3QFGA

Structure of a putative lipoprotein from staphylococcus aureus subsp. aureus nctc 8325
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
145
structure length
145
Chain Sequence
NMDIKIKGDTIVSDKFEAKIKEPFIINEKDEKKKYIAFKMEITAKKDDKDLNPSSISHDYINITQDDKNTVNKLRDGYLLSDKKYKDWTEHNQDQIKKGKTAQAMFIYELRGDGNINLNVHKYSEDKTVDSKSFKFSKLKTEDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of a putative lipoprotein from Staphylococcus aureus subsp. aureus NCTC 8325
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 32
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16729 DUF5067 Domain of unknown function (DUF5067)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1240 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qfgA00
4LESA 1LMIA 3CFUA 3QFGA 2LLGA
chains in the Genus database with same CATH superfamily
1JNNH 5I73C 4E0RB 3MJ9A 1OTSC 4E5XA 3BZFA 1RK1B 4QRSB 1KF9B 4I0PD 2A4CA 4OTXH 5DJ2B 1N6QL 3GMMA 2AS5M 3D51A 4EI5A 4JQXC 4EUPH 1RVFH 1YPZE 1N64H 2RH0A 2AANA 3LKSA 3VJ6A 1A3QA 2AXWA 3D9AH 2LR4A 1UFUA 3PDGA 2ARJB 2F58L 4V1DE 4XOCA 1KLGA 1E43A 2WMPA 4MX7B 1DVFA 1PIGA 2X12A 2HVKA 3QO0B 3JZYA 5IFJB 3EYOB 4E9XA 4JPKH 2OBGA 1KEML 3QUYD 4PJCA 5HGBA 1RP8A 5J6GA 1DSYA 1ZWIB 1I8MA 1QFOA 1ZXKA 1S7SA 3BWAA 2FWOB 5BUAA 4UZGA 4FZEL 3S2AA 5DYOB 1F6AA 2K7QA 1CDUA 1TZIB 3OZ9H 5EBLA 3WIIL 4XGZA 5SV4A 3N0AA 2D03H 3QDME 4P5TB 4LIQE 3DC0A 2V0AA 2E0PA 2G5UA 3FUFA 4QXTB 3BH9A 4DSYA 4HKBA 4OF6A 5I0VA 3H53A 3I6KB 3QQDB 4F37K 2E9GA 1J1OH 4KROD 3TFKC 5K59F 2X6VA 2XTJD 1JBJA 5FOJA 3UG3A 3VUAA 5SWSB 5AVVB 2NNCA 3FHAA 3ZZLA 5A2FA 1MCJA 4PJ9A 4ODSH 5E56A 5D7LA 3CZJA 4PLOB 4M7ZC 2ODHA 3ARDD 1G7QB 4NWUH 4IK6A 2JB6B 5GPRA 3QCVH 3FQUA 3DHJA 2Q8BL 5EIIB 4B3VA 1D5XB 1R46A 4F27A 3GS7A 5ESQA 5JYLA 1OGAE 3RGBA 3RVUD 1LE9B 2FT7A 1BF2A 1A6VL 2TRHA 2PXYB 4Y19D 3RILA 4KY1H 2B4CH 1MJ7L 2VUOA 3HB3C 4ZQKB 2P42B 5BZWA 4HDIB 1X5AA 1XF4A 3N42F 1UT2A 4UM9D 1UM4L 2ZF9A 5DHVH 2JCCF 2W80C 4MQSB 4CNIA 2OMWA 5DEFB 3QHFL 4HK3J 1DBJH 4CU6A 2Y07L 1R5IA 4Y4KA 1UCTA 4M3KB 5ISZA 4U6HB 4AXWB 4TVPH 1RZGA 5EUOF 5GRUL 2V9QA 3DOIA 5I5JA 3ZYJA 1ORSB 1GRWA 4H8WC 4FF9A 4OLXL 3L9RB 5TTRA 3PWNB 1F4HA 4YZFE 1KBGL 3K81A 4PJAA 5MI0B 5IB2B 4CVXA 3DROB 3BEWA 3F7KA 5H2BB 2V5TA 3F7PC 3GO1H 2A9NH 4KZ0A 1RZJH 4AZUA 2QTEA 5KVEL 3B2DC 2ZG1A 3TBSA 1CLVA 3N44B 1ITBB 4BQ9A 4TLKA 2XA3A 1U6AL 2V3EA 3HS8A 4ONHA 3MNVB 1T21B 2V7NB 2RMNA 1Q0YH 4OI7A 4DAGH 1EIBA 3W39B 2PYEE 4XPFL 4QTHB 4Y2LA 4XWOD 3ARBA 5AOZA 4NQCA 2B9BA 4M62H 5FGCE 3SDAB 3KS0J 5KBDA 2DBJA 1K3ZA 1RHFA 3V10A 1X5ZA 1EK3A 1CLOH 3WTWA 1O0VA 4ES9A 1EDYA 3P4NA 5IBTH 2FNWA 1UTDA 3QYCA 1OAQH 4TOYH 4Z7VA 5I6PA 4EVNB 4BXVA 3MCG1 5LGHH 2HRHA 3HG2A 2HJFB 4P2YA 5C9JB 4JGMA 2PCPA 2FX7L 3QUXD 5JPMB 3EFOA 4YR6B 1KCRL 5IR1A 3UBXG 4L3EB 5LCVA 4GAFB 4WI4A 1J8SA 3GSQB 2EDJA 3MRLB 4A67A 1Q1JH 3FCTA 5T5FA 1IBDA 4B5ZA 4XPGL 3CDZB 1EDHA 1S9XB 4YSOA 3T0BA 3B6SA 4O4YL 3MKGA 1OSPL 4A7QA 2EKJA 3T2NL 4ALAC 5HGDA 2VLRB 3APDA 4D0DB 7TAAA 4HC1H 4MB3A 1BD2E 3AS2A 3AXIA 3KL0A 3FCSB 1RZIB 1R19A 3GJEB 2D0FA 3TC9A 1CICC 4JUTA 2XWRA 4QUOA 1KENH 4FTVB 1TZGH 2VTFA 2WP3O 1BX2B 2X44D 1KLFA 1NMAH 1G9NH 1PFCA 4JVWA 4Y5XB 4JFXA 5AALA 4AIXA 1NUNB 3V4VH 3TIEA 1TLMA 4YDVB 3ABLB 5L88L 4S10A 2OSWA 1DEDA 5DYFA 1Z5YD 2EXWD 3FAXA 3BE1H 4HLJA 35C8L 4E2OA 1OLLA 1CFTB 5FA3A 3VE0A 2WYZA 2HFEA 3PWPB 4FG0A 1HH6A 3HUJE 1ZPLA 1YYMH 3MLYL 5D1XB 2FECL 4JRYB 3K2MC 3BVUA 2QGEA 4HCRA 2ZAIA 1IM9A 3HE7C 3LN4B 3UIZA 3KXFD 4P4RB 1CGTA 3MZGB 1QBLH 4Z3GA 2MHAB 3X13A 2XPGA 5L2KA 3GSWA 3QHZL 1S9VB 3CXDH 5E4OA 4BQ8A 2DQJH 3MV9D 2BSTB 3H3PL 2BW4A 4PBVC 2W0LA 5J9PB 5BS0A 3S88H 1JNHA 1T20B 1M42A 4NKDB 5F7AA 1K5WA 2WXHA 3WKMH 2FQFA 1HHKB 2EUVA 2N0MA 1VFBB 4MCMA 4LQFH 3UAJC 2C3HA 1WAEA 3GWJA 3QHTC 4PRNB 4FADA 3G08A 4JL1A 5D4HA 2I5YL 2YPLA 1NBZA 2IIJA 3BAIA 4LHJB 2F8OA 4IGBB 3VXPA 1CFNA 3RHWF 5GGRA 3ENEA 1R5VB 3EG9A 4S0SD 4UU9B 3C9NB 3MV8E 2GIYA 2H6PB 2DQTL 5KAQG 2GIMA 2PCXA 1FVDB 4GRMA 3F6LA 1TTGA 2ZUXA 1YPZA 1T0OA 1X9LA 3IWUA 5KZCB 5CKAA 5CZXC 2LV4A 2Q7YB 2NOYA 4P3CL 5TDNB 4NUMA 4N2AA 4HPOH 5SX4I 2NPLX 2FTAA 4G7YL 3EGDB 2VDLL 2GPZA 5IJKC 1YEWA 1RV6X 4PJDB 3NCEB 4MKTA 4P5KA 4Z7UF 3V5HB 3P3SA 1J8KA 1TJHH 2GFBA 1U58A 5GS3A 1RLWA 3X11A 2YKLH 3UTQB 3OXSB 4HIEB 3ZRCC 1FC1A 1XCWA 2CO2A 3KBHE 4A37A 4CSTA 1HXYA 3BRGC 4IJ3B 5EZJB 2PR4H 2BVPA 3CHSA 1DYZA 3FTGB 3QZPA 2JSFA 1OXYA 1FL5B 5T3XH 3VGEA 3ZE1E 4BHUA 3IFNL 2ZUQC 5F7YC 4GSRA 2A1WH 3BAEH 3P11L 4L8CA 2VUKA 1YEKL 4OZFH 4JANA 1U93B 4GW1B 3H85A 4IOFD 1W72H 2BVEA 4WHYG 1UKSA 4ZAKA 2G75A 5HVWA 5CHNB 1T5XB 3OAUH 5AW2B 1FNGA 2DEWX 3RY6A 2K78A 3GC3A 3PAYA 1MXDA 4L9LC 5DCCA 3ABMB 1KV7A 3F12B 2C7UA 3VFRA 4JN1L 1RK0B 4RGMC 1FP5A 3UMTA 4AMXA 1Z9SA 4HULB 4IU3A 4HHAA 4A2LA 4HWBL 1FHNA 2VLKA 3GI9H 4MXWL 3SGDH 3HE6D 4OJDH 5D1ZA 4LRIC 3M45A 5DQ9B 3D0VB 1EEZA 3KPQB 3GIZH 3TEZA 1OQOA 2V2TB 4HWZB 4HX1B 5D7JB 5E9DD 2GT9A 4PHZA 2YPKB 5H37H 3ARGC 1RURH 5IMOA 4Z76B 1GL4B 4HPYH 4IS6A 5BV7L 4HCRL 4BXSV 3NJHA 3Q05A 1JPST 1DDHB 2WZ6A 3CAFA 4GRWH 4M6NL 3KPRA 3AADB 3IDMB 2F54B 5KYUA 3RWJA 4YFLI 1QI4A 4NM8H 3GS4A 2G3ZA 3L3HB 4AKOA 4W9CC 