1A3LH

Catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
b'EVQLEESGPELVRPGTSVKISCKASGYTFTNYWLGWVKQRPGHGFEWIGDIYPGGVYTTNNEKFRGKAILTADTSSSTAYMQLSSLTSEDSAVYFCARAGGYYTGGDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN FAB 13G5 (LIGHT CHAIN)
publication title An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 38
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lH02
4WWID 1MAMH 5E7FA 1Q9WB 3SGJA 4M5YL 5EN2A 3NCCB 3ESVF 4S0TD 3R06B 1YUHA 2J4WH 3OKLA 3TT3L 4PJ5D 4UQ2A 3T4YA 3MBXL 4Y8AA 1SYSA 3F58H 2BVPA 1XR8B 4YQXH 1IM9B 3AS1A 1JGVL 1K6QH 5D1XA 3OKDB 3RBGA 4P9MH 3UTSE 5FM5O 3BEWB 1KJ3L 2P5WB 4HJJL 3BKJH 1DQQA 3L3DA 5F9WB 1JHTA 1MREH 5DUPH 5GGRB 2ARJB 1FDLL 2VR9A 4X99A 1NEUA 2P8LA 1XIWB 4H26B 4JDVA 4X7TB 5JO5A 4JZJB 4PUBH 5KVFL 2EXYC 5DJ0A 4HS3A 2ED8A 3B9EA 4FFVD 4S2SA 2WUBH 3REVA 1MJJA 4JVUA 4Q0XL 5JOFA 3IDMA 3GMPB 3HNTH 4NQEE 4YHOH 3UZQA 4HQQL 5CJQH 1Z9SA 5C92A 3IFPA 4QEGA 1F42A 4XCYB 1QRNB 3DROB 4UB0H 1IL1B 2VDOH 2YPVH 4UINH 1N7ML 1AI1H 1Q1JL 2LU3A 5DTFA 4PJGB 5J9PB 1A7RH 4HUUB 1HH9B 4DJMA 1EBPA 2A9MH 4WJ5B 2D7PA 2EO9A 1CVSC 1QACA 3H3PL 3LEVH 2W9LA 4ZFOA 5I1LA 5I0ZA 1KYOK 3VWKA 1R5VA 3V0VA 3C09B 4W6XB 5IV2B 1S9VB 2Q86A 4ZODA 2RBLA 4PTUA 1PY9A 4X9BA 1H8SA 1MHPH 3T04D 1A3RH 3QWRA 3Q48A 2XWBB 2W07A 5EU5A 5HYJB 4OZIF 3O2VH 3MOQA 3RWGB 5IG7B 4KDWA 1UM6H 1HXMA 1JYWA 2NNAA 3DVIA 5DJXB 3V4VH 1AD0B 3OKOA 1YEKH 2AJ3B 2PTVA 5IW1A 3STZB 5A2KH 1DANU 1RZ8A 4NWTL 2ENYA 2F15A 1IQDB 1L0YA 2AJZB 1QSED 1IILE 1YEIH 5ESQB 3OPZH 4D9RD 4JAMB 3IFOA 5E2UL 4Y1AB 3SCMB 4DVRL 1CT8B 1B88A 1I75A 1HI6A 4FN0A 4NGHL 2E5EA 3HE7B 2BDNH 1MCDA 1L9MA 4MJIA 4M00A 5F7KC 3UTTB 5FOBA 3GSUA 4X5WA 5HVHC 4UQ3B 2PETA 1RUML 4FFVC 4JQVC 4OKVB 1JZ2A 3HZKA 1YEEH 3SDDB 1YMMD 1U8KA 1M7IB 3UBXG 2FHFA 4JFXA 2DF3A 5J06A 5HJ3B 2HRPH 4ZXBB 1ZLSH 4P0DA 4CU8A 2V2TA 3PL6A 4IIQB 5C07A 5LQBL 2PTTA 3TO2A 3PWLB 4G7VH 3SKNA 4NQCB 2DD8L 3REWB 3MRHA 1BBDH 1I9JH 4M7ZC 3Q6GL 1BFVL 5F9JB 3S36L 2AJSH 3B2VL 2FGZA 1M1SA 4ODWA 4MNHA 2KL6A 2WBJB 2FYYB 3HNVL 2CLVA 4IJ3B 1QFOA 3LRHA 3CMGA 5KTEH 3KPSE 2CK0L 1QLFB 3OKMA 4M5ZL 4C83B 2GTZB 5CP7B 4P2OB 3JWDC 4LCUB 1TQBC 3GGWB 4L4TA 3AB0C 4U1MB 2VDPL 3UP1A 5BJTA 4M43H 4Z76B 4JDTL 2OMNA 2VLME 1OVZA 1KELH 3MV11 3UC0H 2DL9A 1JGUL 3WN5C 3WFEL 2YPLD 4GBXA 5MERA 3VI4E 1FYTB 4NRZB 1D6VL 4L8SC 1PY4A 3BN3B 1BWWA 1A3LH 3MRPB 3RA7L 2FO1A 1FG9C 4JPWH 4RDQF 1LDPH 3FTGB 1J87A 4P59H 3TV3L 3CNKA 1EIBA 4LQ1A 5JA8B 2X1XR 4FTVA 1YYMH 3ARUA 1KBGL 5BVJA 3ESUF 1UJ3C 2D9QB 1G6RH 1P4IH 3B5GA 1YEDB 3I6LD 1OLZA 4F7MB 2X4SB 4L29B 5FKAA 5IEKB 5EU3A 3QEQE 1LD9A 5IB2A 4LKCB 4OLXH 5JW5A 1VGEL 2XACC 4CVZB 5DDHA 2OXGA 2WQRA 4PJCA 4FQXC 3U6RB 2D0FA 3HKFA 1NSNH 5IHZB 2O5XH 1UENA 5LBSH 4G6ML 1A1OB 4LDEB 4M6OL 4KI5F 2AEIT 2FEEI 1XF5A 4M1CC 1U95A 3ZDZF 2YKLH 3T65B 4U6XB 3RGVA 2OJZH 3ZT6A 1WIPA 4L9DA 2Z8VC 1UKSA 2XYCA 1B6DA 1J11A 2V7HB 4PRBB 1A6TB 5C08B 3T4AB 4MA1B 1CLYL 4X0KA 4MCYA 4DVBA 4U49A 1MLCB 3IDGB 4TOYL 3IJSA 4HGKC 4DOHE 1CGWA 32C2A 3O3UN 4I8DA 2BXZA 4TSBL 4PJBA 3T0XA 2LU4A 4NC1C 2DYPD 4BFIB 5GGVL 3LSOB 5LWYL 5E94B 2FX8H 2GY5A 3BIKA 3R1GL 3HZMB 3P0YL 2BNQE 1LVEA 4NRYA 4Y4FD 3T1FB 35C8L 5F7LB 1BJ1H 5E4IA 5MP6H 5DEGA 3S35L 1ZHLB 1RAMA 4L9LA 4XBPB 3NA9H 5IIEA 1H3UA 5CWSB 4UT7H 2D31B 2Y06L 1D9KA 4KKBD 3C5ZC 1CFSA 1EHAA 1J0JA 2OR9L 1IC1A 5MEPB 3UTSB 5JOPD 2OP4H 2AERT 3NMEA 1U91A 2Q8BH 3ARXA 2CDFA 1ZK9A 5TFSH 3B9KA 4OJFL 1GJIA 4JN1L 3JXAA 3MFFA 1EZVY 4JPIB 5EU6E 2Q7YB 1BAFL 3HI5H 1MRDL 4M7LT 1QO3A 3L3JB 4X98B 5D93C 1OWRM 4M7JH 1BIHA 3W81A 2JCCA 4PJXA 2AQ2A 3MRDA 4JFHE 3T3PE 2R4RH 4MCZB 1A6WH 4MB3A 3E6HB 4BQ6A 3MLVL 3FT2A 4ZAKB 4NQEB 4LLMA 1TCRA 4M4PA 3EYFA 5IBTH 2A9ML 3S9DB 2KQNA 3PQYA 4R2GD 1KIQA 4JQXC 1LWRA 4EEEA 1NDGA 1MQKH 3KLSA 3VFTA 4YBQD 2EDXA 4L3CB 1MIEH 3DRTA 4YPJA 5D1ZC 2M8XA 4PIRF 3NAAL 1NGWA 3VFUB 3AY4C 2PO6A 1OGTA 5J7CC 1CXKA 4LSUL 3U36A 1T7WA 2XN9E 5KJRL 4HUMB 1BQLH 4L8CA 3GJFH 3FFCE 4Z9KB 1DBAL 3FT4B 1WZLA 3DUSA 4JR9L 5BRZA 4RWYL 2H6PA 3U30C 1ZA3B 1LNUA 2QQLH 1ADQA 1A4KA 1ERNA 2VAAA 5BW7C 3QRFM 2VLKA 3L3HB 4NO2A 3ARDB 2XY1A 4KJQD 1CD1A 2HJKA 4YGVA 3RL1A 3FOLB 2ATPA 5D7LA 2SEBA 4Y4FC 2Z8WC 1R3LA 5ILTH 1YEIL 2CKBL 1RJYA 4PJ9B 4U1SA 2ED7A 5KVDL 3GMNA 1ZMYA 5I9QC 2Z92A 1LK3H 3DBXA 1YEJL 3X3FL 2HFGL 4K3JL 5I1EH 3AUVA 4R4BB 4WHDA 1QG3A 3NCEB 1G9EA 3ALXA 4YFEA 5C0AE 4AEHL 1IGCL 1RZ7L 2A77H 4YDKH 4HJGA 4J3UA 4GKNA 5DQJA 2R2HB 3TYGH 1E4KC 3QAZC 1MJ8H 4LPCA 5JZ7D 3QPXL 5CEXB 5J13B 4Y0GA 1J7VR 1UCBL 3B3IB 4Z7UF 3QZWG 4GMTL 3JWOH 5EO1A 3P11L 1I9EA 3U9UB 1UEYA 1F6AA 4LAJH 1U8NB 5IOPB 4PR5B 4XGZA 3AVEA 1QYGL 1XH3B 5I19L 5KOVC 4Q6IB 3RVUD 4R2GC 1I8MA 4WFHE 4YBQC 5FUCC 1UJTA 2JIXD 2A74B 2VZ1A 3QT2A 4BQ8A 2EIZA 4LCWD 3DRQA 1CS6A 2WIIA 1MCHA 4XH2B 5SX4H 3WE6B 3OAUH 5JIHA 4K94C 1MI5D 5CJ5A 5BV7H 4ZTPH 1AKJB 4HBCH 2WUCH 1IKNA 3KPSB 4NO5A 4JY6A 3LKRA 3WUWG 2VR4A 3MPCA 1RHHB 3BGFC 4W4NA 3UTQA 4AJ0A 1RHFA 2HFEB 4U6VH 4WEBL 3WUWB 4KJQC 2ZUVA 1IAIH 3LKOA 3C6LD 3V5KA 5E8DL 2XQYG 4LVOB 3WFBL 4PG2A 4NZRH 1ZXQA 4QO1A 4Z95H 4ZQKB 4LHUG 1JZ7A 4P5MA 3MFGB 1N5AB 1BVLA 2BSRB 