5BUAA

Lysine 120-acetylated p53 dna binding domain in a complex with dna.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
199
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural Basis for p53 Lys120-Acetylation-Dependent DNA-Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5buaA00
5AOLA 2VUKA 2BIPA 2RMNA 2IOMA 3D08A 3QYNA 3WTVA 3WTYA 1UOLA 2AC0A 1CO1A 2XWRA 3WTUA 5AOKA 5A7BA 4LOFA 4IBZA 1H9DA 1HJBC 3WTSA 4AGOA 4L18A 5ABAA 1T4WA 3US1A 5LAPA 2J6WA 2P52A 3VD2A 1HU8A 5AOMA 5AOIA 4AGQA 2J20A 4IBUA 2XWCA 3WTXA 4IBSA 4G83A 1TUPA 1KZYA 2BIOA 1GZHA 3IGKA 5ECGA 2X0UA 2J21A 3D09A 4IBWA 4AGPA 3VD1A 2BINA 1YCSA 4MZRA 4L0YA 4MZIA 3US0A 3KMDA 3EXJA 1EAQA 2YBGA 5AOJA 4LOEA 3TS8A 3D05A 3QYMA 2H1LM 3Q05A 3ZMEA 4AGLA 2GEQA 2X0WA 3D06A 5G4MA 3WU1A 4IBVA 5LGYA 2ATAA 3WTWA 4GUOA 2IOOA 3KZ8A 2J1WA 5KBDA 3VD0A 1CMOA 2OCJA 4IBTA 4L0ZA 1EAOA 4AGMA 2X0VA 3EXLA 2ADYA 5AB9A 2FEJA 1E50A 2BIQA 3D07A 3WTTA 2WGXA 1GZHC 4A63A 4AGNA 4GUQA 2J1YA 5G4OA 2AHIA 4KVPA 2IOIA 4QO1B 3IGLA 2PCXA 4XR8C 1LJMA 1HJCA 4HJEA 4IBQA 4IBYA 3D0AA 2MEJB 4IJTA 5G4NA 1IO4C 2J1XA 2J1ZA 2BIMA 1TSRA 3Q06A 4G82A 4LO9A 3Q01A 5BUAA 1EANA
chains in the Genus database with same CATH superfamily
1C1EH 1WWBX 2L7EA 2V33A 3AB0C 3K3QA 4P5RA 1AMXA 2YPLB 4YAQA 3MNWB 1DQIA 1J1XH 3V55A 1EO7A 5I30L 5J12B 5FW6A 3FSVA 5TH2B 2ZYHA 3FQWA 5KYYB 1OOWA 4PP2A 5IMLA 3T2NH 1WP6A 4JO2H 1XCTB 2JVUA 2ODIA 4X8GA 3MRGB 4HJJL 5CP3A 3MNZA 4HUXA 4I0PA 3RKDD 2A77L 3ZZSA 1KLFA 1M7UA 2Z93A 5I82A 2OJZH 1SOXA 3KLAB 2WXMA 1DVXA 3K5SA 4OKDA 4QRTB 3NFSL 3O6KH 7TAAA 4FABH 1UT9A 3SGEI 1ETB1 2ZUSA 1U9KA 4LVNC 4U0QB 3GPEA 2PWGA 4EN3B 2PYED 3OX8A 3QZPA 1AGBB 4O5LH 3IDXH 2HT3D 2GK0A 2HPTA 3KCPA 3TTSA 4MJID 5E6SB 2BZCA 3NSJA 4PJFB 1KB9K 1BXXA 2CALA 1UD8A 4FFWC 3GMRA 3T8XB 5A2CA 3I84A 1EMTL 4U2YA 1WZMA 1HTYA 2FL5B 3GRWH 1T0MA 1AYOA 1HI6B 3UEZA 1EEUA 3ZE0E 3ZE2B 1NCCL 4QRPA 1B90A 1O7DE 1A6AB 3IJYA 1N67A 2G5BA 1QNZH 2EDLA 5J1SC 2EXWD 1TITA 4JRXE 2PYFA 2XTJC 2I7OA 4HXAL 5G55A 3EF7A 5K1JA 4R7LA 1W8OA 2H1LM 3C5SA 3PWVB 2GUOB 3P3SA 3UJJH 4X4ME 2J25A 5D72H 4BH8A 4GRLA 1D6VL 2AXFB 1G9HA 1IM3D 1XR8B 4TUUA 3V5KA 5D2NE 4L8SA 4AH2A 2WYTA 1YQ2A 4U3SA 5D96B 3TO4B 5BJTB 1LO4H 4N2IA 4QHUB 2VMDA 3UTTD 2AJUH 1J8HA 1Q9WB 2B9AA 5A7EA 2J5LB 3U48A 3MV01 3T3PB 1QUNB 1UH2A 2ZWZA 2PCFA 3GBDA 1OB1A 3M17B 3O3AA 4HHAA 5DVMA 5TPWL 3WNOA 2K70A 2CIKB 5D1ZC 4S1SH 1WE5A 5B7EA 2EECA 3G08A 1EK3A 3TBWB 2Y23A 4ZFOB 3WIIL 3MRPA 4KKBD 9PCYA 1U8JB 3TGXA 5IK3A 4ODVH 5AB1A 3T0WA 1W8EA 2BP5M 2X70A 4BHUA 3CX2A 3RIFK 1XV8A 4V2CB 5EU6D 2ZNXA 3N55A 4G6JL 5GSVA 5G4NA 3B7RL 3FB5A 4JRWA 4GUPB 4FNSA 3HBPA 1KIRB 2P8MA 3U30B 3CZFA 1MG2C 1OTSC 3OSKA 3IFNH 2ZICA 2J71A 3MRNA 2JKRM 3ZKMC 4TM9A 2O6DA 4MLIA 2HMID 3MLWH 4MJIA 1XMEB 3PGFH 4JANB 2AEWA 3DIDA 3QDJA 4JPVL 1JNNL 1TCMA 3VGEA 5JIPA 1RPUA 4JHAL 1RU9L 4X6BB 3G6AB 3FCUB 4B0MM 4OGYL 2NSMA 3QVAA 3LEYH 4N20A 3LB6D 4DK3A 5FB8A 5GS0D 1NWPA 4MDRA 1SLUA 1HQ4A 1VADB 4JJOA 1KJ2A 1UB5A 1L9SA 2OJEB 3KJ6H 4G9FD 4JZNB 2RIKA 1QEWA 1YUHA 4XPTL 4Z7WF 1PZDA 1ZANL 2Q76A 3QIWD 4M1GL 1MAMH 4ORGB 4YWGL 3WN5B 3MJ8B 5EV7A 3JT2A 1GL4B 2VH5L 3CUPA 1F4WH 5DGQA 4JN2B 