1ET5A

Crystal structure of nitrite reductase asp98asn mutant from alcaligenes faecalis s-6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNINFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic roles for two water bridged residues (Asp-98 and His-255) in the active site of copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords NITRITE REDUCTASE
total genus 93
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2000-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1et5A02
4JHUA 3QJTB 3T6XA 5I5JA 1X9RA 5E9NA 5B1BB 1L9OA 1NPNA 4KOBA 1TKWA 1AZRA 2IWEA 2JKWA 5I6MA 1OE1A 4AI7A 1N70A 2XX1A 5B3SB 4ZK8A 1ZPUA 2XV0A 2DY2A 4UANA 4HCIA 1ASPA 1GS8A 2A3TA 1PZAA 1OCRB 1N68A 2YAHA 3FS9A 2BHFA 3KW7A 1XB3A 3X1GA 3L45A 3T71A 1A3ZA 3FYIB 1J5DA 1PLBA 3DKHA 1BXAA 2XV2A 3JT2A 3WNIA 2CCWA 1GYCA 1SDDA 1NPJA 2YAMA 2JXMA 2E86A 4BXSV 2AFNA 2ZWNA 1TEGA 1NDTA 5F7AA 4BDVB 8PAZA 1MG2C 1WS7A 2DV6A 5I5IA 2BWDA 1NZRA 4E9YA 2PLTA 1EHKB 1OV8A 3NJGA 4KO9A 1PCSA 3WKPA 5I6NA 1WA0X 1ILSA 2HRGA 2IH9A 4HAKA 4HHGA 2R7EA 2BP0B 1W6LA 5TK2A 3ABLB 4YSCA 3NP3A 1SFHA 1RCYA 1ADWA 4YVNA 3UAAA 3FQ2A 2OV0A 3CDZA 3ABMB 5LDUA 1KV7A 4DPBX 2FJSA 3X1BA 3AG1B 4A2EA 3FSAA 1BQ5A 3DTUB 4AX3A 2UX6A 2RACA 2R7EB 1L9QA 2N0MA 3PAZA 2PPFA 3X2QB 1OE2A 2DYRB 2PCYA 1I53A 3FU7A 3KW8A 2FQGA 1SHWA 4FAAB 2BP8A 2QPEB 5I26A 4KNUA 1KDIA 3NSDA 1AANA 1T5KA 3X1NA 2WSDA 1JZIA 4HZ1A 2XUWA 1JXGA 3ZIYA 3S8GB 1TU2A 1ZDQA 2I7SA 3IN0A 1PLCA 3OQRA 2VW7A 3NJHA 2P80A 2YAOA 3NSCA 5I6LA 1ET8A 2OCCB 4DPCX 2PP7A 4EF3A 3CDZB 3NT0A 5D4JA 3CVBA 4DP8X 1JZJA 3N55A 4YSEA 1RZQA 1ZIBA 4F7KA 4CSPA 4DP4X 4DP5X 3EH4B 2W88A 1YLBB 1PLAA 2BO0A 5FC9A 2BW5A 2EIKB 3NJLA 4NAJA 4K9JA 5ANHA 3HEIB 2UXFA 2I7OA 2VM3A 1BYOA 4M4RB 1J5CA 5I6KA 2GC4C 4BDVA 1J9RA 3PXLA 4E9SA 2VSKB 4KO7A 3QJVB 1IBZA 2QPDB 3WG7B 2FT6A 3WIAA 1WS8A 3AW5A 4L0PB 1SNRA 4F2FA 1AIZA 4W9ZA 1JZGA 4DP7X 2TSBA 3OD3A 1OCCB 1URIA 2W8CA 1DYZA 1IBYA 5D4HA 2FT8A 2AZUA 4AKQA 2XWZA 2B3IA 3TBBA 1L9RA 3FU7B 1XB6A 4JHVA 3IBOA 4YVUA 1WA1X 2FTAA 2CUAA 4RH4A 1BXVA 5B7FA 2I85A 4G7QB 3EH3B 3PPSA 3ZX1A 4HCGA 4W1TA 2IDSA 3OMNB 3OMIB 4AKPA 1JVLA 3TBCA 2XV3A 2ZOOA 4N4YB 3QJRB 3ASNB 3SBRA 3CVDA 3H4HA 2CAKA 1KYAA 1KBWA 4A66A 3T9WA 4DP1X 1J9TA 1MZYA 2ZONA 5I6OA 3D12B 1KCBA 2PPAA 1VLXA 4P5SA 4BXVA 4DPAX 3IN2A 1ET7A 3WNJA 2VM4A 1E65A 3H56A 1CURA 3GDCA 1CYWA 1AR1B 3JTBA 1AZUA 2JFCA 2QT6A 3AG4B 1MZZA 1NIBA 3ZBMA 2FNWA 2H47C 1GS7A 2HX9A 2XYBA 1BAWA 1NIEA 2DWSA 3FPXA 2IAAC 4Q89A 6PAZA 3UGEA 4M3HA 1BYPA 2X87A 2PP9A 4YSDA 1NWOA 4G70B 2MRYA 1IKOP 2HZHA 2H5UA 5EHFA 1PNCA 2FQFA 5B1JA 5B1AB 2YAQA 5B7EA 1NIDA 3T6VA 1JZHA 1AG0A 2GIMA 3EHBB 2FT7A 2QDVA 4KOCA 1F56A 5D4IA 2HXAA 3BQVA 4E9XA 5I28A 1ETJA 2WO2B 3H4FA 3PCYA 5TK4A 4BK5C 3AZUA 3FQYA 4HALA 1M57B 1RKRA 4UF7C 3UAEA 1JXDA 4Q8BA 2B08A 1ZV2A 2PP8A 2XXGA 4A2GA 4E9QA 5B1KA 4BWTA 3G5WA 1E30A 3ZDWA 4YSRA 4MFHA 2MTAA 2IH8A 4YSTA 3V9CA 2YAFA 1AS8A 2J56A 4X4KA 1QNIA 3IE9A 2UX7A 1NICA 3WKQA 1HAWA 2VSMB 3S3BB 3QJQB 4G7RB 2BWIA 3QJSB 3HB3B 1DZ0A 2H3XC 3N2JA 2XU9A 3QQXA 4PAZA 5AFAA 2YAPA 4GY4A 5F7BA 2YQBA 1PY0A 1A65A 1AZCA 7PCYA 1AG6A 1ZIAA 1JZFA 3NJMA 2PPCA 4A2HA 2IWFA 1KDJA 1ZDSA 2P80D 3FYEB 2GHZA 3SQRA 4E9RA 3ABGA 2PPDA 4GP5B 5AZUA 5I5MA 2FQEA 1ASQA 4CSZA 1GR7A 3ASOB 2EINB 3PLYA 2Y69B 1A8ZA 1OE3A 3IEAA 3TASA 2GI0A 1OCOB 4WTQA 1GW0A 4DP2X 1OOWA 2XLLA 2Q5BA 4QLWA 1XB8A 1SFDA 4HIPA 1E5YA 3X1FA 1KGYE 3ABKB 3NSFA 1JXFA 1M9WA 1SF5A 4YSQA 1PMYA 1AZNA 3U25A 2YXWA 4G72B 1W8EA 4BWWA 2J55A 3FU8A 3EH5B 4A68A 5PAZA 1A4BA 3NJJA 1JZEA 2IDUA 4GP8B 1A4CA 2IDTA 2WO3B 3NYKA 4KNTA 2AZAA 4YL4A 2CBPA 5A7EA 3NP4A 2J5WA 1UATA 2ZXWB 4A67A 4NB7A 2VN3A 2AANA 3UABA 3QJUB 4AKOA 1GS6X 1M56B 2BZCA 2NRDA 3GXUB 4G71B 3SBQA 9PCYA 1OCZB 1PAZA 2BZ7A 2PPEA 1QHQA 2YARA 1IUZA 2YXVA 2XXFA 4A2FA 2GC7C 1L9SA 3FPYA 3T6WA 1HFUA 2FWLB 2OJ1A 3QPKA 4BWUA 1V54B 3S3CB 4HHWA 3NJFA 1AOZA 2J57A 2EIMB 3CZUB 3NJIA 1PF3A 4GP4B 4YSAA 4YSPA 3AY2A 3S8FB 1ET5A 3PAUA 1NIFA 1ILUA 1NTDA 1MG3C 3UADA 1AZBA 4G7SB 4P5RA 4DP0X 1ID2A 3TA4D 3BVDB 6PCYA 3V9EA 3EF4A 1SHXA 4YSSA 5I6PA 1MDAA 3FT0A 2UXGA 3MX0B 2LLNA 1WA2X 3UACA 1B3IA 1NIAA 4YSUA 2VW6A 1AACA 1A4AA 1GSKA 5AKRA 4FA7B 1X9UA 1E67A 1HAUA 1BQKA 1TEFA 2GBAA 2EILB 4QKTA 3NSYA 3T6ZA 2IDQA 4GYBA 4DP6X 4DP9X 1EZLA 2VMJA 2FQDA 1JVOA 4NERA 1L9TA 2HX7A 1JERA 1BXUA 2Y1AA 2UXTA 3AG3B 1L9PA 1AAJA 2HX8A 3SBPA 2QDWA 1V55B 4ENZA 1NWPA 3FSWA 3OMAB 2BP0A 4JKNA 4F2EA 1KBVA 1FA4A 2Q9OA 2AVFA 4HCFA 4YSOA 2EIJB 3NJNA 2XX0A 4UAHA 1J9SA 2UXVA 4A2DA 3MBWB 1RZPA 4E9WA 1AS7A 1NINA 4KO5A 1QLEB 2TSAA 5PCYA 3S3DB 3FU9A 5IY5B 1SF3A 1J9QA 4PCYA 1CC3A 2YAEA 1SDDB 1GY2A 1JOIA 1FFTB 1WAEA 7PAZA 1FWXA 3GYRA 4N8UA 2PCFA 1BEXA 1IC0A 1PZBA 2X88A 3CG8A 2IWKA 3C75A 1XMEB 3FSVA 3CVCA 3OM3B 4GXFA 2GB2A 2GSMB 1CYXA 2CALA 4KNSA 3TU6A 1GY1A 2XVBA 3RYMA 2BP8B 3NJKA 2BW4A 1PZCA 1V10A 4WKXA 4TXVB 2DYSB 5B1JC 1AQ8A 3FSZA 1W6WA 2CJ3A 2DWTA 1KCWA 3PAVA 2VW4A 2IDFA 1CUOA 4KO6A 1OF0A 4E9TA 3ERXA 5B7MA 1ASOA 1BQRA 2HRHA 3WI9A 3AG2B 4AZUA 1AS6A 1E5ZA 2HLEB 3DIVA 3FQ1A 1PNDA 3X1EA 1SJMA 4E9VA 1R1CA
