5BUAA

Lysine 120-acetylated p53 dna binding domain in a complex with dna.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
199
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
publication title Structural Basis for p53 Lys120-Acetylation-Dependent DNA-Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5buaA00
3IGLA 4MZIA 5AOJA 5LAPA 3EXJA 4LO9A 2AHIA 1TSRA 3Q06A 5AOMA 5KBDA 3QYNA 4AGMA 5BUAA 5G4NA 2ATAA 4AGPA 1UOLA 1H9DA 5A7BA 2J1WA 2BIPA 4IBTA 1HJCA 3WTYA 2X0VA 2OCJA 2GEQA 2PCXA 1GZHA 4IBQA 2BINA 2IOMA 5AOKA 1LJMA 4AGLA 3US1A 2J1XA 2J21A 4A63A 3D09A 4QO1B 2XWRA 4LOEA 3D0AA 4L18A 4KVPA 4IBVA 2WGXA 1CO1A 1IO4C 1EANA 1EAQA 2FEJA 4GUOA 3Q01A 4IBWA 3QYMA 5G4MA 3D05A 4AGNA 2P52A 2J1ZA 4L0ZA 3WTTA 3WTUA 2BIOA 2ADYA 4L0YA 5AOLA 4MZRA 4XR8C 3WTVA 3D06A 4IJTA 3KZ8A 4IBSA 1GZHC 1KZYA 2IOOA 3KMDA 3US0A 3IGKA 2XWCA 4LOFA 4G83A 2J1YA 2J6WA 5ECGA 3Q05A 5G4OA 4HJEA 1YCSA 2X0UA 5ABAA 3WTXA 3VD0A 3VD2A 2IOIA 3EXLA 3D07A 1TUPA 2X0WA 2VUKA 2MEJB 2YBGA 5LGYA 2RMNA 3TS8A 2AC0A 2BIMA 1HJBC 3D08A 4IBUA 3VD1A 3WTWA 1HU8A 4GUQA 4G82A 2H1LM 4IBYA 4AGOA 5AOIA 3WTSA 1EAOA 5AB9A 1T4WA 1E50A 1CMOA 4IBZA 4AGQA 2J20A 3WU1A 3ZMEA 2BIQA
chains in the Genus database with same CATH superfamily
3IXAB 3QNFA 3LYRA 3MAWA 2X9YA 3HB3C 2IANA 2VZUA 3MNZA 5E2VL 2WKGA 2E46A 1NWOA 4B96A 4XN5A 1KTBA 2C34A 1QSEE 2C3GA 4YSEA 3O81A 1U92B 1HIML 4O2FA 4TUUA 4AGMA 1EHLH 5JW4Q 1CBVH 4UQ2B 2Y7QA 4C59B 1XF1A 4G11A 4A6YA 1BYNA 1XGYL 5TDOA 4AIXA 5I1JL 5AUMA 4HC1L 1A6TB 1SEBB 1WCQA 2H1PL 1KEMH 5KYYA 4OZIF 2EH8L 1UJ3B 3C08H 5CU5A 1QQDA 2YPLE 3TT1H 3GSOB 2CQVA 2ENQA 1NOFA 3W9DB 1IJNA 1A6VH 2CLRB 3RGVB 3OKYA 2X4QA 1S7SB 4MAYB 2H6PA 2PABA 3HG1B 3T0AA 5E70A 3QC6X 1I3RA 4HKZB 2I07B 4KX9A 5C9JB 1KTLB 1OTSC 3MLYL 2XXMB 1NBZB 2P43B 2X10A 1R3HA 3CMGA 4LFHD 1UTDA 2EP6A 1WBXA 3RE0A 5J5EA 5DTFA 4U1GB 3S36H 2P8PB 3QXUA 1ZT1A 3SJVA 3KWUA 3BUPA 1V54B 3FZUC 4NJ9H 3WENA 4QOKD 2DBJA 4I0KA 5KAQF 2EDQA 5JNYA 1N5AA 4UT6L 3TBWB 4L1SA 4JEGB 5KVDH 2YA0A 3B9EA 1YJDC 4APXB 4CW1A 2WYHA 3CCHB 3CK0H 3AJ7A 3UTPE 4B3VA 3CPUA 4PBWD 3OAUL 4XMXA 3ZYIA 1YEIH 1UCBL 3WXWH 3RZCA 1CN4A 3OV6A 2B4CL 4XE0A 3ZVVA 1N8OE 3LEVL 3NSFA 5DO2D 3TEXA 3AITA 4QLRA 5HDOA 2L7UA 4N6RB 4C4BA 4NFDA 2D3VA 3P4NB 3QCTH 2DQHL 2NW2A 4HS6B 1FPTL 2KLRA 12E8H 2PXYC 3IDYB 4Y5VA 4JQVC 2LW3A 1UWGH 3DC0A 4JO2L 3HE6C 4BA8A 1MN4A 4X2UA 3LHPL 3BGFB 3MLPA 1INDH 1V7MH 1D5IL 4IIQB 3V4LA 1EAPA 4O2CA 1ZVSB 4N2GA 3BKJL 5ID1B 4RMRA 5C08A 1OSYA 3MROB 1VESA 5LBSH 5I1IL 4HZ1A 4L9LC 5HYSA 5IFAL 4H8PA 4DKFH 1RSYA 4IU3B 4K71B 4HUXB 3H85A 3O4LA 4H25B 4BWUA 5EZJB 5L88L 1NC2A 3GI9H 5AAMC 2X3AA 2VL5B 5DRZA 3AMLA 4ZT1A 1GKOA 5I1KH 2JKNA 1RZPA 1JP5A 4RQQB 1KXVA 2AK1L 4OV5B 5HI3D 2VXSL 2VN4A 1CLYH 3VD4A 1CI3M 2BSTB 3QYNA 1SXNA 4PLKD 3VRJB 2LLLA 5CUSL 1DSFH 4U1KB 4DP5X 4DEPC 1T89C 5E23A 1K3ZA 3ZKNC 1A7PH 4I5BB 2ZPKH 4JM4H 4OIAA 4QRBA 5DFVC 2UVFA 5CM1A 3L8QA 2X89A 4KJWD 3MRKB 5EUOF 1JXJA 2ZSVA 3LZFL 2C3VB 3ESVF 3ISRA 5CBAA 4G8GE 2ZAHA 3U30B 1Y1DA 2FWLB 3WS6C 2APWA 1HVXA 1N6QH 5CKGA 2EVIA 4Q14A 2PYFA 1C08B 5CLXA 1B0GB 2G3ZA 3QFDB 4XNQA 4J28A 3DJRA 2J44A 2JKIS 4WO4C 3OR7B 3MLRL 4PCKA 4OVUA 1H5BB 4PV9A 1INEH 3FSVA 2ZZUT 5DJZA 2YARA 3ALPA 4V2CB 1JK8A 3UTZA 3J07A 1OAZL 2YOAA 4FTVA 1WA1X 4D9QE 1MLBA 1IGTB 1NSNL 3E38A 5IOKA 4GKNB 1Q94B 5F2FA 1E4XL 5F7MC 5J6SA 1NFDA 2BVEA 3VDAA 3F84A 5BO1L 1MFVA 5IF0B 2AEQH 4KXBA 4I7ZC 1NCJA 3TX4A 4OCRL 3UJIL 5FEBA 1EDQA 4JFFE 5KVGE 2FZ3A 2Y7MA 3QQ9D 1B2WL 2ZXCA 3NGBC 5DJ8A 5M94B 1D5ZB 1QMUA 4LCCB 4NNYB 5IW6A 1L7TH 2G9HA 2GQHA 1R0AL 3U9PH 1OZTG 3ULUD 3IJYA 1M71B 5G5DB 4RZKA 3FT4A 3BC9A 4BUQA 2AK4A 1EXUB 2IAMD 1P9MA 1HSBB 3MNVA 5D2NE 2R0LH 2OCCB 3D39D 5KVEH 4U3SA 4GUCA 1P7QD 4P2RA 3D07A 2YUWA 3ZL4L 3IMBA 4OLVL 1MREH 3HE7D 1CGUA 3MR9B 5A43C 1KELH 2XN0A 1AIFB 3D08A 3BRGC 1S9WA 2E4TA 4M8QB 3WN5A 2IIJA 4Q9BA 4JFEA 4UIMA 3LIZA 2DLHA 1QWUA 3KWWB 5EIIG 4YSQA 1M1SA 4XMLH 3WLBA 2VRKA 3TJHD 1VF5C 4H40A 1TTGA 4ES8A 4DIXA 5CEXA 4HMDA 1O7DE 4JB9H 2A0LC 3KAAA 4H8WH 2EDTA 3QNYB 1JWSA 2WCGA 4ZFOB 1K4DA 1KUMA 3EUDA 3LHAA 5ICUA 3TA3A 2Z65C 1PZAA 4Q89A 2J12B 3BYTA 4F2ME 5JXAL 1SDDB 4NZUH 2K6YA 3NUKA 4G72B 4K7FB 3OB0H 2H26A 1Q0YL 2AMGA 3QWRD 5F89A 4ILDA 1XGZA 1KBKA 3JQOB 3UAJA 1AZZC 5EZLB 1LEGA 4KO5A 2VLME 3GUTB 2BRRL 4F5CE 2A9NL 2C7FA 2NY4B 4YN3A 1FNEA 2CK0H 4R7NA 1IGYB 5IROA 3WE6A 3LRKA 3Q5TA 4P2AA 1PAZA 2D9QB 4QHNA 2UYLA 2LLGA 3NABL 1RIHL 1U8MA 5ICXB 4GT0A 1JPFA 1TNNA 3RDTA 2AGJL 4ONHB 1BZOA 4HXAL 3STZB 2YD7A 1YYLL 4OI8A 2OAAA 3P3RA 2FJHA 2ITDB 5MERA 3EYFB 3FOMB 1BZ7B 3G5YB 4J3WA 4U1LB 3KJ4B 4PREB 4LSVL 5C3IA 2R2BA 3LKNB 4LSUH 3ILEA 3O6KL 2DTMH 1AYOA 3C5ZC 3ESOA 4UOZA 3RL1A 5AALA 1WIOA 2V2TB 2WOBA 3U0TA 3MV7B 3L81A 2WUBL 4XAKE 5I76B 5T1KA 3ILQD 3EJSA 4PJFE 4FFZA 4MQTB 2X2UA 4PW9A 3FQTB 3FTGB 4RVBA 4PJ7B 5FKPA 2GITA 3PL6A 3QUZB 2MOVA 1S6NA 2NPLX 1G4RA 4PH8A 2CGRL 4Y1AD 3MCG1 4ALAL 1TNMA 5F93C 3SGEH 3ULSA 1BQHA 3VMNA 3VXSE 4JFYB 4JKPH 2Q6WB 3UYPA 3CXHJ 5CU9A 4JX0A 3PAZA 3VFPB 3VD0A 1WZLA 5KSVB 4O02H 3SYCA 3QJHA 5CJXA 1YZZA 3GDCA 3DIDA 1G7MA 