3QFGA

Structure of a putative lipoprotein from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
145
Chain Sequence
NMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDLNPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYELRGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Structure of a putative lipoprotein from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 32
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16729 DUF5067 Domain of unknown function (DUF5067)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qfgA00
1LMIA 3CFUA 3QFGA 2LLGA 4LESA
chains in the Genus database with same CATH superfamily
4RETB 3GF8A 4WFGD 1EBPA 4Y9CA 2AMUA 3DHUA 3DOHA 4RCAA 4NPYB 5FWRA 2DTSA 2VKWA 4DSYA 5C09B 5CKAA 4NIKB 4OSUL 3ZMEA 4AQEA 1U95B 1GGTA 1HKLH 2NCEA 2UYLA 3AQZA 4HETA 2I07B 3FMGL 1LO5A 1RUML 4HXBL 2F54B 4LVHB 1DQQA 1O5DT 2CRZA 3O6LH 4Y4KB 5I30L 1ZHKB 4XCEA 5F3BA 4IBQA 3D39D 4OLUL 4M7ZC 1E5ZA 1Q8MA 3FO1A 3G6AB 4IKLA 3P30L 5FA4B 3MOAL 4WSKA 2YAHA 1FFOB 2P5EA 3MJ8B 2Z34A 4TL4A 3CZGA 4K23H 2FEDD 1EQWA 3HNVH 3FRUA 1LDPL 2QVMA 3FOMA 1XGRA 3VI4A 4BFNA 4LHUG 3EHBC 1JZ7A 3OF6A 3IFOB 3QFJB 3SDAB 1U41A 2QKIB 1S4IA 3BWAB 4XB7A 3SBPA 1O9ZA 1KTDB 3MSPA 4YDJA 3F5WB 4A39A 3T1FB 5KSUB 3Q05A 3IMTA 4E9XA 4L4TD 3HN8A 3LV3B 3MLVL 1ERNA 1BQLL 1CXKA 3NCYP 3WJJC 3ISWA 3B5TA 4DP2X 2ADJB 4KOBA 2DKSA 4Z8FH 4L29A 3MFFB 3RTQB 5JPNB 1TQVA 1TNNA 4GUPA 4LL4A 4ZQTA 1MCWW 2DN7A 4NNYA 2OTWA 3Q6GL 4PB9L 1XEDA 3LQAH 3FS9A 3RWHA 5FCSH 3QR0A 2RHEA 2BNRB 1NCGA 4W9EC 3MBWA 3LIZH 1U2HA 4RISL 1YAZA 4KFMA 1BLNA 4WJ5B 5DS8B 2GY7B 4NFBA 4N0CD 5HYSG 3CVIH 1IVLA 2WSKA 3OZKA 4PY7A 2DM3A 2E5EA 4G82A 4K8RC 3MRQB 4A55A 3VD2A 2LOEA 3CFBB 4BXVA 2LABA 1DEDA 1MI5D 2R2BA 3T4AA 4RX4A 1EK3A 3CH1A 1X7SA 2FO4A 2IDCA 4N8PA 4DZBB 1IM9A 5EIVA 4Y4HB 1W72B 3KLAA 4P2RB 3TT3L 2GBAA 3ESVF 3OL2A 2K45A 5B3JE 1NEZB 3DMMD 3BESR 1TF4A 1ZTXL 4UV4L 3X3FL 5DA4A 4Z76B 1PX4A 4M6OL 3MV7A 3TJEH 4I3SH 4JEGB 2B8OT 4XNZB 2ZUYA 2D7TH 1XH1A 3VXTB 4M7LL 3D39E 3NCBB 3TA4D 4BZ1H 5IQ9B 4U1MA 4WU5B 4U1HA 3UZVA 5DK2A 4A2MA 2R0LH 3RUGF 3ZBMA 2JWYA 2R1XA 1IBGH 1G7PB 3CGTA 3TZVC 2OCCB 4ZFGL 4A2FA 1JWMA 4PIBA 4AXWA 4BZ2L 2A73A 4FQXD 1C1EL 4W93A 2IDFA 3TBVB 1WFIA 3NFNA 5BVPL 2RTTA 2WXMA 5F9JA 1P0SE 1A4CA 2AEQH 2EXYC 3TO4C 1NZRA 1YEEL 2AXJA 4B27A 4PG9A 5A3IC 5HPMB 2OCJA 1Y07A 4TUKL 4XI5D 3WNOA 3CFKA 1UJTA 2ZOLB 1XIWB 6TAAA 4OZ4B 5C0GB 3QJFB 4P3DA 5I2IA 4PJAA 1TVHA 4L4TE 4DP8X 4DGWC 1GGIL 2W88A 4GH7B 4B9CA 4XNDA 2VDRL 4R7XA 1BPLB 2P48B 1N18A 2WYTA 3D9AL 3EJTA 2YPKA 1X5ZA 2A6DA 1D9KC 1CGWA 2QLYA 4HF5H 3W39B 2G30A 2ADYA 4L9LC 2VXTL 2IAMB 1JS4A 2ZIDA 4PHXA 1BG9A 1WYJA 3ARDD 1PIFA 1JGLH 4JANA 4CVXA 2BFVL 3U30B 4OZGE 3EYSL 3AAZA 5E6RB 3JUZA 1IGIH 2KMWA 1A7QL 2R69A 2DV6A 4NPKA 1J1PH 1B3JA 4N90E 4B3VA 4EAEA 1CDJA 1LEIB 4J8QA 3MNWB 4Q7DA 4RGNE 3NPSC 2AAVA 1CS6A 3V0IA 2YD5A 5EEWA 5F88A 1EPFA 1KIPA 1BFOB 2ICES 5HBBA 2JKNA 2R4RH 1T21B 2EIEA 2Y5EA 2VE6B 4JDZB 4V2BA 1P84J 1QLEB 3QCVH 4GQPH 5I8EA 1A1OA 4JFHD 2VW4A 3EO0B 3H3PL 4AGLA 4J3XA 2Y07L 2QPEB 3A47A 3HLKA 1R1CA 4PV8B 4XBGB 3KXFE 3HUJB 1PZDA 4RDQF 5D1QA 3AZUA 4BD4A 5IT2L 3L9RB 1U8QB 4PWEA 1HL8A 3QG6B 4I89A 5L88L 2Y6SD 5GS0L 4JFYB 3LDBB 3IRZA 3O3DB 4XODA 1UCTA 2DIEA 4TTGA 1OY3B 3ELQA 2IWEA 3NIGE 1A6WL 3ETBF 1Z7JA 2R1WB 3DOSB 1IC5L 3HVNA 4G83A 1TZ8A 2Y2TA 5GS1A 3OLDA 1NCWH 4FXKC 1ZGLP 1BEXA 3KM2A 5EF3A 2B2XL 2H3NA 3QIUC 4OLYL 4HEME 1TTGA 3SPVA 3T4YB 1T7VA 2QV4A 3C5JB 3O6FA 4K7PL 2YEQA 3N44F 4QHLA 3MRKA 4ABQA 2WTRA 2B16A 4TVPL 5MP6L 4LLVA 3QUKB 4GUQA 3CXHK 4N2OA 3O4OB 5LJYH 1GTNA 5HYQB 3T3PE 4QO1B 1A0QH 4MNHB 4POYA 1JDCA 4WJG3 4GG6A 2P47B 4XN8A 3NH7H 3UGEA 2F6AA 3EKCA 3S8WA 2I07A 3U9PH 1WISA 1OTSC 5EDXA 4MA1B 3EO9H 3L5HA 3SDCC 4EKXA 1ECZA 1B6DA 2V7NA 3DUUB 5SWQB 5IHZA 4JCMA 3T8XB 1TYJA 3QUMA 3T0XA 3NYKA 4N2BA 3BLBA 2C26A 5FM4A 4GSUA 3LQMA 3D33A 4HWEH 4N86A 2ZNXA 4BQ8A 2VMCA 2F08A 2HFFB 3O3AB 5FUZH 1MQKH 3QXTA 4KK8C 5ABAA 1A4JB 2VRQA 1YDPA 4LHJB 5LBSL 3O2WL 2XG5A 1NGXB 4L8SB 1J87A 4CU6A 4OCNC 2PR4L 3IFOA 4BKTC 2P80A 5IZ7A 3U6XA 2C3WA 2IH1B 3F5WA 1HXMB 4JY4A 2ZUSA 1AAJA 1F2XK 4BK5A 5I6NA 5ETUB 3FB5B 3DETC 5E6ID 1NBQA 4J3OG 2OL3H 1JD7A 5CCHE 2XQ0A 4PW9A 1S8DB 5D7LB 3VI3F 4WEMB 2KH2B 1OALA 1ZV9A 4L4VA 2EDKA 2FX9H 3TPUA 4P3CH 1CGSL 3A4DA 5D7JA 4Y9GA 4UOQA 5DJAB 4OVVA 5JQ6L 3BEWB 1AACA 3F7LA 3R1GL 3DTXB 3W9DB 4M61A 2OLDA 5JA8B 1DBKL 3ULUH 3P11L 4ZUSB 4AYFA 2BNRA 2NT0A 1MAML 3LNHA 4JO1L 1KCUL 4PY8I 5JXEA 4CRPA 2DWTA 4M1DH 1OEZW 2I7SA 4HT1H 1R24B 2YRZA 3UFIA 3H53A 2IIJA 1D6VH 3VRLE 3BRDA 4JFSA 3VFWA 4WW2B 3HPLA 3NABL 5DEGA 4YPJA 5IIEA 1I4FB 2YMXH 1OE3A 1WHPA 3UBXA 1K9TA 1TJGH 2BVUA 4BQBA 4P5TB 3ZRCC 2VAAB 1ZLSL 1AXSA 5HI4C 3ARZA 4PEEA 2OZ4A 4LL1A 5KVFL 2X1QA 3VYOA 4EKJA 4P5MA 4W68A 3C6LA 4DZBA 4M9OA 3WHXB 4Q6KA 1W72A 1SY6L 2OMVB 3B2VH 1A7NH 4P2RA 3PU7A 4LDLB 4QUOA 3ESMA 4OLXH 4W1TA 4XC3H 1P2CA 2WKGA 4J3WA 4CN1A 1NEZA 2D31B 3RWDA 4AYDC 3SGJC 3RIFF 1BFVL 4JKWA 2PW1B 3IJYB 1AO7B 4O5LL 2GIYA 4HOZA 2DQHH 2X1PA 4NZTH 2X4PA 3TBSA 5I82A 5A6IA 2EYSA 2MNUA 4LVNC 1FO0A 4YO0B 3FFCD 2IBZY 