1A3LH

Catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
EVQLEESGPELVRPGTSVKISCKASGYTFTNYWLGWVKQRPGHGFEWIGDIYPGGVYTTNNEKFRGKAILTADTSSSTAYMQLSSLTSEDSAVYFCARAGGYYTGGDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution.
pubmed doi rcsb
molecule keywords IMMUNOGLOBULIN FAB 13G5 (LIGHT CHAIN)
molecule tags Immunoglobulin
total genus 38
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3lH02
1TZHA 1KPVB 4TULH 2J5LB 3DGCR 4HFWA 5JO5A 3MRRB 3LQAL 4ONHB 3IVKA 1F90H 2FX8H 3WFCH 1RUPH 1T21A 4QRPE 3KLAB 2C3VB 1LO5A 4JZNA 5DJ2B 2UY6A 3DVFA 3DSFL 4W6XB 1WF5A 3U4BL 3CUPB 4NM4L 1JIBA 3CSBA 4KROB 1K6QH 4EI5A 1QA9B 4JHAL 3S6CA 1J11A 1NGZA 3I6LE 5TE6L 4Z77B 3IDXH 5EORH 1I1FB 2JF1A 3C5ZD 4KVNL 3BKCL 5E1AA 2AV7B 2DQCH 5E9DA 3P4NB 2A38A 4TSBL 1FL5A 1S7QA 5JDSA 4Q9QH 4LAQH 2WP3T 3GNMH 2AEPL 3DX7A 5IFJB 32C2A 4OFPA 5TQ2H 4J3XA 3IXAB 3W0WE 4XAWL 1AGBB 1QFOA 1UZ8A 2HJFB 3TIDA 4C4KT 3EYQD 1K5NA 1ZHBA 4JO2L 5ID1B 3WIHL 1UKTA 4QLRA 1EAPB 4FFYL 4LCCC 2VIRA 2XICA 3H9ZA 3M8OH 4DEPC 4CJ0A 4RSVA 5D2NB 1MHEA 3L3IB 4PTTA 4ZFGL 3K80A 3CMOL 2HG5B 4ZPTB 1LE9A 2IBGA 1N5YH 3SQOH 5KG9B 1S78C 1F2QA 1CLOH 1YEJL 4LVOC 5FYJU 4LEXL 2Z4QA 1EH9A 3NTCL 3BAEH 3RDTC 3CGTA 3V5KB 3MOAL 1M7IB 3D3VA 2MHAB 1ZT1B 3BE1H 3AC0A 1CK0H 4D9RE 4ZSOA 3G9AB 4PR5B 2X9XA 1SJXA 3MV01 2HTLC 3SE8H 3CK0H 1QFUH 3BDBA 1S9WB 1CT8A 4LVEA 4WVRA 4M3KB 4UAOB 4OZFH 3E3QE 5D7KE 4NP4L 1FVCB 2J6EL 2RR3A 3TJEL 1C5DB 1DSFH 1MHHB 4FZEH 2D0HA 3B5GA 5K59F 4TVSa 5I71B 1XR9A 4MAUH 2NW3B 4R2GB 2R0WL 3MLWH 1JHTB 3B3IB 3QEGH 4N8VA 4HS6B 4JRYD 4MCYB 3S88H 4R7DB 5FUZL 1ZS8B 4ISVB 2Z92B 1QVOB 2OSLB 4U1SA 5FGRA 5EN2A 3VRJB 1OGTA 4PJFB 2EDDA 4LQ1A 3PWNB 3EUUA 3O4OC 1D9KC 2R69L 2IFGA 3B43A 3GBNH 1N3NB 3L5XL 1CICA 3CFDA 1T0PB 2EIEA 3V6BR 5ID0A 3WFDL 3ZT5A 4CU6A 2Z0BA 3MLSH 2P42B 3VWJD 5CZVL 2CPCA 1DUZA 1FNSH 1UM5H 3KDMA 3GO1H 4XX1G 3OAUL 3WEXA 5E0QA 1IC7H 1OW0A 4ONOA 2Q3ZA 2X9YA 1P7QD 5LGHH 2XA3A 5SX4I 4YXKL 4LCCA 1DLFL 4UUJA 1XGUB 1IGTB 1VFBB 8FABA 4MDIB 5JW4Q 1WZKA 4MNHB 4FQ2L 2F19L 5F7YC 4XPAL 3T0BA 5KZCD 1BFOA 3GSUA 1DVFD 1HQ4B 2J3SA 4P9HL 1H5BA 5MI0B 4MD4B 4L4VA 1DUYB 4Q97A 1NBYB 4B50A 2Y9RT 5D5ME 5C3TA 5EBGA 5HHNB 3RDTA 2CUHA 2W60A 3GMLB 4Y1AE 5IVXE 3CFIC 3U79A 4P2CG 3KPTA 3TJHD 3W9DA 1B4JH 4H8WL 4M9OA 1ZGLA 5KVMC 3RPKA 2G75B 4X99B 1S9XA 1A02N 4Z7OF 1JGEA 1NCTA 1JYWA 5DUMH 1L0YA 3OX8A 4I0PB 2MMXA 1KTLB 1MF2L 3MUY1 3TT3H 4JM2A 1VGEL 5L6YH 3ZL4H 3QFJB 5D1QB 4FMKA 1YYMH 3AROA 4OLWL 2EDJA 3GMOA 5MEOA 4HV8B 1A4JA 1Q0XL 3HKFA 4NRZB 3T1FA 1NFKA 3BGMB 4KRPD 3MRLB 3QIUD 1OPGH 3IKCB 2VMFA 4ZOBA 4F3FA 2MFNA 3SJVB 2X42A 2AJZA 2DLGA 5FYKD 4HKZB 3ARBD 3ZTJG 3IDMA 4HHAA 1EZVY 1NC4B 1A6ZB 4OFKA 4IRSD 4QF1A 4IMLA 1WICA 2DBJA 1DFBL 1JRHI 1T4KA 3EDKA 4XPBH 4GRLC 4YHIB 4Z0XB 3QG6B 1XFPA 2X4PB 1AR1C 3QXUA 4LFHD 4G8GB 4H25A 4PRNB 2E27L 3FQTA 5J13C 2WAHA 1B0RA 5DJZA 5IB4B 1R5VB 2J5LC 3CZJA 3WHXA 4YGAB 4PJIB 2P7TB 4E41D 3MLTA 4YHOH 3O2DA 2YD8A 4M5ZH 2VXTH 1F6LL 2XWBB 2VUYA 1XGPA 1B6UA 1ED3B 4BYHA 1FFNA 2AGJL 5E6ZA 4BH7A 3NIGE 4G8EA 3I9GH 4KROC 1KPRA 1QBLH 3QAZC 5INCA 3BT2L 4OF6A 2GY7B 2VDKH 1NAML 2FR4B 1UT9A 1P84K 4GMTH 5D72L 5C0CD 2O5XL 5AUMB 3EYSH 1FO0H 1S9VB 5I2IA 2OL3H 2XZCL 4HS3A 3QJFA 1BEYH 4HIEA 4N0UE 1IFHL 4X7FC 4YH6A 3NFNB 2MCPL 4YK4B 1L4IA 1WV7T 4LHUA 3X3GH 1OTSC 1P6AB 1F4WH 1I8LC 4JJHA 1SHMA 2OK0H 3OZ9L 1FFPA 1XF1A 2AJUL 3PWVA 5ISZA 3QHTC 1DBMH 1N8ZA 1WAAF 1JHKH 3SPVA 5F96L 3WLBB 5D2NC 4OLZH 1S7RB 2F54D 3TT1H 3TM6A 3BZDA 4GKZA 3UCRA 2FB4H 4W81A 2VXQH 3MXVH 5I73B 2W91A 3UDWC 5I8CB 3MUZ1 1TTGA 4WHTA 3JV5A 2NLJA 2RCSL 1FL3A 5GS1A 2X4NB 2R9HC 5ACZA 1CL7H 5HSFA 1SY6L 1QLFB 1UKQA 1JHLL 3VXQA 1EUUA 3IT8D 3OXRB 1U8OA 4OV6F 4WEBL 1LEIB 5C08A 4D9LL 3OB0K 3T65A 4GAFB 1XGTB 3W5MA 4UAOC 4W70A 2NY0B 4I18B 3FB5B 4PJEE 4PJAE 2DQGH 4KQ4H 4GRLA 4KAQL 4ERSL 1F4XH 1A8JH 3IFOA 5EFIB 1ZLVK 1PG7L 3I02B 1JF6A 1PG7X 4KJPC 4PRBB 3TVMB 3ZDXF 3HNSH 2VXUL 3CZFB 4GQ9H 2M8XA 2CSPA 3DGGB 2F5BH 4U1KB 3MRRA 5I71C 1ZOXA 4JPVH 3VRLF 2HLFD 4ODWA 4R2GC 4CVXB 2QHRH 5M7QA 3MCLH 3KLAA 2C3VA 1D5XA 5EULV 2VDQH 1GGIL 1MCDA 3PHQB 4HD9A 4RBPH 1LP9E 1I9JH 1R3JB 2CGRH 5GIRB 2AI0L 4UT6L 3OAZK 3AS3A 4WI5A 5A3ID 3CUPA 4X7CC 4K2UL 4TTDD 1G9EA 2YK1L 2XXMB 4YHNB 1YEHH 2I27N 4TNWF 4DZBB 1QA9A 1LNUB 2BSSB 1YUHA 4YHZL 1NFDB 3RJDA 1JGDB 1Q9OB 1ZVHA 3L9RA 4G8FB 4XCYA 3LEYH 5FYJH 2AV7A 4TUJB 4XI5C 4AEIL 4MQSB 1NFIA 1KIPB 2DM7A 5ESQB 3VW3H 5IM7B 1CE1L 5C0CE 2DLTA 5IFJA 5DT1L 3IXAA 2OP4H 3GMNB 2HJFA 3MV7B 2OLDA 4KMTH 5HGGS 3MRHB 5DO2D 3E8UH 1N2RA 5C92A 4JCMA 1EAPA 2XTLA 3MJ8A 1H3PL 4A6YA 4ZFOL 3PWPB 4HC1L 5D2NA 3L3IA 5E08L 1PVHA 4CU8A 3EYOB 4KJWC 3TA3D 4ZPTA 1EERB 4ZMAT 1CDJA 1BFVL 1K3IA 5DK2B 3VGEA 5MENA 4ONGL 1SBSH 4DN3H 4UU9A 5KVDH 2VLJD 4ENEC 1F97A 2FATL 2NMSA 1Q9LB 2GYSA 3V5KA 2PXYB 2EDEA 1M7IA 1JF1B 1I85A 4TNVF 2MHAA 6FABL 5J3HC 4HS8H 4B7LA 4PB9L 1Z9LA 4HXAH 1HZHL 1J1OH 1NCWL 2YUZA 3ARSA 1HYRC 1Q1JL 2YUVA 3QEQD 4U05A 4LLDB 4DKAA 5ITBH 1S9WA 1MCKA 1NKRA 2J2ZA 2HT3C 3QRGL 4ZUWA 1HK6A 3VWKB 2DLFL 2A77H 3IS0X 4JFZL 4M6ML 4TQEL 4JPIB 1FCCA 4GRMB 2H41A 5JNYB 