5JXEA 3G08B 2O26U 1E4XI 2B20A 4N68A 3SKMA 2N56A 4QXUH 4Z0BH 4DKTA 1AQ8A 2V8MA 2AERT 1RUQH 2VUOA 5JOPE 1A7OH 1YNTA 2XZZA 1TZGL 2NYKA 2W9DL 1BZEA 1P7BA 1X5FA 1DANU 1OCCB 1F6FB 3GSWB 1JZ8A 2ENYA 1SYSA 3OG4B 2IQ9L 3QDGB 2A9BA 3FU5A 5D2NC 4ZW5A 3PQYE 3FB7B 3BPNC 15C8L 3OC5A 5TK4A 4PJXE 3AW5A 2WLZA 4LKCA 1DFBH 3VM7A 1BM3L 2Q10A 3HC2A 3H53A 4JO3H 1E9PA 2VXUH 2QGDA 1ZDQA 3HI5L 1MFMA 1ZRUA 4Y5YB 5IMOA 1FYTA 4YDKH 2VSKB 1PNDA 2PWHA 5IVXF 4HBCL 9CGTA 5JPNC 2ERJB 4DO6A 3OF6D 2B9BA 2EIZA 3UPCA 5CGBA 3N41B 3EZJB 4JZJC 5C71A 5DMKA 3COOA 1AI1L 4C56A 4YHOH 2FTAA 2WXMA 4DAGL 4KVNL 5AZUA 2IWEA 5F72S 4A67A 3WKNA 1EWHA 1UKQA 4WI8A 3US1A 3C60C 2K6WA 3T0DA 3CH1B 4RAUA 1JTPA 1K5NB 3FSZA 3HRZB 4UQAA 1MVUB 2XYCA 4JQIA 2XVBA 4PWIA 4EI6A 4P4RA 3NFPA 5JIMA 3NZ8B 3REWB 1QFOA 5AKSA 1IBFA 2C4XA 4DCQA 3KLAB 5E4IA 5BS0E 2FLMA 2A6KA 5FO7A 2HG0A 1ND0B 4J3OD 4WCYL 2X05A 1OTUC 2R7EA 5HI5C 3K71B 3ARDB 4GMTL 4XGZA 2P52A 3U4EB 2LOEA 1BMWA 1L6ZA 2XDHA 4JRXA 2EIDA 3WTUA 3GZPA 3EFDH 1CBVL 3MLZL 2JTDA 4PGJA 1KPVB 2TRYA 4X83A 5G2NA 4DGIH 1CB4A 2GBVA 4X9HA 1KEML 3A6CH 1LLAA 2VLKE 4X99A 3TBSA 2WXQA 3V52H 1XMWA 2DJSA 5C09E 4HIXH 3R1GL 1PFOA 3GMLA 2PYEB 3GMNA 2GFBB 2R1WA 2YAPA 5C0CA 5FW6A 1QLFB 4YVUA 4M9OA 1OPGL 1DQMH 5BXFA 1DJYA 3ZO9A 4A55A 4Q9RH 3QXAA 1RULL 1P1ZB 3F7YB 1ODAA 4OZFA 3O0LA 1BAFH 3VXNA 5IMLB 5E5MA 1O9ZA 1B3JA 3ZE2B 3AMKA 1CD1B 4CC4A 2DIAA 4YK4B 4LEOA 3S36L 3P0YL 5C0AA 1ILUA 4N28A 3VSTA 4TTGA 1IM3D 4I9WD 3GMRB 1MCRA 1QHPA 3ARUA 1KIRA 3N9GL 4TTDC 4IEFA 4WU7B 1EBPA 1C7TA 4Z7NB 5FYKE 3KYNB 4E41A 1E50A 1MEXL 4YFDB 5F9DC 1IX2A 5D1XE 4PP1C 4L3EA 4PJHA 2O6DA 1B2YA 4XODA 1F4YH 2ZP9A 3RY4A 5DZ9A 3DRTB 4PJIF 1A4JA 3LH2H 1CWVA 4U1GC 3OZKA 3X17A 4C58B 5BCAA 5D7JA 5D1QB 4TVPE 4IRJB 1CF8H 4AYFB 3ARFC 1G7IA 2JB6B 5AYUL 3BP6B 2F53D 1SHSA 5L4IA 2NW3B 4P46C 2BZDA 2OBGA 1PW3A 4JUSA 1UWGL 2FO8A 5T3ZE 1RIUL 5F7KC 1BG1A 5B1AB 2YEVB 2NYYC 1AG0A 3QFJA 4YWGH 5KYUA 3T2OA 5HGHB 5KSAA 1V7ML 3ARBB 4NQEB 1FG2B 3DX8A 1MCPL 2H45A 4NPJA 1JHTA 2V5RA 3VFNB 3TT3L 4WV1C 2VIRB 4IRSA 3E1F1 5GGTH 3QZOA 3TWYA 1UM6H 1DO6A 1A3LL 4IIZA 4PV8A 3IDYC 3RQ3A 5ABDE 4KROB 4G43B 3N1MC 1IGIH 2P5WD 5D7LA 5HVGB 3LKQA 4ELMB 1M6UA 2KQMA 3UXFA 3GI9L 3BVUA 2ZAGA 5IVZA 2HUHA 1X5XA 4P5RA 4EDWH 2WYTA 3ULVH 2G5BB 3BI9X 4U7MA 4FG6D 1PEWA 3BEWB 4Y2NA 5FCUL 2GY7B 1X4XA 2DW5A 3TVMB 3DO4A 2JK5A 1WLHA 1ZKAA 1CLYL 3UMTA 5K9JL 4XC1H 4BZ1A 4UV4H 3KXFE 2BCKB 4XP4L 4ZPTB 3ARGA 3EDKA 3GRBA 2XV3A 4MYPA 4L37B 2YA2A 4JO5A 5BVJB 4NHCH 3BYYA 3RVXD 3VXMB 3DX7A 1NGXB 2F8XC 1U42A 2FWSA 1KCLA 3W37A 1TJGH 3U6RB 4FFYH 4XVUD 1NPUA 3MUZ1 1THAA 2IJ0C 5D1ZC 3IPBA 4LLYB 3TBYB 4FXKA 3AM8A 2KKQA 1RCYA 5T1LD 5M95B 4ZBJA 4L8DA 1M2OA 1VKXB 4HK0A 2WHVA 3Q05A 4IBLT 1BOGA 3VQ2C 2OZNA 4MJJA 1JZEA 3E6FB 3N42F 4JM0A 4OFQA 2XG5B 4K94C 4A7GA 5C6TH 1IBGL 5KJ4A 4QYAA 5IKCB 1OIOA 1WGVA 1S78D 4NO3B 2PO6B 2DM7A 2XJKA 1DVTA 2P49B 3LN5B 2WTRA 3RZWA 1FORH 1WITA 4WFEE 1O9VA 4PLOB 4IGBB 1MHCB 1GMIA 2AFNA 3U82B 4EIBA 2O6CA 2IEPA 3EBIA 1R3KB 3NJLA 1Z5LB 4G6KL 1E5AA 5BOZG 4JPSA 3OLGA 1F3DH 1QUNA 1H6TA 2BIIA 3LVEA 4ZUWA 4BGLA 4ZTEA 3CD4A 1J1XL 3MV8A 5JHDD 2WYZA 5CO1A 4HT1H 5D70L 5FOJA 3MUUA 1A9BB 3VXPB 3CBKB 3FU6A 1YUKB 4H8QA 4HKXB 5DC9B 1YEGL 1B9ZA 4TXVB 5KVEL 3UP1A 1B90A 4JGJA 4ODXA 1ZHKA 2O5YH 2UUDK 4HSAC 3BSHA 4NQXA 3HNSL 4TNWK 1VZHA 4P4KB 2VZSA 4LCCC 5DFWH 4Z7OE 3PHOA 3MLVL 3RY6A 5B39A 1NCBL 1P4IH 5D4QA 5FYKU 4F7EA 1I1RA 1PZCA 1RZ7H 2RACA 2Y7NA 1FFNB 1FL6A 4A63A 2NOYA 4AT6B 3NZHH 2DMCA 4XMLL 5HGGS 1Z9PA 4BE6A 1URIA 4HULB 1BAWA 1XBRA 2GEEA 4KJQD 4LFHG 3HBPA 5DURD 1BD2D 4CU7A 1L0YA 4PRHD 3NIGF 3SPHA 2FEJA 2MQ0A 3Q3GA 2D9CA 1H15A 3MBWA 1BQSA 4U6HA 2UXTA 5TF0A 2OMYB 4POYA 4KTEH 5E03A 3SKOA 4DGVH 3B9AA 1JE6A 1JZ4A 3QDMA 1QKZH 1BVLB 4QWWC 3WGUB 3TESA 1G1KA 2C4FU 1TG8A 3O41A 4A7TA 4Z1PA 1ZVNA 2DYPB 2H1XA 3T1FA 4DFHA 1MH5B 5J56B 1ZK9A 3RWJB 3JV0A 4M4PA 3QIWB 4GKSA 1FIGL 3BPOC 3BVVA 3ISYA 3KYKL 3B83A 2X1XR 1AH1A 2B0SH 1I3VA 4GBXA 3H8NA 4UM9D 2PR4H 1X9UA 3SQRA 3P4MB 3G5XA 1E7UA 3LKPB 4UBDD 4DWHA 2OI9B 2ED6A 4X9YA 2HH0L 1BYPA 1KBPA 2Y6SC 1HHHA 3U1PA 1LQSR 3BAIA 4DVRL 5L0QB 2AC0A 3C5JA 3OHXB 2CDGA 1WC7B 2GTZB 4PRDB 1RUAL 2E8ZA 4DKEH 1ZLUK 1DBAH 4FLSA 4KK6D 4U05A 1KIUB 1WFIA 2BIHA 2NSXA 5BJTB 1A3RH 1ZV5A 4F8PA 3IM1A 4R83A 5GISL 4FXTA 4NRYB 4OKVA 5JR1H 4U6XA 4IHOA 2VXQH 1NFIA 3OX8B 2P5EE 1N9PA 3EFOB 3HA0A 3GEWB 3GSNB 5KSBF 5DWUL 4AM0A 1U91B 1I1YA 2BHFA 4HWZA 3SEPA 2HZHA 1K6QL 5GJSH 1O0VA 2DV6A 4H8VA 1R17A 5JW5A 5HTSA 1BLNB 2ENPA 1SUJA 1PF3A 1SN0A 5I1GH 1WAEA 5I8OL 1C5BL 1QLRB 2DH2A 3KJ4C 2E59A 5HPMB 4BELD 1LE9A 5MEOA 3BP7B 2IWKA 3KW8A 4L8CB 4EUPG 3MLTA 1TZIB 1V3KA 1J0HA 2ATPB 3LEXB 1L9QA 3NSYA 1FFRA 5HHPA 3STLB 4QHMA 3ZYOA 4W9EC 4XP1H 4ODUA 4HW6A 1JYVA 2VXTL 3ARSA 3P2TA 3VMOA 3BIKA 4XWOD 1S8DA 2BNRB 1ZHBA 1EXGA 2ZWYA 3QUZC 3FCSA 1RHHA 2FATL 2NX5A 1A7OL 2J1XA 4OFYA 1P4BH 4ODBD 4YSRA 5FYJH 4FQIH 2WVUA 2GKIA 4XZUA 3KGSA 4MJIA 3CFUA 4EI5C 3PABB 4ZS6D 1ROCA 3ETTA 2WC7A 5E4AA 5DHVA 4I2XB 4JDTH 3LZLA 3EYQC 3K2KA 4KRPC 2HVJA 4L4TB 3T0BA 1OWWA 4CILA 1Z2KA 3L3OA 5DCCA 