3QFGA

Structure of a putative lipoprotein from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
145
Chain Sequence
NMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDLNPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYELRGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of a putative lipoprotein from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 32
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16729 DUF5067 Domain of unknown function (DUF5067)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qfgA00
3QFGA 4LESA 2LLGA 3CFUA 1LMIA
chains in the Genus database with same CATH superfamily
1BLNB 1DDHB 2K8QA 2Y4SA 2E4FA 2W9DH 2E27H 3DLQR 3ISYA 2FJSA 2X4TA 5KSAD 3WBDA 1BECA 3ZDYE 4DGVH 5E0FA 4MMYB 3CSGA 4PJBE 4B50A 2G3ZA 3QCUL 5E94A 3G6AB 1QNZH 2O6FA 2LLNA 5CCKL 2OR8A 4F57L 2DQIH 1Q9LA 1NJ9A 3LS4L 4ZAKB 1HXMA 1I7UA 2PP9A 1RUKH 2Z4TA 2OQJA 3ARFD 3DHPA 2DOCA 3TV8A 3NFSH 5I9QC 2P8LB 5FR3A 3ARBD 5I2IB 2RJMA 1L6PA 3G08B 5DYFA 4WHCA 1E42A 1X5MA 2QSCL 2PYFB 2PTTB 4R26H 4CJ0A 3V79C 2DQDH 4XPTL 3CFUA 3B2DC 2EIBA 4IMLB 2YO3A 1YYLL 3SDDA 4UT9A 5E23A 1QLRB 2Y24A 2WLYA 3PPSA 5MI0C 3PWPE 3VFGH 4PJXE 1J1XL 3ZE2B 1JZFA 1TZOA 5KSUB 5LBVA 4FQQB 4GSQA 1GR7A 4Y8AA 3VQLA 1DTUA 3VH8A 4WHTA 1LO3L 4L8DB 1OOAA 4QDGA 4FJZA 1SLXA 4IBWA 4DEPB 1BQSA 4JQXA 2NNAA 2CE6A 1CFQA 1IFHL 1V3KA 1J88A 2V3FA 3QEQD 2ZPKH 1OGTB 2VMCA 4N8VB 3MNWB 3MA9H 4MD0A 4N2LA 5C1MB 1T89A 4UQIM 1NAMB 3WHE1 3P4MB 4ACTA 2X6VA 3A6BL 1F11B 1E2VA 2MNJB 1URIA 3HI1A 3KDPB 3WKQA 1ZT4A 4KKLC 4GKLA 4DFIA 2B1OA 3DPBA 4H26B 5BCAA 2FWLB 1FO0H 5ADOH 1Q38A 5FYJD 2WBKA 1YPZE 4AQAA 2YQ2A 2ZXBA 3QUZC 4P5TC 4D9QD 4FOMA 3ZR6A 2X4UB 3MJ9H 4KHXH 1SYSA 2G5RA 3O3AB 3IDMA 1WZMA 1CL7L 4FQXB 2VXUH 3FUJA 2BHUA 3LEVH 32C2A 3N85L 3TN0C 5K69A 4YPGB 1NCWH 4NC0B 1E4JA 3UC0H 1SVBA 3D3VA 5D72L 5C0CE 2ESVD 3AG2B 5IB5A 4XH2A 1JPEA 1I8KA 1TO5A 3PL6B 5E8NA 3DYPA 4ZFFA 2SEBA 2ZD0A 1OARL 3QUXA 3C6LD 3RX5A 3GUTB 5D2NB 3VXNA 2HB0A 3QUYB 4ZMAT 3OLIA 5LKNA 1RMFL 3KPTA 4WK2B 1XCTA 1Z0NA 4R97B 1X5GA 2R1XB 4WI0B 2ADGB 4KQ0A 4ZD3H 5E4OA 1BSIA 3KYOB 2ZOLB 5T5FL 1NEUA 2A6KA 5JNYB 1MJUL 3HC0B 1BG9A 4Y4HD 5ICUA 2AP2A 5EUKA 2V2XB 4FQHA 4KXBA 1DVZA 4QRAA 3Q2LA 3WOVA 4XCYA 4FNSA 5F9WB 3RA7L 2VR9A 3V0EA 4R9HA 4AVIA 4MB3A 2VL5B 2DTMH 2VO5A 3ARYA 2RFXB 2HPTA 5DMIH 4JFOA 3M17A 2FBJH 4HJGB 3C08H 3HB3B 1P7QB 4KAQL 1MCRA 4KHTH 2WQSA 4MB1A 1MVFA 2CIIB 2GJ6B 4KMTL 2X4PB 3GFUA 5KJRH 3DETC 4B9PA 1CFNA 2GAZA 1CGXA 5SWZE 3DO7A 1KN4H 4XB3A 2YPLA 3FQTA 3EZJB 3GMRA 4LHJB 3V9EA 3S36H 5AUMB 2W8CA 1PVHA 1E4XH 2H6UA 2FAUA 3UAEA 4PJ5A 2R8SL 4R7NB 4YDKL 4Y1AB 4ES8A 4YFLI 1ETZA 1OAZL 1NGZA 2D4FA 2DTSA 1XIWB 1EANA 4WKXA 2CK0L 2BVEA 2AV7B 2CXKA 3N44F 4LCVA 4A7UA 5DJ2B 1Y6KR 2K0RA 2YQGA 3SBPA 4XVUC 3LH2L 4UQCA 3S37L 3TCTA 2GSGA 3DJZA 4IEFB 4WF7A 5T5FA 3DUSA 3EDFA 2WV3A 1H5BC 4AQ1A 4XWOD 4XPAL 4FNLH 4PIRF 3I6GA 4M5ZL 5KYWB 1PAZA 4NZTH 4N2CA 1NCBL 2OL3L 3VDBA 3N3EA 1QKZH 1IQDB 3EYUL 3BFOA 3MRHA 3CNKA 4JFXB 1OTSD 4JN1H 4LCCC 2E75C 2Z7YA 1FIGH 3KPLB 2Y07L 4M8QB 2YFNA 4KQ4H 5EO9B 4OZIE 1KB3A 4UOW1 3SOBL 3MGAA 2G9HB 5D1ZI 3UTPE 3WJJC 3EOBA 1JYNA 1NFIB 2EIDA 4UNUA 2GTWA 4GNKB 4D9RE 4WTWA 4LRNL 4WW2C 1KGWA 1FNEB 1D5IL 3SJVB 3STBA 1NGXA 3TU6A 3OM3B 5E1HB 1CDJA 2X10A 4PGDB 4XVTH 4U05A 5F70A 3TCLB 3U0PB 1BYNA 1AI1L 1BM3H 1L5GA 2JCCB 3QORD 1MCFA 1MCPH 1KIPB 4GYBA 5EU7E 1A3QA 3GNML 5HYSB 4X9YA 1D9KB 3GK8L 1WIOA 2NY1B 1YAIA 2VLRB 3DVGB 5B39G 5GS1A 2NR6A 4P2RE 3BKYL 1MCNA 3GZOA 4U6YB 1S2EA 4B7IA 3PABA 5FWRA 4F37F 1TVHA 1H19A 3OAUL 4XPGL 4F7EA 5LHDA 1TG8A 4W9EC 2VIRB 1ZLUH 1JHLL 4A6YH 2FO4B 1MHEA 2ZOOA 3PGCB 4TUJA 2R1WB 4PN6A 4CMMB 4EN3C 1FL3A 1LK3H 3MJ8B 3NJGA 2FJGA 5MEQB 5FYKU 5BS0D 2NW3A 2MOGA 3BOVA 3KPOB 4E0RA 3FHAA 3OJDB 3CE1A 3TVMB 3MLUH 1MI5B 4H0HB 1AMYA 3F84A 4HC1H 4YO0B 5AVTB 2GHZA 1OWRM 2E8ZA 3RDTC 3VFUB 3QCTH 3VI4A 1G43A 4UT6L 3CHXA 4H0LC 1JF6A 1PZ2A 5EU6E 2UUDK 2JJUA 3CFJA 4P9MH 3WNKA 3DJ9A 1MFCH 2WZ0A 1T03H 2P24B 1E6OH 3QDMA 3J07A 3JZYA 4O2EA 1I4FA 1AZBA 1W0VA 1AGEB 2J8UB 5FXCH 3WUWA 2AZAA 2AERT 4AKOA 2Y36H 3NG5A 5B8CA 3V0JA 3LN5A 4HH9B 3IFLH 5HDOA 4QUOA 4XNYH 3QG7H 1CR9H 2NY4D 3JWOL 2FWUA 1Y18A 3MMEB 3QFJB 4YHZH 2FL5A 1GPOH 4LAQH 2XN2A 4GRLA 1HQRB 3OKKB 4UT7L 2NOYA 1JXDA 4PJ6A 4K7PX 2E9WA 4WSJA 3RL1A 3CFDB 4I0CC 2BVUA 1IM9D 2CNYA 3CSYB 4QMEA 3RRQA 2R1YA 1HHIB 1EMTH 5DF0A 3RU8L 4CNIA 2DIEA 3OR7B 4FMVA 5FHAL 3V5DA 2X1OA 4QTHB 1J9TA 3CIAA 3KXFA 2B5IB 5L88L 2BSTB 1BBJA 2IPUK 3H55A 4J28A 2XA8H 2W88A 5AG8A 3OAZK 1PYWB 4OCNC 5MHSE 5ESVA 3BLBA 3FZUD 5E2TH 3HE6B 1GY1A 1AFVH 5KBKA 1LWJA 3ZT6A 4L37B 4X4XA 4DGIL 5FM5O 1ANUA 4TTGA 4NAMA 5IM7B 4RA3A 1O75A 4U2ZA 2YUWA 4XPBH 1CWVA 2N0MA 3TIEB 1PNDA 4Z3JA 2OM5A 3AABA 2EABA 4QLWA 4Q9RH 3P2DA 5FKPA 4ELDA 5E2UH 1R3KB 4XOCA 4JG0H 1V7NL 3HNVL 4LSPL 5J9PB 3VXUB 1B9KA 1DZBA 4W68A 4AKPA 1MVUA 3SODB 5LWYL 1WISA 5EU4B 3V4VA 4PGZA 4AIEA 1UB5B 4EI5B 3ORJA 2NNCA 3AB0B 3C8HA 3KD4A 1TMCB 4IRZH 5TH2B 3X3GH 4R83A 5J6HA 2CLZA 4PGCA 2ZICA 4NRYB 5FO7A 2G0LA 3UO8B 2AK4A 1ILSA 2Y6SD 3B56A 5D1ZC 3D0LB 4UQ3B 4YHML 1PTZA 5L9DL 3BAXA 