chains in the Genus database with same CATH superfamily
3PWVB 5F88B 2VR3A 4H0IA 2OXHB 3P11L 3QJTB 1HEZB 4JM2C 2J2ZA 5FHAH 2IGFL 2CBMA 2W9DH 2YD8A 4PJXE 4APXB 1ZHLB 4JE4B 1TKWA 1QVOB 2XACC 4Z0BH 4UM9A 3RFZC 3DOHA 3AT0A 1NFDA 2L8AA 2O4EA 3IMUA 4GKSA 2OMWB 1E5AA 4JEGB 1A9BB 3JWNE 3LMJH 2DY2A 1HL4A 3B6SA 2VDPH 3IRCA 3LQAL 1EAOA 3O6FD 4V1DA 5E9DD 2P48B 2YR3A 2BFVH 4PS7A 4I0PB 1U8LA 4LPUA 3T71A 3ARDB 5KJRH 4WNQA 4R3SA 1CDHA 2KYIA 3DX9A 4X4MA 3MRCB 3RVXC 2EDTA 4PGDA 3OR6A 3GF8A 3H2PA 4RFNC 1T1YA 1NMCC 5IF0A 3OVUB 3O4OC 2ZWNA 1CGVA 4BDVB 1RUKL 2X7LB 1A6AB 3OJMB 3IXAA 4EIZC 2BWDA 3DO4A 3ARXA 4OZGE 1U8KA 3HS0C 2X6VA 1TCRA 4D7PA 2C3VA 1ILSA 4P23A 2MCPH 4M43L 4K71B 4OIAA 3RUGB 4CDGC 4FP8H 4IRJC 3QIUA 1C08A 2JKXA 1Q94A 4LBAA 4JPSA 3LNHA 3ABLB 4BGDA 5K5YA 1I9IH 2CO6A 4RZCB 3WN5B 3IMSA 3LRGA 3RJDA 2QVMA 4S1QL 5D2NE 3JBG7 2P44B 4JQIH 5A16A 1EMTL 4LSVH 1P7QD 4GG6A 5D2LA 3TBSB 2UX6A 3M1CA 3KHOA 3Q1SL 3GSOA 3FQUB 6FABL 5FW6A 4KV5F 3GKZA 5DWUL 3MDJA 1YQVL 3FU7A 2PW1B 2FQGA 2X5PA 4H8WH 4IHOB 4UUJB 4GUQA 1KCLA 4KNUA 2WYZA 2WV3A 4KMTH 1T1WB 5GZND 4FFYA 3QDJA 4WFGE 4JZOA 2PYEE 2DQFB 2ENQA 2QV4A 4XP6H 5J11B 4YDKH 3SQOH 3QDME 1PLCA 1CXEA 4JM2A 3LRHA 3VWKB 2V7HB 3W9DB 3D0VB 5I6LA 3MO1A 4JANB 5C7XH 2NLJA 3QDGA 2Q7YB 1CVRA 4MJ5A 3U0PB 2VXTH 3N55A 4A6YB 1HXKA 3AS3A 4S1RH 3RVVD 1T5XA 4ALAH 1YLBB 1FDLH 3RKPA 1XGQB 1OAXL 4DJMA 2C3HA 1CDYA 4M5ZH 1F8TH 3B43A 1FL3B 4GOSA 4WWKB 3F7YB 1ACYL 2UZIH 4Z7WE 3KPSE 4C54A 3D4GA 5BVPH 2IQ9L 1FZKB 1OAUH 4N5UA 2ZOLA 2ZKXA 4M9PA 4LHUG 5HHQA 3D52A 1W72B 3NIGE 4NX0A 1A6WL 1QO3A 2YPKA 3EW3B 4ZMAT 1YDPB 3WTXA 3QJVB 1ZTMA 4UINL 5I1JL 3RZCB 1OZUA 1P84K 1Y1UA 1MCSA 2H41A 5F9WC 5IREA 3RIFF 1DEEA 2L7QA 3TEUA 3ARGD 1UT9A 4MWFB 2HMID 2OMTB 2Q20A 3QRLA 2HPTA 1LP9A 3JUZA 3ZZLA 43CAB 1EXGA 2JE8A 4QUOA 5CJ8A 1U8MA 3CSYA 2CGYA 4Q9RL 5HYJD 4LMQE 1DFBL 3TBTA 2OMXB 5EBWA 4NKIL 5SWSE 5IQOA 3AU1A 3MTRA 1AQKH 4UQAA 2HCZX 1OT2A 1IGJB 3CN2A 4QAMB 1H3VA 4GXUM 4U6TA 5JW5A 3APDA 1ACCA 4PR5A 5EIIB 2PETA 1T0MB 5DHDA 3N42F 3QFJE 1K9TA 4HCRL 4U1MB 4WV1A 3GS7A 4N25A 4F3FB 1MHPH 1FNEA 5FGSA 4OY9A 3VFTB 1IAIM 3FTSA 2JELL 3GK8L 4UCFA 4YFDB 2ZOWA 5IHLB 2R15A 1OM3H 4XRCA 2WUBL 2DYPA 3G5VB 2MPAH 2G4GA 1AQHA 4J6RH 1T0MA 3HKZA 4OGXH 3WNJA 4XBGB 2J4WL 5A2LH 2YMXL 3TNNA 3IFPA 4AIZB 3WTSA 3HZKB 1XR9B 5EFIB 4LLQB 3U83A 1RZKH 2HX9A 3PP3H 4OLXH 4B9CA 1UUNA 3MX0A 5EPMA 1QUNB 1A3RH 2V8LA 3R06B 1ZSHA 3FPXA 3QC6X 3BRGC 4N8PA 5LN4A 1UB6B 1ZHNA 2JKRM 3UGEA 3SD2A 2X2IA 3ZKXB 5CEYB 5KG9B 3QFJA 1A25A 3CU7A 5KANG 4IS6B 4XMKL 1SQMA 2AHIA 4DK5A 3FAXA 5KVDE 3V5KA 5LGKA 5TPWL 1F4XH 2DM3A 2MNJB 3BUQA 3L3IB 1KCVL 2NXZB 3L95B 2FLBT 4GBXC 3ZTJH 4L29B 2Z4TA 4F9PC 3DDGA 3IFOA 4AGPA 3CFQA 2HXAA 2O5ZH 3D9AL 4H26A 1DVFC 4RWHA 2ZYIA 1A6ZB 1F42A 4ZQTA 2X1OA 1U93B 3ZDXB 1SOQA 3QW9A 1NMCB 5L4MA 4ZW5A 4HALA 1RKRA 5T1KA 3LKSB 4B96A 3QXTA 3VRIA 3GSNA 2DL9A 2XXGA 2BS9A 4JFQA 1T20B 5D1QE 3TJPA 1TQTA 1MJJB 4S1QH 4YGVB 4KKAC 4AGMA 4TSAL 5DZLA 3L5WB 3TZVA 3QUYA 4WI0B 5FECA 3VXUE 3Q01A 2NUPB 1EZUA 1MCOL 1A6TA 4MZ2A 4RAVA 1QHOA 3RGVC 5J0BA 4OFQA 4XN5A 1JWUA 3HPJA 2V7HA 1KZYA 4OCRH 1PEWA 3FUIA 4WFFE 5IK3A 4D0BA 5GIRB 1JI2A 4M48H 2KC0A 2R1XA 3N2JA 3DX1A 4OD2B 2ETWA 2YAPA 2YPLB 4LO9A 1PY0A 3QORC 1OSPL 4M00A 2ADIB 4NZTH 4HIIA 1TVHB 3O11A 1LP9F 4AMXA 3CSTA 5C0FA 3DUUA 4X9HA 4HSQA 2V5MA 5IMMA 3RWEB 1MRDH 1E9OA 4WGVB 1J0YA 4FQ2L 4R5TA 4CDHA 1MFMA 5HYQA 4GQZA 1ASQA 1C5CH 2DWEA 3DVGB 4IRZH 3WTTA 3VNYA 4Q6YA 2NY1B 3I6KA 3H42L 1CIUA 2F7PA 4OB5L 3IJYA 5CS7A 1BQHG 2R56L 4JO2L 4H1LG 4U1LB 5A2CA 4Q14A 3QP3A 1JV2B 3AXHA 2Z34A 2HLFD 5DZPA 4AEIH 1QSEB 4H7VA 1K2DB 1OAXH 1JXFA 2CHZA 3WSQH 3HE7A 1OP4A 2PXYD 2CLVA 5DJ6A 3F58H 4WUKH 1ACYH 2UZIL 1ZLVK 1YEIL 5DJ2A 3CDCA 1KTCA 1A2YA 2QV2A 4KJYB 3B7TA 2OL3L 2O30A 2DBJA 4ENEC 2YKKA 1A4CA 4KRNA 1XBRA 5E6IC 1H15B 1R4XA 3JVGA 4Q52A 4XAWH 4XB7A 1I7UA 3V79C 4X6CF 5EULV 4PWJA 4CW1B 3PV7A 1YJDH 3P9MA 1CS6A 3CBJB 3VMNA 5IWLC 2ESVE 5DK3A 4HK0B 3G6DH 3UABA 2BS71 4YE0A 4L8CA 3FCBA 4PREB 4QY8B 4AYFB 2Y06H 3ILQD 1OTTC 4L3EB 3AU1B 3F2LA 4Y2DC 5DR5H 1L7TL 2Y7OA 4PWGA 1L9SA 5DQJB 4DGVH 3VM7A 4KXBA 2W60A 1U6AH 1DFBH 1A1MA 3JVGC 5F21B 4CGUB 1NAMA 1FYTB 5T3ZH 4QT5B 3V4VH 1N0XH 3DX8B 2ZUWA 2Q76A 1LEIB 3QIWD 1ET5A 3WL9B 5F3FA 2G3XA 1XQ4A 1N9PA 2QR0B 2EEFA 3THML 1YYLL 5TH2B 3T4AA 4BZ2L 5ID0A 3QYNA 5J12B 3M17A 4PJ8A 5SV3A 3MA9H 5E6IA 2HFGL 3CXDH 5HGDA 3TVMB 3A4EA 4F57L 5CCKL 1A7PH 4LCCC 2DEYX 1KWKA 1K6QL 1GJIA 2QQLH 4FMFA 2ITDB 3TJEL 4XPHL 1XX9C 2AV1B 1XGRB 3CHXA 3OLDA 3L9EA 1SJXA 5JYLA 4G80B 3O81A 1TITA 1YCSA 4I2XB 1IGIH 1UM5L 2HJFB 3VG0H 3CZJA 1CICB 2VITA 3K1KC 3N1MC 5TQ0H 5DRZA 4OZGF 4HEPA 1T89C 3K4DA 4FNRA 1FCCA 1S9VB 2XN2A 1D5IL 1ZVSA 5L2JB 1E4JA 1ID5I 5D96C 3BSZA 1FZJA 3CFEA 2EDKA 3HE7C 4WEMB 2BNQB 1U8JA 4PRAA 4TS6A 1MFVA 4R4FL 4EEEA 5CD3A 3I3DA 2OXGB 4IDJL 7CGTA 3QPQC 2WSKA 4LDEB 2R0WL 3D9AH 3VU2A 1DO5A 4LKXB 5C08B 4F8LA 3SDCB 1SBSL 5C07B 1RZPA 2GCYA 2VR4A 3ULUC 1H5BC 2PWEA 1Z9MA 4K7FB 3QBTB 4NC1C 3CFJB 1CC3A 1QSEA 5EU3B 3LZOA 3WIFA 4KGLA 4U1KB 2ED6A 2WZPA 4KDVA 2PWDA 1I9JL 2WVSA 5HI4D 4PS4L 5AAWC 