3QFGA

Structure of a putative lipoprotein from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
145
Chain Sequence
b'NMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDLNPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYELRGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of a putative lipoprotein from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 32
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16729 DUF5067 Domain of unknown function (DUF5067)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qfgA00
3QFGA 1LMIA 4LESA 2LLGA 3CFUA
chains in the Genus database with same CATH superfamily
4JX0A 43C9B 2NT0A 1HN1A 4HIHB 2DKSA 1J1XH 1WAAE 2DQDL 5D6CB 4WI6A 5DS1A 4WU7A 4QRPB 1RHHB 4G6AC 4AITA 1QLEB 1WC7A 3T0WA 3QZBA 4DUXA 2NYZA 1DSFH 4PGEA 1TOXA 3HRZA 4X6BB 1E43A 12E8L 4B5ZA 4UZGA 3V6FA 3NTCH 5EO9B 1FN4B 3L5XH 3AG1B 4WEBH 3KLHC 2YA2A 4MQXC 2RH0A 2O6PA 3S88L 5C97A 3QH3B 3HMWL 3N40F 1TPXB 1EZVY 4OKVA 3MGOB 4U7SA 5H35B 3JUZA 1GGBH 1VFBA 1LO3H 2VABA 1IBFA 4TULL 1QSVA 3K2MC 5I6XB 3BAEH 1T0PB 2QJDA 5I2IB 2A3TA 3DECA 4FXGB 1U8CA 3LKOA 4GIPD 2DWTA 5KVGH 1AH1A 1JXGA 4XP9H 1KGIA 1VADB 2R69L 3GMNA 3P73A 4N26A 1L3NA 4HJ0C 4DGVL 1EBAA 4Y5XB 1T7ZA 2OMYA 1KXVC 1GGYA 5LCVL 2FSEB 4HJGB 2UYLB 4ZOEA 4NNXA 4N0YH 2OTUA 1TTRA 3QPKA 4M3KB 1UYWL 3JWDH 4J3WA 3QXVA 2KZWA 5D71H 1WFTA 5F1NA 1ORSA 4LKXA 5TJWK 1KCRH 3SQOH 3O0RL 1FORH 3DSFL 4N24A 3G5ZA 4BQ8A 1J18A 5CU5A 1WRFA 2DYRB 1K9TA 4ZXBB 2AJYH 4FD0A 5SWSE 3L1FA 5CZKA 1HH9B 3NJXA 4PGZA 2VO8A 5IGXL 2R51A 3EYSL 4GG8B 3DO3A 2NZIA 4Z3TA 2XRAH 2BJML 3QXUA 4KOBA 4TNVF 3TEWA 3SPIA 5GHWL 5FECA 1FFOB 4WHTB 3CWGA 5D1XD 4LLVA 5C0JB 3EGSA 4V33A 2XZAL 4QPEA 3VYPA 1GYUA 3U0TA 4L4VE 4P2QE 2ESVE 4EIBA 3EH2A 2IMNA 2NY3B 1T89A 4HEPA 3KYMB 3NFNA 4AVIA 1OV8A 1A9BA 2WWKO 4P0DA 1CXHA 1QSEA 3AC0A 2A83A 3LKPA 3LEVH 2V6HA 1M05A 1DANU 4GNKB 4TSBH 1SZNA 2X9YA 4FQ1H 1WA1X 4OQTA 4XO3A 1NL0H 5SWSB 1QEWA 3G5XA 3PWJA 3U46B 1FZMB 2AVGA 3F7YA 1JZIA 3MV8E 1JWSB 2YD9A 2ZG1A 4MNQA 2J57A 3GJFH 1DLFH 1MRDH 1OEZW 1MWOA 2H6PA 3CFMA 4F8NA 4ZG1A 1K8IA 1CTNA 3JV0A 4KJWC 1JWUA 3AVEA 5D7LD 4M7KL 4GEIA 4OCRH 3BCFA 2H0JA 3DO7B 1S7XB 1G6RH 3TT3L 2ESVB 3FO9A 2GB2A 4N0RA 5D6DC 5AYUH 1UJ3B 2WUBL 1F4AA 4FFYH 3MZGB 2ARWA 1FFPB 1HHIA 3R0MA 2PP9A 4KJYA 3GS7A 3IGFA 2LU4A 3VRLF 1QG3A 2A4EA 3SJVE 3DI2B 2ZNWA 3QHZH 5CEXA 3MLRH 4HV8A 5CINH 3VFUA 3R1GH 4IRZA 2A99A 3O9WD 1NQBA 1AY1H 1RP9A 4EEEA 3QAZB 4XAWH 1JZJA 5JOFA 2XG4B 5I75B 1XSJA 1YEDA 2R1WB 4UV4H 4TV3A 1W6LA 2B0SH 1XWVA 1ZTXH 2FIKB 1JVLA 4GRWF 1BYNA 4YK4B 2ILLA 5TPWL 3VXUE 1ZLWK 4JRWA 4RGND 3D3VD 4KK8C 2EUXA 3JWNE 1SMAA 3BH9A 4PD4J 5LB1A 3SKNB 1O5DT 5LXGH 4KROC 4AIEA 3VFSB 1E5YA 4I3RL 1MNNA 5GGUB 1F18A 1KXQE 2VMFA 4PJAF 4AZUA 3A6CL 4JDTH 2ZG2A 4WNQB 3U6XS 1ONQA 1I4FB 1S78D 4PY8I 1DZBA 2AKRA 1BMGA 4FFZA 2X89D 2A9BA 2X2UA 1JPGA 2Z3FA 3RGVC 2ZICA 1YRKA 1A3QA 3TOPA 3WS6A 2IPTH 3Q44A 2TRYA 1R3KB 5IM7A 3T08A 4PCKA 3UERA 4WFFD 2Y1VA 2P52A 1RP8A 2N1TE 4HUUB 3UAJC 2WBKA 5C0BD 4DW2L 1M6UA 4X7SH 4H1LG 5E2TL 1OM3H 5D70H 5GGSA 2MQGA 4H8WH 2HA1A 3DPBA 1SEBB 1C12B 4XB8A 2YSTA 2VLME 3RWIB 2VC2H 3TV3L 2FQGA 2XICA 3KM1A 5HPMA 3T0AA 3PGDA 3RB7A 1EVUA 1KOAA 5KVDE 4HJUA 2JB6B 3KPRD 4IDJH 2GY5A 4N0FA 2E86A 4ZBJA 3L3GA 2CDGA 2B1OA 2EDHA 2EXSA 3MRIB 1IILE 1J1PH 2MQ0A 4PJIA 1CYXA 4YFDB 3T0EC 4JFVA 5JHLH 1CIUA 1I3UA 1HHJB 3PIQB 4QRSA 3JV4B 2OAAA 2E0PA 4YBHA 4CGTA 1MHHB 1PKOA 5AVTB 5JNYA 3K6FA 3DETC 1NUGA 3CSTA 4TLUA 1AJ7H 3FB7A 2ORBL 3FC8A 1GC1L 25C8L 5JMRA 1ZE3C 2LLNA 1YJDC 5F1SA 5DK2B 1R4XA 1EIBA 3P9WB 2NY2D 2Y69B 4GAJL 4MJID 4N87A 5B3JE 1K3IA 4PMEA 1UQSB 1V8HA 3D34A 15C8H 2AZAA 4EN3B 2W92A 4L8CB 1E4KC 5JHDE 5J6GA 2UXVA 3VMOA 4Z7UE 2GJ6B 3MO1A 4UMGA 3N1GC 1TR7A 4HUKB 4AMWA 1JGLL 3RZCA 4IRSC 5ICXA 1SOKA 3AT9A 1ES0A 4QRQB 2BP8B 2N0MA 3GSQA 1WH0A 5FGCE 2E5EA 1IEAA 1P84J 1XO8A 1KJMA 4OZGA 4S1RH 4ZSOB 2K1MA 3WFCL 2I9LA 2R29A 4GG6B 3S36L 4ZJ9A 4HZ1A 5JLZB 1D5MB 5FOBA 1T66C 2XQBH 5L88H 2ADFH 4PJCA 4KFMA 5L4JA 2YKLL 2NRDA 4QEGA 2P26A 1HE8A 2OMTB 4BDVB 2FJHB 1U58A 3G5VA 3DBSA 5FA4B 3H0TA 3IM1A 2R27A 2WNKA 5FUOL 4U6XA 5D5MB 4NHCH 3T3ME 2OFQA 2QQLH 3FF8A 1BYPA 1OY3B 3F6LA 4Y5VA 3D3VA 2IGLA 3MLYH 3MUUA 4FFVC 3SZKC 3BKYH 1HOCA 1RI8A 1VRSA 1B4TA 4JQVC 5GZNA 1ACCA 2W59A 2DQFA 3V6OE 5KVEE 3TCLA 4E41A 5FGCB 2VITA 1UWYA 3QUYC 3LZPA 4Y9EA 1RIVH 2HMID 2QADC 5EUOE 1NLBL 1EV2E 1SNRA 1PKQA 1TENA 3ABMB 1TJGH 1NMCC 3L3IA 1J8HE 3L3OB 3H2QA 3QIBB 3KXFD 4M6MH 5HVHB 3MRHA 3K6NA 1AE6L 1KUMA 2EO7A 2BSEA 5T3XL 1MAML 4AMXA 3EF4A 3E3QE 2BC4B 3GIZL 4OT1L 2VL5B 1KC5L 3IJHA 5F7LB 3AREB 3PREA 2VXSL 5BQ7A 3V6ZA 4WFED 1JXDA 2ZPKL 3U6RA 1ET8A 1UD2A 2DH2A 2PYEE 2V3FA 3T3MB 1T04A 4KNSA 4G6KL 4DKFH 2ZF9A 2C3XA 2F54D 3D09A 5AD0B 2A38A 3EJPA 1F41A 1TVHB 4OCYL 4UU9B 4KO7A 3W37A 3NSXA 2J20A 3QORB 2XACC 5EUOB 3EO9H 4GKLA 5CBEB 2F0CA 4YSUA 4GRLC 1RMFH 4KDVA 4GXVH 3RUGF 5HYQA 5CILH 2D7QA 4U1JA 1EEZB 4AC4A 3VFRB 1ZVSA 3MLTB 4G9DA 4AH2A 5E8DL 2PW1B 3I2CL 1KMGA 4JN2A 2D03L 1RZKL 3C75A 1CE6A 1S5IH 1T5KA 4P3CL 4YSDA 3IRCA 3NUKA 4XPBL 5BS0A 3PYCA 4F7EB 1XGRB 2XNAB 