3WIHH 3VE0B 1DFBL 3DUUA 1S9XA 2XACC 1JZ2A 3A4EA 2D7TH 3HUJB 3N0AA 4NCC2 1A25A 2OMTA 4ZDHB 5LNDA 2XNAA 4M1CD 3W0WA 4G42A 1CICA 1LO4H 3ZHLA 4WK0B 1XGPB 2D31B 4U1JB 1N64H 1XR8B 2IBBA 2X40A 4P49A 3GLZA 3BGMA 4DP2X 4XB7A 2IDQA 2FK9A 4LT7A 4Y5XA 2AABL 4LARL 5LVEA 3WKYA 3VFSB 2ADJB 4FXGA 2PTVA 1HHIA 1A2YB 4G8AC 4ZW6A 1JUFA 2BVQB 4UM8A 1XB6A 4XP6H 5TQ0L 4R9HA 4PJEF 3EJRA 1R5VB 2VN7A 1I82A 2WLYA 2A6JA 4R4FH 2VDMB 2ERJC 1MG2C 4WK4B 2Q8BH 4OM0H 2VH5H 2IANB 3MNZB 3GJFK 4BQBA 3KPMA 3JWNE 1SLXA 3QJTB 3DETD 1UWFA 4HPYH 1MCDA 3H9HA 4FAAB 4O2FB 5SWZD 4DK3A 1YYCA 5A6MA 4LSQL 1UYWH 1DP0A 5KBLA 3CVHA 3OKOA 1JTTA 2HTLD 4A6YB 1T6WA 4OF6A 5TDOB 5AUMB 5DRNA 1SHMA 1G7LA 5KYYB 4GQ9H 3GT6A 4K2UL 4BCZA 1F56A 3GXTA 4JZNA 3IJ7A 2Z91A 3VH8G 1R3IH 2K4WA 3A6CL 4OCLC 2A99A 4O9HH 2B15A 1GGBH 4KTDH 3TV3L 3ZDZF 2X4QB 3AXLA 3EJYC 4PP2A 2H6PB 2WWOA 4B9FA 1T04A 1I3RB 3FYEB 1MF2H 2HRHA 1CVRA 5CZVL 2ZX9A 4KUCF 1MI5D 1RERA 1ZTXE 3NRQA 1DQML 1EFXD 3QZWA 3R4RA 3GHBL 4XPFH 1R3HB 3UZVA 3WNJA 4XN9A 5KOVC 1BAFL 3PP4H 3QORD 4KFZC 5DTFB 1MCOH 4ZD3L 1IC5L 3S3BB 1ZT1B 1SOXA 3SJVB 2ALAA 1XH1A 4C4KT 4KHTH 3BE1H 5BUPA 4Y1TA 3LNEA 3B7SA 5AYQA 3U0WL 5JNYB 3CQPA 2AV1A 1GC1H 2W59A 1N5AB 3ESMA 3EYOA 4TQEL 4CW1B 1Q9KA 3SDYL 4M6NH 4P0DA 1HINL 1UWXH 3RZCB 5E4EB 4NIYE 1O7VA 4V1DA 1LMKA 5E56A 3AG4B 2BHYA 3SGEI 3UZEC 5H35A 3AT0A 4GRLD 3H9SE 2PCPA 1HYSC 2OSLA 1JV2A 4YK4C 3CX5K 2X1PA 3W1ZA 4PRBA 2NW2B 1WSST 2F58H 1ECZA 3AABA 4GAAA 2E9BA 3HB3D 4Y5VB 2QBWA 4GI9A 1CF8L 1LGVA 4QRRA 3WJLC 1KJ3H 1B6DA 3DKHA 3ATDA 3LDBB 5D9SA 3ZSSA 4UMGA 3H55A 3RUGE 5I75B 1EO7A 4BKTC 2ARJQ 3VNZA 1PSKH 3A3YB 2GT9A 3APFA 1EAPB 1U33A 3EADA 4O2CB 2YUZA 3R8QA 3UERA 4JK0D 4PJ8A 2FQFA 1BBDH 5C08B 2ADGA 2W38A 2AEIT 5HYSB 4QRPA 5IJKC 1WZAA 5AZ2H 4FGMA 3EH1A 3ZIYA 1UQSA 2NTFA 2DWYA 4AY0A 5GGTL 4FABL 1JMXA 1UM6L 3O4LB 4GNKB 5HDBB 2OJ1A 4MNQD 1NC2B 4P2OC 4PAZA 2CR6A 1FFTB 5BRZE 4DNLA 5DRZB 1IGIL 2VUKA 2HRPH 2C9AA 4FZ8L 1OTTC 1ED3A 3V4PA 1FP5A 4ODVH 1SLUA 2X6CA 2Z31C 3G5WA 4UINH 5FOBA 4WF7A 1VZIA 3DX4A 1NL0H 3HAEG 1JK9A 1G5GA 5AL0A 3IMWA 3L48A 1OTSD 3D33A 5DMYA 1E2ZA 5CF3A 1FH2A 3L13A 3HI6L 4LLVA 4UV4L 2X4OA 3FZUD 1U4FA 3MXVL 4KROC 1J8SA 5BOPA 4KI5F 3CSPA 4AQAA 2QVMA 1J5CA 4CN4A 1GY1A 3BKYH 1PZ2A 2ZSVB 1A21A 2NNFA 3DSFH 4X80L 5CBAB 3QWQB 5DUML 4LSSH 3ULUH 1I7ZA 1TJGL 3JWNC 3K72A 4LK4A 4NKMA 4FF9A 4XNQB 4BFRA 3QGVA 2H0FA 4G6FB 3GSQA 4IJ3C 1LO3H 2BS71 1TJIH 4BSWA 3F6JA 1P4LA 2DQDL 4PV9B 1KYOK 4U1MA 5E8OA 5DJZB 4BK4A 2APVA 5HYEA 1RD6A 1JK8B 3K3QA 3UTZB 4Q74A 5TE4H 1JGEA 5E8DH 1HDMA 4FTVB 4M6OH 4OZIA 1MLBB 2GBAA 5A16A 2X5PA 4GY4A 3Q8CA 5IB1A 1RURL 4NZDA 4AVIA 2WVVA 2JCCE 5J1SC 4HWNA 5LAXA 2XTJB 2EDMA 2CJSA 5ADPH 2H3NA 1NFDB 2AJUL 1N4XL 3V4UL 2H32H 4LCWA 4FC3E 2FZ3B 3OAYH 1G0XA 5TPWH 5DJ8B 1OD9A 5CJBA 5IW6B 5T33H 1A0QL 1IGFH 2DDQH 2G9HB 2RD0A 3B9KA 4NHUA 5DGRA 3NZSA 3UC0H 3IJYB 2PO6C 3K6OA 3FT4B 2AK4B 4J4PA 1QBBA 2WBWB 4Z7QE 4HCFA 3MNVB 1TMQA 2B3IA 1CGYA 1TTFA 5B3NA 3QQXA 4U3SB 3V6OC 4HT1L 4P2RB 5CSGA 5HY9A 2VLRB 4EN3A 5E08H 1ZPUA 1QSZA 2RQ8A 3BP4A 5E1AA 2AEOA 5C3LD 4DF9A 1TPXC 2AMUA 2F18A 5B7MA 3H0TA 1BIHA 2CBPA 3WY3A 1S9WB 1K4CA 2Z35A 3ASWA 5EU7C 3ZTJH 3WN5B 4JHUA 3HMWH 4JFEB 5AKVA 4BXSV 4UIMB 1BREA 5E1QA 5FR3A 3NEEA 1CLVA 7FABH 3WLBB 4PJCA 4ODTL 4KOCA 4D9LH 4RWHA 2IDSA 4J8QA 4J2QA 3TO4A 5DRWB 1UEYA 5CEXB 1W72L 2QHLA 1JGVL 1FO0H 3TN0D 1JWSB 1QSED 3FQ4A 1K4DB 5F88A 3TA3B 5HDQH 3P9MA 1HN1A 3IU4H 4WO4D 3SGJC 1HJBC 1R47A 2HB0A 2X6MA 3NCJH 4FL4C 4Z6AT 4Z7IA 3IVKA 4ZTOL 2P28B 4QCIA 2H26B 2K3HA 1V7NH 4WWPA 2EICA 4OCWL 3F00A 5F89B 1MJUH 3ZRSA 4DGVL 3BAEH 3H3PL 1LEGB 3U4AA 2F1EA 1QKZL 3UROR 3CZUB 2CIIA 4BFNA 1FNEB 1NCIA 4R7NB 3WE6B 3VTMA 1PKOA 4DSYA 3H7BA 5IB2A 4QHNB 4N2FA 1G1OA 2UYLB 4OW6A 2XY1A 1E5BA 1U8MB 4XHJC 5DJYA 3MNDA 1JPFB 3RDTB 5IJCC 1AHWA 1PX3A 2PN5A 5JIIA 3NJJA 4PI2A 2FECL 3FQRA 5ACZA 5A7BA 2WZ6A 2FJHB 3PPEA 2V37A 4AQ8A 2TRHA 2LV4A 3UPRA 3I9AA 5MERB 2VDKH 2EXTA 3POCA 4FA8A 1BIIA 2NR6A 2IALA 2VTFA 3HAEH 5EUOA 2OV0A 4HCRH 4RZCB 3QIWC 3RP1A 5I16A 2R2BB 4OQTL 1EA9C 3IN0A 3P54A 4H2AA 3RL1B 3U0TB 3O6FA 4LLDA 4M03A 5T1KB 3B37A 2VXQL 2OI9C 2AJSL 3Q6GL 4XMPH 3CDYA 2JFCA 5FKPB 1LP9E 2GITB 3PL6B 1AQHA 4ZQTA 5MENE 1HXKA 2BS9A 3OHXC 3BSZA 4KVCL 4GMSL 3KPTA 3ULSB 4F8TA 1BQHB 3QQ4A 1MFBH 3WFDL 4UTBA 2QPFA 2WANA 3UYPB 4ZW7A 4ADJA 1MCWW 1XGTA 3QJHB 2WZ5A 3CN2A 4YHML 4ZUSA 4X7DC 5SWSA 5CMAA 3WNLA 1N5YH 4H26A 4KUZH 3SKMB 3V0DA 1C16A 4XP1L 4I0PA 5B38A 2W0FA 4AC4A 2WVSA 3N1PC 3VA2C 3IF1A 2WLMA 1YNTB 2J3SA 1TTBA 1NMCC 4HSQA 2N1TE 1AC0A 2D4DA 4ZFQA 4G71B 3OJMB 1R1CA 1SYSB 4LASL 1II4E 3DGCR 4NWTH 4U1HA 4F2FA 3EXLA 3F85A 4JO4L 1DVFA 1F42A 2VLLA 3F83A 4N2DA 3VG9B 3MYZA 4POZD 4HC1A 5T1JA 4KU1A 4LKCB 4RFOH 2ZUWA 1RK0A 2FH8A 4JDTL 5A3IC 4OZGE 2DJMA 4J3OH 3FHEA 1TQBB 3BH8A 1E9PB 5JHAA 5GZND 5DGQA 3ZIMA 1WBYA 4G7YH 4H4NA 1ID5I 1UD2A 5IMOB 1FYTB 4UOW1 2LHAA 2VR8A 2YRPA 1NGYA 4LGSB 3K8LA 2EIZB 2XX0A 8PAZA 3ARXA 2BM3A 1FZOA 3GXIA 4G8GD 4OIBA 4MCNA 1IFHH 4XCCL 4XCEA 5DMKB 2HX9A 4C56B 3SBWC 3C5ZD 1L3WA 4IM8A 4MFHA 5LAPA 3UOAB 3UTQA 1KCKA 1XB3A 