3STLB 2WWNA 5B7FA 2WC7A 1J5DA 4R84A 1KGCE 2XWBB 4HEMA 1A7NH 5F3FA 4OFQA 5ITFB 4HA1A 3N91A 3RVWD 5EOTA 3S35H 4CRPA 1R24A 4X2UA 5I1HH 2YO3A 3FFCD 1FRGL 3V5HA 1PW3A 3VGGA 1WVZA 3AITA 8FABB 3VGAB 2AFNA 5F7BA 2VLRE 1F6LL 2R69A 5FK9B 1G7MB 1FJ1A 3L9BA 1OPOA 4HMCA 4U1SA 3T6VA 4MJ5A 4XE0A 1ASPA 3D51A 1ZJBA 5C08E 3MCKA 3IJSB 7FABL 4F7PA 1OAUL 2IAMC 4WCYL 2JTYA 1TLMA 3RHWF 1JWUB 4PJ9C 3LHPH 5KSVA 3M6DA 5AZEH 4OFIA 3K8MA 2JELL 3K4DA 1F00I 4NJAL 2EYRA 3V0FA 2FEJA 4FFYH 1FVCA 5IB2A 3PAZA 1H5BC 1RK0B 1RK1B 3ARDC 2V9UA 5F9OH 4ZW8A 1UACL 3TN0A 4MD0B 1ZOXA 3UBHA 1JF1A 2AHIA 1KGJA 3QHZH 3JWDH 1ZHKA 3PWPB 3Q1SH 4AWJC 5JXAL 1Z0NA 3SKMA 4H2AA 2M2DA 2BNQA 3KD4A 8CGTA 2FNBA 2I07B 3QDGE 1KYAA 1U8LA 4J8QA 3W9EA 1CK0H 3QDAA 3RUGA 2EDJA 3H3BC 1EEYA 3ZYZA 4N2HA 3VI4A 1NCWH 5EC2A 1HKFA 1IEAA 1O6TA 4HJUA 4YXLH 2CMRL 3PL6D 2GFBB 2CGYA 2V5SA 3L5HA 2F58H 3ETBJ 1Z3GH 3OAYH 4CJ0A 4LSSH 3IFPA 4XP1L 3WHE0 5KYWA 2YWZA 2W60B 3MRIA 4GEJA 4X80H 1R3IH 1UJ3C 1NCHA 5JW5A 5CBAA 3C5XA 3CVHB 4H44C 4P0DA 2CKBH 4UIKL 1NCAL 4Z77A 2NXZD 1U8IB 2AV1A 2JB5L 3AVEA 2IEPA 3FRPG 3TT1H 2A6KB 1ZGLM 5CEYA 4G8AC 1R17A 5DD0H 3QZWA 4XNXH 5FUCE 3A6CH 1E4HA 3T71A 3K6NA 3DOSB 5SWSB 3TX4A 4OLWH 1TEGA 1HH9A 3TESA 3LDBB 5FKAA 2DQIH 1NEPA 1AIFA 4JFFA 5KOVC 2Z31D 4WUKL 5EZIL 3OGCA 2CPUA 1E5CA 2R69L 2G4GA 4PG2C 4DAGH 2SEBA 1T1ZB 2ICWJ 5J13C 4XBEH 3AT8A 1RKRA 4LCYB 3DETC 4N5EC 5BMFL 3OKLB 4PRPE 4TQEL 3UBXB 4RAUB 5JHAA 4HJ0D 3PAUA 1EZSA 1ANUA 4TOYH 1BBJB 3QEQE 4CKQA 3FHEA 3BEWB 1HDMA 1CXFA 1GIGL 4TL4A 4JN1L 3BDYH 3MFFB 4PSPA 1AO7B 3DX4A 3GMNA 2FB4L 1NMCB 3QEGH 2WBWB 4PGCA 1T20B 5D9SB 3FQ2A 2EIBA 5EA0L 5LGYA 3TWYA 3VSQA 4R0LC 4JDVA 4QOKD 1S8DA 2VZUA 4FGMA 4B97A 3IJHA 5TQ0L 4UBDC 3RWGA 1BZ7A 1D5XB 2APXA 3IMSA 3REWB 4OLEA 4JM4L 3KPOA 3R0MA 2OYPA 4H1LH 4Z7WE 4YN3A 4M48H 1M4KA 3IDMB 3K4AA 3T65A 5T1JA 3TVMD 2BVPB 4WWKC 1SYVB 2CSPA 1KB5A 2QT6A 2QQKL 1M7DA 1ZSDA 3HG1D 1UZ8B 3RJQB 4HKBA 3DO3A 3FBQA 1DEDA 3CZNA 4HCFA 3NJHA 1JHKH 4PJ7A 1BFOA 4R4NC 4C54A 5BRQA 5KVMC 3UO8B 5ICYA 4JG0H 1CBVL 5K9OA 1WA2X 3RWIB 1AXSB 4MNQA 3WJLA 4KDTA 1KEMH 4YO0A 5SX4H 3D1MC 1LE9B 4LL4A 5FYLL 1IFGA 3QJSB 4XWOC 4GXVL 2ZCLH 3P0YL 4NDMA 3T2PA 4Y1AD 4I0CC 3T0ED 4CC4C 1H15B 2QSQA 3O45A 5J1AB 4E5XA 2ENYA 4LXFA 5FYJU 5AAMA 2V2TA 4RRPG 4PWFA 3MRCA 3BW9A 3FQYA 2KHAA 5T1MA 1NUNB 2X4RB 3DIVA 5TE7H 4GBXD 1PAZA 5J11B 3P0GB 5DD6B 1YY8A 4PLJC 4G6MH 4MVBC 1MVFA 2GBUA 3BXNB 3P4MA 3QWRA 1GSMA 4QRRA 4NIKB 2WLNA 3GSWB 2J6WA 5EPMA 4Y5XC 5HJGA 5EORL 4XX1E 3TBSB 4LKCB 4NQED 2C4FT 3I74A 4PGBB 3BP5B 3ZO9A 4WW2F 5KAQG 5CWSB 2UY7A 5FA3B 4J3WA 3C12A 5I1LB 1P0SE 3D85A 3JUYA 4BK5A 4Y2DC 1QFWM 2DQUH 3BKYL 2F15A 4D8PB 3DVNB 4OCYL 3FZUC 3HJEA 4ELDA 1BVKA 1P1VA 4YLCA 3L3KA 1ZIAA 4JJ5B 3TVMA 2YD3A 3ZDZF 2WNGA 5JLZA 2NZ9D 5HI3D 2WKGA 1XGUB 2DMCA 4OLVH 5BS0A 1UXSB 3TBCA 5JO5B 3LN4A 2VL5A 2OP4L 5IJKA 4LSVL 1ZWIA 1CFTA 3F85A 3UP1A 1HS6A 1KB5L 3TEZA 2QADC 4AQEA 1CWVA 2MKLC 3K46A 1N64H 5I1EH 3U36B 3HFML 1S5HB 2BHYA 4BE5A 3AU1B 2Q8AL 3ZOAA 3CK0H 2ICWB 4WNJA 1BEYL 5DZPA 4JGJA 2XG4B 1NC4D 1NBCA 3BCFA 3V0VA 5H4ZA 1IBFA 3U0TA 4Y1AA 1I1YB 4PRAB 4JFZH 2QPSA 3O2DA 1IE4A 2R1YA 3ROLA 1J8SA 3ZTDC 1OAQL 3RWHA 