4KRPC 1OP9A 1T89C 3HC4L 4E5XB 3HZYB 1JZ6A 4FQIL 4JO1H 3T2QA 1K8IB 3OX8A 2LABA 2YPKB 1J1XH 2EDYA 4LHUB 3ZDYF 3VDBA 3BDYH 1UB6A 2YD1A 3GIZL 2VH5H 4UU9B 1UH2A 4JFFD 2FWOB 4RRPG 3ZT7A 1YQVH 1R3KA 3M8OH 1HH6A 1K3IA 2J5LB 4LSQH 4YK4B 3GMLA 5T3XH 1UWEH 1BOGB 4EVNA 3BPNC 5JZ7C 3QEQB 2D9CA 4H20L 3BO8B 3BVNB 3BKYL 4K23L 2FATL 3PWVB 5B8CC 3CDGA 3CVIH 4MAUL 2FRGP 4LVNC 5E5RB 3RDTA 1DQMH 4R6UA 3QR2A 2O5YL 1FYHB 3BHBB 2CUIA 4ZFZB 2ADJA 5HI5D 1HQ4B 1XGYL 2PN5A 5KANI 5J1SC 1Q9OB 3RVUC 4HH9B 2F53A 4KKNA 4MD5A 2H26A 4WI6A 4WFGE 1EHNA 1QKZH 1CK0H 2MSPA 5AZ2L 2EDLA 5DJCA 4XBEH 2DI7A 1PG7W 3S37X 3MLRH 4R8WL 4LCIH 4UIKH 3T0ED 1HOCB 3MLWH 4D9QE 5K9OB 3FN0L 2VXQH 4LRNH 4NZJA 1YNTB 2UZIH 4NO0A 4X9FA 3EZ8A 5T1LB 2EYSB 4X4ZA 2HH0L 3MJGX 5KVEH 4LCYA 1K4CB 5F88B 4OLZL 4XP6L 1A7PL 4OCSL 1LO3L 4YX2L 3OQ3B 3ZDXF 3WNMA 4DOHB 1WWAX 4QCIA 3B9VA 3RVXD 1F8TL 3RAJH 3O3AB 4F57L 5I8CA 3WIIL 4WFFD 4QYOB 4OI9A 4Y2DA 3OJDB 5C0DA 5LAXA 1T1WA 2IBZY 2BNQB 4GRWE 4B7LA 3DIFB 5IQ7L 1F4YH 4PJEF 3D0VB 5HDQL 5IKCB 3N1MC 4MXVE 4N1HB 3C6LC 1CR9L 2H32A 4PRPA 3WSQL 4XNMB 4FOMA 1FLTX 1FAIH 4M62H 2X4PB 2AK1L 4UV4L 5FO7A 3FO9A 2JE8A 2PCPB 4XCFH 5I1HL 2C7UB 4JO2H 1NEZG 4OUUB 4GRLB 2L0DA 3ELAT 4PRNB 5KZCB 1ZKAA 5C07E 3KNBA 3QBTB 4HUXB 2IEPA 5EU6B 1K8DB 2FJFB 5FF6B 1XGQB 1CGUA 1NEZB 5EWIL 3D3VA 2K3TA 2VITB 3G5ZB 4Y5YB 2CLRA 4GXUN 1ZHNB 5D9SB 3GEWB 2HN7B 2J1KA 1P2CA 5A16A 1ZWIB 3Q6FB 1A6AB 3RNQA 1RFDL 2IH1B 1NBVL 5FB8B 4YDVA 3VD4A 3TBSB 4UDTB 4PJ8B 1OCWH 4ENED 4YXLL 4L4TE 5D6CA 5HI5C 4L8SA 4LARH 5BMFH 4X80H 1J18A 2W65A 4MHHG 3UTPE 2C3WA 3H9HB 2EDTA 4U3HA 3NFNA 3FMGL 3GSNL 2IFFH 5FYJH 3ARWA 4Z7WB 4YHZL 3T0EC 1Z0NA 3KVQA 2FBJH 4U1JB 1VEMA 4Y19D 1UJ3A 1CE1H 3RIFK 5I1AA 1NGZA 5D1QD 2HRLA 1R0AH 3BKML 2XN9B 2AEQL 3FFCB 2XZQL 1KJVA 4G8FB 4FTVE 3RVXC 4R3SA 1CFVL 5E6ID 1JV5A 1RIVH 4M61A 4LFHD 1TQCB 5F7DB 4NRXB 2DM7A 4FQXA 3S37H 2X4RB 4ZS7L 3P9MB 4BH7B 5IESH 3N06B 4PV8B 4KQ4L 4XZUB 2CJUL 4GW5A 4ZSOA 1FO0H 4DAGH 4XCNB 1A1NB 1ROWA 1CGXA 1T0MB 5DJ8B 3G5VB 4JJ5B 4PJCE 2V7NB 5TDNB 4FRWA 5EB9A 1YNKL 3LEXA 1JMZA 2E7MA 1ZVHA 5TGBA 5T3ZL 2HAZA 5C0CA 3KLAA 5I1IH 1BZQK 3ARYA 1U36A 5C0AB 5E4EB 4BKLB 4PJAF 3T0DA 2R0ZL 3SJVD 2FO4A 1KTLA 4NM8H 1FL6B 4X6DF 1YDPB 2LFGA 4BM7A 1EPFA 3UO1H 4OCWL 5DD6B 4IDJL 2RAMA 3FQRA 3BPLB 1U8PA 3M45A 4G5ZH 4H1LG 5GRUH 1UB5B 5HHVH 2XXCB 3PUCA 3W39B 3QXDB 4PJBE 5FFLA 1S9YA 1X7QA 3EYOB 3QUMB 4LLWA 4ENEC 1CDGA 2YPLA 4UOW1 1RIUL 4H1LB 5EN2B 1IMHC 3C5ZA 3ECBA 1LO2L 3OKLB 2B39A 3FQWA 4OLUL 4UQ2B 3T4YB 3SY0B 4WO4D 1S7UA 1SYSB 1YY8B 4L5FH 3VWJD 2Z9TA 3K2MC 1FP5A 4YHPA 3ARZA 3BGAA 3CPLA 4J12A 5HGHA 2CGRL 4ZS6D 3X3GL 2MCG1 1FNFA 1DQQB 3L3DB 1JHTB 1HKLL 3F7VA 4LLVA 4P2QB 1QHOA 5D1QC 5H2BA 1U8HA 3QI9A 2B8OT 3ZLQC 4X99B 2P8LB 4YR6A 3WO4C 3D1MC 4KUCF 5ADPL 1MUJA 3MOAL 3U0TA 4JCLA 4JDVB 2AJVH 5I66A 4U1GC 3BUYA 4XC3L 2X6MA 1D7FA 5JO5B 2GJZA 4MZ3A 3CGTA 2W59A 3EO1A 2JCCE 4GRMA 1KCRH 1CF8L 3PABA 4PJXE 5DJ0B 1CICD 1N64H 4HS3B 2OR7A 3CFJA 43CAA 4KTDH 5BVPH 4JQXA 5C0EB 3D18A 4FQLL 4OCYH 4KJPD 1IC4H 1JWMA 5D1ZA 5F9OL 5JOFB 1ZE3C 3SQOH 3N85L 3M8OL 1I7UB 2Q8AL 3AY4A 4P5TA 5GS2H 1A6UH 2DLIA 1QFUH 1RUQL 3F7YB 5D71L 4U7KA 2CDGA 4KAQH 1JUFB 5CGYD 5GIRA 3MRKA 5DTFB 2B5IB 4HLZG 4TUOA 5E2TL 4FQJH 4HEME 2MPAL 5DLML 4OLVH 4RFNB 4ZFOB 5I1LB 1XAUA 4KC3B 3FO1A 3V0VB 3QCVL 4MJ4A 2BY3A 3S3SA 2BHZA 2Q86B 4APQD 4KKCC 4JGUA 4PTUB 5BRZE 4Y4FA 5JIKA 1UYWH 1DL7H 3RRQA 5EU5B 4XWGL 4Y2OA 2ESVB 4RMWA 2APFA 1DBML 2VLKE 2MKWA 1HXMB 2NNAB 4YNYA 1BVKA 1NCCH 2RCSL 5D7LE 2PR4L 1Z9LA 1QHPA 3I84A 5FA4A 4WO4C 1UFUA 3OKOB 1CDYA 4NNYA 5CIPH 3VWJC 2FZ3A 5IW1B 1ULVA 1J1OL 3GBNH 3DPBA 4G8IA 3X14A 4ZS6C 2AXHA 1PJ9A 5LJYH 1OHQA 2I60L 1E4KA 2DBLH 2BSSA 3T08A 1Z5LA 2OJEA 3X12B 2WBWB 3CU1A 3OXRA 4PGJA 2IPKB 3VGHA 1HI6B 4RCAA 3BJ91 4GRWB 2VZUA 3QEUA 5FOBB 1G7MA 1CICC 5T5NF 4XCFL 4Q97A 4X5WB 4EI5B 2G5BA 4J6RH 2OK0L 3CX2A 3RKPA 2BP3A 15C8H 2FL5A 5CUSL 1W72L 3HZKB 3QDGA 4KJPC 4NCDA 5I71C 3MQIA 4LPVA 4JFXB 1ONQA 1CU4H 3VFOA 1T04A 4DKFH 1E6OL 3G6JA 3RX7A 1ORQB 5E1HB 5CSZA 3PL6B 5C07B 3L1OH 3ARED 2PTTB 3TO2B 3SKNB 3AU1A 3WLBB 1JYVA 1I3RA 1GGIL 3MRHB 3BYTA 4XBGA 5CGYC 4WU5B 4DWHA 5H35A 3ZE1F 3P30L 3SDYL 4F8TA 4EUPG 1WF5A 1RI8A 1W8OA 3HZVB 3HFML 4QNPE 3LD8B 4ODWB 2FECL 4MNHB 1FNLA 4PGBA 4MVBD 4J3VA 2F58H 3TIDA 2CLVB 3MLPA 4EUPB 5E8EA 1RZGB 2WBKA 4OCMC 3D48R 3OKMB 4V1DB 3CH1A 3S35X 4KY1L 4APQC 4QLRA 3PWUB 5DMKA 5J89A 4U7SA 2Z8SA 4L4TB 3O2DL 5BJTB 3U0WH 2VTFA 4PBWD 5DSCA 3O9WD 4OGAD 4TVPE 3DX6A 1KPUB 1A7NH 1VFUA 3SO5A 5F6HI 3GSQA 1GXEA 1KF9B 1XCQA 1DCLA 4LHQB 1FZJA 2RIKA 1YPZB 5DURD 4ZOEA 4P57B 3HC3H 1B90A 1NBQA 4CL7A 1WFOA 4GAJH 4I2XA 3GKWH 3LKPA 4FTVB 3EAKA 3TESA 1Q0XH 4NZTH 1AY1H 2MHAB 4JRYD 5AAMA 2UVFA 3HPJA 5ID1A 5BVJB 1TVHA 5B8CA 4O00A 3IKKA 3QIUD 1XGTA 4HMCA 4M9OA 3ILPB 5FKAB 3U2SA 5EU3B 1LD9B 1RJCA 3UJJL 3B83A 3ZE2F 2Y72A 3MV01 2MCPH 3CCHB 5DDHB 3ZSSA 1KLGB 2R0LL 4PJCB 3KPRD 2VL5A 4PJ5E 2ADFL 2N4IA 2JIXA 4LCWA 2PYEA 3QCUL 4HIXL 1YECL 5LGJA 1XF5B 1U95B 2F53E 1I9IL 3AREC 3RGVB 1MI5A 4XWOD 1AP2A 2I27N 1H3PL 3BZDA 1I1CA 5I2IA 