1TVDA 3JVGC 3T2QA 1G87A 4RAUB 3RVWC 5HYJE 4XP6L 4EI6B 4I89A 5C3TA 4P4RB 3NFPB 4UT6A 3DYOA 2GAZA 3SE9H 4ETYA 4ZUTA 1AACA 3HEIB 4R4FL 4DCQB 1QFWH 3HRPA 4PJ9C 2FJGA 2Q8BL 1GTNA 1TTCA 2A6KB 5FO7B 2DBLH 3VXRE 3RPIA 5AD0A 3HZKA 1DYZA 2R7EB 4KAQH 4GAYA 4XGZB 4GYBA 4EZJA 4WFGD 4JRXB 5TE7H 5DMGC 1RUMH 3L3JA 1O6SA 1T2QL 2E7DA 4EMZA 5LCVH 4XBEL 2XBDA 1AKJA 2OMVA 3VI4F 4GQ9L 4X99B 3TBSB 4UQIM 2OMBA 1TZAA 1R3IL 1UA6L 2NT1A 3D4ZA 3GMLB 3GMNB 2FECI 1HCVA 2R1WB 5C0CB 4B7IA 4O9HL 5BXFB 4EPSA 4R8WH 5LWYL 3QXAB 3N04A 3ISWA 1MF2L 1MCWM 1Z66A 4HUMB 1YPZF 4OZFB 3IGAA 4JRFA 4N9GA 5HHXL 1R3JA 1AO7E 1AD9A 1NAML 3F64A 1WE5A 4JFDD 5E5MB 3VXNB 3HJ0A 2WPGA 5DRXA 2LFGA 4X6FA 1DL7H 3RIAK 5JYMA 4LEOB 3PP4L 5LJYH 5K69A 1MCOL 1N8ZA 5C0AB 4LQ1A 1RZJH 1KIRB 2QFRA 1M7UA 4IEFB 3V95A 3BE1L 4LLQA 4UT7L 2O61A 4DW2H 1OCWH 3ABMB 4E41B 2ALWA 5C0FA 2DWDA 3JWOH 4L3EB 3LRGA 4PJHB 5ECGA 5FGBA 1XCWA 3GM0A 4LSRL 2JSFA 2NY6B 5B7EA 3BN9D 3UJTL 4JM2C 2W0LA 3H1ZA 1A4JB 4Q56A 3C60D 4JFHE 1UH4A 3CFTA 4E5XA 4Z7UE 3V0FA 3CSFA 3FQ1A 3MJ7A 5HHMB 4ZXBB 1JXKA 3OJVC 1GL4B 5D7JB 1TQSA 1XO8A 4LXFA 5DVNA 1G7IB 4H2CA 1AVAA 1LD9A 4HG4J 2F58L 4OJYA 1LHZA 3TJEH 5C0EA 5GSRA 2DEXX 1V5JA 4EE2A 1OTUD 4JFZL 1IKFL 1E6JL 3V5KA 1KJ3L 4OQ1A 5HI5D 3RZCC 3WFCH 1WTLA 2XN9A 3QFJB 5KYUB 1HNYA 4X5XA 5KSAB 4Z9KB 4AQ1C 3DX8B 3PHQA 1MCJA 3MBXL 4PGDA 1JHTB 1DLFH 1HZHL 5AW1B 3OB0K 1BBDL 1XL6A 1KTDA 4IRSB 1F4XL 1A5FL 1D7BA 1EHNA 4PV8B 4WY7H 1A7RH 4Y5VC 3QCUH 2A74C 4XX5A 5D7LB 2C9VA 4F7CA 1E40A 1X9QA 3LKQB 5IVXA 4ZFZA 4N90E 2CKBH 2GJ6A 2XN2A 3RA7H 4MCMA 5DQJA 5IVZB 2QEJA 1OCOB 5CJOL 3UEZA 1SFHA 5GIRA 4LDCA 4NQTA 2AVGA 2JK5B 4JFXA 3PYCA 4N8VA 1KOAA 3D12B 3QUGA 4S0HA 1XVSA 5KYNA 2P47B 5D93C 4PYHA 4W4OA 3ARGB 4KKZA 1MCHA 3T3MB 3BKML 5GGUA 4L18A 4Y2LA 4TTDD 3KPSA 1ES0A 4OT1L 3DX7B 1V8HA 1DBKH 1WBZA 4HS8H 1CJYA 2G0KA 3BKYL 3HG1D 2EKJA 3DSFL 4X7TA 1Y1UA 1KXVC 4PS4L 1P7KA 1MWAH 1DVQA 1NCWL 3P30L 3B4NA 4LSSL 3SDCA 5BVPH 3ULUL 4FXKB 3W39A 1IC0A 5KG9A 1YEDA 3EF7A 4L8DB 4AGNA 4HK0B 1XIWA 2IH9A 1EAJA 1M2VA 1BOGB 3GBNH 3C5XA 1A6ZA 2O5XH 1QZNA 4ZOCA 1MNUH 4B9KC 5AKRA 4H1LA 3MXWH 3S9DB 1RKRA 2C7UA 2CR3A 2Z92A 4APQA 5JOPD 4OF3A 1ZCRA 3RI5K 1TOXA 5TE4L 1JNHA 5IFJB 3ILDA 4M6OL 1HNFA 2QVKA 2WTRB 3NEOA 4DPBX 1T20A 3US9A 3PQYD 5GGVY 3DXAA 4GG8A 3PPSA 5DLLA 5LO7A 3N44F 1SM3H 4PQXA 3PP3H 2DWEA 2X12A 1XB8A 2HAZA 3LNIA 2WAHA 4JBSA 3D48R 1HKFA 1GS7A 1YQ2A 1QUNB 4DP9X 1FL5A 4ZUWB 4G9FA 4YPJA 2EUZA 4IOFD 5LGYA 2P46B 3AY4C 1QUPA 1IGFL 5CD3A 1U8IA 3BSGA 3MV8B 3UC0L 1VGEH 4YZFE 2OMZA 1HFUA 2XTJC 3SYOA 2XWDA 2VW4A 3S5LG 3GBLA 4FCAA 1R4XA 5E6YA 5F9AC 4ZW8A 4ODXB 1ZHKB 4NQXB 3L3HA 1WEJL 2EEAA 4FLRA 4PRPA 2WXLA 3PHOB 2BSED 4QYOA 4NAQA 4PJIA 3WFBH 3W2DH 3SDAA 5B39B 1K5WA 2DQ6A 4F7EB 4BDVA 1X44A 4GP4B 3HMWL 1DVZA 1PDKA 2ZE0A 3AFLA 1FL6B 4XX1E 3MN8A 3N91A 7FABL 1TDQA 5FW7A 3PXHA 2VDPL 4Y4KC 1OWRM 2OP4H 2XA8H 1UACH 4ZPVA 2EDHA 2KZBA 3DOIA 4NGHH 5FUOH 2X09A 2DN7A 4I3SH 2YD5A 2D0GA 5F0MB 5KVDE 3V4VH 1FO0L 2JKWA 1I7UA 5I6PA 5HDQL 1ZDSA 3Q3GB 1H15B 3KYOA 3EHBC 1PLCA 2ZF8A 3IU4L 3MBWB 3PGCA 4H88L 1ADQL 2EH7H 1FGNH 4U6HB 5FFLA 5KOMC 3S34H 3SKOB 4UT9H 1MW0A 5EO9A 2FAUA 1IT9H 1JPTL 1E9QA 5HI4C 3MUGA 4C4UA 1UWEL 2XETA 3O41B 1EJ6A 5K9QI 5C09D 3T1FB 2D3NA 4G59C 3HOGA 3TA3C 5HBBA 1AZUA 1Q0XH 3MFGB 4P3CH 5KVFE 2X1QA 3MRBA 4GKSB 2HCZX 1WRFA 3HHRB 1KV7A 4FMVA 3TIEA 4AQZA 3PWPA 1FI8C 3BPCA 2E7LC 1DEEA 4GBXB 3P3UA 4GRWB 3G5XB 4L4VA 3QAQA 2GIYA 2G0LA 1DHKA 3AQXA 3QP3A 1HHHB 1SJXA 1NICA 7CGTA 1NEZG 1Y18A 1BGXH 3C5JB 2Q2EB 5KBNC 1LL1A 2CDGB 5FXCH 1JCKA 4PJAF 2GUOA 2VDKL 3EOAA 1BQUA 4GW5A 5A16B 3T8XA 1IILE 4S1SL 4CBPA 5IFHL 5IQNA 4OKVB 4HX1A 4NAMA 1PG7H 5GRWA 4NBZB 1COBA 5B8CA 4IHOB 1TF4A 1NFIB 3DO3A 3S35H 4YFEA 5I6NA 3VD2A 3TF4A 3MGAA 4BYHA 3VI3F 3L4WA 4AL8C 1H3GA 4AM0B 4XCFH 3LN9A 1I1YB 4HWZB 1ORSA 4M3KB 3ME0B 4Y4HA 5JW5B 4EJ1C 1HCZA 1L9MA 4LZKA 2IMMA 2V7NA 3GRWL 3ZHDA 1LE9B 2RALA 4KI1A 5FFGA 5MEOB 4M1DL 3RYMA 3CXHK 1MFBL 3MLTB 3PXLA 4JQXA 2IDTA 3SKUD 5T3ZD 4ZS7H 2HMID 5HHPB 4QHMB 2CD0A 2B8OT 3BMVA 4ODUB 5JW4M 3CGTA 4OM1H 4YSCA 1SRDA 4Z7VF 3ALWA 3BIKB 3KBFA 4A2GA 1S8DB 3PL6C 1ZHBB 5DLMH 3FCSB 1RHHB 3U7WH 1VEMA 4QWWD 4DP8X 3ULUF 2NX5B 1UOKA 2MPVA 2EC9U 3EIFA 4TUJA 1JYNA 5FM4A 4XZUB 5D2LF 4MJIB 1MJ8H 3O0RL 4JHBA 3A5VA 1KGJA 3KE0A 3N85L 5CJXC 5F9WB 1NM9A 1CBJA 5DHVB 5I1DB 5JXEC 2LE9A 2HVJB 3HMXH 3L3OB 35C8H 3UG4A 5ICYA 1DN0A 1KENL 5IG7A 3DUUB 1S9XB 3KXFD 5K93A 2ZOUA 3ZKXB 4Y8DC 2OMTB 3U1SH 2XNAB 2YKLH 2Y6SD 2YD3A 4RGNB 4G42B 3W0WB 1CICB 2NY4D 2OSXA 3D4CA 3NTCH 3BGMB 4OCMC 4IBVA 1HKLL 4Y5XB 3EYVA 1IFHL 3VG9C 4OZHE 5IMKA 4XPTL 2VDNB 4FXGB 2W91A 4P9HC 5D5MF 4X9GA 1TQBC 1WTGT 2VERN 2YSSA 4UM8B 1E5YA 4PWEA 5AB2A 3OKMA 2AXGA 1F45A 4GO9A 4UTCA 2WWMC 4XVSH 2A6JB 3EDJA 4PLJC 2VDQH 4ZODA 1KFAL 3VG0H 3L08A 3ZR6A 4HEMA 5JHLL 4XR8C 4DN3H 2JI3A 3TJPA 1TO4A 1ZWIA 3KPMB 2VDRL 4CDHA 3AC0A 5BV7B 4JDEA 1T80A 3H9HB 2DBLL 2IOOA 4GSXA 5AVTB 2FB4H 2YEQA 1BM7A 4MXVF 2YAQA 3CVHB 1ZAGA 3OKOB 2VJXA 4IOSD 3ELAT 5DRNB 5F3HA 1G7LB 4OD1H 2A73A 3QUZD 3EF4A 25C8H 3NJVA 4JZNB 2Z91B 4OGZA 