1FVCA 2X4RB 2JCCB 5D1QC 1EHLH 5CINL 1P4IH 3D39D 3VFPA 1QYGH 3MO1B 4UOW1 4NQVA 5KN5B 2NW3A 1UCBH 3GBML 3HG1D 2OI9C 2Y7QB 2X1QA 3B3IA 5CCKH 3IFLH 4HS6A 4R7DA 3GHBL 1ZS8A 1AO7B 4JGUA 3QO0B 1JGVH 4ISVA 1QVOA 3OWEA 3WIIH 4JQIH 2YWYA 5LBSL 4PV9B 3VRJA 4PP1D 3O2WH 4DZ8A 1I7TB 2IMNA 1PYWA 4YNYB 4UTAH 4KKLD 1X5GA 5DD3H 1GGBL 1JWMB 5E8EA 4HIJB 1VFAB 2XTJC 1RJYB 5FGSA 4ODTH 1WISA 3UX9B 1TMCB 3N50A 4UQ3B 3BISA 3O6FC 1RK0B 2DMBA 3QDGA 4HWBA 2OMBA 1YECL 1HWHB 5HHMD 4QWWC 5E24E 1A7BA 2W9EH 4WTZG 5E5RB 1VFBA 3HR5B 2VXVL 1M7DB 4HGWB 3EYUH 4MNHA 1P2CB 3MJ7B 4OCYH 1QACA 1JNNH 1GHFL 3KYAA 4MD4A 1BD2B 1NBYA 1X5XA 2HJKB 2FGZA 5HHNA 3VI4E 3GMLA 4R4ND 1U36A 1JPTH 3UTZB 4YK4C 1JNHB 1KLUB 5AWNH 3BMWA 4B41A 3FQRB 3BD4A 1U0QA 1YEIH 4M8QA 2G75A 2B1AH 4ZOAA 2R1YA 1TXKA 1U92B 2VLJE 4S0SD 5DMGC 4KGLA 4I77L 3S35H 4G7YH 2X4TA 3U0PB 4HIIB 3RWFB 2V5MA 4I0PA 5SWSB 3GMMB 2D31B 1KTLA 1ZGLM 2ORBL 3BX7C 1TLKA 3STLB 3RBGA 5T1DH 1U2CA 5I73C 1CDBA 4N0CD 4A2LA 2Q3AA 3P4MB 5F70A 4HV8A 4NRZA 3KS0H 4WO4D 2ICWJ 4NKQB 3ZYZA 3U1SH 3PABA 3MRLA 4UV4L 4ZO7A 1NMBL 3MRFB 3O4LD 1KSRA 3ARQA 4GBXD 4PPTA 1E6JL 3SJVA 5J6GB 3IJHA 4HKZA 3D39E 3B2VH 3VMPA 1NAKH 3WFBH 3L5IA 3RIAK 2WUCL 3GI9L 2QLVB 2IWGA 1KXTB 4KTEL 2NY0C 4I18C 3K1DA 5FOJA 3V4PH 5ANME 4JN2B 3V2AR 4G8GA 4H26A 1MIEL 4OLUH 3UJIL 4HT1L 5HI3D 2ICES 1SEQL 3TVMC 5IB4A 1R5VA 3BZFB 1JGLL 4PJIA 3PGDA 1ZHKB 4PB0H 4MXWH 2XWBA 2PETA 3RKDD 2YA0A 5GJTL 4JCLA 4RDQG 4JRYB 4EQ2A 3DTXB 3MX0A 4BZ2H 4UV7H 3BIAX 3VFWA 1GH7A 3L3DB 2EDWA 2OR7A 4H1LH 3G5XB 4HUXB 2RGSA 2EE2A 1LQSR 2BZDA 3MR9B 4AG4H 4K9EC 4AL8L 1MHCB 3P3YA 5IT2H 3GMQB 3MOBH 2ID5A 5AUMA 4ELMB 1BFSA 1G9MH 1CXLA 1S9VA 2IFFH 5J89A 4FG6D 2CDFB 4TOYL 4MZ3A 2QHLA 3QT2A 4ZO6A 4HUUA 3BPOB 2E7LA 5E8DH 5F93C 3GJFH 3NFNA 5C0EA 5BRZD 2NYYC 1DDHB 5D7IE 1RVFH 1V8HA 4J3SA 1QEWB 3BD5A 5DQDL 3OR6A 3PWLB 5IUSA 3QRFM 4OZ4A 1YYLL 1CIUA 1DBKH 1S7RA 3VXOB 4EQ3A 1JZ2A 4HWZB 1FJ1B 2R0LL 2HFGL 2NPLX 1ADQL 5I8KH 2OCFD 5AAWA 2MSPA 1EUTA 1HHJB 2H32B 3ISWA 5I8CA 1W8NA 2X4QB 2CRYA 3UPCA 1JMZA 2PXYC 3RWIB 5D6CA 5EIQA 1P84J 2BSED 1INQB 1A6PA 3TYGL 4KKAD 4JO4L 2W9DH 1HHIB 1LEIA 2DKMA 1QZ1A 1UWEH 1QBML 5HPMB 1XF4A 1HIML 4XXCA 3UJTH 3X14A 5FO8A 1XGTA 1J8HE 3VWKC 3FO0H 1M1SA 4I18A 3O4LE 1S7XB 4NQED 2LE9A 4HGKC 4AM0B 3EYVB 1H3GA 4OCRL 2DQIH 2R29H 4X4ZA 5C86A 4PLJD 2J8UE 4ZDHA 1RHFA 3BKJH 1QBAA 5EFIA 4PRBA 3TVMA 5DFVD 5EZJB 3V0VA 1BVKA 3AS0A 3CZFA 3DV6A 1Q72L 3V9FA 3DGGA 3HNVL 4O4YH 3FMGH 4U1KA 4ODSH 4NRYB 5IQ7H 1AD0A 3KLHC 1NPUA 4CVXA 3KPMB 1RIHH 3G9VA 2H2PC 2QQLH 3PHQA 1EFQA 2QR0B 3MGAA 5GIRA 3BD3A 4YDKH 3T2QA 4XPTL 2Q8BH 5BMFL 1AE6H 4QY8A 3S34L 4YHNA 1URLA 4JREB 5CWSB 2RAMA 4LLVB 3V8OA 4MLSA 3BPCB 1FVEB 1NFDA 1Q9OA 3RI5K 4G8FA 3B8YA 3VCLB 3PGFH 1U3JA 2Y07L 4MA1B 4U1MA 3WS6A 4TUJA 4E41B 3TBWB 1TITA 4KRLB 4L4TD 1KIPA 3O3UN 4XB7A 4AIZA 4Z76B 5TDOB 2E3VA 1D3CA 1I8KA 3QDJD 1IM9D 2A9MH 4MNQD 3ARRA 5AZ2L 4OZHB 2FX8L 3WFCL 1RUPL 3GMNA 3MV7A 1R3LB 1UACH 2DQDL 3MRHA 5JR1H 3VI3F 3HNTL 2NR6D 4Q6IB 3UTSB 2VN4A 3HMXH 1WITA 2BHZA 3Q6FA 4L3AA 1CXKA 3DXAB 5BRZE 1OAUL 3EYOA 1CR9L 2I9LB 2DMKA 4GG8B 1WIPA 1RUKH 5DR5L 4LCIL 1K6QL 5F3BB 5D4QA 5KSUB 3KAAA 3MMEA 1JGUL 3DETD 5EORL 1MAKA 5CGYD 1CD1B 1OCWH 4NM8H 1Q9LA 4QT5B 4KHTH 1T7XA 1IZKA 1JF1A 1NGQH 1G9NC 4V1DB 4Y0GA 3GSWB 3CC5B 5I0DA 4XZUA 5ICZB 4G5ZH 3STZB 2EC9U 2KZWA 2ZNXA 1OSPH 2VYRE 2F54B 3QB7C 1IRAY 2A6KA 3QCVH 5JHDA 1N26A 4JPIA 1I1AB 4YQXH 2EYTB 5JNYA 1PY9A 1FL6A 3M8OL 2EXWD 2X4RA 4FQIH 4WWKA 2JCCA 2CR3A 4FQQB 4NQDE 4PJIF 4LP4A 1MREH 5DD6B 2ZG1A 2X9WA 1S7SB 3U83A 4DN4H 4CNIB 5FYLD 3RUGA 3RTQD 4WV1B 5KN5A 2VDMH 1XT5A 1SJHB 5JZ7C 3SDXA 2Y7QA 1DCLA 2FEEI 3BAEL 3ULSB 3K2UL 1TJIH 5I6XB 3TV3L 5KW9H 3PQYA 5EBWB 1AO7A 2Z8VC 1N6QL 1IGJA 3UZQA 3GHEH 4KKCD 5IVZB 5SX5K 3ZE1E 1I7TA 2NY1B 3INUH 4YNYA 1CFVL 3FFCD 4K7PL 4K7PX 3I50L 3QULA 5GGSB 3BP5B 3SE8L 3CK0L 4KKBD 1QFUL 4ZUTB 1W0YT 2IGFL 2DI9A 3KYKH 2DAVA 3U6RB 5E4EB 4U1LB 5DHXB 4KPHH 1RJYA 1BJ8A 5MEPB 1QD0A 4DTGH 3TO4D 2CIIB 4GXVH 5IBUB 2DL9A 3PDOB 2JB5L 5F9WB 1GOFA 3FAWA 3X17A 5JIIA 4K23H 4YBQD 5CILH 4CU7A 4L4TE 1ERNA 1QSFA 4NHUB 4XGZA 3U46A 3QEGL 5CAYB 5C0FB 2GI7A 1OAQL 1AXIB 3QDJE 4RCAA 4Y5VB 1U8JB 3HR5A 4U49A 5DUPL 5HDBF 2GITA 3U9PH 5ADPL 1MCNA 4X80H 4WTXA 3MJ7A 4K7PY 1EX0A 1A2YB 1T1ZA 1BD2A 1LE5B 1FRGH 3REVA 1A1OB 2HJKA 3BI9X 3BPOC 2R15A 1MI5B 4FZ8L 3O8XB 1YQVL 1FGVL 4NO2B 2CKNA 1A6TB 3UTZA 4MA8L 1FYTD 5E6IB 1S7VB 3FQRA 1TJGH 2GT9A 3IYLW 3QA3B 1OP9A 2ENYA 2HT2C 3B6SB 4KTDH 1U92A 1BZQK 3NCJH 2E7MA 4NBXB 1DBAH 5BJTB 4PTUB 5D7JA 5DQ9B 3BYTA 4OGAC 4POUB 4PRAB 4HIIA 1CFBA 3RWFA 3SGDI 1R5WB 3U0PA 5EZIL 4Y4KD 3TA3B 2AXJA 2PTVA 1GOGA 2D31A 4WFED 5TFSH 4GAGH 3U4AA 1RHHB 5GGRB 5GRXG 4X6BB 2BK8A 3SEPA 4Z7WE 1ULVA 4UIMB 5FA4A 4AY0A 1MCFA 4R7NB 3TJHC 5JUEL 2GJZB 1C7TA 3HC4H 4XNUL 5L8KB 1MNUH 4HX1B 5HYIA 1CDCA 1ITCA 1WCQA 2PYFA 2PW1B 2A1WH 5CJOH 3MSPA 4FFZH 1MJJB 1ORSB 1FZMA 3KYMB 5BW7C 2DYPD 4EOWH 2GUOB 1NFDF 2CKBH 4P2QA 3HMWH 1KCSL 5E2UH 5IB2B 1MCJA 5DUML 3BZFA 2XQYG 1JI2A 4WHYG 4OZIE 4XVUD 3VXUB 1A7RL 1HXMB 1S5IH 4KRPC 3TT3L 3H3PL 