1HXYB 4TUOA 2P5ED 3VXQA 2YBGA 3VVVA 3WSQH 1CDHA 1HNYA 1RU9H 2PXYD 4X5LA 5FO8A 1DN0B 4PRID 5IHBA 2G2RB 3KPSB 5B1KA 3LZOA 3PP4H 4PS3A 5EU4A 3ZDXB 3MLXL 1I4FA 1UZ8B 4Z3FA 1OB0A 1NBVH 4HFWA 5ANMA 2VLRE 1T21B 3VFVB 3QQ4B 5J57B 2R9HD 2XUWA 4JG1H 2ZKWA 4IYKA 4L1TA 2QZQA 1TKWB 1A8JH 2J8UE 4K9EH 5AW0B 3VXSE 5IIEB 4XOBA 3CUPA 4PJAF 3VX1A 3S3JA 4KDWA 3QJFA 2DI7A 1RZ7H 3VDCA 4U1MA 3KS0J 1UD3A 1DO5A 4PBDA 2P7TB 1NSNL 3ARBB 4X4ZA 4G8IA 5I6OA 3QXAB 4YLBA 5AAWC 3ZOAA 4UT7H 3GT6A 1A3LH 1A7QL 3INOA 4EKJA 1QSEA 2XIDA 2WXPA 4RMSA 4CSZA 2QMKA 3T65A 1OAZL 3HIZA 2WSPA 4GSUA 1OSPL 4HK0B 5I1DB 1MJUH 4G8AC 3ZYOA 4EDWH 3MBEC 3ILPB 5JHMA 1RU9L 3AQZA 2HFFB 3FT3B 4X7TB 6PCYA 4J3OD 3M8OL 2QV2A 3CSBA 3D50A 5KBKA 5KYNA 5EWIL 5A7BA 3RWCB 3CZJA 5INCB 3D4YA 4FQPA 3VFNB 3QO1A 2JKXA 3CDZB 1U8QB 4WI3A 4WUUD 1H15B 1A6VH 1ND0B 1SHWA 3OAWA 5HHMD 2QGDA 5IWLC 1BFTA 1NOFA 3RGVB 1EFXA 5I1CL 1UWXK 3L1GA 4KNSA 3N1PC 4A1RA 3P4NA 2H1PH 2APBA 3SY0B 4U2YA 4BFEA 5IBUG 1KFGA 3FULA 3ZYIA 2EE3A 1FFNA 1LP9E 3L3GB 4P5TB 4HVBA 2CHWA 3MJ9L 7PAZA 4NP4H 1OF2B 1JNJA 3AROA 3QBTB 4LSSH 3SOBL 1I7ZB 1UCTA 5C09D 3FUNA 2BC4B 3MV01 2VLKD 2IDFA 3NK3A 4EDWL 4X98A 1T4KA 2J1XA 4JRXE 2BIPA 5HGBB 5I1HL 1T03L 1J0JA 5D7LA 2C9VA 3PV7A 4HCRH 2ADJA 3AQDA 5FKAA 3V5KA 4WFGD 2D3VA 3OR7B 1U3YA 5B39A 4J6RH 3SZKC 3L5IA 5DMIH 1OHQA 1WG3A 1DVFD 3SDAD 2UXFA 3T2NL 4GB9A 2RTTA 4JL2A 1T80A 3UOAB 3MGOB 5EBGA 2ZCKH 4UNVA 2Z35A 2D7TH 3WFEH 2OX5A 2A0LD 1QBMH 3KWWB 1U8MB 2AJSL 5AOMA 4YR6A 4X99A 1X5ZA 1A6VL 1M7DB 3K2UH 2Y69B 1XIWB 5I5RA 4TSAH 2X4OA 3VXRA 4OR1A 4Z7UB 1J5HA 5H8DA 2Y3AA 1GW6A 1J5CA 1TU2A 5HVHC 4GRMA 1UG9A 5HGGS 2P8MA 3WV0A 3M1BA 4EEEA 3CG8A 1OEZW 5HHOD 5IK3A 1JZ5A 3DTXB 3QUXB 4TYUA 4MRBA 2G3MA 1F6FB 3P02A 5FAAA 4BWTA 2FAUA 3MV9E 3W1ZA 3O9WA 3WJMA 3QA3A 2QGCA 4UDUB 4ZPVB 5B1JC 1BG1A 5DTFB 5LN8A 5ERWB 4GG6E 2C3GA 3Q01A 4F8TA 2APFA 3H2WA 