3NIDE 3QUMH 3ZE1B 1AOHA 5E24E 1O5DT 2I69A 2O4EA 3QRLA 1SEQH 1MLCA 4R97C 2P80D 3AXLB 4PP2B 1WFMA 1HAUA 1T04B 2KLTA 1P69B 3AU0A 4BFEA 2OL3L 5AB9A 4KRPD 2WW8A 2DIJA 1QHQA 2GVYA 3QZWB 1CMOA 2Y1YA 3UZVB 4ZAKA 5I17A 3QSKB 4WI2A 3N50A 2A83A 4MA3B 4M8RA 1OAKL 4YHNA 1VPOL 3FQXA 1D5XA 3LIUA 4TMPA 3VNYA 4GI6A 5KSBA 4P2QE 2FIKA 3QDGD 1CFVL 3KPRB 5IB5A 5DR5L 2AV1B 4ZG1A 1Z9SA 1ZLWH 3EYOB 4ZMNA 5AOMA 1BCIA 1Q9KB 1UH3A 4X0KA 3JWOL 3GHEL 2WQXA 5EEVA 1CE1L 4J8RA 1H9DA 1WT5C 3TFKC 2HT2C 2P7TA 5H35B 1X7TA 1YMMA 4F1SA 2OSLB 1JV2B 5IEKA 4RIRA 2FBRA 2E7MA 3TASA 1S7XA 5ELIA 4PRBB 4CC1A 3B3IA 1JAEA 4JL1A 4Y9BA 5FECA 4P57A 4F2EA 4YXLL 5AAPA 5K9OA 2J8OA 4QRRB 3MO1A 1KB5L 5FX3A 3ML9A 4E0RA 3WEBA 4CU6A 2Y2WA 3WFCL 2GT9B 4J39A 1YJDH 5L7XH 4AIEA 4PJ8B 1W91A 2ADGB 3O9WA 1X5MA 4JN1L 5C70A 5D7JC 1WZ1L 2XXCB 3PJSA 4QRPB 2JLLA 2QQKH 1UQSB 2NTFB 4DQOH 1NCAL 2KYIA 4NT6A 1XZWA 5JW3H 3WIFA 5IP4A 2D2CC 2J8UE 3V4PB 3ARDD 2XKSA 2CKBL 4Q0XH 3MV9B 5FOBB 3NDZE 1JK9B 4U33A 4YE4L 1G6RH 4PHZA 4W68A 4O5LH 2XWCA 2P5ED 4LLVB 5EPMA 2FHBA 2J6WA 1CIDA 4FCHA 2R27A 2X4OB 3BO8A 3V0WH 1SLWA 4AQAB 2NQDA 4PJEA 1LK2A 4Y19A 3LX9A 1J0YA 2XWEA 5T5FL 5IVOA 4AK2A 4HPOH 5LG1A 2CBMA 1I7ZB 5EOTA 2FD6H 4NKMB 2WXOA 2Y06H 3K72B 3GIVA 4J3OF 3ROOA 1R46A 4M4RA 4L29A 5D7KE 1MWAL 2CPCA 2GK0B 2IPTH 3GSQB 1MCBA 3ABLB 4S0TD 4XPGL 4BSWB 4OCSH 1P4LB 1PBYA 4TUOA 1LO5A 4U6TA 3TYFA 1NUGA 2IDFA 5E8OB 4U1MB 2H8PA 3FAWA 2Q5BA 1JGEB 2CA4A 1HDMB 3C6SA 3QIBC 4OZIB 3ORJA 4R7DA 5TFSH 6CGTA 5IB1B 1V3LA 2WVVB 5DVMA 2ESVA 3EOTH 1E43A 1YUHA 5LAXB 5DUJA 2X53A 2JIXA 4XNXH 4L8BA 2H3NB 4LLUA 2ZJSL 3V9CA 4CMMA 1HEJC 4OCXL 4HPHA 1NGPH 4LCWB 1PZUB 1LO0H 2C3HA 1B6UA 4JFQA 4M48H 2G75A 4FLQA 2DL2A 2XQBL 5MEQA 3INOA 3QRFM 1D7DA 3RTQA 2J25A 4NHUB 2XIIA 3B9KB 4HUKB 4UF7C 5D1QD 3V0VA 5I6OA 4B7LA 3ABGA 2WO4A 5GJTH 1RUPH 5ISZE 2BRQA 5I74B 5JW4R 4JPIA 4P2OD 4N0UE 3PGDA 4Y2DC 1I8LA 5E8PA 1H9VA 2NRDA 2HP4A 4F15C 1G6VK 3GI8L 5CILL 5KW9L 1VGEL 1OTTD 2O5NA 4N0CD 5HY9B 5KN5A 4EN3B 5AQ0A 3MODL 2ARJA 3BP4B 5E1AB 2MCG1 3VXUA 4NQED 2FGWH 3H0TB 2Z35B 1K4CB 4LGPB 3F5WA 2EECA 3QH3A 2JTYA 4GW4B 1G9NL 1Q72H 5E1HB 3ULAB 1HL9A 2YAFA 4HEPA 2VSCA 3W2DL 4KROD 4PJCB 3HS9A 2HFGL 4S11A 4WFFD 1VACA 2ROYA 3TO4B 3I9GH 4I1PA 3T4AA 1UM4H 1Y6NR 4ZTPH 2JKRM 2VN6A 4BHUI 3BT2H 3QCVL 3IRZA 2NCEA 5AOLA 4CRPA 2WZAA 3FBKA 5F88B 3P9MB 3VSVA 4NGHL 1JFQL 2V33A 3TVMD 1DQJA 3P2DA 3PAUA 4I3SL 4LSTH 1DQDL 3MV01 4FKKA 5ENWA 1BFOA 1GOFA 3IVKB 1G9MC 2L0DA 3CFBA 2QV2A 4QCIB 1N12A 3RY6C 1MCQA 1YYMH 4TOYL 3KR3L 5CJ5A 2HJKA 3LXBA 4LKXA 1MRCH 2BPBA 5LG6A 3VXMD 4N2CA 1MQKH 2FX9L 4MA7H 1OAXL 2CIIB 3DHMA 3RWGA 5AFAA 4X4MA 4EZLA 3VW3H 2FSDA 4P48A 3F6IA 3ARRA 3H7BB 3KPOA 3SPJA 5IB2B 2YK1H 1Q0XL 1S5IH 1YN7A 2ZXWB 3CNKA 3UBGA 1D5MA 1CGXA 4Z7AA 1UG9A 3TEWA 2ADIA 5DJYB 1VCAA 1HK6A 3VXQA 1AHWB 1OO2A 2YD6A 3QARA 4AMKH 5E51A 2WXJA 1JZGA 2PO6D 4P3WA 5I1CH 5IIEA 5H37G 3FQRB 4LCIL 4M8UA 1ZA3A 4FN0A 3UPRB 4X0NA 1TSHA 1BIIB 2YXWA 3K91A 3OTTA 3B6SA 5LBVA 4IGBD 4AVJA 2IALB 4Z8FH 4X6DF 5EUOB 2ITFA 4N8CL 2O93L 5I16B 2BOCA 4KV5F 1MSPA 2ZG1A 5FO9A 5J57B 3V6FA 1J10A 3IT8D 4ZMLA 5D7IE 1UENA 2UY7A 3O6FB 4RWYH 4LLDB 5EOCH 3GNMH 5EG6C 3ULVE 4WHDA 3CFEA 2D73A 1B9KA 3Q1SH 1RK1A 1KY6A 5EZOH 3ZK0A 3ARWA 1EHAA 1F97A 4OLXL 2A4ZA 5E7BA 1NKRA 2JNZA 2Z4TA 3U36A 3RBSA 3QQ4B 5H4YA 4LLWA 3QZBA 1ZTMA 4AGLA 2K1MA 4PVBA 5L2KE 1XGTB 1FFQA 3C8DA 4HIHA 2WQSA 1WUNT 2Q20A 4P4KD 4ZUSB 3UTTA 5SWSB 3FU0A 5CMAB 4H26B 1UWXK 4ZS7L 1C16B 3OR6A 4M5ZL 3VDCA 4I0PB 1XQ4A 5B38B 2W0FB 4PJBF 1IO4C 2WAQA 3IF1B 1EAQA 4LQFH 3BWAA 5DLML 3JV5A 4XO8A 2BSSA 5FHBH 4H20H 2X1OA 4M5TA 3LNHA 3MRPA 2NY0C 5D7HA 1T7XA 1PZ3A 4U1HB 1X7QA 3D51A 4K5OA 4V1DE 1DVFB 2BFGA 2VLLB 2V9RA 1UVQA 2NUTA 5I1HL 1IC7H 1W80A 1RK0B 3B2XA 1KCUH 2X4SA 4XHJD 3HMXL 4GIOA 2XU9A 3BH8B 4LPTA 1BJ1J 2WSPA 2CBTA 3DX1A 4LIQH 1WBYB 4RNRA 2VQUA 2DI8A 1I7TA 1ACYH 2C1OA 3SCMA 5KVGH 2ZICA 1NGYB 2DYPD 2YKLL 2V6HA 4JDZA 1KBWA 5DD0L 2X6VA 2QZQA 4MMZC 3H2PA 2UXGA 4LVNC 1DBJH 1FZOB 4ZNEE 3QIWD 3UP6A 4FNQA 4X8GA 1VHPA 3NCYS 2WWKO 3UTQB 3L3OC 3QUYC 1FN4A 3O2DH 3ZKXC 2WZPD 4P5TA 1NCDH 1I7RA 2FBOJ 4HJTA 4NAJA 2GAZB 5HJBA 4ZUTB 1LVEA 1B3IA 3CC1A 3DV4A 4RMVA 5CSBA 1ONQA 1MHEA 2FJGB 4M43H 4KHXL 4A04A 4MS6A 2F74A 3RPIB 5AD0B 3HZKB 4Y5XC 1DJXA 2VLJE 4TQHA 2JB5H 2VR6A 4J12A 1J8HA 5AW0B 3GINA 4GAYB 4PR5A 1CXLA 1DVSA 2DQUH 3REVA 3OQ3B 3HC4L 1UXMA 2FB4L 2QQNL 4WENB 3L3JB 1O6SB 2XX1A 2AJ3A 5AW7B 3I85A 1TQWA 3F7VA 3QDJE 1AKJB 2OMVB 3FUIA 3JYCA 4UI2A 4OD1L 1QSFA 2HFTA 1A47A 1CTNA 4HCIA 2Y72A 4HIPA 5EO1A 4Q2ZA 4MA8H 3ZJAA 2J71A 3HR6A 5BV7C 1IVTA 3UZQA 3KL0A 4LLAA 4N25A 2DQEL 3EG9A 1QBLL 3DA0A 1FLRH 3FTWA 5A3ID 3IGAB 5LGHH 4N9GB 1FSKB 2IXQA 1R3JB 1AD9B 3I50H 1FAKT 2VGLM 3OAYK 2BNRD 3OPZH 1YC8A 5DT1H 5GGTA 3P3YA 5HGAA 5DRXB 1PZDA 4X6FB 1AJ7H 3FU3A 5HHQA 3K8MA 3O11A 5E0FA 4W6WB 1N8ZB 4K07A 4UOJA 1WFNA 2E9WA 3TYGH 4AUYA 4YSUA 4KZ0A 2FWOA 1JBJA 1MY7A 4OFVA 4LLQB 5JA8B 2O61B 2YN3A 2H5UA 1UADC 5EU3A 2DWDB 5C0FB 3EO1A 3EYSH 1PU0A 3T2PA 2ZSWA 4GEIA 1YVLA 2CXKA 3LRMA 4YR6A 2ADYA 1DCEA 3KLQA 2RTTA 4AX3A 3C2SA 