4GUPB 1ZHKA 3VXME 5L6YL 3CFKA 4QOKB 4OAWB 4ORZC 1EDQA 3ORJA 2GSGB 3ARBC 3DTXA 4RWYL 4TSAL 5IEHA 3BKMH 5INDA 4NOBA 2WK2A 4JREC 4PLKC 5HYFA 1OTTD 4OM0H 1MHCA 4JHWH 4RMRA 3FB6B 4OBSA 5KTEL 5HJ3B 1DTUA 4K3JL 4MA1C 4KV5E 4ELMA 3U0WL 5KSAD 4ODVH 3B9DA 5GS0D 4XCCH 1AJ7L 2Q86A 3VMOA 4BZ1H 5BS0D 1RQ5A 4FQHB 2DQEH 4M3JA 2IG2L 4NO5B 2XY2A 5HI5D 4I4WB 5T1MA 1D5BB 5F3HA 2YD4A 1DDHA 1BQLH 3IFNH 1AXTL 1LWRA 1RZGB 2ADIB 3QCTH 4MXQD 3ZT6A 5HHMB 4KZEL 2QADD 2XKUA 4XWGL 2UUDH 4WCYH 1FYTE 3I9GL 3THML 4FQCH 3VXOA 4D0DB 4IM8A 1FJ1A 1NANI 2JCCF 3H7BB 1JNLL 2X1XR 3KPOA 4YXHL 4Y19A 5EZOH 2FNBA 5DZOA 4TVPH 4NYLB 2H32A 3K74B 3ZHDA 3EDEA 3EYSL 4LLMB 5TJWK 5FYJE 3RWIA 3MBXL 3VD3A 2ESVB 3ZO0A 3MRCB 4QRTB 1BEYL 2QQNH 3IU3B 4HPYL 1INQA 1VCAA 3DVGA 1HHIA 4HMCA 1MRCH 3M07A 4QNPF 4APQB 4O5LH 2P8MB 1F4WL 1QRNA 5DRWB 3MRQB 2OK0L 4UDUB 1G7JB 5BW7A 1S7XA 3SDDD 3C5SB 4S1RH 4M7KL 2AJVH 4FFWD 3EYVA 4ETYA 1JHKL 2KH2B 4NO0B 1MFDH 4KZDL 5D7LB 4YHLH 4WV1C 4I1NB 3MXVL 4WHCA 1CXEA 4GBXB 4MA7H 1OP3H 5I6XC 5HGAA 1CL7L 3JTTA 1UH3A 1P9MC 15C8H 1HYSC 3TH2T 5L8JB 4XBEH 5I1IH 2NY1C 1N7ML 2NY5C 5FDYA 3QI9B 4MS8C 4LASH 5CWSA 3WKMH 3BN9C 4LLVA 2R56H 3LPGA 2EC9T 3BPCA 2HFEB 3S9DB 5F9OH 4QHNB 1KEGH 5HGHB 3VCLA 4NSKB 3O6KH 5E4EC 2EDFA 5FO7A 4KDWA 2JKXA 5DK0A 4KQ4L 1MWAL 3V7MA 4Z76A 4LLYA 5TDOA 5DHVB 2E8YA 3AMLA 3C9NB 2NY6D 5F9WC 4MHHI 1EEZB 2F5BL 4PJCA 5T3ZH 4JPVL 1E28B 1KN2H 3HS0B 4JQXC 4YIQA 5AZEL 3MC0A 1NCNA 5JW3L 5A3IC 2CDEA 3MCLL 4OD1H 4RAHA 1IC4L 2HMID 4Q6IA 3UTSA 3GGWB 4PBXA 4YHKL 5BS0E 4Y5VC 1GPOH 5DS8A 2I9TB 1T3FB 1EIBA 2NXYD 4POZC 3OB8A 5BCAA 5LQBL 3DXAA 2EEBA 1ZANL 1RD6A 2I9LA 1U93A 2RB8A 2C7UB 4GG8A 1YEHL 5E5UB 5F3BA 3LN4B 3ARDD 5FGCB 4R90L 4F2MB 4OT1H 4QT5A 2QBWA 5E6IC 5FYJL 4JKLA 5FECB 4NNPH 2QSTA 4V1DA 3GSWA 4ZFFB 1GC1L 3CC5A 1L7IH 5GSRB 4PGBA 2R4SH 4XP1H 3IGAB 2YD7A 1K4DB 1WZLA 4PJ8A 3STZA 2K7PA 3BIBX 4JFEB 4TRPH 4KMTL 4GLRI 2BX5A 5E03A 3TA3C 4L5FH 1I1AA 4LLUB 5HTSA 4PV8B 3WD5L 4LSRL 1FZOA 3UTPE 2AK4E 2XZZA 1RV6X 4FQQA 4QHUB 5DD6A 3OKDB 1HILB 3CSYB 2UWEE 1S7SA 5EBMA 4PJ7B 1CTNA 2FX7L 1MH5A 3WN5B 1FG2B 4NZDA 1SVZA 4JZOB 4WV1A 5SWZB 3MGOB 1EXUA 1SBSL 4KFZC 3O3DB 1X5KA 2JB6A 2WBJB 1JFQH 3ULSA 5EBWA 3A0OA 3HZMB 2Z8WC 3PV7A 3T0AA 3F5WA 4NUJB 5IJVA 1P9MA 3LIZL 1JBJA 3DRTB 4HDIA 3TZVA 5IVZA 3U7AA 3RX5A 4M1CD 4ESKA 4ELMF 1WBYB 3QUZD 4ZUTA 5F1SA 5ITBL 1C5CH 1KXQE 2A77L 5EOTB 4U1LA 4NNXB 3MLZH 5IB5B 1LK3H 1U3YA 1RZ8B 2GTZA 2PYED 2B1HH 1P4IL 5KSVB 2Y5EA 1QYGL 3MV9B 5DVNA 5GRYA 3BGFC 1NL0H 1UG9A 1HNFA 4G42A 1UCBL 4PP1C 5IHUH 4BM7A 3JSSA 1AGDB 1PQZB 3IFLL 4M02A 3IDNB 2HVJB 2DQJH 2GJ6D 1JGVL 4PY7B 3WIIL 4JQIL 4KKLC 3V4VL 1RURH 3DPBA 4N8CH 3BW9B 1BWWA 3D25A 3ME0A 4S1DD 2ERJB 1WWWX 3C8HA 4UTAL 4F80A 5EUOB 1A1OA 5CP7B 1P5VA 4X6EA 5C6PB 4PYGA 1GZPB 3O8XA 2XWTB 4NO2A 2IEPA 4JFOB 2DLHA 2JLLA 1S7VA 3WDJA 3UJJH 3LHPH 3UTTD 4J3VA 1EFXB 2G9HB 2UYLB 3H9HA 3VU2A 3QA3A 2HKHH 3B6SA 3LN9A 1MCRA 3L3JB 3GSRB 1CVSC 4KXZI 3RNQB 2BNRA 4PTUA 3BDYH 4PRAA 4JQVC 1R5WA 4WI2A 5JHLL 4U1IA 4NPYB 5GQBA 3LS4L 2VLKE 5GGRA 2XI9A 2NXZD 3V5HB 4X6BA 3R8BB 2EE3A 2L0DA 1I3RA 4UIMA 1GGCH 4B0MM 1KG0B 1CDYA 1G7HB 4R4NC 3LN5B 1JNNL 3OKNB 3C60B 2GJZA 1FLRL 4GAJL 1I3VA 2PW1A 1DQDH 5MP6H 3RWDB 5FUCC 4APQC 4HMEA 3BZEB 1YEIL 5D1XD 1C12A 5D93B 3MJ6A 5A1AA 4U3XA 5IBLD 3V4UL 5DRXB 4C55A 2GUOA 1S9KC 1V5JA 5EIVA 2RIKA 2YN3A 5IB2A 3I2CH 3S35L 3QPXL 3S35X 3VGHA 2C3HA 1WTGT 2EO1A 4OI8A 4PRDA 2EZ0D 3V6OE 5I75B 3VXUA 4F7PA 1TETL 4GUPA 2YUWA 3QUXA 1CZ8H 5I76B 4QOKA 3P30H 4GBXC 4QO1A 1LILA 2E7HA 2IPTH 2YEZB 5FHAL 1S5HA 3F12B 1AFVH 2H6PA 4OUUB 2VUOA 2H1PH 4NQXA 5BZDB 5DF0A 2X89A 5HHOB 5HYJD 4JG1H 3QI9C 2PYEE 2HAZA 3QUYD 3I6KA 3ET9F 3WFBL 4BK4A 5HXMA 3PL6D 4I48B 5HJ3A 4F57H 4E42B 4XAKD 2DQHH 1WZMA 2JK5B 3IU4L 2VABB 2GJ6E 4OLUL 4RGNB 2LABA 3DX6B 4J6RL 1DL7L 3RKDC 5EOCL 4ODHH 3RGVB 5DJXB 1Q94B 1RZKL 1D7FA 3VFUB 4JPKL 1N6UA 4MHHG 3DVNB 1D5BA 4KJQD 3ZTNH 1FIGH 3VXRE 4PB0L 1RZGA 2ADIA 1MJ7L 4MAYD 1TCRA 4ZUVA 1G1YA 2C26A 5GZND 2DDQH 3B9KA 2BVOB 3UBXI 3UTTE 4AEEA 2PTTB 4UZGA 4PLNC 4FTVD 3TFKD 1XCTB 3H7BA 3ECBB 4FG6C 2E8ZA 4HEPG 4EIZC 5IT2L 3AMKA 5ETUB 1ZA6B 1HCFX 3A67H 4ZUSA 4LLMA 4O02H 5F9AC 3BEVB 2ESVA 4V2CB 5TE4L 3MRCA 4QRTA 2X10A 1MVFA 3MNWA 4XP5L 4RDQF 2VERN 3LMJH 4EN3B 4LSTL 1IEHA 3DUHA 4YWGH 5JLZA 5E8DL 4YFLI 2PKDA 5GRZA 4APQA 2P8MA 5KSBE 1KN4H 4KK6D 4XNXL 3MRQA 5DRWA 1XR8A 4UDUA 1G7JA 3C5SA 2V2TA 5HI4D 2HLAB 4IRZL 1A14L 3CX5K 4MCZB 1UYWL 1DBKL 5AYUH 2P43B 4P5MA 4YLQT 4NO0A 5IIEB 3GBLA 4LQFH 3WN5C 1E4KA 1QLRB 5D7LA 1EMTH 4XP6H 5I8KL 4ZAKD 1GJIA 1RJZB 4PS4H 1IC5H 4KU1A 2VZOA 5C07B 1N4XH 4OQTA 3RBSA 4YE4L 4OTXL 4G80A 3ESVF 4S1QL 2DYPB 4P3CH 2W9DL 4UQ2A 1I7ZB 2JJUA 3SDYL 3U48A 2LTQB 5E6YA 4QHNA 4QXTB 5HGHA 5ELIA 5DFVC 4NSKA 4ZTOL 5B39A 5DJYB 5HYJE 1UFUA 3P9LA 1YEGH 2DQIL 4PJBE 3ARWA 1JPST 2CD0A 2WM0A 3BKJL 2XN9D 2AW2A 3C9NA 4HH8A 4BH8A 1KCRL 2VLRD 1LO3L 4TUOA 4O4YL 1IAOB 3B83A 1ACYL 1E28A 2AJXH 3HS0A 5IQ7L 2BRRH 2CO6B 1HSBA 1KELH 4KRMB 4U6YB 3O45A 1PGRB 3GGWA 2ZNWA 2D2OA 2XT1B 4R4FH 1QUNA 1T3FA 3DHJA 4YDKL 3IXTB 2ZSVB 1ZEAL 