3BKJH 4N0FA 4U1IB 1U8LB 4YNYB 1IQWH 4HPHA 1RUQH 4JFDB 4D8PA 1VZGA 2HRGA 2X05A 1UZ6E 2DQUH 4YHLH 3TBVA 1ECYA 5D72H 2DDQH 3ARRA 1E5BA 4DF9A 2GBVA 3LN4B 2L0DA 4DEUA 5I1LA 3W5NA 1FL3B 2AJYH 1NJ9B 4KXZI 3CZKA 4H8WH 4RVBA 2A0LC 4PLNC 3IAQA 1C8QA 2DTMH 4MA8L 3P9LA 2WO4A 4G9DB 2HVBA 5EWIH 4PVMA 1EJFA 4PJ9B 3VTTA 4NDMA 1T1WB 3V8OA 2AJUH 1N8ZA 2H32B 2MPAH 2WHVA 2VO8A 4FTVE 1D5ZA 1PLBA 3RWIB 4WU7B 4OLZL 4X8XA 1J5OL 3ARGD 3RDTC 3KPQB 1K4CB 2IAMA 3L3HB 3ZIMA 1WFTA 3T6WA 1A7BA 4QXGL 3GHBH 1PD6A 1UOKA 1JTPA 1FNSL 4YLCA 3WKYA 5M7QA 3DX9B 1IM3D 2B1HH 4QHMA 1FFTB 4N0YH 4NWTL 1LEIA 4P04A 1EJ6A 1Z3GL 1TQWA 5DC4B 1DQTA 4F2ME 5GISL 4IRJB 1FRGL 3SDYL 5JHLH 2ZUWA 2ZXBA 2X6CA 1QSED 3FYEB 4IJTA 4IRZL 5E2UL 1ORQB 2BXZA 3WLBA 4QWWC 1Z2KA 1FG9C 1CFVH 3GO1L 1NL0L 2EECA 3IS1X 5IVXB 3E1ZA 1JGEA 3EH3B 4RIRB 5HDBE 3NZHH 1KPUB 1AGEB 4OKVB 1M71A 5DEJA 2YGOA 4ODUB 1N6QH 5E6YA 1GIGL 2Z1PA 4BUQA 1PNDA 3D34A 3MQIA 4B9YA 4DP5X 1AR1D 4WW1B 1CLOH 4BZYA 4JFFD 1FZJB 2WXHA 2W81C 1MRFH 3REVB 4XB3A 4TXVB 1QFPA 2XX1A 1JNJA 2HJKA 1IFRA 1TJHL 3OKNB 1IZJA 2CCVA 4FCHA 1OT1A 1S7SA 4M48H 2VISB 4LSVL 1ZHLA 4M8RA 3BD3A 3S9DB 1QACA 1RMFH 4XMXA 1X5LA 3SDDC 1XH3B 1UKQA 3WLWD 5D1ZD 2J5LB 1UM6L 5JHDB 5E1IA 1YLBB 3B9KC 2X2IA 3QNZB 4KJWD 2EIKB 1LTXA 4XPGH 5IB3A 1LWHA 3SYAA 5DD5H 3BISA 3MBEA 4X4YA 4LB8A 3SDXE 3GS7A 4ZSOA 1BQKA 4FHKA 3S4SB 4QO1A 4XP9H 1UVQA 5D2LF 4AVHA 2W07B 2CDFA 4OH2A 4OVUA 4XE5B 3T0EC 3O2VL 5E9NA 4ZMTA 1HSBB 1X6NA 2D3NA 3V52H 2O6CA 5D2NC 5SV4A 2PUQT 3BN9D 2EJ1A 3L3GA 3LNDA 2AQTA 5SWQA 3V4PA 2XNAB 3IMVA 2XN0A 1SXZA 3QDGB 1S5HA 1UFUA 1JF6A 2OFQA 3VW3H 2ZCKL 5AVWB 3VG0L 2D3JA 2ESVB 1LD9B 2NY2D 2WB7A 3H9ZA 2EO7A 2VDPL 2HFFA 4IGBB 1DL7H 1LGVA 2ZYIA 1E5UI 1EXGA 4P2OC 2B77A 3VJ6B 3L3JA 1F58L 1A9EA 3K74B 5M94B 1CR9L 3VXME 5E0FA 3IBOA 1NFIB 3H55A 5IP4A 1ANUA 2IH1A 1NIEA 3RDJA 1HXMA 4NO5A 2BY3A 4N2CA 3ETTA 3EGXB 4AGOA 1TTBA 3L5WB 1KXTA 3WMQA 4ZOAA 4HZLA 3E1F1 2XPYA 2J1YA 1BDYA 4HJTA 1HWWA 4LZKA 4HXAL 1BZEA 3DRQA 4P4KA 4PWGA 3MGTB 3FU0A 1AI1L 1TEYA 3OXRB 4LSTL 4UUJA 5DJAA 5D8JL 4LSDA 4MLIA 1RUAH 3QCUL 3QZOA 4MDIA 3LD8B 5E5UB 4WK0B 3S35X 4J3UA 4ZDHB 4V1DA 2BMKA 1JFHA 2K6ZA 1AIZA 3MMEB 3V0WL 2CIKB 3P9MA 3WIHA 3OAUL 2WQRA 2HVJB 4FL4C 5FM5O 4Z3FA 3B2MA 1JPFA 3BH9B 1Q94A 4WIQA 2XX0A 5KYXB 1NMBH 1P7QB 1T83A 5C0AB 3SQOL 4AMWA 1QUNB 2QQLL 4LHUD 3EO1B 3JWNH 3FAWA 4DPBX 5L8KB 1DVFC 4X5QA 4Z95H 1EAOA 2OMVA 1GH7A 3SGDI 1WCQA 1J8HE 2NMSA 5HVHB 3T1WA 3FTYA 4POZC 2DYPB 3UAEA 4N3UA 3ROOA 3SKMB 5TQ2L 2BVQB 3AUVA 1PD0A 5E9DE 3IJYA 1U8KA 5BMFH 5A2FA 3RYMA 1OLZA 3I6LE 2O4EA 3F7QA 2WINA 3PDOB 5IROA 3UADA 3I6KA 2X9ZA 3C5ZC 4N9GB 4HCRL 1HHGA 4QNPE 3AS3A 5AG8A 4FNRA 4UTAA 5CD3B 4F15C 3QQ9C 3QWOA 2V5RA 1OTUD 1SN0A 1SPDA 2CKBA 4FQLL 1AZVA 4YUEH 3TASA 2O5ZL 3ZTNL 2ADGB 2GK0B 1E4KA 2C4FT 2NXZC 4A7UA 3F58H 3QDMD 4R7NB 1FL3A 5B3JF 4Y7OC 1CYWA 4AGNA 1BOGB 3K1KC 1U91B 4U3CA 3OB0K 2TRHA 1TZHB 2DAVA 25C8H 2ZOUA 4PJ9A 3ZE1B 5KSBE 3NJFA 1TYRA 1OGTA 1HZHL 2CIIB 1HXKA 1WF5A 3O45A 1P5VA 5GGQL 4A7SA 4KUZH 3NIFE 3RWIA 3CV5A 3D85B 1WAAA 4ZUVB 4C4KO 1KBGH 1S7VB 3E6HA 1BJMA 2Y2YA 3B43A 5DMJB 3SPHA 3AREA 3L3HA 3CLEL 1WIOA 4HGKC 5DJXA 3PWLA 4I87A 1P6WA 3TEZA 3RBGA 5CLZA 1GZHA 3KLKA 5DI8A 3ZDYE 2BZCA 3PP4L 1LEGB 1ZV5A 2HLEB 4RRPG 4CADA 2NY3B 3HFFA 2J6EL 4PJIA 2IEPA 3BJ91 4YK4C 3E9UA 5JIMA 4IRJA 4MAYD 5DMKB 4UT9L 5IVZA 3C08L 3EFFA 5E0QA 1HCFX 2P3YA 1KNOB 2QT6A 5BZWB 5T3ZH 3W82A 2D2OA 1S3KH 4OAWB 5C0RL 4OGAC 3HBZA 2B4CL 5FO9A 4P2QA 4BWTA 5C2BL 4FMFA 4X50A 4YDLB 3L1GA 4W4OC 3QHZL 4OKVA 3MO1A 4MZ3A 4OZGF 3PRZA 5DJZB 5FUOH 4AL8H 2XG4A 2GJ6D 1G5GA 1CXLA 4YZFE 1T0MA 2ZAGA 2YPVA 3AG3B 3SJVD 5C97A 4LOUC 5L2KB 4A2HA 1KENL 1L9RA 5KSAB 1FZJA 2W80C 4LKXB 4DERA 4DUWA 4MNGB 5CM1A 4YHKL 3UJTH 7FABL 1EAQA 4HIXH 4L3EE 1Q9WB 4BA0A 3OKDA 1A4BA 4O02B 5IV2B 3T8MA 1S7QB 1B3IA 4P46B 4NQEB 1XGZA 2R69H 4FJZA 4R0LC 5F0PB 5I1JH 4FYQA 4XXDA 3NA9L 5AW8B 4C55A 2A1WH 1SQMA 4NT6A 2P8PB 4QGYA 1E4XI 3QNZA 5CZVL 1SXSA 3D4CA 3OQRA 3PDDA 5GZOA 4Q0XL 2D0FA 1OAQL 2H26A 4GMSH 1TTFA 3QDME 4HJJL 3MV9B 1JXFA 2B1OA 4XNYL 2PPCA 4S2SA 5I1IL 2N1TE 5LCVA 2ZKXA 2BH0A 1UH2A 2OI9C 3NIGF 4S1RH 2F53E 4LCWD 3QS2A 4HIEB 4X9YA 3LHPH 1CE6A 3UZEC 2PF6A 4H8PA 2VR5A 4L0YA 4XBEH 5IW1B 2YHGA 5HVGB 1HDMA 2AK1L 4WO4A 2XNAA 3K5SA 1NGZA 1OF2B 3MRBA 2NNAB 2VC2H 2RD0A 3CX5J 3QQDA 4O58L 4X4MA 5CJQL 2XC8A 4BHUA 1KPVA 5KVDH 1GMIA 4KROD 1QNZH 4X0NA 5C0JA 3UO1L 2I60H 1IGYA 4JY5H 2IOIA 2YN3A 4LLUB 3VJ6A 2X4QA 4N68A 1WHOA 3TN0A 1L9MA 3T3PF 4HC1A 1WT5C 3MLWH 2Q76A 1I9RH 4KKBC 1T7YA 1DO5A 1F6FB 1G6VK 4HJUA 1P1ZB 4MB4A 2WUCL 2YXVA 2VDQH 3BW9A 1OAZH 3L5WA 3WD5L 2KERA 3CG8A 3MC0A 3ZKND 1EEQA 4ZTPL 4XHJC 1BHGA 1YMHB 2XUWA 2Y7MA 3TIDB 1AP2B 5JHMA 1INDL 5GZNC 2VM3A 3MGTA 1BG1A 1I3RA 2K78A 1KC5H 2DQJH 3DJTA 4HKZB 5I15L 4LLYB 3SBQA 4PJBB 2ICEA 2VLKB 3ZYOA 2NSQA 3BPCA 4L0ZA 2NW2B 4PJGE 1IGTA 5FYJD 4RQQA 4L3AA 4ZDHA 1RZJC 2IANB 3QUMH 1YNLL 3FCBA 5BPPA 3LZFH 3WAKA 3KHQA 3ARSA 4X7SH 2Y1ZA 2HFGL 1BVOA 2M26A 3QZBA 2F2HA 4FQ2H 2SEBB 4HIHB 4Y5XA 4M93B 3MLSH 3BH9A 4O4YL 4Y5YC 3HBPA 1P7QA 3N41F 5C0AA 1J9QA 3QIBB 2EIZA 2GC4C 4JFXA 