2DQTH 4E5XB 4ONFH 3EJQA 2LAAA 4ETQA 4WI0A 4OLWH 3MJ7B 1RZKC 4KKNA 3E8UH 4KX7A 1NKOA 4FHKA 4GIAA 2EIEA 2XIBA 1LD9B 3C6LA 4PJ9D 4HU8A 1KY7A 5C0EB 5DEJA 5GSRB 4D9RE 5GXBB 3OM3B 4OUOA 3V5KB 3EKCA 3TP4A 4XWGL 2LAGB 3QWNA 2XN9B 1TXKA 3EDFA 5CEYA 1NMBL 2YMXH 4ADIA 5DMGD 5J11C 3PHQB 4R84A 3BOVA 1BJ1H 1S9YA 3QXDA 4TUKH 4PGDB 5L7XL 3LPFA 4CC0A 3FN0H 1KTDB 3VAEA 3L9EA 2JVUA 4GW1A 5EDSA 2IAND 1QR4A 2VC2L 2CHWA 4HJJH 2IV8A 4KKQA 2IO5A 4PPTA 5D7EA 2YQ2A 1ZD6A 2EE6A 4W9JC 5A2FA 5IVXB 1YN6A 5F97E 2GJ6B 1KPUA 3MRIA 2XV0A 4LGRB 1CXFA 2DQCL 1SBSL 5DQJB 5FYJE 4EVNA 2OSWA 1CFNA 5GIRB 5KUMA 4U7SA 1F8TL 1KGIA 2F9BT 4PJ8C 4JFXB 1MFDL 2HPTA 1QRNA 3QEHA 3UG3A 4N8VB 3RWEA 3KGTA 4YDNA 4ERSH 1D6EA 1M7DB 2HVKA 3CFKA 4O5LL 4LPXA 4Y88A 1J5OH 2Q76A 5GGUB 5G4NA 1S3KL 3NACL 5IBTH 5MEND 3KPSB 1ES0B 3TXAA 1WBZB 3MRNA 1NANI 4Q6YA 4YSTA 4X7TB 2CCLA 4D2NA 1UATA 4HPOL 1N67A 3SDCB 3GGWA 2PCXA 2ZNWA 4HLZH 2VR5A 4KMLB 1YEDB 3FKUS 4NUJA 4RMQA 3W39B 5KG9B 1M2VB 4AG4L 4RBPH 1HX0A 4IK7A 4ODHL 2ZOOA 3IJ9A 1A6ZB 2IPTL 4CA4A 1JGIA 32C2A 3NIFF 4RSYA 3S5ZA 4GT7A 4H1LB 3SJVD 1UXWA 3BUQA 5DD1L 2QR0A 4A38A 4OCSL 2C7UB 4HK3N 2NDGA 2XSKA 2Z92B 4APQB 3F04A 3QJSB 1W72A 1L9SA 1KDJA 4X5WA 3B8SA 1JNHB 1DR9A 3VI4A 4HH8A 4RRPA 3V5DA 1N68A 1T20B 4LBAA 4TSAH 2ZCLH 3EOTL 3RZCD 3DXAB 4GG8B 3UCRA 1EHXA 4KK8C 1BZ9A 5IEHA 4QOKE 2MQGA 2YHGA 1NGPL 2JJUA 2DWEB 4UYQA 4HXBL 1VIWA 4YDMA 3WJJC 5GS1A 3F58H 1KTKE 4GXUM 3F6LA 1FL5B 1JVLA 1YPZA 4G9FB 1KBGH 1WS8A 2YGQA 4M62H 5CD3B 1U8IB 3BW9A 3Q1EA 4JNXA 4K94H 2OMZB 2HPOA 3PUUA 4OFPA 1ZANL 3F65A 5E9DA 1MAKA 4BK5A 1N0XL 4YXKH 5DXWA 2IGTA 2OZ4H 1Z1WA 4UTAH 2X0UA 3ZTEA 2GTQA 3L3HB 4AQOA 3O2VL 5C08D 3HHMA 1RZGA 2AQPA 3NJKA 4PRPB 4QYOB 2X2JA 4PJIB 3SDAB 3U6XS 1OCZB 4BDVB 1SHXA 1ZY9A 1Q72L 1UT9A 3BD4A 1PDKB 5DK0A 1ACXA 3Q2CA 3O4LD 2NXZC 1NC2D 2DB8A 3L7EA 4J3TA 2F2HA 1E4WL 4OQTA 4ZPVB 3D2UA 1OB1A 4BXVA 1ACZA 3O45A 2WCSA 1OT4A 1UM4L 2EYSA 4R5XA 2WNWA 3HN8A 2A9AA 2XLLA 3BT2L 2ZXDA 1HHGA 1I7UB 1Z9LA 1ZGLA 2R0WL 2VXQA 3QDMB 6FABL 3KYOB 1MZZA 3PGCB 5EBLA 3BKCH 2DWXA 1FBIL 5E6RB 3U46A 3WS3A 3MV11 1C8PA 3BQUA 3PV6A 4IRZL 4UZSA 5EO9B 2XZCL 1XF3A 2HJFA 4B95C 2X89D 3S98A 3PUCA 2QGBA 3H42L 1E9QB 4YBQC 3MUGB 4MMXA 1O5PA 1MQKL 2BFVH 3FUDA 3IDXH 2MIZA 5E8EA 4FA6A 3OKLA 3MRBB 4JAMA 3UACA 2YUXA 3VW3L 1NZRA 3G7TA 3TIEB 3PWPB 3BPCB 4JFWA 1BA9A 2YK1L 4L4JA 1S5IL 1DEEB 5E9NA 1AXSA 1JYWA 1A6UL 1N2RA 4WEMB 3SE3C 3OWRA 4L4VB 5T3ZH 5AG8A 2Z1KA 5DZPA 5TQ2H 1FWXA 2OYPA 1T1YA 5ESVA 3T6VA 4FTVD 4HUVA 1X5HA 5FYJU 1JWMA 3VMPA 2R4SH 3DBSA 4RMWA 5CFHA 2LU5A 1Y18B 1NC4D 2ZUQB 2IGFL 1IZKA 5HHNA 5C07A 3PRZA 1PLBA 2XTJD 3SPCA 5T1MB 2GUOB 4RLDA 3B7UX 3EOAB 4Z8FL 4FKHA 3T8XB 3L95A 3M86A 3ZDXE 2EC8A 3NH7L 4HX1B 1GZQA 2BDNL 5B8CB 1T5XA 4FQCH 1OE1A 4JFHD 5C97A 1AHWC 5I8CA 3BFOA 1CURA 5D6CA 1BVNP 3N42B 4G1MA 2IMNA 3FCTA 5FS5A 4AQ8C 2AK4D 1ORSB 1RLWA 2ZKHL 4Y4HB 1Q9OA 3IFNH 4Y4KD 2NR6C 2V7NB 1QFPA 1IGMH 2NNRA 3JVFC 2VDLH 5DFTA 2K9UA 5ANMA 3PJLA 3IGKA 1GVIA 3EHBD 3O6FC 1U3HA 5E6IC 5CD5C 1ZHNA 4JFED 3LZPA 4GLRH 3P0VH 4BQCA 3D39E 4KQ3H 3IS0X 4U49A 3M7OA 2UWEF 3L54A 4N8UA 3DTXA 4HJUA 4PJGF 4X5LA 3EO9H 3L3GA 1CL7L 2F54E 2I26N 5HI4D 1IB5A 3V8CA 4AE1A 3VQMA 4MKMA 4TLTA 1OAQL 2V2XA 4TUJB 5J89A 3TA3D 5FHBL 1Z3GH 4F7PA 1AG6A 1CGSL 5FLUA 3OQRA 2VKXA 2ZYSA 1JPST 4OF7A 1RFDL 1CFSB 5ICYB 1NLDH 1DN0B 1IC7L 1JVKA 4I0PC 5GGQL 5IG7B 2BSRA 3DTUB 1EPFA 4MXQC 3M46A 4JMXA 4L48A 3KH4A 3DVFA 1MJ7L 3GC3A 4N87A 2UZIL 1GYCA 4AJVA 5KVGL 5IROD 2PF6A 3RJDA 3WD5H 3RIFK 1JRHL 1DVFC 1CDJA 4XXDA 5HYQA 3EYVB 2X2HA 1L9NA 1NAMA 5IMKB 3PDGA 3NJMA 2A7BA 4KXDA 4E9SA 5I73B 3NIGB 2MQCA 3IKKA 3K2IA 2NDFA 2YSSB 4KTGA 2CLZA 1YA5A 3OKMB 2AXGB 5DHMC 3HN5A 4OFIA 3CH8A 1F0LA 4ZFFA 3MRJA 5EWIH 4HQQH 5AAWA 5HI3C 5F44A 1QYGL 2QKSA 1OF2A 3NP4A 1NIFA 1ZWIB 4XPAH 4M43L 1I9JH 3ZLQC 2ZF9A 4JDEB 3VSQA 3EGDA 1QO3A 3E9UA 4P05A 5AW4B 4Q6IA 2W80C 4WFHD 3VA6A 4M6MH 4CJ1A 3D5OF 2ICCA 3AY2A 3UJJL 3CLFL 4KJWC 2IFFL 5JTWA 1PFCA 5F3HB 2HKFL 3NCFB 3PL6D 4UMSA 3ZE0E 3U79A 2OSYA 5IJVA 2A73B 5M7QA 3JWNG 1CXKA 1E67A 3KYMA 1S9KC 1LK3H 4U31A 3V5HA 2TSBA 5I30H 3T0EA 1MCCA 1MLCB 1VERA 3JTSA 1OM3L 2ED7A 2BVPA 4HGWA 4ABUA 4OUUA 1KZYA 5C6WH 2C9RA 3K74B 3AB0B 4FMKA 4PJAA 1X5IA 3KLKA 5JXED 4N2LA 1OPOA 4FP8L 1F6AA 3OZ9H 2WB1A 1PD6A 1WD8A 4Y1AE 5I17B 4ZAKB 2VO8A 3PP3K 3AG2B 1U8CA 3I50L 2A83B 4X4XA 1OW0A 1FH5L 3HI1A 5DT1L 3NG5A 4YHNB 3FQXB 5LLIC 4B9CA 1D5XB 4HK3J 4U3XA 5EF1A 3VI3A 2FIKB 4H0HB 1DJIA 1JOIA 5F71A 5IB5B 2MFNA 4XNUL 1Z9SB 5F7DA 1HCYA 4UQCA 1AE6L 4X0KB 2LGNA 3HFMH 3NA4A 5GGRA 4GEJA 4DGYL 4BINA 4L23A 3KDMA 5JQ6L 1OV8A 2ZUVA 4J8RB 3RWDA 2P7TB 4YC2B 1YMMB 2IAMC 3SKJH 1FAIH 1A4CA 5IEKB 1FYTD 2QPEB 4UILH 2WWMD 3EZ8A 4RIRB 4ZQKA 1S7XB 3MTXA 3CMOH 4OLWL 4TQ8A 4Z7VA 3FUFA 4IKJA 4UV7L 3B3IB 1OP4A 2WMPA 3E8UL 4N2AA 2LU7A 4LDLB 1QNZH 3MLWH 4BCXA 4P57B 1J9RA 4HG4K 3V6ZA 5FECB 5K9OB 1JV5A 2CHZA 1KN4L 4NZFA 3MO1B 4NN5C 3SDDA 4C56D 1CL7I 3CDFA 4NQDA 3FW6A 4FFWC 2W92A 1IMHC 1IL1A 4E0RB 1M6OA 3U6XA 5D2LA 3T3PE 2ZCHL 2EEBA 3DGDA 5ALCL 4O00A 4HWEH 4DK5A 3Q2NA 1E28A 2Q86A 1WHPA 