3N9GH 1YC7A 3GBMH 3SDCA 4A68A 4N0FB 1PMYA 3GSNH 4HJGB 3D48R 1HOEA 2K6WA 3S6CA 3HN5A 2CJTA 1L7IH 4GBXA 5J0BA 4BRVA 4L29A 4AM0A 4Z0BL 1COBA 2CCWA 3TH3T 4MHHI 4DGYH 3LKSB 1H3UA 1VZIA 4NQVB 5F71A 5F7FA 3T8VA 2GTZB 4TLSA 5DEZA 2WZPA 3RIAF 4C47A 5BOPA 3NRFA 3W0WD 3JTTA 5GRVK 4LSQH 3FU8A 2DBJA 3VXUB 5C0FA 4KKLD 2DQEL 1FBIL 2Q3AA 3QORB 1A2YA 2R56L 3MCLL 4UMGA 1INQA 2FZ3B 5JR1L 5D6DA 5DRNB 1A7BA 2QTVA 1UUNA 3ESUF 3E1F1 3HR6A 4IHOB 4CVUA 2CKNA 2DWXA 5HYSA 1DVQA 5FYJH 1RIUL 1CGXA 1OIOA 4LOFA 4EI0A 2HZHA 4PTUA 1IKOP 2F19H 3FQ4A 4EIZC 2IJ0C 3L4XA 3WFDL 1X4XA 5C97A 4WSKA 4QDGA 4AYMC 3DTDA 2XWTB 4L4VB 1RZPA 4RESB 4KTYA 1UEMA 4FN0A 4N2MA 2UV3A 5LDSA 2WVUA 3TBTA 5EU4B 3U6RA 2KZKA 3HE7D 1T6WA 2Y7OA 3FT1A 4PJCF 3GBNL 3ZE1F 1CGUA 3COOA 4K3DH 2NCMA 1Q94A 1KTDB 4XNZB 5EO9A 3GZOA 1RZIA 2XTJD 2VLLA 3LKRA 4PHZA 3IM1A 2P8PB 2IQAA 1U58A 3S36X 2ZTBA 3W2DL 3HC0A 2HG5B 3QH3A 4MA8H 1JVOA 2HUHA 1MCRA 2ZXAA 3OKYA 5DJ0B 1DBKH 3WYRA 2P46B 4MS8C 4NKOB 5ACMA 1NBYB 1DFBH 3VACA 1JVLA 1SDDB 3NG5A 2EACA 5JHDD 2BVOA 5D71H 5CD5D 3MV9B 5E8OB 1FLRL 1AZNA 2XZCL 3VUAA 3G6JB 3Q6GL 4GB9A 2EINB 3IFLH 3P11L 3SBPA 2B2XH 1Z5HA 3VD0A 1CDCA 3EJUA 5D1ZD 2ZWYA 2IBZY 5AG9A 2YN3A 3VH8A 1FZOB 3W0WA 2A83A 2X3AA 4TYUA 3QUXB 1YEKL 4KMTL 4NFDA 3VG0H 4PJ8B 4O02A 4UV7L 1BQLH 3L5WA 1GGBL 1TDQA 1SF5A 5J6SA 4MAYB 2PPDA 2YUVA 3I6LD 4L4TE 3DBXA 5FGBC 3ZDZE 3PXLA 2VLKD 2IAAC 5F93C 1MHEB 4ZQKB 3L2MA 1UB6A 1INEH 2E7LC 3W39A 2JJWA 1JI2A 4PRHD 3KGSA 2EKJA 5LWYH 2RCSL 2OK0L 1OTSD 1R5WB 4LOUD 4DW2L 4JFPB 3OKEB 1ORSA 3NIGF 4JRYD 5E0QA 3ZKMD 3KYOB 5JZ7C 3PDDA 4XP4L 3I6KA 1KT2A 2WBJA 2EH7L 5CHNB 2H0FA 2XT1B 1MHPH 3GK8L 4JX0A 4K73A 4ES9A 3OZ9L 4L5FH 2W9EL 1CLOL 2QKIC 3MOQA 2R9HC 4FZEH 1HKLL 4HPOL 3EH5B 2YK1L 1SVBA 4O00A 2G0LA 4S2SB 2HT4C 4ODBD 1SJMA 2VIRA 3KBEA 1YEHH 1AQKH 4G2AA 4K7PL 4IRZA 1KIPB 1LDSA 4EXPX 3DVFA 5GRYA 4Z3GA 4ZW3A 1ZLWH 5IP4A 5AZUA 3GJFA 1O0VA 4K9EL 4NP4L 3CX5K 2AS5M 2BSRB 1L0QA 2XWDA 4B9CA 3WAJA 2HFEA 4I8DA 3Q2WA 5T3XH 4JR9L 3VFPB 1J0KA 2LQRA 3ATFA 5E5UB 1G5AA 3SDAC 3ULVH 2F5BL 3QZWG 1QZNA 3O6ML 1ZVSB 3EO1A 4BFGA 3JWDC 1TMQA 4C83A 2HUEA 4J27A 3C5JA 1F6AB 1OHZA 2O6PA 1OAKH 2CBQA 4P2QB 1XZ0B 2GQHA 3KS0H 4O02L 3ZKND 2WLKA 3RWJA 1E6OH 1FYTE 3FCGA 1UATA 1T6BX 4AXWA 4HWEH 4EO5A 3NN8B 2ZP8A 1XIWD 3D18A 4IOSA 2IAMD 2IH9A 1N7MH 1B9ZA 1TTAA 4IS6A 4PJ9D 1TTGA 2Q86A 4PRHA 3G5ZB 1KXQA 1NUFA 2R4RH 2R0KH 4Y0GA 4ZODA 4MCZB 3PNWA 2BSBA 1ADQH 4JRYA 4U1NA 4PJCE 2BDNL 2OBGA 5F2FA 1OAXL 3ZE1E 4JUTA 4LASH 1YEDB 3BJ91 5E9DE 1KJMA 4C8XA 2CLRA 2AJYL 3NZHH 5DHYA 2K1MA 3H55A 2BHZA 3NRQA 3X3GH 3R18A 1FAIH 3F00A 3OTTA 4MD5A 3WY2A 4Q6IA 3EGDA 5C0IA 3DX0A 3GIZH 3RVXC 3B43A 1E8ZA 3OJ2C 5T1KA 1KG0A 4AUJA 2JWYA 4GRWH 4DGIL 1W72H 1R5IA 3ECBA 1KC5L 2R0ZH 1K3ZA 5DFWH 4UOW0 3CFUA 2FQEA 4P05A 2XZZA 3FF7A 4LSTH 4J3BA 4CILA 5EF3A 3O6LH 5E70A 4G8IA 1KEGL 4K2UH 2NUPA 1QOKA 1Q0XL 3RB5A 3V95A 1RZ8B 2PO6B 2BY3A 5EWIH 4NN7B 4YSCA 2YGNA 4XXDA 3MAWA 3X14A 1MNNA 5IEKB 5F7DA 3PDGA 4QXTB 1HWGB 1UG9A 3IDJB 1YEIH 1A4BA 3NJMA 1MNUL 2XIBA 1GPOL 2C34A 4HS8L 4L3EE 3F05A 2Y5QA 3QBTB 3CG8A 5D7JC 4N1EA 2X4TB 4Q56A 3ZN6A 3RPIB 1M3IA 2WN2A 2ZOLA 4E5XG 1JNJA 4M7JH 5B4MC 