1UXMA 1RZ8A 4NO0A 3DX7A 3TPKA 5CR1A 4G7YL 2JI3A 2Y25A 9PCYA 4MXQC 3ULVD 4B0MM 5DJ2B 2AV7A 3OGCB 3RVXC 5T33L 1HTYA 1ROCA 5E4OA 1JNLL 4JPKL 5FKPB 1JVKA 1TZOA 4J3OD 1TMQA 5ESAB 5A2CA 2BVQA 4XPFH 5H35A 3VRLF 3VGAB 2Y5TA 4XO8A 4XVSH 1I8IB 3Q2VA 2AP2A 1EFQA 4C56D 5F89B 5T3XH 5DCCA 5D71H 2VR6A 4RGMC 1J0YA 4UAOB 2AERT 3HN3A 3BKML 4DQAA 2C3XA 3WL9B 2QQKH 3P54A 4GW4B 3NDYE 4OB5H 4Y8AA 4OY9A 4Y1AB 5AW5B 5HJBA 1FYHB 1ASOA 5TE7L 3SY0B 1B4RA 4NNXB 1KIUA 4RRPM 1EIBA 2AABL 3U0PB 1WITA 4LEXL 4PRHA 2FL5B 1UD4A 5I71C 2VM9A 3Q5OA 2VO5A 4GUCA 4LT7A 3Q6FB 3MV8D 2K4AA 3DVNA 3GGWB 3G08A 1NLBH 4AJYV 5D4HA 2LFEA 4EN3D 5IFHH 3LS5H 4EIZC 2DF3A 1S7XA 2D0HA 3GSQB 2OZ4H 3CU1A 4G3YH 2YPLB 1FLTX 4JO2H 4WJKB 3BKYH 2AQ3A 4OT1L 1GPOL 3QNYA 5J1AA 2O61B 4ZUVA 2R9HD 4UIKH 1PKQB 2PCPA 3O9WA 2BVEA 2G2RA 4XP4L 5FC9A 3TFKD 4XP5H 32C2A 3EOTH 1J9RA 1UZ6F 4ISVB 5HHVL 4KMTL 3B2XA 3IDJB 3MX0A 3G5VA 4GKZB 3HJ0A 4HCFA 5MEOA 2QDWA 3STLB 3ZZQA 2ZP9A 4GKSB 2WBJC 4XWGH 4HWBA 4F7PB 4DKEH 1CXIA 4GQRA 2OK0H 1XGTB 5F7MC 2OTPA 2OMTB 1OGSA 5T1DL 3CN1A 1KNOA 3QIWA 3R0MA 2YKLL 4L1DA 5BZWA 3IXTA 2MCMA 3T0DA 5F7LB 5HHPB 1I7TB 4JG0L 4RAUA 4NUJA 2APXA 4HALA 2Y7NA 2AXGB 4PJ5E 4X6DA 4AZ8A 2Z93B 3EJSA 2WNGA 2XQYK 3GMRA 4KAQH 4Z0BL 4ZFZB 4U0RB 4ELMA 1E6OH 2X4OB 3OF6D 3UP1A 5EORL 3CFNA 4LSQL 4P9MH 2IPKB 5D7IB 3HG1E 3U7AA 2Z31A 1CFTB 3C75A 2XWCA 3MACH 2R29A 4F8PA 1EUUA 3SE8H 1MLBB 3DX6B 5LDSA 4Y0GA 3HMWL 4JDTL 4LPTA 3FU7B 5E8DL 3HE6C 1P4LA 2V2XA 2HN7B 3TYGH 2ATKA 2KZ1B 3ZGIA 2ADFH 3FUIA 1HJCA 1IRAY 4D8OA 3RA7H 4ZD3H 1S9KC 4NCC1 2XDHA 3OGOE 3B7RL 5EOQL 1O75A 2VXUH 5AYUL 2DB8A 5FW6A 5BO0D 3W11D 4ABWA 2K70A 2F7PA 3L4YA 1KGCD 1SNRA 1RZGA 2XV2A 3HC4H 4M8UA 5HDBF 4E41B 4W4NA 3CZFA 1ZT1A 1OO2A 3FB6A 4ENED 1BF8A 3KGRA 1IFGA 4F92B 3GXTA 3V4VA 4Z5RA 3PWVB 2W9DH 1LO0L 3O6ML 2VH5L 4EBQH 1KV3A 4ZX6A 1CE1L 1PJ9A 2VWEE 4GW5A 1CIDA 4FQHB 1BM3L 3FQXB 1NOLA 3BQUB 2CDGB 1JRHI 3LXAA 1MCPH 3QJXA 3KDPB 1OGAB 4RX4D 3LNEA 2BZDA 1WBYB 1IM9D 4BFGA 1HCVA 4WY7L 3HMXA 1K8DB 5FO8B 2CD0A 4TSAL 1OTTC 1T66D 3THML 2CRIA 2QGEA 4WUUD 4IEFB 1NGQL 3D4ZA 4FXGC 2Q86B 2KPWA 1SYSA 3QAZC 4MQ7A 2APBA 2HT4C 3MV7D 4I48B 4NZUL 2A5UA 3FF7A 1N10A 2D03L 4JO5A 4UB0L 4YDZA 4P59H 5F2FA 4LLUA 1QBML 1MCLA 4F9PC 4M5ZH 2NY0D 4YZWA 3GI8L 3SDXF 4G5ZH 1E42A 1YEDB 1SOXA 1Y1DA 3C09B 1JPST 1QABA 2R1YA 5GHWH 5KJRL 3NBNA 3DXAA 2FX8H 4KHXL 2WKOA 1EFXB 2AI0L 2H0FA 2Z91B 2DOCA 4MJ6B 4YHML 1P1ZA 5IHBA 1HS6A 5KVEH 1X4YA 2NXYD 2D7NA 5HJ3A 5L6YL 1YN7B 5BXFB 1MJ7H 4LPWA 1BAFH 2IQAB 2OULB 5EZOL 2HLAB 2EKSA 4JM2B 1XGUB 2I9LA 4NQTA 1AFVH 4UANA 5ITBL 3LKRA 3X1EA 2XIDA 4TKWA 4K7PX 2GCYB 3VMOA 1SVZA 4PJBA 2VLKA 2A6KB 5E7BA 3ATBA 3WV0A 3BH8A 3QUZB 3UJJH 3V4PH 5EEVA 4GSDH 3TC9A 4G8GE 3STBA 5I74C 5EEYA 4FA6A 4MX7B 3JT2A 3SKNB 2ZJSH 5ES4B 5JHAA 1LP9B 2HTLC 4YDIL 5DURB 2VDLH 1KIQB 5IQ7L 2OSLB 2A4ZA 2ZOTA 1N6UA 2XFXA 3QEQD 3DX2A 4NKIL 2XOTA 5INCB 3F7VB 1BJ1H 2FSEB 1MFVA 3OKLA 4W6WB 3UGXA 2GI0A 2ILLA 2Q87A 1CFMA 4YSTA 2XCMC 3S4SG 4I2XE 3TEYA 2O5YH 1U58B 1C5BL 3KJ6L 1R4XA 4JRXB 3VFGL 2CK0H 2ZWKA 4GRWE 5GRZA 1UEYA 4PCTA 1VADB 4M4PA 3INUH 2GJPA 1I8IA 3WAJA 1Y6NR 5F89A 2QSCH 1YEIL 5AAPA 2AZUA 3D3VD 2AKRB 4WUUE 1QI5A 3EBIA 1TQCB 3AACA 4UIMA 3IJHA 1ZT4B 2G75A 1BVKB 4Q4IA 2PN5A 5E03A 3GMQA 2JELH 4PS4L 2AJVH 1X5MA 1P53A 4NQVB 2AEPL 2Z8VC 3DKHA 3AG1B 4L1BA 4XN9A 2JLLA 2K8QA 2CO1A 5G55A 3CSYB 1HYSC 5LGYA 3MUUA 3BDYL 4FLOA 1I8AA 3WIHH 3L4XA 1YJDL 2JCCA 4M7JL 2IWGA 3DECA 1RCYA 2H5UA 4H8VA 4PP1C 2Z64C 3PWPE 2GKIA 5F7BA 2OMWB 4YFLF 5MENB 1U8OB 4HK3N 4U1NA 4W70A 1R5IA 3GSQA 4G8IA 4UQAA 1U8NB 1NMAL 2VJXA 2YPLA 4QLRA 4U6XB 2HMID 4QNPF 2J4WH 4IK7A 3P2DA 1PKQA 4WWKB 5AOMA 3P73A 5K1NA 4ECNA 5IFAL 2ZXAA 1G43A 2HZHA 5IMKA 2VDKH 5J1SC 2EH7L 4A7GA 3VD3A 3QK0A 1KTRL 1NDTA 1AHKA 1CUOA 1KCLA 2Z35B 1CQKA 2F54D 1JI2A 3VD0A 4AI7A 4Y4KD 3C60B 3OAWA 1CB4A 2E7HA 2WNKA 2GSIA 2UWEB 4XPAH 1JYVA 4NP4H 5EUOE 1CT8B 3T6ZA 3GSVB 3Q1EA 3UERA 1NUGA 1UQSA 4AOFA 5F9WC 3VXSA 3IDNA 2OMTA 5KSBF 1MREH 3NJHA 1I9IL 4R83A 4OCWH 3VFSA 2OYPA 5HPOA 1WS8A 1TETL 4L4JA 3NIFF 1YY8B 5EFIB 3D08A 3DGDA 5E5MB 4JZJB 3DPBB 3ZHKA 3SDAD 2P80D 2QZ5A 2VMEA 5D7IA 1JZ8A 3BSGA 1F56A 1UACL 3MNDA 4UOZA 2GEEA 2OR9H 2CPCA 3ZDYF 1GHFL 4FI7A 4MKTA 1MLBA 3DC0A 2CO3A 1UJ3A 4XNUH 4Y5VA 3FU7A 3DUHA 3TBYA 3BXNB 5LGHH 3RTQD 4X98B 4U1KA 1FA4A 4U7MA 2X6AA 4LQFL 1Z66A 3TA3B 1F11B 5D7JD 3BH4A 4MJ5B 3D3VE 2Q9OA 4I0KA 3Q9PA 4LBEA 4RFNC 3O4LB 3R7RA 1KJMB 5GGSY 1MJJB 4QRFA 1RURL 3L9BA 3W2DL 3WO4C 5AWNH 1ONQA 1HEHC 5CGYC 2BNRD 1H8LA 5JXED 1NAMB 3LKQB 3WUWA 1MW1A 4KJYA 2JV6A 1VHPA 1S7UB 2IH3B 4YSSA 2DQDH 3QRLA 3EYQD 3HNSH 5DQJB 5DC9B 2A9DA 5FGCE 1ZSDA 1MFDL 2BSDA 2YAQA 3IMWA 3K4ZA 4YZFF 1DE4A 2CJSA 3H85A 5JOFA 3I9AA 3FH7A 4LLQA 3P4LA 1KLFA 4PRDB 2DYSB 1FJ1B 4PV1C 4Z0XB 3O3UN 3VXPA 3BQUA 1O7DE 4QHKJ 2CDGA 4YHOH 4AGPA 4F57L 4P23A 1U8CA 1NOFA 1SVBA 1WBYA 3EH4B 3C6LD 1DO6A 4Y4HD 5EU4B 5C09E 4Z3GA 4EXPX 4P2RD 1S3RA 3B2DC 4EI5B 1OANA 2JB6B 1KLGA 3TWYA 1IEAA 4NQCB 3RY4A 2CJTA 3P9WB 4CAGA 3SZ6A 3NGBC 1U3YA 2F54E 4UDUA 4XBPA 4NS0A 5DJ0A 5F72S 2VDQB 4LEBA 2W65B 1TKWB 2E7MA 4WSGA 1L5GB 