5CINL 2JWYA 4ODUA 5CJBA 1Z9NA 4CUCA 1U8OB 3II2A 3WMPA 2XPZA 1G9NH 1TO4A 1XMEB 1JWUB 3HPJB 3FSVA 1P4BH 4LEXL 4OFPA 3WFCL 3MLXL 5IVXA 2L3BA 3VH8B 4E42A 2NCMA 4K73A 1AY1H 1M1XA 1OD7A 4UI2A 4TN9A 3I9AA 2P45B 3QDGE 3RGVA 1UGNA 5F1SA 2ADIA 2CMRL 2IFGA 1PZCA 2VABA 1J8HB 5IT2H 3QG7L 4NHCL 5KN5B 4Y16A 3FQXB 1WHPA 4Y2DB 5HD8D 1QMUA 5IVXB 4CSTA 3LS5H 2DEWX 2HKHH 3G5YA 4ORGA 4PJ6A 4GSDL 4ZTPL 4AW7A 1A6VH 2KUTA 2YD7A 3Q2WA 4M7KH 3SE4C 3ZOAA 1G9EA 4YDIL 4JJHA 4QF1B 1KTBA 2ZKMX 5HYSB 3CCHA 1ZWIA 2X9YA 1A7NL 2K70A 4P5MB 4XVTL 3IDXH 3MU3A 2H7WA 1GGYA 3QNYB 3KLQA 4QHKI 1JGLH 3T0DA 4CN1A 3ARDA 4WNJA 5JHDA 2Y07H 4WI6A 2ARWA 5LBSL 4J2XA 2CDEB 2JMRA 3L6FA 5I6MA 5KS9E 1M3JA 4G6JL 2HFEB 4WZ9A 3FB6B 5JO5A 1WC7A 1ZPUA 3GSQA 1A6AA 4LGRB 3H3PH 5I1IL 4GW1B 4JPVH 4XMVA 2A3TA 1N68A 1XR9A 1CGYA 2BIIA 2EICA 3L45A 4JQIA 3KE0A 4O2CB 2G5UA 3QUKB 1B6UA 4NN6B 1BHGA 3MNWA 4HJSA 3QO0B 2H0JA 3ARDC 1INQB 2D03L 3TH2T 2HT4D 4QAWA 1BBDL 4EN3B 1RZ7L 3A24A 5AW8B 1HYSD 5CEYA 1YMHB 4X6CB 3D6GA 3ZE0F 4JAMB 5SWZD 4I88A 3NN8A 4RGNC 4G7VL 4GQ9L 2ZX6A 3P3TA 1NZRA 2W9LA 4J1UB 5F89A 3TEWA 4K3DL 1E8ZA 3DO3A 1Y18B 3UEZA 3ZYOA 4Q6IA 3BSHA 2WVTA 4DGVL 5BUGA 3C12A 4IS6A 3PDDA 4PW4A 1NEUA 4QR7A 2XZAH 3LQZB 1ES0B 1RZGA 3F7LA 2XETA 4G6AD 3GO1L 1FO0H 5DA4A 4BHUA 1SGKA 1YMMA 5KVEH 1NUFA 3BUBA 5J6HB 5DHMC 1CGXA 3N9GH 2X2HA 1CICA 3T0VA 1QLRB 4J27A 5HPMB 4RQQB 5IJVB 1TEYA 3BD4A 3Q13A 3RZWA 1IBGH 4Y16C 4MB1A 1J1PL 1DBJL 3OTTA 4PJEF 4WJG3 4OTXH 1NEZG 3ATEA 2H26A 5DJAB 1IM9B 2WTPA 3Q6FB 3MCKA 3TEYA 3VFGH 4HJTA 2NX5B 3OF6A 4Q58C 1CFQB 4PJGA 4FYSA 2OMUA 3ALWA 3ZYIA 2WSDA 2HVKB 3ARBC 2FHBA 3HI6H 4WENB 5DD5L 1ZA3B 2CHNA 4MS6A 3TCTA 5AW6B 5J1TC 1UH3A 1I8LC 2GTZB 2ZJSL 2BIOA 5C0IA 3KYMB 5BRZE 2A9ML 1HNFA 1FZMA 5JIDA 4G8EB 3RWFB 5HYJA 3NSCA 4X5XA 2EO7A 1X3DA 5F7UA 2VLJE 3NT0A 3CVBA 3IFNL 4Y8DC 2R8SH 1M71A 4QRQB 2HLAB 3TV3L 3D85B 1E28A 2NOYA 5KJRL 5AVSB 1HYRC 5DVMA 3DX0A 1KXTB 3GRGA 3I9GL 1A0QL 4HUUA 4K07A 3VI4A 5KVMC 4PLKC 3S3JA 2IQAA 3DVGA 5JHDB 2QVTA 3A21A 4K3JL 2NR6A 1KTLA 5G5DB 3CMOH 3K72A 2CO7B 1XD1A 4MAYC 3DOSA 1ULVA 5F0MB 8FABB 4UV4L 4MAUH 5KVFH 1NCWL 1PKQB 2JKIS 2W91A 2Z64C 4PY8I 1I9JH 1MVUB 1EEZB 1NFDF 5H4ZA 2EE0A 4ZUWA 5CIPA 2IIJA 2OR9H 4M43H 2MCPL 5I1KL 5D7LE 4DZ8A 1AYOA 3PABB 2RB8A 3Q43A 4OCNC 2IAMA 5KYWB 3ULVL 4KKNA 5D5MA 2HN7A 1Z0NA 4ZDHB 1KTKE 2WCSA 4HD9A 3FQWA 2FX9L 1DYZA 3C6LC 2HJKB 5C0EA 4BUHA 1IZKA 5DJCA 4KBPA 2DDQL 4FKHA 2K1MA 3PXJA 4WFGD 3ROOB 2CO6B 1PG7X 4G9FA 4XHQA 5GRYA 3SCMB 4X6DA 4P9ML 4JVPA 4DZBA 4LLUB 1W80A 1OB1B 1ZT7A 1NGQH 1LE5B 3OR7B 1S3RA 3CK0H 4FFTA 4DO6A 1TQCC 3OAUH 1BXVA 1BVKB 3ZHKA 5AD0B 5IROD 1CZ8H 4FXTA 4OZHB 1RFDL 3BDYH 3P3YA 2OK0H 2NZ9C 4BHUI 5IW6B 1DVZA 3OKMA 1Q38A 5L88L 1UASA 3GI9L 3HFFA 1QFWL 2BIMA 3QIWC 4FXLA 2PW1A 5C2BH 1BQLL 3QNFA 3ARRA 1DN2A 2V5SA 3T9WA 3LPOA 5GSVA 5F6IB 1WITA 5C0NC 3V5HB 4OCLC 4NO2A 4OF8A 3CBKB 2YPVL 3GLEA 5D7SL 1CYWA 2DQFA 1WV7T 2WWOA 5D6DA 1MHEB 1G1YA 2AK4E 5JOPD 5EEXA 4ONFL 3QQDA 3MRGB 1SUJA 2FNWA 5CSZB 1GS7A 2B8OT 2QVIA 3AAZB 4JDEA 1UWYA 4NCDA 2ESVB 3F62A 6PAZA 1MJJA 2CIKA 3KD4A 4DN3L 1BYPA 4GKNB 4RBPK 4W9KC 3E9UA 4CC4C 3BO8A 1RZ7H 2PXYB 3CQFA 2HZHA 4LOEA 3U4BL 5CF3A 4FL4C 4I2XA 4IU2A 1DP0A 4XMZA 1D5BB 1VZGA 3VGBA 3LH8A 4BZ2A 3BUPA 3D7PA 4RGNE 5FM5M 5MHSD 5BUAA 5JUEH 2Y5EA 3QUXA 4FLQA 5DO2D 4K5LA 3TLRA 2HUEA 1WFIA 2Y1YA 2XN0A 3LNIA 1SYVB 4IBLT 1CE1L 3B8SA 4FTVB 5L8LB 1TUPA 3PCYA 1II4E 4UMGA 1A5FH 4JFHE 2F54A 1OP3K 2XKSA 2UUDH 1HWWA 2XTJC 4LAQH 3B7YA 5JOEA 2IF7A 4HWZA 5AAMC 4BWTA 3TYGH 5E5MA 2CCVA 2DICA 1OANA 4MFHA 4G82A 5KBPA 2AJUL 4FTVA 2X2YA 4D9QE 1NBCA 2CQVA 1SEQL 4PJGF 2J7LA 2EE3A 1TTBA 1CL7H 2Y0SA 3D3VD 3KNBA 4AYBA 4F9LA 4NPYA 2QTEA 4CVZB 3ECBB 2ZUXA 2VO8A 5GGQH 3WJLC 4W9FC 2APSA 1TTFA 4EZLA 1NPUA 2ENPA 4PJEB 4BZ1H 1BG1A 4PJ5A 1L7IH 2LT9A 5BZDA 5IQ7H 2WBJD 5B4MD 2APTA 3DGDA 1DZBA 3FO0H 1DJWA 4M6AA 4DVBB 1D6EB 1PPIA 4P46B 1ZIAA 4YIQA 2PTVA 2FRGP 1OM3L 2CGZA 4G8GD 2B7DT 3C08L 3QXVA 4I87A 4F7EA 1OL0A 3FU3A 4JFYA 4Y4FC 4WWPA 1CTMA 1D6VL 1UXLA 3IJ7A 4X7TA 1CL7I 1CF1A 1QFUH 1BFVL 3MV8D 4FULA 1EJ8A 3SPIA 3C2AH 4HWBL 4PYGA 4X9FA 3LN4B 4F7PB 4HK0A 3ASOB 1BQHB 2LU7A 4NQCB 1WCBA 1OF2B 4DKTA 4GUOA 3QQ9D 2XN9E 3F64A 1VGEH 3GIVB 3IMVA 4MCYB 4NUGL 2DF3A 5DJYA 2IPTH 3C5ZC 5AOLA 2D3VA 4N68A 1YSOA 2WXOA 5C1MB 5CO1A 1BQUA 5CN3A 3KG5A 3ENEA 4HOZA 5LGYA 4YSQA 5A6MA 2X4TA 1NANI 4L3EA 3B9VA 4ESKA 1H9DA 1FHGA 3C8HA 1OM9A 4H5SB 1NM9A 3VWJC 3FKUS 5PAZA 3UYRL 4ZJ9A 1VHPA 4YHPA 3V0WL 4P5TB 3FF7A 3RI5K 4FFYL 2AITA 3V4PL 2EDRA 2R0KH 4TULL 2BOCB 2D8KA 1E2ZA 3ETBJ 5B22A 2Z31A 2VN3A 4ONOA 4W9CC 1IAII 3H0TB 4GAJH 3TYFA 1BEYL 2GQHA 4FJZA 3IKCB 1LE5A 3BFQG 5I30L 2A2QT 4XMUA 3T6WA 4BD4A 1X7QB 1N5AB 4NPKA 3EO0A 5EU6A 3P40A 2CHWA 5H37A 4R0LA 2FJUB 4XTRD 3SJVE 4I48B 3FH8A 3ARED 1JZ5A 3NJIA 4GP4B 3SDAD 1N6VA 1G7LA 1M42A 4JM2B 2ODIA 1DJZA 2FSEB 4Q2ZA 3SGJA 1SN0A 2FWOB 3FT9A 4NJAH 5E00A 1KEMH 2FJHB 3GI9H 2VDLB 2NYYD 4XO4A 3BVDB 2Z35A 3B2UC 4KI5F 6PCYA 4M6NH 5DC0A 4A6YH 2X4RB 2WUCL 5FECB 1RK1B 2XWJB 3O41B 2DOCA 5IMKB 3EDFA 4R9HA 1XEDA 1JZ6A 2AC0A 1IBDA 2BWQA 2LR4A 1WZ1L 