1G0YR 5FW8A 1FV1A 3O9WB 4KY1L 4JKKA 1JFHA 3PJSB 3SZ6A 4FNPA 4XNZB 5FDWA 4NT6B 1PNCA 3K0WA 3WIFB 1KN2H 2H41A 4HJJL 4OJFL 1A7BA 1L9RA 3KHQA 1OP3H 1SMDA 5AW6B 1KCVH 1JXGA 4JRXD 2HX8A 2XTLA 4I77H 2A9CA 2XQYK 4XRCA 1IAIH 3MREA 5DK2A 4KK9C 5MP6L 1JHLH 5EPMB 5D5MA 4GFXA 5I6LA 4PRAA 5KVMC 3BO8B 2K45A 2AQTA 1J5OL 4PJEB 1LK2B 2PPAA 4Y19B 1U30A 3L4TA 2DLTA 1ASPA 3K2UL 5C0CD 2H3XC 3OD3A 4NQCE 5EOTB 1JNNH 3FQYA 3GIVB 3ROOB 3CSGA 4M4RB 4L29B 1EGJH 4MRCA 3DJTA 1MFEH 4U0QB 5E2WH 3B8YA 3ESNA 3TWCH 2PTUA 3TFKD 3S2CA 4QLWA 1DJSA 3X12A 3TCXA 4TUOB 1LO5B 3TYFB 3VFVB 1J8KA 5HPOA 2R1XA 2H8PB 6PAZA 4LU5H 2J88L 4X7FC 1JGDA 4K8RC 2IOIA 2GHWB 3CHQA 2X70A 2F5AH 5T5NG 4FKEA 4R7DB 4E41D 5GSVA 4PRNA 4LE8A 1THCA 2ZUYA 1FO0A 2ESVB 5BQ7A 2BIMA 2Y5EA 1GOHA 2JIXB 2WOYA 4L8BB 4LLUB 4CMMB 1G9EA 1ADQA 4HUCA 5FGCB 5C2BH 3ZDZB 5I1AA 1XIWC 2ZCLL 3MA9H 1C1EH 4YFLI 5F7YC 2NNAA 4I9WE 4JFQB 3RJQB 1AQDA 2G75B 2XZQH 3KPPA 4MHHI 2GABA 1D9KA 5F7EH 3JWNH 3NAAL 5HHMD 5MEQB 5T8IA 5D7JD 3F58L 3RTQB 3SDXE 3V0VB 4PJDA 1UJTA 1WF5A 2BNQA 3RAJH 5A2AA 4UIKH 2X3BA 4K3JH 4I1RA 4JPIB 2OW6A 3AT9A 3PGDB 3LEYH 1F11A 1MFCH 4X6EA 5E95B 4RGOH 5E8PB 4JREC 1V55B 4K3GA 4WUUA 4OD2A 3AU1A 5KN5B 3QFJD 3V0GA 1A4KA 3BH9A 2ARJB 3VXUB 1YQVH 1FNFA 1GGCH 1FF5A 2OZ4L 4YHZL 3FFCA 2WO3B 3F5WB 3QH3B 3QPXH 3UBFA 3E2HC 1WG3A 4XVJH 4YFLF 3MZGB 5FK9A 1ZT4A 3MLXH 1BXAA 5CEZD 4B9PA 3SO5A 1VACB 5D7LD 4N0YH 4XNYH 4N26A 2B5IC 2MCPL 1IU1A 2IF7A 5MEPA 4WI5A 3CZNA 1KB9J 3KNBA 4NI3A 4TLKA 1DQJB 4HOMA 4J3VA 1IKNA 1IC1A 1IEAA 1DQVA 1PGRB 1BFOB 5ENWB 2P5WE 3CFBB 3ARGD 5FYKL 3UGXA 5ETUA 4YBHA 2DQMA 2IPUG 4OD3H 2EIBA 2HJKB 1D7CA 1CLZH 3JZYA 4LKXB 3GRWA 3D05A 5DHXB 2BSCA 2XN1A 4BD4A 3GSXA 4XI5C 2CM5A 3RWGB 2ZUSA 5IJDC 2VRAA 2BJML 4XPBH 3O8XB 1LDPH 1BZDA 1KXQA 4BH7A 1FRGH 1B4RA 1M7IA 1WAPA 4JRYA 3KPOB 4C47A 5IQLA 1HQ4A 1GSKA 1YN7B 4IBSA 1KJVA 1PLAA 4TVPL 1D5MB 5I23A 3WUWA 3FYIB 2ADFH 2ADIB 2HXAA 2R69H 4B6ZA 4R4BA 5JO5A 2AZUA 3VXQB 1Q9WA 1QI4A 4PJFF 1KNOA 4M5YH 1K8IA 5T3ZL 1KV3A 5IIEB 4N3UA 2ISDA 5BRQA 1P53A 1JD9A 1ZA3B 2AANA 4AI7A 5HHOA 3B6SB 2ZXEB 2OR7A 1WJ3A 2VRQA 4I3RH 4R26H 3WJMA 5CP3H 3PNRB 2BOCB 4YEFA 4UQBA 2WXPA 3R8BB 5FO9B 4FQ1L 1WAAE 3BZFA 1A6AA 1U2CA 4WW2F 3RURA 3V6FB 4HAKA 3HC3L 1L6PA 1RVFH 3N0PB 2UY7B 1ETB1 4MQXC 3IS1X 3GKWH 3CFEB 2JKTM 4K4KA 5K33A 1AC6A 1RK1B 1XX9C 2KPWA 3NSJA 3FB7A 4F57L 3H3BC 2IADA 1EIBA 2ZUQC 3LRHA 3QIUA 4QAMB 1JS4A 3CDCA 3CLEH 5DMIH 5FIEA 4ZO7A 1WFUA 2FSEA 3WSQL 3U36B 2AAVA 1IGML 4LLWB 3X1BA 3Q6FA 1ZLWK 2VDLL 4HIHB 2XKUA 1XV8A 2W94A 3I02A 4Y5YA 3UTTB 4M7JH 2A1WH 4PJXF 5JHDE 3VTAA 2AQNA 3WFEL 5DU7A 3S37H 4DESA 3OR6B 1MDTA 5EU5A 3S97C 5KSUA 3CV5A 2V3EA 2VL4A 2HG5A 3MJGX 4DP1X 5JHLA 5KSBE 4GG6E 5CZXC 4HFWA 1X4ZA 4KQ3L 3CSYA 5IM7A 1QA9A 3BWAB 3LXUX 3NJXA 1JWUA 2ORBH 5A1AA 1QEXA 3EO9L 4LLMA 2E6PA 5D1ZI 2BSSB 2X7LA 4G7SB 3TNMB 3ZBMA 4U1SA 1W8NA 3MRPB 5E2UH 3M1CA 3SZKC 2Z0BA 4YDZA 4JQXC 3CH1A 1X7QB 2JE8A 3MKKA 5HYIA 2AVFA 1MCIA 4XTRC 4QAWA 2NUTB 1H6FA 1DSWA 1UVQB 1J0KA 3H6JA 4R7LA 2V9TA 4L1TA 2CUHA 5C0RH 1T1ZA 1E9OA 5E5RB 2X4SB 2B77A 4K9EC 3BZEA 5J6HA 1CO1A 3SE4A 4ELDA 4RNRB 3ZKMC 4DOHE 4PRHE 1AGFA 2ZXGA 5E99H 1I7TB 2C1OB 1WH0A 3FRPA 3SCMB 3GSNH 4JDZB 1CXIA 2VJ0A 2OL3A 4GXUN 5I0VA 4YL9A 2F53A 4HWBH 1L5GA 3QHZH 3E9TA 3IAGC 1PCXA 2ETWA 1A1MA 1OAUH 3HNVH 3ZMNA 4GBXD 2O6PA 1F3JA 3IAQA 1DE4A 4AKPA 1TYEB 3J8F7 4XOAA 4E9YA 2EDBA 1MOEA 1FN4B 5K39A 3QS2A 1JMZA 4P5TB 3VD3A 1I7RB 2PYEA 4LSPL 4LOFA 5JIPA 4QR7A 3DUHA 5CN3A 5T3XD 2BXYA 4Z76A 3DV4B 4FG6C 3BMWA 1MHEB 2XWBA 2N7SA 3S4SA 3SGDH 4HQQL 4TF4A 4HJ1A 1JDAA 2F74B 6PCYA 5HYSG 1GCFA 5I5IA 4KKPA 1J8HB 4FDWA 1T83C 4BGDA 3LJ3A 2EEFA 3BPLB 1I9JL 4PR5B 5I73C 2GJJA 3REVB 5EEWA 3C12A 5GHWH 4TSCH 5I8KH 4MSWA 3GXUB 4HMEA 3GSUA 4BHUA 1NCGA 3P3SA 2AJ3B 3T2LA 2D8KA 3V10A 3LOWA 5JHMA 5JIKA 3F7VB 4LF3A 1EO8H 4Z18A 4AJ0A 4ORGA 5DZNA 3NVQA 1QVOA 1O9WA 5I9QB 4ZMAT 1KB5A 1KBVA 4MASA 1QSFB 4MDIA 1LK3L 5EO1B 3ZMEA 2QADB 4Q2ZB 1CGTA 4ZUVA 3UMNA 3WY4A 2NY0D 3IWUA 3UZQB 3ZKSD 3DRQA 5EZIL 2Q8AH 3EG9B 4FOMA 2A77H 2VXVH 1X5KA 3BVDB 5SX4H 3NCYP 4X6DA 3H9ZA 5I26A 4PRIA 1ET8A 1Z7JA 3ARZA 1TSRA 2PW2A 4N2HA 1B4TA 2C26A 2IXQB 1ZGLM 3GMMA 5E6UB 3D0VA 1MIEH 3CX2A 4KKAD 5HGAB 3T2NH 4JKNA 1AKPA 4WUKL 4FD0A 3P4OA 2ATAA 5C2UB 3O11B 2NX5D 1M1XA 3U0PA 2NZ9C 2FWOB 2CKBA 1Z9OA 5CHNA 3HBQA 1Z9MA 2BVUA 4MD0A 5EU3B 3AUVA 3EO1B 1USZA 5DJXA 1R6VA 1BV8A 4ECNA 2ZSWB 4OF8A 2HN7A 3VGDA 2JJSA 4YR6B 4ZMVA 3I75A 3QUYD 4HS3A 2JLPA 3QO0A 1NBVH 3FSOA 1FVCA 3U2JA 4ETQB 4WI0B 2R9HC 1KJ2L 4MDJA 1FAIL 4RGND 2R83A 3W0WD 2DPKA 5KWYC 4CVXA 5T5FA 4A6YH 5F9JA 4UILL 3TGXA 4PJBA 2NY1B 2ZOTA 3EJUA 2DD8H 2G5BA 1DBML 1PKQE 3ASNB 2GJPA 3C6LB 3CMOL 4GLRI 4GRWF 4M1GL 4MNGA 3JUYA 2EIMB 3LD8B 4FE9A 1QNZL 4TSBH 3GQFA 5C0BE 5GZOA 1MWAA 5J12C 4Z7WE 1FE8L 5ABZA 5L2JB 5LGKA 1ZV2A 2WXGA 2PCYA 5CEYB 5K1JA 3VGAB 3EYUL 7PAZA 3GK8H 3HS0A 1T0NA 1S9YB 3QXDB 4R2GB 2FLBT 5CZKA 3V0IA 3UTSA 4N2EA 3JZ7A 3R7QA 1F4WH 3L9YA 4GW1B 1TQCB 4FLOA 3KVDD 3JV6A 4ZZFA 2FQGA 2GSMB 2J1KA 2A5UA 4G83A 1TVBA 2K3TA 5I15L 1YN6B 1KPUB 3MRIB 3CFJA 