2C9UA 4C4UA 3SDXA 1R46A 4Z1PA 4K7PY 2G75B 4LSSL 2H6PB 1IILE 4OFYD 1D5XA 3ZYZA 5TPWH 4JO3H 4U1LB 4XODA 1D5MA 1A6ZA 5B3JE 4JPWH 2XSKA 4ADGA 2E5EA 1VGKA 1F18A 3ZHNA 2V5YA 5AUMB 5F7HA 4OZIA 1DQDL 5EOCL 4I3SH 2Z7YA 1MI5B 1ZHNB 3GSNB 2CO7A 2ZCKL 3OAYH 2Z93B 5MEND 2ZUXA 5CSBA 2BVOB 5MP6H 4NZFA 1RL1A 2I7OA 2LLGA 1CF8L 1PAZA 3KLDA 5GS1C 3OAZK 4I0PB 1J0ZA 3OR6A 4K3JL 4ZMAT 2YSSA 1MCWM 3KH3A 4QGTA 2XWRA 3Q43A 1FV1A 3ATFA 4EVNB 3HNTH 2IBBA 3CC1A 4KDVA 5CZRA 5LDUA 4N2NA 3IFPB 1XX9C 4GSXA 4L3EB 3INUL 4V1DA 5KSVB 3LNHA 3TYFB 3UBXI 3O4LE 1JF6A 7PCYA 4NC0B 4L05A 1KEGH 3JYBA 2EC9U 1CE6A 3T2OA 4FZ8H 1LGVA 4QXGH 2PYEA 5TPWL 5H2BA 3SCMA 4HISA 2VIRB 4JPWL 4LLWA 1RZIA 4B95C 1WP6A 2MJWA 4IEFB 5IMLA 5FUCE 3MNVB 5CJXA 3R8BB 1ZS2A 2D31A 3GSNH 5CFAA 1D6EA 3L6FA 2GKIA 2BWDA 4OCYH 1UH4A 1BD2D 4LCWB 3RJQB 2WZPD 5MP6L 4QRUA 1U8PB 5SWQB 1RIHL 1EUUA 1ORSA 3BUIA 4WAFA 4DHLA 4DVBA 1G7MB 2XXMB 2VSKB 1T0PB 2L8AA 3NG5A 3AT8A 3P4OA 4EUPB 3U4EA 4IU3A 5LCVH 5FEBA 1ADQA 1EHNA 3MCG1 5E8OB 5JHLA 5GGRB 3CFTA 1A6TA 4HIIA 3X1FA 1F11B 2CO6A 1MRCH 1RZ8A 3WUWG 1YC8A 5ISZD 5E94B 5F9OL 2FGZA 2AHIA 3HG5A 1SN2A 4KXZI 1FFOB 3KJ6H 4FZ8L 5L4MA 4KVNH 4QXGL 1XXDC 1VADB 2N7BA 4JFDA 3DVIA 1NDTA 1LEKA 3ARBC 4ZBJA 2ED6A 1BX2A 4ISVA 4N0RA 1GPOL 1MREH 3O3EB 5DHYA 1G7JB 1U2YA 3GSNL 3DIFA 1R0AL 1RUQL 3NSFA 4J4PA 2HG5B 2GJ6B 4EKXA 1OAJA 1W0VA 4I77H 4QRPD 4AW4A 3NCYP 1FE8L 2CK2A 3SE4C 1NAKH 3PJNA 3MRIA 1RZJH 5H35A 3RA7L 1D9KB 3B7SA 4MX7B 5C0GA 5C6WH 2V2XA 4MB4A 3NIDB 1YEJH 1DQMH 2R0LL 1EEZB 4G6AD 1AI1L 4JQXC 1LLAA 4HA1A 2VITA 4JFEA 2NCEA 5HDWA 2VDKB 1CU4L 5I17B 3RGVC 3KJ6L 4R26L 2W9LA 1HCZA 3EH1A 4GSDH 4DW2L 3IFNH 2ENPA 1S7VA 3CSYA 4ALAL 4AQOA 4YOKA 3ROOA 2A5UA 2QT6A 3BN3B 3EBAA 3IJ8A 1DUZA 5BVPH 1ZPUA 2D7QA 2WXGA 3OXRB 1EH9A 1MREL 2WINA 3HAEH 4P5TC 2YD6A 5D2LB 1UEYA 2BNQB 2F19H 1DR9A 4L4TE 3DIDA 2NOYA 5E4OA 3BW9A 3IBOA 