3SPIA 4Z3IA 4OUOA 2B14A 4A37A 4I77L 4XT1C 4G6ML 4HBCH 1WIUA 2A9CA 2BK8A 5E8OB 5E08L 4J3TA 1XZWA 4M6ML 1F42A 1YN6A 4MQXD 5EOTB 3ZOAA 3TV3H 3MOQA 4NOBA 5EBWB 5ICYA 3QFJE 2NUPB 2EYRB 4QAMB 4EUPB 1MFBH 2KT6A 5LCVH 3LMJH 3S37L 4XMUA 2GCYA 5I6XB 1XIWD 1WJ3A 4MMXB 3BQVA 3FT4B 3LB6D 1NMCB 3DSFL 3I9IA 3VU2A 1A65A 1AXTL 1S7TB 4DP6X 4ZOBA 3R4DA 3UOAB 3K2IA 3U83A 1Q1JL 1FGNH 1HIML 2L7QA 1UYWL 1J1XL 1OV8A 1B2WL 1MAKA 2V17L 1IARB 2IAMD 5E94A 3H6AA 4EZLA 2R0WH 1XF2A 5B1CA 3BUBA 4NNPH 3TJHD 1YY9C 1LP9A 5HHOE 4UT6H 2IALA 2E9IA 1SLVA 2OSLA 4ODHH 1HK6A 5GGRA 2IPTH 1BBDL 3ZN6A 3HW7A 3OZ9H 4HC1H 1T3FA 2YEVB 4Q9QH 1E4WL 2XRAH 1TPXC 4TPRL 5KWYC 12E8H 4Y4FB 5KYWA 3D0LA 2NY5C 3E3QE 4PJGF 2VLJE 1JGDB 3LKNB 4LFHG 4ZMXA 5L7XL 4IBVA 3L4WA 3WY3A 1TJMA 4AZUA 4KRPC 1OCWL 2VUKA 2BP0A 5D55A 1IIIA 4Z7UB 5C7XH 4FE9A 2YGQA 2NSMA 5CJXC 1BZDA 3AMLA 1E8YA 2OP4L 2ZUTA 1FFPA 5D1ZI 3S97C 4Z78A 2H0EA 3BIBX 2PO6A 1YO4A 1ASPA 4LDCA 3M45A 2TSAA 4K8RH 2MSPA 3HHMA 3O8XA 1JFQL 1R46A 2DWEA 2H6OA 1D5IH 1OB1B 5EBLB 2AQNA 1A9VA 1SEBB 1HH6A 4LP5A 3L3OC 2BJML 4J7RA 5ICZA 4H0LC 5BV7L 1DBBL 1K85A 3SCMA 3LHAA 1PEWA 1J86A 4M3JA 2Z8RA 3KGUA 1E8WA 3Q5YA 2W9EL 4PJHB 2PETA 3MNZB 4I88A 3UTZA 2VUYA 3QPQC 1OK0A 3QO1A 3KR3L 5MENA 3QZWA 4QKXB 3N5AA 1QG3A 1BW8A 5HY9A 4LCUA 1KN2L 1OSPH 1F00I 3RWGB 5KVGH 1MFCL 3CBRA 4H0IA 5EIIB 1IGJB 3V10A 4DVBB 2DRUA 4WWKA 3WXWH 4E9TA 4OD3H 5ALCL 1OP9A 2XWJA 4FQIL 4KMLB 4ZZFA 4JHWL 4BWWA 4G42A 1WAPA 5IKCA 2Z35A 4EVNB 3RNKB 1KFAH 2XZQL 2UWEA 5LVEA 2IC2A 5D7SL 2DQTL 1CT8A 2WZ0A 3G6JE 4DUVA 2L8AA 4GY4A 1XGYH 3QR1A 3ASOB 5HYEA 2N7AA 4BRJA 5IQOA 2YJLA 3ATFA 5DGQA 2YN5A 1E9QA 5TDPA 2Q2EB 7TAAA 2VZSA 4DPCX 4YEEA 3VH8A 1YY8A 3N0PB 5A7EA 1F4AA 5J12C 3LIUA 4GRMB 2DLFL 1UD2A 2XA8H 3ILQD 3BVNA 4BV1A 3KYKL 1D3CA 3GSNH 5AYQA 4JG5A 1FG2B 4JMXA 1BD2B 2D4DA 5JIQA 2C9QA 4I3RH 4W9ZA 4NJAH 4CJ1A 4XAKD 2XN9B 3PFQA 1KELL 4UDTB 3WKMH 4Z7OB 4BGLA 1QRKA 3CDFA 2X7LA 3W1ZA 4MCYA 1YEJL 3MLXL 4MBRA 3VSVA 5BNXD 5I5JA 1X5KA 1TJIL 3LRHA 3HUJE 3RWCB 4P4KD 4DEWA 4FABL 1BVLB 2AS5M 4AIEA 2XTSA 5HHMB 1UA6H 2VZOA 2XLLA 2Y7OA 1ROWA 3H9SB 1ET8A 3LPFA 1B9ZA 1DDTA 5I1KH 2F15A 3QB7C 1H6EA 3LKQA 3HAEH 1ZHBB 4V1DD 5DVLA 5I1HL 1IFHL 2FEEL 4KUCF 2NY5L 2UY7A 1EDYA 1HILB 3O2DA 2CO2A 4LSPH 4X5XA 4QOKB 3S6CA 2PYFA 5F7DA 2L7UA 4L3CB 5DZLA 4YIQB 1B4LA 2K9UA 2DQEH 4J3OF 1HH9A 1A7RH 2E7BA 4P5TD 5K9QI 4QRAA 3ME0A 3S8FB 3CBJB 4FJ6A 1Q9LB 1XZ0A 5CJ8A 5DSCB 3GBDA 2XBZA 4FJYA 4JLRB 3BAEH 5EU4A 5F9OH 5A1AA 2YRPA 2AJSL 2ZWNA 4R7DB 1TUPA 2JB6A 3K6FA 1QWNA 1S6NA 1BYPA 3SO5A 1V8HA 1U30A 3C8HA 1AZBA 3MJGX 2HT3D 5DMYA 4YXHH 4LASL 4WHYH 3SE4C 5F1NB 2DWYA 4F7TA 3T2NH 5LQBH 1ZVSB 1MVFA 4JK0D 3GSXB 4GPVA 4BELD 5IROD 1OCOB 4HGWA 3U1QA 3GLDA 1QFWM 1L5GA 1N5AB 1Q0YL 4XAWL 5T1MA 5I1EL 2HKFL 2E76C 4PGEA 3KYAA 2ZP8A 1FL5B 2DMBA 2ED6A 3EGSB 2KDGA 4B50A 1R34A 5CEZH 1A1MB 3H7BB 1ITCA 1S9YA 3VRIB 3K71B 2HT2C 2QDVA 1NLDL 2ZPKL 2Q7YB 3L08A 1F6LL 1OAYL 5DRZA 5EOTA 4KY1L 1REIA 4RWYH 1D5XB 1DLFL 3U4BL 1RQ5A 1C5CH 1NSNH 2XZZA 4C54A 4X4XB 3LH8A 4UBDD 1ZIBA 1UTDA 5MI0C 4PJ9D 4XAKE 4H7VA 3E2HC 1ZJAA 4ZYKA 1NWPA 3PAZA 5D7LE 1BVNT 1TENA 1DJIA 5MEPB 3V6OE 5I8CB 5C0IA 3HTLX 4G7QB 1YC7A 4R6UA 1M1XA 3OJ2C 1P4IH 1Z5LA 1XR8B 2NZIA 5DVPA 5F9DC 2NNCA 4AEFA 1FNEA 3IDGA 1WBZB 5JDSB 2HG5B 2JKTM 1CD1B 1S9WA 3GUTB 3GXDA 1BA9A 1ZT7B 4MSWB 1DSWA 1UH3A 2XVGA 3Q48A 2J8UA 3KH3A 5ISZA 4DFHA 1J1OL 4X7TB 4IOIB 3UC2A 4IRJD 5SX4H 4IU3B 4Y4FA 5D1XA 2J5WA 3E3QC 4KKCC 3D4YA 4TQHA 1KGUA 2YD6A 4BSWB 5D9SB 3LKNA 3KYOA 1UM5H 4HS3B 5ESVB 3NQKA 2N0MA 5GJSH 3RUGB 1AYRA 1JXKA 1I3UA 4NQDB 4GEIA 2AGJL 2VLME 4Z7UA 1EBAA 5SWZA 4QRSB 2PABA 5DRNB 1EHAA 1XCQB 4ZO9A 5AZ2L 2X3BA 1IC1A 4PJEE 4XVUD 1GKEA 4RNRB 3QUYA 4Y2DB 3RI5K 5CUSH 5AVVB 3QEUA 1N59B 4R4BA 4M5SA 3CSBA 4IBYA 4NKMA 5J6GA 4DGYL 3P3SA 5JDJA 2YBRA 2FGWH 3K4DA 4HDIB 1DUYA 1AO7E 3MAWA 1S78C 1X5XA 1YEWA 2HJFA 3FCUB 5EO0A 4BQ6A 5I18L 4MQTB 3VXNA 6CGTA 5GXBB 3QUXB 4PB0H 4QRQB 1ETJA 1FYTB 3INOA 1XGPA 2WKLA 5DGRA 4MJIE 3GBMH 4ABUA 4WNQB 4F20A 4R4ND 1N64L 2BFGA 4K9EC 4JCWA 5GSVB 3RBSA 2NTSP 3IF1A 3N43F 4JFDE 3W0WB 2JKXA 1UT2A 5DD6A 4Z6AT 3JWOH 4QTHB 1FN4B 4U3SA 4K94C 2OMYA 4OCLC 2XA3A 2NY4B 2C9RA 2X53A 1W91A 5I1CL 1PLAA 1I1YA 3V5KB 1IGJA 1RIVL 2EE6A 1AKPA 1KGWA 1SM3L 2R2CA 3V55A 1DBAL 5D93B 3W56A 3GKZA 3ZGHA 2LE9A 1Z0MA 1C12B 5FCUL 2ZX5A 2JK5A 1SOQA 2ALWA 3N42F 4HMEA 3TCLB 1BJ1J 1FC2D 3N50A 3VWJB 4AQ1C 5IUSA 3IKCA 1A64A 3QDGD 2FEDC 5C3IA 4YSEA 3GB7A 3CFTA 2J8OA 1THAA 2C4XA 2ESVD 4IMLB 4KVNH 5FF6B 5J6HA 2X09A 1GA2A 1XDTT 4X99A 2AQ1A 1EGJL 3O3BA 2R2HB 1NIFA 3BWZA 4L1HA 1I9JL 4LMQE 5TE4L 3I2CL 3WN5C 2ZOKA 4PRIA 3DRTB 4MCZB 4OCMC 3TN0D 1UKSA 3WSQL 1P5UC 4QGTA 3KW7A 4MS8D 5CIPH 5AOIA 1OAKL 1KCRL 2WZ5A 1FG2A 5ICXB 2XZAH 2Y72A 2AV1B 5HGDA 3FHQA 1ACXA 3B56A 2XN9A 1Q1PA 4QTIH 4BFIA 4UDTA 1ML0A 3KPRB 4G80B 4ODSH 1SUJA 3FB8B 5LHDA 3BWUF 4PJ8B 5EUOF 2MCPH 3JTBA 5IVXE 3F2LA 5IJCC 1PG7H 5IQLA 2CALA 1BVLA 5DJDA 4ZZKA 4HJSA 1FVDB 3UEQA 4QCIB 4CC4C 4MCNA 3NRPA 1VZIA 2V33A 4JFUA 3B7UX 4ZT1A 3NN8B 1OF0A 2FT8A 5H37H 5AAWA 4N0CC 1JTOA 1X7QB 3QRGL 1ZHBA 3N85L 5FYJU 5FYLD 