3U9UB 4PPTA 4R7XA 1XTMA 1V3JA 2EDMA 3KBPA 1NCNA 3LKPB 2OULB 4KX7A 4NQUA 2DWSA 1OANA 1H3TA 3TA3D 4DZBA 1G6RA 2J4WL 2AJXH 3KLHD 4KZEH 2VC2L 2PABA 1J8HD 3FYEB 2IEPA 3IFOB 5BW7A 2DI8A 4UOW0 1LD9A 1JHKL 4XXCA 4KTEH 1KULA 4AE0A 4B27A 1I7TA 5E1QA 2AJSL 1T1YB 1UOVA 5I6XB 1EZVX 2BC4B 4XVTH 3TCLA 3MXVH 3TO4D 3RDJA 3L4CA 4NRYA 5EU4A 3HNVH 4MA8H 2PR9A 1HT6A 4K3DH 3C8KA 2X53A 4GP8B 2OLDA 3MBXL 1OT4A 2HLAB 2WZ0A 2VB5A 3NPZB 3T3PF 2C1PB 2LAAA 4ICXA 3W3BA 2EXTA 5CLWA 2PYEA 3GHBH 1NMBH 2PTTB 1AFVH 3ZTNH 3IDXL 4J2QA 4PJFB 1E6OL 5GHWL 2NY5C 1CDBA 2D2OA 4JFHE 5DHXB 4LESA 4OSUL 3BSHA 3BHBA 2QQNL 3IDGB 1EUTA 3L81A 4DP1X 3BKJL 1NGWA 2IPUK 4AYBA 3QW9A 4PJ5E 5A2AA 2EC8A 2R51A 1A7QH 1VIWA 3BAJA 1TVHA 3ZSSA 1SJHB 4H1LH 4KMLB 1IAIL 3IMTA 3LD8B 4LSSH 1PLGL 4M1DL 4F8QA 2YKKA 3WO4B 4BFJA 3Q8EA 4HG4K 3TYFA 4E41A 4LVHC 4F5CA 2Z4TA 2JB5H 2DQGL 3RI5K 1LLAA 2UY6B 2WBJA 3DRTB 2VIRB 2AEIT 3IDIB 1T4KB 4FQQB 4HJSA 2ERJC 2ADYA 1NAMB 1K5NA 2CLRB 1X7SA 3RWHA 4KGLA 2OMYA 4WIQA 1ZA3B 3S3SA 4YSCA 1SJMA 1AXTL 3DGGB 3OKKB 3MOBH 2YS4A 2W8CA 1Z3GH 1ZTXH 4NBZB 5E8PB 4IU2B 1KOAA 2R9HD 1U95B 3TIDB 5CWSA 1IC5H 3IM1A 5CN2A 1OLZA 2WWMD 4EUPG 3QORD 5CCJA 2IH9A 4FQIL 4F1ZA 2GBUA 3QFJB 25C8L 1FVCA 1EJ6A 2YPVL 4U6YA 1A3RL 2YD5A 3STZA 5BO1H 1JWMA 1ORQA 1U8CA 4TNEA 2QVFB 5AYUH 2Y72A 4ZFZB 3P2BA 4WU5A 5L2JA 5DZJA 3O9WA 2FNBA 4EIZC 1SYSA 2EXYC 4PLNC 4ZXBC 4OD1L 5AQ0A 2Y2TA 1FUNA 1S7UA 2XSKA 4Z95H 3H9SB 1QFHA 3MGOA 3L6FA 2VR9A 3JWNH 3C60B 2R56L 4LLDA 2GUOB 4D9QD 3VFPB 4EN3B 1AXSA 4R5VA 4HPHA 4AIOA 3S3BB 3PS6A 2CBTA 3BH8A 1BZ9B 3LIZH 1F1GA 2A74B 5EZOL 4IRZA 1JGUH 3CLFL 4QOKD 1AQKH 3SDXE 3MCLL 3ESMA 4R97B 3W2DL 3ZKXB 1YYCA 3CCHB 5D7KE 1GY1A 3H42L 5GGSY 2JELL 3MCKB 4DGYH 3IGAB 1HHJB 2EDFA 4H26B 4H88H 3OMAB 4TRPH 2OMZB 5HHME 3CFDA 4ELDA 3KH3A 2FZ3A 3LYRA 4JUSA 4PS8A 6FABL 3ES6B 3AFLA 4GAGL 2B9AA 3VW3H 1AY1L 4MD0B 4HIHB 3QWOA 2K9UA 1RUPL 3U4AA 3FQYA 1H19A 1IJNA 2LE9A 2GSIA 1IFRA 1PD6A 1XGPB 1UD4A 3EXJA 2ZF8A 4OZGB 5ENWB 1WC7B 2W65A 4KXZH 3HC4L 1KXHA 3KW7A 4DP4X 2C7FA 1EXGA 4NLAA 2HJKB 4YMPA 2Y06L 3CQPA 3GMQA 1IQDA 1F8TH 4JKMA 5IJCC 3BUBA 1RZKH 4A6YB 5I1KL 1OE1A 2Y7OA 5JR1H 4JCWA 4XB7A 3WOVA 1KIPB 1RIHH 2E74C 4LXFA 4MSWB 2HKFL 1MLBA 4X5WB 1PU0A 3KS0H 1LDPH 3LKRB 4ZBJA 1YDPA 1XH2A 5GGTL 1VERA 5D1QC 3EKCA 3D8MA 4X6FA 5IGXL 3O3EB 1NC2D 4GW4A 1IBBA 3VFTB 5D4JA 1ZMYA 3NFNB 4HKXB 5CJOL 1Y0LA 3ATEA 4X99A 5E2WH 4OZHA 1XCQB 3ALWA 3HJEA 1YJDL 5I0ZA 4PGCA 4LL4A 5DHEA 4JFPB 1UH3A 3P3UA 4XC1L 1N8ZA 2WUBL 3MROB 1IB5A 5E6SB 3DO7B 5LB1A 4JKNA 4M7LH 4YSDA 3QEQA 2XTLA 3Q2VA 2VZTA 4P59H 4HMEA 4PJBA 4Y2DC 3RFRA 3FQTB 2O6FA 1V05A 2OSXA 3NP4A 5HHQA 3H7BA 1KYAA 5T1MA 1Z9OA 1KTCA 1UACL 5D5MA 2AEPH 1Z6JT 4NJ9H 3P40A 4BEIA 4NXKA 4BSWB 3BO8A 1E5BA 4HS6B 3ELAT 1ETZB 1A6TB 4RAVA 5DHDA 4YWGH 2H2SC 3ZKMD 5SWSD 1WZ1L 4QXUL 4XMLL 4I9WD 1MKFA 1FH5L 3VAEA 1G43A 2CKNA 4Q89A 2P24A 1KYOJ 2LU4A 4YHPA 3SZKC 3UP1A 3CSPA 4PJAF 3LPGA 5C07A 1RUQH 3EH2A 1R5WA 4XP5L 5HHOB 1BEXA 3SCMA 3OGOE 1J86A 4LLWB 4R90H 5HI4C 3MLWL 3W57A 5DMJB 1ZA6A 1ZHBA 4RFNB 3REVB 1LMKA 3EBGA 3ARTA 4P46C 3SYOA 2ETWA 3ULVC 3KJ4C 1NQBA 1VFOA 4MJ4A 1T2QL 5KN5B 3QQNA 2OPCA 2EILB 1WLHA 2VZOA 4B9JA 4MAZA 4WSJA 4P5MB 2QT6A 1I1AC 2BP5M 3SKJL 4LCYA 4ELME 3OJDB 4CMMB 3S96B 3GSNL 4BE5A 4H8HA 3LS4L 2Y69B 3PQYE 4HJ0C 5CKGA 5CEZL 3QIWD 2FJSA 2C9XA 3O3DA 3SPVB 3ETBF 3X2QB 3FO9B 3PWUA 2L8AA 1EX0A 1YN7A 5E2VH 4WK4B 1D6EB 5DUPH 4BD4A 4NO2A 1KGWA 3LXUX 1L9OA 5ELIA 4QY8A 4BKLB 3KM1A 1TJXA 3QRFM 4J6RH 4ZS7L 2WQ8A 2P80A 4NO5A 1II4E 2QQQA 4Y19E 1WBYA 1G9MH 4KO6A 1AGEB 2WCPA 1PAMA 1C16B 1GYAA 2DIEA 4WUUB 5I1JH 3MGAA 3WY2A 4IEFB 3RIFF 1BG1A 1LJMA 3MRPB 2K45A 3MBED 4J1UB 1E4HA 1XO8A 2WSPA 1NGQH 5CD5C 4OTXL 1O7VA 1EXUB 2YC1A 1MHHB 1RVFL 1N64L 5I1LB 1SJEB 5IOKA 1OTTC 2C3VA 1NGYA 4XP9H 2WN2A 4NAQA 4JQIA 1XBRA 2QSCH 3GK8H 2Z8RA 2VXSH 3ORJA 1YEGH 1JYXA 4LO9A 1I82A 2CM5A 1KJ3H 3DYOA 1IC0A 4XNYH 1J11A 2VABA 1CF8H 5D7EA 3G6DH 5GJSH 1WYJA 3IXAA 3ZYZA 2A4EA 3ULUF 4L3ED 2NLJA 3F5WB 5I66B 3PJLA 4N6RB 3KCWA 1ZLVK 2JXMA 4WU7B 1UCBH 1HHHA 3RX7A 2P5WA 1T0MA 1K4DB 1RU9H 3DHMA 3OZ9L 3SBWA 3FTXA 4F7MA 2IDQA 3WYRA 2D03L 2DRUA 4HIJB 2Q76B 1BCIA 1MHCA 1J0IA 5AEAA 3QXAA 1JD9A 3WDHA 2VLRD 3FU6A 4DP8X 1FL6A 3GXIA 4HS8H 4HOMA 5AENA 5CBEA 3NCCB 4Y5YA 3HZKA 4NPYB 4XMZA 1D5MB 4Z7NF 3LEXB 1WH0A 1NANH 4FTVD 4ODSL 4YC2C 2XA8H 4MAYA 4Z8FH 4KV5F 5KSUB 4P4KD 4NWUL 2WINA 3MA7B 5DD0H 3RURA 3U36B 1N0XH 4OZFG 4NQDB 1NFKA 1SNRA 3WLBA 5HTSA 3SDXA 4E9SA 4Q9RL 3UIYA 4ATTA 2KZKA 4M03A 4FXKC 4IHOA 4DWHA 4C47A 3II1A 4V2BA 2B4CL 3PWPD 5D1XD 3V4VA 3IVKB 4KOCA 2GJPA 3CJJA 4JM2B 3SDCC 3B2VH 4ETQB 1YPZF 3KPLA 1A6UL 5JMRA 2XN0A 1DE4A 4LPUA 4YJZL 2FWSA 3RIAK 3D12B 4K23H 5D71L 4W9HC 1DBJL 3I3BA 4XO5A 2DQUH 3BZEA 2CDFA 1OAXH 4S1DC 5TDPB 1XH3A 1XIWA 4P99A 5H37G 3TNMA 4TVPL 3RTQC 1OARH 2EIEA 4NKMB 4U1IB 1QG3A 3BAWA 3NOIA 3PJNA 2Q6WA 3L95A 4XWGH 5I23A 1MHPH 2BIIA 3ARFA 1AQDA 2C9UA 4QRPD 4W9KC 2EYRB 4UINH 5IB3A 2A9NL 1RZJL 1F56A 4G6MH 4LMQE 2Q2LA 1E9OB 1B3IA 4LSTH 2K70A 4IGBD 5CMAA 1NCAH 3FQXB 4AKQA 3GGWB 2O61B 4PJIB 3KXFE 3B7YA 2W9EH 1Q0YL 4DAGL 4FA7B 1BIHA 4IMLA 2O26U 1MLCA 