1TQBB 1BLNA 4HWUA 2OCJA 2WCPA 5IHZB 3NP3A 4Z23A 5D9SA 3LCYA 2DBJA 4LVEA 3ZX1A 1EAPA 1ZSDB 3O2WL 1FQ9C 4KJQC 1KIRA 3CFCL 1E9QA 3IN0A 4MD5B 5ILTH 4MJIA 3EOBA 2CJUH 3MPCA 1MQKL 2XTJB 4ZW5A 1XGUB 3FT0A 3CPUA 3RWDB 4UTCA 2E8ZA 4KAQL 3MODH 4HBQA 2GIYA 2YD7A 3WJMB 4ORGA 1JZEA 4G6MH 4IJ3C 5DD6A 1SXZA 4D0BB 4W9FC 5DUML 4RQQA 4PW9A 4M62H 5EPMA 4I18C 4GBXB 5I1GL 4QKTA 5DA0B 2FWOB 4N8UA 2UZIH 4HGWB 5I28A 5BO0D 4ZMWA 3H85A 5T3XD 2FGZA 4G7VH 1DP0A 2FHFA 4FKHA 5GS3A 5IESL 2X1QA 4JE4B 1H3WM 1F3RB 1C5DA 3MNWB 2H0EA 3GSUA 4PJHA 2DIAA 5CUSL 2W91A 1D2PA 4QT5B 1AXSA 2YC1B 3K1KC 5IFAL 5L4MA 1MFAL 2X4NB 3WIFB 4YLCA 3GJFA 4CN1A 1HL8A 3EJZD 3B6SA 1QPKA 5BMFH 1FVCB 2F74A 1SVCP 2H7WA 4JBSA 4D0CB 1I53A 3LKSA 4GT0A 4YDMA 1G6RA 5C09A 3KPNB 1GXEA 3CHQA 5GRVL 3HFML 4XN2A 4MDIB 1RULH 2WWMC 2VW6A 3MV9B 2R4SH 1VA9A 4DO5A 3LXUX 2VR9A 2XV2A 4KQ0A 1RZFH 2HKFL 1OHZA 3PAZA 1RUPL 4XVJL 3ZSSA 2HJKA 3F83A 1QUNB 3G04A 3B4NA 4AXWA 2OA9A 1A9EA 3I6GA 2F1AA 5D1QE 1JCKA 4ZUVB 3KXFA 3RHWK 5F6IB 2C9PA 4DGYL 2FT8A 2ICWJ 2PR4L 4XZUB 4MA8H 5D2NE 4CBPA 4KUCF 3VRLE 3I6SA 3TBTA 1RLBA 2JTYA 2CR6A 2VDPH 3VB9A 1AGBB 1CR9H 2EYRB 2OPCA 1UM5L 1AYOA 1GJIA 4ANKA 1MH5A 1EHKB 3VGBA 1HCZA 4K4KA 3SN6N 2Y6SC 4LARL 3KCPA 1ZHNB 4LCUA 1J1OL 3GEFA 5ITFA 3AM8C 3BWAB 4QHLA 4FQHA 2HTLD 4GRWE 4BM7A 4WWKC 3GMQB 3X14B 2A6DA 1G7QB 4UQDA 4F80A 2OMXA 3CFJB 2YD8A 1Y18A 3J27A 3SPJA 4MJJA 2XYCA 1JF5A 4JDZB 3U30B 3TFKD 4F8QA 5C6PB 2ZD0A 4PJAE 4PEEA 4YPGB 3ELQA 3IJYB 1A7PH 5CLYA 4LIQE 4JHAL 4H8QA 4HFWB 1A6UH 2VRAA 4OGZA 5ISZD 4LLYB 3RRQA 2WHVA 1HSBB 1UA7A 2Y5EA 3SE8H 4M8UA 3DTXB 1UWGL 1T3FB 3UTPD 2FLMA 1G7MA 4FC3E 2PTTA 4YVUA 3UROR 1P5VA 4PJEF 3ESUF 3ZPDA 3US0A 4Q9BA 5GS1B 3FFDB 5D8JL 4FN0A 4JZNB 1TNMA 3HG1D 5T1LB 1UXLA 1JHKL 1G9NC 1YUHB 4DPAX 4TUJB 1T21A 5CKGA 2XU9A 1B6UA 4CVZB 2VKXA 1GYCA 2MSPA 5I5MA 3K5RA 5LN8A 3O6LH 3HRZC 1TTGA 5JHLA 3WNOA 2AEQH 2IQ9L 2NNAA 5IEKA 4PJAB 2FJGA 4WUUA 4PB9L 4AL8C 4P57A 3JWOH 4GP8B 5F1IB 3R19A 4YGVA 4UOQA 3RHWF 4DP5X 4KKCC 3GMLB 4G9FB 2APXA 3ARDD 3BMWA 4LSDA 4Y9FA 5AB9A 2TSAA 4QWWD 2GABA 2F53B 3CDYA 3DSNB 3VQLA 4K8RD 4EDWL 5I8OH 3AGWA 1VZGA 4DEPC 2AK4D 3I6KB 3FH5A 5JDSA 5EFIB 2B20A 5JIIA 2E9WA 4XOEA 2AXFB 4I0PC 4CVXA 4YDVB 4L4TE 1BM7A 1G7PB 2CUAA 3GQFA 3MOBH 4N2BA 2LTQB 5DTFB 5EIQA 4DP0X 3EG9A 3ZDYF 3V0JA 3VFPA 2KT6A 4R4FL 2BVQA 3Q43A 5CD5D 4KQ3L 3N6YA 2Y7QB 4QRPD 3FT3A 3D69A 5L9DL 2XN1A 2Q7YB 3NGBC 1A4AA 4AENA 5CR1A 3DV6B 4TSAL 3N42F 4LLQB 3S35L 4OR1A 5HDQH 4EE2A 1S9WA 4WDIB 5DJZA 1A6AB 1I82A 3FSZA 5C0NC 3L2NA 4JW3A 3GHEH 1DFXA 4FKEA 2ZOKB 2KHAA 2PYFA 5BV7C 1KBPA 3IXTB 4TNGA 4HJ1A 1JZ2A 3C9NA 4FG6D 3FMGH 2IQAB 2JXMB 1B9ZA 5EZJB 3VTAA 4XNXL 1P4UA 4MSWB 4OCSL 4JFYA 5I6NA 3MV11 1JWMA 2NY1B 1T89C 2DQCH 2M83A 1CF1A 2CA3A 3AW5A 3HCVB 4HHAB 3OWEA 4DWHA 4U1GB 8FABB 4CSZA 3NZ8A 4NWTL 5J6HA 4TL4A 3WKMH 4HIJA 2YS4A 4FGMA 2Y9RT 4DGWC 5F9JB 4LMQI 1ZJAA 2BS9A 4LLMB 2P5WA 3BP4B 5F21B 5C6TL 4UYPA 1QKZH 4C59B 1AO7A 2JK5A 3LZFL 4BWWA 1RZIB 3NH7L 2F9BT 1J7VR 4I3SH 4Z95L 1NWPA 2X88A 3KPOA 2V2TB 2AJXH 4X5RA 4AGPA 4GIOA 2YPLA 5DHVH 3Q8CA 3CVIH 4FZ8H 4FLRA 5EUKB 2CGRH 4ZXBD 1DBJL 5T5NF 1VEOA 4QTIL 4Y2NA 2ALWA 1WUNT 2DQTL 4X7FC 5TQ0L 2IFGA 2ATKB 1JXFA 4ZS7L 2YD6A 4M7ZB 3QZPA 1EDYA 1CJYA 2AQRA 1E90A 3MYJA 5FF6A 5KVDH 5L7XH 4N6RB 3UMNA 4JRLA 5DC0A 2ZWNA 3KYKL 1QW9A 4KKQA 4JUTA 1Z66A 2Z64C 1BIIB 4HSAC 4BZ2L 5EEVA 3VTMA 3P1VA 1MW1A 3TN0A 2NY3D 4EVNB 3OPZL 5DUPH 3S96B 3OG4B 5GGVY 4JFDA 3RWCB 3W9DA 1AYRA 1NMAH 3QXWA 1KIUB 1QBML 4FQIH 4FHKA 2H2SD 3ZHLA 5KAQF 5AOMA 1ASQA 2NXYB 1JZGA 4LQFH 3KPPB 3QULB 2NW3A 1MCOH 5SWSD 4HALA 5LQBL 5MEOB 3BLKA 4PJ8A 1A1MB 4JJHA 3ATFA 1TZGH 2GC4C 1DE4A 4MXVE 1V3LA 1EZVX 1I9JH 4DTGL 1AI1L 3D39A 3P9MA 1MIML 5HJ3A 3BRGC 5EU4A 3GUFA 5EH1A 2Z92A 4F8OA 5FW7A 1XL4A 1ZCRA 3MJWA 1QI5A 1OQXA 1Z9OA 3JSSA 4OZFA 1OF0A 5T33H 3EGXB 1I8AA 3F6JA 4GUQA 4M1GL 4L4VD 2JCCF 1CFTA 2ESVD 3EBGA 2F08A 3BZEB 1HQ4B 1SM3L 1DJGA 5D2LA 5B1JA 2R1YA 4X5XB 4PFEA 5TDNB 5CLZA 4AVKA 2E6PA 1AQKH 1VJSA 1I1CA 1ZXQA 4ZK8A 2ZOLA 3BVNA 3WS6C 1OAUL 4M61B 4JGMA 3CAFA 3M86A 3MA7B 2OJ1A 4XWGL 3WJLA 1AIFA 3W82A 3NDZE 2PR9A 5D6CA 3IVKB 2BIHA 1Q9WB 2CK0H 3RUGB 2LAAA 2QVMA 3ZKQD 3H9HA 1NBYB 3L3JB 1KEGH 4GH7B 1U95B 4B27A 1BIHA 4K9EL 4NI3A 1HINL 2H4EA 4JKNA 5BZXA 1K3ZA 2J3SA 4LOVA 3S34H 5ID1B 1FN4A 4XBEL 4C55A 3JYBA 1Q1JL 4N6QA 3UP6A 4YS4A 5CCJA 3QH3A 1N18A 5SX5K 2XVLA 4XMVA 4FQ2L 5ITBH 2Z35B 3O45B 5B1AB 1SLXA 3RWJB 1GOHA 2CHNA 2G0LA 3VCLA 4QJ4B 5HHNA 3T71A 3VMPA 2VLJA 5EEUA 1YEIL 4FXGA 3LNHA 3MV7B 5DR5H 3S36X 4XMWA 4HPHA 4PVBA 3GRWH 1UXSA 1X5FA 2FCBA 4XMKH 4RMQA 5CFHA 1NICA 4JJ5B 4YDKL 1IFRA 3EH1A 3CE1A 3KBEA 3W0WB 2XETA 1WAAA 1L9PA 3OC8A 4P4RA 4Y5XA 3V9CA 2UY6A 1E2WA 3EYUL 4AYBA 2AJ3B 2FSEA 1H9VA 2UYLA 1YN6A 4OM0L 4ZUWA 3GD1C 3MA9L 4NPKA 4QLRA 5GIRA 5BZDA 5E6ZA 5HHPA 3MACH 1U8MA 1EMTL 1JF6A 4R26L 1BMZA 2WXLA 2K6ZA 1BQKA 1BWWA 4UDTA 4M7LT 4FYQA 2WP3O 4TSCL 4OJFL 5E8OB 3LNDA 5IBLC 3S3CB 9PCYA 4I4WA 1YMHA 4OLWL 1KTLA 4PJFF 3O8XA 2E7DA 1HEZA 5ICYB 4MD4B 1OXYA 5JXAL 3RZCC 3WNKA 1WHOA 5LUMA 4HMDA 1X5MA 1KIPB 4DETA 2G75B 4HUMB 1FFOA 1XT5A 