1HILA 1QBLL 2PYEB 3KPSA 4JN1H 3KL3A 4ZFOA 4FA8A 1F4WL 4KTDH 3KNBA 2DPKA 3AXLA 4HG4J 2JH2A 4MKMA 1RPKA 4URKA 5ID1B 2JMRA 1SZNA 4E5XA 3CBKB 4JRYB 1P7QD 5C0AD 5JHDE 4FFYL 3DMMC 4IJ3B 2WLLB 5DWPA 4TLSA 2QPUA 4D0DB 3IEAA 5HGHA 3ZE2B 1PKOA 2VXQL 5DQ9B 5I8KL 2YGPA 1JZJA 1XCTA 3WE6A 2F5BH 2DYPD 3EYUH 1ZVHA 2GUYA 3BHBA 3FU6A 2DKMA 5F1NA 3B6SA 3IRPX 1ZVSA 3ZDZB 3OKKB 5FWQA 4FQXC 4KFZC 5MERA 3U82B 3QDGE 1YQ2A 2WWKT 4M7ZB 3FO9B 2F58H 1KTCA 2ESVE 1XVSA 3EDFA 4PJ7B 5DHXB 1FZMB 3DTUB 4AK1A 1XD0A 1WLHA 1RUPH 4QRPE 4XI5C 4JB9L 3H7BA 1U8HB 4PRHD 3AU1A 2YOAA 1ACYL 1I7ZA 1WA0X 2CR0A 2ZKHH 3NT0A 3QGVA 4HKXB 5DUBA 5IMMB 2FLMA 3K71A 4HCIA 3L3KB 3REWB 1FV1A 2IADB 5LAXB 4DIXA 5HD8C 2CO7A 2C1PA 4PWFA 1RU9H 4LCCB 1JGIA 4X4XA 3ZL1A 4JO8A 3HG4A 4F7KA 3QH3B 1FNGB 3ARDC 3D8MA 3UMTA 4JFEE 4N5UA 3OKOB 2ATPA 3RURA 3IU4L 1E28A 4G1MB 4ZX4A 1O6VA 3D85D 1TMCB 1UUNA 2AJXL 2X9XA 2WVVB 2ZSVB 3O9WD 4GSQA 5ECJE 3RHWK 5TFSL 3LRGA 4ODWA 5C1MB 2YC1A 3L17A 2AJZA 3QWRA 3UIZA 2A74A 1BAGA 2VDMB 4XO5A 5KYNA 4AYGA 2LLGA 1ZT7A 1CZ8L 5KSVA 3WFBL 4WFEE 1OXYA 3UTTB 4DN4L 2EKJA 5C0FB 4IOIA 3G5XB 5FYLE 1QLEL 3VO0A 1CL7L 1IKNC 2WXOA 4FQQA 4GKLA 4IU3A 3IFPA 2WN2A 2RBLA 2NNXA 4X6BA 3HR5B 3QIWD 4CNIB 5TD4A 1RXLA 3V0AC 5ACZA 2B59B 1KXHA 2BCKA 3HPJB 4HUXB 5IG7B 3JV0A 1B0RB 4BSJA 4HS3A 4ETQB 5JORA 1T04B 4IIQC 1AJ7H 3U1SH 4G59C 2NNFA 3RUGA 5B39A 2Y6SC 5C92A 1EHNA 1A3QA 2P28B 1HL4A 2WGNB 3BGMA 4I1PA 3VXRA 2XJLA 5JLZB 3EFDH 3KWWB 1WZ1H 4Q6YA 1R9FA 1IB5A 4ZFFB 4Y2DA 4G9FA 2FE0A 4LPUA 3POHA 3N9GL 4PLJC 4MB5A 2G3NA 1OSYA 4NO3B 4AYBA 5L2KD 1SLUA 1SJEB 2UZPA 1YMMA 2R0ZL 4ZJ9A 1H15A 2HKHH 4UQ2B 5FOJA 3ARBA 4JJ5A 5C08A 4KI5C 3C5XA 3CHRA 4X5PA 2HH0H 4X6EA 4ZW6A 2EQDA 3GMNB 3ECVA 3CN4A 2Z92A 3EUDA 4NQED 1T6BX 3CTTA 4PQXA 4OI9A 4YN3A 1XBDA 1LYQA 3QZPA 5E95B 3EFOA 3W0WA 1GC1C 4OCSL 2HWZH 3EG9A 4FLRA 3POCA 3MOBL 5B4MC 3FFDA 4YDKH 3FQNB 4O9HL 2AFNA 1NC4A 2Z9TA 3MJ7B 3IFNH 1NIDA 1YVLA 3QDJE 3U46B 1XF3A 1M3JA 1ZE3H 4K2UH 4EUPG 2BWDA 3RNQB 1UCBH 4I7ZC 4G11A 3EYFB 3TO4B 4JFZH 4LFHD 2VAJA 1ZHNB 4TOYH 4OM0L 3QC5X 3WFDH 2V37A 3SKOA 3LSOB 1S7RB 4TN9A 5JW4Q 4EZJA 2W8CA 3F12B 4TULL 3CZSA 1DJHA 3VWJA 4WI9A 2EE9A 2WVUA 3Q2CA 1MHHA 1NCTA 2ZF9A 3PV6B 1Y6MR 4RMVA 2YRBA 4YSOA 2A9NL 4WV1B 1D9KB 3LH9A 2CE6A 2YEZA 2Z6FA 3DO3A 4YXKL 3GSWB 1ZY9A 2R2HA 3QISA 1IAOB 3TL5A 3AROA 5DD3L 3D18A 4XXWC 1RHHB 1E9PB 5E6IC 5HYJB 4J23A 3FO0H 1MAJA 2Q3XA 1QSFA 2W0FB 4M3HA 2AV1A 5DFWH 2UXVA 4B9PA 4RLDA 2XWTB 4WWID 4PN6A 5AW0B 3GD1C 4G80A 4XMLL 3EYVB 4PJ8A 4FQ1L 3G6JF 3G3LA 4I4WA 5B8CC 3ZYIA 1GXEA 1Y0LB 3KEHA 5K1JA 1Z9OA 4BUHA 4B9ZA 5FXCH 1VERA 3H42H 5IB2B 1U8MB 4B97A 2VLKD 3QE5A 2EDFA 3WKPA 4B5ZA 1GAFH 3EOAB 4EDXB 4JZNA 5L2KE 1IBZA 5DR5L 3D4GA 4MNGE 3HS0C 5HHNA 3Q8CA 4YPGB 2FBJL 2X44D 4M02A 5L0QC 3X14A 2D3VA 1A8ZA 3MDJA 4RFOH 5JPMC 1OK8A 2F19L 2F8XC 3ARUA 4NQEE 4PTUA 4PV9A 4FXKB 5DF0A 4PS8A 5GS3A 4JRYA 3X1NA 5I76A 3HUJF 3K2KA 3V0VB 2ODIA 2AXFA 1KDJA 3QIUB 3QIBD 4OFKA 3BDXA 3P02A 4D0DA 2R23B 1J88A 5E2WH 2Z7UA 1DQLL 1Z3RA 3QI9A 2JXMB 4LRIA 3F01A 5EIIG 4GMTH 3TURA 3DV6B 5FLVA 3MV9E 4ODVH 5TJWK 4XVJH 4BZ2A 3UYPB 3V9FA 2UXGA 1LK3L 2HXAA 3N06B 2Y0SA 5H2BA 2P43B 3DSNB 4TSBH 4YMPA 5DTFB 1ZK5A 3OKEA 3ML9A 3K4AA 4LP4A 3S36X 3PNWB 3TBBA 2H8PB 2BWQA 1IAIM 2I5YH 2VXVL 3C6SB 3JYBA 3PUUA 3SDCB 1ES0B 2XICA 3WTXA 1CN4A 1JK8B 2J88H 3M1CA 2CCLA 2K1MA 3VI3A 1WE5A 1XAKA 4H1LA 4OGXL 1GSKA 1XHHA 1AHWA 5EU6B 5ILTH 4GO6B 5T5NF 1NCAL 5KYYA 3FHEA 4DGIL 3H3BC 1U8HA 2VLLB 3VFUB 1IGMH 4WWPA 1FH5L 4YHNA 3DROA 2Q20A 1IAKB 1MCOH 4OD2A 5D4IA 1ZWIA 2WAHA 4LCCA 4YAQB 4CBZA 3NEEA 3RAJL 5I6LA 3ARGC 4X8JA 3TBTA 1FFNB 3QH3A 4MWFB 5HDWA 3LQAC 2DI9A 2WLMA 2A77L 2YPLD 4N2NA 4WEBH 1CK0H 3JTTB 5SWSB 3ULUE 1MG3C 4DCQB 5DEFB 2MEJB 1HU8A 2ZSVA 4QTFA 2GBTA 3WFCL 3L16A 5DWUH 5DQDH 1NUDA 2C3VA 4AIOA 1UWGL 3SD5A 4R3SA 1F45A 4JDVA 5TPWL 1NDGB 2G0LA 1AD0A 3UTTA 1U36A 4YX2L 3WUZA 2YAEA 3MXVH 4NHUA 2IANE 4AEIH 1OAXH 1PD1A 4XPTH 1JWUB 1OPGH 5HDQL 2W60B 4UILL 3VXSD 4E9VA 1B9KA 1IQDA 3CXFA 2H6PB 1TJXA 4Y2NA 4HUXA 5B1AB 5GS2H 3PIQB 3HRZC 3OM3B 1I3GH 2ZONA 4UZUA 4W9HC 4F3FA 3NMEA 4OZFH 4E0RA 5BJTA 4U3HA 3DO4A 4KHTH 2DI8A 2NR6A 1K8IB 3IXAA 3UBHA 1KXVC 2CHXA 3D5OF 1UUSA 2WLHA 3M17B 3BWSA 4FNQA 4UNUA 4J5VA 4LU5L 1F90L 1RUKL 2ORBH 2VDOH 1F4XH 4UQ3A 1DQMH 3V8CA 4IHOB 4H2CA 5EEXA 2ZNWA 1ODUA 3H6JA 1SBSH 2AITA 4YVNA 3WFEH 5ENWB 1EO5A 3UBXI 1AD9A 4WW2F 3S37X 3X11A 4GP8B 1TVBA 1MHCA 3APCA 4KJWC 1DN0B 4ZXBC 3MJ9H 43C9B 1G7JA 4LVNB 1VB9A 4N0UA 4Y1AE 4YSRA 3PXHA 2KHAA 4E41D 3O6LL 4M8QB 3K7UA 1H0DA 2CNZA 1D5BB 2TAAA 5CBAA 5JNYB 4PJEF 3FAXA 3FQNA 5B1BB 2FJHB 3KBEA 1HHJB 3QA3A 3GMOB 2VDPB 4NYLA 2G0KA 2DM7A 5F44A 2P46B 1F3DH 5G4MA 3RNQA 1EDQA 1UKTA 3EYFA 4KQ4L 3LEVH 1A6ZB 4K23L 1ZHNA 3UG4A 3BQUD 5LBSA 4C58B 1XEUA 1QQDB 3U0TA 3FT3A 4M4RA 2NY2C 1OGAD 3O6KH 4BKLA 1S7RA 2FX7H 2L4OA 5DO2C 5DLMH 4OJYA 1F3JA 1HL5A 2UX6A 1TCRB 4K3JH 5EO1B 4C83B 1P7HL 3IVKB 3KPTA 4HUWA 4ZTEA 4ZODA 3ZSTA 5JQHC 1PZ5A 3ZHLA 4WV1A 5CIPB 3RDTB 1ZGLB 4YSCA 1JF1A 3GSWA 4J3VA 4BYHA 2A83B 5HGBB 4OZGB 5AB2A 4H25B 2VGLM 5JOPD 4Z8FL 4WTZA 4AM0A 4L1SA 3CFMA 