4RBPK 2C7UA 2ERJC 1JPSH 4ZNCD 3KJ6H 3LN4A 2MNUA 5ICXB 1MPAL 4F37F 3FQXB 4P23B 5F7DB 1TZIB 2QTEA 4HQQL 1MCQA 1TCMA 4PG9B 4FTVE 3G6JB 3HUJE 4J2XA 5IWLC 3MCKB 4Y4FA 5FECA 3M45A 1F13A 1MY7A 2IMMA 2P5WA 3L3KB 2WQ8A 4ZFFA 4Y88A 1INEH 4MJ6B 3HE7A 4OCLC 4AIXA 2X1WL 4HLZG 4O2EB 3MRMB 2JIXD 3FAXA 4JFEA 4PJXA 3HAEG 2IPKB 4XMKH 2NQCA 3O2DH 4RMUA 2XV6B 3TC9A 2XNAB 1U8PB 3H3KA 4PV8A 4RZCB 2OX5A 4WTWA 1OLLA 3D2UB 3BP7B 3D9AH 4NDMA 4QHUA 1IGCL 3OKDA 5JW5B 1HILA 5D9SB 3DWTA 3WN5A 3C60C 2P45B 4U6VL 2N56A 1FORL 5SWZA 3L5WA 3MGOA 3QXDB 4JFDE 4C54A 3IAGC 3O3DA 3U36B 5HY9B 2WBJA 3QUKB 3QYCA 3HZMA 4KHTL 4CDGC 4UINH 5L2KB 1VACB 3KLDA 5D93C 1JWUA 2A73A 2J1KA 2X09A 5IG7B 2DOCA 3SDDB 2OJZH 2HP4A 4G5ZL 3D85B 3VFSB 3IDGB 2VWEC 1TPXB 4R8WL 3DMMA 5EOTA 5I75C 1WCBA 3QCVL 4NNXA 1DE4B 2BVTA 3PUCA 4HF5H 4YQXL 4U1HB 2BCKA 3NCEB 1LHZA 2P8PB 3TESA 1F4AA 3A6OA 5KSVA 4DN4L 4B5EA 3E2HB 1I4FA 1T6WA 3TN0D 1C1EH 3QSKB 2VDML 4KKCC 4M7LT 1NAMB 2ZJSH 3MGTB 3Q6GH 4PJ5E 1RZIB 3D6GA 3NABH 2XN9E 5HGDB 3SE3A 1PQZA 3IDNA 2HVJA 4L3EB 2VLRE 3DJ9A 4KKBC 4PY7A 4MXVE 4N0RA 4PRHB 3GHEL 3BW9A 4LRNH 3VD5A 5E7FA 3C5JB 4AQOA 3INUL 4XNQB 4KVCH 3OF6A 1WIOA 5CEZH 5KOMC 3TO4C 3L95B 5EUOA 5DGRA 5CP7A 2HH0L 3RGVC 2YN5A 2NY6B 3KYKL 2NTSP 2XWTA 5HHPB 4M7LH 4JFOA 1UVQB 2A6JB 4JRXB 4YBQC 2IQAA 1J0JA 5GRJH 1LO2L 4GXVL 1EFXA 2CR6A 2G9HA 5D2LA 2UYLA 1JNJA 2KKQA 5IESL 3L3JA 1JTTA 4NKIH 4NFCA 1DLHB 3RNQA 5JIKA 1MFAL 1VDGA 1KIUA 2MQCA 1Q9KB 4LMQI 2JELH 4P46D 5B22A 3ARDB 5DWUH 3BN3B 1AQKL 3PHOA 3U9PL 3LS5H 5I74B 1KG0A 4X80L 3NCBB 5LWYH 5GSVB 1ZTXH 1FRGL 1HDMB 3GSNA 4EN3C 1U95A 4FXGB 1P4LA 1KEML 3RWJB 2AXGB 4JGMA 1A6AA 5IB1B 2Q8AL 3RWDA 3LY6A 3S3PA 2QEJA 1IC1A 1U58B 5BO1H 3BZEA 2BY0A 1PG7W 4R97B 2OZ4L 3TPKA 5DRXA 3BQUA 3PF2A 3VGAB 2P49B 3K0WA 5ITFB 5CSGA 2E5EA 5K9OB 3FRPG 1XF2B 4P4KA 3L7EA 1T80A 3QDMD 5GRVL 1JWSB 4R26H 2LAGB 1CFTB 1PZ5B 4TVPE 5I76A 3IKKA 1U3HD 2YEZA 3F12A 4H5SB 4MNGE 5TE7H 3UAJC 5BZDA 2V17H 1ZVSB 3HC4L 4NKOB 4BSWA 1K8DB 4KJYB 2YPLD 3T8XB 4L8DA 5CJOL 2V9RA 1U91B 3RY5A 5DA0B 3VFVA 1X5HA 1BMGA 1BIIA 4CN6A 4I48A 3RZCD 4E42A 1NEZA 4EOWL 1RUML 4XVUC 2CKBL 2JK5A 3HMWL 3NN8B 5E2UL 1CN4A 1W72B 1OGAB 3ARGD 3PGCB 1J5OH 1KJ3L 3F65A 4LCUB 3RGVA 3OGCB 5DJXA 4NN5B 4LCYB 1F8TH 3VFUA 1BJMA 2V9TA 5KANI 3WIHA 3DVNA 5DRZA 4KI5E 1XGYL 4M9PA 5IJKC 4LMQE 1D5MA 4ZFOB 3K2MC 3SGEH 3FJTA 1CU4H 4PJXF 1OTTC 5C0DB 5DA4A 1IGIH 1YEFH 2BVOA 1QHPA 3BKML 4P9HC 3HAEB 4NHCH 5HGBB 1JK8B 5C0RH 4XCFL 1FGNL 1AD9B 3ECBA 4I13B 4JHWL 1Z2KA 1S3KL 4P23C 4P5TB 3EOAA 1G0YR 3O3AA 5GS0C 4H8WC 3RGHA 1ZA6A 2GTWB 4HKJB 3WKNA 4D0BA 5HI5C 4TTGA 1T5XB 4WY7H 4XCCL 3A6CL 4EN3A 4BZ1L 5DC9B 3GK8H 2DQEL 2WIIA 1OARH 1DBBH 4PRIE 1DQLH 2BOBB 4PJAB 5T3ZE 1QHOA 4AJ0A 1DQML 1BQLL 1FV1B 1ZKAA 5CJQL 3QCTL 4DWHA 2J6EA 5HD8C 2VC2H 3GJFK 3T2NH 5JXAL 2HLAA 4MCZA 4LU5L 5IEKB 3NPSB 1I1CA 3ARTA 4LSVL 4FQCL 2EDHA 3O6LL 4QRPA 1QLRA 1OD9A 1PKOA 3QIBD 5E8OB 5E2JA 4TVPL 3RL1B 1YMMB 5CGTA 4XPGH 5EA0H 1RJZA 3S3SA 5HVHB 4H88H 4KUCF 1FAKT 3DHMA 3GJEB 3SOBH 1MFCH 3BH9A 5KVGL 5CMAB 3UEZA 4Z0BH 5GGVL 2LQRA 3SDDC 4G7VH 5EO1B 3QXVA 1IKFH 2DMCA 4JY4A 1H0DB 1I7ZA 4MJIE 1ZWIA 3ARZA 1TPXC 4QXTA 1ES0A 1MQKH 2D03H 5I0ZA 2EYRB 5TF1H 4YDVA 5K59E 5EUOF 2AJVL 3AXLB 1HN1A 1U9KA 1K4CB 4XXDA 4EI5D 4R3SB 2ILLA 4LL9A 1KTRL 3W0WA 1CFSB 4XBPB 3E2HC 1MFDL 4NJAH 1IAOA 2R8SL 5E9DD 2P24B 2ED8A 3H8NA 3R06B 4FQ1L 5IJKA 2Q7YA 4MA7L 1R5IB 1WBXB 1LD9B 1VEMA 3QUYB 1K8IB 4S1SH 3UROR 4X83A 2VSDA 1MHPH 3FB8B 3IXTA 3WXVL 5C6TH 1MCEA 5GGVY 5I1IL 1YEKL 2Q76B 5T5NG 3VFNA 3WKML 4HW6A 5DRNB 3MQIA 1H3UA 5ICXA 3P11H 1AIFB 5F7DA 4ZS7L 3MBEA 5F9OL 5B4MD 3QXWA 2NY6C 4PG9A 4AYFA 5FGBC 1P1ZB 3G6JA 3TNNB 3RA7H 4U6XB 3MCG1 3MLUH 1NQBA 5CHNB 1VFOA 1L9MA 5C2BH 4JB9L 4LGSB 2HMIC 1ZHLB 3PXHA 2CLVB 3ZKSD 4FN0A 2VE6B 2ED9A 2NXYC 5T3ZL 1KN2L 1RIVL 2KUTA 2IPKA 1IARB 3C08H 5E00B 4OD1L 2XNAA 3DV4A 2AXHA 4IMKA 4RZCA 4Z78B 3ARDC 1GPOL 3D2UA 2XZAH 4XB8A 3BP7A 3QH3B 3HCVB 5ILTL 1Q9WB 5JW5A 1UWGL 2VKXA 4OCSL 5I74C 3ZE0E 3MJGX 3DYOA 3OTTA 5D9SA 1QBBA 1A21A 3RVVD 4X7SL 1XGQA 3QXDA 5E2WH 3QUKA 1WVZA 3C2AH 3OG4B 1N64H 4JRWA 1FPTH 5L2KA 4LVNB 2R23A 4ZQKB 3D0LA 4R97C 1CGTA 5C9KA 2R4SL 5IG7A 5JQ6L 1CLYH 1G6RL 4OF7A 3D85A 3VFSA 2AQ1A 4LSSL 4HGMA 5I1GL 4YPJA 3L3OB 1T20B 2CO7B 3OBAA 4L5FL 1DE4A 1QSZA 4RMWA 3UO1H 3C5ZA 2AERT 4PY8I 3ZDZF 4ZAKB 2P8PA 1NCBH 7FABL 1CGUA 1CICD 1SYSB 3DO7B 5GISL 1F3RB 2VZTA 1P5UA 5GGTH 2ZSWB 3AVEA 4POYA 1BP3B 1E27A 4HK3N 1NAMA 3MGTA 4EVNA 1RZIA 2DJSA 4XRCB 4IOSD 5A2KH 1PKQE 1AGCB 4PRHA 5E9DE 3L5JA 3SDAB 3C5JA 3KPRB 5D70H 2VKWA 4XNQA 5DDHB 3O0RH 2VO5A 4N90D 4OFYA 3FRUB 4Y1AA 4LARL 4I3RH 2L7UA 4TSCH 5D7SH 5DD5L 4D2NA 3L95A 1VA9A 2DL2A 3QISA 4X5XB 1C5CL 5GHWL 3QHFH 4NQTA 2A2QT 1AKJB 2W0KA 4KDVA 4NZUH 3T4AB 1UVQA 1UADC 1FN4B 3MNVA 2A6JA 4JRXA 3CXDL 5DVOA 3Q5TA 4L4VD 3L3HB 2DM2A 5KANG 4MSWA 3BJ91 2ZOLB 3BOVA 4YDJB 1YDPB 3RDTD 1T66C 4O2CA 1CVRA 4XBGB 1NL0L 5DSCB 1HHGB 3VXPB 2EIDA 4JKMA 5ADOH 1Q9KA 4M8VA 4F9PC 4OB5H 4S1DC 1E4WL 4YC2B 4F7TB 3U4EB 4P5TC 3PIQB 2YD9A 1JZ5A 1RURL 3LRSB 4N8CL 4X9IA 4PGJA 1SY6A 3EFFB 