4CNIA 1KN2L 3APDA 4G6AD 4PB0L 4EVNB 3CN4A 3RX7A 1MY5A 1CFNB 2APSA 1KWKA 1FIEA 3KCPA 4HLEA 2NZIA 1BD2A 4K3DH 4QTIH 4ANVA 1JZ5A 1QRNB 2B9AA 2VMDA 3RWEB 5GS0C 5C0JA 2HVKB 3CFKB 4UQEA 4D8PA 3X13A 2G2PA 2Q76B 3HIZA 5SWZE 5JUEL 2GJZA 4Z78A 3MRNB 4M93C 4JRWA 3GRGA 3KM2A 2MH4A 3V7MA 1AHMA 3WU1A 3R06A 4R90L 1SFDA 3GGWB 1CDUA 4B53A 2R2EA 4K3EH 2HLAA 2DS4A 4KY2A 1JNNL 1TEYA 4NUJB 3X3FH 1EGJL 3AS0A 4BKLA 2W9EH 4DERA 1MFEL 3QEQA 2WNGA 32C2B 5HDRA 2WVTA 3SE6A 1UXWB 3VFGL 5KBDA 1JTOA 2QR0B 5F96L 4KZDH 2QMJA 4K9JA 2WLIA 4PD4J 5GGRY 5ACLA 1W72B 2ZG3A 4LU5L 1MI5E 4X5WB 5TH2A 3QC5X 2EE0A 2QDVA 3LQMA 3VI4B 2DQJL 1OD7A 4WVRA 1X6NA 2F5AL 3V5DB 4OTXH 1P2CA 2Y5TA 4X6CE 4M5SA 1R3LA 2GC7C 4FRWA 4V1DD 4MGXA 1BZ9B 5IEHB 5C2BL 4P07A 1S3RA 4MJ6A 4QPEA 5GS1B 1NJ9A 1SXCA 2DMHA 1PY0A 4Z7OF 1NPJA 2XZQL 1YPZB 1Q1JH 4U0RB 4ZMOA 3EJTA 4KO7A 1CR9L 3KLDA 3BW9B 4WI6A 4QRRD 1T7ZA 2CRMA 3IN2A 4UIKL 3RAJL 3RKPA 2B1HH 2QVIA 1QBML 4JFVA 4UAHA 1MFCL 3IMRA 2XQYA 5DQ9A 2W95A 2L04A 2WBKA 3QZMA 4TPRL 2J57A 4PJ8D 2X9WA 1RZGB 1YQVL 1GGCL 1XSKA 5FYLD 1BQHG 3RTQC 4KJYA 4QRPD 2OK0L 3FQWA 5C92A 1AXTH 5DK0B 4YEEA 5B21A 4PW4A 5I0XA 1TJXA 3MLXL 3X1NA 3L7EB 5F21B 1ZTXL 4UANA 2EO9A 3DV6A 3L5JA 4G7VH 5KZCB 2F8IA 3BDXA 3D2UB 1OB1B 2BP3A 4MBRA 3O45B 4M56A 3BIAX 2YRBA 3WKMH 2EYSB 4DH2A 4ZNCD 5E5LA 1R75A 1AQKH 4XMVA 3CFDA 3ZRCC 3K5SA 1HHGB 2X9XA 5CLYA 3ZE1F 1ZGLB 1I4FA 5EBLB 2FBJH 3U46B 3WFHA 4FG2A 4WI9A 5CIPH 3WS3B 3BQUB 5MI0C 3PV6B 3IFOA 3T0WA 3VD5A 1XF3B 2HJFB 4NI6A 4OD3L 1IC4L 1ID2A 1KEGH 4EKXA 4U6YA 2I24N 4OLEA 3T4AC 1NIEA 2P4AB 4MMXB 1AZNA 4YDLB 1E4KA 2E9IA 3TLRA 2QSCL 2RFXA 5E8EB 3OKLB 4JAMB 1WWWX 4KK8D 3U2IA 3U4KA 5EU6E 3FHAA 1Q0EA 1YEHH 4JO1H 4P23A 1U8NA 1BLNA 5GRVK 1AXSB 1CZ8H 1N2RB 3FB8A 4F7MA 4LO9A 2ADFL 5CN1A 5MHSD 3EUUA 3G6JA 1T1YB 5ESVB 4HUVB 1QTPA 4PCYA 4QTHA 3THMH 1JWMB 3LIZH 3A4AA 4N5UA 1IAII 4DEUA 4Y89A 2Y2YA 5HHNB 5C07B 4DUWA 4E68A 5JOFA 2HTLC 4LCWD 5BZWB 1GHFL 4I3RL 2FT8A 3HMXA 4P59H 5ERWA 3L95B 1WHOA 3ZYZA 2YRLA 1MW2A 4JY5H 4QHKJ 4HWUA 2HKHL 1T5XB 2FL5A 1LJMA 1RVFL 5LXGH 4HKBA 3B9KD 4AUUA 5BMFL 5I8CB 3L2LA 3QJXA 1YEEL 2R56L 5D6CB 3GZKA 2CNZA 1A7QH 4G1MB 4UAOB 3FCTB 2NXZD 4EXKA 1DQLL 1Q9OB 4CKQA 1NBQA 1DCLA 3BAXA 1GS8A 4EN3D 4EBQL 1M3JA 4AYMC 4Y2OA 5ANMB 3OG6B 5LQBH 2A6IA 3QYCA 4CMHB 4GO8A 4JVWA 1BQ5A 1Q8MA 3ENEA 2DM2A 1U3HB 2OR9H 5JQHC 1ZHNB 3B5GA 3B2VH 4M7JL 3N44B 3ROLA 4DZ8A 1XD0A 3DTXB 5CINH 5E1GA 2YS4A 1H3XA 3L3GB 4OB5L 3TO4D 3A24A 4OZFG 3VX0A 3KZ8A 3APCA 3TH2T 2V2XB 4WI7A 4AL8H 3UYRH 3U9UA 1KLFA 3US0A 1RIVL 4B9JA 5E2UL 4IDJH 3FH8A 3QDHA 1QP1A 4XO5A 4F7PB 3BAJA 3BZDA 4NCDA 2EABA 3CWGA 3GTVA 1MIMH 1T3FA 5C0RL 2BSRB 1GPOH 3CVIH 3NFSH 4LEXH 3DROA 1AYRA 4D0BA 1I75A 1HC1A 2P48B 3FTUA 3U7YL 3HKZA 5IJBC 3C09B 2EDWA 5D72L 1C5CH 5E99L 4FQPA 1EEYA 1PX8A 5AW3B 1W6WA 1ZEAL 4XXDB 3FTZA 1WUZA 2XA3A 4NKQB 4X4ZA 4DETA 4F93B 1NAMB 5HYQB 3DHUA 4RISH 4HIIA 4ZMTA 3QHZL 4W9CC 2BX5A 4YHYC 1AR1B 3MCLL 2BK8A 4N5EC 3HNVL 2CLZB 3MRCA 1J87A 3MVSA 5DWPA 3PF2A 4ZFFB 1JHKL 2HX7A 3MRJB 3EBAA 3F01A 3QZLA 3W9EA 1U36A 2BMKA 2NR6D 4G9DA 1OGAA 1OF2B 2AI0L 2HLFC 2WLNA 1PZ5B 1LEIA 4FQQB 1BDYA 4MNQA 1MW1A 3EGDB 1QO3B 3VO0A 1RUKL 1T2XA 4ZSOA 4Q6IB 3O6FD 3NBNA 5F0LB 5E6ID 5I2IA 2I9LA 2DMBA 3DOSA 5CD5D 4X9BA 2J5LC 3M7FB 3NDYE 2OJZH 1GZHA 4JFTA 4P5TC 4RBPK 4A2EA 4TSCL 3QNZA 1BF8A 2GYSA 5DEGA 2YFOA 4QTFA 5IJVB 4F7KA 4YIQA 1BVZA 3NCWA 2R0ZH 3KYMB 4P9HH 4WWID 1TKWA 1H19A 4G6MH 4YXHL 3V5HB 2AEPH 4NSKA 5LB1A 2YMOA 3T0EB 5GGSA 2I60H 3JTSB 5DZAA 2BVPB 4HGWB 4DT2A 4OUUB 4TRPL 4PJCF 2CRZA 4V2BA 2QHRH 3BPLC 4PJAB 5SWSD 1TZ8A 1U8OA 1F6AB 2VXVL 2A77L 2VJ8A 2YQGA 2GC4C 3T0VA 4OFDA 1QOKA 3GLAA 3CFCH 4I0PD 4KNQA 1G4MA 4KJPC 2XYBA 1BFVH 1U8CB 5KVFH 1I9RH 4MXQD 4X4XB 3X1GA 1FGVL 3HI1B 2FX7H 4HU2A 4YMPA 5AZEH 1I31A 3N2JA 3VI3B 2QPDB 2Y07H 5J1AA 1NEPA 4JQIH 2B3RA 3IRPX 1TFPA 1A7NH 5FB8A 2PXYA 5F7DB 4QUOA 3UO8B 3L4VA 3G5VA 3INUL 1DVFD 3KW7A 3L3DA 2FQEA 4JPVH 4PJ5A 4G8EA 1MUJA 1H3PH 5GGRB 1EMTH 3QPQD 2AXWA 3HE6A 3KDMB 4MVBC 4KDTA 4NCC1 3RUGF 3OLEA 4ANWA 3CHXA 4U1NA 3RWDB 4XPHH 4E9QA 1LO2H 1UZ6F 4XVTL 4BH8A 2IH1A 3OGCA 3E7JA 4ZQKB 4Z7VB 2WQRA 3WDHA 3MLUH 4QRTA 2WMPB 2WO2B 4DFIA 1JXFA 2UWEA 3A4DA 4PJGA 4FNUA 5FWQA 3V6ZB 3V55A 1JV5B 2GSGB 5E9DE 5H4ZA 3SDDB 1FFPA 5C0GA 5IESH 3H9YA 3FO1A 4NQDB 3L7FA 1IL1B 4KQ4H 1M6OB 1EAOA 3LQAL 1YSOA 4ONGH 5D2LB 1CPUA 1FNAA 2K0RA 2L7QA 1E28B 2Q86B 4ABVA 4JHAH 2FGZA 2P44B 1FV1B 2XWXA 1DQTA 3AACA 4TNWF 4ABWA 4FZEL 4NN6B 1NGWA 4OZFH 4F92B 4PMEA 1G94A 3ET9F 4MD5A 3TN0C 1CE6A 1IBDA 5AL8A 5FDWB 1T89A 4KC3B 3D3VE 4B0MM 2MTAA 4KKRA 5B39G 1PLGH 2AITA 4HOXA 3LMJH 3HBGA 1U6AH 2JF1A 3QB7C 3VGAC 2HWZH 1BPVA 3V8OA 3GKZA 2E74C 1QSEA 4AITA 4G3YL 4XRCB 2EDJA 1I8UA 3V0JA 3MREB 4R2GC 2NZ1A 5DK2B 5BOJA 2YFNA 2X1WL 3KPNA 5I71C 1FQ9C 3ZTCC 5D5MB 4H5SA 2XJLA 3WHXA 2P8MA 4PRAB 1AKJD 4TL5A 3SD5A 4ZYKA 1TQCC 2AV7A 3QUKA 4LIQE 4UYPA 3IWVA 4WFGE 4J6RH 5CZRA 2LLNA 1JF5A 1QFWM 4NENA 3A6OA 3VGFA 4YHKH 4LOEA 2YPLA 2JCCF 1WFTA 1U8QA 5L9DH 5A2LH 1MCEA 2Z8SA 1Z32X 4BZYA 3SGDI 5CJQL 3N40P 3X12B 3IPFA 1NLBH 3G5ZA <