3QFGA

Structure of a putative lipoprotein from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
145
Chain Sequence
NMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDLNPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYELRGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative lipoprotein from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 32
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16729 DUF5067 Domain of unknown function (DUF5067)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qfgA00
4LESA 1LMIA 2LLGA 3QFGA 3CFUA
chains in the Genus database with same CATH superfamily
1PNCA 1CD1A 4MZ2A 1P7HL 5CSZB 4RA3A 1YQVL 4Y5VB 5EUOA 3GB7B 5HI5D 5IVXE 5IK3B 4EZKA 5IBUG 3L9YA 2UX7A 4Q89A 3QJZA 3IAGC 5F9OL 5L88H 3PGDA 4OCXL 3ILQD 4BYHA 3KPRA 3VFTA 3DV6B 3I2CH 4H4NA 5DD6B 2B9BA 3KCPB 2HJFA 3CXDH 3LRSA 1IBZA 2FWSA 1CD0A 2YLHA 1FWXA 3SCMA 2HKFL 1I8AA 1R3HA 2GBVA 1F58H 4JPKL 4ZO7A 3VVWA 1EHLL 3F00A 5EC2A 5E8EA 5MEOB 2GK2A 3I85A 3TF4A 1BYNA 4XNXH 4XVTH 4ZODA 5GGSY 5DUJA 1JK9A 5CCKH 2VLRA 1TT6A 1OK0A 1X9RA 2AV7B 2QPSA 4LASL 4KK8C 5FUCC 5IB5A 2WWKO 4A66A 4N8VG 1TQBB 4P8QA 2KLTA 2BNRD 4W81A 1C7TA 3AT0A 3EFOB 3Q1SH 5IJKC 3P0VL 2XZAH 4FFZH 5LNGA 1UD5A 1G7PA 3OKMB 2YD0A 5IUCA 3F65A 1AHWC 2DLFL 3P40A 4Y2OA 3CMGA 1ORSA 3LKPA 5JW4M 1L7IL 4TKWA 4P5KA 2VKXA 4BFFA 5BRPA 1I8LA 3V0IA 4K7PY 1EBPA 2VR3A 4TMPA 4S0TD 3ZU8A 5IVNA 4LU5L 3MBXL 3NQKA 4L4VA 2YMXL 3LXAA 3U2SB 4HIEA 2R1YA 3JT0A 2QELA 1CFVL 1MAML 4RAHA 1FNGA 5DJ0B 5F89B 3U4BL 1SHSA 3FSZA 1TYRA 1XTMA 5AOJA 4LLQB 1T2JA 1K4DB 1LTXA 2F0CA 6FABL 4H88L 1EERB 1BVNP 2APBA 2SODB 2WCGA 4ELDA 4PVBA 4XP1H 5FO8A 3RE0A 4X6DB 1KB5L 4KZCA 4ZMVA 5LKNA 2XNAA 4NBXB 2CGYA 2IAAC 3OG4B 2RMNA 2EIDA 2XTJC 2ZSWB 1AGBB 1ZVHA 2BVYA 3V0JA 5C6TL 2X4SA 3QAQA 4G6KL 4BFIA 3CSGA 3VD0A 5EEXA 3MRDA 3NYKA 3GKZA 4NQCA 4YHZH 5DD6A 3KYNB 4JO3L 3DX8B 1JD7A 3QVAA 2JCCF 4MQSB 5IB2B 4RNRA 2O5YL 4IOFC 1BFVH 2C7UA 2FB4H 5TQ2L 1ACZA 1XGRA 3EBIA 4OJFL 2FLMA 3FOLA 4IOIB 4OFPA 4PRIB 2NXYD 1MJ8L 1UZGA 2DQIL 2VTFA 2H1XA 5IHBA 4NHCL 1D7DA 3U7YL 3BAIA 5BVJB 1TU2A 1WWAX 1JZHA 1RK1A 1TXKA 4RCAA 4I2XB 2EO1A 4LGPB 1WITA 5B3NA 1XB3A 2Z1KA 1ZAGA 4JPIA 1D7FA 4MBOA 2YBRB 4Y1AB 2FHCA 2E0PA 3HZKA 5TE7H 4ABUA 4KQ3H 5HVWA 4NUPA 4RMTA 4ECNA 1G6RL 2CA3A 1CGTA 2WPGA 3B7RL 3MV7D 4MASA 2V2WA 1F42A 2AANA 2YO3A 1S78D 2NR6D 4FERA 4Z3IA 3EJUA 5T1MA 1OTSC 5C9JA 3ME0A 2B16A 4Z3TA 1LWJA 3QR2A 2B7DT 4RAUA 5I75C 2Q76A 2FATL 1TJMA 2EDTA 3ZQWA 4Z7OF 3QYNA 3IDUA 2IV9A 2ZOOA 3LCYA 2Z3FA 1M42A 1KG0A 3L4TA 4NZFA 2IPUK 2VDPB 4JG1L 4XO3A 1B4JL 2OYKA 4OQ1A 4MAZA 1N8ZA 3FO2B 2F15A 3J2PA 1A7OL 4MA1B 3FRPB 1R17A 3QNFA 1G9MH 4MCZB 5DEGB 3O9WD 3ZDYE 2WLZA 1CZ8L 1RZKC 1JVLA 2J56A 3CHSA 2XIIA 3MCLL 1IT9H 4LNRA 4GRLC 1XF5A 2VAAA 3ARXA 1X5LA 4FXGB 5HYSA 1RUPL 2WTPA 5IBTH 4XNQB 5IB3B 3AVEA 3Q5TA 3LZNA 4IK7A 3ZL1A 5C71A 1KCBA 3UTTA 3SQRA 1NDGA 3BAEL 4B9ZA 3T8MA 4Y2DD 3U6XS 4HYTB 5IHZB 3BN3B 2BSED 3EDJA 3ZN6A 4IS6A 2NY6B 3D12B 3VXNA 5DTFB 1UGNA 4HGKC 1IC4L 1ZT1B 1T5WB 1MRCL 1IGJB 2XWBB 3EYSL 1CDBA 2QADC 4OZHF 1CLZL 3ZZQA 1KLFB 2W0FB 2J1YA 2Z4QB 4UQCA 3MUUA 3ZR5A 4QR7A 3SE3A 4N2DA 4XP1L 4FNRA 1N0XH 4PRAA 2F19L 2QHRH 4WW2B 5J89A 4L5FE 1UWYA 3L8QA 1N12A 4PVNA 4J3UA 5DEGA 5ABDE 1HINL 1JWUB 4FFZA 5F7BA 5KANG 4A37A 4AT6B 2H41A 3PUCA 1MFUA 2D03L 1BAWA 5F96H 3QULA 4KXCA 5BXFB 5DD0H 3IPFA 1JZ4A 4ZZFA 3TVMA 2C4FU 3NSFA 4FQXD 1PY4A 5C0BA 2B1HL 5T3XH 2QTVA 4H0GA 1P7QA 3CLFL 5JIPA 3ZGHA 1JGEA 2VW7A 4OW6A 1RFDL 4YDVB 1SXBA 2AEQH 3AB0C 3RPIA 3TT3L 1RU9H 4M5ZH 3P1VA 3NSCA 1YC7A 2ZXCA 5LBGA 1FSKC 5HHMD 4OZFH 5F88B 3WENA 5IY5B 2R1XB 3AAZA 5K59E 4OZIE 2WQ8A 3GQFA 2V8LA 3MJ7A 3LS5L 5KS9A 2MCMA 1XF4B 5DS2A 4UTCA 1DQDL 2WBJC 3VI4B 3PGCA 4MDIA 3RWEA 4OSUH 3H3KA 2EDBA 3ZYOA 1MHCB 2DY2A 4MLIA 1F58L 4ONHB 1GAFL 4M61A 1K5NA 2YK1L 4UAHA 4U31A 5B21A 2P43B 3QCVH 3VFTB 4X6BA 4OCMC 4XBPB 1PJ9A 3MACL 4U3SB 3UPRB 1U3HB 2R2HA 3TH2T 3FN0H 1AO7A 3QEGH 3ZTJH 4XMUA 3EH2A 5HHMB 2LT9A 1GGIH 5IMKB 1MN4A 5CJOH 1JHLH 3GHBL 1RJZA 3C6EA 3W9EA 1M7IA 2VDQB 4NNXA 1YNTA 5KSVA 3GSQA 2R2BA 4HHWA 1RHHB 5HI3D 5I8CA 2LFGA 1KB5A 1QLEL 4DNLA 1DSYA 3TPKA 4KH9A 3UMTA 4XP6L 2VLRB 4AQZA 2D3NA 3QT2A 3QORD 2JJVA 2EXWD 3FL7A 2AQRA 2X87A 3O3AA 3L2MA 3FQNA 1GR7A 4XXCC 5D4JA 1SJHB 4EZMA 1F4WL 1ZRUA 5C09E 1MJJB 5KYUA 2UV3A 3UO8B 1CDIA 4QRBA 5AENA 1RUPH 1QA9A 3JTTB 3NJHA 4MDIB 4CKVX 1P4IH 2LLNA 4U4IA 4BA8A 3OAUH 3RQ3A 1PKQB 2KKQA 3VX0A 3GK8H 1TZ8A 3WNMA 3EFOA 1MLCB 3BXNB 1I9JH 1BXXA 1M9WA 4FXGC 4HJGB 4QRUB 4YOKA 4D8PB 3BPNC 3T1WA 1P5VB 4JE4B 2DDQH 4FFVC 1FZOA 1JZEA 3IPBA 2FH6A 2ITDA 5DJDB 4AVHA 2CUHA 1MRCH 3O8XD 3ABKB 4L3EB 1DQQB 4GUOA 1AQDB 2CUIA 1HKLL 1QSVA 3O6FB 4UOQA 4JFUA 2YAFA 3H9ZA 4D0DA 1Z1WA 2BP8A 3U4EB 2D4DA 4FE9A 2IPUG 1A3RL 1OP3K 4QRAA 1CG9A 4X9HA 1I1YA 2NX5B 4JFSA 5CINH 3PP3K 4UBDC 3DIVA 4ENED 2AVGA 2CKBB 1BP3B 5EEVA 1NEPA 4LLQA 1WC7B 5DUPL 1U2HA 2P45B 3UCQA 4PGCB 4UT7L 2C9PA 3I6LE 1LHZA 1S5HB 1A6ZB 4P2OC 4XN2A 4B9IA 5LAPA 4W68A 1RZPA 3PABA 4OIIL 1UM4H 2E7LC 3ZHDA 5E1IA 2ORBH 5FGBA 4GAYA 4OV5A 4JZNA 5EIIG 1L9OA 1DZ0A 