1VGKB 3MV7D 1Y0LB 3H7BB 4X0KB 2K9UA 1FPTL 3IJSB 32C2B 3QHFL 1FE8L 2V2WA 4PJBB 3SGEI 1U93B 4U1IA 3BIKB 1RZFH 3LS4L 3CDYA 4MQXD 4NRYB 4TNVK 4XT1C 4HXBH 4XP5H 5DEGB 3CFIC 3KPNA 3O9WC 4OGAC 1PGRB 2EIBA 3S4SG 3NCJL 4L9LB 5ALBH 1I3VA 4PRPE 5IIEB 3MA9H 1SMOA 1K5NA 1VPOL 2ICEA 4OAWA 2QQNL 1CFSB 2D7MA 5DMGD 1HKFA 4LRIC 3P4OB 4EDWH 2EH7L 3SGDI 1U91B 1KTDA 1P4LA 2CDFB 2IG2H 1AFVH 3B9KB 1V3KA 1MFEH 1JYNA 1HIML 4HUKB 2X1QA 3MFFB 1RMFL 1L7TL 5CEYA 1NANI 1RZKH 1YEFH 2AXGA 4P3DA 1QO3B 4UILH 4M1GL 3WD5L 3D3VE 2JCCB 4QHKI 3VXUD 3VFNA 2XPGA 4PJXB 3MRDB 3QIUC 1GGBL 1X4YA 4JHAL 4Z7UA 5HVGB 2YOCA 3VG0H 5ACMA 2Z4QA 3P4LA 1BIIA 3BGMA 3EFFA 1BJ8A 1H3XA 4OSUH 1FHGA 4N9GA 1MWAB 4LLMB 4HKXB 3EYFB 4MD0A 4PLKD 1GPOH 3SEPA 1NDGB 3VFTB 1NMCB 3SPVA 1A6PA 5I1CH 1D3CA 4LSPH 5KVGL 1EEUA 4WI3A 3DRTB 1LHZA 4KROB 4C59B 3GSVA 4XWOC 1G9NC 3CSYA 2PO6B 3LQAL 4D9RE 1OGTB 2NY5H 2Y4SA 1PQZA 4OB5L 1MNUL 4Y16A 1J0HA 3NPSC 5D2NA 3U36B 5ICYB 4NBYB 5C6WH 4GO6B 4WGVB 2NY0D 4G42A 5BRZB 1HWGB 2H6PB 3C60D 2E9WA 1EFXD 2JB6A 3DSNA 3MJ8B 1EZVX 1IKFL 1A4KB 3QRGH 3NCFB 2VAAB 3GNML 3MLXH 2OL3B 2VLKB 4NO2B 4RMUA 3V7MA 4M48H 1CD1B 4YGVB 2DQHH 3RL1B 1HINL 2ATPB 2X4UA 1YMME 4LEXL 2DJ4A 4MQXC 2SEBB 4LGPB 1R3LB 2DQJL 5JLZA 1RJYB 1ZVSA 2HWZL 4U1SB 4ZSOE 3GMNB 1O5DT 3JSSA 5F6IC 3WYRA 4B5EA 4ODHL 2Z92B 1JGEA 4ZO6A 4F9PC 2BSTA 4YPGB 5DMGC 5FYKE 3BYYA 2YMXL 4H1LH 1V3LA 3QJHA 1KTKE 5C0CE 3VD5A 4M93C 1YEHL 2H2PD 4OZFA 4DZ8A 3F5WB 4PGCA 4HJGB 1MJUL 4NOFA 4GKNB 4UV7H 4OQTA 5DQJB 5MI0C 3A0OA 4GXVL 1U58A 1MPAH 4NC1E 5GJTH 3X17A 4JHBA 5HI4D 4KPHH 4Q74A 3HG1B 4HS8L 2PNDA 3C08H 4F37F 3QUKA 1AD9A 5EO1B 4NNPL 3I3BA 3B5HA 3SDXF 3HR6A 4HIHA 3QUZD 1F6AB 2J12B 3T3ME 4WV1A 2Z31C 4DW2H 1JHKH 1T2JA 2DM4A 2YPLE 1MCWM 3QXVA 3ZYOA 2EEBA 3MJ9H 4PLKC 3WJLA 2NQCA 3MRIA 1I8MB 1VADA 1OL0A 2P49B 3B5TA 5HHMB 4ZNEA 3IU4H 2LVCA 4Y19A 1HWHB 1YY9D 1NMBL 4H5SA 2WIMA 3DRQB 4GMSL 5LCVH 2WIIB 1E4XH 1WIOA 4I9WD 4TTGA 3MROB 1I85A 5EZLA 3CK0L 3F8UB 1EVUA 4OLYH 4ELKB 3M17A 3AXLA 1Z9OA 3MLSL 4DUVA 3CSBA 1DFBL 4EN3D 1SY6L 4NO5B 4JY6B 3LKRB 4KUZL 2NY0C 2EDJA 3LN9A 3C60C 3UTQB 4RIRB 3WNLA 2DQIH 3DUUB 4HFUH 1IEBA 4LU5L 1A0QL 2OXHA 4PJEA 1CL7H 3O2WL 4YJZL 3LKOB 2BCKA 3V5KB 4HLZH 4R0LC 1BVZA 4NM4H 4P2RA 5GZNC 5JW4R 2CMRH 5TF0A 2V17L 3EOBB 4WGWB 3CXHJ 2GY7B 2W9DL 4DFIA 1AY1L 1BVLB 3L5IA 2H9GB 1P9MC 3RUGA 3VFGL 3ARPA 2Q20A 2W38A 1CE6A 4LSRL 2R69L 3QNXB 5D72L 2H2PC 4U4BA 2DIAA 1IBGL 4YHIA 3ZKXC 1A14H 1R3KB 3I50H 4DN4H 4HMEA 3FQUA 2GJ6B 1HH6B 3WL9A 1L6XA 5FM8A 3GMLB 1J86A 4EVNB 4P46A 3HPLA 3M07A 1KN4L 3SKUD 4ODVL 1WSST 5HI4C 3BKCH 5E99L 3ZYIA 3SKOA 5C0RL 1N6QH 3EDDA 3CDGB 1YEGL 3RDTB 1KEGH 4PJ5B 3QUZC 1KC5L 1J8KA 1B4JH 1Y6KR 3H0TA 3MRFB 4WO4A 3CVHL 3GMQA 2VXUH 3VWJA 4GRWH 2IQAA 4YDJB 2RB8A 4M8VA 4MD5B 5CJXC 3G9VA 4QOKD 4OFYD 2R1WA 5DJCB 3MGAA 1YY9C 4M8QA 4AIZB 1JNHA 4DUWA 4NO0B 1PKOA 1U3JA 1H15A 3FQTB 4U7MA 2OS7A 2IADA 4PJGF 4X9IA 4JVPA 2ID5A 3CSGA 4WU7A 4EN3C 1CICA 2NMSA 4QCIB 5J3HD 5HVHB 1Z0MA 1JL8A 4HG4K 5I8CB 6FABH 2OLDA 5AZEH 5C0DB 4Y2DB 3VA6A 5LAXB 4HT1L 4LLUB 4JKWA 1KN2L 4FQ2H 4P4KD 1MCLA 4H0IA 1JBJA 5MENA 1T1WB 1LMKA 3KS0J 1HDMA 2FGWH 3VG9C 3WDJA 5L8LB 1DN0A 5DHVA 2H32B 1G0YR 4PRPB 4RBPH 4EUPH 2AV7B 2PXYA 1ZANH 3RKDD 1A5FH 3UAJD 1FFOA 4ZDHA 5F7UA 3QDGE 3VI3F 3MRCA 4MMZC 5FO7B 1YYLL 2FX7H 3FO9B 3QHZH 4M7ZB 3W11D 4I3RL 4I18C 5TE6L 3G6JE 1WTLA 4TPRL 5DD1L 3ULUD 1MFAH 5IVXA 3HRZA 4O2FA 4K9EH 3KNBB 2VDML 4HC1A 4PJAA 2HKHH 4PYHA 2X1WL 1JI1A 3D3VB 3H9ZA 5IWLC 1D5ZA 1GL4B 1T4KA 1VCAA 4RBPK 2CLRB 25C8H 1TQBB 4EDXA 5E95B 1U8QB 2ZKHH 4X83A 2VUOA 4FZEL 4H0HB 3A67H 3RNQB 3PGFL 2VDLH 3QJFA 4UIMB 4YIQA 5HVFB 2YWZA 5DD5L 4YDVB 4OGZA 4FZ8L 4QRRA 1M7XA 3NN8B 5D6CB 2LE9A 4L8SB 2YA2A 4BSJA 5I1KH 4EIZC 1HHGA 3IAGC 2W65B 1R6VA 3EYSH 1CIDA 3QDMD 2YS4A 4JPKH 4HULB 1C8PA 1KGCE 3NFNB 1I1RA 2VDRL 3D85D 4Y88A 5HI3D 4ONFL 1UJ3B 1HHJB 4H88L 2HJFA 1EGJL 5I1AB 1NGZB 1CLCA 3MMEA 5DO2D 1MHEA 4UNUA 1CI5A 1KJVB 4XAWH 4I2XE 5I1JL 1S7TA 2J6EL 1INDH 4KK6D 4R3SB 5J3HC 1EJOH 5CD3A 1JV5B 4M61B 4QRPA 4P4KC 3VFVA 4KHXH 4FQXB 4OIIL 1YMMB 5KANG 1KENH 3QUML 5SWZD 4G80B 3NACL 3QCTH 3RPKA 3KWWA 5DD3H 3P9LB 5CJBA 1MCWW 5CBEA 5L2KA 5EC1A 1MAJA 4HX1B 4JKPL 4ZSOB 2GT9B 3RKDC 2X10A 4WTZG 3Q2CA 3UAJC 1QZ1A 5DHYA 4QRSA 1IQWL 2I5YL 1UM5H 2DMBA 2Y23A 3LEXB 1F4XL 3H6JA 5TDPA 4LCWE 5TGBB 3W11C 5C0CB 4BZ1L 5A2FA 4DQOL 4Y4HD 2VXTL 2PYEE 3QQNA 3ULUC 1JWUA 4RFOH 2JB5H 1U8IA 3QNZA 1MI5E 1EFQA 3D9AH 2FO4B 1C7SA 3LEYL 5JDSA 4U2YA 2ICES 1HYSD 3RJQB 3C5SA 5B3JE 4G6JH 1N6UA 1S5HA 5FUZL 5KW9H 4YH6A 4MDJA 3FQRB 4LSVL 1U8PB 1G0DA 5GHWL 1TVBA 2V2XA 1TZGH 3BDBA 1S9YB 1X7QB 5E8NB 4GW1B 4K2UL 4LLWB 4AT6A 1JPSH 2YPLB 4X7EC 2EEDA 3C5ZB 3ECBB 5F7EL 3FQWB 2KPNA 2QQKL 1HXYA 4WDIA 1J9CT 4JPVH 4E42A 4GKOA 1NC4D 1S9XA 1GC1H 3CPLB 5HGHB 1MWAH 5HI3C 1Q9LA 3ES6B 5GQBA 4JRYA 1KIPB 5TE7H 4NQDA 5D93B 4LLVB 2DLEA 5H2BB 1U8HB 3QI9B 5BV7C 5I15L 1IGIH 1TJGL 1FVEA 5DO2C 1MUJB 3H3KA 3U0TB 3G04A 5I66B 3BUYB 4KK6C 2GJZB 3EO1B 2NLJB 2GUOA 4J8RA 4GRMB 1F90L 1NGPH 3PABB 4KXZI 3MJ6A 3KPRA 3MA7A 4Z7UE 43CAB 3CFJB 1SHMA 