4ZX3A 5DMGD 1AOHA 1X9UA 2Q3XA 3ZDZF 5AKVA 5DJZA 4HS8L 32C2B 1JXJA 3WDHA 4NQEA 1U8PA 3OJ2C 2CGRL 4P05A 2P8PA 2K6WA 1CPUA 4ZS6D 2HX7A 2NW3A 1MJUH 5CLTA 2A9NH 4U1SA 3M7FB 3GUFA 3KLSA 1EV2E 1L9PA 2J8UE 5C09E 4ZMOA 1ACZA 5F7LB 4M4RA 2VT0A 4CC4A 4N0UA 1DLHB 4K5OA 2E9JA 4HHAA 4PP1C 3MPCA 4RMQA 5KOMC 3UMTA 4R7XA 3PREA 4J3OG 2GTZA 5KZCB 1NCCH 4YSOA 3BLBA 1AXTH 1KIUA 1SRDA 1WBYA 2EIZA 3UJIH 5LWYL 2E6PA 3CC1A 1ZPLA 3S88H 1T7XA 4KO5A 1A5FL 5CMAB 5DYFA 5LNEA 3US0A 2IPKB 4HPOH 4ZSOB 3MLSH 4PVNA 3IVKA 2X4OB 4IK6A 5IB3B 1DO6A 2X3BA 4PGDB 4TF4A 5T33H 1JOIA 1EO8L 1T21B 4U1MA 5B21A 5KVFE 3FOMB 4F1ZA 3ULUL 1U3ZA 2EADA 1QG3A 4OCMC 4N8VB 4TOYH 3DI3B 3VXMA 2GSMB 3PWJA 2IPKA 5T5FL 4OGAD 3UYPB 3P9MB 3ZO0A 3RL1A 3A67H 4KNSA 5JO5B 3UTTE 1UC6A 1QQDB 2GI7A 4NM8L 5D1ZI 4PRBA 4NNYA 2O5YH 4LVOB 3F7VA 1W6WA 3BE1L 1F2QA 3Q5OA 4CRPA 2ISDA 1FBIH 4KY1L 4HEPG 5C0CE 4HIEA 5FYKH 2FZ3A 4JFPA 4JDTH 2F1EA 2WAHA 4K8RC 4JO1L 1KCUL 5CCKH 2HRHA 3NQIA 3WLBA 3GRWH 1ROCA 1AZVA 1JGUH 3AVEA 3P3UA 1A66A 5KWYC 1BIIB 3OGCA 5A2KH 5KSBB 5MEOA 2CD0A 2WLLA 4KK8C 2NY7L 3SPVB 4G42A 4TV3A 2EEDA 3REVA 4DOHE 1MELA 3X14A 4YS4A 5TQ0L 5DCCA 4EXKA 5I5JA 1E8WA 2MEJB 4MNQB 4AIOA 1EJFA 3VFOB 5B1BB 4JO4H 3VGAC 2IANA 2KLTA 2JKWA 3QJHA 4LVEA 4LP8A 1AHKA 5I76B 3Q5YA 2DLTA 2YBRB 4S1SH 4M8RA 3VGEA 4NXKA 1YC8A 5D1QC 4UANA 5E03A 4HCIA 1PQZB 2OZ4A 1HH9B 1NC4B 3W39B 4FE9A 3WEXB 2Z7YA 2EDEA 2WOBA 3PL6A 1I7RB 2V4LA 4XZ4A 1BOYA 2DQJL 2GY5A 1A3ZA 2NTSP 3TBVA 3V0WH 1MN4A 2P43B 3PAYA 3CX5K 5F1NA 4N2OA 1SEBB 4PJ7E 1JHKH 5E2JA 3EH1A 3PWLB 1J10A 4ZMYA 2PO6D 1G9HA 1OTUD 4KX7A 3N06B 2GCYB 3E3QC 5H94B 1SM3H 1OV8A 5C0AD 4KPHL 5EDXA 4YPJA 5JLZA 4OCXL 4Y9FA 4LFHD 4ONHA 5E2WL 4GUPB 3P02A 2MNUA 4MTMA 2ZOTA 3UTSE 5FUCE 2ZD0A 5GZOD 4OLZH 1WUZA 4LF3A 3DGGA 4QRPE 5EOTA 3WE1A 1AJ7H 4FQXC 3L5XL 1GGUA 3VXPA 4F20A 4MJ5B 1KC5L 1SJEA 2XVLA 1KV7A 4FL4B 3F3HA 3RFRA 2BSDA 3BAJA 4MLSA 1ZLWH 2PTTB 4KKPA 3OAZK 4LSSH 4TUOA 4AYDC 4BSVA 5JXEA 2W9EL 1VADB 2N0MA 2ADJB 3MBEA 1Y1DA 3MNVA 1OE2A 4MMYA 4PP2A 2E27H 3KBFA 1JHLL 4YC2B 1K4CA 1PZUB 2H2PC 3KPSB 4DKAA 5CNHA 4ZFFA 2FBJH 1AANA 2NY4B 1BBDH 4GW5A 3VFPA 2VDML 2Z7UA 3MRKB 3DOSB 4C4BA 1N10A 1YYML 4LSTL 2DW5A 2VAAA 3OZ9H 2V0AA 4XBGA 4EIGB 4XH2B 1RPKA 4LLAA 3MRDB 43C9A 1U8KB 5DO2C 3PJLA 4PBVC 1L0XA 4ZW3A 4XRCB 2CPCA 1E4KA 3H3PL 4YHNB 2F15A 4HJJH 1HHJA 4LDLB 2A77L 2XBZA 1BIIA 3OGCB 4PQXA 43CAA 3UAJC 4YSEA 3GTTA 4ICXA 5EBGA 3UGUA 4OZIE 3L08A 1I82A 3GO1H 1VKXB 2B0SH 3OKOA 5I19H 3AREC 4X6BA 4PW3A 2BO0A 4I0PA 5BQDA 5HDOA 2BW5A 2EDFA 2FCBA 4A7VA 4MNQA 3N9GL 4EAEA 4H44C 5B38B 1TFPA 1OSEA 3FH7A 4A7GA 1EGJL 4NNYB 1YNKH 3MN8A 2WMPB 3BAEH 4PJCB 2QFPA 3FTUA 4QXUH 1DQML 1UM4H 4BDVA 2XWTB 4F92B 1YMHA 1T0NA 1FL5A 3IE4A 2AXGB 3SPHA 1CLOL 5T5NF 2XQYK 3L95A 3WIAA 5ID0B 4XMTA 4Z3IA 1VGKB 3GZOA 3RU8L 4RAUB 3HI6L 3OG6B 5DD5H 2AQQA 1EXHA 4G5ZL 1L0PA 5FYKU 3O8XA 4ZTOL 2ITDA 1HCVA 4FMKA 2XWTA 5D4HA 2JCWA 5LAXB 2RBLA 1PD0A 3NACH 4HX1A 4JG1L 1Q1JL 4UNVA 3HG1D 2H3NA 3C6LB 2XWZA 2VXUH 3ZRFC 1OAQL 3QCUL 3CPUA 4Y5VC 1U0QA 2ZWKA 4OJAA 1IBGL 3UAJD 3ZY7A 1S7TB 2FO1A 1TJMA 5KVDH 4JG9A 4DO4A 5A43C 2O6FA 2IXQB 3MBED 4PY7A 2GBUA 4PI2A 5HHMD 4XMLL 1KELL 4Q4IA 4FQXB 2H1LM 5KSBF 1CDUA 4NNPH 1KZQA 3AAZA 2XJLA 4XHJD 5ANMA 3NFSL 1KB5L 2VDKL 5K1JA 3KLHD 4OZGB 3H4HA 2R2CA 2DLHA 5KVFL 3ULUE 4FQQA 4HUKB 5CM1A 2G9HB 4PJXA 5GZOA 3WO3B 2O6EA 4LNRA 4YQXL 4ENED 3VAEA 3LRLA 4N0CC 1YQ2A 1FC2D 1CB4A 5J8OA 4R5VA 1PZ5B 4W70A 2R8SL 1AGCB 3ETTA 3EO1B 1L9MA 5CEZE 3EDDA 5DS2A 5E9DB 1NIEA 5IMKA 4ZFFB 2XBTA 2CKBH 4XVOA 3CZKA 3KPNA 2X4NA 4Q89A 5DD3H 3BW9B 3STBA 3BWUC 4H2CA 2G2RB 2WXLA 1X5AA 4ZOAA 1B2WL 4RFOH 1X5KA 3HC4H 3RWGB 4L4VA 4JHWL 4WUUD 5CUSL 4A04A 3GZKA 1KXTA 3ZXAC 4PJBA 1GL4B 1AXSA 4G3YL 2R69H 1X5GA 1FIGL 1M71B 4LLYA 4CMMA 1MIEL 4E9XA 2UY7A 2YPLA 1W72A 4DW2L 1DJHA 3UTZA 4AUJA 2DI8A 4P2OC 4WK2B 5D1XE 5GRUL 3U7YL 2Y24A 2WZ6A 4LHUA 2WWMD 3ULVH 1N4XL 4X8GA 1VACA 2A9DA 2R9HC 3BYTA 4OI7A 1CGTA 4JY5H 1J8SA 3U6RA 4P2YA 3QDMD 1GZHA 4UF7C 4JFOA 1I4FA 2C4FT 2JB5H 3GBLA 1YA5A 4G59C 4W68A 4ZG1A 1K72A 3I50H 5FV2A 1E30A 3HG4A 1TJGH 4HYTB 4QWWC 4ZPTB 2X44D 2YKLL 3TA3C 1WZKA 3BXNA 5DA0B 1AI1H 4AV0A 2P8MB 2AQTA 3APNA 4I7ZC 3DYPA 4XC1L 3V0HA 2HT4C 5HVHC 5I1EH 4ONGL 4WO4D 3CN0A 1RJYA 4V1DB 2FH8A 1X4YA 2IAMC 4PB9L 2R2EB 2YO3A 4NQVB 4BKLA 2C9AA 2Q0ZX 3CX2A 4IGBC 4P2OA 3N41F 4CU8A 1OW0C 2BSSB 4A2HA 2PYEA 2W0LA 5F7YC 1KDJA 1CDIA 3D33A 1U8NB 3UG4A 3DMMC 2HFTA 3SSGA 4D2NA 4CVUA 3VXMD 5B38A 5DHXB 4KFZC 3GSNB 2JF1A 4XPBH 4N90D 3PWPE 2BVQB 4NO0B 2EH7H 3KCWA 1ZGLB 3MNMA 4B27A 3TO4A 4J1UA 4WTQA 1Y07A 3MRQA 5IROC 3OAWA 5TGBA 1OOWA 4LLQA 4QLWA 2E5EA 5T5FA 3STZB 1HINH 3UBFA 5GZOC 1YHPA 4JFHD 1A1MB 1VJSA 3GZPA 4KTDH 1KGYE 5FO7B 5I1HL 2YMOA 4OZIB 1GYUA 1U92A 3P0YH 4OKDA 4IRSD 1X5XA 2CJTA 4OT1H 4OV5B 1G7MB 3O3AB 4HH9A 1GGBH 1ES0A 1AHWA 2F5BH 4JY4A 3TA3D 1CXIA 1EMTH 3AROA 3AWFA 4RQQA 1N6QH 1FIEA 3QCVH 1N59B 1Z1WA 5FA4A 3T0EE 4XMXA 1QSFD 3NJJA 5KSUB 1COBA 4Z7UE 4FRWA 1NEZB 1G7JA 2VR7A 4MJJA 5AVUB 2QFRA 4QIRA 5HGGS 1ZS8A 1CFBA 1YAZA 4A67A 3KDMB 3QJUB 4FZ8H 3GXUB 3SBQA 3K2IA 5I71B 