3VXRB 4U1IA 4W6YB 4WHYH 3L4YA 4GQ9H 2ORBL 1M6UA 2OMXA 4XTRC 4QF1A 3P4NB 4PJAA 4P8QA 3LH9A 1GZHC 1IJ9A 3EFOB 3IF1A 5LAXB 1QR1A 2OR7A 3C9NB 2VO8A 5DVNA 4M7KL 4KZDH 4OF3A 3QQ4A 3C6EA 5DS8A 5GHWH 3D9AH 2ENPA 3QS3A 2FGWH 5INCB 3QNZB 3RTQC 3AROA 1SY6H 2VAAA 4HKXB 1R46A 4J6RL 5EO1B 4Q9QH 4EZMA 4FFYL 3ZJAA 5CBAA 2O61B 5E51A 5EORH 1WP6A 4KJQC 1AXIB 3BD4A 3PS6A 3UJTH 2P5WA 3ARDC 4NQSB 1U95A 4ZFZA 5B1CA 1X9RA 5I26A 1JZDC 2DLEA 2OA9A 1XF2B 2MHAA 4Z18A 3U7YH 1JPGB 3NABL 5ACMA 5EBLB 4GRWF 1ILUA 3LKQA 4LCWA 5CCHE 4JZJB 5BJTB 1FNGA 2ICEA 5F6IC 4JY5L 5TD4A 1NEZG 4M6NH 1JZHA 1G6RL 4JY4A 4LSTH 1A8JH 3RKDD 1G1YA 3BKML 3M1OA 5HHXH 1RLBA 3O0RH 1PZ3A 2GI0A 2D2CC 2F7IA 2OTUA 5I30L 4N6QA 3DRTB 1XCXA 4ZS6C 3ROOB 3AU1B 1GZPB 4LIQH 3O2VL 2IH1A 3II1A 4XZ4A 3BE1L 3DVIA 3TJEH 2ZAHA 2EICA 5HYJA 1X6NA 3QBTB 1K6QH 3DX3A 3W0WA 1I3VA 2DN7A 1AQKL 4HJ0C 4M00A 3E6HA 2R23B 3FMGL 1CBJA 5HDBF 3AS3A 1UFGA 1KFAL 3WO4B 2OTPA 3EHBB 3M46A 2H2PC 4NQDA 4N86A 5C07B 5IGXH 1IC4L 1JNJA 2GC4C 4JFFE 4PJHA 3OKOB 1UZ6E 3Q6FB 3DMMD 4OQTL 2DAVA 5A2BA 1KBWA 1MWAL 4NKOB 2Z0BA 3LQAC 3L81A 4UBDD 3WGUB 4CAGA 3T6QC 4M03A 4ZO9A 2O4EA 3DA0A 4X80L 1R3HB 2ITCB 1TCRA 4G80A 5HI5D 5JW4Q 2ZP9A 2X70B 4HPHA 3HBZA 1S6NA 3HI5L 4E9VA 1JGUL 4GSRA 3RILA 6PCYA 4GO6B 3F7VB 1OAUH 4FXKC 2JV6A 4G1EA 1EVTC 2X05A 1R5WA 1ZLEA 3DUUB 1WAAF 3VGEA 3SDAC 2QSQA 5BRZA 3NJJA 2R4SL 3KWWA 4HXAH 3HBGA 3MOAL 4GG6F 1FE8H 4I18B 4FZ8H 4TVPL 3T1FB 3DIFB 3EYQC 4LHUG 5J11C 1THCA 4M1DL 1FF5A 5FECB 1A6PA 5MENA 2R27A 3BFWA 1RK1A 3NZHL 4F92B 2ATPA 2N3JA 4PRHD 4JFHE 4DPCX 2QADD 2OYPA 1P4IH 2NW2B 2Y7MA 4NQUA 1ZTMA 5IB2B 3UTZA 1W0WB 4D0BB 3A3YB 1A3LH 1QO3B 1RXLA 4GJTB 1AHKA 1OIOA 4XP5H 3BSZA 3D2UD 4N0FA 4BFFA 4LOFA 1BM7A 1ES0A 4OQTA 1NKRA 4QRPB 1NBYA 2HJKB 4LLQA 4QYOA 1KXHA 3WENA 2DD8H 5D7JB 3SDCA 1OAKH 1KTCA 4QHNB 4AYEC 1HAWA 4P46A 4TVPE 1ASPA 4XN9A 3LSOA 2FEEL 3ABGA 4U3XA 3T8MA 1JVOA 1BQHG 1N4XH 4DP0X 2OMBA 4ZXBA 1A3RL 1U8JA 2XZCL 3MROB 2LABA 4AQ8A 3QJHA 1T1ZA 4NJ9L 4CRPA 4L4JA 1MJ7H 3QYMA 1QOKA 5CP7B 3WFEL 1CL7H 5A40E 1KGCD 3DX2A 4YFLF 2MQ3A 2WNKA 1R5IA 3ARPA 4RMVA 4XBGA 3W5MA 2E9IA 2YEQA 2E9GA 1XGPA 3BKJH 3O3BA 4JCLA 4QO1B 1CG9A 1K9TA 3T4AC 3OAWA 5DHVA 2WO2B 2XCMC 3GPEA 3MOQA 2HJLA 1GZQB 1GGCH 1QR4A 1X4XA 3PHAA 1WZKA 4HS6B 3L3GA 4W9ZA 4WJ5A 5FUOH 1LO0L 2OMNA 2JJTC 4Y5VA 2B4CH 3MV7E 4YQXH 1AIFA 4ZOAA 5KOVC 3ULVD 5BUGA 1BOGA 1HHHB 3MRRA 3ZW3A 3Q6GH 4MJIB 4U0RC 2B16A 3MCKA 2N7BA 4TLSA 4LNVA 4XX5A 2HRPH 1SJXA 2XN1A 3TA3C 4CVXB 4KVPA 4WUUB 3GMMB 5IVXF 1MDAA 1KMGA 2BS71 3C8DA 4BGLA 4M4PA 1KTLA 5JHLA 2AV1B 4LFHG 4A2MA 4BK5C 4RX4A 3W56A 4KTYA 5IROA 1OTTC 4LO9A 1ZLDA 2QQKL 5FV1L 3OZ9H 1BD2A 1T4WA 5DZAA 1USZA 5IJVA 2NX5A 4KNQA 2YPVA 4XCNB 3CN3A 1UEMA 2QR0B 2XC8A 3N44B 4M8VA 3D0AA 2Q87A 5TF1H 3U9PL 4L3FA 2Y72A 3OKDB 3LTVA 3MRNA 1T21A 4AJWA 4PP1C 3B5HA 1UJTA 1DQTA 2HVJA 4K73A 2J6EH 2NQ3A 5IKCA 3DX8B 4PJ7A 1KTDA 2NY2C 4Q9BA 1ZLWK 1XB3A 2FYYA 3HHRB 3P40A 3FRUA 3MCG1 2PYEA 1EX0A 3WE6B 3GD1C 1CICB 4R2GB 5CMAA 4ZO8A 1FZKA 2NQCA 5AOJA 4Y89A 5LJYH 1MCIA 3LEYL 2RTTA 2P46B 2UXTA 4L4VE 3CFMA 3UROR 1Q9WA 1AACA 3BP4B 1DE4A 1MRDL 1ZGLP 4K2UL 2WWKT 4RGND 1UCBL 3X1NA 4HHWA 3D25A 4E9SA 4NO0D 1ZE3C 3N50A 2XV6B 4DAGL 4Y2DB 2EH7L 2YBRB 4UQEA 5AVVB 1AS8A 2JB5L 4MZ2A 3VWJC 4FTVA 3SBQA 4R3SB 2PKDA 1QEWB 3LNGA 3ETTA 4K7PH 4Q0XL 4FXTA 4TRPL 4LRIC 3U0WL 4LVEA 2EVFA 5IR1B 4JY6B 1HH9A 3QIWC 2WINB 1I8IB 2X28A 2GJZB 1MLBB 4PLKC 3LEXA 1DBBL 4ZUTA 4GO9A 3MODH 1M2OA 3ZL2A 4Y4FC 2FH8A 5JOFB 5IT2H 1NGPL 3ZQ9A 3FT9A 2OMVA 4TL4A 2X4NA 5GGUB 3ZKND 3MBEC 5G2NA 1TT6A 1DEDA 2L4OA 1MAJA 5B39B 3GS0A 5E2VH 5KAQG 1MEXL 4LDOB 4LSQL 4PYGA 1SXBA 2QMJA 2VM9A 4Y5XA 3DI2B 3ZKXC 4N1CA 5I9QB 5D5MF 1RULL 1DR9A 2XPGB 3KPQB 3MRFB 4ZNEE 1WWWX 1CTOA 4GMSL 4W9CC 4MYWB 4PJCF 1D6EA 1PZ5A 3T0BA 5KAQF 1COBA 3X1EA 2WO4A 1DN2A 4P23C 4BYHA 1XCQB 2APSA 1SN5A 2KH2B 3LAFA 1DVFD 1WRFA 4NLHA 2OXGA 1PG7W 2R83A 5MI0B 2CA4A 1I1AD 3H2PA 2PW1A 5D71H 1MJ8L 5TK4A 5L6YL 1JHLH 3D6GA 3FFCE 1EJOL 1IAMA 4KV5E 4WI3A 2BNQD 1WFIA 3MV8B 5AD0B 3H7BA 1XF5B 2CUHA 1A4CA 4EIBA 3CDFA 2CSPA 4FD0A 4RDBA 2NT0A 5DXWA 3H8NA 4X7CC 2BVPA 1HHKB 4OM0H 4C56A 1IZJA 4MMZC 2OCJA 2E7HA 2FHCA 3LVTA 4XBPA 4UZGA 1WD9A 2O1AA 4UT6H 2RAMA 3RY4A 4G6ML 4JO3H 4PRIB 4ONFL 1FV1A 1Z9SA 4H8WC 1ZWIB 5ECGA 5IFAL 3QJFA 3B8YA 3MO1A 3QUZB 4P5TB 4S0TD 3UIYA 4G9FD 4XPHL 3BMWA 4Z0XA 5EG6C 4E9TA 2NY0C 4MNQD 5LGYA 5F7DA 1JPST 5T1MA 3AADB 3F7QA 2BCMA 3H9SD 4MXWL 4HMDA 4QCIB 1TTCA 1JPSL 1ODAA 5C08E 3P69A 4MMXA 3TN0B 4XXDB 5I1EH 4AEFA 4PJEA 1SFDA 4UIMB 3JBG7 5E24E 2ZOKB 2CA3A 5F1IB 2QSVA 5E08H 3QHZH 3FT3B 2HH0L 5DHDA 1XGYH 1ZEAL 2IBBA 5AKVA 3FU7B 3QDJE 3TPKA 1FFOA 1SHXA 2QKIA 4P48A 3ZRFC 1KDIA 4W81A 5KUKA 5C0DA 5DJZB 4OIIH 4A7VA 2Y0SA 5CLYA 3MX0B 3D4YA 4PJFF 3GGWA 4NKDA 2XV2A 3ZR5A 2TRYA 5GZOA 1PF3A 1TQSA 3L6FB 3KLHC 3HR5A 1NFDE 2Z31B 3HI6H 3HKZA 1TENA 5I73C 2WGNB 2W92A 1RKRA 1A7NL 1O5DT 4LSSL 2H6OA 1ZY9A 2A74B 4LSRL 4UANA 3SY6A 3QHFH 2A9NH 4HEMA 4ZMWA 4Y2OA 1IGIH 2VDNL 1CF8L 3LV3A 4JR9H 5SX5K 4WU5A 5C9JA 4HIIB 1WWBX 2NSMA 1B3IA 4QHLA 3D1MC 4Y7OC 2DLTA 3V4LA 1Z3RA 3JVFC 2CLVB 