2FBJL 4I9WE 1IQDB 4I5BA 3KDMB 3RWCB 2FUTA 2P49B 2YMXH 3KYAA 4P59L 5L88H 3FU6A 2DM3A 1E4JA 2P5WE 5I15H 5T1LD 2JI2A 3PWLA 2PETA 1ZY9A 3DMMA 3BD5A 3QUYA 3U82B 2FRGP 2IAMA 3DETD 3JT0A 4N5ED 3U9UA 4DK6A 1DR9A 4MB3A 1A7PH 1WPCA 3NIGE 4MB5A 3T3MB 2ARWA 1WFIA 2XFGB 1FO0H 4MFHA 1J9SA 3ARBC 4TVPH 5JPMB 3TEYA 3HZKB 5MEPA 2Y2WA 1C5DA 5FCUL 1BIIB 1OARL 1PLCA 4DERA 1O6VA 5CIPA 3LX9A 3ARDA 1LP9A 4PGEA 2V0AA 5L2KA 3FOMB 3F7KA 1NGYA 4LEOB 5IVZB 2EDQA 3QZBA 2VDNH 2E3VA 4LP4A 1ZA3A 1KCVH 3ARGA 3BT0A 2XXMB 4PJDA 3CDYA 1JGUH 3B7SA 2ZAIA 1E2VA 3W9DA 5LO7A 4B9FA 1LO0H 3D05A 4UBDD 3CE1A 4R4BA 1S9WB 4IBVA 1UM4L 4RGMC 4N25A 5I17B 2ZUUA 3AS1A 1IGCL 3WHXA 3Q2NA 4XOAA 4F57L 5CMAA 1CE6B 4X8CA 2AQ2A 1EGJL 4GP8B 1EJOL 5FYKD 4BHUI 2W0FA 2PYEE 3REVB 4LLDA 5DJCB 4G7QB 1T03H 4ODSH 4AV4A 4EE2A 3VXOB 1EDQA 2FLBT 5SWZB 3A67H 2XZQL 4R5VA 4MAUL 2VABA 2J8UA 1CGSL 2GITA 4XGZA 5EBWB 3BN9D 2DQTL 4R4ND 4M8QA 4ZTOH 1N5AB 1PLGH 1WCBB 3BZFA 1U8NA 1AMYA 2R1XA 5FM8A 1U30A 1B88A 4G71B 1TYRA 3FTSA 1IEBB 2VDOH 5DQ9A 1KOAA 3IJ8A 4DEPC 4XWOD 2VO5A 3HRZA 3QAZC 2E9BA 4G5ZL 4Y5YB 3BUQA 4A7SA 2NX5A 1BYOA 2PW2A 3NPZB 3VXMA 1WRFA 3I6GA 3FUDA 3QJQB 5DC2A 1J88A 1DCLA 5AYUL 3ECWA 2KMWA 1A7OL 3SO3B 2NR6C 4ODUA 4WDIA 3UTTE 4A38A 4YSQA 1RUMH 3TH2T 3GS7A 5DK0B 5B3SB 3F2LA 2WZ0A 5BUAA 2EDDA 4QTIH 3O6FB 3UYRH 4PLJD 4JPSA 4X4XB 4UCFA 3JV5A 4MVBD 1PAMA 3QIBA 3FKUS 2WXNA 1RUKH 5KSUA 3HBQA 1H9VA 5K1NA 4ZX5A 4IBZA 5H37H 5TDNB 4NM8L 4PW9A 5H35B 1K4DB 2YD7A 3O81A 4Q4EA 4JKMA 1QBAA 2ZWNA 2BJML 1TZHB 3CZLA 4LGRB 4DSYA 1LEGB 1QLRA 3NCYS 1QTYT 1S5IL 1TT6A 1JPGA 3HZMA 5HYSG 3BX7C 3SYCA 4GMTH 5SV3A 4Y2DD 4UM9B 5EU6E 4JHZA 1S7XA 5KS9A 4JFXA 4N1CA 1DQDH 1ETZB 1NAMB 3MUGB 3FZUD 4Z78B 1JPTH 4H7VA 1OTUC 1SXNA 4IU2A 3CPLA 1MDTA 4AJYV 3WIHA 2YN5A 3H56A 4WWKA 3FQTA 2AI0H 3SJVA 4JGUA 4I13B 5L2JB 4XI5C 3E3QE 4N22A 3LV3B 3K6SA 3QUZD 1YEGL 1USQA 3UTSD 3PWUA 5FEBA 1R0AH 3VFTA 3LH2L 3QI9C 2BX5A 1DEEA 2CR0A 5JA8B 5IF0B 2VSMB 1E7VA 2QADD 1A14H 2Y5EA 5J56B 2MCPH 15C8H 4NKIL 4AMKH 2D3LA 2X4SA 2CRMA 5C07D 4N24A 4J6RL 4CGUB 5DZAA 2IANB 1KV3A 3QB7C 1U6AH 3X13B 4NZDA 3HHSA 2ITDA 5GSRA 3MXWH 5IFHH 5MP6H 3VD3A 4CC4A 3O9WB 4G9FE 2X4OA 4TTDC 2OCJA 5CR8A 2IXQB 3R06A 3QWOB 1YNLH 4PS8A 4BFJA 1YEJH 2Q3ZA 5EN3A 2NQ3A 1XH3A 1BJ8A 4DWHA 2XBDA 1SJHB 4U1HA 5IBLD 3ROOA 2WVTA 3WNJA 4RWYL 3RWFB 3VH8G 5I1KL 5I19L 3VWKA 1VERA 3BQUC 4Q2ZB 3R8BB 4G8GA 3FFCE 4FYSA 2ZNWA 4WI0A 3OXSB 5BV7B 4WENB 4XO8A 5CSZA 4R83A 3LN5A 4MJ6B 4FCHA 3HS0B 1BZOA 1NDMA 2X9ZA 2ED8A 1BYNA 2AK1L 1ZV5A 1CU4L 2DLFL 2VO8A 3C60A 4N68A 5GJSL 5TF1L 1NZRA 1G7LA 3ZVVA 3L1GA 2Y69B 1A6VH 5TE4L 5IMKA 5D7EA 5INDA 2FD6H 3X1GA 3QO1A 5F9AC 5IQ7L 4K94H 3IDIA 4NQQA 3VFSA 2NSQA 4JFEB 5I6OA 2LAGB 2EDTA 1MCEA 2XYCA 4MCYB 3GM0A 1IC7H 4GAJL 3WIHL 4XE5B 4DQAA 3VFWB 4XNDA 5BW7C 3QXDB 1TJXA 4HIJA 1HHIA 1XGRB 4AGOA 2HJKA 1NAKL 2EYSA 1DVZA 1DBJL 2V7HB 1MCOL 2ZWLT 5JQHC 4M93B 3VXSA 3HI6H 4P9ML 1M53A 5LG1A 1SQMA 5A2IH 2A6DA 2UZIH 4OZ4A 3RZCA 1IAIL 4GO8A 2GG1A 2Y06L 1XSJA 4MDIA 3TF7C 1KCSL 4K7FA 2CK2A 1Y18A 4HEPA 4KZEL 4WLCA 5L0QC 4M9OA 3FRPB 1DVFB 1VFBB 1LK3H 4KOCA 2VQTA 3D3VD 5ICXB 3S96B 5T33H 4JM2B 2JTDA 1JZ7A 2O5YL 1J1PL 1A6UH 