2HP4A 2Y5TB 4Z7NB 5FA4B 4Z3HA 3I74A 2OXHA 1YY9C 2IFFL 2YARA 1JFQH 2NNCA 3O8XC 2A7BA 1G7QB 4JG1H 2WINB 1OWWA 3LVTA 3NEXA 5DJZB 3RILA 2BSEA 2EE6A 5TF1L 3U6XA 3MV9E 1UZ8B 4DHLA 3R18A 5L9DH 1P7KA 2R2BA 4U1NB 2G5BA 3EDJA 2G0LA 2E76C 3V4VB 1A02N 4JFXA 2A9AA 3QUMA 4R4BA 1IL1A 2P42B 1AZBA 3H6JA 4MBRA 1A6UL 3DOIA 3V0JA 2YD9A 4B3VA 1KB5H 4B9FA 1MNUH 1V5JA 2VABB 3LEVH 3CVHB 3HAEA 4MJ6B 5HHQB 2NY3B 3SDAA 4K2UH 4U1HA 5ETUB 3GKWL 3HS9A 5I8OH 4CKQA 2NNRA 2E7BA 3WXWH 3WGUB 1MJ8L 1T66D 1BF2A 1FFOB 1AXSB 3I6LD 4ZMLA 3FHQA 2BXZA 4TUOB 3V52H 4BSVB 2H0PA 4V2CB 1G87A 1B0GB 1H6UA 2D2CC 4L2YA 5J6GA 5HDQL 5LHDA 4XNAA 5FLUA 1G0DA 2BIQA 1JERA 2Y1AA 3WEBA 2DS4A 2UXTA 2FHCA 2YOAA 1BZEA 2CBOA 3SBPA 4Z8FL 1R24A 4XNUH 4U33A 5HGAA 3QUZD 5LJYH 4EQ3A 3FO1A 3L6FB 3HC0A 3EUDA 4RVBA 1DQLL 4IBYA 1HH6B 1UT1A 3HPLA 4UQ2A 5CD5D 4H40A 4WHYH 2OQJB 3UBXB 1FZOB 1XR8A 5LCVL 3VWKD 3ZRSA 3WY1A 1HE8A 35C8L 3W82A 4IIQC 5D1ZD 1F00I 1NGXA 1TDQA 4Y5XB 1IFHH 5F71A 1T1YB 4XBMA 2OI9C 4XC3L 5D1ZA 3GK8H 5AUMA 1HEJC 3LEYH 4OZFB 1FFTB 3WLWD 2HJFA 3Q3GB 3SDXE 3ZQWA 2PCFA 2WUBH 1BEXA 2FZ3B 3CG8A 1HQRA 1T66C 2AV7B 2IWKA 2XG5A 1QACA 1H0DB 1XXDC 2LAAA 1AXIB 3B9AA 1Y6NR 1YEFL 3K3QA 3CE1A 3UBXI 5HHNA 2C7FA 3R06A 2R23B 3FFDA 1XZ0A 2FH6A 3QS2A 3FDWA 3TU6A 4N2HA 1KACB 1QTPA 3BIBX 4NUQA 1L9NA 5B1JC 3O8XB 3GINA 2A6JA 4ODWA 5E56A 1QR1B 4Q9QH 2IDFA 1RJCA 4LVHC 2HKFH 1E4XI 1VB9A 5ALCL 3QWRD 1DUZB 5JW4Q 4XN7A 1BQRA 3L2LA 1BREA 1DEDA 4IMKC 1Q9KB 1HHKB 3IAPA 1IMHC 3CVIL 5HI5C 4GRWF 5FXCH 3ULVE 2FBRA 3DK2A 3MUZ1 4HISA 4FTVD 2EDLA 3LH9A 4Y5YA 3K71A 3F7RA 4ZZFA 4NZJA 3V0VA 5DD6B 1CLYL 3ARSA 4X7SH 4NWTL 4Y2OA 3RY6C 1S5IH 2ITCA 1UD2A 3W5MA 2XX1A 5E2UL 3SGKA 3DIFB 3V5DB 3WS6A 1ZVSB 4IKJA 4I3SL 4TNFA 2NW3B 3QIBD 3TPKA 3TGXA 4UT7L 5IESL 5D70L 2V3EA 2E0PA 1YEKL 2Z7ZA 1ORSA 4IOSD 3FYIB 1HDMA 1NDGA 5LWYH 3EYFA 4XCEA 2AMGA 4Z7VE 1BM3L 2OULB 3IDIA 3QS3A 5CCJA 2WBJB 4TSCH 1DBKH 2VUYA 1QOKA 1V27A 3DUSB 2F18A 4JRXE 4GSRA 3MROA 3O4LB 4WO0A 1EAJA 1XBDA 5FGBC 1FZKA 3KPOB 4ILDA 4QRAA 4XN2A 4IGBD 1QVOA 1SOSA 3RVTD 2WJ7A 3G3LA 5DU7A 1AR2A 2HRGA 3X11A 4PJFA 1JGIA 4X5PA 4PWIA 4E41A 2F68X 1E3XA 1QWHA 4PJBF 3EJZC 1DBBH 1RHHB 3GSNH 5IFJB 1W6LA 5E2TL 2PWHA 3VSUA 1BW8A 1HKLL 3A67L 3BSGA 3MRIB 3MR9B 4NP4L 3W9EB 4OLYL 4BSWB 1A9EA 1V7ML 5E8OA 5BQ7A 1PYWA 3L17A 4HIJB 2O5YL 4NQSA 3TC9A 4EI6A 4Y5XA 2DI7A 2NY0B 3V4UH 5CR8A 4KQ0A 1UA3A 2D7QA 2ZSVA 1CGUA 3H1ZA 4Z78A 5D2NA 5DJ2B 3BAWA 4MNHA 3ILPA 5AD0A 1MLBB 1CG9B 3TCXA 3CFBB 2R29H 1YEIH 5AB0A 1FJ1B 1VFAB 1WBZB 1OB1A 3D25B 4RRPA 1XF2A 5AL8A 2D7TH 2K3TA 5D7JA 3WXWL 3ESOA 5ICYA 3X1NA 3C5ZB 4Y19D 3VXRA 4OAWB 3FXIC 1JZIA 4R7DB 1DL7L 2PMZA 3ES6A 3TPUA 1OTSD 3S8GB 2ITEA 3JV0A 4L0YA 1NCJA 2X4PB 5T1DL 4WKZA 4P5KB 1GHFH 3Q48A 1A8JH 3CPLA 5HDRA 3NABL 5IB5B 4IKIA 3ECWA 2P80A 4NUPA 2P1YA 5DVNA 2GSGB 1ET8A 2OCCB 4H1LB 5D1ZB 4WJ5A 2HTLC 2B2XH 1JZJA 1A64A 3VFVB 2E46A 1WJ3A 4YHML 1UM6H 3HBQA 1BPVA 3CQQA 2YBRA 5LAPA 1R3KA 4N2KA 4NNXB 2FWSA 3MBWA 4OUUA 1PD1A 1FH5H 3EH4B 3TT3L 4PJ9D 1N8ZB 1E9QB 1MREH 2AI0H 3UCRA 1EJOL 3ROLB 5I73B 3PL6B 4TKWA 4Y4KC 4L1BA 1DDHB 1ROWA 2WXFA 4MSWB 1J0ZA 1PJWA 1G7LB 2DQDH 1YEJL 1J5CA 4HJ0C 4YXLH 1ZV9A 4ZYKB 4IHOA 3GUTB 1MEXH 2NZIA 3PDGA 5BOPA 3IFOB 3PG2A 3HNSL 3P73A 4XPAH 4Z76B 1NOLA 3NZHH 3VRIB 5JHBA 3D0VA 4PVLA 5F7FA 4PH8A 1SJHA 1RVFL 5EEWA 4HZLA 4HEMA 1T2QH 4OFYA 1N5YL 3NDZE 1HL8A 4X8JB 2GAZB 3LV3A 4DP7X 4ZO6A 3OD3A 3OKNA 4RDQF 4LCYB 2Z91A 1UT2A 3PWUA 5FYKD 3NFNA 1KXVC 3EJCA 1VFUA 3BKCL 4AKQA 3APFA 1ZCRA 2X89A 2Q86A 3EFOB 4X5XB 1SLUA 1Q0YL 1P1ZB 2E6QA 4DQOH 1UZ6F 3PJSB 2W9EH 4Q6IC 3MXVL 2Z8WC 1I8MB 3RGBA 3SQBB 3A47A 4RH4A 2GTWA 4IQHA 2N59A 3O9WB 2HWZL 4FQIL 1BZQK 2AABL 2BMKA 3OMIB 2ZF9A 1HXYA 1BECA 5JDSA 4KZDL 1XO8A 1E5CA 3VFSA 3MLYL 4LPTA 5IB1A 3RPKA 5EF1A 1E9PB 3LD8C 3N40P 2YRLA 3N85H 5F44A 1KYAA 3ZE2F 1KNOA 1ZXQA 1VENA 3BPOB 2Y2YA 4B9JA 1KCBA 1VLXA 3A22A 1NAMH 2PABA 3UZEA 1L7TH 3DTXA 3H56A 3RZCA 4QY8A 1CURA 5EOCL 5KVGL 3JTBA 1E4HA 3P3RA 2P8LA 3ZDZB 2DMGA 5DC9B 5JQHC 3TBTB 5IB1B 2ADGB 1I8AA 3LNGA 4LVOC 1NGYA 2HFFB 1ZA6A 3MNZA 3HG1A 4PGBA 2DTMH 1DJYA 5L2KE 3EJUA 3OLIA 2DQUL 2IAAC 1OP9A 3BSZH 3VFNA 4P04A 2ZXAA 2I25N 5KYXA 4L8SA 2ZG1A 1YEDA 4H8WC 3SZ6A 4HC1L 1GVIA 4GLRI 1IKOP 2MRYA 4BE6A 2OZNA 5FF6A 3JT0A 2IV9A 4KQ3L 3EDKA 3QUKA 1ODAA 1DQMH 3MUGB 3LNEA 1NBVL 3HR5B 1XMWA 2ALAA 3ETSA 5BV7H 3O2DA 1PG7L 3DVNB 4ZPTA 3QZWB 4Y4HB 1WWWX 4ELMB 3Q6GL 5DHEA 4HF5H 4R7LA 4NO0D 2ZCKL 1EZVY 2ZXEB 1T3FA 3HZYA 4XP5L 2OKMA 1IAMA 5DVOA 3EAKA 2F54D 3QDAA 3FQYA 3P11H 2MQCA 1F4WH 1LO0L 4C59B 3DV6A 2WP3T 5CEXB 4I0KA 5KVGE 2B08A 1JPTL 4I0PD 1WEJL 5E94A 2COVD 4L37A 3GSRA 1B90A 4HWNA 3C6EA 5GS3A 4APQC 1AGEA 2JB6A 4GS7B 2OMYA 2Y6SC 2CDEA 2J56A 5JORB 1ICTA 4WW1B 4WI4A 3VXUA 4TVPL 2VSMB 1JD7A 4Z7IA 5DEFB 2FWOA 5EC1A 3QO0A 4KFMA 2PCFB 3L16A 3S5LG 5BZZA 1KG0B 2ZOUA 3HLAA 3QC5X 2G5RA 3QR0A 1EGJA 3QQXA 1KJMA 2Y36L 4L3CA 5AFAA 2MMXA 1QFHA 3GJFB 3F84A 3KWVA 4ODTL 5E51A 3S5LA 4J3OC 2WLNA 1UACL 2R23A 3FFDB 2PPCA 4MYPA 2NYZA 5KYUB 2VMEA 4FLOA 1LO5B 1E43A 5DK0B 3BH8A 2FECI 2XQBL 1E2VA 5IJKC 3B9DA 4HUMB 3BPCA 