1JYNA 4LOEA 2MH4A 4JQXC 1W0VB 4U6VH 2ZKMX 1CU4H 4P9HH 4BE6A 3GK8H 4M5TA 5BOZG 1MXDA 3COOA 5LXGL 3EOBA 3IDYB 3LQAL 3WIIH 1RI8A 4BFFA 5AKVA 1Z5HA 1EFXD 3PUCA 4KXBA 1J0JA 1U8JA 1HQRA 2MQ0A 3HNTH 4S11A 1KYOJ 1BM7A 1JIBA 2IFFH 1C16B 2UVEA 3FQTB 2EDWA 1QATA 1Y0LA 3EZ8A 3QQ4A 5C0DA 4P4RB 1PW3A 4K5OA 1FZOB 2H41A 2JTYA 1ZVNA 4FKKA 1U8MA 3PWUB 4PR5A 1Q9KB 3TXAA 3MJ6A 2EXSA 4LVOB 3WS3A 4EDXA 1A2YA 4HZ1A 4GOSA 1SY6A 1XR9A 3GJFA 3NIGB 5D2LA 2ODHA 4LLMA 4HJIA 3LAFA 2FVNA 1A6UH 3GRBA 5IHLB 3KVQA 2XWZA 2YD2A 4HUUB 3W57A 1CDCA 5E23A 3FTGB 5INDB 3HZMB 1FE8H 2BC4B 1IGFH 1GW0A 3F62A 5DURD 4N5ED 5B1JA 3MRPB 3ZK0A 5GGTL 2Y7QA 2DLEA 4FXKA 1MSPA 5IVXF 3TJEL 4I3SL 4TYUA 3LN9A 3GSUA 4E41E 3CFCH 3SDDB 3V0VA 2D7TL 5E7FA 2WWMD 4HWZA 4BZ1L 5DD1H 5EC1B 1LEKA 2NNRA 3B9KB 4CU7A 2AQPA 5GRXG 1JZ6A 1C08B 2E7LC 3VFTB 3UYPA 2VN4A 4EQ3A 5F3HB 5EEZA 2G4EA 5BVJA 1OGAE 3T0EB 1OTUC 4LLWB 1HX0A 2CLZA 3NSDA 4JFPB 2ZSWA 3G5YA 2AEQL 2FH8A 1U3HA 2B0SH 3CSFA 4GW1A 3CDZB 2PO6D 2NSXA 1JPTH 4XHQA 4HUVA 2ZE0A 2PXYA 1G7MA 5DZVA 1I1AA 1J8SA 4RDQG 5AVQB 2FRGP 2NLJB 4JL1A 2N59A 2OV0A 2OTUA 3QXDB 4JPWH 2VLLA 2WQVA 4GJTB 3U79A 5JOPE 2WXFA 3LVEA 1I1RA 1UWYA 5IB4A 7PAZA 4P2OB 4KVCH 2QBWA 1AGBA 4XOCA 1GL4B 2VUOA 3V0DA 2R39A 3SCMD 2CO4A 5CCJA 2X70B 1FIGL 4FN0A 3SOBH 3BCFA 1IE5A 4UQBA 3SKJL 1IGIL 4OCYH 4HEPG 2GFBB 3H3KA 2H3XC 5A7BA 5MEND 2IGTA 1C9SA 4F33B 1J1PL 4G6AD 1M05A 5IJVB 5IB1B 1IBYA 4S0SD 5PCYA 1FPTL 3BP5B 4DCQA 4W9KC 3HLAB 5ESQB 2NY7H 4WWKD 1DVZA 1JYWA 2GTZB 3EXLA 1CDGA 3ZTCC 2HP4A 3CFDB 3QCVL 4MAYC 1LHZA 4HW6A 2QTVA 2ZUUA 3PAVA 4UQDA 1DUZA 2I85A 3C60D 3PGFL 3MTRA 1BIIB 4JR9H 4JN2B 4KPHH 1KACB 1JPGA 2YD4A 2AEOA 1JWUA 1I8LA 5CP7B 1FAIH 3JWNE 5IEHB 3VSTA 3NJIA 4RDBA 1BF2A 2UUDH 4GRLA 4WWNA 1LVEA 3DGGB 2PPDA 4FL4B 5T1LA 3H4FA 1GMEA 1OSEA 5EU7E 4ELKA 1ZIAA 1UADC 2X4TB 4MAUH 4WCYH 5AOJA 1PNCA 4UM9B 5I1AA 5IF0B 1DVFB 2IWFA 5KUMA 5FOBA 5HGGS 3SGEH 1GYUA 4GLRI 1JV5B 5ADPL 2FNWA 3E9TA 4JRXE 1DR9A 3ZX1A 4ANUA 4FG6D 3PDGA 5EHFA 1QFWL 2FIKB 4WHTA 4O02L 5I6KA 4J4PD 4KX8A 1U0QA 2X4NA 5DVKA 3D39A 1L7IH 3X13A 4PBWD 3NH7L 1FQ9C 3U9PL 1WD8A 2W5PA 4U4BA 3I02B 4OZHB 4F15B 1AQMA 1QA9B 2DI7A 5J89A 2Q1EA 1KYUA 2QADD 1BV8A 1G7LB 2LV4A 3MRFA 5EF2A 4GXUM 2NXZB 4S10A 3TVMC 1R19A 1MWOA 4HWEL 4IKJA 4K73A 2A6IA 1MJ8H 4D9LH 1X9QA 4F8NA 1FUNA 5FUZL 3VQ2C 1BSIA 2K9FB 3KWTA 1MQKL 3IDMA 5BUGA 2BRQA 3RX5A 5DJ6B 3V5DA 3I9PA 2HRHA 1DJGA 4NN6C 3HE7C 4L4TA 4UM8A 3CVDA 1EVUA 2RFXB 6PAZA 1PSKH 1E7VA 3U7WL 1CBVH 1RV6X 4ZO6A 4NQCD 4YDMA 4XPBH 1JDAA 2OL3L 4XXCC 5HGBA 1RSYA 2KBGA 3MGOA 4OZGA 4H25A 4QJ3B 3KWUA 3I6SA 3P3RA 4OSUH 3OWEA 5T3ZE 4PSPA 2FX9L 5BOPA 2AXWA 4AT6A 1H6FA 1H6UA 3L9YA 1P4BH 3ZKNC 3B83A 5IMLA 3FQRA 1RUMH 4O2EA 4YK4B 3ZE1F 3ULUL 4APQC 4OLUH 1YYLH 3A22A 3B1UA 1ADQH 1D2PA 2PW2A 4HT1L 4M1DL 4MD5B 1QEWB 3F6IA 4EN2A 4HKBA 3MBXL 3LNFA 4N2FA 1P69B 3BPOC 1EZUA 3BSZL 1F0LA 4ZFQA 3KXFA 4P4RA 1TJGL 2FT7A 4NRZA 2ZG2A 4JCLA 1ZA6A 4NM4H 3S2CA 4ACTA 3IAGC 1PZUB 3SQBB 4QRTA 3IJSB 1SF5A 1VFUA 4DPRA 1DQDL 3FQYA 5LNGA 2EZ0C 4Z7VB 4BRVA 1U93B 4L3FA 2DZEA 3DJRA 3IMUA 3LKPB 1VACB 3FN0H 3B2VL 4W9FC 5KJ4A 5LB1A 1A7NL 1I8MA 1G7IB 3DIFA 4OLXL 4XC3L 1HZKA 2BC4A 4PYGA 2E27H 2ZWYA 2VQUA 3O4LE 1CF1A 2CDEB 3U25A 4UMSA 3CVCA 3D05A 1RZFL 4TLTA 4U7KA 1HI6B 2BNUB 3T2PA 1AGDB 3LKOA 3L13A 4NZTL 2ROXA 1OWWA 1I85A 4HEMA 4HCRA 4R0LB 3QT2A 4WSJA 1M7IA 1Q0EA 3C8KB 1G0DA 3QS3A 4GAAA 5GGRY 4Y4FD 3BKJL 2IXQB 3B1TA 1KWGA 4M1GH 1F4HA 5IR1B 1MDAA 4JW3A 1HE8A 1J0KA 4OF5A 1C08A 1RUQL 1TTCA 4OJFH 1MLCB 3LQZA 3W37A 2DQUL 4OIIH 4YHLL 3Q8EA 2OI9B 5D72L 2EE0A 1SYVB 4I9WD 3F85A 4JFPA 3DWTA 4H8WL 2DTML 2Q8BH 3QUYD 3ULSB 5CMAB 5IVNA 4NQCE 3DARA 4IRSC 2AJUL 1AKJB 1TNMA 2MPAL 3QXDA 1SGKA 1RPQA 3K2MC 5C0EA 1FP5A 5CLYA 2W9LA 1GY1A 1ID5I 4PUBH 2FWOB 1R6VA 2R83A 4ZMAT 5K69A 1ZTXH 4N4YB 1OB0A 2WLNA 4L8CB 1UB5B 4PGZA 2R9HC 2WNXA 1WVZA 3MCKA 1U8IB 2B1HL 1CCZA 3G5ZA 2IOOA 1HVXA 3CUPB 3L7FA 3NEOA 4M7LH 1BOYA 2J6EA 4N0YL 4F33A 5MHSE 1YSOA 1PYWB 1YNKH 2YXMA 4UT9A 2JKLA 3S5LB 2J20A 2XFGB 3WYRA 3SE3A 4BHUI 3D7PA 5JHLL 1PIGA 1U21A 2ED9A 3QULB 3B2UD 4PW3A 4OUUA 4U6TA 4AYMC 2OQJB 4WTXA 4LEEA 3RY5A 4KVPA 3IJEB 4MXWH 5BVPH 5I9QC 1CFVL 1QZNA 3VDCA 3NSCA 3GSRA 1ETA1 2X6BA 3NFSH 3BT0A 2GTWB 1AGCA 1YEEH 1I1FA 1M56B 4D7BA 3NZHL 1L9SA 3H1ZA 3ALXA 4XZUB 3FZUD 3MV01 2F0CA 4P05A 4E9SA 1N6QL 3QCTH 4JPVL 4OZFB 4QRRB 3OSVA 1NBZB 1T6WA 2DQIH 3JWNC 1SMAA 3O81A 4AVIA 2MWCA 5H94B 4H1LH 5LG6A 2YAPA 3V6FA 1CLOL 3ULUF 2E6QA 1MRFL 1OL0A 3DGGA 4PRID 3GPEA 4X2UA 5D4QA 5EU7C 1JYXA 4XMVA 4GP5B 5F70A 3ZZ1A 4Y5YB 4M48L 2L7EA 2X4TA 3KCPB 4MNQE 2XPGA 4NRYB 4PTTB 4ZRGA 4UOW1 5DZPA 1A7QH 1AIFA 1FAKT 1RMFL 2D8KA 5I0XA 5D7HA 3P0VH 1WK0A 1GZPA 1JV5A 2XN9D 3MRGB 3OR6A 2VJ8A 4M56A 3SYQA 3VU1A 3M7FB 1RLWA 2FJGB 3M6DA 3BUTA 3C2AH 4CKVX 1THCA 3AVEA 3NAAH 4XPGL 1DCEA 3X3GH 4JFVA 5DD5L 1WUZA 2XVKA 5LKNA 4FG0A 3FDWA 1E3XA 3P4OB 5HHMD 3H3PH 3U7YH 4O51B 1WV7T 3O41A 4HLJA 4F37F 4RGMB 5IW6A 5LAPA 2X1WL 3V52L 4YWGH 5IT2H 1E4HA 2BWIA 4LSSH 4WQOA 1DJYA 2YD9A 5CZXD 3QJZA 3SGDH 3K8KA 4YR6B 3D06A 3ECBB 3T4AC 1CICA 3HJEA 3KPSD 2G5RA 5I1DA 2WLIA 