4OI8A 5L6YH 3M1BA 5C0ND 4J3OC 4NNXA 3OGCA 5LGHL 1JWMB 1MLBA 4IRJA 5D1ZB 4OT1H 2EH8H 1ZA6A 3WIFA 4HKBA 1RK0A 3MGOA 4QTIL 1F13A 1JE6A 4P5TB 4YGAB 2OL3H 1CBVL 1EEQA 1T03L 1UA6H 1HE7A 3QA3B 2ZSWA 5CP3H 4NSKA 4Y4HC 2A1WL 3Q5YA 4XPHH 2CDGB 5GIRB 3C9NA 3MV7A 1KJ2H 4I48A 3ZZ1A 2DQUH 4LGRB 5CHNA 5EA0H 1F45A 1LO4H 1HYSC 4HPYH 3U30B 1NKOA 2F9BT 5JMRA 4ZO8A 3V0WH 2BJML 2NY7L 4WFFE 4G8GD 4TSCH 3FO1B 1V7NL 5D2NE 4GAGL 3HAEG 3MUGB 1GZPA 3ULSA 4Y4FB 3K4ZA 2IPTL 4M6AA 3FJTA 4LIQL 3O41B 2N7AA 1X5KA 1P4BH 5I9QB 2CUMA 4YNYB 4JHZA 4LSSH 4TN9A 2GK0A 5FA4B 1EHLH 1NC2D 1MCSA 1EA9C 4NNYB 4CN1A 5SWSD 2R8SH 2FZ3B 4I0KA 2XKUA 3MXWH 3VFMA 2EKJA 5FV1L 4G8IB 3MV8D 1FL3A 5BOZG 2B20A 4MA8L 3LHPH 2BSSB 4ELMA 1Z5LB 2OJEB 4YHKH 5DRXA 1MOEA 5C0BA 4JVWA 1CDUA 3K81A 3T2PA 1AC6A 5DRZB 2NY2B 3CFCL 1GGYA 3W9EA 1QVOA 1G7MB 1KPVA 2Z31A 2R56L 4FXGA 5BZWA 4OM1H 2G5BB 1FBIL 2X9YA 1OD7A 4R2GB 3DJ9A 5C0NC 2FL5B 4S1RH 3VGAC 5I6XC 2NXZD 2UV3A 2UUDH 3QDGB 3DGGA 2B4CC 1JHLL 4N8VA 3LH2L 2VZSA 1ONQB 4I77H 3VFOB 3G6JB 4G6KL 2DQEL 5T1MA 5CSZB 2B0SL 2IAMD 2E7LC 2VZVA 1CGTA 4CVXA 4POUB 4ZNEE 4MDIA 3AU1B 4RX4A 4Y19E 4N8PA 2FSEA 1I3RB 3RNKA 3GMOA 3MRJA 4XBGB 5H35B 3RP1A 1MFDL 2EE6A 5T5FH 3IXAA 3UYOD 5DR5L 3I3DA 4DZBB 3BGFB 1EFXA 4PGBB 5F21B 3PF2A 7FABL 2H1PH 3TIDB 2JELH 1OP3K 3CX5K 1GOHA 1ZT4A 4MNQD 3MLUL 1JFQH 5E8EB 2JJVA 4ODTL 2NCMA 2L4OA 3CH1B 2EDOA 3K80A 4G3YL 5DMKB 4O02H 1SM3H 1I9RH 5FYLL 4KRPB 2WANA 5DSCB 1XF2A 3DX6B 4XNYL 1N4XL 5JR1H 1P9MA 4XMLL 3MJ7A 4AK1A 4P2RE 2WW8A 2D7TH 1A7QH 3NABH 4GQ9L 1N6VA 3O6LH 4IBLT 4XAWL 1FZJB 5IBLD 3WNOA 3UPCA 1QBBA 4PJHA 3VXOA 1MVUA 1NMAH 3WFHA 3RUGE 1WLHA 4CN6A 1G6RA 3O81A 5F6HJ 3MXVL 3QWQB 3BPNB 1A6ZA 4I2XB 3LKPB 1MEXH 4LMQI 5J6GA 2DI8A 3HPJB 5ID1B 4AY0A 3AROA 1TVHB 5B8CB 1IFHH 2DKMA 4LVNB 2YZ8A 5IJKC 1VFBA 3DXAA 3G5XB 1K3ZA 3KPPA 4HK0A 1XGTB 3QUZA 4POZD 1NH6A 3B9AA 1TITA 1QFPA 4YDLC 5FM4A 3C5JA 2ICWI 1F02I 4KK9D 1Q94A 1UACL 4CVWA 5CJXA 3NIGE 5B21A 2NXZC 2VL5B 3Q1SL 5F8RC 4N68A 3IVKA 2JIXB 5HPOA 4F58L 3V4PL 4LCWB 1WEJH 1ZLWK 2NZIA 5J11C 2PYEB 5GZOD 3VI4F 2IAMC 4WTXA 3VH8A 1MI5B 3OXSA 1AP2B 3I85A 5KS9A 2N1KA 1NCTA 1ETZB 2CRIA 4Y5VC 2KH2B 5I2IB 4KZEL 3DGCR 3MRBB 4OZ4B 3TBYA 1TJHH 4P48A 1N0XH 3V8CA 1AXTH 3H2WA 4LSTL 4FFYH 3DMMD 1CD9B 3BT2L 1WBZA 2B1AH 3MGTA 2V5SA 5IFJA 2V2WB 2W0LA 2IF7A 1F3DH 4U1IB 5EU7C 4MA3B 2VQ1A 1RZJL 3GI8H 5F9AC 5I30H 1GGTA 1WGOA 4GG6A 4LKXB 3MNWA 1BBJA 5D70L 3JWDH 4IRSD 2F54D 3E3QE 3KPNB 3S34H 3V52H 4PREA 1UWXH 5L8JB 5B38A 5JXAL 1K5NB 2ICEB 3RWJA 3TZVD 4OAWB 4FXLA 5IBLC 1XMWA 5FO8A 1FZKA 3B2UD 4QGTA 1KTDB 1P4LB 4AEIH 3A6CH 1NCAL 4Q9QH 4ZFGH 5IVXE 2YUZA 1D5XA 1PLGL 2XTJD 1QFHA 1HCFX 4RISL 5CEYB 2AXGB 4P3DB 5C6TL 3O45A 1JNLH 2DL2A 5EU4A 2ZCKH 4KVNH 2WMPA 3VFNB 3GKZA 2XPGB 4BK4A 1GAFL 3DSFL 5L7XL 3PHSA 4Z7UB 4POZC 4JFYA 1ADQL 2Z4QB 4FQ1H 1BIIB 5DXWA 3EFFB 4ZMAT 1FRGL 4JHWL 4QHNA 4JEGB 4M3JA 4JZOA 2QHLA 4N9GB 1ZLUK 4KK9C 4QHKJ 4LLDA 3TH3T 4F80A 3VXPB 2GSIA 4OFYA 2DKSA 3V8OA 3TT1H 3WIHH 4MD0B 5J12C 5GGUA 2AJYH 2O5ZH 5F1NA 5H37G 4JY4A 5DVLA 1ZLVH 5IF0A 1EXUB 4FP8L 3CSYB 3FB7A 3MODH 1P7KA 4DKDC 1QSVA 4P2CG 1JCKA 4Y16B 3FKUS 1TNMA 4OLEA 3GZKA 2QADD 5D2NB 1DBJH 2NXYC 3DMMC 4G42B 5IW6A 4BZ2H 1OAQH 2JB6B 1A7OH 3T3PF 2DQCL 5JORA 1FIGH 3BSZH 5HGBA 1IGMH 1OLLA 3SQBA 2CXGA 4PD4J 1KCVL 1X3DA 5I8KL 3FL7A 3DX9A 4IRSC 1YN7A 5E9DA 3BW9A 5JLZB 5L2KE 5FHAL 4DGIL 4N1CA 4GAYA 5MHSD 1JGEB 3TZVC 2BSTB 1W0WB 2HT4C 4A2LA 3B2UC 1XR8A 3QJHB 2XA3A 1IM9A 1UVQB 3BE1L 3S88H 1WQVT 1U3HD 3OKDA 3QG7L 4Z7WF 3WDHA 4OF5A 2Q7NA 4OZFB 3QFDA 2XTJC 4DZ8B 1MRFL 1T20A 4TSAH 2YD9A 2ARJA 4OF8A 3V6OA 3GBMH 4JFDD 1FJ1B 3K3QA 4H26A 1P6AB 3HMXH 2VMFA 4XVSH 1KCLA 3MSPA 4U6TA 2MWCA 2K7QA 3QUKB 1AD9B 1RUKH 1A22B 2AEPL 4TVPL 2I9LA 1OD9A 3ZE0E 1OAZH 5E70A 4WV1B 1NAKL 3MC0A 2CLZA 4HHAB 5TE4L 5FHBH 3MRIB 1VADB 3RGHA 4OLWL 2DM3A 4Y19B 3BP6B 5GS0L 2H1PL 3THML 3WLWD 1MF2H 2DIJA 4H5SB 4ODUB 4LFHG 3PP3H 3CLFH 3WO4B 1IGTA 5EZLB 4KMLB 4U1GB 2E8ZA 3RU8H 4JRYE 1JZ5A 3JV4B 4NQDE 1PYWA 3M17B 4ODSL 1P69B 4WJ5A 2QADC 2AGJH 1IT9L 1KPRA 5HDBE 3KPOA 1B9ZA 4M6NH 1D5BA 3MRRB 2R2BA 1NLBL 5HHQA 4PRID 2QQQA 3NABL 3R8BB 3UJTL 1IEBB 2CRMA 2AJUL 3MNVA 2R15A 4K8RH 4P9HL 3KPRE 4RMRA 2BCKB 3GBLA 3IXTA 1U3ZA 1XF1A 4Z78A 4HJ0C 2FJHA 4WI2A 1GGCL 5T33H 4HWZB 5DA0B 4I1NB 4U33A 1Q0YH 4BFEA 1E6JH 4NC2B 3RUGB 3SJVB 3HAEH 5KG9A 1CE6B 4LPXA 1GOFA 5DT1H 3I2CL 2R2CA 1U3HC 4WNQB 1CG9B 1MCPL 3DI3B 3ZE1E 4YHIB 3MV7E 3DVNA 5E6YA 4OCLC 2GEEA 3T2NH 3WL9B 5ESQA 1AC0A 2DBJA 2CIIB 4Y1AA 3HPLB 5DWUH 4WW2F 1AJ7H 4MAYD 3SKOB 4JQIH 3VGDA 3OF6D 4YUEH 1AHWC 4LAQH 3C87A 3H0TB 1EJ6A 4WO4B 3ROLB 5DZNA 4JY5H 3DX7A 1IC7L 3VWJB 2JJWA 5JHDA 1NC4A 2IQAB 3SDDA 5J56B 5CCKL 2YBRA 3WLWC 1HQRA 1J1PL 1RSFA 4M8QB 1JNHB 4NFCA 1P84J 5FM5M 2ZCHH 2XI9A 3OBAA 5IFHL 2C3GA 4P23D 4IIQA 1WK0A 3MRNB 4HZLB 1MQ8A 3L5XL 1OP5K 4AMKL 1DEEA 1C12A 3UBXA 3ULVH 3VXMA 5DJ6B 5ISZD 4XPGL 3BH9B 4HWNA 4S1QL 1RULL 5F9DC 4WU7B 4LL9A 4ELME 3QO1A 1CICB 4K94H 1I1FA 4TRPL 5E8OA 4L3AA 2WBJA 1NFIB 4LQFH 5DUML 4YWGH 5C0BE 3P9WB 3FRPG 1T1XA 1S7QA 3JBG7 2VKXA 4J3WA 