1W0VA 2V2XB 3INUH 1WLHA 1ZHKB 3NFPB 1JNNH 3IDYB 2H1PL 4HLZG 2ZXBA 4FP8L 2GUOA 3KLAA 5JXED 2Y69B 3K80A 5ICXB 3UBXG 4AGQA 3KGUA 1GGIL 2VDNB 4TNGA 4BGLA 4ZMXA 4AH2A 5ISZE 4ACTA 4F58H 1T1ZB 3VFUB 4PRIB 5F8QC 1U41A 4R2GB 2P47B 4OJCA 2XQ0A 5AB1A 1MY7A 2WXJA 2GKIA 3NTCH 2AJXL 3OHXA 1PD6A 2A9BA 4OSUL 2DD8L 2ZKYA 4Y4KA 3MRRB 4BWWA 4G9FD 3FU8A 5E4OA 5DZNA 5DWUH 2CDGA 4MA8L 1BOGB 1TIUA 2JKSA 3MRNB 1MCRA 4NN6C 1PFOA 4NJ9L 1LQSR 1UYWH 4GI9A 3RWEA 5AW4B 1KPUB 1XGYL 3EH2A 3SPCA 4KNTA 4EN3C 2J5WA 2D7MA 1UATA 1RULL 2X12A 2XHNA 3EADA 3HFML 1I1AD 3IJEB 4UZGA 5DTFA 1I9EA 3V0AC 2VQ1B 4RNRB 1XH3B 1QD0A 3L1OH 3RVXD 3IRPX 2B59B 2B77A 4ODSH 1MQ8A 3A0OA 2EUZA 2X1WL 3T2LA 4P3WA 4G9DA 5E4EB 5AEAA 2Z0BA 3S96B 4JFWA 1DQDL 2APWA 4KQ4H 4X80L 1ADQL 2BNRE 3NAAH 4WK4B 2BOLA 3QDMB 1KF9B 5I8KH 3MGOA 2FGWH 2J57A 4ELME 3BZ4B 3ILEA 1L0QA 4JFZH 4AZ8B 4JVUA 5JW5B 1DLFL 3N42B 3QJZA 4WY7L 3IJ8A 5F93C 3SKJH 1KB9J 2VLRD 5CAYB 3CU1A 3QULB 1YNTB 3FHAA 1JZ3A 4YK4B 1RJZA 5I6PA 5TDOA 5CJOL 2NSMA 5ADPH 2BVEA 2LLNA 1JJUA 2JKJA 4YSUA 2D3NA 2V5YA 4S1DD 4IOIA 4OLVL 1T5WB 1IARB 2XKNA 3WJMB 1HAUA 2BHYA 4JRFA 5TE6L 2XZAL 3EBHA 5B3JE 3HE6B 4N6RA 3JV5A 1OARL 2BVPA 1JDAA 2W81C 3BPOC 1FFQA 4O2FB 1JVOA 4F7TB 2BCMA 2D9CA 1QNZL 3O3BA 4KRLB 5GRXG 3M46A 4IOIB 4JREC 1NLBH 3EFDH 5IP4A 1QUNA 1OAKL 3MRQB 3RL1B 3TF4A 1ZT4A 3FQRA 3LNDA 5DVKA 1N6QL 4ABQA 3NRFA 3RWCB 3E6FA 4JL1A 4W9JC 1KBKA 3SDCC 1FNFA 4GFXA 2Q9OA 2FK9A 3EKCA 3MJ8A 1FYTE 4FG6C 1IC1A 2GTQA 1JPFA 2J8OA 1NINA 1TO5A 1R0AH 5FO7A 2ZSWA 3KJ4C 3CIQA 1U2YA 4JANA 5DHYA 3ISWA 1IAKB 1CDCA 1QFWH 1U8QA 5E0QA 4KZEH 3TCLB 2EVGA 3E9TA 5F0JB 3G6JA 1EVUA 3BESR 1CU4L 3RDTD 1J8HD 1NJ9B 2C3XA 1UWXH 3PNWA 4LSRH 3WY4A 2P7TA 5L2KB 4HQQH 4MMZB 3P73B 3LYRA 2CALA 3GMQA 4HUNB 1RZKC 3FFCA 3HHMA 1WHOA 3GDBA 4NKQB 3GXFA 1J0KA 1B4LA 2C1PB 2EIEA 5BXFB 1R47A 1OO2A 4P3CH 3ELQA 1R3LA 2IJ0C 1BWMA 4FNQA 3MNVB 5IW3A 4FQJH 4H0GA 4PHZA 3MLWH 3P1VA 3T8XB 4A7QA 1OZTG 1P1ZA 2K8QA 4BZ1A 1A7QL 1IU1A 4JGMA 4RGMC 4UTBH 5GRVL 4DOHB 1CFTB 3KXFE 1URZA 3AG2B 4AZUA 3TTSA 2XQBH 1MNNA 3PWUB 3DIVA 3ZDYE 1KPRB 5GGSB 1MRCL 1WGVA 3OPZL 1RZ8B 3P2DA 5I1AA 3EYSL 4HGWA 1BIHA 4F27A 5LO7A 3AM8C 4J12A 2ZX8A 2HRPH 2EDBA 3HBGA 3OMZA 4GRMB 4FHKA 5HDQH 1X9RA 2I9LA 1JK8B 2X6BA 3L1GA 1MUJA 2F1AA 5E6SB 3MLTA 1TQUA 1K3IA 4NN5B 4PJ5D 2Z65C 4ABWA 2VN6A 4JJOA 4AG4L 2DTSA 4MBOA 2HLAA 1MQKL 2F5AH 4WNSA 4Y9BA 5EMYA 3VE0A 4P9MH 1D9KA 2H6UA 1M1XB 1MCOH 4G7YH 3A6BL 3HMXA 3D39B 1ED3B 1OCRB 2YAHA 5JW4M 1MCCA 3FF8A 5JPMB 2MH4A 5KS9F 4FFZH 1FH2A 4AQ8A 3JYCA 3VD0A 1ZTXE 3DKHA 1BXAA 2XV2A 3G5ZA 3ZZQA 3K5RA 1F41A 4FC3E 1JWSB 5F7KC 1GCFA 4QKXB 1PZSA 1Q9WB 4NZTL 5I6XB 2WM0A 2AFNA 4EI6B 1EH9A 2KZ1B 4C56A 1VFOA 5B39B 2BSCA 3RURA 2BOCA 4TNVF 5J13C 2F19H 1K5WA 3D25A 3AQXA 1PVHA 4HLJA 1WA0X 1GW6A 4YHLH 1Q0XL 4Z7QB 1CQKA 3VFOA 1HWHB 3IFPB 1MLBA 2BH0A 1QPPA 4BRJA 1CK0H 2Y6TE 4IKKA 2DM4A 2EH8L 3MV7B 1W9XA 1QA9B 3HZYB 3HIZA 4G8FA 3RTQA 5EPMB 4YSCA 5A16B 3BUTA 5D7JB 4LQ1A 3RWHB 5B8CA 3FQ2A 5HYJE 2VDOL 2WTRA 2Q6WB 5CBEB 2AQ2A 5LDUA 3KVPA 4KZ0A 4Z3FA 2A1WH 4TSBL 3NA9H 2YA2A 2BVPB 5DUBA 2F53B 1C7TA 1SDAB 4U1JA 4GAAA 2B4CL 3TT1H 4A38A 3G6JF 3AGVA 3ARGB 2PCYA 1Z3RA 3UL4A 1XGRA 2EDNA 2A6IA 5I1CL 2GG1A 1MSPA 3O45B 5B8CB 4F8OA 2H4EA 1IVTA 3GPSA 2WMPA 4BA0A 3NN8B 4MA1B 2A4EA 2DWXA 3EGSA 4XNDA 1MFEH 3GBNH 1JDCA 2XUWA 2VDKB 4PJEE 3CZFA 2Y7QB 3ARGA 2A74A 1QNZH 3N43B 2ILLA 4UIMA 3PDOA 4YHKL 1BEYH 3GXPA 3QFDA 5IROA 5D7LA 2AQSA 2PP7A 3Q8FA 1EDQA 3QRGH 1CCZA 4OCSH 3G04B 2R9HD 5IESH 4W81A 2FB4L 1FLTX 5AOIA 4AK1A 1ZIBA 2DEXX 4RIRB 1VAHA 4HULB 2V5TA 4UT6A 2XI9A 4IU2B 4LVHB 4O9HH 4OFDA 5HDBF 3HHRB 4OCWH 3JV6B 5JXEC 4ZNEA 4PVMA 3FH5A 1ZVNA 2XN9D 2CKBA 3QIBB 4RCAA 1MRFL 2GJPA 2WXGA 2WLIB 1NGPL 3ARFC 4M6NL 5DMGC 2EVJA 1G6VK 3NOIA 4DF9A 2P5WD 1J9RA 5F9OH 3L5JA 2I5YL 3G9VA 5JMRA 3WG7B 1IBZA 3O6KL 3OKKA 2MCAA 2DH3A 1PIGA 1P5UA 4QNPF 1U8PB 3QUGA 3II1A 1HKLH 3AS2A 4O02B 3EO9L 4L5FL 4K9EC 2X9ZA 5T1DH 4R97B 2IPTL 1LO2L 1KTRL 2WLKA 3ET9F 4Y19E 1IBYA 3WJJC 3MCYA 1YN6A 1OW0A 1Q9LA 3QFGA 2N7AA 1L5GB 1I1CA 2VXVL 4W4OC 4I9WD 2OTUA 3TBBA 2OYMA 5TE7H 1A14L 1DVSA 3IBOA 3TESA 5F6HJ 1P2CA 3HE7D 4LRIC 2KS0A 1UWGH 1ETB1 2ZYSA 4F24A 2NY6C 3DX7A 4F93B 3M45A 1FFNB 5E5RB 3IETB 4JFDE 2AJ3A 1BMZA 5HJBA 4CMMB 4HIHA 2ATKA 4OZHE 4A66A 2DQDL 4HPOL 3UTPE 1ITCA 1Q94B 3D12B 4JRWA 1ML0A 3LZQA 2BRRL 4KGJA 1HXMB 4M8QA 4BXVA 2MPAL 3GSOB 5DQ9B 4DZ8B 3DX3A 4AQ1C 1DBMH 4P23D 5HI4C 2X4PA 5C0GA 3U36B 4MXWL 4G1MB 4JCLA 3RFZA 4EOWL 1VCAA 4I1RA 4PCTA 4UTAA 3RKDD 1RXLA 2NY0C 4LU5L 5C0EB 2VDRB 1XXFC 4XWGL 2GJZB 4K7PY 4K4KA 3TFBA 4FNTA 4NJAL 3WENA 2PP9A 3LS5L 4POZD 4HT1H 4XNMB 3V6OA 4QTHB 2IAMD 1DDTA 1S2EA 2X4TB 3GEFA 4HETA 3T6VA 4A55A 4ELMF 4IK7A 4XPGH 4ZUTA 2QDVA 2YC1B 1TTCA 4FNSA 3EXJA 1M1SA 1OK0A 5IMOB 4RMUA 2NZ9D 2KDYA 5F7DB 3DXAD 4K15A 3WN5A 4FHJA 4YC2C 4NRXB 4PJ9A 4GW4B 4QHNB 4UM9D 5ERWB 2C9UA 5FHBL 5I66B 3A6CH 2VC2H 5MEQB 3CFCL 4IOSA 3N85L 4XPTL 5LBSH 5FK9B 3QHZH 2N7SA 4CVXA 2ICWI 2O6CA 2VDOH 4S1DC 5E4AA 4WO4B 5EBMB 1X5JA 5EEVA 1DVQA 3HI1A 4KAQL 5F2FA 4L1HA 3O6FC 4DFIA 3WFDL 2A83A 3NIGB 2RR3A 