1P7HL 3B1UA 2DM7A 4MASA 3KH4A 4QHKI 3BDBA 4EZMA 4R4BB 5KZCD 3LTVA 3FOLB 4C58B 3T0DA 4ODHH 4QHMA 4AUYA 1D9KB 5IBTL 1Q9OA 1CURA 4AVKA 4OV5A 2L3BA 4YNYB 2CHZA 1OAQL 4ZW8A 3WEBA 1JNJA 1FGVH 4TOYL 4HJ1A 5LGHL 1D2PA 5J56B 1G7LB 2CR6A 4XRCA 1BZ7B 4F80A 3ILEA 3F3HA 4B7IA 2GCYB 1LVEA 5I6OA 4TSCH 1SOKA 2DQDL 2GQHA 3D7PA 2R0ZH 5EWIH 5IJBC 3VD4A 4I0PA 4XHJD 5EN2B 1Q1JL 3SQOH 1EMTH 4P9MH 1DCEA 2R69H 2VRAA 4ZSOB 2P7TA 2VQUA 3ZKSD 3IU3A 1HWGB 2YD4A 5FOBB 2EEDA 3BKCH 4XNUH 5E6IB 3JUYA 4LSUH 4PBWD 3TEUA 5K9QG 3MRRA 4LOUD 2ED7A 3SKNA 2X1XR 3T8XA 3OG6B 5KYWB 4H1LG 4L8DB 4HC1L 3SDDD 3US9A 2N01B 4TSAH 3TGXA 1GS6X 3QUYA 4WV1A 3L4WA 4OZFA 2N7SA 3BVNA 1DJSA 4M7KH 1W72A 4R4ND 1KENL 2R2HB 4MHHG 4PWJA 1ZGLP 1NBYB 5A2KH 3JUZA 2ITFA 2C8NA 3W0WB 2B8OT 1TZGL 5JHLH 1JSYA 1LXMA 5DMGC 1NMAL 1JVKA 1G9NL 1Q8MA 4J3UA 2Q86B 3TU6A 1M6OB 3SGKC 1WA1X 4MA3B 4MJ5B 3N40F 2K7PA 5D7JD 3GRBA 4N90D 3VWKC 4KRPD 2D9CA 5HI3C 4EF3A 1MNNA 3U7WH 3V0VA 4CAGA 4PREB 2EO1A 3BE1L 4FA6A 3C2AH 3BGFB 4WW1A 1H8OA 1UM5H 3FHQA 5E23A 4DN4L 1KTLB 1S7WB 1YYML 2F54D 2ICWA 4JZOB 4PN6A 4TNWK 5H37A 3UXFA 3ALPA 1A66A 5DRWA 4B9FA 3KEDA 1BWWA 1PY4A 1U9KA 1A7PH 2YXVA 3MRFA 1DBKH 3HEIB 5F9JA 1COBA 2DN7A 2WVUA 2HB0A 4HCIA 3ARDA 1QBLL 2Z92B 2CXKA 3FB8A 3MJ6A 4JO1H 3CXDL 3VFSB 2CHDA 4LCCB 5EU5B 5FFGA 4GLRH 1GTFA 1HH9A 2ZSWB 4BJLA 4E42A 4Z7QB 5HPMB 2J72A 1WTGT 2JFCA 5CP3H 3VRIB 3H4HA 5HJBA 4CSPA 4GQZA 1XGQA 5E9DE 5JPNA 3S88L 3B56A 2NNXA 1UKTA 1M7DA 4NO3A 3GBLA 2JTYA 4NQEB 4Y19A 1ZLDA 5D8JH 4HUKB 3VFWA 4N86A 4X80L 3JWNG 4G80B 4XO3A 5TQ2H 1U8PB 3QIBB 1UD8A 4UM9A 5F7BA 3WJLA 2Y7SA 1M1SA 1DSFH 4PFEA 4PS4H 2VLJB 2D31A 5CNHA 3SJVA 2QELA 3BSGA 2IV8A 3COOA 4MA1B 4LLVA 2Q9OA 1ZT1B 5C1MB 3BPLB 1J8HE 4TUOB 1RK7A 4UQEA 3AXLB 3PWJB 1D3CA 3FB6B 2R2EA 2VN3A 3GB7A 2IPKA 1LDSA 4HPOL 4X9GA 1SMDA 5A16B 1DQKA 2GITB 2MFNA 1YMMB 2IADA 3HR5B 1OPGL 2W0FB 4JFZH 5FO8A 2L7JA 5DXWA 2R1WA 1YVLA 3D6GA 2WQRA 2BDNH 2OMTB 4F33A 2ITCB 1TJHL 3KPSB 1S7QA 2EABA 3AVEA 1XGRA 2YKLL 3M07A 4XBEH 3BSZA 2JTDA 3IAPA 3HUJF 4JLRA 1F4YH 3D52A 3POCA 4RWHA 4C4KO 4MNQE 4ONOA 5KVFE 1WVZA 2ADIA 4FQCH 2X05A 4OJCA 5T3XL 4YSPA 4PJHB 3QNXA 3VGGA 3R4DA 4DP0X 1ONQA 1PW3A 2A1WL 3BAEL 4I1NB 1S8DB 1QPKA 4GMTH 1W72L 3AW5A 4LGRB 5ABZA 4WO0A 1T7ZA 3OAUL 5KVEE 5JXED 4NBYB 2FYVA 2CH8A 4GIAA 3JTTB 3QUXA 4ONFH 1MJJA 4GG6E 3OGCA 1M7IA 4ODWB 4U1NB 1KB5B 3QFDA 3QFJD 3ZRFC 1ODAA 3KNBB 4BFOA 5I1CH 2NY3C 3GIZL 1CGXA 1RURL 4DKTA 3N40P 3HC2A 5JORA 2KBGA 3OKMB 4HPYL 1UWEH 4UYQA 4O5LH 4FQXB 1E3ZA 3NIFB 4H25A 4P5RA 4DPRA 1TQTA 1I3UA 4ENZA 3VGBA 1HYSC 3H9SD 1T66C 4NM8L 2EEBA 4KKBC 3C60D 1IO4C 1FL3A 3QJSB 3VRJA 2AZAA 2YXFA 2M8XA 1KPRA 3EUUA 3K6DA 5AAMC 1DLHB 1URZA 2AJXL 3ECUA 4KZEL 1FG9C 3CVCA 4ZMNA 2R2CA 3AG1B 2BIOA 4N85A 4NRZB 2WGXA 2GK0B 4KTEL 4PRHB 1FV1A 4Y16B 1UGKA 1NOFA 3RBSA 3NZUA 1YEEH 3LIZA 1OIOA 4XVTL 3MXVL 1MCPH 4W6YB 2KS0A 1QBMH 4A7VA 3HNVL 4MA8L 3LB6C 3ZE1F 3QAZC 4K3DL 4NO0B 5JQHC 1CBVH 4NM4H 3A24A 4L9DA 3KXFA 1Y07A 4D9QE 1CFSA 5GS1B 3NTCH 3GHBL 3MV9A 1NMBL 4YEFA 2W0PA 3E0GA 1AFVL 1U8MB 2VQTA 3EJRA 1ILUA 1J8RA 4N2MA 4P3DA 1F3DJ 3HRPA 3VFGL 3VA2C 2UYLA 4R0LA 1N6UA 4JDZB 4GXVH 3MRQA 2MNUA 4QOKE 2W5PA 4KK8C 3ISRA 1ANUA 3CHPA 5I74C 2R39A 3VDCA 5J8OA 1A6PA 2NY0B 3L1OH 4U6XA 1JGVL 3X1NA 5JZ7C 5JLZA 1S5HA 1A7QL 3IDNB 5EEWA 5F21B 3IB4A 4BZ2A 4HD9A 3L7FA 4MBOA 1ACYH 3MRKA 4LE8A 4LSSL 2XQ0A 1S4IA 1AHWB 1S7RB 4IYKA 4OLYH 4DIXA 5L8LB 4PG9A 3QULA 1P5UA 1ROWA 4KMTH 3DVNB 1L3NA 3GSUA 3TBWA 3V4LA 1MIEH 1PD1A 1EPFA 1WWBX 1I9RH 4FQ1H 4KH2A 3ROOA 2P5EB 5DJ6B 4DP7X 5EDXA 1B9ZA 1PNDA 5INCA 2X09A 2XICA 3NIDF 3TZVB 1J9CT 1RULH 1UT9A 4ENED 1AP2B 2Q20A 3OHXC 4YL9A 5IQOA 4NP4H 3UX9B 3S9DB 5TF0A 3GXFA 3MOBL 4YIQB 5DF0A 1M2VB 1Z3GL 1R3KA 1ZTXL 3GMLA 3DIFB 1IC5L 3NZ8A 4KFZC 2BM3A 3DTXA 4AV5A 4UAOC 1G87A 4X9HA 2AJ3A 4ELKA 1TIUA 4HKJB 1PS3A 1T7VA 1SPDA 2CLVB 3DURA 1RP9A 4JKKA 3IPBA 2CJUH 1SEQL 4P04A 3LZRA 4M1GH 5AYUL 3WIFB 2VE6B 3ZSTA 1TZHA 3P3YA 3QDAA 3UTPD 1O7DE 2HG0A 5I2IA 3HG5A 3I02B 4IOSD 2ENJA 4TM9A 3UADA 4AQEB 3P77B 3I50H 1U2CA 1JPGA 3BD5A 3QO1A 4Z95L 1FZMA 3E6HB 4WTQA 2V8LA 3DDFA 1QABA 4HLEA 3POHA 4FFWC 4PSRA 2C9QA 1OZTG 3QUMB 1AZBA 1QP1A 4C4BA 2YIHA 1C5BH 1NGPL 2FH8A 3V6OC 1F4XL 1ZRUA 2AK4D 3WGVB 3RNQA 4LDLB 2PO6C 1DZBA 3LIZL 3V4PB 3F7RA 2A83B 3C5JA 1JGUL 3F7YA 4UIMA 5E9DA 1AQKL 3SB3A 2L04A 5FECA 4YOKA 2FL5A 3LKQB 4MZRA 1DHKA 4ZS6D 2AV1B 4DGYL 5DLLA 1OSZA 2X42A 3K8KA 2XNAB 5BRQA 2NY2D 1NPJA 4H88L 4PYGA 4TRPL 5SWSE 4DEPB 2ED9A 4J8RA 3U0WH 2AKRB 4UZSA 4EE2A 1Q9WA 2JLPA 2CD0A 3FRUB 1BJ8A 1UG9A 2J8OA 2N59A 3BPOC 1QPPA 4WFFD 3VW3L 2IQAB 3FUIA 3QJQB 3EYUH 3QJHA 2Z35B 3CSYA 2XZQH 1ZEAH 1IGFH 1MRFH 2ZXAA 3FDWA 4JO3L 5TE6H 1EGJH 2HT2D 2ZCHL 2VR4A 1TKWA 5D2NA 4CDGC 1U8LA 1TPXC 4MFHA 2EIJB 1SZNA 4ZNEE 4OUUB 5DDHB 3LIUA 4ZMLA 4UNTA 4X2UA 4PJ8C 2AFNA 4WUUD 3EFDL 3UC0H 1G1OA 4DUXA 3TCTA 2YRZA 2ZOKA 5CEXA 5DZAA 2NXZC 5F3BA 1F8TL 1NIEA 2O5YH 4HYTB 1RZKL 1PJWA 3FO1A 3VI3B 2BP0B 4Y9EA 4QIRA 2H0JA 2ZWKA 4QGTA 1KCUL 1AG0A 2VO5A 5DR5H 1RIHL 1M05A 3IJHB 2F53A 4YGAB 3QI9B 4GQPH 4OZ4B 3VNZA 4U1GB 1CPUA 1LDPL 1MY5A 3CDYA 5B8CB 2IGTA 4O51A 2JK5B 3EH3B 