1J18A 4PB9H 3TZVD 4CBPA 1AG0A 1Y0LA 3MKGA 4HCRH 3TO4C 1F90L 1VACA 2R9HD 4TF4A 4N20A 5ABZA 4JDEB 1T5WB 4P5SA 4Z7AA 3E2HC 3PYCA 3FO2B 1NA8A 3GSOB 4MCMA 4HK0A 3O6FB 2JQMA 2A4EA 1LDPH 3L9BA 4MA1C 4JFDE 2UYLA 1HESA 1KDJA 5I66A 3KMDA 4Y19A 1AYRA 1QBLL 1V27A 4KI5C 2Z1PA 4JFWA 3L08A 4MSWB 3Q8CA 2A2QT 5DJDA 5I5MA 4QRRD 5DUBB 4PRNA 4WU7B 2EZ0D 3C60D 2ORBH 4GRWB 5DFWH 1KENH 2ZYHA 4I2XA 3P9LB 3CXDL 4LGRB 4KRPC 1TYRA 1H5BB 4XCCL 1QFUH 2BSRA 5HD8D 1TZAA 1DQQB 5DURB 4CU7A 2KL6A 1U8HB 2ED9A 2I60L 2P5EE 4GBXA 5DO8A 5L7XL 3DJRA 3KM2A 5A7EA 1O9WA 4P2OC 4UIKL 3GHPA 5TE6H 2ILLA 5DJ8B 1KCRH 2V4LA 3O6LH 1HL4A 2EKSB 1UQSA 2NUPB 3Q43A 2XNAA 2YMTA 4LCCB 1LO2L 4JO4H 4NZUL 1BJ1H 1NDTA 2HG0A 5J8OA 1EO5A 4GRMB 1XAUA 2HT4D 3MXVH 4LLDB 3SPCA 5JORA 2WNGA 2CK2A 1UVQB 4OCYL 43C9B 3LKRA 5JPNA 5HDBB 2ZUYA 4FYSA 3PP4H 1EAOA 1GIGH 2VDMB 4I4WA 3RLSA 3FQRA 1RZKL 1F42A 1N6UA 1PD0A 1G9NH 2ZKYA 4Y16C 1FC2D 5GISL 1HXYA 2A6JB 2D0FA 1FSKC 2IQAA 3KEDA 3QDGE 1K2DA 3BISA 4EBQL 4OBRA 5FYJU 3ULSA 1XH3A 2XZQH 4X6DE 1DN0B 3O2VH 1YDPB 1P2CB 2HRGA 1F3JB 4X5RA 4AH2A 1PLGH 3CLFL 2Z35B 1HH6A 4MJ2A 1JUFA 5ISZB 5GRJL 5KG9A 3PAVA 1CXKA 3OLGA 4PY8J 3TTSA 5HYQB 3TP4A 3L2MA 5GRXG 1CFMA 3CSFA 4DFHA 1A1NA 4XN1A 3ZUCA 1FN4B 3RHWK 4JFEA 3X12A 4AYSA 3LRMA 3LZQA 4ELME 2DQUH 5EUOE 2N59A 4GG6B 3CFTA 1WBXA 4AC4A 4AC2A 3QRGH 3AG3B 3MJ9A 5HJGA 2ZQKA 1JN6A 5DUPL 3VXSE 3NDYE 4DQAA 4G8EB 4MAUH 5CR1A 3RDTB 1M53A 4ODXA 1BQ5A 2A3TA 3N0PB 2Y5QA 4TQ8A 2OMTB 2WVVA 1BQLH 5LN8A 3FQWB 1QW8A 2HKFH 3ZRSA 2AEOA 4LHUB 4HIEB 4GIOA 5CR8A 2ZSVA 2BCKB 3GBNL 4UB0L 4AYBA 3MRCB 4PGEA 5HJ3A 3RGVC 2GABA 3MACL 3MRJA 3RWDA 3WFHA 2CLRB 1EQWA 4HF5H 4R4ND 5L8KB 2HX9A 2H6PA 5CJXA 3I02A 1GKEA 5DZNA 3T0EA 3A5VA 4OKDA 3DK0A 1CYWA 3MOAH 2ZNXA 4E42A 3BFQG 3EOYG 5DFTA 5L2KB 2BVOB 3Q5TA 4HKJA 3UTQA 1XXFC 2NXYC 1JFQL 3R7RA 1LJMA 1RFDL 2MSPA 2IGFH 4FFZH 4BZ2H 4NHUB 1UKSA 3VI3E 3IETB 3KPRE 4ZTOH 5E5MB 1T0MA 3RVTD 4BCXA 4AX3A 4IQHA 2EUXA 5ETUB 1YUHB 3BAYA 2F2HA 1DL7H 1NOAA 2A9MH 2KLRA 3C5ZC 4GAFB 4UNVA 1GW0A 4L0YA 4JDTH 1ONQB 4AIOA 1E3FA 1BQHB 1I3UA 3OKNA 3QWRA 1QRNA 2YMXH 4KROC 3HRZB 4XNUH 1JGVH 1G9EA 4YHPA 4ZW3A 2WGXA 4RBPH 4LBEA 5FGSA 2GBTA 4IDLA 1RUPL 4MJHA 4WNQB 1JYXA 1RJYB 1T1XA 5D1QC 5ANME 3WHXB 4JE0A 1OP5K 5F44A 1DVXA 2IDFA 2P4AB 1KJ2B 3LS5L 2EECA 1DCEA 2AITA 4PBDA 2WXOA 1ORQA 1L7TH 4Q97A 4WQOA 2V9TA 4R7VA 2AI0H 4NIYE 4Z7QF 3NSXA 4OB5H 4D2NA 2F7PA 4NHCH 5IMLB 4BQ8A 4PLJD 4ABUA 5IVXB 4I3RH 3WD5L 2X44D 3O6ML 4HKBA 3IXTB 4YGVA 5FK9A 4M48H 4ZZFA 4HIHB 4NENB 2YC1A 3SZKC 4FA6A 5D1ZB 1BVNT 5DZPA 2IH8A 3OJVC 4JRYB 5E8DL 1BYPA 2IAND 1Q0EA 1FFNA 3OMNB 1HWGB 4KU1A 2IWFA 1FNHA 1UACH 3R7QA 1U4FA 1VFBA 4IIQA 3CVCA 1VJSA 2XICA 4JMXA 2NQDA 1YEFH 4M4RB 5IESH 4N1HB 5B21A 4BHUA 2Q0ZX 4XMZA 4IRSC 3UJJL 4DVRL 3CH1B 1AHWA 1SBBA 1YEHL 5I8CB 4ADIA 1P9MC 3H9HA 4JPVH 1SBSH 3MYJB 2ED6A 5BQ7A 1OO2A 5DJ0B 3RTQB 1J0HA 2FQDA 3W5NA 1G1KA 3LXAA 5C0AB 2H1PH 1KLFB 4M61A 2BMKB 1IEAB 3HC3L 3V6OA 5IB4B 4Q2ZA 3JZ7A 4G42A 1QFWI 3IJSA 1VZGA 4F8QA 3ARDB 5F1SA 2BSSB 4KI5F 1ZHLB 1HOCB 5HHQA 3INUL 5E8OB 5HXMA 5I74C 1TU2B 4OH2A 3TNNA 4I48B 4P2QB 2XG5A 3P3RA 3OKLB 2VR6A 4X6CE 5F6IB 5KSAC 4HHAB 5DK0A 1KCVH 1WF5A 2FH6A 3EH1A 3CMOL 4PG2A 4A6YA 1IBGH 1MCEA 2QTEA 3D85D 4OLZL 2WO3B 2WXLA 3BDXA 3LCYA 1KEGH 5I8KL 1T6VN 3SDXA 1LQBC 3P3YA 1T66D 1IIIA 1LWHA 3GSNA 2Z92B 2X2UA 3K2UL 3FQYA 3JTTB 4PI0A 3CFEA 4WNSA 4M43L 2V5YA 2QPDB 3UYRH 4OZGE 1NAKL 4V33A 3RWCB 3VFPA 4HC1A 3ABKB 3FB6B 2VYRE 1UCBH 3K6NA 1YEDA 3NCYP 1T6BX 3FUKA 3CD4A 4UQAA 4CBZA 1DBJH 3BIKB 2AJZB 4ETQB 2JB5H 1TQCB 3KL5A 5D5MB 5K9OB 1TQBC 4KTGA 2Z9TA 3GSUA 2Z7WA 1PX8A 3HPLB 4MXQC 1WITA 4PJCB 4DVBB 2ISDA 2V2TA 2JELL 4FQPA 3ULUC 4TRPH 2UWEA 3BZDA 4LPTA 1I3RA 2ZYSA 3CQQA 4ZUUA 1HYSD 1F4WH 3ES6A 3BP7B 3RB7A 4J4PD 3QK0A 5TGBB 1N9PA 2XTLA 3M1BA 4S1SH 5DRZA 5DD0L 4DNLA 3D39A 3VWKD 4KDVA 3EH3B 2YGOA 5FDWA 5D70L 4I77H 1SYVB 5F88B 4HQQL 3EIFA 3QR0A 4FP8H 5FYKE 5I1IH 1DJHA 4FXKB 2IV8A 1MEXH 2VAJA 3NACH 4U7SA 1AQDB 4D94A 3T2OA 1MFVA 3SDAB 1WG3A 5JPMA 1DSYA 4I0PC 4MA3A 4APQC 3S35X 4C57C 3NCCB 5F7BA 1LK2A 3FTVA 3FSWA 5AVUB 1K8IA 1VPOH 3NDZE 5MP6L 4EE2A 5FO8A 3OHXC 4NQEE 1HYRC 4XCFL 5F3FA 2J6WA 3CX2A 1QHOA 3ZL4L 3MUGB 3OB0K 4A2LA 2R2BA 2BIHA 3BVVA 4F1ZA 3BEWB 1BX2B 1XSOA 1L6XA 5CKAA 2LFGA 1ZANL 1AGBB 4WUKL 3L3OB 4HWEL 1IILE 2XN9E 2X2HA 5IQ7H 1PGRB 1NCIA 2D7PA 4NP9A 1TIUA 4GEIA 2E59A 3S5LA 3UACA 2ZXAA 1URZA 5F6HJ 1ITBB 3VFVB 3BYYA 4YDIH 1CGSH 1DQIA 4R96B 2WQAA 2JB6A 4NUPA 2OTWB 4OIBA 2Q6WA 2XYCA 2AEWA 3B8SA 1XF4B 3HG5A 3ARGD 3VW3H 3WS6C 2CO2A 2XTJB 4GB9A 1ADWA 1FBIL 3LKSA 1SN0A 2YD6A 4R4FL 4Z7UA 5T33H 3T65A 3QIBD 2V3DA 3QNYB 4IRZA 4AIZB 4DP8X 3U1QA 1N7MH 5CAYB 4KZEL 1G4MA 3BUQA 3JVGA 3WMPA 1VENA 3QNXA 3V6ZB 1F58H 4JO8A 2AJUH 4B5ZA 4PRPE 3ZT7A 4XNZB 4TSBL 4PG9A 3O4OB 2O5YH 4WWKC 3GTTA 5JXED 4QRUB 3UCQA 4PJFB 4YHNB 5JZ7C 1ESOA 3MYZA 1YMME 3S8GB 4L48A 4OBSA 5GGTH 3ZLQC 4AQEA 5E9DD 1LP9F 1TJIH 3DRQB 3U6RA 2WOBA 4IKLA 3VDCA 1DBML 3QIUD 2HX7A 3UPRA 2PXYC 3FU6A 3W11C 1SY6A 3FU8A 1CURA 4OLYH 1NCAL 2TAAA 2FO1A 1YYCA 1M7DA 5KSBF 4MA8L 1I8LC 3B9KD 1BLNA 1DDHA 