2WQ8A 2XN9A 4KXZI 4PJAB 4X4KA 4KVCL 4FF9A 2CPUA 2UX7A 2EDJA 3RDTC 3WKQA 1T1XA 4NI6A 2MQ3A 4FQHB 4GRWH 1U91B 1AHWB 2OSLA 4B3EA 4JL2A 3OKLB 4BQ9A 4ZPVA 1JTPA 4FXKB 1EJ6A 1DR9A 2DMHA 2YOCA 3UFIA 1KGJA 4GY4A 3MLYH 4NBYB 2OMZA 5C0DB 1N3NA 2NX5E 1H8OA 3PIQB 4Z7UB 5EWIH 1JHKL 3NJMA 3M8OH 3O6FB 4MB4A 4YE4H 4U7KA 3MUJA 3LPWA 4AYGA 1KFAL 1JMZA 5LBVA 5E70A 1ESOA 3X3GL 5ACZB 4P3DB 2GITB 2YGPA 2F74B 3QHFL 4LAJH 2VYRE 3O6MH 2QJDA 3QJFA 4I3GA 4PLNC 2QHRH 3G6AA 5EEZA 1UA6L 2VQ1A 4LOUC 1KMGA 1A8ZA 1YEGH 3T65B 1F4WL 3BJ91 1OCOB 4IBZA 4TNWK 3JZ7A 3VTAA 1G43A 3FFCE 3UC0L 3RVWD 2J44A 3WUWB 4KY1H 4OF6A 4U31A 3EOYG 4LBEB 1JRHH 1A4KA 3UMNA 1K8IA 1KOAA 4M8QB 4PREA 2ZWSA 3IM1A 2XPGB 4NN7C 1NMBL 1SYSA 1M2VA 4TVUA 2BCKB 1S7SB 4DAGH 2B14A 3OB0H 5GZNC 2PYEB 5AG8A 3VRJB 2WWKT 2XWRA 1IM3D 3EOAA 3TOPA 3NP4A 3ARUA 2HFEA 5D8JH 1OCWL 1CLZL 4UMSA 4N3UA 3ZR6A 3VYNA 4ZUVA 1M56B 4G71B 4G6MH 4MCMA 4R8WL 1PAZA 3REWB 2QELA 5J1AB 2IMMA 3F6LA 3QUZA 4DZBB 1MCBA 1IKFL 4C56D 2GSIB 2ATKB 5K9QG 3D0LB 2P5EB 5IQNA 2MQ0A 2NQ3A 3ZLQC 2CRZA 2XWBA 3TV3H 1K85A 1PF3A 4JN1H 3BPNB 5GGTL 4KRPD 4QRUA 3IDUA 4YH6A 5T3ZD 1EXUA 1UADC 2FX7L 3L48A 3U0WL 3OKYA 4U1IB 1F4YH 2LFEA 3L3GB 3LKSA 4G7SB 5MP6H 4N0UE 3CMOL 5AVQB 3RX5A 4QRPD 5AENA 4TPRL 3FJTA 4WUUB 4L0ZA 3EYOB 2G0KA 2CO1A 4I0CC 2H6PB 4MAUL 5GGUA 4NNXA 2N1KA 1LE9B 3AXLB 5CJQL 1KGCE 5JW3H 1GOFA 1MF2L 2FVNA 3QWRA 3NEOA 3PV6A 5A3ID 4WWID 1KJVB 2DM7A 2Z0UA 4FYRA 4TMPA 3MO1B 5CSGA 3D34A 4NCC1 4PIRF 3L3GA 4MA7L 4FXKC 1BJMA 3UIYA 3HLAB 2PYFA 4JZJB 4QKTA 4WEBH 1S8DA 4DP6X 1EZLA 1G7IA 1H5BA 2OTPA 3RU8H 3NSXA 1CFSB 3C6SA 4JFEA 4NERA 1FNGB 2Q3AA 4FQLL 2FD6H 5GHWL 3NCXA 3SYAA 7TAAA 5D7KE 4MQXC 2ZSWB 2A5UA 1RIVL 2EEAA 3S6CA 3EUUA 2FYYB 3WUWG 2EDMA 4UBDD 5IBUB 3GMQB 4FERA 2BP0A 1AIFB 2P5PA 3QG6B 1DHKA 4AEEA 4Z0XA 2Y7QA 2CM6A 1ORQA 2JJUA 3NJNA 2BNUB 4ODUB 1C16A 3KYOA 2EXWD 1RD6A 3LSOB 3VXSD 3ZZ1A 2V9QA 2I07A 2VXQA 4JRLA 1P5VA 1QLEB 4PJHB 1AD0B 3S3DB 4GG8A 3H9SB 1S46A 4R7NA 1XIWB 4K23L 4YX2H 1QSFA 4KV5E 3B2VH 3KJ6H 3QEUA 1G94A 3CQPA 4QHMA 3I75A 4P49A 5KOVC 7PAZA 4EBQL 1QBMH 4N8UA 4FQCL 1OQOA 4ERSL 5LGHH 2I9TB 4LASL 2G60H 4G83A 3PHQB 5ICZB 1OAZH 2Z93A 3PS6A 3E3QE 1GY1A 2HFFA 2NY2D 3IMTA 3MNZB 5KTEH 3QI9A 1XF5A 1WYJA 4WV1B 3WN6A 4F3FA 5DO8A 2WKGA 1KIUB 1WBYB 2EIZB 2X70B 3G6AB 4PJCE 1YZZA 2DWTA 4JUTA 3U7WL 4EDWL 1U95B 4M1DL 4O58H 3BKYL 1YNLL 5JXAH 2QMKA 3VDBA 4OFKA 4F33A 1UM4L 4TLTA 3V8OA 5IB3A 4PBDA 5CR1A 4V33A 3L3KA 4PJIF 5IEHA 2ZKHH 4M7KL 4K7PX 2W92A 1JWSA 2V2WA 4X0KB 3O6ML 4FX5A 4N2IA 2BSRA 4LAQL 3MOAH 4RLDA 3CZNA 3ZW3A 3NGBB 1LWJA 3B37A 2YQ3A 2BVTA 3GS0A 1NUDA 4KRPB 1CDJA 5T5NG 3HS0B 5ITBH 5DEGB 5JOPE 3V6OC 2EXYD 3QIWA 3RTLA 5I1DA 1CL7L 4JAMA 4M62L 1ASPA 4UM8B 1HQ4A 2VXTL 2H0EA 1CXHA 1LO4H 4BQ8A 4Z7VA 4JQVA 3ROLA 5JIPA 2KLSA 4FG0A 3A4DA 5KBNC 5DMIH 1I8KB 1KELH 2WXNA 1GGTA 1M05B 3L9RA 3V5HA 5JPMC 1M7IA 3Q8AA 4ZFGH 1UCBH 4Y2DD 3C60D 4N86A 2E86A 1KENH 4J3BA 3W81A 3GSXB 4KZEL 1BAFH 3L2MA 5LG6A 2BPBA 2WGNB 3TA3A 4KO9A 4G6FB 1EZSA 4YQXH 4WUUA 3T04D 2YXFA 1BJ1J 3TEXA 1LGVA 2ZIDA 2PR4L 2IPUG 1FO0B 1MWAB 3QNXA 5C0BD 5C0BB 4XMPH 5KYUA 4NUGH 4OIIL 3SKNA 3CDYA 4PJHE 3EO1A 3LDBC 3CFJA 3OPUA 3HUJE 4OJFH 3BCDA 2DM2A 1N0LB 4NQUA 4P07A 3U79A 4QYOB 3ATAA 3L4VA 2VRAA 3HC4L 1MHCA 1YEWA 4P23C 5C08A 2YHGA 1AKJD 2XNAA 5EU5A 5DVLA 1I1AB 4D0DB 5DHVB 3US9A 2IEPA 1JGDA 2YD1A 2HT2D 3UYRH 1MOEA 4U6VL 2NDFA 4I2XE 3WNMA 5EU3A 3QDJB 3CUPB 3KW8A 4OZGA 1ZT1A 3BWSA 1WFNA 4FAAB 2AJSH 2C1PA 3OX8A 4X9GA 3U7YH 2WVVB 2K45A 3WIHL 3MAWA 2YD6A 3MFGB 3PWLA 1J12A 1KUMA 2DLIA 4AGOA 3PNRB 2GJRA 1NGWB 3B34A 1KYUA 2ZCZA 2VDQL 4WO4C 2AW2A 1PZ3A 2I7SA 2WQXA 1QRNE 3GNMH 4D0BB 3P4OA 4MD5B 3KPOA 2ICEC 2VW7A 3OWRA 4URKA 3JYBA 4NUJB 3CLFH 3LH2H 4R26H 2CDFB 1BVOA 2WP3O 3V55A 4LLVA 2ZNWA 2A6DB 4WLCA 3ZKQD 5D1QB 2XTJD 1BA9A 5JHLH 2DBLH 3TVMD 3WDIA 5L9DL 4DP5X 4N2MA 4XAKE 1I3VA 3MA7A 3CFTA 4DN4L 1BMWA 3K72B 1YC7A 1NDMA 4KRPC 2LGNA 2F74A 4FNLL 2EC9U 2A1WL 2YPLD 4TSBH 5G55A 1I1FA 5K9KB 5F88A 4JKMA 3VFNB 3EG9B 3GWJA 4U3CA 3V7AG 3GSVB 4WHDA 3ZL4H 3UYOD 3LEVL 2QL1A 2JLPA 1KCVH 4E2OA 3VFMA 4UU9A 4F1SA 2C9QA 1H3PL 1IJNA 2XPGA 1FFPB 4HEME 4KVNH 3MUGA 2WNKA 4HOXA 1BBJA 3S37L 2UV3A 3MRCA 1JF6A 4ABVA 2EH7L 3I84A 4I1NB 4RMBA 1MFEL 1OLZA 3GBNL 1QBBA 3ZO9A 1LP9E 4F7MB 5K9OA 5HD8C 1M6UA 2EACA 2N1TE 3FCTB 4U6YB 3CIAA 1MI5B 5KBDA 2H8PA 3VFMB 2CG9X 4X6FB 3MCLL 1OKEA 4ZS7H 2FX9H 5TGBB 1PY9A 3SEPA 3I02B 1ZA6B 5FUCC 3UTOA 4O58L 2ZXQA 2VKWA 3D4YA 2VISA 2KZWA 3MRLB 5F96L 3V7MA 5L8KB 3DSNB 3UJTH 2H32H 2VLKB 3SOBH 5AAPA 2BY3A 1YEDB 4ZX5A 4L8CB 2WPGA 3MODH 4HCRH 2P28B 4U1JB 3M1BB 3OMNB 2J12B 2OL3A 2OJEB 2BSSA 3K4ZA 1I3GL 3O3EB 2ZOOA 3BEWA 4IIQA 3WFZA 1NEZA 3MHZA 1YMMB 3O45A 4RSYA 2GEEA 1E7UA 1MRFH 3BAXA 5GZNA 5B39G 4I85A 4MKTA 1BFOB 1EDYA 2DRUA 1RZGB 5I6OA 3VD1A 4LLWA 5H2BA 1UQSB 3MLVL 1E65A 1U8HB 5IEKB 3GDCA 3AITA 5EEYA 2V17H 3E8VA 5AUMB 5LBGA 3QYMA 3VDCA 2YPVH 1AZUA 2JFCA 5DD0H 2YD3A 4WSGA 3GJFK 3JSSA 1IO4C 3BFOA 2ZICA 1AQMA 3ZKMC 2R56H 5J56B 4K8RL 5CU5A 3SJVA 3H9HB 5DMIL 2Z91B 3GB7A 5LB1A 3CMGA 4N22A 4AOFA 5JR1L 1MFDL 2ICEB 