5I71B 3QSKB 3U79A 1HDMB 2IGFL 4P2OA 4LCUA 3LMJH 1OPGL 1DN0B 4R4FL 2E6JA 1U0QA 3NFSH 5GGTA 5DUBA 4U1MA 2C9AA 4HF5L 1UZ6E 4B53A 1V7MH 3ARGA 1FFOB 4O4YH 4PP2A 5IT2L 3MRCB 3O3DA 4AG4H 1J0ZA 2VXVL 5TQ2L 3VFPA 3NZHH 4YO0A 3J7HA 1WFTA 1FYTA 3LZFL 5IVXB 1H0DA 1T0PB 5ITFA 4U05A 4AENA 4XNZC 4G8GA 5IB4A 4BUGA 1PAMA 1RZKC 5KN5A 4APQB 4R26H 3RTQD 1JZ8A 4FFZL 5DC4B 1QNZH 1D5ZB 1JPGA 1T4KB 2ZJSL 1CQKA 4M4RA 4PPTA 1LEKA 3UYPA 1WV7T 2KQMA 2EDHA 4RGND 4F7MA 1XCTA 2IPUK 3QJFB 4TULH 4YIQB 4GRWF 4UUJB 1A9BA 1YJDC 5GSRA 5IEKA 4NUGL 1NC2A 2X1PA 2XQBH 4MXVF 1T22A 3IF1A 3LS5L 4JO3H 1KYOJ 1EERB 4CVZA 5IGXH 1HHGB 3U6RA 1OARL 4K3HA 5FYKL 3SGKC 3I75A 1ITCA 3IFNL 3DURA 3MV8A 3IDXH 3QH3A 4XP4H 1A1OA 5AG8A 1HHIA 4KTEL 4RZCA 2BNUA 4H8WC 3EUUA 4PJHE 1BGXL 4P23C 3T65A 1G7JA 3WJJC 3MV9D 1I3GH 1UM4L 5IJKA 1KNOA 3MMEB 1MHEB 4Z77B 2PW1B 2WP3O 1YN6A 1S7TB 1T80A 3P40A 4NHCL 3ROOB 2R4SH 5CD3B 3R0MA 3Q5TA 3VFSB 2Z93A 1MLCA 3C2AL 3DXAE 3VFVB 1FO0A 3ZKSD 1EMTH 5L2JA 1OAUH 4JFEA 1TLKA 2YUXA 3KWWB 2VDQL 2D7NA 5CBEB 4U1HA 3ARBD 3P4MB 5EC1B 2IAMA 2IQ9H 4JG0H 4PFEA 5DHYB 3AREB 4QRSB 3T1FA 3DI2B 3U83A 3SDAD 4LP4A 4Y5XC 4OUOA 1DP0A 3PWPD 2X4QA 4Y5VA 3UPAA 5TDPB 1KCSL 4I5BA 4XPTL 3OG6B 4I9WE 2CDEA 2D31A 4M03A 3TH4T 4QXWA 7CGTA 3RVWC 1JWUB 4XCCL 5LVEA 1U8IB 5MEPA 1T6WA 1YPZF 4XVSL 5KS9E 1ZV5A 4XPBH 2P44B 2VLRA 2XIDA 3KDMA 3RTQC 1BOYA 3C5SB 3OTTA 3O0RL 3K46A 4U1LB 2I26N 1E27A 3ZHDA 4NJ9L 2Y07H 2QSCL 4CRPA 4MDJB 3L3JA 4N5ED 4X98A 2AXFA 1TVBB 1KT2B 2V2XB 4JREC 4RGNC 3O9WB 2DTSA 1RZIA 4BQBA 3U7WH 1JNNL 1UC6A 4LDOB 4AT6B 1OF2A 4GG6E 1VKXA 4NOBA 1ZHBA 5DURB 5T1DL 4Z7QE 4FS0A 4PJCF 4WDIB 5EG6C 1J5OL 4LASH 4E42B 5CZVH 4JRXD 1Z3GL 1S9XB 3VGEA 1WIUA 2V5YA 5HGGS 4L3CA 1Q9LB 4JRYB 4NQDB 4DGYL 4UZGA 5F7NC 3N9GH 3QPQD 1NGXA 3RBSA 2WWMD 1FVEB 4O2CA 4P3WA 5E2VH 1QSZA 3G04B 2VDKL 5H37H 1DLFL 3V7AG 3MRQA 1CDIA 2GUOB 5CJOH 4RGOH 5EOQH 2J8UA 2C4XA 3KPRB 1JPTL 1AGBA 1ZA3A 3SE3C 3VCLA 2YSSA 3O6FD 4PJBF 3LQMA 4L4VD 4K3DH 4NNXB 3OGCB 3V4UL 4KMTH 3ARDA 1MLBB 3FZUD 2PTUA 3FOLA 2X9WA 3EGSB 1ZA6B 5D2LA 4HKBB 3MGOB 1RK0B 1RURH 3SDAC 3QISA 4PYGA 1U9KA 3BIBX 4XNUL 5EBWA 5I8OH 2CIKA 2R2EA 4G8EB 2X09A 3NPSB 3C9NB 3FO0L 3MV7B 4QXTA 1ITBB 1JF5A 4I48B 1P5VA 1MCRA 2V5RA 5CHNB 3QUYD 5ADOH 1FGVL 5EORL 3VXNA 2P7TA 2A38A 1A3QA 4L1HA 1IGFL 4N5EC 2R2HA 2IAND 2NR6D 3TPUA 1GZPB 4IRSA 3ULSB 2JCCF 3AMLA 4PJXF 5A2JH 3OAYH 5GISH 2P5ED 4Q9RL 4PBXA 2DI9A 4CMHC 5F6IB 5CIPA 1TTFA 1PG7X 3FB6B 1WZMA 5E9DE 1U8NA 3EFDH 3QZWA 2GK0B 3SGEH 4M93B 4Q6IA 4BQ9A 3CZFA 3ULUE 1OW0C 5HVWA 4PB9H 2NY1D 1AQKH 3ARTA 4FA8A 3VFMB 3ZT5A 1LP9A 5MI0B 1G7QB 2NYYD 1FL3B 4M6ML 3VXUB 3PHOA 3QPQC 4HIEA 4YE4H 3W0WA 4ELMB 5D7SL 1TETH 2DRUA 2ORBL 4QRTB 5DRXB 2ATKA 5C0BB 2EIDA 2VLJD 3SGDH 5BS0D 1NL0H 1SBSH 4NWUH 5D8JH 3V6OE 1QR1B 3U1SH 3W9EB 2HT3D 1QVOB 1KPVB 2Z31B 5BZWB 5GGSA 1VENA 2HFEA 3O6FC 1NANH 4BA8A 4N1EA 5E5MA 1DVFD 2G9HA 4A6YH 1KEML 1Q72H 5BOPA 4XVTH 3FZUC 3DGGB 4N8VB 4I3SL 4KKAD 1BJ1J 5IJVA 4L8BB 1U41A 3EOTH 1JTOA 5T1MB 3WKMH 4OCRH 2XWTA 3WXVL 4ZQKA 4CVXB 2BSRA 3RNKB 2FSEB 5LG1A 3HZYA 3GMOB 3MRJB 4K7PL 1X9QA 1K85A 2WK2A 4JFOA 3RHWF 4ZFFA 3IXAB 5DHXB 2NY0B 5T3ZD 4LHUA 1DN2A 3QUYC 3C60B 1EFXB 5BZDA 2VC2L 1INEL 5F93C 3VD3A 2P5WD 4M3KB 1F4WH 3TFKD 4AL8H 3TN0D 3FOMB 3BN9C 1KTRL 1C5BL 5IMMA 2F74A 4S11A 4OD3L 1HN1A 3U4BH 4R0LB 1XIWD 3QEQA 1LEGB 3SKJH 3GFUA 3WHE1 1UG9A 3CUPA 4JM4H 3H7LA 5ANME 5K59F 5CINH 5F97E 1XF2B 2H2SD 3BHBA 5I18H 3MJ7B 1F58H 2VQTA 4OFIA 4XP1H 4MGXA 1HQ4A 3OB8A 1JYXA 4PY8I 4QF1A 4K3EL 4MYWB 4HH9A 1WWCA 4PJHB 1C5CL 5AYUH 2CKNA 3ZKXB 4JO4L 1DBKH 4ZUTA 2LAGB 3VXOB 2HJLB 3WFHB 1HOCA 2NYYC 4HWBH 4WCYL 1QRND 5T3XE 1YNTA 4KHTH 1A6ZB 4Z0BL 2BFVL 5GRJL 5C9KA 4QNPF 5T1LA 2DLTA 5J6GB 2GKIA 1F3RB 3S97C 1C5DB 4D9LL 1KSRA 1AHWA 5E2WH 1V8HA 2GJJA 1VFBB 3GMRA 3DXAB 4XP9L 3BXNB 4M7LH 5E00A 4YBLB 3KPPB 4HK0B 3QUZB 3WFCL 4Y1AE 5EH1A 1KB5B 2HT3C 1WITA 4EBQH 4KK5D 1MCOH 1WTGT 3ORJA 1RJLB 3W2DL 4QXUL 1MH5A 4KQ3H 2VDNH 2YD8A 1Q94B 5HYIA 2M26A 3QQ4A 3U7YH 5L0QB 3RI5K 3IVKB 4GSDL 2X4OA 5GJSL 5JHDE 4XMKH 5INCA 2AJXL 3QHTC 3V0AC 3VH8B 1BEYH 3OXSB 5DVKA 5KS9B 3QEGL 1A6VL 5A43C 1FNAA 4PLOB 4F7EB 3K2UH 2J2ZA 1OAKL 2CUHA 5ALCL 3U82B 3LKSA 3TBYB 4HUXA 3B9DA 4PRIA 3D6GA 3G6DL 4WI4A 3VXME 4PRDA 4LVEA 1FQ9C 3TFKC 3TN0C 1M6OA 4MX7A 1FAKT 5IFJB 4HC1H 2FIKB 2VAJA 3DUHA 1FGNH 1NQBA 3GRWH 1XIWC 4LASL 5HPMB 5SV3A 2VQ1B 4GG6B 3D87B 3HE7D 2LVEA 1DDHA 2HA1A 4QWWD 3MNWB 1BBJB 2NY4D 3WMSA 2IH1A 5FB8A 4HPOL 4BJLA 3UTTD 4UDTA 3TJEL 2H2SC 4I18B 3N9GL 1FH5L 4R90H 5ACZA 5C8JA 3KHQA 1PEWA 5B38B 1JRHL 3CLEH 3H9HA 1U8LA 5FO8B 1FZKB 1N5YL 1MJ7H 4ZOBA 3DV4A 1R3JA 4LLQA 4Z7WA 4ZXBD 1G1YA 4FQCL 1FYTE 1D5XB 4QHMB 4PJIA 2IBBA 4ZD3L 4XCEA 4NQCD 4G8GE 4ORZC 5J57B 5EU4B 1LO0H 4TUJB 4PS4L 4M1DL 5IM7A 1U6AH 4G8FA 3VMNA 4JFYB 3KYAA 3KR3H 2Q6WA 5ITBL 6CGTA 4QHNB 4X7DC 5HHOA 5CSGA 4OF3A 1H5BC 1RD6A 4JZOB 4IM8A 4KVCL 3TGXA 1ACYH 3VXQA 4LLDB 2VSCA 2X4RA 1MAKA 3P9MA 1MCQA 2Y7QA 4PV8A 4XC1L 4XZUA 5I1GH 5FYJE 5C09D 3FN9A 1T0MA 2PUQT 3WJJA 1QLEH 5IF0B 1NLDH 5GGSY 3TBWA 4ONGH 3MV8E 5F1IA 1R3IL 