5D7HA 1DVTA 1NAML 1U4EA 4U0RB 4HOWA 5DJCB 4IMKA 3TV3L 1QPPA 3MRMB 4MMYA 3TA3B 3VXQB 4U1LB 1TETH 5AW8B 4A67A 1EXHA 4OTXH 4EKJA 3DXAE 3G6AA 4LESA 1JZ7A 2Z8SA 2YQ3A 5FYLL 5FCUH 4ZAKA 2Z34A 1ITCA 1TZHA 3BMVA 2BZCA 4HUXA 5BUPA 2P8LA 4HUNB 1ND0B 1PNCA 1NC2B 2PETA 3SCMB 3I6KB 3WKML 1OW0A 3HFFA 4KPHL 1LE9B 1MAKA 4LDLB 3KPPB 3LMJL 2PYFA 3MBXH 4Z78A 4PJ9B 2AZUA 2D31B 3EJYD 4QRQB 1EBPA 1P7KB 3GIZL 3OR6A 4F7PB 1PMYA 3T0VA 2MMXA 5I18H 3UP6A 1TO4A 5FFOA 3CN1A 5CJXC 1QLRA 3QXVA 4QR7A 1ACCA 5F9OH 4DQOL 1B90A 2NY2B 3PWJA 5KSUA 3G5ZB 1C1EH 1HNGA 2YN5A 4NQQA 1KXQE 2R29L 2AQPA 4L8DA 4U1KB 3B3IB 2F9BT 3V0GA 2V6HA 3BD5A 2J3SA 3LRSB 3FONB 3QCVL 1OGTA 4N8VA 5FYLE 3DGDA 3MNWA 4QOKB 2E7CA 3ECBB 3P4MA 2P44B 4MZRA 3VVVA 1F11A 5FA4B 2CWRA 5LCVL 2Z93B 3NH7L 3SPIA 3ARXA 2YR3A 3F05A 3FO9B 1AR1D 4WEEA 3FHEA 3SDDC 4H26A 3VWJB 3NFPB 2WVTA 1BJ1J 3AT8A 3T2LA 1F1DA 2DPKA 2H8PA 5E56A 4N26A 3ZO9A 3KPSB 2X4UA 4ATWA 1OGAB 2BHYA 3O3AA 3QIWB 4U6VL 1J11A 3QH3B 4FQXA 3HLAB 4Y2LA 2VLME 4KNTA 2DMGA 4QXVA 3MZTA 2QQLL 4Y4FB 1BLIA 1ETJA 4JQXC 5AB9A 3HCVB 5AENA 3QW9A 2B08A 2IFFL 4UM8B 1TNNA 4BFNA 1J8HE 5E2JA 4G8GB 3MBEB 1T89C 1U8IB 4U1NA 3H7LA 4ZTPH 2F8XC 4RSVA 5CZXD 1GTFA 3VUAA 1OAQH 2MKWA 3BHBB 3PQYB 2WQVA 3PL6A 5HGHB 1NUFA 3FCBA 3ETSA 1CI3M 3MLZL 3GUTA 4ZFOL 1MFAL 5D2NA 4PJ8D 2R29A 3AWFA 2B3RA 2ROXA 3QJRB 4XP4H 1EH9A 4IDJL 3ZKXB 4JPSA 2IEPA 4HGWB 3VE0B 2CCVA 1GL4B 2R1XA 4WI0A 1SOQA 4IOFC 2ADGA 5GS0D 4CSSA 4TUKL 5GISH 3MLWH 3KYOA 3PWUB 2ZOLA 4U3SA 3D8MA 5JDJA 2JJSC 2NLJB 3HC0A 3UBHA 4LLUA 2GBUA 1BP3B 5AVQB 5I6XC 3CUPA 4KTDH 5EWIL 1FYTD 1DQLL 3ARTA 1IV8A 4XP9H 5CD5C 3EH4B 2VDLB 2RFXA 5GRJH 1MFEL 4HSAC 3QUXC 1T1YB 1ZTXH 4W9HC 4A7GA 1N12A 4F37K 3V0WH 1U58A 2CIIA 2GJ6A 5L0QC 1OSPL 3EXJA 3FTWA 4YUEH 2X4PA 4FNPA 1H15B 2ZF8A 5E7BA 5FV2A 5C86A 4QRTB 5CWSA 4B97A 1KY6A 2D3LA 3VTMA 4MMZB 4AE0A 5AUMA 1WFTA 1I9EA 1AZZC 1KJ2H 1PZCA 2KQNA 3I2CL 3OXSB 4R7NA 4ODSH 1E9QA 2NNFA 4Y1AA 1BXAA 4UTAH 3BT0A 1XIWA 1KTKE 2QHRH 4A1RA 4M9OA 2AV7A 1MAMH 2NY0B 3D05A 3SPGA 3QXDA 5GPRA 3F6IA 3U48A 1IGJA 3RL2B 4MCYB 2WQ8A 2F0CA 3TFBA 4BELD 2BM3A 4IEFA 2FCBA 1OM3H 3EJCA 2CHWA 2JI1A 5DQ9B 4WFED 5HHOE 1RIUH 4OFIA 5LGJA 2AQRA 5KYWA 2N1TE 4YZFF 4WO4B 4LEBA 3HUJF 4ALAC 5TFSL 3AVEA 3V4PL 1AZNA 1BGXL 2J1KA 4CSZA 5E8PB 4WNJA 2IF7A 1IQDA 5IMOB 1JD7A 4E41D 1N0XH 3WDJA 1OTUD 2IG2H 1JXKA 3QPXL 4JFXA 2YJLA 3MUUA 4Z7QB 1ZKAA 2Y7NA 3DURB 3TWCL 5HBBA 3KPLA 1BFSA 1UM4L 4M8QA 1I1RA 1KPRB 3GI8L 3NJFA 4ODVH 2ENYA 3O4LB 2G9HA 1GYWA 3VU2A 2DQ6A 3L17A 3E3QC 3QWOA 1CE1L 1U33A 1UOVA 4K07A 5CJOH 4BKTC 5JYMA 1FNSH 3CPLB 4MAYC 4Z77B 1E90A 4WEUD 3DX7B 4PB0H 1MH5B 2J6EA 2Y06L 4AQ1C 3SJVA 1WFMA 4PGDA 3TCLA 1RZJC 3U0PA 2JCCA 1SM3H 3GLDA 1BVZA 1KIPA 1IC0A 1B4JL 1DQKA 2VLRA 3DVGA 3G6DL 1LO5B 3NSYA 4K71B 1NMBL 3GTNA 4N8CH 4KBPA 1A47A 1NLDH 1QLEH 4G59C 4U6YA 5FUCC 2X53A 3TO4B 1OY3B 2VIRA 3NIFF 2F58H 3E2HB 2CPCA 5GGRB 1KT2B 3SKNB 3OAYK 1D5ZB 2FO4A 3PGCA 3GXDA 4PS3A 2R1WA 4X9BA 4X6FB 1PIGA 5DVPA 3RIAF 3TL5A 2Z8VC 3MJ8A 5T3ZL 3UL4A 3QVAA 4RGOL 3HZ3A 2HTLC 3D09A 4MA1B 1CYXA 4WSKA 3FB5B 4LARH 1FNLA 1VRSA 1J1PH 3E9TA 3QI9A 4LLYA 1MI5A 4PWEA 4YO0A 4ZRGA 1OAYH 1QFHA 3QZPA 2DLHA 1RK7A 3DHJA 4H0GA 1UC6A 3VFUA 1WFNA 5J6GA 4MBRA 3S35H 4OZFG 1ADQL 5GS1C 5H37A 1KEML 3SGEH 1WHOA 3K4AA 4XX1E 2NR6C 3V5KB 1S9KC 1UG9A 2YQBA 4KRPB 3CQPA 5DTFB 3K2MC 3ZO0A 4AYID 1A7OH 2P24A 1HIMH 3IMBA 1AO7A 3QEHB 2J8UA 1AGEA 3QFJE 5F7KC 1L3WA 4M5YL 3W38A 4EF3A 4HH9A 4KNUA 3RI5F 1XGZA 2X7LB 4P2OB 5IQMA 1I3GH 2ZG3A 1E3XA 1WT5C 4MD5B 4UNIA 1B4TA 3NAAL 3NUKA 1RSYA 5T3ZE 2APWA 1CLZH 1UJ3B 3J7HA 3KLAB 1QQDB 3JWDC 3OKKA 3INUH 3T77B 1LTXA 1GGTA 2ADFL 3L3JB 4N87A 3EUDA 1FGVH 4L1HA 4Z95H 3ASOB 1OM9A 4KMLB 3RE0A 4S11A 3CFDA 3G5WA 1KZQA 3BP6B 4UBDC 4HOZA 2AC0A 1HHIA 1HFUA 1T5XA 3DTXB 4XPFH 2G3XA 2NUTB 1U0QA 5INDB 3OR7A 5ADPL 2PP8A 4P2YA 1QMUA 4WWNA 1KLUB 2OYMA 4QTHA 4Y16B 1ZLVH 4OLZH 1QBMH 2J73A 1NMCC 2BSTA 4FI7A 1FSKB 1T83A 1PYWA 2KI6A 5C0CD 3P3SA 4JEGB 5AWNH 2JNZA 3HE6A 4MDJB 5C0BE 3CBJB 3QXUA 1FORL 1ADQA 1HTYA 3C2AL 4L3CB 4NQCA 4E5XG 2ETWA 1FC1A 2EIZB 5FYKH 4LCYB 1IZKA 2CALA 1IGCL 4L37A 3RVXC 4QD2E 4V1DB 4GRLC 1M9SA 4OJAA 5IM7A 4QYAA 2P80D 3TIEA 1YEEH 3S7GA 2CGYA 1SLWA 3VGFA 7FABH 4FA8A 4C54A 1R3KA 3U82B 2ATKB 1BXVA 1P4BL 2FT6A 4EUPH 2VL4A 1YEJH 2QGBA 1QZ1A 3DARA 3VXUA 5J9PA 1SPDA 1DQDL 1QSEB 2JELH 4OF8A 5I1JH 4J3SA 5EU4A 4JRXB 1UB5A 4HIJB 4EI5A 2WYZA 2GIXA 1NDMB 2D7OA 1CFVH 1ZT1B 4PI2A 4Z7NF 5TH2A 2IDUA 5BNXD 3K6SA 1QSFE 1OHQA 1WWAX 4ZPTB 5I1GH 3Q3GA 3CTTA 2RQ8A 1E27B 5IZ7A 1EO8H 3FTYA 4UQ3A 5DYOB 2VUKA 4IJ3C 4PJ5D 4KVNH 2YAFA 3IKKA 3K91A 4NQXB 5SWZD 3VXRA 4XBEL 5HVWA 4A2GA 1JG9A 4J23A 3RGVB 3FSAA 4KXZI 3P4NA 3W9EB 1LL1A 2AABL 5HI4D 3EFOA 5LAXA 1TLKA 3C9NA 4M6MH 4PJGF 2V5RA 3ASNB 3VSTA 4ADGA 2BOCA 1AD9B 2KHAA 4WWPA 2VH5L 1CVRA 3U7WH 2NXYB 3TJHD 4C83B 1SEBB 3Q8AA 3JWNE 4XCFH 5LBGA 4DWHA 3FU3A 5INCA 3QNZA 4NM8L 5BUAA 4HKXA 4KDTA 3GBDA 3I9AA 3I3DA 4L3EE 4L9DA 5EO1A 1Z66A 9PCYA 4LB8A 5KYXB 1PKQE 2XQBH 2GI7A 1C5BL 5IY5B 2O61A 2VLJB 1LMKA 4NQSA 2JMRA 3GIVB 2A6DB 3FN9A 3QB7C 4JO1L 4K8RL 2E7LC 2BSEA 4JZOB 