2DQJH 4KFZC 3K8LA 4XXDA 4UB0L 1J8RA 3QEUA 1RVFH 3QHFH 3W57A 3V9EA 3MLWH 2X3BA 4JANB 5E8NB 4H8UA 4HUXA 2N7SA 3C8KA 3RWEB 3MXVH 4XXWA 3O9WC 1IKOP 4BJLA 2VLMD 5E6IA 4GFTB 5DEFB 3UZQB 3VFMB 4YH6A 5SWSA 4A7TA 2N01B 4IYKA 3ZVVA 3A4FA 1WDAA 1YNKH 1MJ8L 3MBXL 1RSFA 3FQ4A 1DBKL 3JV6B 4JO2H 1JWSA 4Y5VC 3FTGB 4EN3D 2AJSH 2OR8A 3SGDH 2O5YH 5I1KL 1R3LB 2VWEC 5GZNC 1JI1A 2GJ6D 1KTCA 2JI2A 5KVEL 5DVOA 5LG6A 1Q0XH 3F05A 3K6IA 3LVTA 3KDMB 2HWZH 3MN8A 1DVSA 2KQNA 4KI5F 2R0WH 1IBYA 2DM2A 2WNWA 2A4ZA 3MNZB 1S78C 3QG6A 4L4VA 2ESVA 4P2QA 4TXVB 5BPPA 4LEXH 4FLSA 1UJ3A 1SJHA 3JTTA 4FQQB 3ZGIA 1TQTA 4RFEB 4WU5A 1V10A 5F2FA 5HYJB 4G71B 1KNOB 4YOKA 3IWUA 4PJEE 5DQ9A 1FHGA 2X87A 5I30L 5IP4A 3Q2NA 3HPLA 3HLAA 2R1XA 1Z3GL 1MCPH 3NIGB 5GRZA 2WM0A 3R7QA 3II1A 1BG9A 4JFXA 5I1IH 2B1HL 5I19L 3ZIYA 1JNNL 4R9HA 1F8TL 4L05A 1XF2B 3MV8A 3TYFB 1MCIA 3UO8B 3WIIL 1CCZA 1E27A 1O7DC 3G9VA 3K4AA 2J4WL 1XEDA 3B2XA 3NQIA 3ZOAA 5TE6H 3WNIA 1OALA 4BK8A 1FGNH 2AEWA 5KYYA 3DHPA 1BXXA 1CG9A 4WF7A 2GUOA 4YHZH 7FABL 2FEDC 1E42A 2XBDA 5ENWB 1Q1PA 1INEH 4HSCX 1E0OB 3GJEA 3VFSA 4P5KB 4XB7A 4FQLL 2R56H 4HA1A 1GJWA 3EYFB 2X0WA 4PJEB 3RYMA 4BZ2A 1GGTA 3B5GA 3SJVA 3FL7A 1CYGA 2YR3A 4H8PA 4LGSB 3QIBD 5IQLA 4YSCA 1AZCA 2ERJB 3IDGB 4F2ME 2OP4H 3I02A 1E5ZA 1EHNA 2EKJA 1WK0A 1J48A 2VT0A 4NKOA 1FVEB 5AOZA 4PBXA 3ARED 3LQAH 1RUAL 1NAKL 3ZDYE 3ARWA 4B95C 3VW3H 3GXNA 5I6PA 1BXAA 2Z1PA 2NY2C 5TGBB 3VXUA 1SDYA 2WTRA 2PWEA 1B2YA 5J11C 1NC4B 4JREB 3HC3L 2RMNA 1ZMYA 4UTBL 3FRPB 5HI4D 1KLFB 4ODHH 4HUVB 1BVOA 3FAWA 3QORD 1JNHA 4JO8A 1KXQA 3FO2A 1SF5A 2WUCH 3BUYB 4HDIB 3IFLL 3FUDA 4Z76A 1OAYH 3HRPA 4QXWA 4WHYG 3JV5A 1R3JB 3BWUF 2B59B 1GGCL 1EJ8A 2XWTB 4C56E 5LGYA 4F2MB 3BGMB 1KBBA 2HYMA 4GPVA 4OFPA 4B6ZA 4BA8A 5LN4A 4P2CG 1KPUA 1F1AA 1ZEAL 3ZDYB 3SB3A 3PIQA 5DJXB 4BRVA 1GGIH 1P6AB 4BKLB 4EBQH 2CDEA 1VACB 1URIA 1JMXA 4LIQH 3AQDA 3B2PA 4X4ME 4A68A 4EUPA 1MPAL 1J0IA 2VDMH 3K91A 4NN6C 4ZRGA 3SBQA 4HZAA 4J12A 2VDLB 3SCMB 3ARUA 5DK0B 2YJLA 1EHLL 4Q6KA 5AW1B 3X1GA 1XGYL 3U9PH 1YYLH 1FC1A 3GXDA 3MXWL 1Z1WA 4FTVB 1UQSA 4JG1L 1T0NA 1KSRA 5EB9A 3KG5A 2F5AH 3SO5A 1SLVA 5K9OA 1CB4A 2Z1KA 3VXRB 4KNQA 3B83A 4PLNC 1AS8A 4KHXH 5BJTA 2C3VA 4NUJB 2F61A 4M5TA 3BZFA 3WXWL 1U3HB 2D31A 4GBXD 5E4IA 2JQMA 2VDRH 4YDNA 3ULUH 4YAQA 1BQ5A 4QRQA 2XVKA 1A6TA 2A2QT 2YRPA 1B4JH 4TTDC 4AC2A 4XHJD 2VXUL 3PV6A 2BCKB 1A4KA 2NTSP 2X2YA 1GC1C 4XBPB 2OW6A 4CMMB 4Y88A 1BZ9A 4X4ZA 5JLZA 5MEQB 5D72H 1YEEH 2MH4A 3GBMH 4JZOB 3SGKA 4AQ1B 3NIDF 4P2RE 2R7EB 4CMHB 5LWYH 1T5XB 2HH0L 4XN4A 4HD9A 3ESPA 3RBGA 4UM9B 4TQIA 5BOZG 3TA3B 3WY1A 2FJHA 5JHDA 1SJEA 3C6EA 4PJ7F 4Z7UA 4BH8A 5FA4A 2BVEA 3NFSL 1Y1UA 5DZOA 5LGKA 2G2RA 5EIIB 1XF3A 5EC1A 1DN0A 4KVCH 1PMYA 4QAMB 5IUSA 2J8OA 4FP8L 2YLHA 3BDYL 4BQBA 1BCIA 4RMWA 3ZE1F 3FQ2A 3DX6A 3WG7B 3CFEB 5DLMH 3QJFB 3HA0A 1Q0YL 2AJZA 1FO0B 2NPLX 3QDJE 4E9RA 4NQEB 2JCCE 4J8QA 5DMKA 3BLPX 2XVGA 2HZHA 3ARYA 3GPEA 3TNMA 4A6YH 3D5OF 1GRWA 1KT2B 3QJTB 4E9YA 1UVQA 4FKKA 2XTSA 3G6DL 4G5AA 4PRNA 2YMXL 3L4TA 4MDRA 2VL5A 1V7ML 2C7FA 2TSBA 4JY5H 4O4YH 1QO3B 2ZUQB 1FFQA 5EBLA 2IG2H 2P46B 3JZYA 1NCBH 3V0WH 1A64A 5DS8B 1ETA1 1R3HA 3BXNB 4K9JA 5J57B 3U6XA 1RUQL 4PJXF 1OIOA 2MNWA 3V6OA 3I74A 2QMJA 2XWBB 2YQ2A 4X2UA 2A6KA 3GS4A 4O00A 4FFTA 3QORA 3OAYK 3S35X 1PL3A 2V33A 5IMKB 5K9KB 4MMZB 3UZEA 3H2WA 3QDJB 2H1XA 1L7TH 1OP5H 2JCCB 3WOVA 1PEWA 4MB3A 3B2UD 5D1QD 1J8HA 3P0VL 3QI9A 3M1BA 3MHZA 4R83A 3CMOL 5IMOA 3BT2H 1IAMA 2PW1A 1MEXL 1YLBB 3WN5B 4NN5C 4I0KA 4Y7MA 5CU9A 2W9DL 5FO8A 3OKNA 3O2DL 3WCYA 4RDBA 4JB9H 2PYEA 4LEBA 3PWUA 4R7NB 3RX8A 4L1SA 1L0XA 3HKFA 3N41F 2EDJA 4FRWA 3RU8L 3QWOA 3N40P 3EJZC 1D9KA 3IKCA 2FRGP 1NFDE 4HS3A 5T1LD 2ZCKL 4K3DH 2BOBA 4MD5A 3DGGA 2OI9B 3HG4A 1TZHA 1H6TA 1NANH 1PBYA 1HKLH 4P06A 3HB3D 3O3AB 3ZL4L 4XNMA 5B7MA 5IUCA 4AJ0A 1T4KB 5CXPA 1DQIA 3SKJH 4D0BA 1AD0B 2OX5B 2QSCL 4Z5RA 3CSYA 4Z7QB 5HHXL 4GQPH 1LL1A 2SEBA 4MZ3A 4E9XA 4NGHL 5DD5L 1RZKC 5C07E 4GBXA 2D7OA 2FR4A 1E40A 4LCCA 5CZRA 1E8WA 1FFNB 1LD9A 2LV4A 4HGWA 4QRTA 4OFKA 5F9WB 3ARGB 4G9FD 4IKJA 2IH3A 3E38A 3VXMB 5I5RA 3C5ZB 3QQ3B 4OVUA 1Q90A 2F53D 4OLXH 2WIIB 2J55A 3KE0A 3QRGL 1MELA 1X5HA 3CSGA 1MG3C 1YECL 4NP4L 1K5NB 1J05B 4QT5A 4OBRA 1UM4L 4HXBH 4AYID 2NY6B 2ZUTA 4N8CL 3V5HA 1P2CA 1U8NA 1PG7H 4HMEA 4UTBA 4Q2ZA 4UV7L 4V2BA 1FVCA 2BIPA 4C4UA 2VDOH 2H45A 3BVUA 4D0CA 4PTUA 5E08H 4PJFB 4JZJA 3IETA 3ATDA 2HTLC 1FNSL 5E8PB 3WEXB 5DUJA 3N43F 5B8CB 3CLFH 2B7DT 3DMMA 1Z6JT 2KL6A 4MBRA 3IDMB 3GRGA 4OZ4B 5I8KL 5C7XH 1LE5A 5CN2A 1DLHA 1ZV2A 2P3YA 4KKBD 4KI5E 1J0YA 1QUNA 3T1FB 5IQ7H 3FQRA 3KH4A 1LVEA 3T6QC 4ODUB 4XOAA 3TIDA 1MFEH 3QZWB 5TFSH 2DJ4A 4KWUA 4ZUVA 5CGMA 1IAKB 2WO3B 3ZTJG 1U8LA 3EDJA 1IC7L 4UI2A 4KTYA 1UD3A 1L3WA 3BUPA 2AV7A 2FECI 4W9DC 2XXCB 1J0ZA 5KUKA 2ZUYA 1GZQB 1AGBA 3KPSE 3N06B 4MXWH 2APWA 3Q6GH 3TN0C 1ZK5A 1A4CA 2DEXX 2NY1D 3K7UA 2F15A 4HW6A 4W9LC 3BSZL 2A0LD 35C8L 5AKRA 3QXAB 3K72A 2FBRA 3RI5K 4S1DD 3B7RL 5EU3A 3ZLQC 3GK8L 2PCPB 1Z9NA 2YUXA 1WWCA 2AI0H 5C0RH 4JUSA 1RQ5A 3QUXA 3LZRA 5D1QA 2WVSA 3CFJA 5AUMA 1WZMA 3U36A 1R47A 1F97A 4QHUA 5LVEA 1RH8A 2W5PA 5D2NA 