3P0VH 3RWDB 1XGQB 4BH7B 4I77L 1IBZA 2X4SA 1E3ZA 35C8H 3A67H 2J88L 4GLRH 3CK0H 1IGIL 4FLSA 1NAKL 4JFFB 4OCWH 4ZDHB 1L0YA 4XN5A 4MA8L 1AKJB 4IS6B 5EEVA 3UTPE 1BM3H 3WFHB 5BZDA 1SGKA 1L3WA 3IEAA 3OXSB 1OB1B 1DQML 1OAKL 3VWJA 1GSKA 1C16A 3TZVB 4LEOA 4J39A 2VDKH 2C3XA 1LM8V 4PCYA 1XIWC 1FGVH 3RVXD 5I75B 1USQA 3IF1A 3FSZA 1NM4A 5PAZA 4P2YA 3QUXC 4PJ8A 1XGZA 5F1OB 1EHLH 1INQA 3TS8A 1P7QD 2DQHH 1YY8B 2J1ZA 3DXAD 1AGCB 1ZLSL 5DJYA 1MHEA 5E0FA 4A7UA 4WU5A 3Q48A 1BQHB 3OAYK 4DP0X 5D7JA 1HINL 5D70H 1E5AA 3TJEH 3PXHA 2DMHA 4OLXL 1HU8A 5AVTB 2JK5A 5C07A 1E28B 4O02B 1ZDSA 4HX1A 1MCIA 4MDJA 4PGBB 4LHUB 2AC0A 4FQ1H 4G80B 3QJXA 1NFIB 5BO1L 4XCEB 2FR4A 1T20A 1KJMA 2WVTA 3ARFA 3CPLB 1J5DA 3HA0A 3MNZA 1XAKA 3GEFA 3CK0L 2WP3O 4HUVA 5EU6A 4MNQB 3LMJL 2ENYA 5A16A 3TONA 3DETD 3HBZA 2BHYA 2XQ0A 2XWBA 1OALA 4RQQB 4LXFA 3UTZA 4A7GA 2BOCA 5KS9B 2N4IA 3U46A 4LQFL 1OGTA 2FEEI 5HDLA 1JMZA 3NZ8A 1B9ZA 4OZFG 1A7PH 2ZX7A 3RFZB 5AOKA 2XN9A 1H19A 2VDKL 2ZWLT 3KPTA 1B6UA 4QTIH 1IE4A 4R97B 2HYMA 2Y1YA 1TFPA 1R3KB 4I0PC 3L4WA 2VO5A 1MCWW 3UFIA 3FO0H 2MOGA 4H8WH 3D8MA 4HBQA 5IQNA 1SN5A 1WFJA 4DP8X 4NPYB 1NGPH 3AREA 3DRTA 4Z7NB 3KPMA 1EHLL 2AMGA 2DKSA 4OY9A 1WSST 5F1NB 5B7FA 5EBWA 2YRBA 4IKJA 2HFGH 2NSXA 4A2LA 9PCYA 1DANT 1H6EA 1L6ZA 3QHFH 4MAYB 4MMXB 1SJXA 2NTFA 3TJEL 3EYOB 4DPRA 1RHHB 3DX8B 3IFOB 4A6YB 4HXBH 4ZOAA 3EF4A 3MLRH 2R59A 3R4DA 1IUZA 3SSGA 5E2TH 4Q14A 3H42H 1PCXA 4OLYH 4ANWA 4PLOB 4K3GA 3HE6D 3D52A 4PREA 2BSRB 2JIXA 4HJGB 4AMKL 5HYFA 4YHPA 4NLHA 2XVKA 4HIXL 5CCHE 5TE7L 3VWKD 2YN3A 4GFXA 1A21A 3H3PL 2X40A 3W37A 3AB0B 4TQHA 1FRGH 1OWWA 1PD0A 2WLIB 2YPLE 4N90D 4QYOB 4LGPB 2H32B 3HI1A 5GSVA 1K3IA 2OSWA 4Y1SA 4YQXH 4PVMA 1GHFH 1IGFH 1NGPL 1YEFH 2G5BB 3EBHA 4HIPA 4ZUSB 1CDIA 3BCFA 3VG0H 2HFGL 5M7QA 2N1KA 3D1MC 2CPUA 3SE9H 3QHFL 4YLCA 5GGVY 4E5XA 4A6YH 5K5YA 4HKXB 4O02L 5TDOA 1IZKA 2CDFA 