4UANA 1KLUB 1P5UA 1VDGA 1TJHH 4WFFD 2Q8AL 3R7QA 5B39B 1XGPB 5IJCC 2WZ5A 3G6JE 4OLXH 2R2EA 1WWBX 1Q0EA 3C09B 3GM0A 5D7JB 1PKOA 1UURA 3EFDL 1WWCA 2PYFB 4OFQA 3RWIB 4FXTA 3GS0A 3CX5J 5B7FA 4OFYA 5MI0B 4MQTB 5HDBE 4R5XA 2XICA 5KOMC 5KG9B 2W94A 2MQ0A 3MUZ1 2WSKA 3NFSH 3UDWA 5L0QC 4AEEA 1QHOA 1Z9PA 3FQUA 3NEOA 1S7TA 4H8WL 4F3FB 4OF3A 3GSVB 4IRJB 4XCEB 1A6UH 3RVWC 1PZ2A 4DGYL 5F1KC 3DXAA 3P9LB 2X53A 3MA7A 1A6PA 1KBKA 3UYPB 1FZOB 3CXHJ 3KBEA 1JYVA 1GYCA 2KQNA 3AT9A 4BCYA 1QSEE 3FT0A 2XLLA 3KGSA 4X7DC 1UZ8A 1X5HA 3O6FA 1KELH 4FABL 1J0JA 5DFAA 1JWMA 3FQTB 2AJXH 3ESOA 5LCVL 3P4OB 4YAQB 4XC3H 1S5IL 4YSOA 5D93C 3MTXA 4OZ4B 5AQ0A 1KJ2L 4FNUA 4MKMA 5ALBL 3RA7H 4Z76B 5AWNH 2WTRB 1CE1L 1MCOL 2V6HA 2EDMA 1WQVT 2AXJA 4NZDA 3VFRA 3GMOA 2OSLA 3ESMA 1OHZA 5I19L 8CGTA 3LRMA 2P5WE 1BAFH 3GINA 3G5XB 1XSOA 3R19A 2BIIA 5JLZA 3GT6A 4E42B 4Z7UB 3L5IA 4QRTA 2BJMH 3MV8D 1FVCA 3CVHA 3DTDA 4H40A 4WJKB 1N8ZB 2B59A 2FZ3B 4P46C 2NUPA 2PWEA 3IDMA 2GJ6B 2PLTA 4LAQL 4V33A 4X7EC 3FFCB 3CFKA 1OT4A 4QXVA 4DGIL 3ELQA 4C58B 1U4EA 1Z5YD 2IDCA 3F2LA 4KO7A 5I9QC 4OD2A 1YECL 2F53E 4FI7A 5HGGS 1W9XA 1CGXA 4KMTL 4JFEA 3QUYC 5MHSE 4LCCC 1TTRA 1MNNA 4N0RA 4N1HB 3ULUE 1J11A 2Z92B 3PHSA 2PWGA 3EJPA 2Z93B 1HXMB 2W91A 1BZDA 3EO9L 2CJUH 1Z9SB 3GMRA 1BLNA 5C97A 1XF2A 1DQML 3HC3H 3AY2A 4AQ1C 3CD4A 4YGVB 5F7KC 2CLRB 1HNFA 2XXGA 3HC0A 3KVQA 1SYSA 1TTUA 4QHKI 1WP6A 1J5OL 1ETZA 3MODL 1ZT1A 4FRWA 4R2GC 1F3RB 3PUUA 1MJUL 3M46A 2Y3NA 1FE8H 3C75A 5F7HA 4L5FL 3QH3A 4LP8A 4YAQA 3BH4A 1Q9OB 2DQ6A 3QCVL 3LEYL 2HVKA 3P11L 3LKSA 1DO5A 4P9HL 1CBVL 3DRQA 2ZJSH 3D85B 2ZKYA 3QDJA 1DUZA 4Y4KA 5AW5B 5F8RC 4HOMA 2MWCA 3VH8B 2VM3A 3S6CA 1QACA 1AXTL 3AM8C 1ZV5A 1GOGA 2RIKA 5T8IA 4ONHA 4PJHF 4M5YH 3VU2A 2H3NB 4Y5YA 2XJKA 4KKBD 4NUGH 3O6FD 1SMAA 5EA0L 1PQZB 4OCYH 2R15A 1YNKH 2RR3A 3QZWA 4L9LC 5JA8B 5CZKA 3N41F 2ARJA 4R26H 4F7EB 4LSPL 1NBYA 3L9RA 1TSRA 1KPRB 1VB9A 4ISVA 4U49A 3IETA 1B3IA 4PJDF 3MRQA 3WCYA 1W8OA 3J7HA 3P0YH 2ZX9A 1UVQA 3CFCL 2ZX6A 3EYOA 5DRWB 4O51A 2VZOA 1R34A 1X7QA 2HCZX 2K6ZA 3DIFB 3DROA 3LHPH 1KIRA 4OH2A 1QBML 1V55B 4NRYB 2YBGA 1FP5A 2NOYA 1XMEB 4PLOB 2JH2A 3CFQA 3WJLC 7TAAA 3EJYC 3PGCB 2L7EA 3PQYB 4LSSH 5AWNL 5D1ZB 5AL0A 2D9QB 3D2TA 4K8RD 3QDAA 4JE0A 3RDTC 1DJWA 4KTEH 1F6AB 3N2JA 3H3PL 2V5RA 3DPDA 4Y5YB 3BDXA 3NMEA 1SXSA 2W8CA 5SWSB 5FCSH 4DPRA 4H5SB 5DYOA 3M1CA 2C4XA 4F5CE 2NW3A 1IEAA 3MRGB 2JKXA 4FN0A 1WIPA 2PP7A 3IFOB 1J5CA 1N59A 2PWFA 1M9SA 4IOFD 2MRYA 1UCTA 1N3NB 4X5PA 2NYYD 5F7LB 3H4FA 2CR0A 3X13A 4HFWA 4B9GA 1DDHB 4FNLH 3V52L 5JHMA 4JMNA 1U8CA 1YECH 2APTA 4KHTL 4X7FC 4FQXC 5EZPA 1H0DA 4U0RC 4KMTH 4JM2A 4D9LH 1AS7A 1TZIA 4QRUA 4PJXF 2LVCA 35C8L 1UKQA 2IADA 2FH8A 2KUTA 4EI0A 3FH8A 4UZSA 2OMYA 1A47A 4G8GB 4B96A 1H3TA 3NJGA 2QPEB 4Z7VA 3RUGE 1OTUD 1KIQB 2ZF8A 3AWGA 3VD7A 4QHMA 1GTNA 4MNHA 1VJSA 1FGNH 3CX2A 5TGBA 3QZPA 4ZFGL 1NCIA 2CLVB 3QRGL 1FO0L 3FTUA 3O4LB 2R9HC 1O6VA 3O11A 4Z5RB 1BWMA 5DJ2A 4ZAKD 1ZJAA 2FWUA 4PWGA 3KBFA 4BFRA 5DHVH 3OF6D 4XMXA 4POZD 2UVEA 1Y1UA 3L7EA 3UBHA 4XB3A 1KYDA 1R75A 3IDXH 5D7EA 4HFWB 4WI6A 2G4GA 4KHXL 5DFVC 4XP4L 2EXSA 2ZCLH 2DBJA 3VFSA 4NX0A 4ZX6A 1QFWM 4PUBL 2D7OA 3N42B 4P2OA 5KSBA 2AQPA 4Z8FL 1NFDE 3B9KB 4C4UA 3W81A 3W2DL 2VLKB 4LSPH 1FLRH 2DQCL 4N2FA 4ORGB 1I9RL 1U93A 2PYFA 3AY4C 4KK9C 4QCIA 1M4KA 1FN4A 1EEUA 4L9LB 4NM4L 3EIFA 3QDMD 4LLDB 3ZKMD 4P2RD 1MFMA 4EVNA 4KU1A 5JHDB 3NA9L 3QIUD 2IOMA 1RMFH 3AXLB 5K9QG 3X12A 1FFOA 4J3XA 1AKJD 2DEWX 1UZ8B 3JYBA 3OXRB 4KMQA 3UGUA 3QXVA 1T6WA 3WLWD 5C1MB 2E7HA 3P4MA 2D31A 5KBDA 5KVEL 3ILQC 1H0DB 5DJ2B 5DVNA 3L7FB 4G7QB 1OOAA 5C0JA 5BQ7A 1CGVA 1LNUB 1XVSA 4LSRH 2GW5A 3KWXA 3ZDXB 4YXHH 4FQLH 4OZHE 5EO9A 2J6EL 4I48A 4GRWE 2PN5A 3ZLQC 2VERN 3WGVB 3ZTNH 5BUAA 3ESNA 1P84K 3LNEA 1MW0A 2CNZA 1PLBA 5KSAC 4N8PA 3DXAD 3ULUF 3CCHA 2Q2EB 1BFSA 1DO6A 2WKLA 5LN4A 4WEEA 4DN3L 2CQVA 1CXFA 3CHXA 2MSPA 5BJTB 1KDJA 1N0LB 5DEFB 2P42B 1F90L 5J06A 3VG9C 3BD4A 3LZFL 3HKZA 1TQUA 4PU2A 2EP6A 2O5XH 2OMUB 3G5YB 3PRZA 3UJTL 3NCCB 1LDSA 1FZMA 4KQ0A 2XETA 3GBEA 1OCCB 5JYMA 5LLIC 4NLAA 5E00A 5IVXF 2X4SB 3OKEA 1IGIL 3MJ9A 1S78C 1P7KB 5B38A 4NWTH 1EQWA 3GYRA 2VDOH 32C2B 1SDAB 3STZA 2QKSA 1D9KC 1XH0A 1U8HB 2C9VA 3DTUB 1SGKA 3WHXB 1SDDB 1N64H 2VLKA 5CGMA 4QRTB 2ICES 4Z7UE 1SUHA 2ATKA 2ENYA 5IW3A 3BHBB 3EOAB 5KVFH 1ETZB 5ALCL 3ARDB 3A67H 1I4FA 2ZP0T 2E7MA 3TBTB 2EICA 3LN4B 5I0XA 1OGTB 2YA2A 4A67A 2Y6TE 4YGVA 1MDTA 3AS2A 3L4VA 3TCTA 3Q6FB 1QYGL 2B1AH 4GFTB 5DLMH 3FONB 2AI0L 4ZSOE 4OCYL 3WJMB 5HJ3A 4NP4H 2HG5A 3QC6X 5KUMA 1NAMB 2XIBA 3QPXH 4XBGB 3WEBA 3FUEA 3V7AG 4ACTA 1GPOL 1PPIA 5SWZD 3L7FA 5A2JH 3S7GA 2A73A 5IZ7A 4X80L 3WUWB 4WDIB 4JREC 4UQDA 3E8UL 2J88L 3GMQB 3PXLA 1S7QB 3BKCH 1T89C 5DJYA 1E5BA 4JFDE 1QPPA 3MV7E 2COQA 4K3GA 3RWCB 3U9UA 3MX0B 3UCRA 2YJLA 4H44C 5FO7B 4WKXA 3I02B 5IMOB 1Z6JT 5T1KB 1XGQA 4GB9A 3FPYA 5B8CB 3GRWH 3VFUA 3CN4A 1WZAA 4BA0A 3OAYK 4PJXA 2L0DA 4IU3B 4NQXA 4GI8A 3NG5A 4N0UA 3NA9H 1R47A 3MO1B 3GSWA 3HCVB 4FXKA 4L1SA 4NC2B 3WS3B 4CBPA 3RURA 5KYXA 3BKYL 2NYZA 1BGXH 3CZNA 2W0FA 3X3GH 1R24B 4XXWC 4A38A 1H3PL 1RZ7H 4MJHA 4XNUH 4WV1B 1A7RL 