3M1BB 5CJXC 4NGHH 4WUKL 4D8PB 1A4KA 3LSOB 5IHZB 4H0IA 3WJJC 25C8H 5GSVA 3B2UD 2Q7NA 4K9EH 3RWJA 2AXGA 4X6DB 4YAQA 1WAAE 5IB1A 4Y4HB 3HPLB 5JOEA 2UZIH 2JTDA 5KVEH 2E6PA 3KVQA 3AREA 1OAZH 3OKEB 2LAAA 5ITFA 1YJDC 5IBTH 1IEAB 3NPSC 1XF2A 3MA9L 2F58H 2XA8H 5FYKU 2YUXA 1A0QH 4IS6A 2WLZA 1JWSA 3SO5A 3EO9H 1O0VA 1PZ5A 2AXFB 4BA8A 1B9ZA 5HVHC 1AHWB 1G6VK 1GGCL 4X6CB 3VWJA 1FBIH 2EH7L 4RMVA 4C57C 4N68A 4NKOA 4MQTB 3VFTB 2WUBH 1YEEH 1K8DA 2ZG3A 3T8XA 3KGRA 5MP6L 1U91A 1CFNB 1MCLA 3F7YB 2M26A 3ZDXE 5LCVL 4HAFA 2P5EE 4OCMC 3NN8A 2B2XH 1HHHB 4GW1B 3G6JF 2BXYA 3I6GB 4O9HH 3OGCA 1ITBB 4FP8H 5I1DA 2C4FU 5T1KB 3LH2L 35C8H 4IOFD 1NGWA 4N90E 3TEUA 1CZ8L 4ZFOA 1II4E 4CRPA 1R0AL 1FFOB 1BBDH 1JTPA 4HC1A 1MFNA 1RZFH 3QUYC 1R6VA 1OP5H 5C0DA 1AFVL 4PRPB 1XAUA 5I1HL 4LHUD 5BXFB 5J6HB 1TVDA 1U8MA 1Z9MA 3HAEA 2NNAB 4F9PA 4L4VE 4QRSB 1JK8A 1FVDB 3HA0A 4HJJH 2VAJA 1GAFL 1KENH 3ULUC 4P57A 1QSVA 4U0QB 4P5TA 3LEVL 4JY5H 3ZKND 5I1JH 2X7LB 2GTWA 3PJSB 3KS0J 1V05A 4HKJA 1FE8L 4EEEA 1P4BH 4KJQC 1GIGL 3WJJA 2BNQE 1T5XA 1VADB 5GZNC 3DOSA 3X3FH 3QIUA 2NTFB 1A3LH 5FOBB 4IOIB 5EU6B 2BOBA 4PJEA 5C09E 4PJAA 2BNUA 4DGIH 1FV1A 2GJJA 4Q0XL 1RIUH 4XP4L 3TFKC 2VXSH 3MRGB 5MHSD 4XH2B 3NA9L 4ZFZB 5CEZD 4UB0L 1KCVH 5C08D 3RWGA 1HNGA 1N6VA 4E9LA 5F6IB 1CXHA 5IGXH 4JFXB 3ULVC 3ARUA 1NCDH 4GRLD 5L9DL 3RL1A 1AR1D 1EVUA 4TYUA 2H2SD 1KCUL 3MRKB 2J4WH 1LK2A 3WL9B 1TTUA 2JE8A 2DTMH 4R0LB 5K9JL 4LLQB 4LVNC 3FZUC 4KK6C 3BH8B 4XHJC 5CMAA 3U30B 2DKUA 5EG6C 4PJHB 3RIFK 4F58H 5IR1B 4YWGL 4LSPH 5EO1A 5HI4C 2F53B 1X4ZA 1H0DA 4M6OL 3CU7A 1KTKE 3FOMA 4LSUH 2EYRA 2FGWL 4KK9D 3QDMB 1X7QB 3AXLA 5C0CA 4KROD 4D3CH 3W11D 5GZOC 4ZAKC 5AYUL 1CFSA 1U3ZA 4K71B 3QQ3A 1B2WL 3VXSE 5MERB 4N9GB 1NCCL 2B4CL 3JV0A 2P24A 3ZHKA 1HXYB 1IC5L 4R4BB 2F5AH 4PBVC 1WBXA 1K8IA 2YPLB 3EDDA 5DLML 3MYZA 4JJ5B 5I19H 4M43H 4DK6A 1OP3K 3SDAC 4P3CL 3RX7A 3U7WH 2ARJB 2FX9L 5DRNA 2DQFB 3C6LB 4NN6B 3SKNB 3RKPA 4YXLL 4MQ7B 4XNMB 1P1ZA 3JUYA 4M03A 3TNNA 4U6XA 3OPZH 5I15H 1QSEE 1KFAL 2MJWA 5CHNA 3VJ6A 2ZCKH 1RK1B 3T0DA 5EU3B 3WMSA 2VE6A 1K2DB 1LEGB 4BQ6A 3X12A 1A7OL 2AJXL 5E00A 1KELL 5AAMA 4WUUE 4YC2C 2YSSB 4QCIB 2ADJB 4DFHA 2YD5A 3HCVA 3UZEA 3FRPA 3UYRL 5I1AB 1VKXB 1H3WM 1JPSL 3BRGC 1T6VN 2GSIB 5MHSE 1Z3GH 5C08E 5E4IA 1T7VA 3WCYA 2VB5A 5K9KB 5ACMA 4Y4HC 5SX4H 3FFDB 3UYOD 2MPAH 1M6OB 3VFMB 2O93L 3LZFL 1INEL 12E8L 2FBJH 3D18A 3F62A 4ALAL 1MIMH 2A0LC 3HFMH 4NQSB 4JFYA 1JP5A 2SEBB 1JMXA 4U6HA 3V6FA 5FKPB 3WIFB 1SQ2N 4EDWH 3WS3A 4YPGA 1A6UL 1KB5B 3L3OA 2J88L 4BFEA 4CW1B 1NUDA 3VXTB 2DM3A 1T1XB 5DC4B 2PW2A 2JJTC 4MX7A 2Z35B 2AJ3B 5DMIL 1CBVH 1SM3H 1SYSA 3DO7A 2ZSWA 4O58L 3IVKB 4XI5D 1JUFB 1J1PH 4QHMB 2E9BA 1T21B 1WFUA 2H32H 4I2XE 1LO5B 4JZNB 1WEJL 2C1PA 2DKSA 4Y5XB 1OAXL 5JPNB 3QDGD 5CBEB 2ZOKA 3C8KA 4JHZA 5J9PA 3SDAA 5DDHA 3FRUA 1IQWH 3DROA 1OM3L 4K3EH 5FM8A 4NOFA 1T2JA 1ZSDB 5EB9A 5I1EH 3T4AA 4KJWD 1A7NH 3TN0C 1FN4A 4M48L 5E1AB 1D5IH 3QFDA 3GKWH 4PJEF 4PJAF 5D2NE 1JRHH 1YDPA 1L7TH 4XBGA 4ENED 1L6XA 2APVA 5D1ZB 5DSCA 1C1EL 3KXFB 1ADQA 1U41A 1ODAA 1MAML 2YPVL 1C16A 1UZ8B 3Q6GL 4YUEH 4Z7WB 1K5NB 1YC8A 3UC0L 5FYKH 2VIRB 5HDQH 5CSBA 3RAJL 3K81A 3M1BA 2DQUH 4D8PA 1UH4A 1N59A 2HT3D 4I0PD 4KVCL 3JWOL 3LSOA 3SE4C 1A6WL 3K4ZA 2VDLH 5J1SC 2XRAH 2Y72A 3KG5A 4X6DA 2JJVA 3F7VA 2NY4B 4HUMB 2C4FT 2YPKA 4Y4HA 4F7CA 3HPLA 5E56A 3PDGA 4P99A 3VFGH 1ONQA 3D3VB 5FEBA 5ANMA 5DC0A 5ABDE 5EU5B 4P46C 3LB6D 3SJVD 4ZSOB 3AS2A 5T1LB 4Y8AA 5HHXH 4OZIB 1IEAA 3D48R 1OB1B 3VXMB 4GS7B 1BF2A 2BJML 1KPUB 1WZ1L 1XZ0B 2EH8L 1BX2B 1I1RA 4G8GD 4LVHB 1TTFA 2PTUA 1AHWA 4U7KA 3VD7A 4Z5RA 5LWYL 4K8RC 1M71B 3MRPB 3X11B 4R0LC 4PJFE 1XR9B 3BPNB 1EV2E 3U30C 3VFTA 3WHE1 3HI5L 4JR9H 4HBQA 4TUKH 2UY7A 1BGXH 4WI9A 3NZ8A 1CFNA 4UT9L 3MLXH 5BO1L 1MWAB 4GRWB 4U1SB 3WNKA 3ULUF 5IOPA 2B20A 1MELA 2XZQH 1C8PA 3E0GA 2FWOB 4I0KA 4GW1A 3QWRA 4DJMA 2DBLH 2D7TH 3SQBA 4K71C 5T1KA 1BLNA 3CFDB 5D7IA 1N5AB 5ID0B 3TH4T 4R26L 3Q5YA 3AGVA 2FDBP 5SV3A 3NOIA 2AP2A 3RZWA 1AR2A 3ZYOA 1DUZB 2NZ9C 1WFTA 4YFLF 3KDMB 1BVLA 3CVHL 4NKDA 5J6HA 5EWIL 1CG9B 2KBGA 3EOYG 4UTBH 1FVDA 1PSKL 3CFCH 4Q58C 2W9LA 4OLXL 3T3MF 5DMGD 1PLGH 3ARGC 4UUJB 3FN0L 2X7LA 2Z93B 8FABB 4CVZB 3PJSA 3RL2A 1OTUC 1ZE3C 3ULVF 3DYPA 1BFOB 1FAIH 2NY5H 3GSUB 4UOW0 1MCPH 4P4RB 4OFDA 1H5BB 4FQJH 4WO4A 1AI1L 1VADA 5CKGA 1VFMA 1KXVC 3CDCA 2C5DC 4H1LG 2NTFA 1J8HA 1FCGA 2W60B 2V5RA 4PUBH 5EU6A 3O4LA 3CXHK 5FM4A 5FOBA 1QFWL 2APXA 2Z31B 5C0IB 2GCYB 1ZGLB 4OKDA 1CU4L 2J8UA 3QFJE 3MRGA 4JKPH 1JGEB 4WW2B 3WLWD 3NGBC 2AKRB 1YEFL 1DN2A 1OSZB 1EEYB 3SCMB 1A9EA 4PJGB 4JFXA 3L1OH 4X6FA 4FABL 4JM2B 5I18L 4MMXC 1IL1B 1RU9L 3TVMD 4JM4L 3WL9A 1BFTA 4WJ5B 3H42H 3T1FB 4R0LA 3LCYA 4LLQA 5DD0H 1AGEB 4WY7L 5HDOA 1AC0A 4PJHA 5IR1A 2NY2B 4BFBD 3GK8L 2PR4H 2AJZB 1DBBL 3QNZB 4NKMA 3RVWC 2DJUA 4PJIE 3NCCB 4OZFA 3P9MB 1KC5H 4M1GL 2R2BA 3E6HB 4DAGH 3NH7L 4QF1B 3F58L 3QIBC 1T4KB 5AG8A 4ZTPH 2IPUG 4EBQH 5E5MA 4EUPG 3ZKXC 4H25B 4DKDC 3LKSA 4MJ2A 4CN4A 4AH2B 3NAAL 4KGJA 5MERA 2R2HB 4ZG1A 2YHGA 2X70A 3QPQD 1F3DH 4P0DA 5I8OH 2D9QB 2O5ZH 1IZJA 1IGYB 5IMMB 2HA1A 4HBCH 