5I1LB 4K71B 1C5DA 3KPNB 4HJJL 3RWJA 3T6WA 5IWLA 3VU1A 2JB6B 3LIZA 2GK0B 5AAMC 1BQ5A 5IHHA 5FV1L 3OKEA 3B34A 3H42L 4O9HH 3HS8A 2JV6A 3LAFA 3ZL4L 2EINB 3FQUB 4J27A 3LQZA 2FQFA 4WZ9A 1MPAL 3FSAA 5C70A 2WO3B 1EXHA 5AL8A 1GMEA 4YDJA 2NY1C 5FO2A 4X8JB 1MH5A 1FRGL 2DH3A 2H32H 2X4RA 3PRZA 2CIKA 4JE0A 4YLQT 1N26A 2EZ0D 5KSAD 1ZTXL 3RI5F 1D9KC 3JTSA 1ZXKA 4L8SC 4YQXL 4Q58C 1YEFL 3OB0H 5DUBB 1KYUA 3ETTA 2G5UA 4ERSL 5ICUA 1E65A 1VACA 3GLDA 3QEQE 1V54B 3LEXA 4FYQA 1TEFA 2R39A 3V10A 1MHCA 1SMDA 3IRCA 2GC4C 1OD7A 5GSRA 5BPPA 5ALBH 2J71A 4KNQA 4A6YL 4IKLA 3CQQA 3Q6GL 1MCKA 4JM4H 3L9RA 5HI3D 4DNLA 4Y9EA 5BVJB 4PRPA 4ETQB 4BINA 1JV5A 1HJBC 1UYWL 2VABA 5HHVH 4YBQC 4O9HL 5CGMA 2ZUVA 4R4BA 3GSXB 3UCRA 4WO4D 1WUNT 4BZYA 3IGLA 3FJTA 3UTSE 1BVZA 4Q0XH 4AL8H 1VJSA 4W9FC 4JUSA 4EN3A 3HVDA 1KJVB 3NTCL 3A5VA 1S9YA 2QGBA 3S34H 4EBQL 4ELMA 1DL7H 4RA0C 3DYPA 2PW1B 5C0AE 5DK3A 2VYRE 3VMPA 3DVGA 3PWUA 3QDME 4PTTA 3W57A 2DMGA 1TZ8A 12E8L 3OMNB 1UOWA 5DZLA 5CKAA 3QYMA 1FA4A 3X12A 1A9BB 3TZVC 2OCJA 2IV9A 2MTPA 2ZCZA 3GXMA 4M4RA 2KLSA 3D3VB 3QARA 3SDXF 5J6HA 5ALBL 5I75C 3MVSA 3ARDB 3VVWA 2B16A 1QRND 1YEIH 4KK8C 4N85A 1IAIH 2Z4TA 2D9CA 1R9FA 1JYVA 4OTXH 2ZSVB 1A6AA 3ECBB 1OE1A 5E9DB 1JN6A 2IH8A 2G3XA 2FE0A 4QPEA 5HHVL 3AWFA 5CD3B 4OZIF 3KNBA 2EXWC 3P3YA 4HQQL 1BEXA 5D1XB 1Q72L 5SWZA 1AE6H 1DBJH 2FJHB 1FNEB 1R24A 4JHAH 1ACYH 4NDMA 5ANME 1JJUA 4AL8L 1N59B 4GNKB 3KWUA 3SJVB 3QUHA 5GGUA 3DO4A 3VB8A 3ATAA 1NKRA 3DURB 4FGMA 4AKOA 1WIPA 3O41A 2YC1B 2IXQA 1ZLUK 3VW3L 5DC0A 1SY6A 2FEJA 3TIEA 5FS5A 4Q97A 4KROB 1T22A 5J1TC 2WBJB 1R3JB 3H9ZA 4YZWA 4ZW7A 1G6RA 2FB4H 2FO4A 1RI8A 3WIIL 1QSEE 4LOUD 3CN1A 4GSQA 2H9GA 4FNTA 2DKMA 4MYWB 4R97C 4M61B 1EJ6A 1M3JA 1MQKH 2W0PA 3ZLQC 3BI9X 1IAIL 3NCMA 4N8CH 2EEDA 2FD6H 3B2VH 2AMUA 5DXWA 3ALPA 3IPBA 1N6QH 2IAAC 3SBRA 2PWGA 1XSKA 5CGYC 4DKEH 1VZHA 1KULA 4MAYC 3L16A 