1PYWA 4GY4A 3DJRA 4HZLA 2B3IA 1RMFL 2YPVH 4YHIA 5F9WC 1NSNH 3IDYC 1TQCC 1CFVH 2XWJA 1G9ML 4DN4L 5J57B 4E42B 4A7GF 5F70A 4BKSC 2ZJSH 1M2VB 5TFSH 3IAGC 4WKZA 3KMDA 3B83A 4U3CA 1LDPL 1EIBA 1X7QA 2YGQA 3MJ7A 1NOFA 3VG9B 4L3FA 3NQKA 1BAGA 2X6MA 1FLTX 5D7LA 5SWQB 5C6TL 4QXVA 5G4MA 4X9HA 1MJJB 1JAEA 3H7BA 1OALA 1KJVB 3V4VH 4EZKA 3AT0A 4DPBX 1HSAB 3D87B 2PPEA 2WXIA 2N1TE 3V7AG 1KPRB 1X5JA 4XBGA 1KXTB 2GJRA 2O6CA 3ZQ9A 3CHXA 3FT4A 4PS4L 3BIAX 1BX2B 4V1DD 2FH8A 4JY4B 1L7TH 3AUVA 1I9IL 5D5MB 2P9RA 4KKCC 5D70L 5AB9A 3QEUA 3B9AA 4HIPA 3CDGA 4WGWB 3SE8L 2H1PH 3FS9A 2QDVA 3SYQA 2WOBA 4X98A 2EC8A 4AIZA 3O0RH 3BWAB 1TENA 2DQGL 5DHEA 2O93L 4AI7A 2P8LA 4HKZB 5KJ4A 3CVIL 1JGVL 5HYJA 3ULVC 5JZ7D 4HJEA 4ESKA 2L04A 3MLSH 3WFCL 4JPWL 5D7KD 2UVFA 1NCGA 1I8LA 2MH4A 2UZXB 4QOKE 1OSPL 2VXUL 5E99L 5LBSH 4KC3B 2FWSA 4ODHL 1FG2A 2CGRH 1JGEA 1HEZB 5JORA 2R9HD 4I89A 3TBYB 1AACA 3WNIA 3N40P 2IFFL 4N6RB 2EXYC 2HT4D 2AQPA 3VRLF 3KYMA 2HTKC 4J39A 5F9JA 1D5IL 2AQSA 1NCJA 2CNZA 1ID2A 3D0LB 2B0SH 5D1QC 3HG1E 3MNVB 1HIMH 4HDIB 2DLGA 5DMYA 3MA9H 1SZNA 4H25B 2YD9A 3FTYA 4NHUA 3OAYK 4PBVC 4NWUH 5C0AD 3HBZA 5I1GL 2XQYA 3MRFA 4FTVB 2F8XC 5FM4A 4YOKA 3VE0A 3SDAD 3QHFL 1A4KB 4QXGL 4Z7AA 3OKNB 5C7XL 3QQ4A 5BQ7A 43CAA 2A9NL 5HI5C 4F58L 4RDQF 4QRQA 5I75B 2E86A 4NERA 5IT2L 2OX5B 4X9GA 3ARVA 4KO9A 3SY0B 3Q44A 2Z35A 4LBEA 4O2EA 4YC2C 2JNZA 2DB8A 4YAQB 1U42A 4K3EH 4KVCL 5GHWL 2BM3A 2HCZX 1J0YA 5CJBA 1CLZL 1QBML 5DD5L 1SOQA 3FQWB 4ZNEA 4NAMA 1FGVH 4PP2B 1A66A 2HN7B 2C9VA 4LSPH 2X09A 4IOIB 4RMSA 1MRDH 4WJ5A 1X7SA 3MNZB 4HUXB 3B7UX 3EFFA 1H8LA 1KLFB 2Z93B 1YA5A 4QI3A 3L8QA 2I24N 4OT1L 2FT7A 2WHVA 1RULH 2ZYSA 4NQEE 4QTHA 3DARA 5GGQL 2BXZA 2WLHA 2C3HA 5AYTA 4OIFA 4GKSA 4L8DA 4PB9H 3UG3A 3KYKL 3OX8B 4KTGA 4NZRL 3RDTD 3SZ6A 3SPJA 4F8QA 3MSPA 1ZS2A 2C1OA 3KCPB 4F2EA 3RVXD 1EHLH 2XG5A 4OZFA 1E4XH 1RSYA 1T0MB 5IVXA 3C6LC 4P49A 2H9GA 2OULB 4QRPB 5DWUH 1XH2A 4A2EA 4GEIA 3IJYB 5JHLL 1T0NB 1DQJA 2G5BB 1F4AA 5D93C 4UQCA 1KNOA 3ZHNA 2PYFB 1MXDA 1RCYA 1JHLH 4HGKC 1WFMA 4MX7B 1G9NL 3ES6B 1SXZA 5DMIH 5D7IA 3CN2A 3C5SB 3MRJA 1QFWI 3I75A 4KO5A 3BUYA 3NCXA 2QV2A 1MVUB 1GYVA 4GRLB 1Y6KR 2P5EE 5FGRA 5I6PA 4BH8B 1NMAL 4OD1H 3V5KB 3E2HC 3S34L 2CPCA 5I8KH 4HWBH 4L8SB 4U3SB 1RSFA 3AUWB 4XMKL 5HDBB 5M7QA 2ITCA 5LKNA 5AVVB 1NGPH 3VQ1C 3U7YL 1J8HB 1F11A 2LW3A 4OSUH 1OB1B 3O3AB 4HHAB 3FCTA 4O58L 4YE4H 5D7JD 3L3GA 4ONHA 1A47A 1NIEA 1YN6A 4IMKA 12E8H 5B4MD 1AD9A 4NZUH 3G08B 3MDJA 1UWEH 5H4YA 3ZL4L 2WQXA 5ISZD 3D39D 1A02N 5IK3B 1FHNA 3ECVA 3EJTA 2FQGA 2X70B 1S7WA 4F37K 4W1TA 4W4OA 1NH6A 4UTCA 1HNYA 2KPNA 5L6YL 3MLYL 3JTBA 1GOHA 5LAPA 3V4PL 4MMYA 3ARBD 2ZPKH 4IRSC 3FB5B 2CRIA 1J0JA 4P04A 2XN1A 4ZUUA 4ELMF 1SOSA 4HQQL 5CF3A 2P8MB 3WJJC 3U4EA 2E27L 2DWDA 2K45A 3CZFB 3JZYA 1HE7A 4G1EA 2LV4A 3V4LA 3Q5TA 1C08A 1EO5A 2VR6A 3ZHDA 3ZZQA 5ID1B 1N68A 2QQNL 3VRLE 1I7RA 3DIFA 4HS6A 4MNGA 1P2CA 1SY6H 4MJIB 2DJ4A 2BW5A 4HPYH 3QDJB 3WKML 3CHOA 4AOFA 1MN4A 3OKKA 4YPJA 4LCUA 1RUAL 4MZIA 1XH0A 5DU7A 4KZDL 2NY7L 4PY7A 4DKEL 2APFA 4N0YL 3LQMA 1JD9A 1KYOJ 1IGFL 5AW4B 4XP5H 5IWLC 2AQ3A 2EC9T 2XY2A 1JDDA 1HQ4B 3NACH 5GJTH 5I71C 2E0PA 1UB5B 3GSRA 3L3OC 4JFDD 