1I75A 3FB7B 1IC4L 2UY6A 3R0NA 1T22B 2E8ZA 1KCUH 3AMKA 1HC1A 4HUXA 5CWSB 5ALCH 2GBTA 1R17A 4QYOA 4A6YA 3FRPA 5IBLC 5ENWA 3SE8L 1KLFB 4DKEH 1IC7H 4YO0A 4OFYD 3RJQB 3T8XA 3T3MF 1T22A 4YDVB 4X4YA 3W0WE 3BQUD 3B56A 4ONHB 3SDYL 2GIXA 3FU5A 4KI5C 2XFXA 1HOCB 1YRKA 2BRRH 2YMTA 3AUWB 3G5XB 4HG4J 1MJ7L 2RQ8A 4V2BA 5C0FB 3RIAK 4P5TC 4V1DD 3W5NA 5DQDL 1JYNA 3IE9A 4M93C 4RWYH 5E08H 3HRPA 2W07A 3GJEA 1E6OH 1MAJA 5D70H 1D5MA 1IGCL 5EZJB 1R5WB 1FLRH 1HX0A 1NCDL 3ESNA 1G6RL 5LCVH 4OGQC 1IKNA 1KXQE 2AAAA 1I8IA 1XSJA 3GMOB 4HT1L 3QZWA 4Y4HA 4WU7A 1IFRA 3DV4A 4GBXB 4R6UA 4XOEA 3C8KB 5E1IA 3GIVA 3S3SA 2J20A 3N40F 4DT2A 3UZVA 1JF5A 5CGYC 1YY9D 1H8NA 1FAIL 5DFVD 3T09A 2Q87A 2XRAH 1GKEA 4QRTB 2GJJA 1U4FA 1XF4B 3R4RA 4MXWH 3DX6A 3PLYA 3S5YA 2GYSA 1Z9SA 2VC2L 2WJ5A 2BSRB 4C47A 3KJ4B 4LCCA 1HHIA 4F7CB 3QHTC 3HA0A 3TO4C 1NFDE 3MOBH 1EERB 3VCLA 3L3OA 2VLLA 2OYLA 4Q97A 2LOEA 4F7TA 1JS4A 1QI4A 5JHLA 2FHFA 1RHFA 2AXFA 2FECL 1UQSA 4NBXB 2VJXA 4GQRA 1HL9A 3SDDC 5FF6B 1SLWA 4MDIB 5C0RL 2E27L 2DYPB 4MJHA 4WW1A 3TN0C 2AXGA 3SN6N 4UM8A 5D5MF 2WTRB 1B0RB 2Q6WA 4PJCF 4KRMB 2J1KA 5IG7A 1A22B 1L6ZA 3IXTA 3ZUCA 2AZAA 1YJDL 3WMQA 2VLME 4HSCX 2VZTA 3QVAA 5E24E 5BS0A 2AANA 1YYMH 4LSTH 4XPTH 4DGYH 1RMFL 9PCYA 1CIDA 1TZHA 3KPPB 4DGIL 4DO5A 4BK4A 3MC0A 4N9OB 2IPUK 3HI5L 1I8LA 1KY7A 2Z9TA 1CFVL 3LIZA 2JNZA 4P57A 3T4AC 3MRPB 3WIIL 1U92B 5I30H 4HJJL 5C92A 4L5FE 1OPGL 2VDNL 4NS0A 4X4XB 2NQDA 3P0GB 2H9GB 4IKLA 3AY2A 3S8FB 2O5XL 4LQFH 1SXBA 1EIBA 1MFCH 1MG3C 4N8CL 4HUCA 3KPMA 3OHXC 1LEGB 4GAGH 4GMTL 3E6FB 3OZLA 1QWNA 1I8MA 2G9KA 1GGCL 4NKOA 2XZCH 5GS0D 5GQBA 4YSSA 5IJDC 1GYAA 1N7ML 3FT0A 4ZZKA 4Y5YB 5IHBA 4JHZA 4MS8D 3ZE1E 5F72S 5DR5L 4U1SB 3QZMA 2WLHA 1GSKA 2P4AB 1H8LA 2F54E 4D9RE 4KKQA 1F4AA 3OKLA 4GRMA 2JK5A 3GSNL 1LO3H 2KERA 2GBAA 1RJLB 2EILB 1P84J 1JZDC 2IGFH 2ZCLH 3CDGB 4QRFA 4Y1AD 1RVFH 4DP9X 4YXHH 3QR2A 1ETZB 5TTRA 2MCG1 2ZX9A 1NGWA 3C5SA 3VD3A 3PGCB 3QDMA 1IAOA 2NW2A 4PRHA 4M1GL 5A2FA 3DTDA 3EYUH 2ZOLB 3LRKA 1SVBA 3FSWA 3GXDA 4R96A 2NXZD 2AJVH 3RWGA 5C0JA 3K6OA 1P2CB 4HUWA 3QEGL 1NCCL 2OTWB 5EBLA 4GSXA 3GBMH 3VFRB 2PNDA 3C5XA 2TSAA 3D09A 3I6SA 1A7OH 5PCYA 2IADA 1K2DA 3TP4A 2R29A 3BVVA 1DL7H 1XF2B 1BYNA 1CLZH 1INEH 2UY7B 4KTGA 4RX4A 4AT6B 5LNGA 2X40A 1MWAH 4KKZA 3WKNA 1JV2A 5DEZA 1J0JA 5INDA 5J6GB 1CF8H 1CE6B 4G7VH 4XZUA 5HHVL 3KLHC 4PS4H 5I71C 3LKRB 4WVRA 5I8CA 2DLFL 4ORGB 1WTLA 4XBEL 4UTAL 1E3FA 5E2VH 1GZPA 1O7DE 2P8MA 5K1NA 1RUAH 1WISA 2WN2A 3DVFA 1TCRB 1DVFA 1XH1A 3VH8G 4HKJB 3BUIA 1EBPA 1PKQA 4DNLA 5ELIA 2XVBA 2X7LA 2BW4A 4PRHD 2ZG2A 1NCDH 1FO0L 1G6RH 2OQJA 4MXVF 5J9PB 3HE6C 3BYYA 1ZMYA 3E1ZA 5FCUH 2EDXA 1GAFH 4AEFA 6FABH 3HUJB 2E3VA 5D2NB 5DEFA 5EC1B 2LLLA 2YS4A 5D7KD 4KKLD 4IJ3C 1YQVH 3L1FA 1E5ZA 5F3HA 4GJTB 3ML8A 3HNSH 4LEXH 3WFCH 3GLAA 2RA1A 2VQ4A 2V2TA 1I3RB 1G9MC 4Z3EA 4H4NA 3GSUA 4L8SC 4I0PC 1LK2A 2UWEA 3DIDA 4HFUL 4JHUA 3FUNA 2C9RA 3K5SA 3G08A 1XTLA 1A21A 3BPCB 1NPNA 1S7TA 3LIZH 4KOBA 1QBML 5E6RB 4AJWA 1VEPA 3D3VA 4YHOH 2W94A 3MOBL 4DWHA 4ELKA 2JB6B 5B3SB 3IDNB 2XYCA 4JPVL 3VJ6B 2G60L 2XV0A 1N2RB 5KSUA 4QWWD 5D71L 5K59E 2XFGB 4ZOCA 3IFNH 1XB3A 2VL5B 1U2CA 4FG2A 2B16A 5E7BA 2EO1A 2EUWA 1IQWL 3AS0A 3S34H 5I1LB 3QZOA 5GGVH 4M3JA 2NDGA 5AKSA 3IDXL 2G9HA 1GRWA 5BO0D 4LCUB 2PKDA 1ODUA 1SDDA 2YAMA 5DHVH 2R4SL 7FABL 3CNKA 4BXSV 1MCPL 1OGTA 2X4QA 4A37A 1E8XA 2WINA 4AQEB 3FT3B 1NCNA 3BAYA 5LXVA 3VUAA 3S4SG 1CFVH 5JQ6H 3DO7B 3D8MA 5JOFB 3BN3B 5ACZA 1FCGA 3DTXB 1MAKA 3QJOA 1D5XA 2J1WA 1OAZL 1YECL 2G30A 5DLMH 4LRNH 1OGTB 2X4QB 1CFQA 1CGSL 5BMFL 4HBCH 3BSZL 1IM9D 4ODBD 1FGVL 3H54A 3Q0HA 4KWUA 1N67A 5MERB 2FEEL 1TQBC 2YA0A 1OHQA 4YAQB 4AX3A 2F5BL 2X38A 3ZTNL 1GGCH 1AQKL 3HJ0A 2QBWA 1ORSB 3LIUA 3QCVL 3OXSB 4IRSA 5E5UB 2VN7A 5F0PB 1S9YA 3O3DB 1AVAA 3IVKB 1F3DJ 4FLHA 1E9PA 4CNIA 3MRKA 4J3UA 3IETA 4M5SA 2AK1L 1JL8A 1HXYB 3WE6A 2HSIA 3P2TA 5MENE 1FE8L 1Q9WA 4AITA 3W11C 1TENA 1KENL 5T8IA 2E7MA 5JA9A 3VM5A 3PWPD 1NDMB 4JQVC 3DETC 4X6BB 1R5WA 3CV5A 3SDCD 1UD4A 3C6LD 1F3DH 2X53A 1NAKL 3MUUA 4MX7A 3MJ9H 4ZW8A 1KULA 3MRHA 1IILE 3OWEA 2ZWLT 2VDLH 1MAML 4WU7B 5H4YA 4UV7H 4FKKA 5EEUA 4I18B 1Z7JA 3OKMB 3L81A 1P1VA 4G8FB 4DP4X 1TQCB 2VGLM 2ZG3A 3PL6C 4NXSA 1NFIB 3KPRB 2WKOA 3PABA 4NYLA 3T3PE 2B0SL 3LQMA 1PSKL 1KIQB 3FONB 4QRTA 1VRSA 4M5YL 1MNUL 1F4XL 3DJZA 1DLFH 3O2VL 4P4KD 4Z7QF 3ES6B 5HHXL 4PJDE 5I6KA 4PPTA 2DJMA 4KO7A 3EO0B 5CILL 5E9DE 3BAKA 3VFWA 3OLEA 4ZFOB 4LSPL 4TUUA 3RNKA 1M05A 2QQNH 3SHSA 5FUZL 4J7RA 3EJYD 3U30C 4WKZB 1F3JB 1FC1A 3PGFL 3WEXA 1URIA 3VMOA 4HZAA 2K7PA 2NY0D 5KZCD 4X6DE 3U0TB 4NP9A 4WJ5B 2XIIA 3QFDB 2IBZY 3QQ3A 3QORA 5J6SA 1IT9L 5JPNB 3H9SD 1PY4A 2XA3A 4HVBA 2WANA 4O4YH 2UZXA 1T4KA 3HMWL 5C07E 2J6EH 4Y7MA 5JHLL 1KYOJ 5IEKA 1DQJA 2YBGA 4QRRA 2E47A 2F8XC 3LQAH 1RFDH 3QIUC 2MKWA 4G7QB 4BFGA 1F1DA 4PLKD 4HCGA 3MACL 4BH8B 2OR9L 5I1KH 1X5FA 2VH5H 4MXQD 1YY8B 4HAGA 5TDNA 5EOCJ 2ZXCA 3KYKL 1P6WA 2Y5QA 3L1EA 3MNDA 3PIQA 4Z7UA 2O61B 1AGCA 3SBRA 3CVDA 4AXWA 4XC3H 4DP1X 2IGLA 2VDQH 4GIPD 3UO1L 1CT8B 2OZ4H 3ZT7A 5K9JL 4OKVB 5FA3B 1AR1C 1ET7A 4M61B 1IBFA 1I85C 3RB7A 3ECQA </