1UA6H 4K3JL 3BOVA 3BUBA 1OGAB 1W6WA 4OF0A 5C9JB 3IJYA 3I50L 1OT1A 1RCYA 3MU3A 4XP6L 2O5XH 2Z9TA 5EZIL 4ZAKA 4BV1A 5MP6L 3FTXA 4ZX4A 2DIBA 4PGJA 3L7EA 1IL1B 5JW4M 3Q06A 3MRRA 5B1JC 4XZ4A 3WUWA 4D3CL 4HZLA 3SGJC 3QQXA 1XAUA 5LDSA 1WLHA 3TIEB 4H8HA 5BUGA 4MB1A 5C2BL 3UADA 4Z7WE 4K0OA 4GSDL 4ZX5A 4HCGA 4QHNB 1YUHA 5GS0L 4TOYL 3AABA 2ODIA 3WJLC 4ZUSA 3QG7L 1OKEA 3TJEL 3LB6D 1KTKE 3CFBB 1CGTA 4CVZA 2Y5TB 1R3IH 4GKNB 4JFFE 4TUOB 4X9BA 1PLAA 5CZXD 2NXYD 4RGOH 3MFFA 2XPGA 2NTFB 1F90L 1IGFH 3HHMA 3BDBA 3OB0H 1NGQL 1J9QA 5GRYA 8PAZA 5F1IA 3PGCB 4EZKA 1NKRA 5KVMC 4P48A 5LGHL 3GMLA 1TPXC 1W91A 3LZQA 4ZPTA 1JXKA 2ZWYA 3WEMA 3C8HA 5B39A 4M48L 5ESQA 3BAYA 4BFNA 4JVUA 2LVEA 5IJBC 1AC0A 4JN1H 3ZYIA 5KSVA 2X1XR 3K80A 5JW4N 4FXGC 4Q52A 3TEXA 4F91B 3ROLB 2YN3A 2F5BL 4NIYE 4DN4L 1KBGL 5EFIA 5IVXF 4JG5A 4NAMA 3VQ1C 1BD2E 3HZMA 2YZ1A 4KZCA 4Y5XC 4JFFB 3RI5F 1TJIL 2RTTA 5DD3H 3SHSA 4LNRB 4OD1L 4QTFA 4U3XA 3CMGA 5DJ6A 1WZ1H 3QEGH 2EXTA 3LPWA 4JJOA 5F7WC 5EOTA 4F9PA 4YGAB 2DZEA 3TV8A 1M1XA 1UCBL 4KH2A 2Q7YA 4JGNA 1KFAH 1P4BH 4Y1AB 4A7UA 1CE1H 2MNUA 3HG3A 4ZXBC 1MCBA 1RURL 3OAZH 4LLQA 3O8XC 4H13C 4X99B 3VXNB 4Z1PA 4WGWB 2GBTA 2HKAA 1AG6A 2CKNA 2V5MA 2BSTB 3LEYL 2Z91A 1S2EA 3WXVH 2XZZA 2IBZY 1QFPA 2GTQA 4KRLB 1ND0A 4BQCA 2A6JB 2D0HA 3S2AA 4UT9H 4L4TA 3VM7A 1SOXA 2EECA 3SDCA 3DK2A 2HLEB 1OT4A 5GS0D 5J9PB 2E27H 4WEMB 3NIDE 2HJLB 1C8QA 2NY3C 4IOIB 3W0WD 3RDTA 3STZB 3DX0A 4TPRL 3PRZA 3GDBA 2ENYA 3AAZB 3H6JA 4L1LA 3VD3A 3CHPA 3TEUA 1MXGA 4PJ7E 2H2SC 1LO5B 1JZ7A 3FRPG 3R4DA 5F9JA 3LN5B 3PDOA 4UMSA 3FONB 5E6IC 1XH0A 2XKNA 3Q7JA 2YAFA 1ADWA 1T1XB 1LO4H 2QGEA 4LVNB 4NJ9H 4JG0H 4W4NA 5EIVA 4C4BA 2K45A 4PGBA 3ZE1E 1E7VA 3AB0C 5AG9A 4YXKL 3U7WH 5L6YL 3P11H 2O72A 5EN2B 1WFJA 5EUKA 3S5YA 4IIQB 3A6BH 3LZOA 4XTRD 4YZWA 4ZFGL 4GQ9L 4MX7B 1PZ3A 2BVOA 1VDGA 1MWAL 1UJ3C 1QBBA 3ES6A 2W81C 3L4CA 3TH4T 4A66A 1CYWA 1IO4C 2TRHA 5IWLA 5F7NC 5KVFE 2CLVB 1BIIA 1A6ZB 2I60H 2VSCA 5FAAA 4CVWA 4EVNA 3GBNL 1M4KA 3GO1H 4KC3B 1WHPA 5AW8B 3RWCA 4HXAL 1J9CT 2Y7LA 1C7SA 3OZKA 5IVZA 5DVNA 4PJXE 1JHLL 3ZJAA 1KCUL 4Z3FA 4DT2A 4LBEB 2KUTA 1B0RB 4U7MA 1YC7A 2HP4A 2D2OA 2W9LA 1BAFH 3MVSA 3QULA 1I8LC 4ZW7A 3O4OB 1EGJL 5MEOA 2EYSA 3BKJL 5FPIA 1G7IB 4YK4C 3ZRSA 5I8EA 5KYNA 4NIKB 5D7KE 3FK3A 2I7SA 1NCCH 4NZUH 1KPRB 3WLBA 4ABQA 1T5WA 5TE7L 1I7UA 2WSKA 3II2A 3DVNB 1IAIL 4MBOA 4GSXA 2G3ZA 3O6FB 4H25B 4LCIL 4YR6B 5CIPH 3JTBA 4KUCD 1AGFA 3BE1H 2VLRE 4UT7L 3HJEA 5GXBB 2WLJA 3FU0A 4XP5H 4ALAL 1OPGL 3FSOA 4JDVB 4OLUH 1CF8L 1EJOH 3IFOA 5IFHL 4LVOB 4AQAB 1T4WA 3O2VL 1BZEA 2XZCH 1CK0L 2IDCA 4Y4FB 2PF6A 4P9ML 1NBVL 3FU6A 3MLUH 5DXWA 3NAAL 4GW5B 2V5TA 3VE0B 2VGLM 4M61A 4KPHH 1DBBH 2GITB 1CWVA 2XDHA 2MTPA 5T5NG 2CBOA 1LILA 2W65B 5DI8A 5E9DB 5EIIG 4ZS6D 3K6SB 1FZKA 2CJ3A 3HMXL 2DD8H 4MNHA 5DWUL 1FG2A 3HPJB 4JKPL 1SFHA 1PYWA 1Q9WA 3JWNC 3MOAH 2R0LH 1TZAA 5I1AB 1CBVL 3NBNA 5D7JB 1UM6L 1XCXA 4S10A 1R5WA 3EHBB 2ATPB 1JPSH 4WRLA 1X5AA 3ZYZA 1DBAH 3AUVA 1EJFA 2E4TA 4D0DB 5B4MD 2I27N 3GKWL 2DWDB 2DL9A 3CX2A 1P5UA 3DJTA 4JRXB 1HH6B 3F58H 1IE4A 3N41B 1IGIL 2JVUA 4R0LB 3OHMB 4Y7OC 3ROOA 5C9KA 5KAQG 3DUUA 4AGQA 4A2EA 1NGXB 3BAWA 1I3GL 1JPFA 5I66B 2IADA 4JJ5A 4G6JH 2VR8A 4XPAL 1S8DB 1Y6MR 4FQXB 2EJ1A 2XXGA 2J43A 1N8OE 3BW9A 3VYOA 3CD4A 4K9EC 1CLOL 1EEQA 4UWQB 2B1AH 1NIDA 4N8PA 3VNZA 3PF2A 1QWNA 3MLZH 4CN4A 3T5WA 2VZUA 1NC4D 1MFCL 3B7YA 5CGTA 4ELKB 4ZO7A 2ZAIA 4PR5B 2NY4D 4PRIE 1ZD6A 2BSSB 5INCA 3QC6X 4RSVA 1SRDA 2N4IA 2X6CA 3GHPA 4PU2A 1OAJA 4U1KA 4KK5D 2ZSWA 2BS8A 5PCYA 1LP9B 3RP1A 4N9OB 4J3BA 2HRGA 3MLPA 2VR7A 3P0YH 1ERNA 2D3VA 2WB7A 5L2KE 4G3YH 3WEOA 4EXKA 5PAZA 3R0NA 2OMUB 2AAAA 2X4TB 3O3EB 2Q6WA 4GS7B 2AXGB 5E51A 1FO0L 5I1EL 5TTRA 4X6EA 4GIAA 1SHXA 4GKZB 3SGKC 5IQNA 3D0VB 3D6GA 5G55A 2XZQL 2I5YL 4JMXA 7TAAA 5BZWA 4BSVA 1DEDA 2WBJA 3JTSA 3L1OH 1JZFA 3MCKB 4JO1H 4A39A 2XT1B 4WTZA 3QCTH 3UZQA 3SCMD 1RIHL 2OMVB 5FV1L 4O9HL 3C6LA 3PWPB 5HHQB 4O2EA 3QEQE 2D9QB 4UILH 3TYGL 3X13A 4EMZA 5KTEL 4L4JA 1GHFL 2QSQA 3D4CA 4FTVD 1NOAA 1I9RL 2YUVA 1MVUB 3HFFA 2RCSH 1FSKB 1MCKA 3WFBH 3ZZ1A 5ABDE 3W39B 3VXRD 3IJEA 4Z78A 5D1ZB 4HJJH 3SPHA 2BM3A 1JIBA 3DHUA 3KAAA 4XNDA 6FABL 1U3HD 3HI5H 1L5GB 3ZQWA 4MWFB 1A7RH 2VQUA 1IBBA 4HOWA 2OCCB 4RMSA 3MCLL 3E8UH 4OZIF 3L3OC 3S37L 2VDQH 3O3DA 3QIBC 1E2VA 2MTAA 2HT2C 3FT1A 3NPSC 2H8PA 3HZYB 1FVDA 1RL1A 5CNHA 1ZOXA 4JQXA 4M3HA 4K3EL 4ODWB 1NLDL 4N0UB 2ADYA 1AGEB 1EERB 4K8RH 3AREC 1JPTL 4K2UH 4N85A 3WV0A 4OLYH 2JJSA 2AMGA 3ZQ9A 4AQZA 2XCMC 2QHRL 3ECBB 2RJMA 3APDA 4E9SA 1DUYB 2X9XA 3EYVA 2BNQE 1B4LA 2VN5A 3OJVC 4UM9D 3TA3D 2DLTA 2HFTA 3V6OC 5HI4C 1KCKA 3P2TA 1E8ZA 1OTTC 3QORC 4CW1A 2IEPA 2CO6B 4DKDC 5IBTH 4XMUA 4AIOA 3QZWG 1QLEH 1CTMA 1WZKA 1CDHA 2X7LB 1BVLB 1MWAA 1WIOA 3QI9C 4HWNA 4OM1L 4RGMC 4YN3A 4ZD3L 2XG5B 3C09B 4X6FB 2PTVA 5EA0L 4HKBB 2MOGA 3F84A 4PJEA 4U1LB 2WZ5A 2XQYA 4NQED 2MPAH 3L3DB 3OM3B 5IVXE 3UTOA 2IVFC 4J1UA 3LYRA 4LAQL 4RIRB 3TWCH 1UOLA 3P2BA 3TASA 4RNRA 4ZMVA 3RL2A 1FVEA 2DQMA 5I74C 1D9KC 1FL6B 4F1ZA 4ZFZA 3VXSE 3TS8A 1OSEA 3X2QB 1ETZA 1MJ7L 3TLRA 2VRKA 3LXAA 4KXDA 4D2NA 1P7BA 2GJZB 2GFBB 1LM8V 3UPRA 