2EIBA 3CFQA 4QLWA 3KVQA 1INEH 5CO1A 3E80A 3EOAA 5BRZA 1ACYL 3TVMD 4BXSV 2CPCA 2WXKA 5MEQB 1JGVH 3BE1L 1BWMA 5HHPB 4Y4KA 3BGMA 4TQ8A 3I9PA 1Q0XH 4HIJB 3FQRB 4JPQA 1MXGA 5DDHB 2PLTA 3WIHH 2VZVA 3FO9A 1HESA 4OCMC 5G2NA 3DLQR 1TJMA 1R34A 1XGTB 4MJ5B 3OZ9H 1HEZA 3Q2WA 1DUYA 3AB0C 4L18A 1A1MB 2FATL 1JGDB 3GFUA 4BE6A 4P9MH 1MQKL 4L9LA 3RL1A 2YD8A 2HWZH 2VB5A 5FLUA 4NCDA 2FD6L 1H9VA 3B2VL 3MBEA 4LCUA 4P2OD 4XBEL 5F8QC 3U2SA 4DERA 4JCMA 1FBIL 2DI9A 3BVDB 5D7LE 3WTYA 32C2A 1V3JA 2F1EA 4GI6A 1JHLH 1JG9A 1ODAA 4LF3A 2KC0A 4Y8DC 2HT4D 3AS1A 4M02A 4W1TA 2VKXA 1ZMYA 1S3KH 2XWEA 1INEL 4F7TB 1PZUB 2OMUA 5FOBA 4NRZA 3RWGA 4EF3A 1F56A 2EEXA 4K71C 2JE8A 4JY6B 4J3TA 3MHZA 4NZ8A 3VXRE 2CALA 3DX3A 4K8RH 4ZUUA 3B7TA 3OB0K 3IMTA 3EYUH 2R51A 3ILEA 2N01B 5EO9A 4Z7VA 1ZTMA 3WIHL 2ZG3A 2NXYD 2ZG1A 1NGZB 3PABB 3ZU8A 3QFJD 2AJXL 5I26A 3GSVB 3OZ9L 1U8HA 3UABA 4AL8C 2XY1A 5A1AA 2OM5A 3SDXE 5C0CD 4XN7A 4P9ML 1CL7I 4UIMB 4Y0GA 3RVVD 4RVBA 5CP3H 2CR3A 2EDJA 3EDKA 5E5UB 4J12A 2OSLB 5AOIA 4IJ3B 1DLHA 1FNHA 1UB5A 5AOJA 5GRZA 1MY5A 4OZIE 1A6UH 4YEFA 1M7IA 1C1EL 1KT2A 2YBRB 4Q7DA 4U3HA 5GRJH 3GJFH 4AEEA 3NFSL 4CMHB 5JW3H 4KZEH 3JVGC 5TH2A 1NAMB 3IDJB 1BECA 2WXQA 3OHXB 5IMMA 3VXMA 1X7QB 4EDXB 2J4WH 4JVPA 3UC0H 1KPVA 4K8RL 3OX8B 1ZA3A 1T04A 3JV4B 5J9PA 2H8PA 2ETWA 3EGSA 3EYUL 2Z4QB 5GZNA 5EO0A 2VLRD 3CDFA 5B1JA 4OW6A 2NY7L 4GIAA 4KZCA 4WWKA 3ULVH 2MMXA 3DX9A 2WV3A 4OKVA 5HY9A 4V1DE 1M2OA 2VDOB 3QGVA 4XB3A 1CXFA 4N2OA 1SM3H 5L2KD 3JT0A 4TNFA 5I71C 1HHIB 1JTTA 4U6HB 5C08A 1DQVA 3NEXA 2PYEE 4P5MB 4WKXA 4BWWA 4U3SB 3BD4A 5FLVA 1ZV2A 3VXUA 1MCCA 4G7VH 1FZOB 4NQSB 4Q6KA 2BHFA 5F6HI 3VFMA 2R15A 1YMHB 3LNIA 5ANHA 1SOQA 2P48B 4TUKH 2NR6C 5CNHA 1T0MB 4D0CB 2G4GA 1M7UA 5GRJL 5JW3L 2HN7B 1NAMH 3MRKA 4NNXB 3NJFA 2NUPB 3FN3A 2P3YA 3ARDC 3ISYA 1KB9J 4ZFZB 4AJ0A 3RL2A 3POHA 4ZT1A 4APQA 5HPMB 4PGJA 1V10A 5GS1A 