3GB7A 5B38G 1MCJA 5B38B 1JGDA 1YMME 1YEGH 3U6XA 2J1KA 1M3IA 5CJXA 1BYOA 5SWQB 2J6EH 1EGJA 2WOBA 4GEJA 3OSVA 3GDCA 3PJNA 5SWSA 4Q74A 2L3BA 1RURH 2PUQT 4NUMA 4XWOD 5GRYA 4Q9RL 1JE6A 3DO7A 3ZKNC 3OKOB 1HZHH 5GRVL 1VEOA 4EI6B 3MRQB 1FV1A 4NQVA 2K1MA 2FX7H 1DQLH 3UC0L 1T20B 4HMEA 2F7QA 1HCVA 2Y7LA 5EZOL 1NC4D 2XTLA 2MPVA 4P23A 4TNEA 3UFIA 4WI9A 1MWOA 1KULA 2WNGA 3POHA 4QGTA 1M53A 3ETBF 4M7JH 4FS0A 4JRXD 4NCDA 2CRIA 3HHSB 1BW8A 1YN6A 2YKKA 4KGLA 2X89A 5F1NA 5ID0B 3LZLA 1EO7A 3ZE2E 4YJZL 4U6XA 3SN6N 4B53A 5IEKB 2DD8H 2IBGA 1FYTE 2R0ZL 4MAYB 5JPNA 3UX9B 3MRFB 3PWNB 3OG6B 1Q1JH 1TMCB 1DBKH 3HS0B 1HEHC 2BXZA 3UAAA 4UZGA 5C07B 4E9YA 3K8KA 2OTWA 4AOFA 3INUL 3P3RA 1P9MA 1IIIA 4BRJA 4XP4H 2VXUL 3MO1A 1K4DA 2J73A 1QRNE 2KZKA 1QYGH 2B1AL 4DP2X 5B22A 4N87A 4Z0XB 1ZPLA 4MA3B 5FYLD 5JOFB 3GXDA 2E4TA 4IMLB 3WFCH 5F89A 3KBPA 2R29H 4X6DA 4AGLA 4FZ8L 2RFXB 2B8OT 1EDQA 3NZHH 3V0GA 4M62L 3G5ZA 1Q94B 4LCIH 1I9RH 4G6KH 5IJDC 5DLLA 1GC1H 2AAVA 2IDQA 2MFNA 3RUGA 4ZUTB 4U1KB 3V0WH 5E6SB 3K8MA 2O26U 3BKCL 1MG2C 2H45A 3ARFB 4GRLA 3WLWC 2AQ3A 1RV6X 2EH8H 5E1HB 1O6SB 3KPSA 2QQNH 2Z0BA 5BZWB 3A4EA 4MJ6A 3TBWA 2WKOA 3UH8A 1Q72L 4AQAB 2B59B 2FZ3A 4G43A 1HNGA 4DCQB 2ZKHH 1P5VA 1W8EA 3H8NA 4JO5A 5F9OH 4Z7NE 2E3VA 1N18A 2YD7A 3IDGB 1XGYH 2JCCB 3M07A 1CICD 1XGRB 2HH0H 1L9TA 4KJYA 4HPOL 4GG8B 2DKUA 1MLBA 5D72L 2F1BA 3OQ3B 1KLGB 3MN8A 4ZTPH 4BKLA 3IGAA 4GXFA 4A7GF 5J13B 2GQHA 1KB3A 3UBXB 3MBWB 3TU6A 1KZYA 3KR3H 3PNWA 2CHWA 4HWZA 5CZVH 5A1AA 3DMMD 2CBOA 3EXLA 5AW2B 2DLGA 1RZ8B 4RGNB 3DVGB 5J6GB 3F6IA 3LRHA 1JPTH 3BGAA 4DN3H 3MRHA 5DXWA 5IROA 3QIBC 4LRIA 1WA0X 3RUGB 5FK9A 4IKIA 2Z31B 4DW2L 15C8H 1RK7A 3BQUC 3QXUA 2WLNA 4IEFA 1WYJA 2IQAB 2YPLE 3CLWA 3SDDD 1U95B 2PKDA 3LPWA 1WAAE 3SDXF 1E5AA 1FNAA 4MNGA 1RU9L 4M5ZL 3SDDC 5KYYA 1FFNB 1RIHL 3AQXA 2ZXWB 1N0LA 5DEFA 4HDIB 4L8CA 4B3EA 1X44A 2YR3A 5IQ7H 1D6EB 5PCYA 3NVQA 2NY1B 2J4WH 3NSJA 3DDGA 4CVWA 1E9OB 1ZK5A 4GQPH 4XPTH 3SOBL 2BP5M 3S4SB 1UYWH 4HOWA 3C87A 3PU7A 1D2OA 3QEHA 2ZSVB 5JXAH 1HILA 4Y2LA 2I25N 1TTBA 1T04A 1EO8H 2E9JA 2ED7A 4PP2A 4PN6A 5KG9A 5AB9A 3K46A 3ARFA 3DOHA 1CGWA 2F8IA 2BS9A 2RQ8A 3MRCA 4GRLB 1O9WA 1OKEA 3LQAH 4MQXC 2CO6A 1YY9D 4IOSA 2EO7A 1E30A 3WHXA 2FUQA 4YHKH 2WXNA 2AVFA 5C9JB 2IH1B 2MEJB 4AM0Q 1UASA 4H7VA 4N24A 3O4LD 4P2QB 4F8PA 4MJ6B 3TBWB 3CVIH 4DAGH 5JHBA 5TF1H 4Y19A 3U0PB 1XGPA 3P9LA 4LHJB 1R1CA 1QR4A 2M1KA 2NZ9D 4Y0GA 1INEH 1N5AA 1VFAB 3E8UH 7FABH 3HBPA 4XNYL 1QBBA 3PL6C 5D1QB 2J1XA 3IDYC 2CK0H 3OF6A 4YSUA 2COVD 5F1OB 2Y1YA 1JGVL 1HX0A 1K4CB 3FCUB 1GCFA 4PRHE 1I8LC 3C2AH 4NQUA 5ABAA 4JO4H 2B9AA 1FG2B 1ZT4A 1TQSA 2OQJA 2QQLL 4OZHB 4Q6YA 3QJOA 5IWLC 2VR5A 4S1SH 3MBEA 3U7YH 3APNA 5IJKA 4K7FB 1P7KA 3OAUL 3AABA 3PAZA 1ZHNA 4Q7DA 3GIVB 4Y2DB 2ZXAA 3EOAA 2WXGA 3ZDZE 5I73B 1NCBL 1SDDA 4IBUA 1QSFD 2KLRA 3PJLA 3UEZA 4UQEA 3I6GB 2R7EA 5E7BA 3EH4B 2JCWA 4NDMA 3QO1A 3IMUA 5L2KB 4JRXB 3SGJA 2XHNA 1PG7L 5EEUA 1I3RA 3WD5L 1MCPH 5KJRL 4WENB 2CO3A 4TLSA 4Z7IA 2XWRA 4GMSL 3B5GA 3EO0A 5EN2A 1UXMA 1TQVA 1S9XB 4M8QB 4OLWH 2FIRT 4TSCL 1T3FA 2VW6A 3AQYA 3VI4A 4JQVC 4G6JH 4Y4HB 5H35B 3HCVA 4FXKB 4UT7H 4Z7QB 3S98A 1NCOA 3BWZA 3W82A 4K5LA 1FG2A 4G8EA 1D5MA 1ODUA 3WOVA 4XI5C 4EPSA 1XGQB 1A02N 2ZONA 5J13C 3N42F 4GT7A 4PIBA 2Y22A 4OFVA 2IH1A 3FTWA 1CDHA 3T65A 4JFDD 15C8L 1DVUA 5IMOA 5CEYB 4RIRA 1J5HA 1DJIA 1DZBA 4AK2A 4HS3B 1VGKB 3VJ6A 5I16A 4TSBL 1YHPA 4APQC 1K72A 1VFOA 3S37L 3CLEL 4UTBL 3ESVF 5AB1A 1T2XA 3S3JA 3T4AC 1ND0A 4IRZL 1MIML 1SVBA 2AGJL 1DVFB 5AUMA 3T0ED 3NSXA 5I66A 1IBFA 3GGWA 4HC1H 3K6IA 3HR5A 4FG4A 4Z0BH 5GRXG 3JWNE 1AR2A 3EJCA 3EYSH 2XZQL 3RILA 1MEXH 4JFEB 4BFGA 5AYUH 3VWKD 5SX5H 2IAMD 3NZ8B 4K7FA 4A1RA 2A77L 4Z7WB 3L45A 5IBUB 2C26A 3P3TA 3ABGA 3FB7A 3DV4B 4PCSA 5E4EB 2Q3XA 3DXAE 3LZPA 1QSED 5FB8A 1YUKB 3VB9A 3WFCL 2DDQL 4H0LC 4QRPE 2NZIA 4S1RH 1TJGL 1PZBA 4FKHA 4EN3B 5I28A 1NPJA 1JGUL 5DFVD 5T1KD 5IEKA 1SM3L 4U1NB 3MLPA 2G9HA 3CDFA 4FFVD 3K4AA 1VEPA 4D7BA 1INQA 1UACH 2HTKC 1WD8A 1AMXA 4IDLA 4PBXA 4YUEL 2OK0H 4F1ZA 2HTKD 3CC5B 3NIFB 5EC1B 3T6WA 4LHUB 2WLLB 1GSKA 3EJZC 1FFOB 2EUXA 4KKLD 2YGOA 5F9WC 2OMXB 4NO0D 5JOEA 1ZA6A 1QSZA 1WICA 4N5EC 2W80C 1WC7A 2Z7UA 3CLFH 3F7QA 3MGAA 5CHNB 4A7TA 4AX3A 4X4YB 1MCOH 2PETA 2YD1A 5FOBA 4YQXL 1MKFA 5KYUB 4XHJD 2WQAA 1HJCA 1IKNA 3QI9B 3VGFA 2WUCH 4N90E 1PQZA 3IU3B 4Z77B 1F3DJ 3B2PA 4ONGL 4OIIH 3WL9B 3UAJD 5K59F 1YVLA 1MCCA 3OAYH 4JRYA 1PX8A 3T8XB 1YZZA 4I48B 4JCWA 5D72H 1LP9F 3BPLB 3TEUA 2CO7A 3DSFH 4G9FA 4JDTH 3BEVB 2W9DL 2WXMA 1JTOA 2R56L 5DZLA 3HR6A 3SGKA 5I16B 3AG4B 5AW7B 5JORA 3HS0A 2BP3A 1OOWA 1M05B 1ET7A 4OLZH 5C07E 4IIZA 1CGSL 3STBA 4KI5E 2WVTA 5HGHA 5I5RA 1SRDA 1MH5B 3OR7A 2EDJA 3L4WA 3S4SG 2G0KA 3UYRL 2WVVA 1AVAA 2ZX8A 1RH8A 9CGTA 3TS8A 2EDXA 4NO3B 3N40P 5CAYB 1OP9A 1N59B 3ISWA 4ADIA 3N85L 5BV7H 4G6ML 2B4CL 4AMKH 1J12A 4YPJA 1RIVH 3UADA 2DQHH 4KJWC 2OL3B 5ACLA 1AGFB 1JXKA 4A55A 1EJOH 3E6HA 3RKDD 1UC6A 3JWNH 5TDPB 5I1EH 4DCQA 1RP8A 4GYBA 3WE6A 3L5HA 2F53B 1UQSA 4QNPF 1E5UI 2W65B 4DP1X 1SYVB 1ACYL 3MLRH 3T0AA 2ILLA 3L4UA 3V4PL 4MYWB 3WKYA 1JZ6A 2VWEC 4LPCA 4BQ8A 4DOHE 5CEXB 