5FGBC 3T65B 2Z7WA 1GCFA 3K72B 5E2WL 4OBSA 1ASOA 3S4SB 2CKBH 3VCLA 1BIIB 3C5SB 3SDXF 1OGTA 4N9GA 2EIZB 2ZX5A 2CJSA 1NGZA 4YDZA 5I30H 2W1NA 1RJZA 2DWTA 5D2LE 4JO5A 1CGSH 2KLSA 3O2WH 5FGRA 4M7LL 4HUMB 4PRBA 3A47A 4YSUA 4URKA 1BOGB 1SXNA 1Y1UA 2IMNA 4PY7B 4FFZA 4P59L 4KXBA 1HI6A 2ZKWA 3EO1B 3QZLA 3NJJA 3WXVH 2AEPL 3CFTA 4NJ9L 4D0CB 4X4YA 4TL5A 2BS71 3CZFA 3QVAA 4YDLB 5DRXA 4YWGL 2DEYX 3FOMA 3ULSA 1D5ZB 5IW1A 4ZZKA 1U8JB 1AMXA 3BUPA 5E08H 5C7XL 4PV8A 2FBOJ 5J4MA 4PH8A 1DO6A 3VXSB 5LKNA 2X4RA 1Q9LB 2AHIA 1RUQL 5AUMB 4L3EE 4QHNA 3OG4B 5CEYA 1FFTB 2WYIA 4KI5F 2C9VA 5ESAB 2HX8A 1R3JB 4S1SH 1ZDSA 1LO0L 5JHDB 4ANXA 4NZJA 4WW2C 2YBGA 1A22B 1SFDA 1VFUA 1T5WA 1QW8A 4CC0A 2Y6SC 1ZPUA 3ZL4L 5FM5M 3WS3A 1E9PA 3C8HA 4JM2D 1BEYH 3I6GA 3PHSA 1WEJH 1WZMA 4LVOB 3IJSB 1BZQK 3O8XB 4X6CE 4EQ2A 1D6VH 3V9EA 3TA4D 1HIMH 3P02A 4W9DC 5I73B 2DJMA 4FTVE 4MA7H 4QRUB 4X9IA 1YNTF 3TO2B 3CFNA 3OPZH 2JLLA 4R6UA 3FU0A 1CD1B 4K9EH 4OD3H 5E2VL 3CLEH 4N2KA 1CXKA 1JZEA 4WWNA 3E6FB 2MTAA 5DUPL 4P49A 1LILA 5C2BH 2MNWA 5BUGA 1S9YB 1TVBA 1IU1A 1T2XA 4Y9CA 4WFHE 4J6RL 2D0HA 3DVGB 5EIIG 4U2YA 1FLTX 4FFYH 4UT6H 1G9ML 4UQIM 4MWFB 5D1XE 5C0GA 5BVJA 4J5VA 1HL4A 3INUH 5TH2A 1IFHH 3ZE0E 2X7LB 4GXFA 5I1JL 5FM8A 3GTTA 4JCMA 4DN3L 2NSXA 4UILH 2D3JA 3WTTA 1PZDA 3WFEH 5M7QA 5FO2A 4AQ1B 2HVJB 3PYCA 1NGQL 2LGNA 4DGIH 3FT4A 1HL8A 2HX7A 3LV3B 4L2LA 4ZFOA 1KYUA 3BWZA 4AT6A 4ZFFA 2B16A 4I0KA 1D9KD 2HCZX 4XP9L 2J6WA 2RHEA 4H4NA 3Q9QA 4J3OD 1E30A 1BZ8A 4E9YA 4XN8A 3GK8L 1OVZA 2QPFA 1XR9B 2VXSL 3MRBB 5GISH 4A6YH 3ECBB 1H3PL 1YEGL 3P1VA 4QRPE 5DK0B 3ZK0A 4NCC2 4BBWA 1KJ3L 1X9RA 5J7CC 2R29L 4XNYL 5D72H 2ZWYA 2ZE0A 1CF8L 2F19H 5EU7E 3G6DL 4E0RA 5F7LB 2KPNA 4M7ZB 1B4JH 5BMFH 1INEH 4IJTA 1RK1A 4A66A 3B37A 4QRSA 2R0KH 4RESB 4FNTA 5DJ2A 3APFA 4HH9B 1UCBL 5B1CA 3WFZA 1QSFB 1RU9L 5GS0C 4ELMF 3IPFA 2BX5A 4RWYL 2Y5QA 1P7QB 2ARJA 2QADC 5E6ID 1Z5LB 3HHSB 4MX7A 3QC6X 1CLZH 5J1SC 4GINA 1H3GA 2R69A 3QO0A 4HT1H 5IFJA 5CUSH 3EYOA 4HS8L 1J5DA 4HXAH 3IPEA 4X50A 3UZVB 3BFQG 2W92A 1ZSHA 4Y9GA 3ETTA 4X9YA 2A3TA 4AENB 5AOMA 4JRXB 2XA8L 4JO4H 4XVOA 4BZ1H 2KC0A 2AQ2A 2FWOA 3W0WD 3GSXB 4Z8FL 1FIGH 2Z0BA 5DD0L 5CGTA 4G8GD 3FCUB 1TZIA 1N0XL 4X5XB 4BFFA 3QR0A 4YDKH 3L48A 4P5TA 3DX4A 4QXTA 3VB9A 2LVCA 2WAHA 2PP8A 3BP6B 5BNXD 5JHLA 3I6KA 3QQDA 3D3VD 2A6IB 2QJDA 5J11C 1EV2E 2YSTA 1CD8A 2BJMH 2DV6A 4FI8A 1PDKA 5F0LB 3O3UN 4HK0B 4P8QA 5AAPA 3B2VL 5FXCH 3REWB 1YYLH 3WAJA 3N1PC 2NT1A 4FZ8H 3GS0A 3RWCB 3CX5J 2DOCA 4P2OC 5D7IB 1G7QA 1TF4A 5DVMA 4A1RA 4BH8B 2E7HA 2JB6A 4K8RD 1MCWM 1YEHH 1OAXL 1IL1B 4B95C 3GNMH 5EIIA 1D5XA 1OARL 2ZTBA 4H0LC 4P9HC 3ZHLA 1NINA 1QACA 4UQ2B 1KUMA 1IT9H 3VFVB 2IBBA 4IRJD 1LE9A 1QMUA 4NQED 2RR3A 4NBXB 2PXYA 4XWGL 4ORZC 2MWCA 1MHPL 2IDFA 1OL0A 3MRCB 4ZQKA 1WFNA 4HDIA 4UINL 2XXGA 5DZOA 4G6ML 3LEYH 1QVOB 1EAQA 5DFAA 1U2HA 4LSTL 4OR1A 5HYJA 4NHCH 3PREA 1AIZA 4ZFOL 5DEFA 3F04A 5ADPH 2VLJD 1H8NA 2Z31C 4U6HA 4YDNA 1J88A 2ITEA 3SGEI 2E7LA 1F3DH 3HCVB 3UP6A 1UZGA 3L9RA 4ZI8A 3PWNA 3V4UH 1U21A 3LNHA 3VXRB 5EIVA 4ODHL 5FO9B 1NKRA 3DROA 1M3IA 1YMMD 2F6AA 5H2BA 4AJYV 5C0CE 4X6DE 1O6SB 3QDHA 3OC8A 4RNRB 1EZUA 2ZKMX 4N26A 4QWWD 3KE0A 1T21A 3MNVA 3KPSD 4ZO8A 2WZPD 5HI5C 1TEYA 2V7NA 5B38B 2JE8A 4TNGA 3W39A 4TSCL 4PVBA 3KPPB 5EWIL 2R0ZL 4QTHA 1GS7A 2JQZA 2UZYB 4PJFE 2OYLA 3SDAA 3SQOL 1MCNA 1FYHB 1EMTL 1KB9J 2AMGA 4P9ML 4PRPE 5G4OA 3RVVD 3BKCL 4XNUL 2BVOB 1U92B 4F8OA 5I1EH 1QLFB 1OCWH 2J1ZA 4KRNA 1OK8A 4M29A 4M61B 5FF6A 3N9GL 5DUMH 4J39A 2RQEA 3PDDA 4NJAH 3VGFA 4EVNA 2VW6A 2Y5TB 5JO5B 2HJFA 1TENA 3K46A 5C9JA 2QKIC 1KBPA 4M7KL 4N8VG 4DGVH 5JPMA 4YR6A 2H32B 4KJPC 5KVGH 1VB9A 4L3EA 1JYVA 5JHLL 3BUDA 3GSQA 3MRLA 5DEJA 1UJ3A 4Y4FC 1BFOB 3KAAA 4E9LA 1P7KB 3CDZA 4PJEB 1S9XA 1M2OA 2XG4B 1E4XH 5EZIL 4M8QB 3NJNA 3U7WL 1KN4H 4F7CB 3W82A 2HT4D 2VKXA 4FQXD 5BCAA 2VLRA 2PCYA 3C2AL 4OKDA 5DD5H 4D0DA 4NNYB 3HMXH 3FCSA 1RZIA 2LT9A 3GJEA 5F6HI 4GIPD 3A6CH 2QDVA 5EV7A 4PBXA 5C09E 3QQ9D 1A7PL 1VCBC 1MW0A 3ZYIA 1JN6B 1C1EH 1BX2A 3HZ3A 4JO1L 4HUVB 4R5XA 3HLAB 1OWWA 4Y5XA 3WTYA 4GUQA 4NZRH 4YDVA 2UZXB 3R1GH 4MNGB 4YBQC 4XI5C 3MXWH 4PRHD 4WI5A 3ME0B 4IW4C 2G2RB 4RFOH 1CFTA 1SDDB 5CSBA 5ALBH 5D8JL 3TTSA 3PWPA 3R06B 4TL4A 3IFPB 2VXQH 5ILTH 4JRYA 2IPTH 4OJYA 2P43B 4NO0D 2VRKA 3H9SE 3FW6A 3HRZC 3QQ3B 3ATBA 3PL6C 1DSFL 3LN4A 4QJ4B 4PS4L 4YHIB 2ZJSH 1C5CL 2BVUA 1S9VA 3Q3GB 4G2AA 1UM6H 1L9NA 1KG0B 1WPCA 2H2PC 2ZX7A 3Q9PA 5F1SA 1NLBH 5G5DB 2BSTA 3UBHA 5KJ7E 4Y5VC 2H8PB 2ESVB 5J9PA 3PGCB 5IFHH 2EYTB 4BM7A 2ZUQB 4L4TB 1T20A 2UY7B 2E7BA 1PIFA 1HHKA 1BPLB 5CJ5A 1QLEB 3P9WB 2WQXA 1VFBA 1H8SA 4FYQA 1L5GB 3ROLB 2ATAA 3QNYB 3DYPA 1E5CA 1CGYA 4PRNA 3K2IA 2NY0D 5DFTA 1F1DA 4JFZL 4L9LB 1PG7H 1AC0A 3P73B 4W68A 3FU5A 2BDNL 4N22A 1SEBB 1R5VA 2DBLH 2YZ8A 4RGMB 3C9NA 1X44A 4UU9A 3GQFA 3T0EC 4BE6A 4XBEL 2HZHA 3P9LB 3N6YA 2H6PA 1JZ3A 3RDTA 2KPWA 5EU6B 1F4YL 1QRNE 1FVDA 1UOLA 3FUEA 4TVPE 1XCTB 2XPYA 5IVXE 3TEXA 3F2LA 4FQCL 3PUCA 2P5ED 3AMLA 3D05A 2Q7YA 3NEEA 5DA0B 4RZCA 1UH4A 3TZVD 3EGDA 2QEJA 4JDEB 4PAZA 2AC0A 1KCBA 4PJDA 5B7MA 4UDUB 2IALB 1KIQB 3ZQ9A 3RVTD 1LQSR 3FTSA 3V5HA 3NJXA 5K1JA 3ZMRA 1Q38A 