3NCXA 5KVEL 3PAUA 3C5ZB 2BWDA 1XF2A 5EEYA 4OM1H 3MV9E 2BNRE 2ARJQ 1JPGA 5JW3L 1OSYA 1C08B 4PWIA 5EBLA 1F86A 4PWGA 4JZJA 3PIQB 4KROB 5BJTA 2V33A 4H88L 1LP9B 2KDGA 2ITDB 3CN0A 4FNQA 5AAMA 5JUEL 2ADJB 1IC7L 2JQZA 4KOBA 4LXFA 1HHJA 2QPSA 1YAZA 5EOCL 2K3TA 4JM4H 3D87B 4HS8H 5KSBB 5IVZB 5IBUG 4AKQA 3DRTA 4FHKA 3ROOA 1GZPA 3UTPD 1C9SA 2VE6B 1WAPA 2XTSA 4YHIB 5E6IC 1D6VL 4TSBH 4D9RD 4O2FB 4OV6F 4X6EB 3K72B 5C07E 1LEIB 1UT9A 2R23A 4HS3B 2XWBB 3PJNA 2V5TA 2EXYD 1TJHL 3EYOB 1UUNA 5KVEE 5IBLD 4XN5A 2ICEC 4Z7VE 12E8L 1MIMH 5FB8B 3IFPB 4P2RD 1E67A 4O02B 4KTEH 4L1TA 1YMHB 5DUML 3OKOA 4W9FC 3KHQA 3Q6FA 1FJ1A 1VFUA 2YAMA 3S0PA 3D0VA 4ZMZA 3L3KA 3FUIA 4N6RB 4N0RA 4FG2A 3AGWA 1M05B 3K4ZA 3AC0A 5CFAA 1FWXA 4K3HA 1R3HA 2ITCA 4IRSB 1BVKA 2YSTA 3CDGA 4AL8H 1VKXB 3CZJA 2HT2D 1VFMA 4OLWL 3ZRCC 3KNBB 1EZVY 2EDLA 1ZDSA 2OV0A 5A7BA 3F7VA 1M4KA 3L5XH 2FEEI 1WZ1L 5KSVB 1QI4A 1JAEA 3DUUA 1WLHA 3GZQA 3HZVB 1MKFA 3UAJC 3VD4A 2FYVA 3HOGA 4MD4B 1BQRA 3AGVA 4ZOEA 5EU6D 5ILTH 4I18A 4BQBA 3MHZA 4RETB 3WKNA 5FECA 3AXLB 2EH8L 1ID2A 5FA3B 1IGMH 2GJPA 3OKEB 1GKOA 4NQTA 1RVFL 2BO0A 1EFXB 2BZDA 2ZX5A 4P9HC 1TSRA 2VMFA 5IF0B 4JHVA 2NW2A 5KSAB 1XSIA 3BJLA 3F83A 1R3JA 4P04A 3EOAB 5CLTA 3SDYL 2QPFA 3K74B 4QRPE 1W0WA 3ZKNC 5BXFB 4D0BA 1H0DB 1CD9B 1QO3A 1L4IA 2VC2L 1JVLA 4XXCC 2WAHA 1E6JL 1LVEA 3AQXA 3B83A 3BC9A 3WIHL 3FUMA 5KTEH 4XVOA 1NDGB 4XC3H 2HJKA 1NCHA 3R1GH 5I0ZA 1N2RB 4FFWD 5SWSE 1FZOB 3W57A 3ASWA 3PJSB 5D7JA 5ILTL 3IMRA 3IPBA 2DYPD 1DEEB 4KJWC 3OZLA 1GHFH 2VTFA 4LMQE 2EXWD 4PW3A 3HG2A 5A3ID 2C3VB 2G4GA 1AY1H 5T1DL 3V6FA 2CDEB 4NFDA 3NIDE 3EO1B 3J27A 1GRWA 5MHSD 1RZFL 3QQDB 2CBTA 5IHWA 4HGMA 2MH4A 4WFFD 5J7CC 5CP7A 1BIIB 5FYJE 1OWWA 4XHJD 3FQUB 4M3HA 4A39A 4D9QE 2JI3A 1B6UA 4ZBJA 4X7SL 5A2FA 1ZJBA 2ICWB 3QEQB 4QO1A 4ZSOB 1X7SA 4YXKH 4ZK8A 3I9PA 1KXTA 4MJIE 5I71C 1J0IA 1GZQA 4HS6A 4OU3A 4C4KO 2VDKH 1DJWA 3SDCC 4WUUE 4OZ4A 4G6JL 4FFZA 4BZ2A 1KCKA 3OG4B 1EXUB 2XWCA 3K1KC 5FAAA 1HHHA 3R0MA 3WN6A 4IDJH 2ESVE 4I0PB 3WIHA 1H3WM 1Q72L 4ICXA 1U92A 3HC2A 4ZXBC 5AZ2L 3TH2T 4KKAD 3OSVA 1U8QB 4AQ8C 1SVZA 3OHXB 5HPOA 3GMMA 1FLTX 1J48A 4FQ2H 3G7TA 5AOKA 2AV1A 3L54A 3R06B 5LB1A 5GS2H 1HU8A 2IAAC 2WTRB 4KVCL 3QQXA 2CR3A 3FQ2A 1LLAA 4Q4IA 5DS2A 3WLWD 1JMZA 3ZQWA 4XCNA 1INDL 1DBAL 3B1TA 2QR0A 3CDYA 1RAMA 2W9EL 4Y5VC 1KYFA 1D7FA 3OKDA 4BXSV 2WJ5A 4W9JC 5BVPH 5LDUA 2V7NB 5SWQB 1I9IL 3DX8A 4X9IA 1AOZA 3SQBB 3HUJB 5EPMB 3VFTB 3IFNL 4LCWD 4NUQA 2BOBA 2E7MA 3WE6A 5GRVK 1CICA 4DW2L 4ELKB 3STZB 4JGJA 5AB1A 4FNUA 5CNHA 1KELL 1VESA 5DVKA 3ISWA 1S78D 1ZXKA 1MREL 3K6FA 4UTCA 4AMKL 4RISH 1IT9L 5E6RB 1EFQA 4F5CA 2NZIA 4OF6A 5C71A 4FABL 2W07B 4WWKB 5G5DA 2VQ1B 1AQ8A 5KS9E 4GAAA 3CZFB 3PV6B 3BUTA 1SQMA 1RZ8B 3ILQD 4HUUA 4KUZH 5HYJD 3DV6B 1T0NB 2RHEA 3K6DA 3CVHB 1E7UA 3SQOH 5BRQA 4R3SA 4PVLA 1QEWA 4DEUA 2J57A 3D07A 5BZDB 3UMTA 4JY6A 5GXBB 1HI6A 4PCKA 5IR1A 2VITB 1I8IA 2WINA 5TFSH 1KB5L 4J3UA 5GGSY 2J71A 6PAZA 4BGDA 3L7FB 4ABVA 1JWUB 5DO2D 1Z3GL 5JOFA 2OMZB 5EEWA 3RBGA 1PIFA 2PW2B 3NIFB 5GGUA 2FB4H 5I0YA 4WI8A 3NRPA 3MNVA 1DQMH 2VLKB 5B39A 1A5FL 1RUAH 4X8JB 1YG9A 2EZ0C 1AKJD 5KJ4A 3IFOB 4X9HA 5AZEH 1R17A 4MHHG 3O3EA 1KYOK 2DW5A 2YK1H 3UG4A 5L2JB 3KPQA 2XPGA 3MRFA 4NT6B 3CHRA 5KANG 4F3FB 2MNWA 1DANU 2W5PA 2BY3A 4DJMA 3N40P 1X4YA 2BDNL 3QZBA 4NZDA 4JREC 2XACC 3MNDA 5BRZD 4OCRH 5TF0A 3WY3A 1Y6NR 1ZHNB 1XCQA 1JGEA 4EZJA 4G8IB 3G6JF 1ROCA 4UDUB 1UM6L 2YZ8A 3AUVA 3VM7A 1RV6X 2CD0A 2X4TB 1JF1A 5LGHH 2VLLB 1U2CA 3QJUB 2WBJD 1A6TB 1JRHL 2XBTA 4OZFB 3X1BA 5C6TH 2VZ3A 3UGEA 3IWUA 1A6UL 2BFGA 2Q3XA 1RZ7H 2CUMA 2Q76B 3VQ2C 4JO2H 3MV8A 5AD0A 1XF5A 5EBMB 3GO1L 3RY5A 2ZUSA 4AJVA 4F2MA 4PSRA 5I0XA 2JKJA 1X9UA 2AGJL 2PR4L 2VDPB 2XA3A 4JFHD 3HNSH 4KKPA 2QDVA 3B37A 5K59E 2E56A 3V4UL 4PJHF 1LO4H 1E2WA 5DD5H 5DK3A 4PRIA 1XZWA 1SVCP 1IKFH 5IHLB 1UD3A 4CMHC 3HZYB 3QUZA 4P5TA 3RAJH 5EZOL 4Z7WF 1VA9A 3LOWA 3IYLW 1A9BA 3TPUB 3ZTNH 2X3BA 3R8BB 2WBXA 3HHMA 4NUMA 3N55A 3N6YA 2F08A 4K94C 4JL1A 3B34A 2WK2A 1X5JA 4WI2A 4QCIA 5BS0B 4XXDA 4DP1X 3NAAH 2VZTA 4KXCA 1YEKH 4M5TA 4MD0B 4UIMA 4TVPD 4D7PA 1ASOA 5E6UB 4PS8A 3KGUA 3L2LA 1L0PA 2ZOKA 4DKFL 3BAEH 4JFQB 3FT3A 4E5XB 1XD0A 2A9AA 3RGBA 4POUB 3ESVF 1DSFL 2G60H 3FU7A 3ZGHA 3ZHFA 1SYSB 2OLDA 2J12B 4WI4A 5B1AB 1IAIH 3MX0A 3NJNA 1RPQA 3P3UA 5CJ5A 4LKXB 5AL0A 2NSXA 2C9XA 1T2XA 2NY5H 4Z7NB 2LU4A 3L6FA 5I1HL 2HKHH 1J5IA 1J1OH 3GRWL 4ODTH 2Z31A 3B5TA 2ALWA 1QHPA 2AQQA 3MV7D 1I7TB 2B2XL 2R0WL 4TLUA 2A74A 1TTUA 4HX1A 5IB5B 4DKAA 1SJVA 4ZFGL 3D48R 5EA0L 1QHQA 4HIIA 5D6CB 3TYFB 1WDAA 2Y7QB 2F1AA 3QUXB 4LCIH 1MY7A 1QLFB 5L0QB 2AJVL 2NX5D 3GT6A 4PJGB 1AC0A 4UTBA 3JWNH 2YWYA 4OV5B 2A0LC 3K8MA 4JDEA 1T5WA 3RVTC 1JDCA 3FB7B 3FO2A 2XXCB 3GSOA 1S5IH 2YRZA 3FF8A 2VDML 4O5LL 5A2LH 3O6FA 3MRKA 3WMQA 5I8EB 5GZOC 4XAWH 1G5AA 4R8WH 5DJYB 4ACPA 1G87A 6FABL 3KPNA 4FJ6A 2HFGH 5BV7B 4GRWE 1IAKB 1OGSA 1OD9A 3GS4A 4MSWA 2APBA 1JZ2A 1L9SA 2B9AA 2HLFC 4OW6A 1ECYA 1N70A 3KBEA 5DUBA 4WU7A 1UGNA 2Q8AL 4XO9A 5HP5A 2WUCH 4L8SB 4JGUA 5J3HD 2JE8A 3P9LA 3IVKB 1U6AH 3DO7B 2V2WB 2NNXA 4KFMA 2YPLB 2WKLA 3GRWA 2WPGA 3GMRB 2AJXL 1U3HD 