1XGPB 2EDTA 2R4RH 2BP3A 3LEXA 3KPSE 4Y5XC 4JJ5A 5FA3A 2Z8SA 1BZ7A 4G8EB 4TNWK 2NYYD 3MV7D 5A40E 2ARJA 4P2OB 5B3JE 4G7VL 1IVLA 1IKFL 2DQFA 5INCB 3C6LA 1UA6H 4D0CB 3SKNA 3J7HA 3B4NA 3PWPD 4JN1H 4P49A 3ARFB 4MQ7A 3W2DH 4EDXB 2EYSB 3CFBA 4J3TA 3UPRA 4X6DF 4HS3B 3QJFB 3GRWL 4HIEB 4L9LA 5J12B 1RK1A 1J0ZA 4RFOH 5EU3A 5HBBA 3LKRA 4UT7L 1K2DA 2WV3A 5D1ZC 1CLZH 2PXYD 3LQMA 5HDBE 3GSXA 2HRPH 1UM6H 4NQDA 2YSSA 1A1NB 1FFPB 4QCIA 2ADJA 5ISZB 3KHQA 1N8ZB 3AS1A 3SE9L 3SPVB 4TPRH 5B4MC 2Y06H 4X4XA 1VKXA 2NX5B 4JLRA 4U1NB 3A6BH 3VWKD 5J1AB 4GKZB 5DD1H 4X6CF 3MPCA 4P48A 4NCC2 4WWKD 4NO3B 1Z5LB 2B0SL 1R24B 4M5YH 2NY4C 5FHBH 4TNVK 2NLJB 3HE6B 1KB9J 1I7RA 3RA7L 1FL3B 5GS1B 5ACZB 3VFMA 1M6OA 5C2BL 2AQ3A 2EDNA 3KLHD 1T03H 3VXQB 3HI6H 1JZ6A 1NGXB 2H2PD 1UJ3B 2HRLA 1JPFA 2SEBA 3PQYD 1DEDA 5FKPA 3RIFF 1AO7D 1UENA 3GSNL 2DI8A 3BDXA 1KJ2L 4GS7C 5T5NF 3BJLA 5ENWB 3D69A 5CUSH 3H3BC 5C2UB 4CW1A 3VXTA 1BZ9B 1MJUL 5TQ0H 1T1XA 3RVVC 2XZAL 4XTRD 3LKOA 4LVHC 4XX1E 2EIBA 3JWDL 3MREA 3BPNC 5A16A 4ODWB 1JUFA 4QHMA 4LSQL 3DLQR 1N64L 1D5XB 3MLRH 2DWEA 1RJCA 2WZPD 4Y5XA 5JPNA 1E6OH 5CBEA 2BFVH 3CLFH 2X4OA 1D5ZB 4NC1C 3RQ3A 4JZJB 1KGCD 1N0LA 1QSFD 2EDQA 1ACZA 4HJGA 1EJOL 1YUHB 3KPPB 3GSVB 4QXGL 2FD6H 5I17B 5DURD 4OI7A 1CICC 1ZSDA 1EBPA 3L9RB 3MV7E 4XCYB 2COQA 3DURB 4L4JA 3ZYJA 2FCBA 3MFFA 1NFIB 1BD2D 1NCBL 3MUJA 1JZ3A 3JV6B 3PWPE 5FV1L 3V5DA 4WW1A 1DQJA 5GGTL 3NFSH 5D1ZA 5FF6B 3KXFA 3QUML 2CK2A 1K85A 5I9QB 4Z7WA 1OW0C 3FB7B 3T4YA 5ECJE 1ZT7A 1N2RB 1PFCA 2V7NB 3MJ8B 5EU7C 4A6YB 1C7SA 3UTQB 4LLAA 2BDNH 4AK1A 1GC1C 4GW4B 3O0RL 3FCTB 1U6AH 1XIWA 3EOTL 5SWSD 3UZVB 1I9RH 4I3RL 5D7SL 1H5BC 3GSOB 5MENB 4RISL 1A6VL 2GW5A 4UILH 3QHFL 4UU9B 4NZUL 4AT6B 2Z31C 4PJHF 2WIMA 1MCOL 5KJRH 5CD5C 5D8JH 2JCCE 2EKJA 5EU5A 1MQ8A 4YDIL 5DHVH 1XF3A 1BAFH 3QG7H 5JZ7D 4ODBD 4WW2C 5I1CH 5T1LA 4OZIA 4HUNB 2FH8A 3SCMC 1OB1A 3VXMA 4Y5YB 4ZUWB 1KPUA 2EKSB 1XZ0A 4NWUH 1YY9D 4P2QD 3B2UC 4RIRB 1BX2A 1QR4A 4HPOH 4JM2C 4G6KL 1AO7E 4EUPB 4WENB 5FB8A 1M71A 3MRPA 3VFPB 4XMPH 3E6FB 3X11A 4P3DB 3JBG7 4YBLB 1XCQA 4NQVB 4IDLA 3VA6A 2NY2C 1Z9SA 1TNNA 3T0VA 4XC3H 1BM3H 2Z91B 1BWMA 4Z7VB 1MWAA 2UZIL 2ZKHL 2WMPA 4DVBB 4OF5A 2VDRL 4DZ8B 2VITA 2V9QA 1PYWB 3U7YL 4HULB 5I1KL 2FWOA 1UB6B 1T89A 2YKLH 4AEHH 2MWCA 3MJ9L 1T04B 4XP9L 2CLRA 3MRNA 3T0EB 1N5AA 5E8EB 2HFFA 1T7ZA 4QRUA 1S8DA 3EO1B 2Y36H 4ZYKA 5F8RC 4L8SA 1FBIL 4LPWA 3L3GB 3MTRA 1GL4B 4GKOA 4NN7B 1F00I 1A9BB 3QDGB 4X9FA 1CG9A 4DVRH 3P0VH 5F1NA 4P2OC 3RWHB 3UP1A 4LHQB 2HT2D 5JDJA 4Y4KA 2Z93A 4OGAD 4CVZA 1DBJH 4R9HA 3BPLB 4IOFC 4L8BB 4XCNA 1VEOA 2A6IB 4P4RA 4JDTL 3U2SA 3EKCA 5J12C 3BESR 4H20H 4M6AA 4LP5A 3UPAA 4MZ2A 3DECA 3BRFA 5SWSE 3V6ZA 2VR5A 5C0IA 2Z31A 2GCYA 1QLEH 1J0YA 4OI9A 2V7HB 4M8QB 1T1YB 4W68A 3R1GL 4BFGA 2R1YB 4F7MA 3O81A 2CJUH 4WW2A 2AKRA 5F7EH 3V95A 1ZGLP 3ZKNC 4XVSH 1OSZA 4KK5D 1EEYA 3SCMA 2X4TB 4PJGA 2J8OA 1NCAH 3I75A 5I1JL 1LDSA 2G5BA 4G6MH 1IL1A 3BWUC 4WJ5A 5GS1C 1FDLH 4HIXH 4RFEB 4LPTA 4P9MH 5GJSH 1AGEA 3PABB 2CLZA 4JPWH 1FNEA 1U8LB 2X5PA 3G5ZB 5KVFL 5C0BB 4QXUL 1A3LL 4GAYA 3IJHB 3QNZA 3P9MA 4L29B 4M1DL 3RHWF 5CD3B 1YPZB 1RIUL 3E6HA 3WDIA 3BIKA 4M62L 1CDIA 1Q0YH 3CXHJ 4OM1L 4PLKD 3FT4B 1NSNH 4JRYE 3O9WB 5A2JH 4GG6B 1SYVA 4G3YH 2H2SC 2YBRB 4H26B 5KSAA 4AH2A 4LEOB 5CFHA 4HWEL 4K3DH 2R2HA 5K33A 3PGDB 3U9UB 1NCDL 2EDLA 5BS0A 3O2VL 5E8PA 5TF0A 3QWOA 4OD3H 4Q9RL 3IS1X 5H35B 5EDXA 1BQSA 1IGYA 5IMMA 2P4AB 4ELME 4MWFB 4Z7WF 5GGQH 5E99L 4HLJA 3VFWB 2ADFL 2L7JA 5CGMA 4JZJC 4P2OA 4KK9C 4F58L 2DIJA 4PGCB 3UTSD 3W11C 1VGKA 3VG0L 1RZKC 2I5YL 2QSCL 1F6AB 4D0CA 1M7XA 1KIQA 4OLYL 2D7OA 1UZ6F 4XVJL 1RFDH 3DXAD 1G9NL 3ARFA 4EDXA 2EYSA 3O3BB 4X4ME 1E4XL 5EZLB 4D3CL 3IETB 5J06A 2LFGA 4BQ9A 4HUUB 1E4JA 1UXWA 2A9NL 5DK3A 5E8NA 5FYLH 3TWCL 5C0EB 3M17A 5CLWA 2W59A 4LLWB 4V1DD 4HZAA 5I9QC 3DUUA 2AK4A 2EECA 2MTPA 2F5AL 2CRZA 4OZIF 2X1PA 3MODH 4KWUA 2UWEA 1A1NA 3DSFH 4WHDA 4PJ8D 1VERA 3OR6B 5I19L 4M43L 3FN3A 4ZNEA 4OZ4B 1H3XA 1OLZA 3F7RA 3OJMB 4JHAH 4LKCA 2NX5A 4U1NA 1JJUA 1QPXA 4IEFB 1ZK9A 5J1AA 1I1AD 2JJSA 4HXBH 5DUBA 4NO3A 4KVNH 5ERWB 1Z5LA 5F1KC 1QNZL 5C0GA 5L2JA 1R24A 4PG2A 1IM3B 1WUNT 1CWVA 4BUHA 3MLYH 3HE6A 4CVUA 3NMEA 4HJ0D 2IJ0C 5D6CB 1I85C 1J05A 4M6NL 2ZCKL 2CMRH 5H37H 4M4RA 1NGXA 1UJ3A 4GRWF 4XAWH 2CRMA 3SDCB 5FO9B 5J11B 3P4OB 1XF4B 4JO2H 4OKVB 1X5ZA 3WIHH 1HYSD 4FFYH 4FQLH 4Y5YC 3X14B 5FO8B 1D6EA 3EOBB 5ENWA 5EUKA 2NY1D 1BZ9A 3F8UB 4MS8D 2VISB 3NA4A 4ZFGH 1NGPH 5FYKE 3BN9D 3AY4A 3CMOH 4ZDHB 3MA7B 1EO5A 3V0VB 1B88A 1BVKB 1JPGB 3MZTA 4FQXA 4GW5B 3DV6B 3CMGA 1YEJH 4YBLC 1ZLSH 4X0KB 3W9EA 1Z3GL 3NTCH 1AD0B 3SGDH 1S7TA 2K7QA 1T7WA 5BQ7B 3N1PC 3T09A 2AABL 2MPAL 2BY1A 1UB5B 4E41E 2FBJL 5DQJA 4QY8B 1MIML 1D5ZA 4JZJA 4IHOA 3HFML 3WNNA 3O6MH 5F9DC 3KPPA 3GSVA 3G5VB 1NDMA 4OGXH 4OZHE 4POZD 5I17A 4D9QD 2F74B 4U1MB 3KYNB 2EIZA 4WI6A 3UTSE 3DURA 4OSUL 2X41A 3IJYA 4AIZB 3MLVL 3LAFA 3JV6A 1I8KB 1SM3L 1MI5D 3DXAE 4P59H 3O8XD 4M7JL 1RUQH 4H1LA 2R0WH 5ACLA 2BHUA 5FF6A 2VLKA 5E6ID 1KV3A 4WW2F 2HWZL 5FUZH 5C0AB 2I25N 3FB7A 3CFJA 3V52L 1JZ7A 3LDBB 2V7NA 2QKIA 3MUHL 