5I71B 4HIPA 3RJQB 4DHLA 2ITCB 5I16B 2GITB 2YD7A 2NPLX 1T66C 1WA1X 2C4FU 1DL7L 1TT6A 2PLTA 4PJHE 1QTPA 2YSSA 2X4UB 5KSBB 2EIDA 1HSAA 2Q8AL 3D0VB 3UJIH 3RL1A 1F5WA 3U4AA 1JF5A 4DW2L 4FA7B 4FTVA 3B37A 2BIIA 2Q6WB 1F3RB 5BZDB 2NY0C 4Y1TA 1WCBA 5D70H 4ODXB 3WEXA 2BW4A 5J57B 4HH9B 1HAWA 5I66A 1PU0A 1QSVA 1BVZA 2WXQA 4G6FD 4YHYC 3HHSA 4NKQB 2QSVA 2AXHA 3BP4A 3IETB 5IB5B 1E43A 4TV3A 4F7MB 1ZA3B 2WBJB 4F2MA 3CZJA 2EVIA 1MIML 4CILA 1RUAL 2VCOA 3BE1H 3PHSA 3PJSB 2B7DT 1D6EA 2CSPA 3UZQA 3WKQA 5ID0A 2WTOA 5FKAB 5KEZA 2PTVA 4GFTB 4X5RA 2C9AA 3P69A 3VSQA 1M7DA 1ILSA 1KGYE 4HIJA 4W81A 4M9PA 1BD2E 2IBZX 3ILPB 2HPTA 3WN6A 1G7HA 5A6LA 1FL6B 3O2WH 3O0RL 1NMBL 4CU8A 3SQBA 3MHZA 4FXTA 4XN5A 4Z7OE 2LU4A 3CVHB 3U9UA 1E65A 3VXUB 4I18A 2PR4H 5T1KB 2NUTB 4M7KH 5E8PB 5C8JB 3LKPA 4Z95L 3KS0J 1VACA 3HE6B 3MLPA 1G7IA 3HOGA 1KN4H 2ZAIA 5HHME 5E8EB 43CAA 2YA2A 1W6WA 3TEWA 2CDEA 3QWRD 3ZW3A 4N26A 4HK0B 3H9SE 2BS8A 3VSUA 5BMFL 2V5YA 2DL2A 3L95A 5TDNA 1WZMA 1CYXA 2DD8H 2A6JA 4FFWD 4MB3A 3BP7A 1CGSH 4NUGH 1NPJA 2P26A 4ZS6C 4QOKE 2BIMA 1SFHA 5D1QC 4C4KT 4ANXA 4JE0A 4NO2B 3F7PC 3IGLA 4JO1H 1MAMH 5IR1A 3SDXA 5FYKD 4LNRB 1WC7A 5FO7B 3DK2A 3VFMA 1QSZA 3N04A 4XCFH 5E1HB 1Z9SA 5FLUA 2A4EA 4ZUWB 2ARWA 4MHHG 3I6GB 3F58L 4G8EA 1XO8A 1XXDC 4TUOB 2Z3FA 3PHQA 2HJLA 4WI3A 3UTQB 5HYFA 1AS8A 4Y2DD 3ULSA 4G9FD 1OM9A 1NGWA 5JIPA 1E4XH 4HX1A 4RMTA 4GQ9H 5FHBH 2BW5A 2RCSH 1AKJA 4FXGB 5ABDE 1HXYA 1TOXA 1YMMD 1Y18B 2IO5A 3QAZB 3ARBD 1MG2C 3AQYA 4KUZL 4H26B 4ZMVA 1JBJA 3O6FC 1IM3A 1KBGL 3HN5A 5KG9B 4AC4A 2FWOA 4ZS7H 5GRVL 5I28A 4NOFA 1IBFA 2O5XH 5F93C 1JP5A 1IBDA 4N2DA 1BFVH 4L8CA 2HMIC 3VXMA 2WY3B 3AITA 4PGBA 5IK3B 5AKRA 5D6CB 5C3LD 4KQ0A 1TQUA 1HCYA 2GSGA 3H9HA 4LEOB 3W0WD 1XQ4A 2A9MH 3A6OA 5ERWA 3JWDL 4QIRA 4NN5C 3SOTA 4YHZL 2CLVB 1WO2A 5IWLA 5C07B 1OZTG 2NY4D 1JGUH 3FPYA 3S5LA 3T2QA 4NXSA 3WY2A 2KQMA 2WVTA 2CR3A 5H37G 4LCVA 3VCLA 4RBPH 3QXVA 2OQJA 1OP4A 3U0WH 1DEEA 5T3ZL 1DVTA 3MRRA 3H54A 4YFEA 5HDRA 3NSFA 1VEOA 4R96B 3HC2A 3TT1L 5SX4I 5IBLD 5DRWB 1BZQK 1HOEA 4MA8H 4XZUA 2EDNA 4PJGB 3VWJD 5DHEA 4ZW5A 5FUOL 2CQVA 1X9RA 3S96B 2VL5A 3PGDB 2AANA 5DDHA 3WNLA 3JV4A 4AL8L 4CMMA 3L48A 5I74B 4A2EA 5G5DB 5F9AC 5HJGA 3UDWA 4ZMNA 5JIKA 3IGAB 1D7CA 2W0KA 4OLZH 4PRNB 4JM2F 4ZMWA 2UX7A 4BK5C 1J5OH 3UJTL 1MEXH 4HIXL 4HFUH 5DJYB 3DVFA 4FZ8H 1CURA 1FNSH 3DI2B 1G9MH 1QSFD 1LO3H 4DUXA 1AH1A 3P0YL 5CN1A 5D7JC 2GJRA 5I1JL 4WNJA 4UINH 3BIKB 1J8HA 1I8KB 1XTLA 3SY6A 4WI8A 2Z4QA 1Z3GH 2FJGA 4JPIA 1FBIH 4PMFA 5GISH 5FO2A 1IAIL 5FA3B 2UZXA 4KNUA 4M5YL 4PJ8D 4MVBD 1IBHA 2KLSA 5EN3A 3RWEB 4NQDE 3SDYH 3ZXAC 5E9DA 5E2UH 4QHNB 5JXEC 5LGKA 4WNSA 3N40F 1BZ7B 4KXCA 4Q58C 1NAML 3HBGA 3EYQC 4JY6A 4O51A 1ODAA 2DWSA 3JZ7A 3LHPL 3MODH 2BDNH 1GIGH 4I0PC 5JW5A 4P8QA 4HFWA 4PW4A 4Y19E 1AZNA 2VC2L 2B39A 3T0WA 1FYTE 4B95C 4CMHC 4WHCA 1SBBA 3U2IA 4K71C 3VXQA 3C6LC 4MMZA 5K9OB 1CLYH 3EZJB 4HU8A 1HC1A 5KVDL 1QNZL 3F7YB 2YMOA 4JY5L 4JRYD 2Y2WA 2WJ7A 2R2EB 5T5FA 2P5PA 3NFPB 3X1FA 4ADGA 2ICWA 4DPAX 2ZUXA 5KSBA 3KDMA 4TNEA 1KEML 1ED3B 2AHIA 4AENA 3QYMA 4AIXA 3GLAA 5IEKB 2Q6WA 3HC0B 4BCYA 1UM6H 3BVVA 3WXVH 4B9JA 4QHUB 1L6XA 4K9EH 2VMJA 4KO6A 3PWJA 2VDQL 5DHDA 4BFRA 2C1OB 1MELA 3IFLH 3IN2A 4FNPA 2XTJD 5J9PA 4K94H 4XCNA 4JQIH 2WOYA 1GGYA 4TUUA 4TM9A 1E9OB 1DYZA 2EP6A 5IB5A 2DQJL 4PY8J 3EJCA 1H3PL 2OMZB 4EIBA 2AK4B 1SDYA 3TYFB 3S5YA 4LGPB 1SRDA 5F9WB 3KYNB 2VW7A 2W59A 3LB6C 3WJMA 1OARH 4I1RA 2WD0A 5F8QC 3TX4A 1N4XL 4LHUA 4ZQKB 3IDUA 4X7SL 3S0PA 4FQ2L 3SODB 3ILPA 3MLSL 5EOCH 3A3YB 3HG1B 3BJLA 4P57B 1F58H 1FL6A 2F7IA 2ITFA 5CJOH 1B0WA 3TJHC 1JI1A 3FN9A 4NJ9H 3V0EA 1CR9H 3KPRE 1J5DA 4ALAH 1K5NB 3IAPA 3WGVB 4KC3B 2NUTA 1GYAA 5E8PA 2B3RA 2CGZA 5C8JA 3M8OH 2WQSA 4O00A 4H88H 3AY4A 4L3EA 1GCFA 1ZGLM 2ALAA 1MFEH 3MLZH 3DURA 1RZKC 2IDTA 4U1LB 4QI3A 1HWGB 4RFNB 3EGDB 2J1KA 4XPFL 2B3IA 3CC5B 3HCVA 3WO4B 4XVSL 2HLFD 2CO6B 3UTTD 2DWXA 1A6AA 1XH2A 2KYIA 2ARJQ 5D71L 1LMIA 4AV0A 1N70A 1HEZA 1ZV2A 4WTQA 2PYEE 5C9JA 5GS0D 2BSCA 1ZS8B 4P2QE 3SBWA 1B6UA 4NO2A 2QQKL 3RWFB 3QDMA 1ETZB 4R84A 3UC0H 2QV2A 5FO7A 5B7EA 1QO3B 5AVZB 5HYSA 2RACA 3E6FA 4RAHA 2F53A 1BXXA 3L7EA 4ZUWA 4AKPA 1BP3B 4QYOB 2VSKB 1VENA 1EMTH 5IREA 3CXHJ 2BX5A 3A6CL 4E9LA 3OPUA 4IBWA 2NR6D 3ZE2E 1A3ZA 3UTQA 4YGVA 2VIRB 3RIAK 3IDIB 5CJ5A 2VABB 1NLBL 3SQOH 2BCMA 3CPLB 2MHAA 4TVPD 4FXGA 2OZ4L 4G3YL 1Y18A 4JO2L 3BKYL 3U36A 3BP6A 5KVMC 2X4SB 3OG6B 1HKFA 3ZDZE 4H26A 3MCG1 2CPUA 3NGBB 4UIKL 1ZANH 2YUVA 2WNWA 4IQHA 1LDSA 1H9VA 2EDEA 2Q3ZA 1N0XH 3VGBA 4A6YH 3STZA 5TQ2H 3EOTL 4AEEA 3MBEC 4XP1H 4K5NA 2FR4A 1IV8A 4ZG1A 3RJOA 3GS4A 4PJ7E 5D6CA 4AQOA 1BBJA 1VLXA 1BYNA 4L48A 2JTDA 2BNQE 4PRAA 2C3HA 3BOVA 5E1AB 2PWEA 4XWGL 4DKEL 2I7OA 2F7OA 1X4XA 1J05B 1M6OA 2OK0L 2QL1A 1S9VB 8FABB 4FQLH 1OT2A 1JZ2A 1IILE 3TO4D 2ZF8A 2YFNA 3OHXA 4HLZH 3VFPB 4RFEA 3VYNA 3PL6A 1J5HA 4KKAC 3BSHA 4WZ9A 5ABZA 3EDJA 4G1EB 1G9HA 2GUOA 1Z32X 5DRWA 4DZ8B 2EVJA 4UTBA 4KAQL 2H0JA 1E6OL 3M1BB 4PJGA 1A9BB 2EVGA 4HJGB 1F8TH 3UCQA 4P9ML 4TUJA 1D9KD 5DYOB 3GIVA 1OIOA 3MRJB 5E2VH 1GSMA 4KNQA 1A02N 3C5SB 3SE8L 5EU3B 2VLRB 3RGVC 2ARJB 2GT9A 5EPMB 