4XX1E 3FB7B 3BZ4B 1VESA 1P7KB 1TJIH 2APXA 1SYVA 1SEQL 1U8JB 2IC2A 3KGRA 4ZOAA 2QHRH 3KYKL 1WC7B 4BKLA 4JM2D 1JNJA 4P4KB 2DLFL 4OQTL 4PJFE 5IW6B 3IRZA 5IROC 5DD6A 3NTCH 4X6EA 5JORB 5EZIH 2DTML 4NP4L 2ITDA 1MRCH 3RWIA 3MREA 4QWWC 5ETUB 4U1KA 1BMGA 2NY4C 4Y5XA 9CGTA 1YN7B 4JFEE 4UTBH 3CIQA 5E9DB 2FX9H 4LCCC 3EYOA 4ORGA 3BW9B 4RDQG 4H1LA 3O4LD 4GAYB 4TNWK 4PJ7E 4PRHD 5LXGL 4N0YL 3SE9H 4JDZA 3SY0A 1NGQL 2NW2A 4DN3H 1NCNA 3V6ZA 1YY8A 4OCXL 4HWEH 2X42A 4OBRA 5EBMA 3RTQA 3G08A 1BHGA 1C1EH 2AK4A 4ZXBC 3F7RA 4FQHB 5TDOB 4UTAH 1J0KA 3QFDB 5A40E 4FNLH 1DZBA 5GPRA 4NKIL 3RQ3A 4YDIL 1T20B 4P2QA 2VLRE 3HLAA 4S1SH 2QR0A 5FGBC 4WW2A 1DQLL 5F3BA 4IRZL 1IJ9A 5EU7E 1GH7A 1YC8A 5D7JD 2ZUYA 2VRAA 4DKEH 4LF3B 4IJ3C 3MJ9A 3MBED 2BRRL 2I9LB 5FCUH 2A6IA 2F8OA 5EFIA 4OF0A 3N50A 4EZMA 4MA7L 1QUNA 4QTHA 4OZHB 4KDTC 5C0EA 2VABB 1CLOH 2CLZB 1N2RB 3D85B 4XNXL 4ZO9A 3HI1B 3L5WB 3O6MH 2YN3A 5C2BH 1B2WL 2WINA 1I7UA 2VXSH 5BV7B 1VA9A 5CS7A 4QRQA 1IGTB 4HAGA 3QDAA 5EULV 4Z7VA 3ET9F 3F7YA 2D03L 1AGCA 1JUFA 3FFDA 1PYWB 1G9NH 2A9NH 4JM2C 4UOW0 1KPRB 5L88L 3KPOB 1OAXH 2X05A 1BFSA 1D5BB 3SE3A 2R2BB 1SJEA 4UT6L 5HHQB 4QXGH 5SWZB 1AR1D 4ALAH 4FMFA 5E08L 4OD1H 2J8UE 5FUOL 5ANMB 3MNVB 3GJEA 1GIGH 5HHPA 1DJSA 1FFNB 1OAYL 4EOWH 3IXTB 2JJUA 4KU1A 5CEZL 3T3MF 2ESVA 4Z78B 2FJHB 4PY7A 1XT5A 4HUWB 4Y4HB 2CO6B 1DBBL 3IFLH 5D2LE 4ZAKD 4NQED 4O5LH 4LNRA 5KG9B 3CDCA 4GUPA 5GRVL 5IHUH 3I9GL 3SHSA 2UYLA 4EBQL 1BM3H 4X5LA 2FD6H 3DVNB 4AQOA 5AG9A 5DK2B 4WIQA 3W82A 3OZ9L 4P99A 3X12A 4DGVL 3UYRL 2IPKA 1H8OA 5F96H 3MLYL 3VRJA 5CBAB 3LIZH 1MCEA 5D7JC 1EAPB 1WBYB 1UXSB 3FQNA 4OM0L 1NCWL 3MBEC 1REIA 1CZ8H 4DEPC 4FABL 3AS2A 2BVTA 2VWEC 1ZGLA 4EI5A 3GHEH 3NPZB 3UEZA 1G9ML 2EIEA 3DX7B 1OW0A 4XXCC 5JHDB 1NC4B 1HEZA 3UDWA 2MTPA 1XGPA 3RWHA 5CZKA 1BFOA 3EO9H 5L9DL 2YBRB 5C3LD 2DDQH 1JF6A 1HQRB 1MY7A 2XZCH 3ZKND 2HFFB 5IMOA 4PJ9D 1ORQA 4YHYC 4OTXH 4R7DA 3PP4H 1DEEB 1C12B 2X5PA 4HK3N 1A4JB 4N9OB 3UBXB 3WLBA 3VXMB 3HCVA 4WU5A 1LP9E 2Y36L 2XRAH 4Q2ZA 3HZVA 4X4XB 3W0WE 4D3CH 4XPFH 3QO1B 2C1OA 1I1FB 3KYMA 3QFJA 5E8OB 1IEHA 2VE6A 3O6FA 4L4VA 5FAAA 1L7IH 5HDOA 4EUPA 1T1XB 3VGAB 1S7QB 5I6XB 1FNSL 1RZGA 1RUPH 4V1DA 1S5IH 1OQOA 2N56A 5DMIH 3PWUA 2YWYA 1NAMH 2EDWA 1NGYA 1ZGLM 1QFWL 5DUBB 1RIHH 2E9IA 3MUJA 4MXWL 3ARGB 4PP2B 2IMMA 2ZPKH 4UT9H 4WY7H 5JW3L 3O3DB 2DOCA 1UT9A 4KXZH 1KPUA 2DKUA 4ZAKC 2FCBA 4Q9CA 3QIBD 3VFPB 2AI0L 4YO0B 2O93L 4G7YH 1MIMH 1H0DB 5ITFB 1YPZA 4PGZA 2XTLA 4AENB 3WS6A 2WNGA 4P57A 4G8GB 4PJDB 4X4MA 5IB4B 1QBLL 1OSPH 5KN5B 4NC0B 5EZOH 3S96B 1LEKB 1JPGB 1FLRH 2MHAA 2LV4A 3SE8H 1JVKA 4Q7DA 1E4WH 5TF1H 1AKJD 1RUAL 3MLZL 5GGQL 1XCTB 3O8XD 1FSKB 3WUZA 3H9YA 3ILPA 2IALB 5GSRB 1A9BB 1M05A 1TENA 2WZPD 4FHBD 3T8XB 1NC2B 1XFPA 5DC0A 1T22B 2AP2A 2XZAL 3IF1B 5DRWA 3RVVD 4XX1G 3CCHA 1EEYB 1KLGA 4XTRD 1KB5H 3I75B 2XKNA 3DURB 2F5AH 3MV8B 1RU9L 3QH3B 5HHXL 1QBAA 3ZKNC 1HHIB 3HA0A 5C2UB 3DO3A 4RZCB 4F8QA 2BNUB 3G6JF 5KSBA 3CFKA 3KPTA 1G7JB 2JJTC 3DNKA 1KNOB 1W2KT 4NPYB 5BS0A 3INUL 4XVJH 4PJFB 2D4DA 4HGWA 1QBMH 1YN6B 4O51A 1ZEAH 3SOBL 3G9AB 4UTBL 4PLNC 1JGLH 1VGKA 4YDLB 3IETA 1N8ZB 1Y0LA 1MAML 3S5LG 3H7BA 4YXKH 4NQTA 5HY9B 2Z93B 5GRZA 1FO0B 5L2JB 4X5XA 1Z2KA 2J4WL 3LCYA 1UZ8B 5EOCH 1NFKA 4K8RD 4JFEB 1MFCH 4WUKH 1CGSH 1U93A 4DN3L 5J13C 4IHOA 3F58L 3R8QA 4U1HB 4YQXL 5J11B 1K6QL 2IAMB 4ZPVA 5CILH 4P9ML 4PJ7B 4I0PD 2YXMA 4ZTOH 3BKJL 1JWSA 1MREL 1ZHKA 2X4QB 4Y5VB 5DUPL 2BNRD 3QIBC 2D0GA 4I5BB 2RFXA 1HHKB 2CDEB 1DQDH 2CRZA 3S4SA 3P4OA 3U4AA 2G2RA 5DFTA 5DS8A 4MNQB 4PUBL 4QGYA 3ALWA 3TN0A 2VLRB 3HC0A 2B1HH 3P3YA 4N90D 3KDMB 2J88H 4I3GA 1OM3H 4ISVB 3P0VH 1E27B 3C8HA 5DD0H 4WI7A 2NW3A 4PRIE 2DJUA 1TDQA 5C7XH 1U8MB 5D6DA 2WUBL 3BPOB 2AXFB 3LAFA 5D7KE 2ZUSA 1KCKA 3O8XC 1RZIB 3HNTL 4HFWA 4YHOL 3QIWA 2J8OA 5CJQL 1ZGLP 4XI5D 1OF2B 4KZDH 4IMLA 1VKXB 1EHXA 4J23A 4FQQA 4OGXH 4UB0L 2VDOL 1ZHBB 3RVVC 1X5FA 2YPVL 4UINL 1WT5A 1MWAA 1AI1L 5JUEH 1FVDA 4XTRC 4HKXA 3KJ6H 1A7RL 1RK1A 3QXTA 4PB0H 4HGMA 4LVOC 3VFWB 2KKQA 2R0KH 4BSVA 12E8H 2NX5D 3LEVL 3FN3A 4WW1B 3EOYG 4MLIA 2ZUQC 3N0PB 3ULVD 4HDIA 1NGXB 4Z7WE 2X89D 1Y6MR 2FECI 3O4OC 1MHPL 4O2CB 1A3RL 1X5ZA 4PJIE 3PIQA 3HMWH 5B3JF 2K1MA 3A6BH 4ZOCA 3T0WA 2BOCB 3O2VL 4QT5A 3PNWA 1J88A 1H5BA 3MRQB 5ICYA 2J8UB 4EKXA 2DQGH 1YC7A 1UM6L 1AGBB 3RFZC 4PGEA 4RA3A 3VFRA 1ACZA 2XA8H 4K8RC 3TP4A 3VCLB 1NCDH 2YSSB 3MJ8A 1AO7A 3V4VL 3H42H 3CC5B 4MQSB 3DOSA 1YEKL 5HHOE 2OL3A 3BOVA 3EZJB 3F6LA 3EIFA 3RIAF 4L3EA 5CP3A 4Z8FH 3IKCA 5D2LB 4I0PC 4PJ8D 3U46A 1KJ2A 1HYRC 3BEVA 3BFOA 3NVQA 1T2QH 1WZ1H 3OPZL 1EO8H 4GFTB 5EBWB 2CIKB 2R2EB 3CH8A 3AS3A 3JZ7A 2X40A 4KKBC 5JW4M 4QXTB 4YPGA 2BDNL 2NXYB 3DMMB 5ISZE 2QL1A 1F97A 3ULUH 5ABDE 5EBLA 4YEEA 5IROA 4JG1H 3VXNB 2P7TB 2HT2D 3HN3A 3BPCA 1XF3A 3F5WA 1N0LA 3ZKMD 1FV1B 5JIIA 2W0FA 3TPUB 5FKPB 1YEEL 4IRSB 3FFCD 2FIRT 5DZLA 2ZOLA 2QKIA 4HKJA 4PP1D 3HG1A 1FC1A 1ORSB 2HRPL 1ZLSL 4XI5C 5DJZB 3WFDH 5CIPB 5TQ0H 3TZVB 4G7VL 1B3JA 1TMCB 3QZWB 2A6JA 4M7KH 1BBDL 1I9JL 2RHEA 3PDDA 1NCBH 1G7PB 4TQEH 2AJSL 3CZFB 3GHBH 3WNNA 1GHFH 4J7RA 2HVKA 2NZ9D 1LP9B 2E9JA 