2QTVA 4PY7A 3G6JB 2AEPH 2Z64C 2NT0A 1KBKA 2J4WL 3EGXB 3RP1A 4HOMA 1BF8A 3UC0L 1Q8MA 1P4BL 3LS4H 2HJFA 4GG8B 1JD7A 4OZHB 5D1XC 4JHVA 5EZJB 2G2NA 1CFQB 4YFLF 3ESUF 2V7NB 4DGYH 1L7TH 1U3ZA 2OTWA 3U9PL 3TH2T 3L17A 4XPTL 3CSFA 3JVFC 3H0TA 4LIQH 1OT4A 4S1SL 1RSFA 4MBOA 4Z95H 1ZGLP 1D7DA 4JFDE 3QUZA 5FWQA 1NQBA 3OF6D 2ZAIA 2LVEA 2WBJC 4KROC 3FFOA 4WJG3 4XMPH 4EI5B 5EEXA 3WEXA 4XCCH 3Q13A 5E6UB 3N85L 4MD4B 4WIQA 4Y19A 3C5ZD 4AIXA 3S8FB 3MJ9A 3E9TA 1PAMA 3BZFA 2X89A 3V8OA 2VLJA 1TQBB 1EIBA 1SLXA 1HXYA 1MOEA 3TA3A 5GHWH 4KI5F 4JRXD 3IDIB 1F3DH 5T1LB 2Q7YB 1INDL 1I9RH 1M6UA 1R5VB 2AEPL 1DN0A 3DX1A 3EUDA 3LKRB 3I3EA 1YY9D 4Y88A 3KPSA 3IDYB 4U4BA 5GGTH 2E59A 2XX0A 1KDJA 5DO2D 5ABAA 2ITCB 3AITA 4KQ0A 4WI7A 1Z9SB 3K7UA 1A1OB 2Y36L 3IE4A 3B37A 3A4DA 3L1FA 2ICWB 2NY2B 3OMAB 4P3CL 3QQ4A 3VFVA 5HYJB 3H1ZA 4NOBA 4JFEE 1TKWA 2VDOL 1D5RA 4TL4A 5C0ND 3L3HA 3IMRA 2Z0UA 2JCCB 2OULB 1S7TB 3PREA 2QSTA 3V0WL 4KJPC 1R3HB 4F2FA 2Q5BA 5EFIB 2IAMA 1C5CH 1B0RB 4WCYH 3PDOB 2Y5TB 3VSUA 2WTOA 2C1OB 4K8RC 1W8EA 1WH0A 2R1WB 4LIQL 3MV9D 5TDPB 2AQSA 3COOA 4XC3H 4S11A 4K7FB 1KLUB 4PHZA 3KHQA 3KVPA 1H8LA 2LVCA 3ARXA 3MOAL 4ORZC 3IPFA 4XPHH 5JW4Q 1WFIA 2B4CH 4F37F 5DJ6B 2DYPD 2QFPA 1GCYA 1H6TA 3V0IA 2CJTA 4WFHE 1TJIH 2WLLB 4KJYB 5LJYH 3TH4T 4Q9CA 4NRYB 1E67A 3DV6B 5IOPB 2RGSA 1BDYA 3RDJA 5CSZB 3C75A 4BQ8A 2LOEA 2GBVA 2TRYA 3FT3A 3KJ4B 3L4XA 3RZCC 4ZMTA 1RIUL 4AT6B 1UM6L 4MNHB 1N0LB 1XR8B 3NFNA 4WTZG 3V5HB 3NPZB 1JI2A 3RWCA 3VFNA 2VMFA 2F1AA 3BRDA 1LJMA 2F9BT 3MFFA 4L1DA 1RLBA 3CDZA 4X5XB 1J10A 5IFJB 2NY3B 1ND0A 3TCLB 1BP3B 1CTMA 5K39A 1F4YH 5H4YA 3FT4B 4JO1L 5GRVK 1JNHB 3MA9L 3L81A 3EYFA 1OTTC 3FUJA 3KLQA 3HHSB 4WCYL 3QSKB 3SDCC 3ZUCA 1MHPH 3UO8B 3DJZA 1ETA1 5EZIL 1CJYA 1MN4A 3SY0A 4P46D 2CR6A 1UH3A 3BWAB 3ECUA 3FUDA 3P1VA 4I4WA 4ODUB 1MCQA 2OZ4A 5C0FB 3WY3A 3L3GA 4KMTL 3O4LD 5DFTA 1E4WL 2AABL 