4ONFL 2DB8A 1O7SA 3LH9A 3RU8L 3UTQA 3OXSA 4HIEA 2YOCA 1RIVH 5EZJA 3FTGA 2B3IA 5J06A 4NAJA 1A21A 4X8JB 3WIAA 1FL5A 5I1CL 1IBFA 1F18A 3O6LH 4JR9L 4LL9A 5B1AB 4WKZB 3RPKA 2SODB 1MUJB 4XCCL 1NSNH 1WT5C 3JTBA 3GBDA 4GW1A 1OQXA 5CHNA 1TYRA 3QEHB 1T5XA 3TJHC 5MENB 1SN2A 4JJ5B 2ZNXA 1FYTD 3F58H 1RZQA 3MAWA 1BFTA 5IQ9B 2JIXB 3KYMB 3KYAA 3ESNA 3F12A 3ZT7A 1RK0A 4EI5C 4MQ7B 3G5VB 2XRAH 4TLUA 1UATA 4K94H 2VR7A 3BMWA 5DQ9A 4OT1H 4IDLA 1JL8A 3D0VA 4KZCA 3KPQA 4NPKA 5KYXB 2V2TA 1DVFC 4HWZA 4HX1A 4RA0C 4FTDA 2BSED 5D7JA 2YPKA 4X7SH 4Z76A 3BH4A 1AGBB 5F7NC 1R0AH 5JUEH 5E8EB 1E28B 1T1ZB 1XD1A 1DDHA 3ARUA 1AO7A 1FCGA 1MQ8A 3AREB 4AEHL 4DKDC 1MCPL 3IDMA 2F54A 5IBLC 3LQAH 1OF0A 1QBML 4AYMC 2WBXA 4I3RL 1YY9C 3L3HA 4AC2A 4A55A 3U9UA 1CBVL 2VJ8A 3GLAA 1KZQA 4YVNA 3LKPA 1WK0A 4Q9QH 1DJHA 1PEWA 5I0DA 1NKOA 3NTCL 3GIVB 3DV6B 2AK4E 4QAMB 1QW9A 3IFOA 4LVHB 3L4TA 1NCHA 2AMUA 5KSBE 1ROCA 2VDNB 1UC6A 4GG6F 1IX2A 4GI8A 3IMUA 1Q0XH 5L8JB 1T1YA 2ERJB 4HA1A 1K3IA 2BC4A 1PTZA 3T4YB 2XJLA 3V6FB 4IBVA 1ND0B 1XMEB 1PSKH 1VPOH 3EYSH 3RWFB 3NABL 2ZSVB 5I1IH 1BG9A 3NIGB 2C1PA 2F7QA 3F7VB 4OZIE 1ACYL 4I2XB 1XSKA 2ADJB 1JUFA 4G42B 4OLYL 2E7DA 4DW2H 2PTTA 4TQIA 3IBEA 1FJ1B 4PJFA 4KMTL 4EXPX 2X6BA 3RI5F 3QR2A 1MIEL 4N87A 3N43F 1I9RL 3QI9D 4FQ1L 3EJJX 4PJ7E 5A2BA 1MI5B 5EOQH 3HBZA 1HNYA 4Y9FA 3IDGA 3QZMA 5A2IH 1NEZG 3MRGB 4G9FD 1QEWB 2BY1A 4M5YH 5DJXB 3BIAX 5F7UA 2XN9B 1RULL 4U1SB 2YD2A 3AS3A 3GTVA 1T1WB 4NP4L 1S9KC 1A3ZA 3LZQA 4WUUE 4Y4KC 2MCAA 3ZKNC 5F6IB 3AG3B 1SJHA 3GXTA 2WOYA 4KFMA 1RIUH 2VR3A 3BP4A 3PPEA 3BVXA 3UO1H 2AJVH 1FNHA 2KH2B 2XQBH 2HJLB 2CKBA 3U1SH 4GSQA 1H9DA 1CFVH 1JPFB 2FATH 4TQ8A 1H15A 4C55A 2CJUL 2NY7H 2VJXA 1I8IB 2VERN 3DRTA 2VIRA 3IDIA 4M1GL 3I74A 3L9YA 5B7EA 1T4KA 4FQQA 3IF1B 1NAMA 3PV7A 2CLRA 2ICCA 3NJLA 4XPAH 1BVNT 1YG9A 1KB5H 1ZA3A 3X12B 2WLIB 4KUZH 3DGGA 1JCKA 3OKKA 1MREH 5JXEA 3ILQD 5JW5B 3ZGIA 5IKCB 5DHMC 2YMOA 2RA1A 3I50L 3NP3A 5E8PA 5IQMA 4IU2A 2HH0H 5GZND 2GAZB 1I8LA 1U95A 3DETD 3TIDA 3ARBC 3MV11 2OYKA 3TONA 4LGSB 2DLHA 1C5BL 5KTEH 3DJSA 3GJFH 3QFJA 4N68A 5LLIC 4HWEH 1SLUA 1MCHA 5AW4B 4ZFZA 4ADJA 3D85B 1FNLA 1VADB 3RWGB 2WO2B 1OAZH 3TOPA 5B7FA 2FIKB 1KGIA 3QT2A 5MEQB 2EDDA 3U0WL 4XX5A 4KKCD 3PAZA 4D0BB 3C60A 1HKLH 1JXFA 4G8EB 3WEOA 1LQBC 4KKLC 1OTSD 5C08A 4AYID 3VFPA 4EIBA 3AM8A 2EQDA 4IIQB 4EN3A 1JK9B 4JM0A 3F8UB 1BZ9A 2A74A 3EYUL 4BWUA 5KJRH 1V10A 3T08A 4JFED 4NFBA 1ZEAL 1IGFL 1MRFL 4PWHA 4DO4A 2BNRD 5K39B 2R7EB 1QR1B 3CCHA 1NCJA 2Y22A 1EGJL 3MCKA 4JFUA 3IGAA 1HHJA 2WVVB 4ACPA 1SXZA 4GRWE 2VDKB 1QTPA 3TVMB 4EIUA 2OMZA 4HMDA 4BH7B 3CMOH 4YE4H 4NNXA 2F1EA 3UC0L 4I7ZC 3CFKB 4ODTH 5CIPH 3WKQA 3M1CA 1Z2KA 1HHGB 4R7DB 2AJUH 2O5YL 3ES6A 3ZYOA 2DLEA 3FTVA 2YLHA 4FFYA 1NUDA 4UT6A 1NEZA 4MD0A 4HIHA 3FQNB 5DR5L 2XKNB 4I4WB 2E86A 4WLCA 3HR6A 1J48A 2GVYA 3U9PH 1NPUA 4Y2DB 4Y1AE 1XGPA 1GVIA 2NQCA 4EXKA 2BVTA 1A1MB 4MJIE 5ENWA 4OZGA 1WC7A 2H1XA 3IRZA 4U1MB 1C5DB 5BV7C 3TFKD 4I1PA 2EEXA 5E24E 1MCQA 5I15H 3B7SA 2Y7QB 5I75B 4P0DA 2D7NA 4NYLB 1HXMB 2HJKA 3H0TB 4ZPTB 4XNBA 2CKBL 2ZYRA 3UTSD 4WI0B 1XF3B 4XC3H 4PHXA 3GYRA 3UO8B 4A6YA 2VM3A 5DD6B 3VQMA 1CL7H 5I30L 2IGLA 4OLZL 2ALWA 2IANE 5B4MC 1CGSL 3EDDA 3O2WL 2ZCKH 1KIPA 4MSWA 4AQOA 2EH8H 3Q2WA 4X5WA 3WUWG 4YH6A 1XVSA 2PW1A 5PAZA 4JPWH 4NC1C 4NAMA 3LKRA 1P7QD 4P46B 3DLQR 3KJ4B 4KH9A 1CDHA 3WXVL 4JQVA 1NBVH 4JBSA 2ZUUA 4MXQC 4TLSA 2BWIA 3HB3D 3NYKA 3O3EA 5FR3A 2DLTA 2YK1H 3VFTA 5CR1A 3VM5A 3NFNA 4HKXA 4F9PA 4QMEA 3G5ZB 4EDXB 3TT1H 3JWOH 1XCQA 3U6RB 2FWLB 4JRXD 4XCEB 4B6ZA 4UZUA 4JFPA 4U33A 5DUBB 4PWGA 5B22A 5EN3A 1WE5A 2VL4A 2GC4C 3L5IA 3DO7A 4UBDC 1I1FB 5C0RL 1CIUA 3TS8A 4LZKA 3KGRA 3DGCR 5JIKA 3MYZA 3VFMB 3WD5L 1D7CA 4XMWA 2CU9A 1NICA 3FQTA 3R19A 4R5TA 4S1SL 1RD6A 3WN5B 4BZ1A 1PJ9A 4YX2H 4NC2B 3F62A 1MWAB 3BLPX 1AACA 4C57C 5ICYB 2OA9A 1RSYA 3O2VH 4BSWA 1BVOA 1W8EA 5A6MA 1KYOK 3WAKA 1GGCH 3QUMH 4HS6A 1ETZA 1H6FA 3ESOA 4IOSA 3SDYH 1BEYL 1IE4A 2EDYA 5GRXG 3RTLA 1WEJL 1W6LA 1HIML 1ZD6A 4MA7L 5IM7B 1WCBB 5HHOA 4OQTH 3FQRB 4LLWA 3VG9C 3WY3A 2E76C 5KWYC 4GP5B 4D2NA 4G8GE 3MUZ1 2QPSA 4K9EL 3REVA 4OD3L 3TV8A 2PWEA 3CLEL 3ML8A 1IAMA 4RISH 3HS0B 4KX9A 1Z32X 3SZ6A 2XV3A 5E2TH 4YSQA 5C2BL 3TN0C 2VJ0A 1P6WA 4MDJB 4FGMA 5GGSB 1ZGLB 1ESOA 3GLDA 5F9OH 4XMPH 1NCWH 4OGXH 4Z7NB 5D2LF 1EO7A 3GBNH 3D3VE 1ZS2A 2IAMC 3K8MA 4AC4A 4FFYL 1F2XK 3EJYC 4P5MA 4PWKA 4HSQA 1JGEB 4HFUL 1IFHL 2IBGA 3OJDA 4WWID 4CMMA 5BXFB 5FYKD 3S96A 3MYJB 4UILL 3WFEL 3SPVA 4CKQA 5AG8A 5IHLB 3LZOA 5K9JH 4NUQA 4FYTA 4DGIL 4Y4HB 3ULAB 1D6EA 1A6AB 2YD8A 4LDOB 3L5HA 1WP6A 4CGTA 3BAKA 5F3HB 5F7FA 3VXRD 4BKLA 4LEEA 3SYCA 4WKXA 1YZZA 2IGFH 4A6YL 5GISL 1AGEA 1SUHA 2COVD 1NMCB 1C16A 4WUUA 3V52H 5DO8A 4ADGA 5KSAB 5LGJB 1CICD 1N59B 4IEFA 5D72L 1XR8B 4W6WB 3WUWA 2F19L 2J44A 2WXQA 3MRPA 5CJQH 4XMTA 1B4JL 5BMFL 1INEL 2ZUWA 5FHBH 5AZEL 3BCDA 4XXCC 4FHJA 1ML0A 4WJ5B 1KCWA 4A7UA 1EXUA 3GSVB 1MHHA 4X6CF 1LO5B 5DS1A 1IIKA 3TBVB 5I1LA 1SJEA 5EZLB 3TF7C 4QXGH 2BPBA 3QDMB 3THMH 4I8DA 3DSFH 2FECI 3I6SA 1CLZL 2VMDA 1YMME 2ZAHA 4XZ4A 1G0YR 4HT1L 3OB8A 5CUSL 4Z3EA 3N06B 2ZAGA 4HXAL 4G7SB 1IZJA 5I0WA 4L1TA 3WHE1 1XGYH 