4P5TC 4CMHB 3VW3L 1AG6A 1YUHB 1BGXL 5CLZA 1QHPA 2Q76B 5F1SA 5C6PB 4UF7C 4FLRA 3RWDA 2PP7A 4K3JH 4CU6A 3NABH 3CUPB 3BH9A 3P9MA 1MPAL 5ANME 2LLLA 1EO8H 3GXMA 2Z6FA 4NHCL 4CADB 2DRUA 4APQC 4Z23A 4A63A 2I60L 2PLTA 4NKDB 1W2KT 3FNKA 3GSVA 3RE0A 1FDLL 2Y72A 4B6ZA 3KM2A 3G6DH 5EOTB 3L7FA 1HL5A 1JYVA 3BSHA 3V5HB 5DVPA 4JKNA 1N0XH 5DC0A 3LZLA 5JHDE 3OMNB 3FFDB 1MFDH 4KPHH 1FJ1B 2B59A 4YDLC 2NR6D 1HN1A 4P2RD 4U1SB 5D4QA 4MJ5B 1UA6L 5CCHE 3MCKB 3H4HA 4RIRA 4F7PB 5CZVH 2OMWA 5KSVB 3GLEA 4KY2A 2QPFA 5CBEA 4NI6A 4IKKA 3MMEA 5EFIB 5HJBA 3GHEL 2EYRB 2J56A 2CO6A 4P3DA 4KTEH 4EUPA 1C5BH 4MRCA 1Z5LA 5LCVA 1CD0A 4ZJ9A 1FVCB 4X5WA 3I6LE 1B2YA 4JL2A 1JGLL 3UAAA 1GKOA 3ZDYB 4YHLH 3TN0B 5IB3B 1P84J 2B5IC 2VLKE 1JF1B 5D1ZI 1G7HA 1X44A 3SKMB 4D0CA 2BNQB 1TCRA 3BSGA 2DM7A 3SBWA 1OTUD 1U8LB 4ETYA 1AZVA 3JQOB 5B3NA 3LS4L 1NLBL 1I8KA 2ISDA 2XA8H 3RUGB 5K9QI 1EEYB 3BYTA 4XX1G 1GW0A 2OTUA 1YEFH 2LVCA 4XI5D 1ZLUH 3VI4B 2FHBA 5EC2B 2R4SH 4KKPA 5DJAA 4N2CA 3ZTEA 5EIQA 4JFDA 1L3NA 5FOJA 2WO4A 2LT9A 3QI9D 4OM1L 2Q8BL 4OQTH 5AVTB 2Y6SC 4FULA 3K1DA 3IGKA 2WQVA 1BV8A 3IFPB 4RFOH 2J43A 3RFZC 4CDHA 3D09A 4W6YB 1PLBA 5KYWB 3MRIB 3WCYA 4TL5A 1L9MA 4BZ1A 3MRRA 2GIYA 5JW5B 2E74C 2NYYC 5CBAB 1AKJD 1CE1L 3EFDL 1MQKH 1MRCL 3Q2CA 4YDJA 2VDLH 4Y9CA 2BPBA 4DOHB 2PMZA 3QWNA 4HEPG 2VRQA 3IKCA 4AL8L 4NPJA 2AV1B 5J5EA 1KENL 3WLBA 2VR7A 1RHHA 5CEYB 3N85H 3QZWB 4TTDD 3KPQA 2X44D 5BRPA 1HH9B 3QR2A 5FYJD 1PTZA 2XVKA 4ZOEA 5FKAB 3ZL2A 4TSCH 3L17A 4K94C 4JFFB 4ERSH 3KZ8A 3VXQA 3J27A 4ELME 3OGCB 4HUMB 4YQXH 1T83C 2SEBB 5ERWA 4JQVC 3BRGC 4LVHB 4X83A 3GDBA 3WD5H 2BMKA 1WUNT 5HHMD 4LQFH 3RU8L 2C7UB 3BQUD 1B3IA 1KCRL 1AQMA 3C2AH 5T5NF 2N3JA 3IT8D 4M6ML 1HDMB 1OP4A 2H8PA 5H8DA 4XPGH 1E65A 1BW8A 1SJVA 2P24A 2WCPA 4ENED 3GMNB 4YBLB 1NCOA 2JK5B 3W5MA 4PGCB 4U1GB 1HJCA 2G60H 3CZUB 3CZGA 3HAEA 4JDVB 2KLTA 5C70A 4A2LA 2D03H 5L4JA 2JKJA 5F6IB 1S7TA 4UT6L 3BEVA 1BZ7B 3L6FA 4MBRA 3RWGB 4B41A 3FN3A 3KPOB 4IGBC 1QASA 5C9JA 1RJYA 2B15A 1GHFH 3BKJL 1A7QL 4NOFA 5IGXH 1XVSA 5LAXA 4OD2A 1C12A 4Z7OB 1NL0L 2EVFA 2K4AA 1TKWA 1P53A 3IJ7A 4CN4A 4Q6KA 4BZ2H 3LZNA 5KSBF 1KB5B 3A21A 4OLZH 5EF2A 3CQQA 1M7DB 2DL9A 4XPFL 1JDCA 4HKBB 1IVLA 5DQJA 2ADFH 1R47A 4YHYC 1P5UC 4PJ7B 1BFOB 2L7JA 1UYWH 4RGOL 1NIBA 3VI3A 1AKJA 5ICYB 3ABKB 5K9OB 1TZAA 1PQZA 1F8TH 4HCGA 1N70A 3N44B 4NN5B 4MNQB 2Q10A 4YO0B 3KNBA 2YFOA 3AGWA 3II3A 2O26U 2ZSVA 3EW3B 4NDMB 2DDQH 4OU3A 1N59A 3H9ZA 5BUGA 2DTSA 2XQYG 2FDBP 1E8YA 1NBZA 2WB7A 1ZLWK 1BJMA 1RZQA 4HIXH 4E5XB 1OTTC 3B1UA 1EFQA 3D4YA 2V2TB 3MRCB 3BW9B 3SB3A 4WFGD 3DYPA 4Q9QH 1JTOA 5T1MB 4WEBH 3FT0A 3MODH 3KPRD 3SKJL 1YY8B 3TYFA 4WJG3 1ZPLA 3GMQA 3MLZL 2F74A 2LLNA 1CLCA 2Y07L 4QXUL 2ZXBA 3ESPA 4P5MA 4QRRB 4H88H 3F83A 1YAIA 2ADIA 3GXUB 3H0TB 3K72B 5EPMB 5FM5O 4K3HA 3BISA 3NP4A 1GY1A 4ZW7A 2GEQA 2VSKB 1A6ZA 4PJAA 5KSAC 1URIA 4GUOA 5F7MC 4AJWA 2UY7B 1F42A 4GW4A 3JBG7 1FZMA 4KKCD 3IPEA 3D85B 1YMMD 4F5CA 4WY7H 2CUMA 3WEXA 3MRQA 3P4LA 3LN9A 3ZKXC 3LJ3A 4PLKC 2WXGA 3QG7H 2J2ZA 5IFJA 3FOLA 3O3EB 4KFMA 4OF6A 3L7EA 3L3KB 5T3XD 2X9YA 1GZHC 2R2HA 2X7LA 5BW7A 4F8NA 5JLZB 4PS7A 3MBEA 5BS0B 3ECQA 2H6PA 1FNFA 3ULVD 2VL5B 1ZTXH 4ZPVA 2IADA 