2B4CL 1T2QH 2EDEA 2YPKB 5BOZG 1WBXB 4GYBA 2OTUB 4X5RA 3NP4A 1OF2A 3IKCB 5MI0B 5E2WH 5IM7B 1TJIL 3CBRA 2D9QB 4MDIB 1I7ZA 5C07E 3SPCA 1CT8A 4Q9QH 1NC4D 1BJ8A 2K70A 3LEVL 4ZNEA 3KMDA 5EN2A 5K59F 3C12A 4JX0A 4HYTB 1CIUA 1T83C 2NY4D 2PXYB 4GKLA 5EU6E 4IJ3C 4WTZA 2PR4L 3OR7A 2F0CA 2N0MA 1F2XK 3V4VH 1ZGLA 4GRLC 1IBDA 2GIMA 4L29B 2H26B 2QL1A 4N0UB 3S36L 5DHEA 4CMHC 1BZOA 3MGOA 3WTUA 3PQYB 3ZKND 1LO4H 1NIFA 1U8MA 3OHXC 4YGVA 2A4EA 1M7DA 1QI5A 1Z6JT 2VRAA 2XN9E 2XWTB 2VDNL 4M7KH 4RMRA 3D0VB 1X4YA 4MZ3A 2O93L 2DQGL 1AS8A 1UZ6F 5CZXD 3QUXA 5D96B 3MRDA 3QEGH 4QD2E 5A2FA 2J8OA 1FSKB 5T3XD 3ABKB 4IRSD 4YHYB 3K6OA 2GTZB 4UV4H 3X11A 3NABH 2Q10A 3ES6A 1JZEA 3L2NA 1T2QL 3NDZE 3OKNB 4UIKH 3VXNB 2RJMA 3BJ91 1HCYA 3DIVA 1Y1DA 3ESPA 2P46B 2G75A 3E8UH 3IBEA 5E2WL 3DK2A 3QFGA 4XN1A 3SDDA 2H6PA 3RJOA 4Q9QL 3O2DH 4XXCC 3REWB 3WE6A 3I9AA 1G9NH 3BKYH 4KI5E 3LKSB 2DQIH 1WK0A 3CIQA 2P4AB 4QRTB 2DJSA 4RX4D 1V5JA 1SYSB 2Q20A 3JWDH 3OLDA 2R23B 4X0KA 1ZLEA 5LQBH 1MI5A 2BZDA 4PJBA 3U25A 4U3XA 4C56B 4FHKA 3IJSA 2BVOA 2Q3XA 2DTSA 4XVUD 4NO0A 4OLWH 3L3KB 4WUUB 1DFXA 1UH2A 2CIIA 3MCLH 3O2WH 4M7KL 4OVVA 2NZIA 3MREB 4I0PA 5HHMB 2OXGB 2QBWA 3O6LL 1GW0A 3WE1A 3QZMA 2E9GA 2QR0B 5D2NB 4EVNA 4HAFA 2HKAA 2W38A 2N3JA 2HFEB 4Z3JA 2FVNA 3IFPA 1Z2KA 4EUPG 3KCWA 5HHNB 1N6UA 1ES0B 3DBSA 4I5BB 1OZUA 3NABL 5KSVA 4ONGH 4MLIA 5FYKU 2E4FA 4M1CD 3UG4A 1T3FA 1TDQA 4GY4A 5EPMB 1JXGA 3O2DL 1P84K 3BKYL 1ZVHA 4HSQA 5AW2B 3K4ZA 4J3OH 4MAZA 4BUHA 4EI5C 4ODSH 1AGBA 3QJTB 3J07A 2XZCL 4JZNB 4UWQB 2PETA 3ZRSA 3FTYA 3MNVA 4NGHH 4P48A 3QWQB 1LK3L 4PGCB 3SDAB 2B4CC 2VR7A 2X4PB 1A3RL 3WBDA 3O3AA 4LCWA 4UTAH 1MFBH 3HAEG 4WSJA 5FYJU 3RY4A 1B4JL 3AM8C 1TQBC 2CZNA 2NLJA 4RESB 3O2WL 3HC3H 3VD1A 3M45A 4HUXA 3WEOA 3UTPD 3UAAA 3NIFF 3EFDL 3IDYC 3ME0A 3VXOB 1DSFL 1HH9A 2VM3A 4EUPA 1BLNA 1HNFA 1G6VK 5KVDE 2OMNA 5BMFH 1IAIM 1RJYB 2NY2C 