4W9JC 2ENSA 1N68A 4AG4H 2CWRA 4UOQA 5HVHC 4JO4L 5I66A 2EUXA 4XAKE 4U3HA 2ZX8A 4N6RA 1FIGL 1G4MA 4WU7A 5JW4Q 5BO0D 3ZZQA 2OV0A 5A7EA 5SWQB 1QHPA 1K4DA 1H9VA 3ZE0F 1J10A 3IRPX 4LLQB 4YDKL 4X5LA 1AGDB 3BW9B 4HIJA 4LLUB 2Q76A 3VVVA 3RKDC 4HJJH 1OGAB 1V7NH 2OSLA 3ISYA 2EIMB 3ZHNA 2CM6A 1GOFA 3UAAA 3EXLA 2BJML 4AK1A 5BVPH 5KG9B 5HHXH 2ZKHH 4NPYA 4PRID 4QNPE 1D5MA 1YYLL 3LEXA 3PXJA 4XNAA 3V9CA 2G0LA 4RAUB 5EMYA 5I6NA 2GKIA 3BT2H 4FZ8L 5JHBA 5KSUA 4AW7A 2UXVA 2NY6C 3HMXA 3MA7A 5IIEB 5F9AC 2WBJC 3U36A 4RMUA 1YEHL 2O6PA 1GYVA 4GMSH 1C9SA 3Q44A 4NQDA 3GNML 4NZTH 4IBTA 3T6WA 2K6WA 5CZXD 1ZHLB 2EH7H 3OV6A 1U91B 3QIUA 1IT9L 1A4CA 5SWZE 2LU7A 3IVKA 2YQBA 3RBGA 4JM2A 3O6KH 1HEJC 5FYJH 3OX8B 1LEGB 2NR6D 3LEYL 5KW9L 5JIMA 2DPKA 4GFTB 4Z9KB 5IB5B 2APBA 3P9MB 4XO4A 5E7FA 4NHCL 2YEQA 3T6VA 2J8UE 1YJDC 3SHSA 4B9CA 1J0YA 5ADPL 3MRMB 4GO8A 4F7KA 4JL2A 2O4EA 2HMIC 5TDPA 2DLFL 5E8OB 1N10A 4Q2ZB 4XBMA 4U1LB 3U7YH 3MLSH 3DTUB 1OTUC 1X9UA 1LTXA 4GAYB 4NKMA 5FGCB 4U1IA 5CZRA 4L4TD 4ZX4A 2ENQA 3VTAA 2V4LA 4PRHE 4WJG3 3V4UL 4PGJA 5FK9B 5IEHB 1WDAA 3FH8A 3QR1A 4UIKH 1SLXA 4N0UE 3GMRB 1SRDA 2EYRA 4Q6YA 4QJ5B 1TEFA 1E9OA 1MFCH 2XXFA 1YN6B 4C8XA 1TZOA 4H8PA 3FQXA 5PCYA 1RZFH 3GGWA 2O61A 4PJIA 2B7DT 6TAAA 3LHAA 4LL1A 5DWPA 3B83A 3NAAH 2G2PA 3TEWA 4R4BA 2Y9RT 1FORH 2E8ZA 3IGFA 3A4AA 1BQSA 2BWQA 2IH8A 2XI9A 3IN2A 5E0QA 3FOLA 2VNCA 3ARGD 3ULVL 3M17B 1QYGH 1GYCA 3LJ3A 4HS3B 3WCYA 5I1EL 2IOOA 1OD7A 2Z65C 1OCWL 1BVNP 2DY2A 2EIDA 3AT0A 1IKFH 4FHKA 3GEFA 1JOIA 4YNYA 4FKEA 4NJAL 5DWUH 1BD2B 2OTPA 4ZOCA 1G7LA 5FKPB 1P1VA 3E1F1 4G6AC 1ZLSH 2PNDA 4DGVL 1MCKA 2MRYA 5KVGL 4JZJC 2GCYA 3FSZA 5AD0A 1MW1A 3MX0B 4NQXB 4LCUB 2WQVA 3VO0A 4IKIA 5EN2A 2MPAH 2K1MA 1AKJB 3T6QC 4ZSOA 4LSDA 5LNDA 2AJZA 2P5EE 3VU2A 3VWJB 2OCCB 2VDOH 1KN4L 3DOHA 4J3BA 5E6IA 4BSJA 1RJYB 3L4VA 4FYSA 2CUMA 5MEND 5KYWA 3BCFA 4U3XA 4L8DA 1JZDC 5AB9A 4XX1E 3HMXL 1IGMH 2VDQB 2CXGA 3HUJB 3A6CL 3ETSA 4J4PA 4QJ3B 4K4KA 4JM4H 2LFGA 2R2HA 5ITBH 1NBYA 3FZUC 2YLKA 1C1EL 3W0WA 3DWTA 4AEEA 3BQVA 3IDYC 2V2XB 3UBXI 1TSHA 2UX6A 3QUZB 1ZTMA 3FCBA 1M6OA 4MA3A 4MJ5A 4NZRL 4N0CC 1DANU 2E46A 3DJRA 3MXWL 4MRBA 5AKRA 2AI0H 1DSWA 4JO2H 4PREA 4JREC 1E7VA 1G0XA 3OWEA 4RFOL 5EUKB 4UT9L 3TF4A 1UA3A 5JTWA 1BQUA 1WJ3A 2DYPB 5ALBL 4PJFF 1KTLA 2VXQL 5ILTL 4JZOA 1MCFA 4ETYA 1IAII 4BHUI 4HWNA 1FYTE 1DVXA 5CGYC 5IQNA 2WLLB 4F2EA 3WNJA 2WQSA 4OVVA 2ZJSL 2Z92A 4FXLA 1U8KB 3MV8B 1UM6L 4LCCA 2YAFA 1EEUA 4CW1B 2ZSWA 1NLBL 2ALAA 5HPMA 4L2YA 4M43H 5IFHL 3LDBC 1QD0A 5KS9E 4OCWH 4NQEA 1CS6A 5FYKH 4JG9A 3SGJA 5I1DB 3B43A 3NCJH 2XY1A 3BC9A 5D7SL 1U8PA 3QIBA 7FABH 3JVFC 1RFDH 5C3IA 1PG7L 3Q2LA 1XQ4A 5C6TH 5DS8B 1JZ2A 4JHBA 3X3GH 3RVWC 3EYQC 1GW6A 5F7WC 1X5GA 2DBLL 2VLJA 4LBEB 1A02N 5G4MA 1ZT1A 2DJ4A 1MCWW 3DUHA 4TUOA 3AXLA 3ETBJ 1HCZA 3L3OC 4YZWA 2NY3B 3PWJA 3FB6A 1RUAH 2B59B 3ZE1B 4OFIA 3DMMA 2CO3A 5CAYB 5I5IA 2XN9D 4Z3FA 5A16A 2GITA 3KPNB 5E6RB 1YMMA 1OAYH 3IXTB 5HD8C 2EXYD 3HR5A 4F8LA 4ZXBD 2B4CC 2W0FA 3OJ2C 3WENA 4A2FA 2XV0A 5F7DB 1TCRA 3R4RA 3FL7A 2F18A 1UXSB 2ITCA 2WZPA 3KWUA 3KPSA 3B9KB 3NFSH 3WFCH 2BSBA 4XVJH 1RIVL 4FEIA 4IBSA 3QUKB 2CHWA 3O4LD 5K33A 4UTAL 2VR8A 4N1HB 4JG1H 4PJHA 3O6LL 1F90H 2ZP8A 5ECJE 5C2UB 4G1MB 2ROYA 4G9FE 1S8DA 4V11A 5TDOB 2H32H 3FQ4A 4EEEA 4XMXA 2YN5A 1CGVA 4WSGA 3LS5H 2DL9A 4EI6A 1FQ9C 4TULH 1RZJC 3APMA 3QAZB 3UGUA 4LP5A 4JKLA 2H0FA 4ABQA 3JTTA 3OF6D 3QZBA 2NNAB 3HFFA 3W38A 5FC9A 4U1NA 1KB5A 2RCSH 5GZOC 4X6BB 5H4ZA 2B15A 3DK2A 3K6SB 4K94L 3WTUA 4OT1L 3EO0B 2QVIA 1X6LA 2D7TH 1HVXA 4XVUC 4X7SL 2KYIA 1SJXA 3E8VA 3B3IB 3OKMA 1T83C 1R0AL 2K3HA 4FQXA 1GOGA 3QJOA 3D85D 5JUEL 4XCFH 4TQPA 2QLVB 5CBAB 5IVXF 5I74B 4EOWH 4OF8A 3LQAL 1LO3H 1O5DT 3ZDXB 2D7OA 4GOSA 4YBHA 5DJDB 3B9AA 4BSVB 4PIBA 1FHGA 3DNKA 4MLSA 3TPUB 5F1KC 4OZGF 4HUUB 1EUUA 1RY7B 1TYJA 3S36H 4ZMTA 4Q9QL 5D6DC 4IM8A 1E40A 1DLHA 5EO1B 3SE4A 1OHZA 2K0RA 4LSPH 1RUMH 2WXKA 1PQZB 5E94B 4NRZA 4PLKC 3UEQA 2GK0A 3SE3A 4Y16A 2E9BA 4IKKA 4Y5YC 5MERB 5K69A 1Q0XL 1UHVA 3CVDA 3RGVC 2UX7A 5DT1H 1H3WM 3OHXB 3JWDH 2BERA 1BA9A 1PSKL 1VPOL 4NO0A 3W9DB 4PJ5B 3L13A 2Q8AH 5I1IL 5AVRB 4OCLC 3KLAB 1F3JA 4H5SB 5FB8B 5GS1A 1GSKA 4RGNC 1KPVB 4M9OA 3VXUB 4X5RA 4UAOB 2XFXB 4DW2L 1U8MA 1QLEH 1NIDA 1Z7JA 3MTXA 1G9NC 1L6XA 2FVNA 4JDZA 4Y2DD 5DC4B 5FDYA 5EFIA 3HZMB 4FHBD 4JFEE 4OCMC 3VFUB 5EOQL 3IEAA 2BIHA 5LBGA 3VGAC 4XN5A 2BNRE 4M5YL 1UXWB 4LEBA 3ZDYE 3DI3B 2X9ZA 1AIFB 1HCYA 5CSZB 1P53A 4P23C 4AZ8B 3IDNA 3IMVA 1VGEH 5TQ0H 4F2MA 4MMXB 1RIUL 3QS2A 4OY9A 4JHWH 1AHWA 1S7RA 3UO1L 2AJVL 1DFBH 4GXUN 2XQBL 1B2WH 3WFBL 4XNZC 3DVNA 3T5WA 3WBDA 2AITA 1PGRB 2PO6B 3Q8FA 3U1SL 2GC7C 1Y6KR 1CFVL 2FATL 4N8UA 3V6ZB 3ARFC 4P46D 5DJ6A 2NY7L 5J12C 3RPIB 3KHQA 3SODB 1DVYA 3MNZB 3TZVA 3QDGB 2VMEA 3K7UA 5FYLH 4K15A 2NYYC 1AP2A 4XPAL 4TUJB 5DHYB 4L5FH 4TNVK 4KUZL 4GBXC 1URLA 3OLIA 1I1AD 4HOWA 5AB1A 4X0KA 1MREL 4YIQA 1M2VA 3OR6B 1QUPA 5KSBF 1JGLH 3DIFA 2F7PA 2HH0L 3UTSE 2VH5H 2COQA 3S3JA 5J3HD 3CD4A 4X7DC 4OFYD 3V2AR 1JYWA 2N7AA 4M8VA 5C3LD 2EE0A 5DMIH 3LZPA 5HY9B 5KTEL 5T5NF 4HKJA 2CLVA 4HWEL 3FS9A 4P2QE 1G1KA 3GSOA 4CGUB 2G0KA 3WIFA 2VE6A 3FB5B 3FHEA 