3LQAH 1ZWIB 1E3XA 1EJ6A 3DC0A 4OZFG 2SODB 4KO6A 4AQEB 4EOWH 5C8JA 2XWZA 1A5FL 5J12C 2Y36H 1ZT1A 1I9EA 2AJVH 3RX5A 4JFOB 1DANU 2HTKD 5FYKE 4M00A 2KUTA 1MFCL 4WTXA 1AP2B 3KPMB 3Q3GB 3V0VB 2DBLL 4GO9A 4OLXH 5D1QD 3WG7B 4S0TD 1FZKB 2R1YB 3ROLB 2C1PA 3QCTL 1BOGA 5E8DL 3MLVH 3GQFA 4YMPA 3RWHB 3SDCB 2YZ8A 2B14A 1J9QA 4EN3C 4ADIA 3QAQA 2Z64C 4XVTL 4L29B 1HL8A 4AM0B 3VA6A 1J48A 3KWWB 1HAUA 4Z76A 3MV11 1QRNE 4FI6A 1WGVA 3BKCH 3ZDXB 4RBPH 2XV6B 5GS0L 1XTMA 2HWZL 3JTTB 3I2CH 5D2LF 1V7NL 5C0FB 4XNYH 4JFYA 4ZFFA 2DJMA 2XPGA 1NA8A 2VISA 4R4FL 3VFGH 1A2YB 1JFHA 3HNVH 3PV6A 5HGDA 2R0WL 4LHJB 1UA3A 2ENJA 3UAEA 1INQB 1PL3A 1TJHL 1TPXC 2W94A 5F7EH 2W0LA 1D9KB 4EIUA 2VDRL 5HYSB 2F18A 3U4BL 5KSBE 5D96C 3TO4C 4CVZA 3MGAA 4FQCH 5CEXA 4PTUB 1JSYA 4B50A 4MDJB 2HG0A 5AW5B 1CGWA 3DX8A 3DGGA 4GO6B 3UACA 2J5LC 5FC9A 5EBLA 3US0A 1S9KC 3BE1L 1FH5L 3ZK0A 3CMOH 4PRNA 3BWSA 4F80A 4LESA 3HI5H 3TL5A 4UV4L 3S37H 3H9SA 3U6RB 4LCWD 3D0VA 4FQ2H 3EYUL 4R2GB 4DUXA 1I4FA 5IBUG 2XDHA 4H0HB 1N8ZA 3ZRSA 1BG1A 2H2SC 2OTPA 1KTLA 1Q94B 4CBPA 5EO9B 4I3RL 1VEPA 1J9CT 4ZK8A 3JWNE 1RZIB 4M3KB 5DLLA 1J5OL 4NQXA 1DVSA 3LKRB 4RMWA 2XKNA 4X6CA 2BIQA 5D1QA 1H6FA 3UTSE 4MXWH 1CXKA 1U3ZA 2DQDH 5ANHA 3AM8C 4A7TA 4MD4A 1OCRB 4UQIM 2X05A 5I5JA 3U30C 4GSQA 5DZNA 3H3KA 4BFFA 4NXKA 1LWJA 2APWA 2ADGA 2Z7WA 5DWPA 4XPHH 3NMEA 4QHKJ 5DZOA 3L5IA 1LEKA 5C07E 2WLJA 2BVOB 4GI6A 7CGTA 4PI2A 4AUUA 2IALA 3Q5YA 1BVZA 2HRGA 2R7EA 4UOZA 3S8FB 1HNGA 4Z7VF 4AJ0A 4GP4B 3G5XA 3CZJA 1LEIA 4FFZH 2EE0A 4XTRC 3FTVA 4TSAL 2WQSA 4L4JA 3VH8B 1UA7A 2A83B 5IVXF 4NO0D 3QARA 1B0IA 4O02B 3LRLA 4JREB 4D0BA 3NCMA 3L5WB 3OMAB 5ADPH 2NLJA 3F7YA 4QGYA 4PR5A 4UINL 2Y0SA 3S3PA 2C3VA 3DBXB 4KUZL 5I9QC 4NEHB 2V9QA 3ML9A 3W39B 3WN5C 4MZ2A 4QGTA 4IRSD 4PW4A 4FLOA 1I7UA 2VXVL 2E75C 2YLKA 1NGQH 1S7VA 1E9OA 4LVNB 4K3GA 5I6LA 1OT4A 1SQ2N 3Q1EA 4X5QA 1KCUL 1ORSB 4Y19A 4XVSH 4PY8I 5CJQH 3ZSSA 5DTFA 3QULA 4HH9A 3I6KB 4MMXC 1KT2B 2WBJB 2ZUXA 4QJ4B 2CA4A 4OZGA 1NICA 4Z18A 1OD9A 1JPST 1SNRA 1A1OB 3FQ1A 3QUMA 4KAQH 3CBJB 3C6LA 4TLKA 1NCIA 1IM9A 4UI2A 2WSPA 3ASNB 1M57B 5I18H 2UXTA 4NZ8A 1CC3A 4EI6A 3TZVC 4LLAA 1KWGA 2VIRB 5GGVL 3W11C 3S8GB 5I16A 1K2DA 1KBGL 1REIA 3O8XA 5EEWA 4WI2A 2XV0A 2DQCH 4YPGB 5H94A 2H2PC 2B1AL 3KPSD 4FZ8H 1ZRUA 2DQHH 4OUUA 4IDLA 4P5TD 4B5EA 3KXFD 3GJFB 4D9LH 5CXPA 3QT2A 4JDZA 3OR6A 2X0WA 2HFEB 3APDA 3MRKA 3GTNA 5D2LE 3MC0A 3C08H 3ZE0B 3P3YA 4XCYA 3RL1A 5CINL 4APQD 4ZBJA 4HJSA 4H20H 4WHTB 3KWTA 2AABL 2E59A 2W81C 3EO1B 2R0LH 3LZFL 1T2QH 2X2HA 1BVNP 2Z8RA 3HZVA 3MFGB 4NO0A 4P3CH 3D3VE 5FKPA 4C83B 3DBSA 2YMTA 4KKQA 3V9CA 2QMKA 3DHMA 3L81A 3GO1H 2J6EL 3QNZA 3UIYA 1BVNT 3CAFA 4UQEA 3RWJB 2QELA 2QV4A 1LQBC 4X99A 5K59F 3KJ4B 1OPGH 1MCDA 2WXLA 3MCYA 1QATA 1AJ7H 1RFDL 5GRJL 3D18B 5DJZA 3GUFA 3TA4D 1JNLL 1B2WH 1VEMA 2FLRT 2E8YA 4IS6B 3JWOL 3AWFA 5EOCL 2Q86B 4HXBH 1P4LA 4PRHB 4U6YA 3ZTNL 4CC0A 5GGTA 4DVRL 2HH0L 3WAKA 1D5MA 3BPLB 2IDCA 4G80A 4WEMB 5K1VA 1G1OA 3PNWB 5J6GA 3LNHA 4M43L 3MJ6A 1WFTA 2C9QA 3VXTA 4V1DE 3GMMA 2CUIA 2CLRB 5LB1A 5DHYB 4N26A 3LDBC 4MD5B 2ROYA 3VXPA 5IMMA 4Q6IB 3EGDB 5C0IB 3BKML 4YXKL 4W9ZA 2IPTL 2EO7A 2WYZA 3N42B 5CUSH 5ID0A 1SBSH 