1RZFH 3QXAB 5DC4B 4YXKH 3EYQC 4KVPA 4G7YL 1UTDA 5D1ZD 1IAKB 4E68A 2VDNL 4G9FD 3RA7L 1AJ7H 3MLVL 4AJWA 1JWMB 1YMMD 5DSCA 5E6IB 3QNYB 3LH2H 3SSGA 4EUPB 1PDKA 1RK0A 3U4BH 2NY3D 4HAGA 2MPAL 1S7RB 3L5XH 2IANA 4L3FA 1TSHA 2EZ0D 2QADD 2A77H 2JE8A 4NM8L 3SDXB 1O0VA 4PY7A 2EZ0C 5DJXB 4ZTOH 5BS0B 1AHMA 3WIIL 3MLWL 1E67A 2F7PA 4YDMA 1IFGA 1KDIA 2ADFH 4KKPA 4NAQA 3WHE1 4HUCA 2QVMA 3DBXA 2JQAA 2NTFA 1VADB 1LK2A 3ROOA 4L8CB 4HPYL 1YEHL 1JNNH 2XQYA 3L08A 4I77L 2YPLD 2DPKA 2NY6D 1MFNA 1QQDA 3DVNB 4JO3H 3BW9B 1ITCA 4POUB 5GISH 3SDDA 4I0PC 4A2LA 4H1LH 2OX5B 1PTZA 2ORBL 4E0RA 1O9VA 2XUWA 4P9MH 4LDEB 3UPCA 4GBXC 3A47A 4OT1H 4ZOCA 4V1DE 1W15A 4YHOH 5TQ2H 3X2QB 3AXLA 3SPCA 4KRLB 2MCPH 4LVEA 3V4LA 12E8H 2HRPL 2NQCA 4G1MA 5L9DL 4N86A 1I9EA 3KEHA 3EFDH 4AYDC 1EO5A 2OR9H 1FQ9C 4KO9A 3L1EA 2P1YA 3QEQD 2FTAA 4OLVH 5L2KE 3VNZA 2V37A 1MUJB 4XNAA 3B9KA 3R4RA 3SDXA 2WN3A 4XBMA 3QI9C 3EAKA 4GAJH 2DBLL 1HVXA 1U93B 3HNTL 4NN5C 3ARBB 2QMKA 4AZ8B 2H9GB 3FSOA 5KZCD 5E24E 3Q05A 1QTYT 4AKQA 3EYFA 2HX9A 2AMGA 1HAUA 2X70B 1N5AB 5E8NA 4E5XA 3PWVA 4F20A 2I27N 1I3RB 2N0MA 4QO1A 3X1EA 2OL3L 3GXIA 2YOCA 5FGSA 1FAIH 3SKMB 3TTYA 4BEIA 2VL4A 4JY5L 1ZGLA 2FATH 3FJTA 2ZZUT 1VSCA 4IRSC 3FO1A 3C08L 1YY8A 4YX2H 1ZE3C 3N40F 2ATPB 4G3YL 4Q6IB 3TIEB 4LNRB 3TONA 1XZ0A 4PFEA 3LRLA 1VACB 5B1JA 5B4MD 4LP5A 1GZPB 2EDFA 1NANH 4AEHH 1GW6A 1NCAH 2ARJB 4F7EA 4KBPA 1JZJA 3UTTE 2E7LA 5ALBH 3Q13A 4F15C 5IJBC 2XQYG 3K5RA 4S0HA 2ZWSA 2I5YH 2DL2A 3RB5A 1PZAA 2WXQA 4AUJA 3B34A 3LHPL 1GGCH 3NCMA 3K6OA 1JI2A 4HS6A 4E0RB 4XWGL 1DVFA 3ILPB 4JUSA 5C0CE 3G9VA 4GG6F 1QSFA 1S7XB 3N5AA 2Y5QA 3QDJB 2ESVB 4WKZA 4Y4KB 1AC0A 3F5WB 1EJ6A 3FU8A 5DDHB 3VD3A 1KCSL 1IC4H 1KBWA 1QFPA 1QO3A 1JPST 3E0GA 5E00B 3ZXAC 3G5ZB 2XBTA 3LIZH 3IDXL 2X1PA 3OAZH 3NRPA 3APFA 2BY3A 5A6IA 4KTEL 3VXSE 1DQVA 2FD6H 1UM6L 1KXHA 3DRTA 4WSKA 2Y7NA 3FB7B 5FFOA 5I76A 4I9WD 3QDME 1TETL 3REWB 5LQBH 1QFOA 3W2DH 5FM4A 3BJLA 3GFUA 2DM4A 3U9UB 1MVYA 4WO4C 3JXAA 1C16A 3SPVB 5FUCE 1IGJA 1OL0A 2XWBA 2ZOKA 3UBXG 5D1QE 3RX8A 1CLOL 5JDJA 1TVBB 4KTGA 5BS0D 3Q1EA 3H6AA 1ZA3A 3MLZL 5GISL 3MFGB 3OLGA 4Y8AA 4PR5A 1OAJA 1N10A 3QAZB 3SO3C 1Q9WA 5I2IA 2H2PD 5EN3A 1IB5A 2XN0A 2ZD0A 3DYMA 4OLUH 1PZUB 5DUBA 1VGEH 4MMZC 2K8QA 3DDFA 5M94B 3DV4A 4CGUB 2QSCH 4HJSA 4ESKA 4K73A 3Q06A 3H9SE 4WGWB 5DDHA 2GSMB 4FQIL 5DJZB 4L3AA 2J3SA 4UYPA 1YRKA 3MFFA 4U0RB 1U8MA 3DIDA 4DP0X 4HLEA 3SQBA 2HKFH 4M61B 1N6VA 3R8QA 5F7MC 2CO7B 4G9FB 4KKAC 3UC2A 2C1OA 1UA6H 3PP4H 1BX2A 1SNRA 4XOAA 4WU5A 4Z23A 4CVXB 3GEFA 4XHQA 2WLLA 3CSPA 1FNEA 2UXVA 5IQLA 3CFTA 3MJ8B 2B4CH 4AMKL 1QZ1A 3A6BL 4Q8BA 2CIKB 1JBJA 5J1AA 1LO2L 2WW8A 3RVWD 2ZOLB 2YXMA 2R4SH 1E9PA 2WUBH 3HFMH 5EBLB 5CHNA 2RTTA 3L4XA 3P0YL 4FXLA 1G5GA 5I2IB 5EZIL 4HH9B 5INCB 3JWOL 1JN6A 1T04B 5FPIA 2B2XL 3H9SA 4GUPB 5H37H 3HRZA 2N7SA 4CW1A 4W9LC 2GJ6D 4K3EH 3QR0A 4YL4A 2IF7A 4XN4A 3SQOL 5C0AA 2Y6SC 2FLBT 3MOAL 3OWRA 4S0SD 3U1PA 4XPGL 5CR8A 4Q6IC 3VGHA 3LNFA 1ETB1 2DMKA 3QRBA 4LEOA 4YE0A 3VFPA 3RY4A 4R3SB 2WLIB 4PW9A 1LWHA 4PEEA 1E5YA 4UF7C 1KUMA 1T20A 1Z5LA 3L5XL 2E27L 5HDBF 2XV3A 1A0QH 3ETSA 4ALAL 2IIJA 5D1QA 2ADJB 2ZKMX 3UO1H 3WJJA 4ANVA 3D30A 4Q58C 3SDAA 2V5YA 3N43B 4PWFA 3V4UL 1KIUB 1NLBL 1A3LL 2CGRH 3HBZA 4DPCX 4YXHL 1WBYB 3QDMA 3D4GA 1T0NA 1XD0A 2PW1A 1R3KA 1GZHA 2FD6L 3IXAB 4AQ1A 1A3RH 1AZRA 3VXSA 2HPOA 2EXYC 4PJHE 3QQ3A 5AZEL 4ZQTA 3MU3A 1PZ3A 2R4RH 4PJFF 2H5UA 1TLMA 4N26A 4XPFL 5EUOE 4DVBB 2FVNA 2BP0B 3LEVH 5C0CA 4QRSA 3SGEH 2ZT9C 4XNMA 1W0VA 2XQYK 3SE9L 3DOSB 2ZICA 5BRQA 5J9PA 2JQMA 2JJWA 3AADB 4X9BA 4HF5L 2F8XC 3BVVA 2D7QA 1J1XH 1T83A 5JUEL 2Q7YA 2A9CA 5F7YC 4ZFZA 1LP9E 3VVVA 5LXVA 1PZ5B 5FFLA 5HYJE 2P5WD 4OFIA 5LDUA 4HSAC 2Q8AH 2JVUA 2A1WL 2WOYA 1Z5HA 2A74C 1VGEL 4K8RH 4M7ZC 5DA4A 5AALA 1LNUA 3F7VB 2C34A 3QEUA 2ZUYA 1FZMB 4GIAA 3O6KL 2I07A 5DUML 5IR1B 1D5ZB 1WVZA 3GJEA 4NQSA 3JV0A 1RKRA 2Y07L 2EYSB 4J23A 2BX5A 2AHIA 2IG2L 2BVOA 3CH1A 4XE5B 1GMIA 2OYPA 1KLUA 1P5UB 3QDJD 4LEOB 4Y4KD 4D9QD 4ERSH 3ARBA 3S5LB 4JFTA 3D52A 1BBDH 5E0QA 4U7SA 3POCA 1MVFA 2K8MA 3UZEA 3RHWK 5BOJA 3G08B 4DKFL 3RWFA 4PWJA 4LDOB 3ARRA 1CZ8H 1T2QL 2DW5A 1T1WA 1DVTA 2OX5A 3NSYA 2PCPA 4FEIA 3HFML 1G6RA 3JWDC 1CVRA 1RZGA 4WWKB 3WNOA 4APQD 3FT1A 1BQLL 1I31A 3V7AE 3SDXE 4FCHA 4R83A 2Z64C 2NY3B 3TFBA 4P9HC 3O6MH 1S7QA 4LFHD 3VSQA 4L4VD 5ACMA 4ZFFA 5EF2A 2G4EA 1T5XA 3BN9C 2Y25A 2V9RA 3KPQB 1TPXB 4CSZA 1Y07A 3VI3F 3VXPA 3BIKB 2WYIA 2OJEB 4V1DA 3BLKA 4QNPE 2F08A 1DBKL 1UD2A 4WI0B 1QFUL 5CD5D 4QOKE 5GGUB 3K6SB 4Z1PA 1KGUA 1AXSA 3MYJB 4F58H 2Q7YB 5JW5A 4PJGF 4R96A 1BZQK 1HHJA 1RULL 4QJ3B 2EUZA 4BWUA 1KF9B 2IEPA 1O5PA 2XV2A 4GUQA 2G2RA 1DQTA 3RJOA 1OAUL 3E3QC 3U79A 2JIXD 2QZQA 2C9RA 4JFOB 4AE1A 5SX4H 1HHGB 3HMXA 3U7WL 3QISA 1M1XA 3H7BB 5I5MA 1PD0A 3IWVA 4CVUA 4TUKL 2GBTA 3DRTB 1R3JA 2M2DA 3MRLA 2IANE 4UM8B 1N6QL 2F54D 1BMWA 4JHAH 3NJLA 5FYKL 3RWCA 4WV1A 3NDYE 3SDAD 4GIPD 1QW9A 3WDHA 4ETQA 1CUOA 5D5ME 3WI9A 2K9UA 4WFED 2AEQL 2XY1A 1H3WM 3O4LE 4AGMA 1ADQA 1VERA 1TO5A 1I8MA 3FFCD 4FI8A 1XF2B 3T0BA 5E5MA 2R2HB 1M05A 4NQXB 1FLTX 4HV8B 2EDKA 4H26B 4ODBD 2H7WA 2NDGA 3LS5H 4H0IA 