1F56A 2QELA 1T7YA 2H47C 4L4VD 1MCBA 2NY6C 3KJ4C 1OD7A 1KACB 3KLLA 4ISVB 5D2LE 5T8IA 4ODWB 4DESA 2IH9A 3TS8A 2I9LB 5DJ8A 1IM3B 1YJDH 3QC5X 3CWGA 2EKSA 2NUPA 1NGZB 1XTLA 2NCEA 4ONGH 2C9PA 4GRMA 4LLDA 4V2CB 4N2MA 4G83A 5DCCA 1BFVH 3LB6C 2ZKMX 5C0JB 5IBUB 43C9A 3WJJA 1MQKH 2DBLL 2IBGA 1FH5L 4N2KA 4ABWA 4MAYB 4B9JA 3MOBL 1E4XI 4QKXB 4AQ1B 5EFIA 2G3MA 2ZUXA 4PJ7F 3I6GB 1VEOA 4TL5A 2QVKA 4LEXL 3GEWB 5EOCH 4MWFB 2VSCA 2A6JA 3BXNB 1PG7H 2XKUA 2UZIH 4IRJD 3QRLA 5TE4L 3EBGA 2LAGB 1DN0A 5C09E 1YDPA 1P2CA 3ILPB 5D7LA 4BZ1L 3WUZA 1F3JA 5EIIA 1X44A 5EU3B 43CAA 3NJLA 3T2NL 5ISZA 2C9VA 1YSOA 4ONHA 5ENWB 5JPNC 4XMPH 2J1ZA 1J5DA 1UA7A 3WFDH 1WAAA 2MPVA 1FN4A 1PEZA 5TQ2H 4RFNB 1BZOA 1ZPLA 2VSDA 3IK2A 1X5FA 4HUWB 4GG6A 4UILL 1T22B 3BKCL 5TDPA 5G4OA 1NIEA 5AYUH 5DT1L 4G8EA 3REWB 4HIXH 4EDWH 1A6VL 1G7JB 3THML 3RDTA 2H4EA 3AT9A 4BHUI 3NCEB 4NUJB 2CXGA 4W4OC 4YR6B 5AB0A 5GS1B 4DO4A 3FQWA 1TXKA 4PD4K 2JJWA 2VSMB 2FVNA 5GRZA 4LHUA 1D5RA 4HIEA 4KX9A 3X17A 5AVRB 1I9JL 3COOA 2BCKA 4G7VL 2VDRB 2X2IA 4BQ6A 2X40A 5FW6A 3ZQXA 3MRCA 4M7JL 2NZ9C 3NJKA 4GP8B 2F1EA 1T80A 1KN2L 5EZIH 1QUPA 2P43B 1XEUA 1SRDA 3RB5A 3OG6B 1VF5C 1DQVA 3T4YB 1FQ9C 5L2KA 2BVOA 5IB1B 4Q4EA 2DQGL 3HE7C 4N0UE 3V7MA 5GZNA 1A7QH 4OCMC 4QIRA 2PPFA 5I15L 2ICES 2QT6A 3DPDA 3DMMB 4HPOH 4NHUA 4KK5D 3IETA 5CSBA 2O6CA 2BFVH 4X98B 4R84A 5E5MA 4Z1PA 3FO1A 4ODHH 2YGPA 5FYJH 2XBDA 4JLRB 1YUHA 5F7EH 1HZKA 5CJQL 2C26A 2KZWA 1GYUA 1ONQA 4OCXH 1GGYA 3BRFA 5K9JH 2VMDA 1BQHA 3BH4A 4NNPH 4OVUA 5LG1A 5B38A 4HWUA 2DYSB 1PZAA 3HRZA 4U1JB 3T0EC 2DQFA 1L9RA 4KKCC 1N64L 1KSRA 3BPLB 2Z64C 5B22A 5AOMA 1EAQA 1RJYA 3FCTB 3MR9B 1RSFA 2APFA 2KS0A 2R0LL 3WHXA 1JNNH 2LLLA 1KJ2A 1L7IL 4H20H 3L48A 1CBVL 1CDUA 2JKWA 2WXJA 4PRHB 3W2DH 4HOXA 3DBSA 1GGBL 4UTAA 4CNIB 4KH2A 1RQ5A 1LDSA 4N25A 2IFGA 2JKSA 1R75A 4O9HH 1QG3A 4FTDA 2Q86B 1BZ7B 5IMLA 5IVXA 4NGHL 3MLXL 3L4ZA 4EI6B 3IXTA 1A02N 2JXMB 3D2UB 5C2BH 1NINA 3TA4D 1J8SA 1T6WA 4HIHA 3BRDA 5D1ZA 1JPTH 1CTMA 2ADIB 2CGRH 4PJIE 1YNTF 5GRUH 2NXZD 3F85A 4IJ3B 4JRYA 1TSHA 5JLZB 4BFKA 4FQJL 1OEZW 3DHMA 2EDQA 1GZHA 2YKLH 2AQ2A 2R56L 3C5SA 5C0AE 1WK0A 5GGVL 4N2OA 4M4RA 4MB4A 3QARA 2YEVB 1MFUA 4JFDD 5I8CA 3CGTA 3ULVE 2HRLA 1EHNA 1BZDA 4EIZC 3MYJA 4ZS7L 5DJ0A 3RTQA 2QBWA 1BAFH 3VGDA 3VVWA 2G2NA 5E95B 2CLZB 1KLFA 2EP6A 4NPJA 2BMKA 5I0WA 5J6HB 5FO7B 3ABZA 5AOZA 4XNDA 2AK4B 4KVCH 3ARDA 2YHGA 2BSSA 3S98A 1ZHLA 4OF5A 4YXHH 1E4KC 3QR1A 4WKZB 5B3SB 1HOCA 2XXFA 5I0DA 4L1SA 4U1IB 4U31A 5E8OA 4GI8A 5IBTH 1WS8A 3LQAL 4MVBD 3QQ9C 4I48A 4IIQC 4J3TA 2A83B 4P2QA 4XVSH 1UTDA 3OL2A 1GOGA 3TT1H 2RCSL 3VD1A 1NOFA 4HD9A 3OKLA 2P5ED 2X38A 5BZZA 4G71B 3B9KC 4L4TE 4HPYH 4NWUL 2BW5A 2WLKA 4HHAA 4EZKA 1MUJB 2Q7YA 5DS8B 1TFHA 4TN9A 3F04A 2JSFA 3LNEA 2JK5A 3IFNH 2CIKB 5GRVL 3S97C 2VAAB 4WI9A 1BEYL 1WIUA 2X1XR 2K7PA 4BDVA 3V6OC 4DO6A 2Z92A 2IADA 5TQ0L 1Z1WA 3N5AA 1W72B 1TPXB 5E6IB 2ZP0T 4XN8A 3RWCA 3B9AA 4UQBA 4PJCE 3FB6A 5FHBH 3MRLA 3GLZA 1GSMA 3OJMB 3SE9L 4NAJA 2Y7LA 5JMOC 2AJZA 4TULH 4ETQA 4KO5A 5EU5B 2DEYX 5D5MA 2IDCA 5K9OA 3CLEL 5JXAL 1G0YR 1DJGA 5LXVA 1WH0A 3HPLA 3EYFB 2IOMA 3FTUA 2CMRL 2MRYA 2VQTA 2WSKA 4JY4B 4UDTB 1BVLB 5GJTH 3SEPA 3MLSL 3VO0A 1ZS2A 5E6ZA 1GS6X 4YWGH 1RIVL 2QMKA 3BP7A 1KB5H 1M56B 2KYIA 5DEGB 1P4LA 2OTUB 3L9RB 3G6JB 5J1SC 3BQVA 5I82A 4UV4H 2EDXA 2EDMA 5KOMC 2ZCLL 3IJ7A 1NC4A 1FLRL 4IBUA 5E1AB 3KM1A 2YOCA 1SYVA 5F7AA 4XP1H 3ISRA 4HJSA 4NO0B 1U2HA 1AQDA 2X1QA 1HL5A 5D1XE 4F15C 3SDAA 2B77A 1OCRB 5H35B 1G9MH 3G5VA 5HHME 4LEOB 5T1LD 3S88H 2JKLA 1YEIL 3RUGF 3DVFA 5E5LA 5A2AA 5E1QA 4PJHB 3MUGA 2V3EA 5TDNB 4CU8A 4RMBA 4YFEA 1KIRB 5JW4N 3HG1E 2K78A 1AZVA 1NBQA 3BEWA 3B43A 3GM0A 1BX2A 1PZSA 3UPAA 2DJMA 1AANA 2FX8H 1AGBA 2CRZA 4Z7WB 3L3OA 4TV3A 4UI2A 2EYTB 3GMQB 3HG3A 1VCBC 4OFDA 4X5XB 1GA2A 4XODA 3KEHA 2FIKB 5FCSH 2NTSP 5EO0B 1GJWA 5HPMB 3FFOA 2UXGA 1DVQA 3MLYH 5JW4R 3VFVA 2MIZA 5JA9A 5JPMC 2MCG1 3KWWB 4R96A 4EEEA 1JV2B 4PY8I 2OTWA 2EIMB 4IIZA 2H7WA 2BNQE 1MFBH 3CV5A 3KPRD 4NUGL 3GS7A 5A1AA 5I1KH 2C3HA 4YEFA 3QNYA 4AIZA 3VSVA 5DJXB 1KJVA 3VD0A 2WIMA 2CHZA 4S0SD 3NTCH 5K1VA 2R69L 3ZE0F 1LILA 2R15A 4FKEA 1A64A 1I1AB 4HT1L 3CH8A 3T0AA 1P4UA 2DKSA 3DIDA 3C6SB 4QRUA 4PJFA 4JFZH 4M6OH 2VXSL 4YHNA 2A5UA 4EZLA 4I9WE 3FN3A 4S10A 2OK0H 1ES0B 1EERB 2B8OT 5BV7H 4MNQE 2J88L 3DRQA 4G6FB 5I71B 3K2IA 3QJSB 4ZX3A 2ZUQC 4ZODA 5CEZE 2MCAA 4NCC1 2VMEA 2JJTA 4AUJA 2J4WH 3SDCB 4OCWL 5JHDE 5EOQL 2F54E 5IW3A 3GJFB 1DQJB 1UA6L 3JVGC 3JTBA 3VD3A 2X88A 4HZLA 5H8DA 1U8CB 4GI6A 1Q94B 5DJCA 4LU5H 3WIIL 4G9FB 3MRMA 3VXQA 3TA3A 1T1ZB 3F8UB 3JV0A 4RWYL 2ZWKA 3P11L 2ARJB 3H2WA 3U2JA 1XBDA 3W9DB 1C5CL 5D7IF 5FGBC 4C4KT 3SKJL 4R4BA 4BK5A 3O3BB 2FX7L 1ND0A 1EZVX 1NC2A 3TT3L 3SCMA 3I6KA 3T3ME 2MTPA 3CZNA 3GDCA 3QPKA 4GMTH 2R69A 2F8OA 4ZX5A 1KPVB 2PPEA 4WJ5B 1E65A 3DOHA 2E7BA 1B0RB 3QC6X 4PJ9A 2D31A 4QRQA 4F7PA 2XLLA 3WIAA 5AKTA 3OKMA 1KJMB 1WA0X 1N0LB 2NY3C 4AJ0A 2Z3FA 4M7LT 2HLEB 2HN7A 4M7LL 1A7PH 3MCYA 4ERSH 3FTGB 5EDSA 3G5ZA 4X7FC 4PWFA 2IQ9H 2YD1A 3QNFA 4XP6L 1UD5A 4G72B 2PPDA 5HDLA 1YYML 4ZAKC 4Z23A 4U1KA 3NIGE 3B2VH 4XWGL 1NZRA 3LRSA 3PJLA 