2GVYA 2D7TH 4IBLT 1D5XA 5I6LA 3L9RA 4I7ZC 2UWEE 1HHGB 5K59F 3L1GA 4QYOB 4FYSA 2BWQA 3BESR 1YY8B 2AQ3A 3MBEB 3QDJD 3MJGX 4GBXC 2WLZA 1R3JA 1RU9H 1UB5A 4LCCC 1A1OB 4F7CA 1BWMA 1FIGL 3ABZA 4F2MA 1J10A 1KZYA 4X0KB 5IB5B 3U4EB 3VI3E 1CFNB 4XHJC 3D25B 4RZCB 5KG9B 5BQDA 2C26A 3ESVF 3X3FH 1Z32X 4AK1A 2EDDA 4U3SB 2HJFB 4L0YA 3FT4A 3QWRD 3VXSB 2ZXWB 4BKLA 3PWNA 1N6QL 1VACA 2X3AA 4QRUB 3KWTA 4KTGA 3Q13A 4W4OA 3UYRH 1A65A 2D4DA 2X1OA 3OQ3B 4JCLA 4G8IB 5IMMA 4LSSL 5LLIC 3MJ7B 3O6MH 3NZSA 4K71B 3SCMA 5JORA 2EE0A 4FI6A 4KXBA 4CDGC 3CN2A 3U9UB 3FKUS 5F71A 5CD3B 4MA3B 1OM9A 1NEZB 1T2JA 4L3EB 4Y2DB 2SODB 4QHKJ 2XA8H 4IRJA 4YWGL 3TGXA 4JFEA 2KLRA 5TDPA 4OF8A 3DMMC 5JR1H 4FL4B 3RWGB 3ARSA 4C56A 4HUWA 4GYBA 1ZT1A 3U2JA 4XNQB 4Z7OE 3HZKA 3P0GB 4I8DA 2WPGA 4BWUA 2PWGA 4HFUL 4DKEH 4HU8A 5D7EA 3KL0A 3VRIB 3L9BA 3ARGD 1D7FA 2E76C 1XSOA 3M8OL 4JPSA 3WY2A 4PV9A 4MQTB 5E9AA 4X4MA 2N0KA 2FH8A 2X4QA 3C5ZD 4F3FB 2BCKA 4NQSA 4YUEL 1U2YA 5KSBF 5HVFB 1XF4B 3ML9A 5F0JB 2W60B 4NQVA 1E30A 4B9FA 2OZ4L 3GSNB 2G60H 4FJYA 1ZA3B 4AQ1A 2CG9X 1OCRB 1YPZA 2BNUA 2J1KA 1R34A 4X6DB 5D4HA 4M4PA 2NY6D 1E3ZA 1LK3L 4TYUA 1FLRH 3LRHA 4F2FA 4UM9A 3TA3A 4IHBA 5H37G 1S7WB 5C70A 5DHYB 2NSQA 2UVEA 3CFQA 2HVBA 5HHOE 4JPWL 2J21A 4JVWA 4XMPL 4OH2A 4EJ1C 4Z7IA 5DD1L 2QQNL 1MCJA 2ICES 3IDYB 2F68X 2A9NH 3DV4A 3V4VL 3QUXC 4U1HB 3ILEA 5D1QC 3B2UC 2VMJA 1DBJH 2WLNA 4N0CD 1AVAA 3KLKA 2DB8A 5E2WH 3AT0A 5AL8A 3LQAC 3P4OB 5DD0L 5D2NC 3ALWA 3FQWB 4AEEA 4PTTB 2WO4A 2YUZA 2NNRA 4M8QB 3QIWA 4H5SB 2AANA 1XIWA 4FHJA 1FGVH 4J3OF 2A77H 1AR1B 4FQCL 3QYMA 4P2RA 1ETJA 1AFVH 3EDKA 2FD6L 4FFWD 3IXAB 1KGUA 3LD8C 3P9LB 4TLTA 3SE3A 1DTUA 5KN5A 3IMBA 4JO5A 2OULB 4XNUL 5KBLA 1NCWH 1WP6A 3QFJB 2AQ2A 3CFDA 5E2VH 4O02B 5GS1C 4EOWL 3VH8A 4I9WD 3UJIH 3RAJL 1J9RA 4XODA 3RPBA 1BPLB 5DS8A 4WK2B 4HPYH 2Z34A 4X98B 1J5OL 2BSDA 2X0UA 4K5LA 3RE0A 2AERT 1A6VH 1HCYA 3HB3C 1L9QA 4LP5A 2ITCA 2Y22A 4YHMH 1FAIH 2NY5L 1NOLA 3HNSL 3FUHA 5DMYA 3FQXB 3UJTH 3TBWB 1Q4NX 1ML0A 2GAZB 4MMZA 4KI5D 2Y07L 4QRAA 1IBGH 1NDTA 1QFWH 3QDJA 4ICXA 3VRJB 2JCCA 3CPLB 2CAKA 3SD5A 3QHTC 4M5YL 3T6ZA 1UADC 3PHQB 2AFNA 3PHOA 2YEZB 1ZLUH 1E3FA 1OCWL 3WS3B 5JW3L 5LJYH 1NGPH 1E5AA 3QVAA 3WL9B 1IBHA 1KENL 1OGAD 4JE0A 1KEMH 3MRJB 3TH2T 4NUMA 1WVZA 3X3GH 4I48A 5CEZE 5CJQH 5E0FA 1GMEA 4LESA 4MLIA 1OE2A 4KKZA 3S9DB 3B7SA 4LHQB 2A9MH 2K3TA 3HUJA 1OAZH 4JK0D 3W1ZA 5EOQH 1KTRL 2ZXBA 3HAEB 1KGCE 5F1KC 4XGZA 4OJYA 5GSRB 4OIAA 4CSPA 1YNTF 5CGYD 2M26A 3B9VA 1XF1A 4LSTL 1NAML 1TTAA 3OZ9H 3UOAB 3DROA 2K4WA 3B9DA 4KZEH 4TN9A 1QWUA 3VWJA 1AKJA 2F8XC 3ALXA 2ALAA 4WY7H 4CJ0A 3SY0A 4R6UA 4R90L 2B4CH 1S7VA 2EUVA 1TJXA 2EP6A 4KKBC 4W9GC 3BT0A 4FI7A 5C0CB 1FPTL 2WAHA 2CM5A 3ARGA 4ODSL 4OD3L 1M7DA 4PREA 3ZUNC 3QDME 4PV8B 1MCWW 5BO1L 1IGJB 2ZONA 3QQ3A 2EEXA 2A73B 2ZXCA 4WV1A 5KS9F 1EPFA 4NQCA 1MHPL 3MNVB 1HHHA 3F6IA 3ME0A 3MRKB 5GRWA 1HXYB 4QOKE 1ZPLA 3SDCC 1NFDA 1W0VA 3BD5A 5EF1A 4G82A 1IEBA 5ABZA 1QD0A 1G7HB 2NY1C 2ZX8A 3RDTC 1Q94B 1WFIA 1RK0B 1DBML 2HVKA 3HHSB 4JFFD 5F96L 2A0LC 1MF2H 4P3DB 4U1GC 2FSDA 3P77B 4PAZA 1ACXA 3NSJA 1ZHKB 3TF4A 3F01A 1BM3L 2K78A 3SY6A 1U8PB 3IYLW 2X09A 1QTYT 3B9AA 5C07A 3O3BB 5B8CA 4G8EB 7PAZA 1CGSL 4NJAH 4OZ4A 5L4FA 1RUML 4Y1AD 1WGOA 2DTML 4X6CF 2K9FB 3T04D 4Q9RL 4HPOL 4PM1A 1HZHH 1WTGT 2BP0A 4ODUA 4LLDA 4XO9A 4L18A 4M7ZC 4AT6B 4WSGA 4OZIE 1U3JA 5DZAA 4EIGB 1CQYA 3HC2A 3V10A 1A47A 4OB5L 2IH9A 3Q48A 5HI3D 5GISL 2ENPA 1G1OA 3FUMA 2RFXB 3LKRA 3X1NA 3TA4D 4DK3A 1FZJB 2CO7B 5E03A 1UGNA 1UZ8A 1IMHC 2CMRH 2JKWA 3MROB 4R96B 1TO4A 5KVFL 2DN7A 2MHAB 3FFCB 1DJXA 3IDJB 1Y7VA 4UNTA 1HSAA 1L0QA 3OKDB 3KNBB 2F7OA 3OAWA 5FM5M 3F7LA 4ESKA 1FNEB 3LB6C 4F8LA 1RKRA 2R83A 4JO3L 4LASL 4NRZA 2EC9T 2NXYC 4K7PY 4ATTA 2XLLA 1IGYA 4NZTH 3ZKMC 3BZ4B 4JPVH 3V7AE 2PCPA 2RD0A 2GBAA 2JI3A 3V5KA 4XP1L 3MLVL 3QJRB 1OVZA 5LNGA 2R2HB 4DVBA 3WTSA 4OZIB 1DUZA 2CIIB 3MRQA 4WAFA 1P1ZB 1MHCA 4JO4L 3EFOB 1A6WH 2BWIA 5I1HL 2G30A 5F7FA 2OZ4A 4XC1L 1QBLH 1S9YB 4EI6A 1QEXA 2HSIA 3GMRA 3KPSA 3M07A 2C9RA 3DJRA 3HJ0A 4Y9CA 4JFUA 5E1AA 3VD2A 1U0QA 4J28A 5AG8A 2BFVL 1KYFA 2C1OB 4LNVA 3RGVB 2EICA 2LQRA 2Y5QA 3WELA 5TK2A 1D3CA 4R4BB 1TUPA 4HWZA 5EOCL 5HYSA 4R7DA 1D6EB 1KYOK 3NA9H 3OLGA 1UZ6F 1ZT7B 3CFBA 3LQZB 3V4VA 4R7LA 4TUOA 1KTDA 4BK5A 3U83A 5F3HB 1RZ8A 4AGMA 4O5LL 1U42A 3GUTB 3BFQG 5K59E 4TUKL 5CCGE 1WICA 5KOVC 3BGAA 2WQUA 3PGCA 1K8DA 3DX9A 3AU1A 2KH2B 1N3NB 5KANG 3GRBA 1P5UC 3O6FD 4PGCA 3NVQA 4AQEA 2EDQA 2PUQT 1L0YA 3FO1B 3CZGA 4N5ED 3K2UH 4MQ7B 5JYMA 2FX7H 5JZ7D 1YQVH 2YD1A 3OX8B 4Z7WA 4AEIL 5GS0C 4PVMA 5TQ2H 1TZIA 3PABB 1N2RB 3H7BB 3LKQB 3QQDA 4IOSD 3MRBB 1ZHLB 3DVGB 1I9IH 4Y4FD 1DCLA 4D8PA 4E68A 1VPOL 4JFFA 5KYXA 2HX9A 1RZJH 1TSRA 2F58H 1XCQB 3EOTH 5F9OH 2FQFA 3R06B 1SYVA 5E9DD 1WBZB 1QW8A 3LRMA 4HWEH 5E99H 1JDAA 5JW4Q 2HFGH 4KJPD 1N10A 1NFAA 1ZLEA 4AYSA 5H37A 3DARA 3GSVA 5FFOA 1OANA 4S0HA 3L48A 1WWBX 1CLYH 1N0LA 4UM8B 3HHRB 3U0PA 3J7HA 1D5BA 1FLTX 3L54A 5E6YA 5FYJH 1A22B 3EO1A 4K7PH 1F02I 4FNLL 1V55B 4PRBB 4HOZA 4ZFFB 1GS7A 2GCYB 1IE5A 2DV6A 5AOKA 6TAAA 5DFTA 1UA3A 3OKOB 2YRZA 4XTRC 2YA0A 2MMXA 4G8GE 