2BVPA 2JB5L 2NY2C 2WXPA 4HPHA 4JKKA 1L0QA 1NOFA 3S5YA 3KPPB 4OQTL 1RZIA 4I89A 2Y7SA 3RJQB 4DKDC 1FUNA 5AW1B 5JQIB 1R3IH 2QGBA 4TVSa 4U7MA 2HVKB 4G80A 4NAMA 3F5WA 4XO4A 5BMFL 4HC1A 4FGMA 3B9VA 1GAFH 4LCYB 5D2LE 1W80A 4PSRA 5FO2A 1NOLA 1TTAA 3LDBC 1WZLA 3O3AB 2A38A 2DOCA 2F18A 4BJLA 5J5EA 1KCRL 4PIRF 2GTWA 3HUJF 3MFFB 5F9DC 5DT1H 3E80A 2J6WA 3O3BA 3CZSA 4DN4H 1GGIL 4L0YA 1L9PA 3AS1A 3IMWA 3EGSA 4KZDH 2JXMA 1IAMA 5ID0A 3F58H 4IJ3B 4NDMB 2VR6A 1U8KA 1MCSA 4NQQA 1FNEB 1EPFA 4QPEA 1B6UA 2W9EL 5EBWA 1HQ4B 4XP6H 5EO1B 3JWOH 3SCMC 1KEGL 1AQ8A 3IETB 2BRRL 5DFWH 1HTYA 4M3HA 3T0EC 5JPMA 4B5ZA 4M93B 5BQDA 25C8L 2N56A 4IIQA 4K23H 2OKMA 4TUUA 3T3PB 3BOVA 1OGAE 5D8JL 5GSRA 4AG4L 2AF2A 2DJUA 3C12A 3OKLB 5K9JL 1T1XB 4CMHC 4KV5E 2ZWYA 2VABB 3KH3A 3VFOA 2VUKA 1EEZA 2YAMA 3MREB 5MERA 2DIAA 3GBML 1VENA 5GRWA 1QLFB 1ET8A 3PQYD 4PRDA 5ACZA 3QUXD 1OD9A 3N1MC 5C09B 2BOCB 1BQUA 4WNJA 3DKHA 4N6RB 3KPRB 1BVKA 5I1LB 3C5SB 2QHLA 1U92A 2PW2A 1A6AA 2XZZA 4DKEL 1HK6A 4GQRA 1YEGL 2X4QB 2IMMA 2LU7A 4HIIA 4OF6A 4W6WB 3MUHL 4PW3A 1A65A 5IF0A 1GS7A 1T6VN 2NW3B 1QQDB 3S8FB 5AW6B 4DP6X 3NTCH 1MCWM 1PMYA 4XTRD 4IMLA 4NP9A 1AI1L 1FSKB 3OSKA 2X4NB 2P3YA 4WW2F 5HP5A 3KVDD 5HGBA 1WFOA 2IVFC 4P0DA 3V6BR 4NQTA 5IHLB 1LE5A 1CE6A 2DIBA 2WBJB 3AQDA 1MI5B 3CZJA 3MRPB 5TTRA 2NYYC 5D7JD 4K3JL 3F12B 2GJPA 4M6AA 5LG1A 2Y2TA 4DP9X 5KSUB 5KN5A 4N8UA 3SZ6A 3X3FH 4GOSA 3OMAB 3HRZB 1KOAA 3P9WB 4JHAL 3MRBB 5FYKH 3RVTC 1GHFH 5HHOA 2P8LA 3GPEA 3ZTEA 1DEEA 1JTPA 3KLKA 1X9LA 3JTSB 2X1QA 1FIEA 1QMUA 3KNBA 1L0YA 3MV9D 4WHCA 1CU4L 3QHZL 5KVGL 3L1OL 2VSCA 3ARGD 1TZAA 1ZDQA 1E9QA 2R0ZH 4JN2B 1OTUC 1JPGA 3D18A 4ONFL 4YHMH 3WFHB 4ZMAT 2D73A 5EFIA 3D4YA 2D9CA 2FBOJ 4O4YL 1NINA 2AK4B 1UYWL 2IWGA 2WANA 4F57L 5ISZD 2ZTBA 1JTTA 5JXAL 3IGAB 1MCHA 5DJCB 2A83B 3BP5A 2BSSA 4H8PA 3D0AA 2FR4A 4D2NA 2X4NA 1CFTA 1HILB 3D09A 4MAUL 5E99H 2FCBA 1QSFE 4LCUA 3LNIA 4OZFG 4ZMZA 2VRAA 3L95B 1Q90A 2PMZA 1WLHA 2R0KH 4R90L 4BZ1A 2VE6B 3U25A 4UILH 3TP4A 1VACA 4U1GC 1A7PH 3ZY7A 3V6ZA 2Z7YA 1K2DB 1KWGA 2FX8H 3FCTA 2UZYA 4PJ5A 1LD9A 5I1LA 3KYKH 1G1OA 1D5ZA 3FXIC 2CO6B 1SLWA 1KELL 3UG3A 2W9EH 4P5TD 1FVCB 3CVHB 4G7VL 4PHXA 5L4MA 1A1OA 1SYVA 1W72L 4N2OA 1L7IH 4Y19B 3U0PA 4IJ3C 4HFUH 3CHOA 3FUDA 2VN7A 3O6FC 3TN0A 4AVJA 2G3XA 4Y9CA 4EVNB 4E9VA 4ZFZB 1KWKA 2PO6B 1G6RB 3KL0A 3TYFA 2HSIA 2YQ3A 4OAWA 2MNJB 4PB9H 2YOAA 3MNZB 4YBLB 1XO8A 3MI6A 1EGJH 1P4BL 1MAMH 4R4ND 4NM4H 3VFNA 4KO6A 2X4PA 3QJSB 4JPIB 2VXSL 2FEDC 1E43A 3PDGA 5E6UB 1RXLA 4C56E 4QF1B 1JRHL 4Q0XH 2IH3A 1FG9C 4MJ5A 3FU9A 4P2OB 3HG5A 5ELIA 5C0GB 5HY9B 3ULVC 4N9OB 5I76B 3B9AA 3OKNB 3FTZA 3H2WA 2P8LB 1DSFL 1TCRA 2VB5A 4OFDA 4J28A 3V0VB 5GZNC 1G84A 1Q0XH 5CLWA 3T2PA 4M6NL 4PRHA 3PV6A 4PJFA 4WNSA 1RI8A 5I73C 3U7WH 5CBAB 4HW6A 2DKSA 2HUEA 4JKLA 1TQCC 5AVQB 1LK2B 3I6GA 1AZNA 1ZHLB 5L2KA 3IGLA 2XTJB 3NAAL 3CCHB 1E40A 1N6QH 2VXVH 3NA4A 3WGUB 2JKSA 4F7TB 2AKRB 1SF5A 3CU7A 1CPUA 3ULUD 3AREB 4BHUI 1OGPA 3DX4A 3B4NA 4PS4H 3M88A 3ZGIA 1TEFA 3TVMC 1CMOA 3MXVH 2QGEA 2XFGB 3PDOA 1C8QA 3TBVA 5MI0C 1MJ8H 1S9XA 2H47C 1PLGH 2Y7OA 4XR8C 2BW5A 1Q8MA 1GYVA 1B4RA 5JPNC 3MKGA 4WJ5A 1Y0LA 3FQ4A 1NFDF 2H2PC 3HAEH 2O5XL 3T3MF 2HRLA 4YSPA 2ITCB 1NEZG 3BIAX 3IVKA 3HPJB 2F7IA 4UUJB 3P2DA 3K6SA 2P8MB 1QWUA 2R7EB 3ESUF 4TSBH 2W0LA 4WNQB 1YAIA 1FE8L 3QWOA 1JXJA 4FTVB 4OCRH 4Q9QL 1OZTG 3FKUS 4AZ8A 2Y0SA 4DEPC 3T6ZA 5HTSA 2OZ4A 1M6UA 4KKAD 4MNGE 4XMLL 5I6OA 1WAAA 1BF5A 5H4YA 2UX6A 1E9PB 4LU5H 4ZMTA 1II4E 5KVFL 4PG2C 4Z6AT 1L9NA 3QIBA 4PG9A 3ELAT 5D93B 1JNLL 43CAA 1DVFC 3TOPA 4MAUH 5E99L 6FABH 4GSQA 7FABL 1GTFA 4C55A 2P7TB 3HW7A 5G4MA 4JANA 2AI0H 5E2UL 3MLXH 1SEBB 4BQBA 1K8DA 1J0KA 3KYOA 4UB0H 5GS1B 4HV8A 3VGGA 2TAAA 1CTOA 4MX7A 3CBKB 1RCYA 5DMIH 3QJUB 5B1JC 3J07A 4ODTH 4TVPD 2JKIS 3GIZH 4HAFA 5CN1A 5JHLH 2CMRL 4XH2A 5HI4D 1IAII 1ZS8B 3ZL4H 3NCJH 2YGVA 4JFXA 4IM8A 1F4XL 4JRYD 4B3VA 1AJ7L 1F18A 3W39B 1IZKA 2EDRA 3MRIB 5I9QB 2HLAA 3THML 3FB5A 1B0WA 4NSKA 4U3XA 1IGML 4ONGH 1R24A 1OLLA 4LDLB 3AG3B 2O6PA 4AWJC 5K9OA 2H32A 1DJGA 4LCCB 1WFMA 1AMYA 1N0XL 5DGQA 5T1LB 3DUSB 1D7CA 2ADFL 1DSFH 2XWTA 2Y4SA 3FTGB 2VDQL 3CFDB 4N6RA 1SBSL 4OD3L 3VYNA 2DQEH 4XNUL 4PJXB 4TF4A 3VGEA 3WO3B 1MFEL 1NCJA 3NZSA 4R4FL 2NY0B 4NKMB 3STLB 3RFRA 5TPWL 2CK2A 1BVKB 3HS9A 4IMKC 4JRYE 2UWEF 4JDZA 2ADGB 2VIRB 3EDFA 3LMJL 4ZMPA 4HIHA 2XRAH 3U30C 1KJ3H 4LK4A 4F7MA 2VABA 4IBTA 3VTMA 4FCAA 4NFDA 4L23A 1FH2A 3O6LL 1AIFA 4DQAA 4F1SA 4M8RA 4KJPD 5GSRB 2KZBA 2RB8A 4J3BA 4HXBL 4KPHH 4OZFB 4PJDE 3AS3A 3X11B 1G0XA 3GBNH 5JYLA 1PLAA 4JZOA 2FWOA 4JFZH 1G9ML 5C08E 1Q4NX 1LWRA 2X4UA 3IU3A 4Z77A 2ZF9A 1XCTB 4MMXA 2MHAB 2WZPA 1GIGL 3MRPA 2Y69B 2O72A 4GBXA 5CIPB 1PAZA 2BZCA 2OR8A 4M7JL 2WYZA 4FTDA 1FRGL 3DO7B 5IBTL 1OAZL 1MEXL 4BGLA 1IBDA 3S5LA 2WBKA 4P59L 1CR9L 1FIGL 3FUIA 3FUHA 2HTLD 2QPUA 1JOIA 4K71B 4ZUVA 2YK1H 1RJCA 3P3SA 5IREA 3MLSL 1L9QA 2DD8L 1ZVSB 4B7LA 3TPUB 3GO1L 4KAQL 5FYJH 2Y5TA 2VMCA 2LU5A 1F2QA 4XMLH 5FCUL 3MGTA 3UZQA 1VFBA 2VQ1A 4YHIA 2ADGA 2VIRA 5J1AB 4LIQE 1GXEA 5GIRB 3C08H 3RP1A 4HU8A 5SWSE 5F6HI 1C7SA 4PRBA 5H4ZA 4LE8A 2GSGB 2MH4A 4XN5A 1IKOP 2PCFA 