1X5ZA 4QOKA 1LM8V 4G1MB 2WUBL 3F5WB 2Q5BA 4IBZA 5IFHH 5F1OB 5KZCD 2Z93A 3X13B 2Q8AH 1JDAA 2YRLA 3FO9A 3QUMH 4S1DC 2ZE0A 1GGIL 2VXVL 3VWJA 5E0QA 3NFPA 2HVJB 2VRQA 4FNRA 4LEEA 2PWEA 4OUUB 5AG9A 1NGQH 4PJ7B 1C16B 2VDLL 3KPSA 4LRIA 1OGAA 3FRUB 1PL3A 1INEL 2X6AA 3F58L 3QIWA 1EVUA 3QH3A 3INOA 3HLAA 2OSXA 1OB0A 3TH3T 4POYA 1TQVA 5KVDL 1QVOB 4KXDA 1WHPA 1S3KL 4UM8A 5GS3A 1SUJA 4Z3TA 2YWZA 4G8GA 3MBEA 5IHUH 1U8IA 4MDIB 1BFOB 3SGDI 2HPOA 4U1SB 3BHBA 2PCFA 3PQYA 4QLRA 5HGHA 4H8WL 4S0HA 1YY8B 2BXYA 4BRJA 3C60B 4CDGC 3EF4A 3BP5B 3UBXI 3L9EA 3QJZA 1UB6B 1J0ZA 1WIPA 2X9WA 4E68A 1S9XB 4LGPB 4MLIA 4PREB 3W81A 1NCGA 2VZUA 1GMIA 4HKZA 4PP2B 3V0HA 3MU3A 3PWUA 4ENED 1R9FA 1CF1A 3QULB 3B6SA 4JG1H 5DC4B 4W93A 3H56A 3NEXA 3T6WA 2IXQA 4K3EH 4Z7OF 1TFPA 2IPKB 2WQRA 3A24A 4YDMA 2X4NB 3RGHA 4PBVC 3GBLA 1YN7B 4M1GH 2BVTA 5D7EA 3IEAA 1WTLA 3VG0H 1H6FA 4PV1C 5HYFA 3PL6C 4RMSA 5KBMA 2V9UA 1EEYB 1T1YA 5I75B 2VOTA 2WLMA 3OWRA 5D2NC 4EQ3A 4NKIH 2V37A 2WIIB 4NQED 5HDRA 1HZHH 1BOYA 1Q1JL 3UTSE 1U3NA 3Q8FA 4BQ9A 3UTTE 2NY7L 3M86A 3RIAK 5EF1A 1PZ5B 3C75A 4MMZA 5DD1L 1JPFA 2F19L 4EMZA 4C47A 4ANXA 4QTIL 2VM4A 5IHBA 3E0GA 3AG4B 2XN9D 5F9DC 5GGSB 2ICWJ 1IVTA 3OXSA 2OXGB 1E8XA 2D7TL 2F5BH 1IO4C 3TYGL 3ZSTA 1NCDH 4KQ3L 3AMLA 2A73B 3WHE0 2DDQL 3ZZQA 2BNUB 4G7VH 1FPTL 4TPRH 4OD1L 3SYOA 3O6KH 3RL2A 5K39B 3NYKA 1VADB 5EN3A 3TO2B 4B96A 3CZUB 5DQ9A 3S5ZA 2PO6D 4UQDA 4C56B 3SPVB 3VFWB 1VB9A 4YSEA 4WO4A 3RI5K 2HVBA 3SBWC 3LPPA 3HMXH 1UA3A 1FRGL 2Z7ZA 3NJHA 2EEFA 4N2AA 4PRPD 5J0BA 5E8PA 5L8LB 1JZ8A 1NKGA 3MLVL 1FNFA 3PPEA 4KK8D 4FC3E 5CZRA 5D4IA 2NYZA 2YD7A 3S5LG 1C8QA 1HSAA 1S3RA 3DURA 3MO1B 1PX3A 1YMMD 4FXGA 3RVVD 1XIWC 4HWZB 4Z0XB 4YSTA 2OYKA 1KPRA 2I5YL 2B4CC 2C4FU 3O4LA 4N3TA 2FLMA 5AFAA 5F0PB 3C8KB 1WEJH 4LSVH 3CPLA 4KY1H 5TE7H 4KRLB 4DZ8A 4Z77A 3VD7A 1HS6A 2I7SA 5CCJA 3FCGA 4Z3IA 3DX7A 5KYYA 2B39A 4NXKA 1MH5A 4BQCA 1IVLA 1UWGH 1X5KA 2OCFD 2WN2A 1YNTB 1CI5A 3LNIA 3FQNB 1YC7A 1UUSA 5F6HI 2CU9A 2AJYH 1S7RA 2EUWA 3F12B 1EDHA 4NO5B 1L7IH 4WHYG 1V3MA 1LO5A 2H26B 2OR9L 3ULVH 1RERA 4FI8A 1WFOA 3OPZL 3TO4A 5KVGE 4DK3A 1UOWA 1FFOB 3JT0A 2GUOB 4CSPA 5C0DB 1KT2A 2GTQA 1OL0A 1I31A 4ZPVB 1D5ZA 1OAJA 2CKBL 4X6FA 3GGWB 3OGCB 4NKDB 2HUEA 3BLKA 5DGRA 1HKFA 1UURA 1V10A 3L1EA 3Q7JA 5DWPA 2AEPH 5JW5B 1XF3A 2A99A 2KZKA 4I1NB 3IJEB 3FH8A 1XVSA 4RMQA 4HLJA 5GGQH 2D0HA 2RD0A 2FATH 4FQJH 3TCXA 5IP4A 4JFUA 1SXCA 4K5OA 4OLVL 3TFKC 3VFSB 2R56H 3V5KA 2E6QA 2BHZA 5DSCB 2EC8A 5DVMA 2IANE 3WXVL 4O58L 4QHPA 3JYBA 3PUCA 3RWGA 3QEHA 4ICWA 1UYWH 5C8JB 3PP3H 4TUOA 5FYLD 1JZEA 4HK0B 2BIOA 2NY6B 5F21B 4ZFQA 3ARVA 3KJ4B 1ZGLM 4WK0B 1UGKA 2P45B 5ITBL 4XN7A 2X7LA 1DBKL 2EXYC 1KNOB 5I66B 1WZAA 3S48A 3QI9C 4HCFA 3TLRA 2IPTH 3MTRA 4FQ1L 1UJ3A 2HMIC 3KLAA 4KK9D 4UV7H 3HTLX 1YNLL 3T77A 2W0PA 3L3JA 5IVNA 1T7XA 4PJBF 2CO1A 3BP6A 3BWZA 4Y1TA 5ES4B 1BFTA 2VLMD 4DN4H 5INDA 2C3XA 4L5FL 3BVWA 4UOW0 2ZOUA 4PLOB 4Y16A 1S9WB 1KLUA 3RVWD 4NBYB 2HT2C 1O7VA 4HH8A 3QUYD 4V1DE 1J8HD 1G9HA 1S7SA 4ZOCA 3BO8B 2KLTA 2BJML 2JKRM 3N06B 5C0RH 2WCPA 5DRWA 4WY7L 4MDJA 4L3CA 4N5EC 5KUMA 4LQFH 1UQSB 1RI8A 4AMWA 2XNAB 2YA1A 4K23H 4LCYA 1HL9A 3JV4A 4G6KL 3BT2L 3HG4A 1T7WA 5KW9L 2X6BA 5DVOA 5I5IA 4KK6C 1SXAA 1JNHB 5D6DA 5AKSA 4AVJA 4PJXF 2QPEB 4QJ5B 25C8L 2VDQH 1UWYA 3H3PH 4AV0A 4GKNB 3VX0A 2ATKA 5HJBA 4RAUB 3FQRB 1U8PB 3ARED 1MG3C 1QSEA 4QPEA 4C58B 1KCSH 3RUGB 1IGFH 4JRXA 1P7QD 2XN0A 4HIJA 3BW9B 4KJPC 2GJ6D 3D85B 4J3OD 4AV5A 5DVLA 4A66A 1HXYB 1NDMA 4F93B 4PS4L 3MA7B 4NFBA 4WJG3 4L5FE 1T83C 4GAJH 4TXVB 3EGXB 2DWYA 4JDZA 3ULSB 1XH3B 3ETBF 4ZPTA 1UXLA 1XTMA 1N3NB 1KGJA 2F53E 4IM8A 4S1RL 2DLIA 4KDWA 2JKXA 5DYOA 4NQXA 5CLXA 5HHPB 4OI8A 4BH7B 3FN0L 4FFVC 3RGVA 1YPZF 3O0LA 1R47A 2NYYD 3KVDD 2PF6A 3QO0B 3W9EA 3KR3H 2XHNA 3P54A 4JPWH 5CBEA 3ROLB 4DKEH 1FO0B 2AEQH 2Q9OA 4Q8BA 4LQ1A 4KC3B 2ENQA 2VXTL 1ZJAA 3A23A 1AD9A 4Q6YA 2X87A 3MNZA 4EI5C 3HE7B 3TBVB 4C83A 1AE6L 1SEBA 3AB0C 5BO1H 1JL8A 5KYXA 3GJFH 3RZCA 3ZE0B 1W8OA 3CFKB 2M2DA 4O02L 2B1HH 3GIVA 4F8OA 2A6DA 15C8H 3NJXA 5K5YA 1HAUA 5J12C 2RMNA 1GVIA 3DO3A 4JZOA 3VFOB 3C5ZA 1NMAH 2WY3B 1SDDB 4XNMB 2HRHA 5D1QE 3WFHB 4Q6KA 4RQQB 3L4VA 1C08A 1FZMB 2GSMB 3B1UA 3NCJL 5CEZH 3VG9C 3PIQA 4OAWB 4QXTB 1LP9A 5SV4A 4AEIH 3G9AB 1UH3A 2ITDA 2DBJA 1T5KA 3UTQB 5F7MC 2ADJA 3IDUA 5HDQL 3N2JA 4M1CC 4DGYL 4HALA 4UMGA 5HI3C 4K9EH 5GSRB 3UJIH 4H5SB 4KDTC 5KSBA 1HE7A 2MOQA 2Y2TA 4YE0A 4RFEB 5F8QC 4KGLA 1R5VA 1XB6A 2PCXA 3ZOAA 3F7RA 4JM2D 3UGUA 3MN8A 5IK3A 1D9KD 1XT5A 4O2FA 2NY1D 3A67H 4X6EA 5H94B 4LVHC 3K72A 4OCSH 3L3DA 1LEIA 2VXSH 2A1WL 4MXVE 4HS3A 4TNEA 4WFGD 3MLPA 1BZQK 1FVDB 3F7LA 5D7IB 4DPBX 3EYOA 1QRNB 3X3FH 1SOSA 3CHSA 5D7SL 1BA9A 4N0CD 2KPWA 4YHPB 3NBNA 1CMOA 4LBEB 1HINL 1P1VA 5AAMC 1VGEH 4QGTA 2YIHA 1OP3H 4O02A 1BREA 1QP1A 1VHPA 4NP4L 3SKUD 1Q0YL 3CN4A 5CGYD 2VW4A 1CGVA 1FCGA 4I3SH 4K9JA 2AJSH 3TVMD 1GC1H 1MI5D 1FGNL 1N68A 4N6RA 3GPSA 1M05A 2FSDA 5DWUL 4CN1A 1S78C 2QZQA 3GDBA 1CLOL 3ZT5A 4HFUL 3VMPA 4A63A 1VKXA 3LPOA 2DL9A 2FT8A 2VR4A 2XVBA 4ZUVB 1P5UA 4QT5A 4HKBB 5KSVA 3L3HB 4BFRA 4OGYH 1NCCL 1SUHA 3D12B 3SBRA 3UBXG 3CG8A 7CGTA 