4JRXD 3N50A 1BOGB 1BD2A 4DAGH 1YEHH 2MCPH 2W0FA 1RPUA 1IVTA 5KSBE 4ZZFA 1X4YA 5DJ8B 1Q9LB 5E1GA 2ATAA 2OJZL 1RZGA 1SPDA 2VSKB 4XPHH 3K81A 3W5MA 5IJVA 3P4NB 2HJLA 1QSFE 1Q0EA 1NAMA 1ZTMA 3GSOB 3B9EA 3NIFF 3OV6A 5GSVA 4WJ5B 3DX8A 1U6AL 1A5FH 4PIRF 4FQXD 1N5YH 2WBJC 1CFSB 5EZOL 1EANA 4HBCL 5GGTH 3FZUD 3EJQA 4A2HA 4UQ2B 1D5ZB 3VMNA 1KWKA 3FONA 2HT4D 2Q3ZA 2DBLL 3C6LC 2WLHA 5SWZE 4WI9A 4WW1A 3S98A 1T1XA 1VZIA 1TYRA 1XHHA 4Z8FL 4PWGA 3BI9X 4N4YB 4XOCA 1OAKH 3TBYB 1WTLA 1AAJA 1MRCL 3QZOA 1MJJB 4M9PA 2P24B 5H94A 5JIHA 4WI4A 1A14H 1SLWA 5CLTA 1BGXL 3ZHKA 2NUPA 1Z0NA 3STBA 1SMOA 2KPWA 4PUBL 1Z9LA 2Y1AA 3KJ6L 4RESB 4MX7A 32C2A 4G8FB 3KLQA 2VYRE 3UFIA 4NM4L 3AXIA 3ZUCA 1QR4A 5F7HA 1MIEH 4JQXC 3DYOA 4PJ7A 4HS6B 2FX9L 5C7ZA 3DRQB 3PPSA 4GRMB 4P9HH 3VX0A 2JJSC 1JGIA 3NJIA 1UFGA 3WIHL 4RDQF 1NEZG 3M17A 2V7HB 3KDPB 1C08B 5DRWA 4AKOA 2FJSA 4W9ZA 1B9KA 4H4NA 4LBEA 4AI7A 2HG5B 3BD3A 5I73B 1ZGLB 5ANHA 4EF3A 4W68A 3EZJB 3PWPD 4ZMLA 5DFVD 3T2PA 3HE7B 4B41A 5HDBF 5FO9B 4W9HC 4MRCA 4GRLB 3KVPA 5DO8A 5FHBH 5B4MC 1N5AA 3TESA 3VD4A 3DVNA 4YR6A 1YEKH 3EJJX 1UH2A 2FVNA 4KMTL 5CLWA 1COBA 5D1ZD 2GEQA 2NX5B 2WMPB 3GSXB 4X83A 2Z7WA 4HHWA 4X9FA 4B3EA 2YAMA 4KY1H 4XCNB 4NM8L 4TRPL 4UZSA 1NSNH 1PSKH 4AQAA 1G9ML 2O61A 3P4LA 4HIEA 1BZDA 4IOSA 1DJSA 1JN6A 2OMZB 4MZ2A 4PJXA 4M43H 5LO7A 3VE0A 1YEWA 3BKMH 1MUJA 1A3RH 1IFHL 3L6FA 3QEQD 5H4YA 1X3DA 2VLLB 4UQBA 4IKLA 4KUZL 4OFQA 4DZBA 4Y1SA 1PZDA 2YFOA 2NR6A 5G4MA 5DUBA 3HNVL 1OAQL 1U91A 4ETQA 1O9ZA 2NY4C 4XNBA 4FXLA 2VLRA 2X4OA 4MAYB 4ALAC 3F04A 1JV5B 4KK5C 3UTZB 4I18B 4J3SA 1E5UI 2DWDA 3L5HA 4DOHE 1HVXA 3OJDB 5I6KA 2OMWB 5KS9E 1I1FA 5F88A 3V52L 4BUHA 4F20A 1KGXA 1E6JL 3GEWB 2CH8A 1CBJA 3VD7A 3E6FB 5ADPL 4TVPE 2Y0SA 4FOMA 4GMSH 3ZU8A 1RJLA 2BXZA 1YNTB 2KYIA 5AKVA 3VFWB 4LVHC 3KW7A 4LOFA 1F45A 2OK0L 5HGBB 3VGDA 4W4OC 4IU2A 2VXVL 4KMLB 4ZTPH 1TIUA 4OZGF 1FNGA 4FG0A 5B7EA 3GI8L 2V2WB 4BE6A 3WHXA 3GSNL 3SCMC 3ETBF 5E23A 3BAJA 4X4KA 4BUQA 4W70A 1FL5B 2ARJA 1ACYH 5TF1H 1N6UA 3J07A 4MDJB 4WI5A 4HETA 4QI3A 1DQDH 2AW2A 1CFMA 2J88L 3I9GL 4X6CE 2ZKHL 1JE6A 1XH3B 3QA3A 4JPKL 1EH9A 3JT2A 1M2VA 3MBED 1FC2D 4ICWA 1LO2L 4RETB 5ALCH 4M1DH 4P3WA 4JEGB 1FWXA 1EO8L 4RAUB 5JA9A 2G9HB 1QR1A 5HHMB 1F2QA 2W0PA 5FKPB 3OLIA 1D5RA 1BVNP 4Y5YA 2ID5A 2OMUA 3VXPA 3KPQB 1EEYA 2AXGA 1HWWA 4KZDH 3HAEG 4NP4H 3EJTA 4YDLB 4YO0A 3LQMA 3VXSD 5TH2B 3T3PF 4AQ1C 5JPNA 2FX8L 4CMHC 2BRQA 4NQDE 4Q8BA 1KXTB 4DN3L 4LPXA 2JB5H 4AWJC 1YMME 3CDZB 3EZ8A 3TA3C 4MA7L 5IV2B 4MB4A 4PH8A 4PRIA 4O02L 3WTVA 3X11B 4L3ED 4Y2DD 1VFAA 4Z0XB 4XAKE 5G5DA 1GKOA 2ZSVA 4MJ6B 1X7QA 5FDYA 5DRNA 3UG4A 2N1KA 4Z3JA 5L2KA 2ZWZA 3GJFK 1AGDA 4KQ4L 4QXUH 2L7JA 4D9LL 3LY6A 3VJ6A 4RISH 2VL4A 3OVUB 3FQYA 2DICA 1UB6A 1AC6A 1CFBA 1JRHH 4J3VA 4PS4L 4YDIL 2DLHA 3QIWC 3MRDA 2FDBP 2QSVA 1XIWC 2C9XA 1I85A 2IMMA 5I17B 3QUMB 4OZHB 3BRFA 2XN9E 2VAAB 4AYFA 1W80A 4NQDB 4XVTH 2IXQA 4C57C 5I15H 4PRPB 3SE3C 2YOCA 4JFZL 3PQYE 1IC5L 4XE0A 1OK0A 1SXNA 5JIDA 5IKCB 1N0XH 2PCXA 3ET9F 3MDJA 3QEQA 5J3HC 4U3HA 1A3ZA 1UZ6E 4LU5H 1OD9A 5ALBH 3U9WA 2R4RH 4HAFA 4DP6X 3LXCA 4U0QB 1A4JA 3UX9B 4CDHA 2A1WH 1UC6A 4QKXB 4WU7B 2C5DC 1WC7B 2VDKH 3BP6B 3BFOA 4LSVL 3UC0H 3IE9A 4PGEB 3QJOA 2CO6A 4C83A 3MRLA 5EC2A 2AVFA 4MMZC 4GOSA 4NZJA 1BZQK 3AUWB 2O5ZH 4XRCA 1XCTA 2A9AA 4UOW1 1WEJL 2Q8AH 1AKPA 1WYJA 2VABB 1IAIM 4FNTA 2NCMA 4K94H 4U1LA 3UEZA 3KWWA 3CXDH 3WN5C 2LHAA 3QDAA 1AR1D 3WIHA 3AG2B 1OAXH 1U8CB 2EINB 2Z31B 3MAWA 1DQTA 5JDJA 1SY6L 2VSDA 5CEZL 3GMNB 1JPST 3P73B 4JM4L 3ZMRA 2BNQA 2RHEA 2Z8WC 5IOKA 2H32H 2XWCA 3U7YH 5JA8B 3QFJD 1JD7A 2OKMA 4J27A 5AAPA 2OMYB 4FNPA 4HF5L 1Z5YD 1F4WH 4XX1E 1KCVL 3OMNB 4M5ZL 4IDLA 5KJ7E 4PJHF 2OTUB 3ZMNA 3ZTJH 4GSUA 2DLGA 4JFQA 2OI9C 4POYA 2GFBA 2LOEA 4OAWA 5F7MC 4QCIA 5F1NB 3QNXB 2DMHA 4Y19E 4XI5D 4PWFA 4QXGH 4LKXB 1S9VA 5IHUH 3G5ZB 2WXOA 2GSGB 3VWJC 1TU2A 2YK1L 1R9FA 5A2IH 3M46A 4XCYB 3DO4A 3CFIC 1CDCA 4MA1B 5IW1A 4MQXD 4OBSA 1QHPA 4TMPA 3QQ4A 2DQGH 1A1OA 5IVXA 1TLKA 3ARGC 5F9WC 3MUHL 1M56B 1J12A 4LSRH 1OWWA 4L2LA 1DL7L 1CFNA 1I8UA 4WI8A 3SPVA 5FECB 3CJJA 3KS0J 2ZXGA 4E9QA 2A7BA 4LLVB 1JGVL 3NIFE 3L95A 5JOEA 3FB6B 1ZWIB 5CJOH 1MJUL 1XGQA 2OMNA 3U0TB 1MREH 2WN2A 3WJJA 2HPTA 4HIXL 5FUCE 1JTPA 1NFIA 3TBSB 1A9BB 1E4HA 3KPMA 4YHOL 1I3RA 1QSEB 2HPOA 2A83B 3LKPB 3CXFA 2QZ5A 1M05B 3RWFA 2UWEA 5CD3A 2K6WA 1WS8A 1S5HA 2J8HA 4Y2DA 4XP4L 1MCQA 3G5XB 3PWJB 3F7YB 5B8CC 1JF1A 3FB8A 2YD3A 3IGLA 1KGYE 4MNQB 3VG0H 2Q76A 3LKNA 4XNQA 4N0CC 3VI3A 1INDH 3FT2A 2H6PB 1XBDA 2F8OA 4WWNA 1K8IB 1JWUB 1YYMH 2AEIT 5C0CD 4X7CC 2YBRA 4U49A 3H3BC 1JNLL 1BFSA 1L6XA 2ZX6A 5CEZD 3FHAA 2DWSA 3FO9B 2YBGA 4PB0L 1E28A 3HZVA 1TCRA 3BP5A 2BDNH 1XF4A 2EEAA 1HHIB 4KJYB 4W6YB 3ZZSA 3ZSTA 3RILA 3AG4B 5CEXB 2VQ4A 1NGYB 4HV8B 3VFUB 5I5IA 1X5IA 2IANE 1JUFA 3IDXL 2UXGA 3AY2A 2BINA 4BFKA 4KO5A 2I85A 3L3KA 1HIMH 1T83A 4WEUD 4OD2A 4D8OA 5JOFB 5HDBE 2IFFL 1CT8B 5MEPA 4LSUH 1YEDB 4OTXH 2JJUA 3QUGA 3EJUA 4KI5C 1MFDL 2QQKH 1A8JH 4MNGE 2LT9A 3BH9B 1XGPA 1I1YA 3ASOB 5HHVL 4GO9A 2XIDA 3NSFA 4AK2A 1A7QL 3LN4A 1U8IA 4DQAA 2RB8A 4H5SA 1IM9B 2E9BA 3IFNH 1KTJA 1G43A 