5KTEL 3ULVC 2ZCLH 5GXBB 3PHOB 4HIEB 3W0WB 1PZ5A 1X5IA 2AK4E 3MROA 5FO9A 5C0AD 3U4EA 2ATKB 1IAKA 4BUHA 4ELKA 1PD6A 2HP4A 4P2QE 5ENWA 4M43L 4RGNE 5FECA 2ZUWA 3O6KH 3UC0L 1KELL 4WFED 2UWEE 5GGSB 4KDTA 2AXJA 4RIRA 4M9PA 1J0IA 1X5XA 3DUUA 5AWNH 5E5MB 5C09A 4XPAH 2G9HB 1IM3A 5JNYA 1A3LL 1W72A 3RX5A 3ZL4H 4JPWL 1LDPL 4P59L 5IJVB 2FR4A 1R3HA 4FQPA 3EOBA 2XWTB 1YYML 2H9GA 3ZSTA 5TF1L 4JFOB 1G6RL 2QADB 1P4IL 4ZFFB 5E8PB 1UWGH 1X6NA 5D1XD 2MKLC 3QNXA 4Z7VE 2F5BH 2Z91A 3MRGA 5BZDB 2HT2C 4JKMA 4OLXL 4CNIA 5ICXB 2GJ6A 4Z7NF 4LK4A 3ZKMC 5IMMB 1KCUH 3U0PA 4QHUA 2F74B 2E27H 5DJAA 2WP3T 2P45B 3FQXA 1N3NB 1NSNL 4YFLF 2F5AL 2O5XL 5LBSL 2Z35A 3WEXB 3OMZA 4PP1C 1CQYA 3CUPB 2DQDH 3O4LA 4RMTA 4PRHA 4Z5RA 4PJ5A 2YKLL 2OJZL 4HXAH 2IFGA 3MRFA 2B2XH 3P2TA 2ESVE 4NJAH 4QF1B 3U9PH 3EYUH 4YDJA 2XNAA 1PX4A 3D2UD 3DX8A 4ZUTB 2OTUA 3BZFA 5HBBA 4AIZA 1TTUA 4OD2A 5EPMA 1EK3A 3MCLH 4PY8J 3FQTA 4NKQB 3NZ8B 4HD9A 4GG8A 3ZTNH 5E4EC 4NZUH 3HI6H 1AHWB 2FX8L 2GITA 3GMRB 3MBEA 5E00B 2CXKA 5BO1H 5MP6L 3QNYA 1L6ZA 2CH8A 4JQVA 2A83B 3NA9L 1MFBH 3VWKD 5AAWA 4LLUA 4LPUA 4UT7L 3MCKA 1MH5B 3UXFA 3ZTJG 2DQTH 4U1NB 3FONB 5C71A 5FDWA 3QQ4B 2E9BA 1P7HL 2OP4L 3FCTA 1BJMA 3QWRD 2Q8BL 2PYFA 3OL2A 4W68A 5TFSL 3B8YA 3WXWH 2AV7A 2X4OB 1XGUA 2O26U 5EUOA 4JRXE 3CDFA 5INCB 1TTGA 2B4CH 2YRLA 3IDIA 1IGJA 3P0VL 8CGTA 4LGSB 4WFGD 3HI5L 3KYNA 5GGTH 3LPGA 4M7JL 3RUGF 4D9QD 2FJGA 3LKSB 5D1XC 2R4RL 4PRIB 1A6WL 3GSRA 4PRDB 43C9B 1KFAH 1M6OB 4FXKA 4MX7B 5DYOA 1AE6H 3NH7H 1HSAB 3QFJE 4YXHH 3LQZB 5IBTL 1U8QA 2XWJA 4CDHA 3GO1H 4L4VE 1DDHB 1MQKL 4F15C 1I7ZA 2QSTA 4MJID 4V1DE 5C1MB 4UIMA 2VZ3A 1MIEL 3WN5A 3NIGF 4XRCA 4BK5A 1CXLA 2OM5A 5ACZB 2HLAA 5IFAH 4HBQA 3NN8A 4Y89A 5C8JB 1EUTA 1DSFH 5A2IH 4XNZB 4BZYA 1FORH 1NBYA 2BOBA 1U8LB 2HKFH 3VGFA 4JB9H 1K4DA 1QSEA 3DV4B 1R3JB 1BQLL 4LLQB 3ISWA 4BELD 3BAEH 1KJMA 3PL6D 1O7VA 1YPZE 2F19H 3W9DB 4PJIB 4CN4A 5T5NG 4XCEB 1HHJA 2QQLL 3H42L 4X4ME 2QSVA 1KLUA 1A7BA 3G6AA 5IM7B 2G60H 2VERN 5ILTL 3WIHA 3MOBH 2Q6WB 5EZJA 5HHOB 3MX0A 1BP3B 1FN4A 1BQHG 3VWKC 5AD0B 4FFWD 4PV9A 1LK3L 3VXQB 1YMMA 1BWMA 4G80A 2Y7QB 3P9LA 5I1EL 1CIUA 4L4TD 4XMPH 4HX1A 3QP3A 2GT9A 2YK1H 4JFZH 4P23B 2FH6A 1SMAA 2JJTA 2J8HA 4O9HH 4LPYA 2A6KB 3RWEA 2A77L 3E8UH 3TBWB 4YDKL 5F1IB 5ISZB 2VL4A 4GBXD 2W9EH 4WTZA 3CFEA 3TYGL 1HZHH 4JCMA 1MJ8L 1SYVB 5KSBE 3L3GA 3NFPA 5IVXF 5SX5K 2NY6D 5JPMA 1U2HA 4ZUVA 3RWFA 1YNLH 5CSBA 1AGFA 3JWOL 5H94A 5BS0E 4WENB 1FNGB 5DMJB 3VXTA 2BMKA 4FTVD 4MS8D 4N8CH 4X7SH 4XVUD 4X6EB 3KPMA 1S3KH 1PKQA 3E6FA 2ITDB 3RWIB 4DTGH 3MREB 5CLWA 4U1KB 2GFBA 5KAQF 4Y5XB 5JHLH 4A2MA 4P3CH 5E8NA 1QD0A 1X5YA 4GW1A 4ORGB 3WNKA 2D3VA 3TCXA 4F33A 3QIBA 2CKBB 4HG4J 3GSOB 2MQ0A 3OAUL 2COQA 5K9QI 1PSKH 1OT2A 5FYLD 3DVGA 4B0MM 1TCMA 4JDZB 2NW2B 5BV7L 4ZTPL 3V6ZB 3ARSA 4HBCL 2WUCL 5EBMB 3RTQB 3G08B 1T5WA 2FH8A 5T3ZE 4WEMB 2DB8A 1OTTD 2AK4B 2VR5A 3V79C 4OIAA 3PL6C 3ES6A 1KIPA 3TT3H 3HMXA 3MBXH 3BUTA 2NTSP 4U6VL 4JREB 4RGNB 1I8KA 3HLAB 2QR0B 1JGVH 1K9TA 1IAIL 2UWEB 4WW2B 5F3BB 3HE6D 1JZ4A 1LE5B 3LD8C 1FG2A 1KJ3H 4HIJA 4HJJH 5E6IC 4NZRL 2NLJA 1KB9K 2UVEA 4Z95L 1FDLH 2A6IB 4FFWC 5EFIB 4JO1L 4QTHB 1J1XL 4FG6D 3BDYL 5KVFH 2VH5L 2P1YA 2BK8A 3JWNC 4ETQB 2WINB 1YQVL 3S36X 4LSQL 4LVHC 4QRQB 3MTRA 1UWEL 2YEZA 5EUKA 4GBXC 5T3XL 3QA3A 4Q0XH 4Z7VB 3CFDA 1D9KD 1AGCB 1QQDA 3FFDB 5E03A 3LY6A 1U8OB 2NY6C 4HQQH 5H8DA 3B9KD 3CVIL 1DQML 1BFTA 2JTDA 1SJEB 5FIEA 1N7MH 2DYPA 4MS8C 1Q1JH 3STLA 4XVUC 5BW7A 4MB5A 1X5GA 3MUGA 3K1DA 5F70A 3H9SD 3GJEB 3CU7A 5HHPB 1QKZL 1CK0L 3ZE0F 4XBEL 1AO7E 2EZ0D 3MLRL 3O41A 3HAEA 4LCIL 1D5IH 4UIKL 3MLWL 2BNRA 4PY7B 2VXQL 4LRNL 2UZIL 2FBOJ 2D0HA 4L3EE 4K7FA 3GSXA 3VGBA 5KVEL 4GAFB 4LNRB 5ESVA 4GUPB 3PQYD 3LV3A 5D7IA 2HG5A 1SEBA 3FT3A 1OTTC 3RAJL 3V6FB 2UYLB 5FCSH 1DLHA 2W60A 2OYPA 2C3VB 2PO6D 1F4YL 5HDBF 3KYOA 3GB7A 3VRJB 3FHQA 3HE6C 4NWTH 4F2MA 4CMHB 4KH2A 3P0GB 5DRZA 2B4CL 3FQNB 1FAIL 4GLRI 4M62L 3BZEA 3QUXD 5E2UH 4DVRH 1ZGLB 4JO2L 3HG1E 4NGHH 1T1YA 4YHNA 5K59E 2ADIB 3KPQA 4JRXB 4XXDA 3FHAA 1HEZB 2NX5A 2VLKD 1LK2A 5DVNA 1G84A 1XGPB 3RWHB 3FB5B 1BFOB 1B0WA 5D7LD 5GRVK 3QO0A 4TUKH 3S98A 3OB0K 4W6YB 1RUMH 5IMOB 2X89A 1R5IA 4R7DB 5HHME 1FFQA 4Q6YA 1MY5A 1D9KC 3V6BR 3HCVB 3EOAA 2DWEB 4Q2ZB 5DEFA 2X1OA 3MR9A 3B9KC 4J2XA 2OCFD 2C1OB 4DZBA 1II4E 3KYMB 3QFJB 1OCWL 4D2NA 5EIVA 5LQBH 4D0DA 2VE6B 5C0FB 3O6FB 4L4VB 4XAKE 2DD8H 1F3JB 4LARL 3FO2A 5BMFL 4X80L 4CBPA 1BFVH 3S36H 3GIVA 3B2VH 3DTXA 5DFWH 1EDQA 5C0IA 3GK8H 1NGYB 2VISA 4YEFA 5J1TC 5DQDH 2IFFL 5FYJL 1BF8A 3EO0A 3F12B 5C09E 1T6VN 1R5WA 2FBJL 1RZJC 5HDLA 2ZP0T 1T89A 2CK0H 4M5ZH 2N7BA 2HYMA 3OJVC 1CE1L 3BP4A 1KXVC 3BJLA 1QRKA 1R0AL 4JKKA 4LOUD 3QUYB 1RPQA 3KHOA 2VDPH 4JDTH 3PHQA 3ARQA 1NFDA 2W0PA 2APBA 2OI9C 2MQCA 1JGUH 1RIVL 2P48B 3WFEH 4PLJD 3S37L 2OZ4A 1D6VH 2PO6C 4ELMF 5EIIB 1J12A 5KOMC 2VO5A 5IESL 2GJ6E 1FO0L 4DAGL 3TV3H 4W6WB 4ZNCD 1TFHA 3G5XA 4OKDA 5I1DA 3QWOA 4O9HL 1LE9B 1FFPA 4RMQA 1M05B 2QV2A 3QUXC 1KBGH 4G9FD 1AR2A 5I1IL 5DRWB 3O4LE 1UZ6F 1ZT7A 4PRHE 4TVPD 1CCZA 3SDCD 2XKNB 4RAHA 5ICZA 4JJHA 2EYTA 4NM8L 1VGEH 4OZGB 1BX2A 