3EJJX 5D1XB 4UM9A 5D2NE 4TLUA 4APQA 4Z18A 3M17A 4G7VH 1DHKA 2F7RA 2K4WA 2YSTA 3CXFA 3OMZA 3U2IA 3VE0A 1W72H 3RZCD 2C3XA 5IVXB 2HVBA 4JZOB 5C0EA 4UB0L 4X99B 4JFYA 2FECI 3E6FB 5IVZA 2IANB 2X9WA 1JF6A 5KVGE 4Q9CA 3L95A 2X42A 4G7SB 4PJIF 4DK5A 3APDA 1AP2A 1NC4A 4I4WA 1H5BA 4P23D 1ZIAA 2ZYHA 2TSAA 4HT1L 1NBZA 2WP3O 1NJ9B 4JCMA 4OD1H 1V05A 4XODA 5DD0L 3U6RB 3IJHB 4WCYL 3WSQH 5D2LF 1T4KA 1UWXH 4N0UE 3GXUB 1LO0L 1PZSA 4HHGA 2ZG2A 4U6YA 3S8WA 2X2IA 2DWEA 1NCWH 3ZKXB 2N4IA 4JY4A 1U8JA 3ZUCA 4KZEH 5KW9L 4OZIB 2B08A 3BW9A 5FHAH 4BUHA 2A0LD 3GZQA 2FJGB 3HHRB 1VFBB 5GGTA 4TPRL 3MLTA 3VI4E 3VGAC 3MV7A 4HUXA 5EZJA 1K2DA 2OP4L 2VRQA 3HFFA 4QF1A 5EOQH 4KX8A 3BZEB 1PG7W 3PNWB 1ZANH 2MHAA 3IRCA 5AYQA 4B27A 3OMNB 4KNSA 4N8CL 3OKNA 5IB1B 2EUVA 2DBLH 3UIZA 3LXBA 2CRMA 5A6MA 3W5NA 4NFCA 2XY2A 2DQEL 4HK0B 3PAUA 4G6FB 3OX8A 4XCFL 1JYXA 4P2YA 3NFNB 5HI5C 3EGDB 4LSUH 4E5XG 3OKKB 3ZL2A 1S7SA 5AZ2H 1A4KA 1KIUA 5E8NB 4PJGE 1BQRA 4FFTA 4PRBB 5GGTL 5SV4A 2VLKE 3M6DA 4X5LA 3CN2A 4PJ7F 4R0LB 2JKNA 2WTOA 3ZOAA 5FAAA 3MTRA 5AW8B 1ZGLB 2AERT 4Q9QH 4ZDHA 4YMPA 3DX7A 2LHAA 2Z34A 3BKJH 3EBGA 1PL3A 1V7MH 2D7TH 5GS2H 1J48A 3FQXA 5FDYA 1IVLA 3ZZSA 2VH5H 3NH7L 3TBYA 2YKLH 3JV4A 2W0PA 3SKOA 4Y4FD 5JLZB 1RUQH 2H9GA 4Y19E 1SJEB 1KV3A 4MNGB 4RMVA 3E38A 4JG0H 5ITBH 5ISZE 1Y1DA 4OJYA 2XI9A 2V8MA 3H55A 1MRFL 4KFZC 5DJ6A 3VX1A 4NS0A 4LQ1A 4F7TA 3QWQB 3HI1A 5F7AA 5HDBB 2O5ZH 4PVMA 3F7YB 3ATBA 1IL1A 3NQIA 3DJSA 2HKAA 2EDWA 3L3GB 1UH2A 2JK5B 3FYIB 1AO7B 2AQTA 2FJGA 2YUWA 1OAYH 2GJZB 2WLJA 3ILPA 4EI5A 1Y6NR 1IAOB 2QGCA 1E8WA 2HFFA 2J44A 3QORB 4FNPA 3MRCB 2OQJB 4WJ5B 1BQKA 3FUMA 1LO3L 1A3QA 4M6OL 4HWBA 1J8KA 1XQ4A 3W11C 4A6YL 4MMYA 3BFWA 3NCJL 5F7WC 1VIWA 4MD0B 5GZNA 3L2LA 1ZTXH 3ABLB 4ABQA 5I1AB 1T4WA 5D1XD 3P02A 2YPLA 4X0KB 1F1GA 5KVDE 5L9DH 6PCYA 3T5WA 1ZPUA 1SDYA 5I19H 1Y18B 2E8YA 4HIIB 4WI0A 5L6YL 3O4OB 2E27H 4GRWB 1JZFA 4Y5XB 4N1EA 4N2KA 4UYQA 1AFVL 5LGHL 2XTJD 3QCTL 3K2UH 2YPVH 4BE5A 3KPLA 3BRFA 3IN0A 4IYKA 1H3GA 4F7CB 4JN1L 5DJ6B 1ZS8A 5IESL 1N5YL 2FJHA 2R0LL 2ZX7A 4AC4A 3D85A 3MCYA 5A2LH 2GTZA 5KSBE 2MOGA 2V2TA 4U3HA 4LLWB 2YMTA 4HCGA 1EA9C 1NZRA 3K4ZA 3FB6B 3HE7B 4GPVA 5AZEH 3KYOB 1OHQA 2NT1A 2NW2B 4RMRA 1UA6L 2JI3A 1YNLL 3L3OB 1R3JB 3MRLB 4TQEL 3TT1H 2CXKA 5CCGE 2CRZA 2FE0A 2CKBA 2XACC 4BDVB 1LDPH 3T1FB 3TNMB 2X2HA 1T66C 3U1SH 5E8OA 2X4RA 4XNXL 3TO4B 3U9WA 1KPRA 4HJIA 1I8KA 2VKWA 3RX5A 2O93L 1S5HA 1S4IA 2BNRB 2HJLB 1EHKB 1BZ9A 4PWIA 3MRIA 4ZBJA 4BSVA 4PJDB 1HHJB 2KPNA 3KEDA 4ZS6C 4EZLA 4Q14A 4YS4A 3ES6A 4ZOBA 5DHEA 4JGUA 1Q0YL 1DUYB 1X5AA 3DI2B 4JDZB 2D7NA 1JPEA 5GGTH 3ML9A 3P4NA 2ZOLA 1PY0A 3KPLB 1F11B 5KVEE 2ICWI 4X6DE 1AS8A 3OV6A 2WM0A 5IWLA 3U9PL 4UM8A 1VCAA 4JREB 2ZUWA 2X09A 4QEGA 4FQXA 2YZ8A 1AS6A 1CF8L 1H8LA 2VWEE 2HFGL 3V0HA 4A2GA 1INDL 1HOEA 3T65B 2GJRA 2K7PA 4AV4A 4BIKA 4HC1L 2HVJA 3R18A 4AQOA 2ZG1A 4HQQH 3RWJB 5HVFB 3IEAA 2I9TB 5HYEA 1QUNB 1UM6H 2A5UA 1M71B 1TZGL 1Z5LB 2W1NA 5DHVB 3Q9PA 1FYTA 3KAAA 3VU1A 3RY6A 2B14A 1DBBL 2WXKA 1DFBL 4R3SA 5DK2B 4TOYH 2DQTL 3LH8A 5DQJB 3UZEC 5FYJU 1I8KB 4NCC2 1YY9C 3KJ6H 4J1UA 1DP0A 2AJSL 4NENA 4HP5A 1IC7L 2D0FA 4XC1L 1PD1A 2XX0A 1DR9A 5I1CL 3ZT7A 1MCQA 1YN7B 1E7UA 4XN9A 4G2AA 1JZ8A 5A2FA 1KB9K 2GTWB 5JQ6L 4IHOA 2ZYRA 4RGOL 4N1CA 3Q2CA 4AH2B 1TJIH 3F64A 4FQPA 1UA7A 2F9BT 5IUSA 1QRND 2DYPD 5G55A 3OC5A 5IBLD 4RGMB 5K1NA 1KN4L 3QUXA 3O45B 4OJFH 2A6JB 3Q2VA 2M8XA 3DYPA 5B1CA 4JRYB 1ODAA 1EAQA 4KNQA 2OXHB 2P47B 2ZSWA 1OSPH 1DVQA 2NY2D 3FT3B 4GS7C 5I15L 1IM3A 2AXGA 3Q9QA 3U0WL 1UG9A 5ERWB 4ODSL 3W0WD 3D08A 2J1ZA 1CD9B 4PB0H 3WKMH 5I5JA 2YFNA 4A7VA 3VMNA 1QABA 4AL8C 2DLEA 3BEWA 5CZVL 1GJIA 3QI9D 3VFMB 5IOPB 5IW6B 3WTXA 1OWRM 1PVHA 1PD6A 3L3HB 3LN9A 5FC9A 2DI7A 1MELA 4W9KC 3X1GA 3SY0B 3FOLB 4HUXB 5EZJB 2A3TA 4KK8D 2R1WA 5ISZA 4XZUB 3VFGH 3JTBA 2BDNH 2H0FA 5D71H 5IR1A 2V0AA 3TCXA 2OI9C 3K6DA 5AG9A 3VWJC 4JB9H 3HE6D 3QXWA 3F7VA 3QEUB 1E4XL 1CO1A 3PHOA 4I7ZC 1CXIA 3UJJL 1CICA 1YNLH 3FTSA 3H9HA 4PJXE 4TQEH 4X5WB 2VSMB 2EQDA 1H8SA 1BZEA 4U1IA 5C0CB 5HHOB 2EIJB 2CCVA 1VF5C 3N06B 4M3JA 4V1DD 3U1SL 3SKUD 1FYTB 5FUZL 4EBQH 3CPLA 2Q9OA 1T22B 3U46B 5GGRY 4JFDA 3US0A 2VUOA 3G6AB 1U2CA 3K3QA 1AZZC 1F3JB 3P9MB 4UAOC 3MNVA 1JGLH 1MJ7H 2WGXA 4QTIH 1OWWA 3PAYA 4PJGA 4X5XA 4WW2C 3FQWA 4K9EC 1U3HD 3IF1B 5CEZD 3D18B 1IAIL 3BGFC 4TRPL 5FYKD 3BAWA 4ZOEA 3W9DB 3V9EA 1HDMB 4ZUUB 3AU1A 1G7HA 3VA6A 4FQJH 4TNVF 1LMKA 1BOGB 4D3CL 1QBMH 4ATTA 4P3DB 3AUWB 1N67A 1R6VA 4FD0A 1CBJA 2DJMA 3U9PH 4YHKL 1JDAA 4PQXA 4JFEE 3O3UN 1S7UB 2VDNH 2NY3C 1QEWA 4DPBX 3FO0H 5H2BB 4M29A 2EYSA 1DLHB 5TF1L 2F53A 2VQUA 4U3CA 1QWHA 4L8BB 1CFSB 4RX4A 4YO0B 4CC4C 5C8JA 4JG9A 4A2DA 4PRNB 2YSSB 3ATDA 2GBAA 4FADA 1I1AC 4OVVA 1XXFC 3AB0B 3O8XC 5DVOA 1T5KA 4XMKL 1CTMA 2CR3A 1UB5A 3RWFB 4HIQA 2XN9B 4NQDA 3DTXA 2YWZA 1LO3H 5C0ND 25C8H 2R4RL 2OULB 2I7SA 1FH5L 4YZFE 1ZLSH 3RWHA 5BJTA 1GC1C 3RGVC 3WKNA 4NRXB 4I9WE 4NUQA 2FX9H 1RK0B 1MWAB 1YEJL 1C08B 4B60A 3VXMA 8FABB 2Q7NA 4WRLA 4BZ2L 3TYFB 3TURA 2ATAA 2AJUH 5F6IB 1HQRB 3L9BA 1X7SA 1CLVA 2R8SL 1D5BA 1NCBH 2UZXA 3BH9A 4JM4H 2VR4A 1TFHA 3V6ZB 3H7BA 2GSIB 