1YEGL 3LSOA 4BZ1L 4HWBL 1NUFA 2B3RA 2ZJSL 2AKRB 4YE4L 2J12B 2NZ9C 2W9EL 2WKGA 1JPGB 3PXJA 2EC8A 5DC2A 4O02A 5ETUA 3THMH 1ORQA 5HHOA 4FG2A 3FFCD 2GBVA 1CN4A 5FFGA 1Q9KA 4HCRH 3GMPA 1F86A 3HG0A 4JHVA 4JNXA 4BK5C 2ZOUA 4MNGB 5GGSB 3U0WL 3KPLB 1LEIA 4BFRA 2A6IB 1JJUA 3KZ8A 3DPBB 2CCLA 5ACMA 1CI5A 4XB3A 3TO4D 5GS2H 2WYTA 1JZ6A 3VFNB 4B7IA 1MCSA 2EDXA 3P3SA 3FO0L 4UQAA 3CIAA 4N0FB 4NZDA 4XPFL 3ZHDA 4G83A 3L3GB 4HLZG 4KTEH 1E6OH 4M6AA 5BW7A 2CDGB 5D7SH 4TF4A 4AUJA 4PJIB 3UBGA 5I71B 1JI2A 4N3UA 4NFBA 3VDAA 1W16A 4P59H 4PMFA 5J4MA 4BGLA 1OGTA 3RGVD 5JNYB 3KR3L 2VXTL 3HC0A 3FB7B 1A0QH 2NY5C 2BIQA 4OGXH 1F58L 1N7MH 4NPYA 5A2BA 4AZ8A 2EUWA 1ULVA 1PX8A 3BISA 3ECQA 4IBZA 2NNCA 2LFEA 1BQLL 2UVFA 3MCG1 1WBYA 4G70B 4J3OG 1Y6NR 2WXFA 4U2ZA 4HX1A 3BWUC 3S0PA 3H42H 1M9SA 4QR7A 1I1AD 2EVIA 1KGWA 2BVTA 2VDLH 1EDHA 3CVHH 4N1CA 1CU4L 1ESOA 4KXZH 4MAUH 5I0YA 4KK6D 2IOMA 3F7KA 5J6GB 1FG9C 1EFQA 4PLKC 3T77A 1EXHA 1SEQH 1EWHA 3TH3T 4GAYA 1UATA 3HN8A 4OFIA 4KNTA 5T1DH 3S3DB 3W2DH 3LHPL 3RZCB 3O4LE 5ICXB 5K9QG 4PQXA 4UYQA 4AW7A 1IGJA 4PRDA 2A73A 3GSQB 2DQEL 5HI3C 2GT9A 1IEAB 4POZD 1G5AA 3FTZA 4OZGB 2I9LB 2CA4A 3T3PE 3G5WA 2VMEA 5FOBB 1QACA 1TCMA 1Q94A 1D6VL 1RK0A 3DETD 4DCQB 4WCYL 4PJCB 2QKIA 3P77A 4NUGH 2N7BA 5EWIH 1ZHKA 3VAEA 5GJSL 2DJSA 4BEIA 3CHRA 3CFKA 3BP7B 1S3KH 2Q2EB 3G5VB 1SQ2N 3ZIMA 1D5IL 4F92B 3H0TB 4LVNC 1NC2D 4G8EA 4IQHA 1UACH 4PI2A 4FTDA 4Y5VB 2FJFB 3D3VB 1UUNA 2NY7L 4ABUA 3QDMA 2H0PA 4K7FA 5E2UL 2DQFB 1Y0LA 1BAGA 3TCLB 4HCFA 4E41B 1BEYH 2EIZA 2XWEA 3V4UH 4QOKA 5DZPA 5KVGE 4WNJA 1EUTA 1PKQB 5MHSE 1I7TA 2WXPA 3MGTA 2H26A 4U7KA 2I7OA 1ZK9A 4AM0A 1NBQA 1IKFH 3OAUH 2RFXA 2Q8BL 3MRHB 1USQA 1OLZA 1FZJA 4LSPH 4XNZC 2ICEA 3S8GB 1FO0H 1B90A 4QNPF 3ULVH 3MROA 2HKHL 1NZRA 1NEUA 3IJHB 5ADOL 1T6BX 2MHAA 4TVPH 2I5YH 3IDJA 3V6ZB 3WHE0 5BQ7B 3DK0A 1GAFL 1T66D 1BZ8A 5F7UA 3KMDA 3KNBA 3U6RB 1HHKA 1NCDL 2CR3A 2J6EL 3GB7A 3RIKA 3T2NL 1T04B 2PP8A 5DJ0A 1CQKA 2BRRH 4L1TA 3QRFM 1KBVA 1ZANL 3T8VA 1I7ZB 3HBGA 2FATH 2Y7MA 3O4OC 3TO4A 1QLFB 5FK9B 1YEJL 5E0QA 1QQDB 2M2DA 3TURA 3H56A 4KZ0A 4DPCX 3ECVA 5JW5A 4OZIA 1IC4L 4TNEA 1HI6A 1UENA 3HW7A 1XXFC 4G43A 5EU6E 1WAPA 1TYEB 2H32A 1X5XA 5HYQB 3RKDD 1P0SE 5CMAA 4DVRL 1H6UA 4HIPA 4U1JB 1HNGA 3LPPA 1TEYA 1ZV9A 4UQEA 2AJVL 4N5EC 4YQXL 1ZVSB 5ESVA 3PG2A 2YPVH 1WF5A 4G9DB 4AH2B 1BVZA 2OR9H 2XBZA 1DFBL 5DJ2A 3NK4A 4JN2B 1AANA 4LLUA 3QPXH 1CE6B 2EE3A 5IMLB 1M7UA 4B9PA 4FYTA 5FCUH 4J3UA 3RA7L 5BS0B 1ZT4A 3ISRA 5D7IF 1EZUA 3MRGA 4F2EA 4JR9L 3C60A 1KJ3L 1S9XA 3E7JA 1BLNB 1MW2A 4UINH 1QTSA 5AB0A 3NN8A 5D9SB 2HN7A 5EEZA 1ZT7A 1EAPB 4W6WB 4XPGH 4KNUA 1KIRB 5CP3A 4KJPC 5EU6B 3EOBB 1I1AA 2NR6C 1WQVT 3PY9A 3NCYS 5FHAH 2CR0A 4RFOL 5IB3A 3LMJL 2GYSA 4PJGF 1YEFL 3HE7D 2CKBH 4J6RL 1F3JB 5DD6B 4BYHA 4NS0A 4J3OD 4RQQB 5TD4A 4GRLD 3IBEA 2BPBA 5EPMB 3B1TA 4HWBA 4KTDH 2FLRT 3VVVA 2OM5A 2AXWA 1KG0B 3CGTA 3FH8A 4QHMA 3WFEH 3RPKA 3P54A 3QZLA 2ED6A 4U31A 4KO9A 1S4IA 4EDXA 3VX1A 1ZS8B 2P1YA 4HIQA 4P23A 1C5DB 3A24A 3UJJL 4BGDA 5E94A 2FB4L 1CFVH 5EBGA 5EU5B 3GSUB 4PJHB 2WJ5A 1T2XA 1N2RA 2VZ1A 2ZWLT 3CSBA 4L8DA 4O2CA 2Z0UA 4XPTH 5AOLA 2EE6A 2DQIL 3TZVB 4DGIL 1SVZA 3GJFB 1NBZA 3MRCA 3DWTA 4PG2A 4G5ZL 5EU7E 5F1OB 2IPKB 3B6SB 2F74B 5DO2D 1ZTXE 2EXWD 2HT4C 1WBZA 3LKSB 4KJQD 1OOAA 4GI6A 1G6RB 1H3PH 4HUCA 5EORH 2Z7YA 3C2AH 5C09B 4M6NL 1NC2A 1WG3A 2J8UE 1G5GA 3VO0A 2ZYIA 4GAGL 3D08A 4XMLL 4PJ9A 1U9KA 4O2FA 3CSFA 2FQDA 5FFLA 2VUOA 4ORZC 1UWEL 4MAYD 1LJMA 4PRBA 4CC4A 4ZFFA 1K4CA 2IH8A 2JMRA 4WTXA 3OKOA 1F4YH 3OB8A 4TLKA 2HJKB 3G7TA 3G04B 1MFBH 5BNXD 4AXWB 1A9EB 3I6GB 3LS4H 3IEAA 1BOGA 1UD8A 2XBTA 5IB1A 1RJCA 1C5BH 3KXFB 5D4QA 4OFYD 1ZLVH 4Y5YC 3VSVA 2WLIA 1GZPA 1PY9A 4R7XA 1H5BB 3BFWA 2MCMA 3TBTB 1FP5A 3GSOA 2WIMA 4KHTL 4Q9QH 3QUML 4UTAL 1ID5I 5B21A 4JY6A 4YLQT 1ZPUA 2Y23A 2X70A 1G9EA 5M94B 1MH5B 3C08L 3UC2A 3N44F 1D7CA 2VO5A 4UQ2A 5KSAD 1D5ZA 3L13A 4MZRA 4XN8A 3KCPB 4LCUB 3B1UA 5BCAA 1LDPH 5ITFB 3N0AA 1SBSH 5DFVC 2YJQA 4FQHB 3LZNA 4BFFA 3NYKA 4JG9A 2WWMD 3C6SB 3OSVA 5ID0A 1UXWA 2A6DB 4G8GA 1XMWA 2OXGA 3BVVA 2OMXB 5IG7A 4EZMA 2AJUH 1Y18B 4AQ8A 5I1JH 5KSBA 5D1ZC 4DFHA 4TQEL 4U1SA 3IMUA 3B3BA 3CFTA 5F7EH 3RTQA 2L7EA 5I18H 3E0GA 4HCRA 2UV3A 5F0MB 1QSFA 3E2HB 4G8FA 4RRPA 1FRGL 2XA3A 3NACL 3ZTNL 3ZDXF 1OCZB 1CZ8L 4HEPG 4OIIL 2AQ1A 5IJCC 4QXTA 1NCJA 3H3PL 5K9JL 2E59A 2BW5A 3GLZA 5IVOA 2VC2B 4FABL 5C71A 1G7MB 3GNMH 2PTTB 1ZGLP 1KJ2H 1MY7A 1BEXA 4M1CC 4Y2OA 4JHWL 5CM1A 3BH4A 5SWZA 1OSPL 2ZTBA 3O6KL 3WY4A 3W5NA 4JRFA 3RKPA 1TJHL 3ECWA 3U1SH 1T21B 3E9UA 2Y6SD 2EEFA 5E4OA 3SD2A 2NNFA 1HZKA 4WW2A 5J56B 1EXGA 2Y36H 1XV8A 4OF5A 1RK1A 4UCFA 1FH5H 1QHOA 3TBVA 5C0FA 3VDBA 2NNAB 3U4BL 2FJGB 4WUUB 3VFTA 3DUSA 2V9RA 3NQKA 4NNPH 4OGYH 5CP7B 4NDMB 5DS2A 1Z2KA 4NT6B 1RUKH 5CEYB 4PRHE 4DQOL 3PWLA 2O30A 3WE1A 4XN7A 4O58H 2DDQH 1AZVA 3ESNA 5I26A 1FCCA 3F65A 3MLXL 4LSQL 4NN5B 4OCWL 2J2ZA 4P2OD 1IGTA 4U6VH 4Y0GA 3QUZA 1MRFL 3B2VL 4NFCA 2J6EA 4NQDD 4Z3IA 5JDSB 4PRPD 1JV2B 5A2JH 3CVHA 2BSRA 4XMXA 1YMMD 3DURA 3T65A 4CVXB 4KMQA 5F8QC 3EYOA 4AG4L 3WD5H 4K5MA 4ODVH 2I69A 1GL4B 1YNLL 5AZEH 3EG9B 2WBXA 4IM8A 