4YHMH 1A8JH 4ZUWB 5KSBB 3UO1L 3CFKB 4NO3A 1IRAY 4NKMA 5GS0D 1ETZA 4G5ZL 5BS0B 4G6MH 3ZTJH 2XZZA 4M6OH 5GRUL 4HGWB 5HHVL 2G75A 4O51B 3MRBA 1JTPA 4OZ4A 2PKDA 3BH8A 3QXAA 1OWWA 1OOAA 3IETB 1B6UA 4MVBC 4NCC1 2APVA 4X5XB 2FHCA 1PSKL 3QQ3A 5T1KD 3C6LA 1P84K 3PXJA 5BCAA 1CLYH 4IHOB 4MA3A 4WUUD 4L5FL 4LKXA 4ZPVB 3OR6A 4TOYH 3RDTD 4HSQA 4TSBH 1JWSB 3QQ9D 1ZHKB 3MUHL 5GGVH 5LWYH 5EUOE 1GYAA 3UMTA 3R1GH 3HS0A 5K93A 2RFXB 4LOUC 3P0YH 5KSVB 1LQSR 2F53D 2AJVL 35C8H 3S4SB 4JFFA 4PJHF 5E1AA 2YN5A 1UXWB 2G2RB 5DS8B 3S35H 5JXED 2YA1A 3TN0B 3HC0B 1KCRL 4PLJC 4O2EA 4NO0D 1N64L 2Y06H 2XV6B 1WZKA 4KTDL 2NW3B 5BVPL 2OR9H 1BPVA 1XZ0A 2NPLX 4OCYL 1IC4L 1MHCA 1WAAE 4OJFH 4JN1H 1IKNC 1KIUA 4HFWB 3QIWB 3SQOL 4EI6B 4D0BA 1IAMA 1BAFH 3BMWA 4Y2DD 4IMLB 1MRDH 1A6UL 2UY6A 1QFUL 5IQ9B 4FQQB 1I1AD 5DA4A 1YJDH 3L7FB 3CX5J 3D2UA 5B39A 4KAQL 3VXPA 1FVDB 3SDCC 1RK1B 4PRPD 1LGVA 3T0EA 3MYJA 4FQJL 4BSVB 2KBGA 4PG2C 2BVEA 4OLVL 1SVZA 5M95B 3MLVH 1ZSDA 1EXUA 4CMMA 4HDIB 5JTWA 1QSEE 2V6HA 5GS0C 5KS9F 3QXUA 4XNQA 4H8WH 3VXRD 3IB4A 1UYWL 3PIQB 5DGQA 1DL7L 1XF4A 3GUTB 1HCVA 1D5IL 4QT5B 3PNWB 1H5BB 3NAAH 1GRWA 3D3VD 2WSKA 3NIFE 1NCCL 4PGEB 3VFRB 1F6FB 2I9TA 1AO7B 4D8PB 2DN7A 1L0QA 5IEHB 4LSUH 3TWCH 4GG6F 5KJRH 3BWUC 4L3EB 1DBAH 2P4AB 2XY2A 3CMOH 4JR9H 3IKCB 3GBNL 2JLLA 4RWYH 1OB1A 3RDTC 4OI7A 2BZDA 3U46B 1KJ2B 3BEVB 4P9HC 4Z7QF 2WLYA 3QQ9C 2DBLL 5F89B 3WKNA 1IVLA 3L6FA 2B7DT 2EKSB 1W0WA 3MO1A 5INDA 3OHXB 1DANT 2CKBH 1UVQA 5JXEC 5EBLB 1H3WM 5KVDH 4Y7MA 3UZVB 4NT6B 3E2HB 3BPCB 3Q5OA 1XF3B 4J6RL 5I75C 1YEJH 5J6HA 3X3FH 1KG0A 15C8L 2HFGH 4H0GA 4K3JH 1F2XK 2W0FB 2NY4B 2VOTA 3OKEA 4YBHA 3VJ6B 1FJ1A 2ZOLB 4LCCB 1F4HA 2QKIB 4HKJB 4AEHH 1IGCH 1CU4L 1RZ7H 4TUKL 4OBSA 4DKFL 1PKQE 1DE4B 4Y2DC 4R4ND 1HHHA 4G6AD 4MJ5A 4B50A 3L1OL 1I1AC 4FQXD 4N0FA 3QPXH 5CGTA 2A6JB 4MQ7A 1UCBH 4HHAA 4GMTH 1CXHA 1S7RA 3U7AA 3P11H 1G7HA 4M1CD 4YC2C 5MEQB 3BP6A 2F58L 2HVKB 5D1QA 5FYKD 1QYGH 5I19H 3CJJA 4ODUA 1PZ5B 5C0CD 1WWBX 2Y5EA 5FO9B 4X6CA 4JFQA 3C8KA 3GK8L 3U4EB 5E6IA 1IAKB 3JV4A 5DQDL 3KJ4C 1V3MA 3DETD 5ENWB 3MACH 3L95A 3U0WL 5FECB 3I6LE 1WJ3A 2Y6SD 4A6YA 3RZCD 3MRRA 2OTPA 5E2JA 1A7NL 1L4IA 5DJYA 3TIEA 5EC2B 1F3DJ 1T7ZA 3L5JA 5IVZB 4UMGA 1L9NA 2R1XA 5C09B 5FA3A 3IDYC 1IM3B 5JNYB 1W72B 2P8PA 3HC3L 2FR4B 5DVOA 1S7VA 1R3HB 4GAJL 3IJHA 1GVIA 4HWZA 3GKWL 4WEBH 3C5ZD 1N59A 1Q0XL 4NZTL 2VZOA 3ULUF 3KLHD 3AM8C 4YZFE 5IMKB 4JM2B 1A9EA 3UPRA 3SJVA 5E8DH 3WFBH 2D2OA 3VE0A 4WNQA 2Z91B 2EYRA 1CG9A 3MRGB 4CNIB 3HC4H 4FQIH 5D5MB 2MCPL 3QI9D 1CFBA 4QHUB 3U0PB 3EHBD 5DJAB 3TNMA 2CIIA 3FQXB 2RGSA 4NBXB 3GIZH 5LKNA 3BISA 4ZPTA 2Z35B 5DJDA 2ZNWA 2H45A 3EJYD 3O4LB 3GMMA 4YHML 4R4NC 1JPFB 4G6AC 4PRHB 4Z5RB 5A1AA 3O3EA 4H20H 3ROLA 5CMAA 2BNRE 3EW3B 3AC0A 3Q3GA 3BKYH 4HWBA 4K23H 4OZHF 2FATH 4MAUH 2XNAB 1WBXA 3DX8B 5D1ZD 5JOPE 2O5YH 2OTUB 3BZFB 3KPLA 3VMOA 2Q87A 1XGYH 4P5TD 4N90E 1TZHB 5D7IE 4LP5A 1Z6JT 4OD2B 2RJMA 5EPMB 1JP5A 3MRNA 3HE6A 4HZLA 5D7JB 2E6PA 4GG8B 2C4FU 4NN5C 5DJ6A 5GRYA 5AZ2H 4ERSH 3BH9A 3DETC 1IAOA 2GITB 4R8WH 1RZFL 3MBEB 4DEPB 2C4FT 3FN0H 1FC2D 2Y6SC 4HXBL 4XP5L 3RZCC 3QNYB 4CJ1A 2DICA 1NFIA 5ALBL 4ESKA 4HMDA 1KIRB 3MA9L 2HH0H 3MCKB 2A2QT 4OLZH 4XP6H 1A7PH 4OCSH 1LO3H 4YX2H 5FDWB 5CFHA 4S1DD 4EDWL 4GW4A 1F8TH 3FCTB 2PYFB 4F57H 3FRPA 3WIIH 2IG2L 1AFVL 5AUMB 1XGUB 5EUOB 4YHYB 1MFEL 1QSFD 2BX5A 2NX5E 1M4KA 5GSVA 2XOTA 1JK8A 1IGJB 2EDFA 2EDQA 3IDIB 5FUCE 2VIRA 3G5YA 3OGOE 4F7TA 5IQ7H 3KLHC 1RZKL 1YEFL 5F72S 3KYNB 4UILL 5HDQH 3ULVE 1CR9H 3WSQH 1OGAD 2AAVA 2FJGB 3VG0L 1LEIB 1H3VA 2AK1H 4UV4H 1V5JA 3AAZA 3R4DA 3GRWA 3GSRB 5IB1A 5I1HH 4PG9A 3WV0A 4OSUL 3HHRB 4APQA 1WFUA 1YJDL 5DI8A 3H9SA 4FXKB 4ZUUA 5DYOB 3QI9C 3OWEA 4D0CB 3EHBC 2ADGA 2XWJB 3AB0B 1GPOL 5HGDA 1PBYA 5I1CL 4LSPL 1I7ZB 5EWIH 3EJYC 2NY2D 2BY1A 3WN5B 4UUJA 1A1MB 4XRCB 4X6FB 5DJ2A 5B4MD 3HNSH 2HLAB 4H8WL 1YQ2A 2NY5L 1G0XA 4JN2B 1I8LC 3QDGD 2BOBB 1NBYB 1RFDH 1NBVH 1K4DB 1CDBA 1QSEB 4YXLH 4KI5D 4P2YA 4P5TC 1KJMB 1T66D 2YD3A 1B4RA 1CFQA 1CLZH 4J3TA 1NFDE 4RWHA 4HCRA 3TPKA 3QRGL 3MLXL 3TWCL 3FMGH 3GSNH 4M48L 4F37K 1KLUB 2DQHL 4NHUA 3G6AB 4WI5A 2PW1A 4YHZH 4Z77A 3CMOL 3QUXA 4Z18A 3ROOA 5EZJB 1FN4B 3VFSA 3BKMH 1VB9A 3W5NA 1IC5H 2AEQH 2XZQH 4PV9B 4E9LA 3B4NA 5ERWA 5AEAA 4S1DC 4C56D 1CFVH 3X11A 3DARA 1YMHA 3LB6D 3P4MA 3AREA 1KACB 4KRPD 1KXTB 5C6PB 3RWEB 3SO3C 2ZUUA 3GJFK 4ZS7H 3DVFA 1KGCD 4HIIA 4KQ4H 2BVQA 2CJUH 4UV7L 3CFEB 4C58B 3QG6A 3TA3D 4NQXA 1MPAL 3L3GB 3NFPB 5GJTL 4KPHL 1UKQA 1HK6A 5JPMB 4ZUVB 3C08L 3RWFB 1YNKH 1AGFB 5KSAD 3TYFA 3W5MA 5H94B 4PJDF 2H8PA 5T3ZH 2QTEA 2EE9A 5D96C 2DQFA 4WFEE 3VXTB 2BMKB 4U1LA 3NA4A 3RIFF 5C86A 4DW2L 1JHKL 3KPMB 1PKQB 2R0ZH 3E6FB 4V2CB 3MJ9L 3D0LA 1KT2A 3JUZA 2XXMB 2GFBB 3IGAA 3O9WA 3IU4L 2NY2C 5IBUG 3F6IA 4OCWH 1FNEA 4F33B 4IDJH 3QIBB 1I7RA 5B4MC 5LCVL 1P6FA 1E4XL 5IBUB 4LRIA 3DVGB 4OLYL 4U6HA 3MACL 1MFNA 2BSED 4P4RB 3RVTD 1RIUH 3S8WA 1T5WB 4KI5C 5BXFB 2PYED 5IVOA 4MXQD 1T66C 1LO2H 4OLUH 4JFFE 2LTQC 2DQIL 3VD9A 1X4ZA 4HFUL 5HHNA 1I8KB 3O8XB 5EDXA 3QIUA 4X7FC 1SJHA 1CL7L 3VRLE 4PJFF 4ZFOL 4NM4L 1JGDB 3HB3D