2ZCHH 2G2RB 2X6MA 2BNRD 4JVPA 4PJGF 3UTQA 3Q6FB 1U8HA 1YNKL 3BPLC 4C83A 4GW4A 4JM2F 5ALBL 1Z0NA 3FCTA 4GXUN 3QZWG 2R69H 4MLIA 3L5XH 4IIQA 3GSOA 3TNMB 5MI0C 3TCLB 1IAIL 1MUJA 3GKZA 2VZ1A 3SKJL 3WFDH 3MMEB 2XWJB 5I1EL 2F54E 4AT6A 5CZVH 2FJGB 1D5IL 4K94C 1CDHA 3GKWL 5IW3A 3MXWL 4Y2DB 4LAJH 1JRHL 4ZPVB 4Q9BA 3B9VA 1OAYL 4XZUB 1XH3B 5IROA 4M7ZB 1QPPA 3LQZB 4E5XB 4QEGA 2BSTB 3ETBF 4Y5YA 4YXKH 1DLFH 2D7NA 4I0PC 2EKSA 2A6KB 3BZ4B 2EXYC 4RIRA 5JHDB 2EDYA 4J7RA 5FYKL 1FL6B 4WWKB 1EGJL 4FQ2H 2F19H 4EUPA 4FOMA 5JIPA 3N1MC 4P9HH 2H45A 2ZPKL 4OCWL 3IRPX 3E6FA 3RUGB 1U42A 4JG0L 4P3DA 5FM5M 3VXUD 4HSQA 4AENB 3GEWB 2VDLL 3MUGB 2XRAL 4QOKD 1WLHA 1NANH 1SEBA 3SDXB 5GS0H 2Z91A 3LB6C 4H8WH 3PQYB 4Z7VA 1FNHA 3AUVA 4JFFB 1IGJB 4HMDA 3DARA 4DVBA 3NCYP 2X89D 4ZO9A 1BECA 2NZIA 5HHXL 4HZLB 1UB6A 3O9WC 4N8PA 2GQHA 3QULB 1N0XL 1RZJL 5E70A 2PCPB 3WV0A 1T04A 4L1HA 2EE9A 3VXRA 3T0EA 1RMFL 1VGEH 4L1DA 3Q0HA 3D0VB 5J1TC 3B8SA 1I9IL 2X2YA 3EO1A 1CGSH 4J1UA 1Q0XH 2P44B 4RX4A 3P4LA 3UTTA 4UDTA 2ZUXA 3RVTC 1MAJA 3NCMA 3L3GA 1EK3A 1CTOA 1OT2A 2GFBA 1A9BA 1EVTC 5T3XH 4JR9L 4TUKL 3RWHA 1QSFB 5TH2A 4XGZB 3U46B 1UXSA 3BP4A 1MI5E 1S9YA 1RJLB 1W0WB 2VDNL 1V7MH 3P73A 5DURB 5FUOL 2GITB 2XY1A 4L8BA 3D87B 5C8JB 2AEQL 2E27H 5BVPL 2A6IA 2QSQA 1GGTA 2NCMA 4S10A 1MEXL 2DBLL 2CK0L 1T1ZB 2XQBL 2D7TL 4MD5A 3REVB 5KSBA 2E7LC 3T0WA 1NMAL 4JHBA 1PW3A 5D71L 2ESVD 2V7HA 5TDPA 3SGKA 2GT9B 1T1YA 5GRUL 3IFPA 4IJ3B 5D1XA 3S3JA 5FKAB 1KUMA 3HC3L 3P77B 5KS9E 4APQD 5D7JB 4LK4A 1WT5A 3BT2H 1FFRA 4W4NA 1GZQB 3N85H 5KOVC 1OP5K 1NAMH 3S4SG 1IMHC 5D72H 1PLGL 2R0ZL 5KAQF 3QEQE 4YR6B 4NO0D 4HG4K 3FN9A 3NIDF 2XZCH 3OV6A 4MVBD 3SBWA 2IAMB 5FA4B 1FAIL 2NY5L 5D7LD 1MCPL 1G6RB 1IFHH 4RFEA 3EYFB 3VGDA 4FQJL 4MJIB 4F33B 2FZ3B 2MCPH 3VE0B 4OJFL 5EBLB 1U8LA 3CIQA 3G5ZA 5F97E 2PYFB 5C0BA 3WLWC 3RVXC 3SDCC 5J11C 4XXCC 4AMKL 3OZ9H 3VXUE 3PWJB 1FZMB 4L29A 2AJUH 5CD3A 1YPZA 1Y0LB 5D6DC 2EDXA 4O2FB 3HG1E 5L88L 5F96H 3QI9D 3BO8B 4P2QB 2R1XB 3FT4A 4GG6A 3O9WA 1L6ZA 2YBRA 3TH3T 2OXHA 4LEOA 2X05A 3RNKB 1UC6A 2FECI 3JTSA 3U9UA 4G43B 3WO3B 2RCSH 4GLRH 3CFKB 5H35A 2FO4B 3EIFA 4OD2A 4N1HB 4G6AC 3H42L 4MAYA 4MWFA 2HTKC 5GGSY 3UTOA 3WXWL 1LMKA 2FH6A 4WEBH 4RMSA 5IEHB 4U1JA 4D9LH 2W0LA 5INDB 4PGCA 4DCQB 3SN6N 3X13B 1HEZB 4FTVA 1YEDA 3IDJB 1F6AA 5JOPD 2E6QA 5JA8B 1KC5L 4HKXA 4Z95L 4Z7UB 4GMSH 1B6DA 2Y4SA 4KAQH 4ZO8A 4ERSH 4DAGL 3WS6C 3O3BA 2MCG1 5EZLA 3AB0B 1PG7H 5HHME 2ICWI 3IETA 4EBQL 3QPQC 4NIKB 4X8JB 2VXUH 1DN0B 1U8KB 2Q86B 1JV5B 3FO9B 1MCIA 3MV8B 1GGYA 2P5WD 5T1MB 5F3HB 4X5WB 4LLWA 1VPOL 2IQ9L 3HE7D 4HFUL 4EXPX 3LDBC 1DQTA 4O51B 4YX2H 3BUYA 5E1HB 4JFED 2YK1H 4I3SL 4YDLB 2ESVE 4YHZH 4G6JH 4JFDA 1BVZA 4NJ9L 3ESUF 1M4KA 2OBGA 3C8DA 1P6FA 4X9GA 3KPOB 4Y19B 1NJ9A 4UIKL 5ERWA 1G0DA 5FUCE 5CLTA 3CH8A 1IM3A 3W2DL 4AEIH 2OTWA 1I8MB 2OZ4A 4QYOA 2DIBA 3MRIB 4IRJB 1CE1H 1T5WB 2A74B 3RY6A 4ZXBA 1MCWM 4GT7A 5SWZD 4XMLL 4U0RB 1W72H 3LV3A 4Y2DC 4Z7VF 1JYVA 5DT1H 2WBJD 2YA1A 2CIKB 3DVGB 4YGVB 4M7ZC 3SDCA 5FO9A 3PV6B 2DLIA 3P4OA 5D7LE 1TZGH 4OKVA 3QEUB 4CBPA 2HRPL 2MQ3A 3EO0A 4HUWB 1QRNB 2Q20A 3EOBA 5IK3B 5D6DA 4DQOL 1H3PH 4N5ED 1K3ZA 4JDZA 1QFHA 2VISA 4NT6A 5E08H 1C5BH 4N0YL 4HLZH 4WWKC 2Y06L 1FH5L 1CGXA 4G6FB 1NCUA 3JV4B 3MA7A 1BFVH 3NPZB 3HAEH 4PJ5A 1JPGA 3BGAA 3DMMD 4GW5A 4KXZH 2XN9A 5L7XL 4X98B 1F42A 43CAB 4CMMB 4X0KA 1A7QL 2VLRA 3VG9B 1PKQB 2FATH 5AEAA 4I8DA 4C59B 2DD8H 5BQ7A 1YMHB 2V2XB 1NLDL 3BSZH 1A47A 3ES6A 1HKLL 3IDIB 3MV9D 5HGAB 2CKBA 4PB9H 3JTTB 4XC1H 1MJ8L 4KUCD 1UB5A 1MFBL 5DJAA 1NCWH 3KR3L 1Q1JH 3V0WH 5FV2A 3D5OF 4RGOL 4XTRC 3QRGH 3G5VA 4M6MH 1QO3B 4JFZH 4TQEH 4HH9B 4KY1L 4JFHD 1BQHG 3LRHA 1NLBL 2F74A 3KYNA 5TQ0L 5FO7B 1EPFA 2OR9H 5DK0B 3OF6D 5CINH 4QTIL 1YJDH 3GM0A 5JOPE 1XEDA 4LLYB 2WNGA 4TULL 3GBMH 2H26A 3RJQB 2EDRA 4PJCB 2PN5A 1F90L 4YIQB 3I3DA 2CDEB 3GHBH 1EFXD 5C0AA 5FGCE 3MLRL 5LBSH 3K8MA 4OGYH 2G2RA 1MSPA 4LIQH 5DS8B 5JQHC 2BFVL 3CLFL 1LEKA 1U93B 1J8KA 1QG3A 3S4SB 3ZKMC 1VFUA 3TNMA 5F9JB 3GMPB 3TCLA 4RGMB 4JFEE 3IDXL 2G60H 2XWJA 3QIWB 4BSVA 2BMKB 5BV7B 3P0GB 2FJGA 2DQCL 1KBGH 3C60D 4WGVB 5B8CA 2L4OA 2ATKB 4PGBB 4Y2DA 4Q9QL 4IJ3C 4ZPVA 4PJ9A 4LAQL 5HVWA 2RFXA 3QNXA 1XH3A 3GNML 1YPZF 4PJ7E 4PJ8B 4PLOB 3LQZA 5D7JC 5TQ2L 4E5XA 4E0RB 1IQDB 2BSTA 4GG6F 4DOHE 2A6DB 3BZ4A 2VXVH 3V0AC 1FZOB 4HWNA 2P46B 3MRJB 3RFZC 1FZJB 1KJMA 5EBMB 4P4KD 4ORGB 1MH5B 1ZMYA 3FHAA 4NQEE 4AENA 1N5YL 3SQOL 3ULUH 1Z0MA 1QR1B 3MUGA 1EXUB 1CLOL 4L9DA 5J7CC 1DJSA 2JB6B 2XG4A 3F5WB 4JFFA 5KJRL 5IJVB 5D8JL 2R2EA 4HDIB 3TZVB 3BE1L 4CL7A 5HHOD 3QG7L 1CK0L 1YY9C 3STBA 2KQMA 4HZLA 1F6FB 3MV9E 3MV11 2PCPA 1S7WA 1FG9C 2ORBH 3TYFA 1P69B 4OZGE 3RWCA 4P2RB 3D0VA 1J10A 5F1IA 2AJSH 2GIYA 1HCVA 4HPOL 3QQ9C 4RGND 2GTZB 3RGVD 1DSFL 4FZEL 4UV4H 1NMBH 4XMPL 3S7GA 5H2BB 4MAUL 5IFHH 1E6JH 3ULVH 4G42B 4JFQA 3MLWL 1Q8MA 2WUCH 3K4AA 3S88L 1RJLA 1W0WA 4MNQE 1OQXA 2B5IB 4KTEH 5EPMA 2WQRA 2X40A 1EHAA 5B39G 3D25B 1SVCP 3UJIH 5C8JA 1F58H 4HT1H 3KPLB 3EJZD 4PRIA 2YKLL 1JGLH 4AEHL 4X6EB 3GBNL 4LF3B 1PJ9A 3CPLB 1GSMA 4YEFA 4KUZH 1B4RA 4Z8FH 4AIOA 3MLSL 3EJYC 3MRDB 