4OF5A 3T2PA 4OZIF 4ZW7A 1RXLA 4HOZA 3UBGA 1H5BB 4FCHA 1OAZL 2CLZA 3I02A 1G4RA 3FNKA 4AQEA 2DL2A 3P77A 4PJ8B 1IAKA 4NKIH 2O30A 3E6HA 4PJ7F 5DSCB 2WQAA 5L7XL 3FO0H 4I0PC 5HHMB 1EZLA 1CLCA 2XVGA 3CN3A 1HKLL 1DJXA 5A2LH 3G6JB 3BD4A 1CN4A 1X5FA 3QUMA 2XWJB 2XVKA 3OLDA 4P2CG 2YOAA 2LLLA 4QGYA 5H35B 5CD5D 5A6LA 2WLNA 3G5XA 5KVDH 3V4PA 4HQQH 1M4KA 2A83A 2V3DA 4G9DB 5KJRL 4NQSB 2VN6A 2BSEA 1IGJB 1OTTD 4OQTA 3RFZB 3H9HB 2D4DA 3LKQA 2J1WA 5DGRA 3QUYC 2AV1A 2OJ1A 5CZVH 4R83A 1MW3A 4NZDA 3CFIC 1GH7A 1RQ5A 5G2NA 2WXGA 1SY6A 2DYRB 2XNAA 4B9YA 2VUYA 1ZJBA 3KVDD 3OQRA 2CRMA 4JDVB 4YE4L 2QVTA 2H0PA 3DXAB 1T22B 4WWPA 4YO0A 4ZUUB 3KGSA 2AKRA 3NA9H 3QG6B 4ODTL 3E1ZA 5E03A 5DC2A 4DERA 3FRUA 2VDNH 3WE6B 1GZHC 2IQAA 4Y4HD 1YY8B 5E95B 2Z35A 3H9ZA 1S46A 1YQ2A 3L5XH 1LEKB 5JOFB 3U9PL 1HU8A 1J5HA 3RP1A 2YAMA 4PGBB 5T3ZL 4EBQH 2DAVA 5I5MA 2G60H 1GGIH 3WNKA 2R1XB 1RL1A 3MJ9H 4OUUA 4OGZA 1YNTB 3BQUB 5DDHA 5I15L 1PLAA 3ARDC 5KSAD 1ZK5A 2V37A 3GZKA 4GUPB 4XC3L 3IGUA 1U8IB 5I18H 3CH8A 1IAOB 3VI3A 2BP0A 4GSXA 1CL7L 4X4KA 4W6XB 5J1AB 3QNZB 5JPNC 1JMXA 5FUCC 5LUMA 3KEHA 2EH8L 3IJHA 4YXLH 3MRNB 3WJMB 4FFTA 3QI9A 1ACZA 4JPWL 4OCYL 4OZ4A 5B8CA 3QDMD 1BVZA 3ZT5A 4KJWC 3WJLC 3TBTB 3F83A 1NBVL 3OC5A 3T65A 1X5MA 1TQBC 3S8FB 2YK1L 3K72A 1WQVT 3E38A 1VCAA 3S4SA 4R84A 1BIIA 3C5SA 4LKCB 3TT1L 5A3IC 2EIZA 4J3SA 4M7LT 1ETA1 3WO3B 3SQRA 4QF1B 3RX5A 3MZTA 1SFHA 4S1DD 1TETH 3IE9A 5K9KB 1P4LB 2WWKT 4JM2F 1BOGA 2YQ2A 1N9PA 4PY7A 5AW6B 3RTQD 4A63A 3EH1A 2D7PA 2GJ6E 1IKNC 4A39A 5IWLA 3S8WA 5AW7B 3EO1A 1KTKE 1UEYA 1OGAD 2YEVB 4D0CA 3H1ZA 3O2VL 2ISDA 1PG7W 1GGCL 4U3CA 4X0NA 1D5ZA 5AW9B 3SDYL 1U8JA 3GXUB 4XOAA 3ABGA 4I3SH 5GZNA 4ELMB 2W9DH 1PYWB 3VXSA 4P5SA 4PJ6A 1EHKB 4LPVA 5AUMA 2Y5EA 3PQYB 4OQTL 5KUMA 1X4YA 4WNJA 5ESAA 1NLDH 4PJEE 4N2LA 3WFDH 1R3JA 4HZ1A 2HFTA 5F8QC 4OGQC 5JHDA 5E2TL 3LRHA 3B2MA 1VEPA 2AAAA 5F9OL 4XMPL 1NCWL 4OGXL 4LOFA 1BAWA 3GBNL 2HT3C 3PY9A 2RJMA 3MI6A 2G2NA 3KVQA 4H44C 2WSKA 4WHDA 4RIRB 3IJSA 3O8XA 2CA4A 4PRIE 4AGOA 3DGDA 4PB9H 5GXBB 2IVFC 3BKMH 3O6MH 4CN6A 4QRUA 1J9QA 2BY3A 4J3OF 3TO2A 4PR5B 2YARA 1IC7H 4LNRB 5K9JL 2A6KB 1CD1A 4RDBA 3H3BC 1TDQA 2XXMB 1DVTA 4WFGE 4AEIH 3AZUA 3T1FB 1BF8A 3E6FA 1X5HA 2VDKH 4QRAA 3HBGA 3Q48A 1F5WA 1GIGH 1S9YA 4LRNH 2QADB 3P30H 1CJYA 3CG8A 3DVGA 2IGFL 3WE1A 3B8YA 4DNLA 3GDBA 2KI6A 2J73A 1E0OB 2FLBT 2XUWA 1QKZH 4QXVA 5ICXB 3V52L 2ODIA 1TJGH 5JA9A 1JD7A 1V8HA 3FRPB 8PAZA 1MCEA 3HW7A 3JWNC 2FGWL 4AQ1A 5FHBL 3LX9A 2HVJA 1CCZA 2D3VA 1BW8A 2IO5A 4P57B 1JPTH 1C08B 1KGYE 3NSXA 1TNMA 1BM3H 2FUQA 5E6UB 4MQXC 3LV3A 4KVCL 1QWUA 3DV4B 2EEFA 2RGSA 5CILH 4PP1C 4QXGL 5TF1H 4L4TE 2JCCA 1B3JA 3BZDA 3MUGB 1OP5K 3THML 2PYFB 4BA8A 3DSFL 3IU4L 4KOBA 3MRBA 1TQCC 5J11B 1XR9A 2PPDA 3ECBA 4YE0A 4ZMWA 3G5WA 4B9PA 5DK0A 4KTGA 4L8BB 4XNQB 1BD2D 2GG1A 5LCVH 3J2PA 1C8PA 4QT5A 1PX3A 1XGYL 3MJGX 5T5FH 4AG4L 4KK6D 2K8QA 5JW4N 5GSVB 2XN2A 4R0LC 1BLNB 3RX9A 4EMZA 3JSSA 5CD3B 3I3DA 4NN6C 5BRPA 4PIRF 1AKJD 1T4WA 1QSFA 1S9WB 4JFVA 4LFHG 1JK8B 1JXJA 4XN1A 4NKOB 5B38G 1P7QA 3VWJD 2J25A 1Z5LA 3HHSA 4HJJL 3S6CA 4ZO6A 2UXTA 2EVHA 1V7NL 4IRSC 4DPCX 1AG6A 1O9VA 4E9WA 4EQ3A 1CXFA 5BVPL 3UZVA 5KVMC 2X70B 1RPQA 5HHXL 4X98B 3GJFK 2ZKHL 3M1BB 5I8OH 5IW3A 1P5UC 2DDQH 4AENA 4JRXA 3LVEA 3NPSC 2X4SB 1WITA 2X4OB 3BT2L 3GSXA 1MWAH 2EDLA 1RZKC 3QUZD 1MW2A 4X5XA 3ISWA 2I26N 2H9GB 5AB0A 4GMSL 3ULUH 1J9SA 3U2IA 4F57L 3Q0HA 2CGRH 3BP6A 5C0IA 2V2WB 1U41A 2DYPD 4QHPA 1C7TA 5MENE 3BP5B 3MLVL 4HK0A 3O6KL 4HJIA 4XN4A 5FYJL 5DJYB 3REWA 2FEEI 1YUKB 2B3RA 3LVTA 3UGEA 3OVUB 4JHAH 3V7AG 4O2FB 4CRPA 3WEAA 4HEPG 1ZIAA 1IGCL 5D7IA 4BH8A 5F89B 2BSSB 3MV8D 3RA7H 4I48B 1IL1A 3F84A 2VXVH 4Q7DA 3CZLA 3U7YL 2UXFA 1ZLWH 2X2JA 3ET9F 5HDBB 1BP3B 4PI0A 1N4XH 4PG2A 4UQ2A 2JJVA 3VFVA 4NLHA 3R7RA 2ZNWA 1FVEB 4UIKL 3C75A 3MRCA 4FLOA 4OIIH 1WTLA 2J20A 4X7EC 1VAHA 3LN5B 3DI2B 1QVOA 2OZ4A 1G7HA 2BRQA 3QEGH 4OI8A 4NN7B 3QPQC 2QKIB 3DHUA 3SGDI 1RZFL 3WFHB 3GXPA 4AE1A 2O72A 3ZW3A 3CWGA 3VFOA 1KNOB 5E4IA 1QFUH 2ICWI 3FB7B 3NAAL 4Y4FB 4LCWB 1AGCB 1FORL 1I1CA 2NY3D 3HCVA 2EE3A 3LRKA 4QNPF 5LDSA 3BYTA 1S7XB 2YQGA 5GRVL 3RJOA 3DRQB 5G4NA 3VXRA 2VDMB 3KGTA 1MFUA 5FO9A 3ZDZE 5ANHA 1QYGL 1D5BB 4YL4A 1G5GA 2G30A 1IKFL 1O6SA 1PMYA 1HYSD 4NQVA 2Y7LA 3DBXB 2DMKA 2BZDA 4L48A 4RNRA 5AZUA 1T66D 3KLLA 4KKBD 4GW5A 5FV1L 4MVBC 3B9KD 1KB9K 5B38A 2O5XL 4M6OH 3ABZA 3NIFF 3NSFA 4I2XE 4LIQH 3W56A 4LKXB 3KPPA 1MN4A 2ZCLH 4GT0A 2UZYA 4KQ3L 3PGFL 2C26A 3SPIA 5DMKB 4H20H 2BY2A 2BIMA 4JFOB 2K3TA 4M1CC 2J8UF 2VDOL 1MH5B 2FHFA 1ECYA 1U92A 2BVOA 3FULA 1QLFA 3DIDA 5CINH 3NCFB 4M61A 5FAAA 1IGML 3QZWB 1G9MC 5JO5A 3LB6D 4CN4A 2A99A 4JM4L 4A04A 2H32A 4RMBA 3PL6B 5ITBL 3OKLB 3ERXA 3DO3A 4UUJB 4RGOL 2FT6A 2IQ9H 3KPOB 3D0LB 1BFOA 1U8HB 3O4OB 1P7KA 4YS4A 4PJEA 1RZ7H 2XG4A 3O4LE 4Y5VB 3VD9A 1ERNA 1P7BA 1MAKA 2W95A 2FJUB 4Z7UA 4M8QA 4F7CA 4KK8D 2AI0L 4JO2L 1G84A 4PI2A 3AQDA 4HEPA 5DQJB 5K9QI 4NNYA 4EO5A 9CGTA 3LZNA 5ITFA 1K9TA 1YQVH 2GY5A 5JZ7D 1G6RH 3OL2A 2D0GA 2JJSC 4CMHC 1PKQE 1JZFA 5C0BA 5L4FA 3T0EB 4NC0B 2WO3B 4KMQA 2AEOA 4HUVA 3HLAA 2BOCB 3OM3B 2XC8A 1MFEL 4YHKH 1A4KB 1HOCB 3UYPA 3OJVC 