1X9RA 2NXZD 2X05A 3VFPB 4QYAA 5FO7B 4XCCH 4KGJA 3FT3B 1NUNB 1F4XL 2CO2A 4LRNL 5JW4R 4L5FH 2F19H 5CSZA 3EKCA 5K39A 4MAYA 1BZ7B 2VLKE 1QOKA 4XO4A 3MBEC 4F7TA 2CDFA 5KSUA 4JRYE 3LNIA 1S9WB 4XBGA 1G0YR 1KELL 1P4IH 1G9MC 5IQMA 3FAXA 1XB3A 1WZAA 1PVHA 4KKCD 1DEEA 2AK1L 4G6FB 1DHKA 2HB0A 2PYFB 4JPIA 3E6FA 1HYSD 1BBDL 1KCLA 4K73A 3UTQB 1XGZA 4HUNB 4TL5A 1HYRC 2Z31D 3VFWA 3RY6A 1ROCA 4ZUTB 1M42A 2FYVA 5AVSB 5B1KA 3WJJC 1JWMB 4M7JH 1MI5E 5CN3A 3KPTA 5CCKL 2CPUA 1VB9A 3T8MA 4AKQA 5JOPE 4NBYB 3NZ8B 2ZX9A 2V2WA 4OCXL 5KSAA 1C5CH 5J6HB 1SXBA 5JQ6H 1NCOA 1U93A 3EGDB 4ABVA 2BHZA 2P5WB 3FCGA 4NFDA 2DLFH 3DTUB 1FL5A 1N4XL 2BSBA 2JKNA 4Y2DC 4LQ1A 1AO7B 1SXAA 1X9QA 2JK5B 2X41A 3D33A 4MDJA 2EKSB 3MJ9H 4FL4C 2X1WL 4LGPB 3PL6A 5IR1B 5KS9A 2YPLB 1SN5A 2BOLA 3I3EA 3D4ZA 1G87A 5DLLA 3ZTDC 4RAUA 5GGQH 5HJBA 4WO4A 2GPZA 3ARTA 3MYJB 5FF6B 1HKFA 3EXLA 2DWEB 3ZGHA 3D39E 1FNAA 1L0PA 4OW6A 3PE9A 3KM2A 1WD8A 5GQBA 4Q89A 4NXSA 5AW7B 3JBG7 3GI9H 1YDPA 3SE9L 2GEEA 3TN0B 3BUDA 4J3TA 4YZFF 5MI0C 1EXUA 1KXTA 4JFDB 4MCYA 4Y19D 2HRLA 4KKNA 1QSED 2WXGA 1P7KA 2DQUL 4LDOB 4NWUL 4X6CA 4KO6A 2ZCLH 5BRZE 3BPCA 4GT7A 3N85L 4ZO8A 3MC0A 5CZVL 4H20H 3GXPA 1G4MA 2IGTA 1SLUA 4FLQA 1I1RA 3IDYC 2R23B 4PJ8B 2PCFA 4MJ6A 1XSKA 2DMBA 1DE4B 4MNQD 4DESA 5FYLH 2DI8A 4EQ2A 5HYFA 4Q58C 4WKXA 4URTB 3D39B 3WGVB 2AEPH 4DUVA 5HJ3B 1KDJA 4OUUA 3U25A 1KCSH 3PP4H 4M7LL 2Z92B 4GW1A 4JCWA 4OZFB 2G9KA 4DZ8B 3RB5A 1DN2A 2DI9A 3QUMA 4P2OA 2CSPA 4E2OA 1IIKA 2B08A 1CFTB 1N12A 2VAAA 1AOZA 3KLSA 2HVJA 2JELL 4NQDA 5FGBC 3LPOA 3WE6A 2R2EA 1B0IA 1A7OL 4MS8C 5D7IE 3MUJA 4ACTA 2R1YB 1FFTB 2GK0A 5AVRB 1RFDL 1YMMA 1RZ7L 5ANME 1U4EA 1NCAL 2ZOLB 1MCWM 3BVNB 4KGLA 3A67L 4AEHH 3VGAB 3PFQA 3WO4B 4OLZL 4XVSL 2GTZA 2BNRE 2QDVA 1OCOB 3NZHH 1AIFB 1PNDA 2EH8L 2VZOA 4F58L 4ZMOA 3FYIB 1KN4H 1UOVA 1R19A 4LLWA 4XI5C 3H9HB 5IROD 3BP6A 4PJGE 2VJ8A 2GSMB 2ZP0T 3IGAA 3NG5A 4Z3GA 1A3LH 1CDIA 4GI9A 2IAMA 2X6AA 4Q14A 2NUTA 4ZTEA 3NCCB 4DK5A 3QDGE 1PZCA 2OYKA 5JYLA 4S1SH 2XN9A 2VM4A 4G7YH 3IMTA 1DDTA 4YHLL 4HJEA 2IBGA 5BW7C 1F00I 4QDGA 4I77H 3PQYA 3VCLB 1IM9D 5EZLA 5HHNB 3A22A 2VLJB 3ZKND 2H1PL 2Z31A 4NZRL 4L8SA 3RJOA 5I1CL 1UXSB 1AP2A 3BIAX 2EDWA 1JZ4A 2G2NA 4P4RB 1ASPA 1JK9B 2UY6B 3CX5K 4LOUC 4IS6A 1C8PA 4W1TA 1LEKA 4IK6A 4ONFL 4LEOB 3C2SA 3A6OA 4ZPVA 2R29L 4BBWA 1YN6B 1AXIB 1DVYA 1BAWA 1PD1A 4S0TD 4ZUWB 4TNFA 3GHBH 4X80L 5GIRB 4FZEL 1Q72H 5BZDB 5HHPB 2EE2A 1U8MB 4G7SB 2ENJA 3HNTL 4N86A 4CU8A 3QNXA 5BVPL 3ARXA 2HRPH 3QDGB 1CO1A 4UDTB 1F13A 3WMPA 1TTCA 2JKJA 2GSGA 3ZDWA 4ACPA 4YFLF 2HLFD 4PGDA 3SDXF 4I4WB 1YMHB 2FBJL 4XCYA 1KTLB 5I23A 3O8XB 2VDPB 1HEZB 1KB9K 2APVA 2F8IA 4Y8AA 3NCJH 1RPQA 2OYPA 2AQQA 2QELA 2V17H 3G6AA 4DIXA 2QBWA 4YL4A 1T20A 1BFVH 1YUKB 3WNJA 4AVHA 3BVWA 4NKIL 3FH7A 2PPCA 4B9ZA 4L2YA 2H41A 3OBAA 4ONHA 4XXDB 4HK3J 3QEUB 5DQJA 3UAEA 3FB6A 1ZWIA 4CNIA 1J1XL 2MKWA 4HUXB 3TBSA 4I2XE 3C8KB 4W6XB 4Y19A 2ZCHH 2G4EA 4OIFA 1JYVA 1S7UA 2QKIC 2Z4QA 4HISA 1DSFL 3SGEI 1CLZH 1BXUA 5M95B 3KHOA 3NTCL 4U3CA 5E6IB 1K6QH 3L5XL 3FTSA 4WEBL 3TEZA 3UTSE 2IGFH 3BCDA 5JIMA 5TDOA 2EDEA 4U1IA 2VZVA 5JHBA 3AB0B 3V0HA 1B2WH 2ZUUA 5IFJA 1GGBL 5IBLD 1LO3L 3Q1SH 3UPAA 3IJ8A 1JZ3A 1P53A 3BAEL 4JQIH 3D50A 2HG0A 4N90E 4B60A 3RZCD 2J5LB 3P30H 2DW5A 5KVGL 4XP9L 2WLMA 4MKMA 4A7SA 4BFBD 4L4VB 3QG6B 4P2QB 3ZDXE 1W72H 4W9IC 3MFGB 1KJVA 5ERWB 2OL3H 1TG8A 1SJHB 3JTTB 3AU0A 4WU5B 2BVPA 4DP1X 1FAKT 2ICEC 3IN2A 4L1HA 4N0YL 5DQ9B 3NA4A 5CAYB 4X4XA 5CJ5A 3JWDL 5E7FA 3HPLB 3HLAB 2R1XB 1XR8A 4KKRA 2QPUA 1IGCH 1NGYA 4XXCA 3BC9A 5D71L 3UTSB 4BCXA 4HS8H 1OB1A 3AROA 1EZSA 3CXHJ 4JFXB 1L4IA 1KCRL 3SQOL 1FORL 3MV8B 1TETH 3T4YB 1E27B 1JFHA 1F6LL 5IROA 4K94C 3OD3A 2HX8A 4X5QA 2AJYL 1CT8A 3TO4C 4NAJA 1T7WA 5KYYB 4FMFA 4ZTOH 4J39A 1CG9B 4ONGH 2GUOB 4ANWA 5A1AA 1W0YT 2XRAL 2IV9A 4BUGA 4UQ3A 2EEDA 5GZND 1UH3A 4E41D 3GJEB 4MJ4A 1JZ5A 3IGUA 4PW4A 1CXIA 1IM9A 2EC9U 5J12C 4BH7A 2EH7H 2QVTA 4NN7C 1VCAA 3WSQH 3SJVB 3UDWA 3N9GH 5CJ8A 2WZ0A 1M57B 3FXIC 1MFUA 4J6IA 3EXJA 1ZVHA 1H3XA 4MJHA 4ES9A 2VE6A 4NLAA 1V3MA 2IANA 4IBVA 2BSED 3LEVL 3I02B 4M3JA 4TSBL 3C60C 4NKOB 4HG4J 2P42B 2FGWH 4FQ1L 5JHMA 3H55A 5J1SC 4ODTH 2RQ8A 2PPDA 1NL0L 2X6BA 3PV7A 2YD2A 4NC2B 3QUHA 3VXUB 3KYNA 2WTRB 4GMTH 4MNGA 3KPLA 2PXYA 1DLFL 2A6IA 1MRDL 2PWHA 5HJDA 1I1AC 4FI8A 5FYKE 4CC0A 4H0IA 4N22A 1PY0A 1PQZA 3DDFA 4KK6C 4Z0BH 3VFNA 1JNHB 2C4FT 3D06A 4L3CA 4YX2H 3J8F7 3FO2B 1XR9A 1H3UA 2CRZA 4OCRL 5SX4I 3ULUF 4HSQA 4MFHA 1G6RL 2FEDD 4Z76B 3OKEB 3GPSA 1OP5K 5MHSD 1B3JA 3OG6B 4DFIA 5AYUL 4IW4C 2BY0A 3SBWA 4FFYL 1RK7A 4AVJA 5SV3A 1CICA 1YAZA 5AL0A 1PLGH 5BOPA 2UZYA 4POZC 3TM6A 4NP9A 2NY0B 3MRMA 4ZMAT 4RAVB 3QHZL 1KPUB 5I16A 3MLRL 4NRXA 2VMDA 3QGVA 2WKLA 5CINL 1O6SA 3R1GL 5BS0D 1KLUB 3D4GA 2CDEB 2WY3B 4EUPB 1AY1L 4EPSA 3VFGH 3DJZA 3EF7A 4XAWL 1LTXA 4PG2C 1Q9OB 2H1LM 4Q74A 3HEIB 1FYHB 4UV4L 4TM9A 2B0SL 1ZTXL 1OF2B 3KL5A 2BVUA 2GC7C 2XWJA 3ZDZF 2BMKA 5EU6D 5G4OA 3LDBC 4NZ8A 1V3JA 1T0NB 5LXGL 1N64H 4PJ9C 3IK2A 1S9KC 4XO8A 4N1HB 4XWOD 5K9OB 2W0LA 1KN2H 4YBQD 3BVTA 5BJTB 4JDTL 2C3VB 4CC4C 3ZO9A 3BZFB 1M7IA 2D31B 2X9WA 2YRBA 3U2SA