2CDGA 5GJTH 3H9HB 4EN3D 4H0HB 4MYWB 1FNSL 1UM5L 1H8NA 3GO1L 5FKAA 2BVEA 3P77A 2MKLC 2BNRB 3HZYB 1IC7L 3KPQA 4LCWB 4YDLC 2DI7A 4DVRL 2PNDA 5LG1A 1GZQA 2IH1A 4U1IB 5LGHL 5IB3A 5F88A 2DRUA 1I3RB 4YR6A 1DR9A 2IAMA 4TOYH 3VD9A 4QRPD 5T33H 1D9KB 1G6RA 4IRJC 1X5YA 3EYFA 3UYPA 3KJ4B 1U3HA 4MJIA 4U0RC 5ALCH 5FM5O 4F33A 2FZ3A 5C7XH 1O5DT 3VE0A 3PP3H 5EBLA 1T0MA 2YC1B 2VWEE 5C07D 5FYLE 2H3NA 4KK5C 2X4SB 3PWJA 1B4JL 3UAJD 3B9EA 3SGJA 1C12B 2KPNA 1Y0LA 5DQDH 4O2FA 3WJLC 3I6LD 3BO8A 5F7EL 3VXSB 2R1XA 1ZXQA 4XVSL 2D0GA 4UOJA 4N9OB 2R0LH 2HFGH 1L0XA 1ADQH 4PGDB 1BQHB 5HHOE 4PRDB 3KLSA 3RNKA 4G43A 4F7PB 3FFCE 4PGEB 3VG9C 2ZZUT 3QUXB 5F72S 3ZL4L 1W0VB 2VL5A 2FO4A 5CIPB 1YYML 3BFOA 1S5HB 2H6PB 3TYGH 4HIXL 1TDQA 4U3CA 4JO4H 1F3JB 1X44A 4NQXB 3OHXA 2FYYA 1OPGL 1QBMH 5JW4N 1HIMH 5DJ8B 4DCQA 1KCKA 1HH9A 2VL4A 3X13A 1HEZA 1CD0A 3I6KB 3IDJA 3WFZA 1QSEB 4Z7UA 1AGFA 4OCRH 2CRIA 4XPBL 3QZWA 4X8JA 4G3YL 4KDTA 1DN0A 4P23D 2VQ1A 1U8KA 2OQJB 1IILE 1UM4H 4KC3B 3DUSA 1J1XH 1JV5A 4K3DL 3FO9A 3MV8A 3MYJB 4DUVA 4K3HA 4YHOL 4JVUA 5B38G 1G1CA 4X5WA 2KQNA 4OD3L 4M5ZL 2VXTL 4ZUVB 1X6NA 1TCRB 4Q6IC 2W65B 4O51A 5BMFH 1GGUA 5GGQL 1CXIA 3B9KB 3CVIH 4F37K 5HD8D 1QBLL 2UVEA 2BRQA 4PREB 1JZ4A 3D2UD 5GS3A 4RGMC 3HR6A 3VA2C 2VDKL 3DYMA 3EGSB 1B0GA 1ZVYA 3RUGF 1RFDL 2FEEL 4GMTL 1G7MB 4ZUSB 1I8MA 2AS5M 5BV7C 1JYNA 3MRIA 1FO0L 2BOCA 4LNRA 4IRJA 1T5WA 2A74A 4WFEE 4X7DC 5T3XD 3SDXF 5J13B 2OL3L 2GKIA 4GXUM 5AZ2H 4X4YB 3MNWB 2WWMC 4J3WA 3FQUB 2CIKA 4PJ8C 5EU4B 5JLZB 4YGVA 4LOUD 5HHQA 5FYLL 2DQDH 3PV6A 3X3GL 3PNWA 3HNTH 3QEUA 5L2KD 3GIVB 4HUWA 5IK3A 3OKMB 4BFIA 1XR8B 3OAYK 2ITCA 4JFPA 3WJLA 2DWDB 3MODL 3MNZA 1I1AC 2V2TB 5C07E 4KI5F 1DBML 3D85D 4U2ZA 5I8EA 1OAUH 1CR9H 2P48B 4OLZL 1J86A 3QAZB 4LCIH 3JV4A 4P5MB 5DR5H 1ZLUH 3TT1L 3FOLA 2HYMA 5ESVB 4HJ0C 4X98A 43CAA 1JGUH 4CMMA 4I2XB 2FB4L 2VXQL 4HXBL 1PKQA 2EDOA 1B90A 4FXLA 3MLYL 1YMHA 2V2XA 3IDIA 5HYQA 4G80B 3TZVC 2CMRL 2VAAA 2VZSA 2E7BA 4UQ2B 3CLEH 4L3ED 1QO3A 2B4CC 4HH9A 1AQDB 4PRHD 4FQLL 5C9JA 5B39B 1BBJA 2DQGL 3P9LB 1NGPL 3PP4H 4OFYD 4Y1AD 3ZT7A 1MRDH 1F4XL 3QXAB 4M93B 5IHBA 3CVHB 3P9WB 2ICWB 3HNSL 4BH8B 1U8IB 3QQNA 4GQ9L 4TUOB 1ZLSL 5FIEA 1EJ6A 3S5LG 4JRXD 3K2UH 2QHRL 3TV3H 3FT2A 1TFHA 1H3TA 4C56B 4WNQB 1N6QH 1E4XI 1HSBB 4ETQB 1SBBA 2VDQL 4P2YA 3O45B 1I9JL 2B5IC 3OSKA 3G6JE 3HHRB 2CGRL 1C08A 4K8RH 3GSQA 2ZCLH 1CFVH 4K7PH 4GJTB 3VGBA 3I50H 1NEZG 1F11A 3O6ML 3S4SA 5CEYB 3U82B 1WAAA 3QXTA 2IGFH 5F9JA 3GMPA 3ZSTA 4OGXL 2AEIT 1U8QB 4Y16A 5J0BA 3O8XC 3AM8A 3QIWA 3LEYL 2ADGB 4CJ1A 2BMKA 4HCRH 2FEDD 4IBLT 4HKBB 3CSGA 4Y4FB 4EI6A 2P5WB 2JB5H 3WFHA 2ATKA 3EAKA 3QNYB 3HE7B 3VW3L 4P59L 3HPJB 1X3DA 1RUQL 2GY5A 1T22B 3F6LA 2I60H 4XPHH 4QTHA 4E0RA 2OP4L 4PJXB 1IQDA 4N1EA 5T3XE 2FJFA 1OAQH 1NC2B 5LGKA 2A6DA 3ARED 3GIZH 3E8UL 4UNUA 3H9SB 5DUPH 2ZCHL 5ADPH 3HB3D 4NDMB 1B0WA 5L2KE 2XPGA 3EDFA 3MRJA 4NQCB 1FZJA 2A83B 4ORGA 1P7HL 3KJ4C 4FZ8H 1QR1A 1YQVH 1FGVH 5M94B 2PO6B 3L5WB 3DX8A 5EC1B 1OD7A 4MA8H 4DN3L 3OJDA 2P5EA 5KVDL 4N0FB 4BKLB 3R4DA 1H15B 1YN7A 4Z7QE 1JWUB 2A73B 4HS8L 3K4DA 4HXAL 1J1OL 2FHCA 4Z7UF 2BVQA 5EZIH 5T5FH 2QQKH 2IBZX 2LVCA 2QQQA 2XACC 3DMMB 4P2RA 4NZRH 1WCBB 1OY3B 1HSAB 3OKLB 2OMNA 2C3WA 2BCKB 2Y23A 1OGAD 3QUXC 4G8IB 4L3EE 1EHLL 4WU7A 5JUEH 4PRHE 3KPNB 3VH8G 4U3HA 1I4FB 4XNUH 1SMOA 5H2BA 1LVEA 3ZDYF 3ZE0F 5B38B 3IRZA 1G7QB 5GS0L 1EZVX 5CCKL 2M1KA 3O11A 1T66D 1SMAA 3CX2A 1LO0H 4JRXE 1NBVH 2BNQA 1V3MA 5ICYA 3O2WL 1KCSH 2IANB 5IF0A 2Y25A 3TIEA 3KPLA 4P5TD 5C09A 2IBZY 5HPOA 1A7RH 1KB5H 4LF3A 2YD6A 3CPLA 1RULH 3IAQA 5DD3L 3TGXA 3H3PH 3ZE2F 1FC2D 1GRWA 4EIGB 1DQQB 4M00A 3MRDA 4ODTL 1CGSL 2IQAB 5D2LB 4OFVA 3GUTA 1HINH 4RWYH 4TSAH 4LNVA 1IAII 3JWOC 1LDPH 3B9KC 3FKUS 1FLTX 2BXZA 2OI9B 3HZYA 5T3XL 4LCWA 2EC8A 3BXNA 5KTEH 2XQYK 2GK2A 1V7ML 3G6DH 4K3JH 4J3UA 4WGWB 3U0WH 4B7IA 2W9EL 3PHOB 4YHPA 2OTUA 3EYUL 4P3WA 4U1GB 1D9KA 4OCYL 1AJ7H 1NGYB 5BOZG 5AYQA 1YMMD 2IG2H 1P7KA 1PEZA 3GSNB 2YC1A 1U95B 1P4LB 2XTJB 1KJ2B 4Y8DC 1A6AB 1JPTL 3CAFA 5TPWH 1AXTH 5AWNL 4ONFH 2X4SA 1DEEB 3SKOB 4KZEH 3O6FB 3ABZA 4XWGH 2B1AL 4NUGH 3KYOB 4WEMB 3BQUB 3VGFA 3VXSA 4MB5A 3THMH 5I1LB 4QRRB 4G7YL 1JNLH 4PGDA 4YXHH 1BQHA 3N85L 4MVBC 2YWZA 4P4KB 3L7EB 1E4KC 3MROB 5DHYB 2HJLA 4ELKA 4PGEA 3KPSB 5T1DL 1W0VA 5CIPA 4PJCF 1UWXH 3MBXH 4J4PC 2YOCA 4NC2B 4XWOC 4HPYH 1KIRA 1F3JA 3U1SL 1CDGA 3AU1B 3S5LB 2IC2A 1OGAE 4Z6AT 4BSWB 4XPFH 4X9BA 5DJ8A 4HIHB 4FS0A 1BOYA 4L8DB 3B2VL 1NAKL 3VFVB 3ZLQC 1BIIB 1QSEA 4M7KH 3LPFA 3BWAB 3ILPB 3AAZB 1NEZB 5IMKA 3ULUD 3V4PL 4M93C 5I30H 4KZDH 1ND0A 2OQJA 1U2HA 3QUMB 2D3VA 3MYJA 4WUUA 1IE5A 2J7LA 2XXCB 5DRZB 1TIUA 1D5MB 3HZKB 4MXWL 5HYSG 5GGUB 2W65A 1VENA 2YRPA 4BZ2L 1N7MH 4UV7L 2K3TA 5EO9B 2WWKO 3LKPB 5FDWB 2X4UA 3DBXA 2D0FA 4AG4L 4PREA 3EGSA 3EOAB 3O3AB 2FHFA 1T1WB 4GMSL 3MOBL 1MWAH 4GRWH 5F71A 1G7MA 4OUOA 3NCYS 3MOQA 4D0BB 3DRQB 1CDUA 1G9ML 2IFFL 4Y4FC 3T04D 1KPVA 3ULVD 4Q74A 3I84A 4X4YA 3HE7C 2LU7A 3FQUA 4ONHA 5AZEH 5EU4A 5JW3H 2WIIB 3WNMA 4G9FB 1IC4H 3ZHLA 2EO9A 4K55A 3FZUD 4YHKH 3GIVA 3OKMA 1YMME 4XHJD 1MRFH 5DJ2A 4WFHD 4LDLB