5E03A 3DJZA 1GKOA 1KIRB 3I9IA 1QBAA 3P30H 4J7RA 3EZ8A 3MV9B 2DKMA 1MCPL 5HY9A 1ZLDA 4DKAA 4H2AA 3T6XA 2WCSA 5E8DH 5LAXB 1A14H 2V5MA 3BWUC 4AIZA 3CXHK 3LSOB 3RBSA 1CD1B 2EEAA 2AK4D 2G30A 2XPZA 5D2NA 3FU6A 5EF0A 4X0KA 3EYFB 3RIKA 2X70A 1ZV9A 3EOTL 3RAJH 2D2CC 4NUJB 4Q2ZB 2B15A 4N20A 5JIMA 3D06A 3K80A 3T3PF 3DTXB 1AYOA 4G80B 3QHFH 1ND0B 4UQ3B 1QPXA 5EBMB 2UWEB 4QAWA 3AREA 4MMYB 2VZVA 2P80A 4DKFH 3BO8B 4XPHL 3W0WB 1JZ5A 1C1EH 3GBLA 3ETTA 3GJFA 1YY8B 3GGWB 4LASH 2UY7A 1DLHA 5MEND 3EGSB 4OLEA 3UJJH 4OKVB 5KVDH 4RRPM 1I3GL 1BXVA 2AK4E 4GRWH 1W6WA 1DDHA 1FNFA 4GO9A 3HUJB 3L16A 4PUBH 1R3LA 2JXMB 3BZDA 3GSUB 5C08A 3FTYA 3WFDH 5L8LB 2Y72A 4IRZH 4ZUVB 3HC4H 4KVNH 3DK2A 1E27B 1VESA 4BFOA 1OAKH 3PWUB 5D6DA 5J3HC 2BVQB 2OPCA 3TNMA 1JGIA 4PJDA 1PLCA 1ZVSA 3BUDA 3AG2B 2EEBA 3G6JA 1BBJA 1S9YA 4N0UB 3BDYH 1M1SA 3IDYB 3KPPA 3MBXH 4MTMA 5BUGA 5GJSL 4NRXA 1X9QA 3UTPE 1HS6A 5HHXL 3QCUH 3HG1A 2XKSA 3NCEB 3MSPA 5DO8A 2QR0A 3LEXA 3MCG1 2VDLB 2FQGA 5IFHL 2PR9A 1FNGB 3QZWG 2IDUA 1XIWA 2DMGA 5FWQA 3VXUD 3HE7A 1HYSD 5EZLB 4PJAE 5G4OA 4OBRA 4TOYL 5MEPB 1EAPB 2RQEA 3I50H 4M5TA 4UT6A 2J57A 4NC1C 3OGOE 1OY3B 3IFPA 2NY4D 5G5DB 3QG6A 2DTML 1VZGA 3OQRA 3O2WH 4G6AC 1SVCP 1N2RB 2X41A 2Z6FA 2CBTA 4HBCH 4WHYH 5T3XD 2X2JA 3BEVA 2X1WL 4PBVC 1OZUA 4I1RA 3SPVA 2ESVD 1KSRA 3OL2A 2WWMC 4X0NA 5HVGB 3LZOA 2DN7A 4G82A 2F5BL 1N70A 3HKFA 4NEHB 3RIFK 4CVZA 3REVB 5LQBL 5K1JA 3KWVA 3O8XB 2BINA 2NY5L 5DHVA 5E9AA 2DQIH 4EJ1C 4NO0B 4QRPD 4YC2B 3V5HB 3NIFE 1ECYA 4Y4HC 4EDWL 3VQ2C 2X0UA 3L2NA 1GGUA 3DHJA 4F8OA 3ULAB 3MV7B 3WAKA 3TFKD 1AQDA 4U05A 4YSQA 3BZEA 5B8CC 2HN7B 4P46D 3EJTA 2EH7L 3CBRA 3NCFB 1V10A 2O6FA 4OQTH 1K6QL 4XXDB 2DM3A 5C09A 1FFQA 1MZZA 3VI3B 3ZQXA 3BWAA 3WBDA 1UATA 3ASNB 3LX9A 4H25B 5E2VL 5K9QI 4C59B 2YC1B 3IT8D 3NCYP 5F7FA 7CGTA 3HRZC 4LRNH 4F5CA 2KLSA 3MGOA 4PGEA 4KI1A 3N41B 3WY1A 4B6ZA 5KS9F 1G9NC 4UQ9A 2N01B 2QQKL 4UWQB 2BHUA 4PLKC 4WY7H 1KGCE 2Q0ZX 5M95B 2YUVA 4JB9L 4ZSOB 3EDEA 2VYRE 3MJ6A 3KL5A 4DGVH 3BRDA 1IM3D 3DGCR 3B5TA 4KDTC 4NNYA 1JPGB 4DETA 2EDDA 4K94H 3U1QA 1OE1A 4R7DB 4UQ2A 5DLML 4R6UA 1B0GA 2NSQA 1SXZA 2Y23A 3CUPA 4U6VH 4OZFA 3MC0A 2Q87A 2IDFA 3IDIA 1F0LA 1D6VH 1LO2H 4OLYH 4X6EB 3ZUNC 1WTGT 4RMUA 5CS7A 3SQBB 2BIQA 2VDRB 2EVGA 3PWJB 1MJ7L 1CI3M 2ICEB 4KROC 4PWEA 4FAAB 1JHTB 2BLFA 3CWGA 2A6JA 2H1PH 3F05A 5IKCB 5KS9E 4CC4A 1O6SA 2PPDA 3UTZA 4MNQE 4OCRL 2CDGA 3WFDL 4HGWB 4YDJA 1I7ZB 3BC9A 4CBZA 3KLHC 4HFUL 3EHBB 3FFDA 1VEMA 1OO2A 1J8SA 1F5WA 3BP6A 2R39A 3OVUB 1AZBA 3C9NB 3FO0L 4PB9L 1R0AH 3CVHH 2AEOA 3TBCA 3WIHH 4PY8J 3VXOB 1NGQH 1P4BH 5D2NC 5F9WB 3RLSA 2WZ6A 3VSTA 4KKQA 2DLTA 5C0BE 4FI6A 1G7IA 4B9PA 5BCAA 1NSNH 3SDAB 2E7BA 1WFNA 3QDJE 3L81A 5DTFA 3S35X 3S88L 3DI3B 1BAFL 3MBWA 2FQEA 2X4UB 3QPQD 1OGTA 4MXWH 2HN7A 1A0QL 4NKIH 3RDTA 4ALAH 2OR7A 2NXZD 2WN2A 3BVNA 4PJFE 1A4BA 4KFMA 5H2BA 4J3TA 4YDVA 3KH4A 1OCWH 1GCYA 3RZCA 3CVDA 1BZOA 4AQ1B 3PHOB 2PYEB 1EXUB 5FKAA 1FPTH 3X14A 2D03H 4WGVB 2NPLX 3ZR6A 5C8JB 1WDAA 4N2MA 1EMTL 1KB9J 4AYGA 5DZJA 3GIZL 4C56A 4ZMWA 5GS0H 3ASWA 3T2NL 4QHUB 1L0PA 4P4RB 3MR9A 2VQ4A 2Q8BH 4HX1B 4Q9RH 1T4KB 1BYPA 3VG0H 2JMRA 4XPFH 5GRJL 4UU9B 4X7SH 3CBJB 4BINA 4IBZA 3D69B 2QGDA 5ECJE 3NABH 1U0QA 3IJEB 4HXAL 4MVBC 1W2KT 5EZOH 4P4KC 2DEYX 1TTGA 2PYED 2VISB 5FR3A 4HLJA 3D0VB 1H3UA 1E5CA 2YRBA 4EIZC 3F83A 1UJ3B 2FIKA 3C8DA 4BRVA 4P46A 3T2QA 1U8OB 4ZW7A 1XWVA 3RIFF 4UT6H 1NEZA 1AQKH 3DGDA 4CN6A 1UB5B 1KBPA 1A4JB 3NACL 1RHHA 1QEXA 5I8CB 5CLYA 3R7RA 3LKQB 1FL5A 1NBVH 2GSIA 4FTVA 3BLBA 1UKSA 4PGZA 1WFIA 3BD3A 4ZW3A 3LQMA 3RIAK 2JF1A 3LMJH 3SKJL 3QZMA 2R23A 1CCZA 4WK2B 4OZIF 1A6TA 3GSNL 1AZVA 3VXMB 3M1BB 1FC1A 4X6BB 1JXGA 2OTPA 1KYFA 4PS7A 3KBHE 2Q6WA 3TWCH 2QBWA 1EANA 4LLUA 5LB1A 5HGDB 4Y1AD 2DWDA 1ML0A 3M1OA 2WAHA 1AG6A 1KENH 4XT1C 4OGXL 1YNKL 3RL2A 4JANB 3RDTB 4U6VL 4AL8H 2UY7B 1OAKL 5A43C 4WI8A 2QDWA 4P23B 4ZMQA 5EHFA 3H85A 1SLVA 4LBEA 1QSEA 5HHOE 1UA3A 4LFHG 2XZAL 4FFZL 4KXZI 4LLAA 5F0JB 4GKNB 5CEZL 2AABL 3HN5A 2HT3D 2NY1C 3EYQD 1A7QL 3REWA 3EYUH 5C08B 3ZTDC 2V17L 4N2HA 3VWKA 1G9NH 3QO1B 4M7LT 2ICEC 4EIGB 3LKQA 1DSWA 4XVSL 4ZXBA 2XN9D 1KTKE 1UWXK 2NUTB 4E9LA 2F74B 5DK2A 3CVHL 2Y1VA 1TO4A 2W07A 7PAZA 3CH8A 2EDOA 3A0OA 3EHBC 3GHEH 1IL1B 1MHHB 1DQKA 4KRMB 4WUKH 1H3XA 4MXWL 4WU7A 1PEZA 4MQ7B 5FDWA 4WHDA 2JIXB 1XIWB 4MXVE 2C9SA 1SEBA 3N04A 4YVNA 1GGBL 3QZNA 5AVSB 3D39B 3FSWA 2BSDA 5K9OB 1J9SA 1UD3A 1KNOA 4BXSV 3AMKA 3QUXB 2NY5H 4ELKB 1L9RA 4LBAA 2GVYA 4JQVA 3CX5K 4FQHB 1UWEL 1KCWA 1N2RA 3FH7A 1G7JB 2XN9E 4NN5B 2B1OA 2BFGA 5AAMC 5MP6H 1HN1A 5D55A 5SWSD 4JHWH 4U1KA 1A6TB 3CFUA 5EULV 3GJFK 2VT0A 3UAJA 2P8PA 4UTAH 3V52H 3Q5OA 4RFOL 4Y9GA 2AQSA 3BDBA 4IW4C 4AIXA 1WO2A 2X28A 2PCYA 3ZDWA 4JO2L 1ZHBA 2YLKA 3KS0J 5GHWL 2WAQA 4O00A 1CDCA 3C09C 1XCQB 4ELMB 2J8UE 4LMQE 4NO5B 3U2SA 3QP3A 2VDML 1FRGH 2VOTA 5FGCE 4BM7A 1AQKL 4XMZA 1KPVB 3JZYA 2XWTB 5I23A 3FU0A 1JPSL 5CO1A 3QO0A 4EAEA 4GIOA 2D3LA 3LS4L 4NN6B 2GITA 3GNMH 3FQTA 3ZHNA 1C5BH 5EB9A 3OXSB 4CILA 3L3OA 2VLRE 2X6CA 5ITFA 4W4OA 1IGTA 2DIEA 2FO4B 3VD2A 1KY7A 1MFCH 1KJMA 3F62A 3CN0A 4FC3E 4PGDB 3BVDB 1G7PB 1CURA 