4FKKA 3B2DC 3S37L 5GGRA 2J20A 3NJGA 4AEFA 2YD1A 4WWOA 1F11A 4QXTB 1A6WH 3BUPA 1EZVY 1WYJA 3JWNH 2W5PA 5E94A 3V0DA 4AKPA 1BZDA 2YEZB 1P4UA 2ROYA 4HPHA 1IAKB 1WZMA 4CVWA 2EUVA 1OQOA 3VD4A 4PRPE 3IJYB 5K59E 1WAAA 2I32A 4QY8B 3AXHA 1MCJA 4FFVD 5ICXB 3SD2A 1OO2A 3QI9D 4N2IA 3S88H 3TFKC 3V8CA 2OYKA 4AY0A 1VKXB 3FU7B 3QYNA 1G7JA 3QXDA 5BQ7A 1TCMA 4OLZH 4PB0L 1OF0A 1SFDA 3VFSB 4XTRD 2HG5A 4KXBA 4UAHA 1MFBL 2JLPA 2NNAA 3E8VA 3GSUB 2XETA 3GB7B 3PWPB 4ELME 2IMMA 3IRZA 4N2MA 2VKWA 3KJ4C 3G3LA 3V0FA 2FO8A 2NCMA 3QRBA 1AMXA 1V3MA 5H37A 8FABA 1UZ6E 4HP5A 2VOTA 1MF2H 4Z7VF 1GYAA 4NO5B 3RWFA 3FNKA 3TC9A 5JMOC 3SODB 4HOXA 4FNSA 4YK4B 5BS0A 5C71A 3E3QC 4E9TA 4ZSOB 2VJ0A 5ESQA 2ZUYA 2I69A 4O00A 5F7UA 2NY3C 1A6WL 4MJID 2QVIA 5BZWB 1S7SB 3OZKA 3SY6A 3HR6A 1TCRB 5I17A 1I9JL 5EIIB 2XOTA 4LRNL 1FIGH 4EI0A 2JJTC 1S2EA 3ARGB 4JVUA 4FQ2H 5FCUL 4NHUB 1D5ZB 1PQZA 2D73A 4GQPH 3O8XA 3L5JA 3S88L 1O6VA 3PWVB 5EHFA 4L1BA 4Z77A 2WXOA 1K8IB 4OLZL 1BQHG 4QOKA 5SWZE 1QW9A 2A6KB 2RFXA 2R29L 5MI0C 3OL2A 4BH7A 2E7LC 2WLHA 2DQJH 4OD3H 4G42B 1LWRA 3W82A 3FH7A 1JHKL 2OQJA 4LHUG 3PF2A 1WS8A 2PXYC 5KVEL 4GMTH 5T3ZE 1AKJA 4KWUA 4PR5A 4N2HA 4IS6A 3HE7D 4Y9BA 1KB5A 2ZWNA 4ZXBA 1RKRA 3IRPX 1IGTB 3JWDC 4JRWA 4AQAB 4DO5A 4NYLB 3NIGF 5IVZB 4L8CB 1DDHB 1LO5A 1IJ9A 2EE6A 1X6NA 3FQ1A 3M6DA 1DVQA 1MY7A 4M03A 4CDGC 1XCTB 3MO1B 1YYMH 3DWTA 5LBVA 4B3VA 5I1EH 5E6RB 5FO7B 2YPLD 1MIEH 4KMQA 2HH0L 3LXAA 1YJDH 1PFCA 1S78D 2BVYA 3FYEB 1D2OA 2O5ZH 3N43B 1MFMA 5B4MD 3WN6A 4FNRA 4M7LL 4DP5X 2GSIB 4YHIB 5D96C 2R2EA 3UJJH 3A24A 1NUFA 2H3XC 1G4RA 1FSKC 2OW6A 3WNKA 4YHYC 1SBBA 2KERA 1OE2A 1G5GA 4R3SB 1LEGA 1NCWH 1KC5L 3ZKXB 3K5RA 5BJTB 1U8KB 4PRHA 5KVGE 1NCTA 2MCPL 3GMLB 4O02A 5BRZE 4DTGH 5KG9A 4QTHB 2B39A 3A47A 4QRPB 1NFIA 1HT6A 4XCEA 1ZLWH 5DYFA 3F2LA 3MV11 5FW7A 4L8BA 5AWNH 4DP2X 2QPDB 5D7SH 4GQ9H 1X5KA 2OLDA 2ICEB 1SOSA