2UZXA 4M43L 1B6DA 4MNGA 3J7HA 2VSMB 2BVYA 2OL3B 3EDFA 3ME0A 5JIPA 2G2RA 4M7JH 1SDDA 3QDJD 1IC4H 4HZAA 4DVRH 4QO1B 4OCWL 5I9QC 2B1HH 1SLVA 2WLKA 4JZNB 1AJ7H 5IJKA 3NCJL 3VYNA 3QYMA 3IFPA 4A2GA 1ZGLM 1EANA 2QSQA 1FSKC 4FL4C 1JV2B 1WGVA 2WWMC 3WTSA 1RFDL 2NR6A 3TO4B 4PJ5D 4B7LA 3HOGA 3QQ3A 5C6TL 3ALXA 3VD0A 2CK0H 3OR7B 3X3GL 4YHIA 1SHSA 3RLSA 3VXUD 3Q3GA 1N0LB 1KG0A 1QO3B 2DICA 3WNNA 5F7HA 2H8PA 2ESVA 4MNQB 2DKMA 3PGCA 2EYTA 2IXQB 4L4TA 2MKWA 1P5VB 4M00A 1RUAL 1FNEB 4OVUA 3NJFA 2UY7A 1BAFH 1AHKA 2IDTA 3A4DA 2X28A 5ID1B 4MMZC 1L5GA 5D1QE 3ROLA 1OAYL 3QNYA 2VDRH 2ATKB 4U6VH 1HJCA 3TBYB 3KWWB 4L9LA 4OJAA 3VXOB 4C56A 3P73A 1B4LA 4DQOH 3EOBB 1SEBA 3ZTEA 4FFWD 3NFSL 4GEIA 3WFCL 4XVJL 3P9LA 1HCVA 5FM4A 5E9NA 4R96B 5EU6A 1UXMA 4JEGB 1XCTA 2PO6D 4LRIA 4E9QA 4LEXH 4UAHA 4XNMB 1ZOXA 3HC3H 2MOVA 3PF2A 3J07A 4JG1L 4XN7A 1F90L 3D1MC 5BRZE 2AJYH 3UTTB 5AVQB 3WY4A 2FCBA 3QDGD 1ETJA 4JDEA 1KBWA 3U25A 4NERA 4UDUA 2IALA 1KIQA 3LS5L 1K2DB 3BWAB 5E1AB 2MTPA 3H6JA 3LXBA 1A1OB 4DTGH 1F6AB 2GBVA 3N43B 5KS9F 4XTRC 5DJCB 4KHTH 5C0AB 2RCSL 3OWRA 4UNVA 4UDTB 3QORB 4X8JA 2ZXWB 1AI1H 4W4OC 4WKZA 2D7TL 4FERA 1MIMH 1MUJA 2GUYA 4KX8A 3ULVE 4KXZI 2Q2EB 4FMVA 1RLBA 3QEHA 3HKZA 4XCFL 4JJ5A 1USQA 4FG2A 4EOWL 4PJ8D 4NENB 1Y18B 1LO3L 4TVUA 5IQ9A 4FQHB 2JIXA 3KYMA 2OKMA 5HHMD 2NXZD 5I0XA 4NFDA 4MQ7A 3G5VA 2ICEB 4IRZH 4LPWA 3EBHA 4NI6A 3S36L 1BREA 2HXAA 3DUSB 4HEMA 4LSPL 2J56A 5KYXA 4H2CA 1RUML 4PCKA 5HSFA 4KJYB 5EF1A 4LSRL 4JB9H 4HJGB 1AGBA 3N1QC 1WRFA 4GRLB 1YCSA 2FEJA 2V9UA 3DX9B 5E8EA 1E28A 1J5OH 4I18A 3AREA 1XDTT 5DT1L 3D69B 3MJ7A 3JWDL 4HBQA 3EDEA 3CFBB 1DANT 3DXAD 2HN7B 2LQRA 3NG5A 1XTLA 2GJZB 2XU9A 1WV7T 1AZZC 4P5TC 3UZEA 3QA3B 3GIVA 1EEYB 2B1AH 1O9WA 3LPFA 3OZKA 5T1KB 1QLEL 3BUQA 5ES4B 2AQ3A 3IAGC 3IK2A 3M86A 1UASA 4G1EB 3PGDB 5DTFB 3ZKMC 1A6ZB 3JQOB 5D4QA 2OTUB 3I3EA 2IV9A 4NUJB 5FW6A 5DJAA 1W15A 5IFAH 3T4YA 1OOWA 4CADB 1YEIH 3BQUD 4ONHB 3V6FA 1AYOA 4PMEA 1B0GB 1MRDH 1ND0A 3RWFA 5EA0H 2ZSVA 2Y2WA 1BYNA 2R4RH 4MD4A 2WQWA 1L0PA 4H0HB 1D5IH 1B6UA 1MFAL 1VGEL 5GRVK 4I2XA 4IBYA 2ADJA 4G42A 4JHWL 5IBUB 4GUOA 1UXLA 1Z9PA 1DFBL 4K5LA 5E6YA 1H6UA 1B2WL 2J2ZB 4HHWA 2HFGH 4BK4A 4F8PA 3VMNA 4ZG1A 1A7NL 3P4NB 3FH5A 2PXYC 5GS2D 2J8HA 5E2UH 1PY9A 1MI5A 1W9XA 1Z0MA 3V8CA 4FYRA 3MRGA 1QEWA 4Z18A 3EYFA 5DJXA 3S5LB 1UFGA 1BPVA 1I3GH 2XN9A 2Y6SD 2WLJA 4U1SA 5FYLL 1KGCD 1IEAB 1AMYA 1T1WA 2NCEA 1CXLA 2VDLB 5CGBA 4BKSC 4L5FL 1JF5A 4HD5A 4TPRH 4ZTEA 1ZVSB 3BWUC 1NC2B 2UZIH 5DFVC 1JGLL 2PW2B 2QFRA 3FCTB 2AQPA 2VH5L 2E7LC 5AL0A 4WI6A 5L9DH 2O93L 3JXAA 5ANMA 2UV3A 5GRJH 5AVYB 1TZAA 4YBLC 5DMIL 3S97C 1XF2B 2HJLA 5MI0C 4DKFH 1JPFA 3NCYP 1QSEB 3SBPA 3BIKB 4K2UL 1I8IA 2WW8A 3TURA 2ZXGA 2E8YA 3IF1A 3QC5X 2VL5B 3QPXH 4LARH 4WK2B 3OKDA 4JFDE 1LNUB 2X89A 3FXIC 5EF3A 4JK0D 1S5IL 3X12A 1ZVYA 2WLIA 3SBRA 1GC1L 3ABKB 3B5HA 1MDTA 3B9DA 3VFNB 3B5GA 5CN3A 4LVNC 5IKCA 5JW5A 4RZKA 3B7UX 3S5YA 1KLFB 2GAZA 4AGMA 15C8H 3FO0L 1V55B 3OF6A 1A9BB 3SDAC 5F88B 2MQ0A 2QQKL 3EOYG 4Y1SA 4ZUSB 3WEXB 2IG2H 4FMKA 4OJEH 3PQYD 5JW3H 4XZUB 1DUYB 5FX3A 2FLMA 1SBSH 3T1WA 2ZIDA 3ZDYF 1BECA 3CN2A 5FUZH 4HQQL 2O5ZH 5DK3A 4PB0H 3KYKH 2G3MA 1FIEA 4WI2A 2ORBL 3SIKA 4AGLA 3Q2CA 3D85A 1BYOA 3P4OB 3RWGA 5BV7B 5CZVL 1CYWA 5I1AB 5JPMC 1F4AA 2FIKA 1IM9B 3R0NA 5CCHE 4K7PX 4ZUVB 2B14A 1WAAE 2XPGB 5MEQA 1K4CB 4I88A 4LVEA 1ZV5A 4NPJA 5KVDL 1JI1A 1UJ3C 3BGMB 3DIVA 2NUPB 3WV0A 2VN7A 2VMJA 1QEXA 4IIQA 2WTPA 2FX9H 2VDNL 3L3KB 1JK9A 5TFSH 1G7MB 3RVXC 2QVMA 2OW7A 3QIWB 5JOPD 4PU2A 2LFEA 3RWEB 2DKUA 2NXYC 4UTBL 5GS0D 2VC2B 4FULA 3L5XL 3CZSA 1XEUA 4TTDD 4W4NA 2Z64C 4GKLA 1BFVH 2R7EA 5K39A 2QADD 4DPAX 3G08B 4EBQL 1QR1A 4KDTA 2G60L 3UERA 4YFLF 2J71A 2WVVA 5E5MB 1GGIL 3T0VA 2V17H 1SDYA 1XGZA 2BP8B 3MJ9L 3TVMA 4BH7A 1NANI 5LWYH 2AP2A 2WXIA 1FZOB 1NCBH 1F13A 3WG7B 3PLYA 3CZUB 4Y5XC 1AD0B 3L4YA 2K6YA 1HHGA 1L9PA 2FWUA 5I18L 2IDCA 2WYTA 4FQ2H 3MBEB 4M56A 1M71B 1R3IH 2NW3B 5D2LB 1W16A 3GBEA 3CFMA 2XKNA 1OSYA 3PJSB 4I4WA 4JQIH 1E5AA 4YXLL 4Y2DA 1S3RA 2GHZA 2XWTB 3PHAA 5E1IA 3S48A 5B1JA 3UBXB 1A1MA 1E8ZA 1U4FA 2OR8A 4PTTB 2X4NB 5CFHA 5LN8A 1LP9E 1C5DA 4U1MA 2ZOWA 1UA7A 4ISVB 3BXNB 1OF2B 4F93B 3ELQA 4MJJA 5J57B 1JS4A 3ZR5A 1U58B 1H8LA 2J1XA 4NYLA 4MAUH 1HXMA 4ZPTA 3RHWK 3QZOA 1E65A 5C0JB 4WI0A 1XF3A 5J13B 2QHLA 4OFKA 2P44B 3ARSA 5DD6A 1HSAB 5DO2D 1OT2A 1WGOA 2Z8VC 4ODXB 1C12B 3VG9B 3NSJA 3C5ZC 3OKEA 1TETL 1X5KA 2WKGA 4JKPH 5E00B 4DEWA 2H3NB 1SMOA 4OM1H 1SOXA 4P46A 4X4XB 1FFNA 2X4QB 3TN0B 2KDGA 3ZGHA 5LNGA 5D7IF 4HXBH 3L5WB 3BAYA 2IAMB 3MNWB 1MG2C 3VFRB 2VISB 3KLKA 3G5ZA 4EDXA 1SQMA 4FLRA 4IU3B 3L3JB 3U6RA 2EINB 2F74A 3RDTC 4GAJH 4X6CB 4I3SL 2UWEB 4XCEA 5GGVL 2W9DL 4K7PY 3IJ8A 4KNUA 5DUBA 4YUEH 2VO8A 4OFYA 5FYJU 1CZ8H 1FCCA 1I1FA 4TUUA 2Z31D 4GXUM 2APTA 3MNDA 4P4KB 2FYYB 3FPYA 3GZPA 3K71B 4KRMB 3VFMA 1NLDL 4Q9CA 3WFDL 2E7MA 3MLUH 2ZXCA 3OAYH 3WN5A 1MWAA 5ICYA 4LU5H 5I19H 1E4WH 2YUXA 2GTZB 1AANA 1FN4B 5F7EH 5ID0B 2PUQT 3DX8B 2OP4L 4F58H 4BELD 2OS7A 5IEKB 5I16B 4K3JL 3FQWB 3U4EB 2KLRA 2X2YA 3ZE0B 3KDPB 1G7IB 4G43B 3B4NA 5A1AA 4PB9L 4XHJC 1WF5A 4Z23A 1WCBA 2HWZH 3O6ML 4G6KH 4YN3A 3JTSB 5IM7A