4ZS6D 3CV5A 5FCUH 3BAXA 3ENEA 3MV8A 5D2LA 2HFEA 2J55A 2IADB 5GRVK 4F7MB 2DQGL 4U1JA 4Z3EA 4UT9H 4YFLF 4RRPA 1PCSA 4YIQA 4KWUA 1D7BA 1DVSA 1ZSDB 4JG1H 4LQFL 1U8QB 4RZKA 1X7TA 1B0GB 2AXFA 3FTXA 3FOMA 3SGJC 1TUPA 1SOKA 5CGTA 1XSKA 5CLTA 4JPWL 1NA8A 3PYCA 4QTFA 5IVXA 3PE9A 2LGNA 1F4XH 5GGRA 1DBAH 1ZWIA 4L2LA 3FFOA 3O4LA 3RUGF 5IQ9A 4YPGB 1J1OL 5D5MA 1MFVA 3OZ9H 2ODHA 3QIUB 3MMEA 2YMXH 2WZ0A 2GI7A 3T0EE 1P4LA 1FNHA 1JUFA 2HT2D 5LGYA 4F8TA 5AYUL 4WO4D 4JFYB 4HZ1A 3E6FA 1AO7E 1E3FA 2ZSVA 2ZOTA 4MB5A 4LAJH 1LO0H 4ODHH 2PW2B 3KPSD 4WI4A 4LOEA 2VLKD 1E4JA 4JRLA 4B9YA 2DI8A 4EUPH 3TPUA 3MCKB 4J4PD 3GS7A 4NJAH 4TL5A 1J9TA 3NCWA 2BC4A 4YDJB 1ZCRA 2UUDH 2GUYA 2HLFD 3OR7B 3DHUA 5T5NF 5GIRA 4P5SA 1B0IA 2OP4H 3RFZA 3PNRB 4XOEA 3MLTB 2F8OA 5DRXB 1EEZB 3MREA 1C08A 1AKJB 2ICEA 4LLDA 4Z7QE 3SPGA 1YN7A 4ES9A 1X6LA 3CDZA 4MD5B 5BW7C 2E9BA 4OZIA 1CE6B 3NTCL 4X6EA 3BKMH 3RGVD 3ARVA 1TQTA 1ZLEA 4XX5A 4N0CC 1ULVA 2BZDA 5HHPA 3HZVB 4RDBA 2MNUA 5J6HB 2GFBB 1ZTXL 3CG8A 4OJDH 5KBLA 3V4PB 1SVZA 3BVNB 4JAMA 3ZKND 2C7FA 1QUNA 3WDJA 2QKIC 4PJHB 1AQMA 5LG6A 1F00I 1LQSR 5IF0B 4ANUA 5LN8A 4M8UA 2Y1ZA 3D05A 4XNDA 3LNHA 3D39D 3X3FL 4QJ5B 5HDQL 1ZHKA 2WMPA 3BRGC 2WZAA 4ZFOL 4OF7A 2NMSA 1NDTA 3DJRA 4JEGB 4Z3JA 1DFXA 4K8RL 5FECB 1OAZH 3BFOA 4JVWA 1SJVA 5AB2A 3VD5A 4CN1A 3GM8A 4OJEH 5B1BB 2Q76B 1NDGB 4OLZL 4Y4FA 4XVJH 1RUMH 1A5FL 2APXA 2XZCL 3BPLC 4A7UA 1PYWB 4IKNA 2C5DC 1OGSA 3T2LA 5FA3B 1CFTB 2XC8A 3OWEA 5KYWB 4F57H 3GLEA 2YKLL 4NNPH 5F1IA 3QIUA 3D0VA 5BZDA 3HNSH 2XA8L 1T21B 1LDPL 4I13B 1MY5A 4U1SA 1ADWA 3QXTA 3WDIA 3ABZA 2YAHA 2Z91A 3I9PA 2GJ6E 4I5BB 4DZBB 2R51A 1FNSH 3AS0A 5DVKA 3LQAC 4FFWD 4R26L 1EJOL 5CILL 4EUPG 2UXFA 1UM5H 2MTPA 4DFHA 5T1JA 5D1ZA 6PAZA 1WG3A 3T0DA 1ASQA 3C6LC 2AW2A 5HYJA 1LP9A 2JK5A 1EUTA 1NGYA 3JWDH 1UACL 2CSPA 3D9AH 4FFYA 4OD1L 2NSMA 5FS5A 5JHAA 2GCYA 3SY0A 4R0LA 3SDCD 4M7KL 3M7OA 3NP3A 3CHPA 3LHAA 3LPPA 2PPAA 3VXRB 2NNXA 1UVQB 5I1JH 1HWWA 3MLUH 3ALWA 5JMOC 1BQHB 3SYAA 3HLAA 4NZUL 3BVTA 2IH3B 4MJ5B 4WAFA 1BREA 4K5MA 1J5DA 4TPRH 1X5GA 2MPAH 3GC3A 4PJHA 5TJWK 4XP9L 2QVIA 3VSUA 2JV6A 4ZNEE 4NM8H 3S2AA 3HG0A 2EINB 5CJ8A 1DVZA 4QYAA 1I8MB 4H8VA 2YPVL 2Z91B 5E5MB 5TE7L 4FQCH 2WKGA 3SY6A 4TUOA 3MX0A 5IMMB 3NJMA 1M2OA 4BFJA 1QLRB 2OBGA 3SKMA 4HUUB 1S9KC 3W3BA 2V2TB 3UPRA 1OD7A 1UFGA 2OJ1A 2C9AA 4PJ9C 3UJIL 4PAZA 1IEAB 4KOBA 4BWWA 1DBJH 4RMBA 1QVOB 1LEGB 5J12C 1MCKA 3RNQA 4OCLC 3VXTB 4XCCH 4TVPE 5DFTA 4D9RD 2LR4A 2HWZL 1TJXA 5C0AE 3KL3A 3CFEB 4X8GA 5TGBB 3ARGC 3TFKC 1B4JH 3RVVC 1UADC 2ITCA 4UTAA 2FX7L 3RWEB 3UC0H 1X3DA 4I5BA 2DQHL 3ZO0A 1RJLB 2A99A 3US1A 3IVKB 2OR9L 1NFIB 3QC5X 4X9GA 3HB3D 1NLDL 3KVPA 1V7NL 1TZHB 5E7FA 2XQBH 3HZYB 2HJLA 2PPEA 3EOBB 4GKZB 4NQCE 4TNFA 4UV7H 2HMIC 5SWQA 4ZUWA 5E8OB 1IM9D 2QKIB 3DSNA 1U42A 2KZ1B 4XAKD 1HE7A 5IG7B 2F5AH 4KV5F 3AROA 2O6EA 3CFJA 4P3CH 1E6OL 4JG0L 4BK4A 3MUY1 5JXEC 4TTGA 1A5FH 2H2SD 1FORL 3G7TA 5J56B 2N3JA 5DT1L 1WBXA 4HEPG 2ID5A 4KRPD 1BQSA 4C8XA 1QO3B 2UZXB 4JHBA 1A2YA 5IT2H 5IMKA 4JQIH 2C7UB 5DD1L 3RGHA 1DJHA 1NL0L 2RBLA 1MH5A 3O81A 2F54A 2ERJC 1KCKA 1AGDB 4PV9A 4BBWA 1EUUA 4EI5D 5I5IA 1SPDA 1A7NH 3L4CA 1HAWA 3LQZA 4ODUB 1T83C 2FQDA 2X4RB 4L48A 3TO4A 1QA9B 2PNDA 1AGBA 5T33L 1EFQA 1R5WA 3QQ4A 4FZEH 4GRMA 3SCMD 2ZUVA 5AL8A 1IC7H 1U41A 1KYOK 3NZHL 1BD2D 1IAIM 1YEHH 1QFWH 2LABA 3MBED 4I77H 1K8IA 1UUSA 4Z7NB 5FYLE 3PWNA 5J8OA 5CUSL 1ZSDA 2NY5C 5K1VA 1XSIA 1S9WA 3I9GL 2VN5A 5LO7A 1MHEB 1WF5A 1GGCL 3TEYA 3FOMB 3HLKA 4XC3L 4HJGA 1P4UA 2F8VA 2XBZA 2VC2H 4N2BA 3F6JA 3U4EA 2X3AA 1MI5E 2MJWA 4HJEA 2DIJA 3L48A 5ITFB 3MV11 3RZCB 2FK9A 1H15B 3X12B 5FGCB 2F2HA 5JW4N 1L6XA 1UKTA 5EPMA 2VZSA 4KH2A 4PM1A 3WTUA 4QRRA 1FVEA 4NPJA 3LRKA 4P3WA 2YQBA 4N2EA 1TZHA 4PGDA 3WN5C 1JV5B 1HHIA 4KI5F 4PB0L 3WKML 3KPRE 1UXSB 3BKML 1WAPA 1NCNA 2BPBA 3PGFH 1R5WB 4GSDL 2FJUB 4L3EE 3CU1A 1NBCA 1ES0B 1KEML 4K3JH 3FB5B 5EFIB 4RAUB 1DTUA 3DO3A 2HJFB 1ZJBA 2J8UB 1DANT 3C6LA 1KXTB 2JTDA 1DCLA 4UI2A 1KJ3L 4DVRL 1L6PA 5DURD 1XTLA 1NFAA 2K4AA 2LLLA 2YRPA 2BVTA 3HG4A 5ISZB 1CJYA 4Q4IA 2J8HA 3KPMA 2CCLA 4KGJA 3KPTA 1OGAB 2FGZA 2BRQA 4K0OA 4PJBF 2QSCL 4W4NA 2FO8A 2XXMB 5DWPA 4PYGA 3UBXA 5LDSA 1CFNB 2ETWA 2A6DB 5J12B 4FQIH 1NC2D 3QJFA 4M7LL 2TSBA 3QQ4B 4FLHA 5DJ8A 2P24A 1GIGH 1WCQA 1AO7D 4HUNB 5FKPB 3N44F 2Y2YA 4V2CB 5TE4L 3TESA 4UV7L 4N0FA 4NZTH 4JO8A 2A4EA 2BSBA 3WEXA 3JYCA 3WNIA 1G6VK 4DUWA 3KPNA 4HQQL 4U2ZA 5ICXA 4JFDB 4XN7A 1F02I 2BIOA 3TN0B 4FQJL 2L4OA 3RFZB 2VQ1B 1PIFA 3TM6A 5DO2D 5HHPB 4E41B 4NP4L 4GY4A 1FDLH 1HIMH 3C5XA 1XCTA 2ED9A 4HKXA 4MMXB 4GINA 4Y2DC 2AEPH 1EZLA 1CFQA 1P69B 3FSVA 5FA4A 1OQOA 3KJ6L 2QQQA 5A2BA 2BHYA 4TSAL 1KCSH 4KO5A 3MJWA 3VI3A 3C5JB 4AJVA 5FGRA 1AANA 5C0GA 4M5YL 1URIA 1INEL 1ZHKB 2WMPB 2YPVA 3BAKA 4AW4A 2B3IA 5CGYD 1S7WB 4JFED 3UTPD 3VWKB 5A2CA 1YMHB 4W9EC 2WNXA 1JCVA 4ZFQA 3CFIC 4AYFA 4QRSB 1KBVA 5FM5M 4PJ7E 3H2QA 4E41D 1DN0B 3FT4B 3FQ1A 5IW1A 4ZAKA 4PJEE 3W38A 3QQ9D 3VFRB 2CHZA 2L7UA 4N0FB 5HHXH 5CUSH 1MWAA 4FXKC 5D1XA 1BMZA 5MENE 3ZSTA 3B1UA 1OP5K 1HHHA 1IQDA 1KBGH 3RPIB 4MRBA 1NFDB 2E5EA 2VXQH 5HI4C 1BQHA 1RY7B 2XIDA 4RISL