2FBRA 3HZVA 3A22A 1HKLH 3ULUL 2AXFB 4MD4A 1ODUA 5E9DB 4M6AA 5TPWH 4R90H 2CAKA 2IV9A 1QFPA 1BXXA 1I53A 1XGTB 2AHIA 4NN5C 1FFNB 4XNBA 3QIUB 4XC1H 5DMGC 5FA3A 4H8PA 4NJAL 4IIQB 3OKEA 3SGJC 4ATTA 4HULB 3MRDB 3QFJD 4G5ZL 1EFXA 5DO2C 4OZIF 4L0PB 1ZS8A 3B9KB 3CZGA 4PYHA 5ALBL 5KSAA 2KKQA 3EOAA 5BXFA 5EEXA 1H0DA 1PY4A 3OSKA 3UGXA 1A66A 5HVHC 1EHKB 4JPKH 5ICZB 1TZGH 35C8H 2CO7B 2PTUA 2EXTA 1QYGL 1F8TL 3K6OA 1NBCA 3FAXA 3DO4A 1K72A 1NDGA 3QEUB 2ID5A 4HA1A 3ARBA 4AM0Q 4CVWA 1G9NC 1N2RA 3ULUE 1FZOA 1AZCA 3HE6D 3PJSA 4IGBD 1H3VA 4RH4A 1DEEA 3TNNB 4L1LA 2C3VA 1GGIH 4NFCA 3P0VH 4JUSA 2CDEA 3EO1A 1FL6B 2EC9U 4NIKB 3D4ZA 4ZSOE 3FQ1A 3B2XA 2IWEA 3QQDA 5C0BD 3TURA 1TJGL 3DYMA 4XOBA 2CM6A 5DC0A 2YLHA 4GXUN 2DKMA 1BIIA 3JT2A 4WW1B 3FQUA 2WZPD 5I17A 1EHLH 1B2WH 2XJLA 4Z7OB 2WLLA 5I5RA 2ICWA 3QEQA 3WTYA 1UFUA 4NI6A 1MW0A 3UBGA 3EFDL 4KJYB 5EZLB 5D7JC 3II3A 4C4BA 1KXVC 3WY2A 2APVA 1NL0L 1EXUA 3EJZD 2CRMA 3J2PA 1AR1B 1SMOA 4I0PA 5FW8A 5E4EC 4F8PA 4YFDB 5ERWB 2OP4L 1MPAL 4QXGH 1GAFH 1QFWL 1A7RL 3OHXA 3HZKB 4MNGB 3CVHL 2WLHA 3WXWH 4B3VA 4P3CL 5KN5B 3D39B 3R06A 2X4QB 4JQIL 1L3NA 5IG7B 4J2QA 2WTRA 4QJ3B 4XI5D 1F5WA 2Y2WA 3F65A 2C9UA 2XZZA 4TVSa 3HHSB 4XE5B 4G5AA 1T4KB 4HGKC 2OJZL 1OLZA 4FDWA 3KL3A 5GSVB 5IHHA 1CDBA 5D93C 4PJ8B 1HJCA 3MJWA 4OJFH 3I50H 2BSED 2V7NA 3MRGB 1YQVL 5CGBA 4L3ED 2ZG1A 1LK2B 3SQBA 1IAOB 4YXLH 3N04A 5EPMA 3VFTA 4BFJA 3SE4C 4QXUL 1R0AL 4XMVA 3N9GL 5B4MC 1ACZA 1HILA 2OS7A 2ZYRA 2HLAB 4ELKA 1CZ8L 1JHKH 1F18A 4Y4HA 3Q2WA 1YEGL 3MKKA 2HTKC 4HXBH 1TTRA 3UTOA 4EI0A 3MV9D 3SO3C 3TYGH 2H0JA 4ZUSB 3VGGA 1FYTB 5ALCL 3T0DA 4JB9L 2JKNA 2O5XH 2W07A 3NPZB 2VQ1A 3AY4C 3TM6A 1SEQH 2JKIS 2C34A 3CZFA 4JE4B 2ENSA 4G6AC 4OD2B 1BXUA 3S5LB 1RZ8A 4WHDA 5LDSA 3DV6A 3Q1SL 1MFDH 1T0NA 1NPNA 5DD3H 1MIEH 4KRNA 3O2DH 2I24N 2JB6B 4ZT1A 3I9GH 3DGGB 4LL4A 1ACYH 2ZUQB 3LKSB 5BZDA 4OUOA 1UT1A 4DP9X 3CFQA 2VITA 1FZJA 3RX9A 4BK4A 5KVGH 1CICC 3EHBD 4R2GC 1J5OL 4PS7A 1EEQA 1FAIL 3L7FA 4HZ1A 1JWUA 1ED3B 2OMZA 1I8LA 5C07D 4OFYD 3VXMB 2B20A 1ZGLB 2VDPL 5DHXB 2XG4B 2PW2A 2DQCH 3KJ6H 4K8RD 2DIJA 2F6AA 1NOLA 2VLKA 3APMA 4PGJA 4X8JA 1SMAA 4UT9L 2WD0A 3IFOA 4J27A 5D96B 2IIJA 1SJEB 3LQMA 1A4AA 2BC4B 1JZ5A 4FCHA 2IDTA 3H3KA 5L2JA 1L9NA 1KGYE 2X9XA 4NT6A 3MCLH 4GSDL 4F3FA 3LPWA 3IDXL 1IJNA 4F58L 3FUEA 3BESR 1U3HC 1JMXA 1F4YL 1G84A 4CU6A 5CZVL 2YSSA 3VB8A 4PWJA 2JTYA 2YMOA 1VFAB 2DLFL 1S8DB 2NY3B 4DEWA 1DZ0A 3BX7C 4AG4H 5EMYA 4A55A 4UDUA 4JJOA 4B9KC 1EAPA 2XWDA 1OE3A 2VLLA 1MW3A 1A0QL 1PFCA 1A6TA 5JR1H 2K6WA 4OZFA 2WWOA 1AGFB 4E9QA 5JQHC 1CGUA 2CKBH 3MLRH 4X7TB 2Q76A 1ZMYA 4MQ7B 3UXFA 2FHFA 1TZHB 3L5IA 4HUXB 5EBMA 5DLMH 3NA9L 3CCHA 1KV3A 2I26N 1CK0L 3KAAA 2E0PA 4KX8A 2K1MA 1NLBL 4CC4C 4Z78B 1R3LB 4BUGA 3OR6B 3APFA 4M8RA 4QRPD 4AEHL 5ID1B 5I8OH 3CFCL 3WY1A 4PJBB 2FSEA 5FUZH 1TTAA 4WCYH 4Y8DC 5GJSH 4HLZH 2Q8BH 2HKAA 3HZYA 2IJ0C 3PWJB 1JHTA 3I6LE 4U6TA 4WFHD 4IKJA 3RQ3A 1NBVH 3TPUA 1II4E 3EH2A 4DOHE 1P6AB 5EZJA 3WFBL 4Z3GA 1MRFL 1P6FA 5SWSD 5D9SB 4YX2H 5BS0A 2FQFA 3BZ4A 4PH8A 1XR8B 2PTVA 2O93L 4NS0A 2CJUH 1UZ6F 2DMCA 2RH0A 4AIXA 4FQ1H 2QGEA 4L2YA 2KMWA 1RH8A 1QNIA 3FK3A 1CIUA 3T09A 4IBSA 2IDQA 3PWPB 3UO1L 4PJXB 2EDNA 4JFQA 1F6AB 4WK4B 4E5XA 2X6UA 5E2WL 1EGJL 4YHKL 2I9TB 2XFGB 3M8OH 2YXMA 4H0IA 1U8MB 3U2SB 5CHNB 4ZMXA 4B5EA 2H8PB 3FSZA 2ZXCA 1YECH 3VXTA 1SN2A 2E46A 3D3VE 3X1GA 2ZKHL 1UXSB 1FDLH 2OXHB 4MJID 4LKXA 2WWMD 2JJSA 4N85A 1OAXL 4ABQA 5E99L 4O4YL 5I5JA 4AE1A 4WUUD 4LPYA 2BINA 5DRNB 1I7TA 3MLTB 4S1QH 4XNXH 2G5BB 4U1NB 3KH3A 4ALAL 3KYKL 3H2QA 4TLKA 3WO3B 4OSUL 1YPZB 4FMKA 5D6CA 3TYFA 3SE3A 2Y7QA 25C8H 5DA0B 1QLFA 2NMSA 2CKNA 3ZTJH 4PJGA 2UZYB 1LNUB 2DMBA 4OD3L 1YN6A 2WSDA 4OV5A 1T3FA 1SOXA 4MA7H 1W80A 3FB7A 4HJEA 3IJHB 1E5YA 2IALA 3SD2A 3STLA 1XSKA 4U3SB 4HJJH 2H0EA 5I8EA 2YD2A 4LLUB 5DJYA 5AW1B 3VXPB 2Z31C 2C9AA 4D3CL 3AY2A 1IAKA 1EGJA 3MGTB 1RZJL 3CUPB 3WGVB 4F24A 3EYSL 4TTDD 4ZDHB 2YPLE 2A74C 3IAPA 4QRSB 4AENB 4J2XA 5CILL 1XD1A 4JFYA 4N90E 4M93C 5E8EA 2EIKB 4DSYA 3VM5A 1U58B 4L8SA 4NM4H 4PJ5E 3CSBA 3T6XA 4I5BB 3IVKA 1F3DH 2V2WA 4N8PA 3IPEA 5JIQA 5CWSB 3GTVA 3S3CB 4FQIH 2AK1H 1A9EA 4Y2DD 4YHLL 1JK8B 1Z9LA 1AS7A 3O6FC 4PUBH 4ISVA 3U4EA 4JRWA 2QKSA 3OF6D 4ODWA 2IAMD 1TYEB 2I9LA 5IW1B 5TK2A 1IM3A 1E9QB 1D2PA 4XMXA 4P59H 3QEGL 4LVNC 4TSCL 1P84J 3RFRA 4YHOH 2VKWA 5F1NB 3VXOB 2AQ1A 1TVBB 3ZVVA 5SWZB 3QXDB 5C0JA 2YAPA 2VZVA 2DQTH 4LOUC 1IGJB 3RKPA 4FG6C 3EYVA 3ALPA 1RPKA 4MAYA 5DEZA 5DFAA 3E8UL 1NBZA 5FUCE 2XV3A 4NBZB 3Q8BA 5I16B 4RFOL 4UM9B 2V0AA 3VFMB 2VDOL 3GKZA 3ATFA 4X6BB 3LY6A 2WHVA 4MWFA 1E8ZA 4DN3L 3WAJA 2YEZB 3H4HA 3BXNA 1FHGA 4CADA 1J0YA 5ANHA 4LPXA 3QUHA 2F5AH 1OALA 3WSQL 5ABAA 4GUPB 5LBSL 5ID0B 3ILPA 1HEZB 1NGYB 4GW1B 3JWDL 1P7BA 4GAGL 4JZNB 3VNZA 1A9VA 3O81A 2WVUA 5EU3A 4HK3J 4PRDB 4BKSC 2DIAA 3R4DA 4Y5YB 2MCPH 5ENWA 4P57A 1A2YB 3QUMA 3QWOB 4K3JH 4MVBC 4FN0A 1SGKA 1I7ZB 1U8KB 5K9QI 2ITFA 4M8UA 3DOSB 4R0LB 2W0KA 4EOWH 1A6WL 4HUWA 1T22A 5EC1A 3LYRA 3MV8D 4K0OA 5EBWA 3REWA 3UBXB 1G7JA 1T2QL 2IVFC 4NYLB 4F2FA 4NUJA 1M6OA 1N8ZB 4YR6A 1T20A 4OZIB 4B95C 4XO5A 4L3AA 3S2CA 3HS8A 5I76B