2YA0A 5IGXH 4ORGB 4PRNA 3D50A 4U6YA 3GMPA 2ED7A 2JKWA 1WQVT 2R7EA 2XQBH 4HMDA 5FV2A 2E7LA 3CLEH 4K5PA 5HYJD 2OYMA 1PZ2A 5TTRA 4GB9A 1F41A 4Z7WE 1M42A 3ASWA 4R9HA 4ZD3L 3RA7L 2AZAA 3ZL4L 4ONFH 2VXUL 3PP4H 4P4KC 5IM7B 1TPXB 4Q52A 1A1NA 3WCYA 5L9DL 1OE1A 1X5HA 1HQ4B 3WIFB 3FJTA 3HC4L 3N0AA 4AQAA 4BFKA 5GGUA 3X12B 2V3FA 5SX5K 2XZCH 5DHVH 4HIIA 3C08H 4GRWB 2B20A 3AWFA 4I0CC 4K7FB 1T5XA 4KRPB 4DGUA 1BZ7A 4OF7A 2W9DL 4EBQL 2ENPA 5AB1A 5C0RH 1WBXB 5DHYB 3WMSA 4OCRL 2B4CH 3MLTA 3S5ZA 4J1UB 5AW2B 3MUGA 4BH7A 2FNBA 2GSMB 3ABZA 1H5BA 1MCPL 2WMPA 3G7TA 5EU5B 4DKFH 2B1AH 1FHNA 3EOYG 3VMNA 4UZGA 3TBWA 3L3OB 2FLBT 1BLIA 5F71A 2W0LA 3N42B 3RPBA 1NGYA 1IJNA 3RGHA 3MRMA 5ANHA 1CFSB 4MA7L 3IGKA 1Z6JT 1KGIA 3F7YA 3MNVB 2X9WA 1HESA 4P59L 2CBQA 1E27A 2P5WB 4M5ZL 3CJJA 3ILEA 3QIUD 1DQKA 2HT3C 4E9YA 2A99A 3TH4T 1PG7W 1ED3A 2FJSA 3QQ3B 5CP3A 3S5LG 2BP8A 5GHWL 4JG1H 2YLKA 4XNQB 2FX8L 3T6QC 3MA9H 4HV8A 3OXSB 3NA9H 4HS8L 4QHUA 3BI9X 5KVEL 5E24E 2XKSA 1T6VN 2CM6A 4IM8A 5EIQA 1U9KA 1GC1H 2JCWA 4OFVA 4Q0XH 1MJ7L 5F1OB 5K9KB 1BAFL 1FLRH 3QG7H 4PRPE 1OTSD 3L2MA 1AFVL 1UD6A 1U3HD 3DO7A 3KW8A 4KTGA 1E4KC 4OZFG 4Q9RL 4WK2B 4PJHF 2QHLA 4PJ6A 2E9GA 2FUQA 1ZOXA 2UZIL 2X6UA 4GG8B 4L18A 1TFHA 3BYYA 2LAAA 2VSDA 4IS6B 4AITA 2YA1A 4EI6A 1AZRA 5G2NA 2QR0A 4UBDC 3U6RA 1BQUA 3UJJL 4GSDL 4PJ9C 4KK8D 4O58H 4D3CH 5HYJE 5C71A 3NUKA 4PJ5A 4JKKA 1A6TA 5J12B 1OD7A 4J6RH 1A3LL 4FMVA 1TSRA 2VZ3A 2WANA 4NENB 2VDLL 4L0PB 3AREC 1JWSB 4N2GA 3LJ3A 2VTFA 1OHQA 2K4WA 4P57A 4PI2A 3BLKA 1OVZA 3CQPA 1M2VB 4L8DB 1GJUA 4GI6A 1K5NA 2O1AA 4QY8A 3V5HA 1I7RB 3EH5B 4LCYB 5ALBH 3SO3C 4D0CB 2WLJA 2OS7A 4IRJC 2O5YL 1V10A 1A21A 3WNMA 4FEMA 4E42A 4JDEA 4N20A 4EO5A 2ZCZA 4GKOA 5DFTA 2CK0L 2BXYA 1T1YB 1C8PA 1JHKH 3CC5A 4XCCH 3LH2L 5C7ZA 3CK0L 1GW6A 3UTSB 3AU0A 3IE4A 1TTRA 4FFZH 1T0NA 4G8AC 3ES6A 2CGYA 5BRZE 4OGYH 2QSCL 3ZPDA 5I8OL 4OJAA 3ZR6A 1OCZB 4X6DE 4X83A 3LOWA 1T4KA 2D9CA 4Z7OF 5FGBA 1G9NL 3A67H 1ETZA 1Q0XL 3D25A 2RQ8A 4YSAA 5IMOB 5LGJA 4XVUC 4GRLD 4FYRA 3L3DA 3UABA 1EO8H 1YNLH 2AJVL 4NC0B 1EANA 1DJXA 5T1LD 3ULAB 2KKQA 4EN3A 5HI4D 1WA2X 1R3JA 3WIHL 1PJWA 3TNMB 1I75A 1KB5B 1B0IA 4PJCE 2C7UA 1MH5B 3QEHB 4R7VA 3MRIB 2UV3A 4FDWA 4R4NC 1NBCA 4GKNA 4K7PY 1KCSH 1JNHB 3OMAB 2J4WL 4JGJA 2KZWA 3CZNA 5L8LB 5T33H 1KT2B 5CEZE 3KAAA 1O7SA 1V55B 3AQXA 3LRSA 4QYAA 3A6BH 4XCYA 3NG5A 1RFDL 5GZOC 4OU3A 4JGNA 2XV6B 3W5MA 1T03L 1R5VB 4N25A 1P7KB 5EU6E 3G5WA 3V2AR 1DHKA 5GRJL 4ZOEA 5A2JH 4XPAL 5E4EC 4NP4L 1QHPA 4X7CC 4Q6IA 4MA3A 5FECB 3AMKA 1KYAA 2OX5A 1CDUA 3F64A 4AUUA 4CVWA 4IDJL 2IQ9H 1MREL 4WO4C 4LVEA 4KGLA 3G04B 4OCWL 1IEBB 1VKXA 2GY5A 3RVVC 5E4AA 4MYPA 4MD0A 3GC3A 2QQQA 3QJRB 5GPRA 5BQ7A 4B0MB 2X12A 1BQHB 5AAMA 5MI0B 4X6FB 1JZHA 1CLZH 3E2HB 5SWSE 1T2QH 5K9JH 4LIQH 2OJEA 1OQOA 4HJGA 4ZTOH 1QLRB 1HOCB 4CVUA 5DK0A 3O3EA 2JF1A 4G8GA 3TN0C 2OR9L 1MCJA 4Q74A 4YXLH 2XHNA 5HI3C 3MRJA 5HXMA 4J27A 4XNUL 2GYSA 3WDHA 5EPMA 5HHOB 2G3ZA 2ZTBA 2F74A 2ZYRA 1G0XA 5LGHL 1KCVH 4XP4H 3QPKA 2F1EA 4N8CL 4NQSB 4N90D 2IWKA 3FXIC 4RGND 1N19A 4KMTH 2YQBA 3QR2A 5E2TH 2Y06H 1AS7A 5C6WH 2LGNA 3PLYA 3B7SA 4PJDB 5AWNL 2XKNB 2EEDA 5KYUA 4CDGC 2X2JA 4I2XA 2VLJB 1Y6KR 2ICEC 4QWWD 1FCCA 1FNLA 5FDYA 2Z1KA 2DQDL 3ROLA 4GIOA 3HNSL 3TNNA 4WKZA 1DDHA 2JI2A 2V3DA 3KXFD 3BLPX 2YKLH 2YWZA 3UTPE 4XGZB 3BO8B 4XN1A 4MBOA 2WSPA 5EN2A 5EZJA 1BAWA 2DJMA 4J1UA 4WUUA 4F7EA 1XGQB 3K80A 1BX2A 1UXSB 1KLUB 2L04A 2P24B 3VG9C 4Y5XC 2MNWA 4XH2A 3BKCL 2WXKA 3DYMA 3RWJB 5IJKA 3AG2B 5C0BB 1KJ2B 1M1SA 4FX5A 4OQTH 1ND0A 4WI5A 2FHBA 4Q2ZB 3TIEB 2XWBA 3R06B 1GGBH 5E8DH 5F1SA 4NEHB 3NK3A 5AUMB 3SPGA 3FUJA 4ZAKA 3SDDD 4Z77B 3PWPA 1LE5A 1XF4A 2AC0A 3QQ3A 1MFMA 3B9KD 5EOQH 3VG9B 1NCBH 5AYUH 1MRCH 2QKSA 4YDVB 2MIZA 4ZMOA 1O5PA 4YBHA 4RGOL 1KPRB 2H6UA 3T71A 2V8MA 2DJSA 1IT9L 1KSRA 5GRYA 3KL5A 3WEOA 4IBUA 1FVEB 1MRDH 3PJLA 1OP3H 3RPKA 4LCIH 3RTLA 2K6WA 4BINA 2UUDK 5FM5M 1YPZB 2J2ZA 1LO0H 4XOBA 3RP1A 3ORJA 3OSKA 4NKDB 5EBMB 1MFBL 5LCVL 5IFJB 3LMJL 1BM3H 4AQ1B 5EUOA 2Q5BA 5F7KC 3KPPA 1G7QB 3G6JB 3CXDH 3IPEA 5FDWB 5E9AA 4M43H 4M29A 1FGNL 2BSSA 3LEYL 4U1GB 4P2OD 4W9CC 3MKKA 4L9DA 1KG0B 4HJ1A 3QUHA 3QEQA 2EO9A 2R0WL 5HSFA 4P5RA 2VZUA 4NNPL 4NZUH 1P5UB 1PFOA 4UB0H 1EJOH 1JUFA 3C6EA 3HZVA 4UT6L 3O9WC 5T5FH 4ODHL 1M2VA 5KS9B 4G43B 2IPTL 3OZ9L 2NDGA 1MWAH 1P6AB 2BHYA 4Q9QL 4KHXH 2XRAL 1IEHA 4TL5A 12E8L 2VDML 4Q9BA 4YHMH 3TWCL 5AENA 1KCKA 1L3WA 1R5WA 5B3SB 3D3VA 3GSOA 4WLCA 4ZPTA 5F7FA 4JX0A 4HUKB 2HFEA 3LRMA 2E47A 2X0VA 3QIWC 3Q8FA 1DLHA 4TSCH 2H2PD 1HHHA 1YC8A 1UG9A 1U4FA 2E56A 4AH2B 3FCTA 4BKSC 1Q9OA 3DX1A 3NCJH 3RFZA 5DHMC 2ADIB 1NBYA 4PLKD 5B7MA 3D2UB 4K8RL 3W38A 1MI5B 1SJHB 4WDIB 5KAQG 3EJZD 4Z3EA 1QHOA 2Z31C 3VM5A 5JXAL 1DVQA 3AUWB 5DEZA 4QXUH 3QJHA 4F27A 1OT4A 1DANT 5ADOH 2NW3B 4MD4B 2NQ3A 2VZVA 3DMMB 4NPYA 4X7FC 3AXHA 5C09A 2KS0A 1KOAA 1JCKA 4UTCA 1U95A 1V7NL 4A6YB 4POZD 1CG9B 3CHOA 3T0EE 5KVGL 2OYKA 2GPZA 2F54A 1E30A 3DGCR 5TQ0L 1KT2A 4Y4KA 4AW7A 4TNWK 3WXWL 5D2NE 4OV5B 1ZHKA 4G6JH 4OD3L 4DT2A 1ID2A 1C5BH 3KJ6H 4FQXB 3G6AA 4MZ2A 3UGUA 4U2YA 4KK6D 5FA4A 1R5VA 3OPZH 4YLQT 3GZOA 4K5LA 1FFOA 1QR1B