4K7PY 2YQ2A 5T1KB 3QUML 2W9DH 1KG0B 1UM6L 3LMJH 3WENA 2WNWA 2ZG3A 3QZOA 5E4OA 1R5IB 5KVEH 2WLZA 1MCNA 3ECBB 3D2UD 4NQTA 2BH0A 1CDUA 5HHXH 5KVFH 3HUJA 2EDNA 5CN3A 2ZXCA 3U4KA 3WEOA 4AX3A 1OD7A 2OR8A 2BY2A 1PFCA 3PCYA 4RDBA 2QR0A 4I87A 3FHAA 1ZCRA 4L1SA 5D7KE 4AE0A 2A9DA 5DQDL 1DO6A 3CH8A 3K1KC 1SEQH 4G8IB 2NUPB 4Z7VE 3HMXA 1AD0B 2IH3B 1NDTA 2VE6A 4YDIL 1IKFH 1NMCC 3CIAA 3EIFA 4XHQA 4XXDB 2ZSWA 4ZS7H 2NY3B 4FLHA 2XN9A 3X14B 1BAWA 5F7DB 2GW5A 2NYYD 3BP6A 4APQA 1CD8A 3OJVC 1FV1A 3GI8H 2E76C 1TZOA 1Z5YD 3M7FB 5IREA 2ZYIA 3TT3H 4C4BA 2GHZA 3DUHA 1IRAY 2YRPA 2MWCA 4ORZC 3V4UH 3GS4A 2ZOLB 4F37F 4I4WA 4HPHA 4QLWA 4X9FA 4BUQA 3A6BH 4A04A 4I5BB 4XMLL 5HHVL 5C0AE 3WFBL 4L3CA 3BVVA 4NPKA 4PJXF 2V5MA 5F1IA 2I25N 3VMOA 4OY9A 3PWLB 3DMMB 1GYCA 3QUYB 2IAMB 3U9UB 5DK2A 2WOYA 1JJUA 1UXMA 1JFQL 4URTB 1XDTT 3CSPA 4XMPL 2VAJA 3TJEL 3DO4A 4N0UA 3E8UL 1FPTL 4PJ5A 1Q0YL 3BH8B 2VMCA 2EIDA 2QPDB 5GIRA 5MEPB 1C5DB 1F18A 2DWSA 4YX2L 1K6QL 1A3RH 4Y8AA 5CIPB 3GTTA 3ARDB 1LP9B 2COQA 4PGEB 3V52H 1HCVA 1ULVA 2DD8H 5L2KB 2XLLA 2TRYA 5EG6C 3F58L 2VXQA 1ZA3B 3ARGB 4PJDB 2JB6A 3GHBL 3CXHK 3W9DB 3WO4B 4JQIA 4JDTL 4R4BB 1T4KA 4AQ1A 5I1IL 3LS5H 5BVJA 4IGBD 2ALAA 1SJXA 1ZS8B 4FQ1L 2F68X 4R26H 5EU7C 3CFQA 1VFUA 1CCZA 3BMVA 3I9GH 2CIIA 3DSFH 3WXWL 2G3NA 4GQRA 3UPRA 2W0FB 4PIBA 4H0GA 1K4CA 2GT9A 2J1ZA 2VZVA 4LLDB 3H3PL 2AAVA 2VC2B 4W6WB 3UGUA 4FQXA 3EAKA 4NFBA 4RFNB 4G9DA 2VABB 2J8UB 2GKIA 3NCBB 4XGZB 2YAMA 1KF9B 5DVLA 4M8QB 3Q9PA 1HFUA 4G3YH 3H4FA 3UBGA 1QNIA 2FT8A 1U8NB 3BZFB 3SOBL 2LU4A 3C9NA 2R1XB 4NBZB 3NIFF 4PWEA 3RGHA 1IMHC 3SQOH 4Z0XA 4PJIF 3RG1C 2BWQA 1U3HD 4BDVB 5DQ9B 1K9TA 3P4OA 4YL4A 3V6FA 3DI3B 3HRZB 4Z3IA 3F65A 4HUKB 5K59E 3BD4A 2P52A 3S3JA 2FE0A 3LKNA 2NX5B 2PW2B 3PNRB 3VXMB 2ZX8A 3I6GB 1OTTD 5E1QA 5EZJA 3QNFA 5ICZA 4IBUA 3CLFH 2ZOUA 2XWCA 2WAQA 4ODUB 2I9TA 4JQVA 2AK4D 5GRVL 1T0OA 4LSUL 3II2A 1VF5C 3KWXA 2BS9A 3WFEL 2FGWH 4ZMXA 5AEAA 3LQAC 5FGCE 3H9HA 3QIBB 2ICCA 4PAZA 3DDGA 2ZKWA 2ZUVA 1XL6A 5KSUB 3KEDA 3OKDA 5ISZE 3D39E 2IQ9H 5BCAA 4YHKH 4QKXB 1HZHL 5BOJA 4PV9B 4LFHD 5KSAD 4PYHA 1KELL 3WKYA 3K8KA 5C0CA 1BD2A 1NAMH 3HZMB 1JPGB 4UTBA 3ELQA 4M6NH 4DP4X 1YEEL 3CWGA 1CICD 1S7XB 3JVFC 2ILLA 4JFXB 3NJKA 2NT0A 5E95B 1U92A 4PGZA 4JQIL 4IU2B 4ZO6A 1OO2A 3CPLB 4B9GA 4NX0A 1MFAL 5INCA 2WBXA 1XF4A 3DV4A 4HBCH 3FQTB 4WWKB 3VSUA 4D3CH 5KYXB 3BZ4B 3SJVB 3WIAA 1LO2H 3QXUA 2OZNA 3K6SB 3QZNA 4OTXH 3N6YA 3VRJA 3PWUB 3VFTB 3FMGH 1DEEB 1UT2A 2X89D 5F7YC 2Z7UA 2YPLD 3NVQA 2I7SA 3BIKA 1ZGLP 1B3JA 1P5UA 4JLRA 5IB1B 3QORC 4DETA 4X6FA 2J1YA 2X4SB 1GOFA 4AQ8A 4YFDB 4ZUWB 3APCA 4EBQH 4PJXE 4PN6A 3HHSB 1T7VA 2ITDB 3IF1A 4OJFH 5GSRB 5C0GA 4Z7WB 5I6NA 3B2PA 1GC1C 3GZQA 4KV5F 4TNVK 1SYSA 4P9HL 3ILDA 1NQBA 2X4OB 3RA7H 5F9DC 1XGTA 2MCMA 3R06B 4FNRA 2MFNA 4K0OA 2ADJA 4RZCA 1RZKL 3BUIA 1XH3B 1JPEA 2GY7B 4EN3D 2E9WA 3MPCA 1DBML 1AHKA 4U1HB 1F1AA 4YSAA 3ROOB 5IESL 4EN2A 4A6YH 3RL2B 5BV7H 3VWKB 3AADB 3QZLA 3CN0A 3HMWH 4G8GB 2DI7A 4IW4C 4XNZC 1E5BA 1IAOA 5CILL 2F7PA 1SMOA 4ODWA 1TQWA 4WI0B 3N1FC 1OW0C 3UTOA 2E6PA 1LILA 3LN5B 4UT7H 4FXLA 2EICA 2QHRH 4P2RE 4HSQA 1NDMB 1H6EA 3H2QA 1KULA 3SE4C 4JQXA 5KW9H 3C60B 5KJRH 3L54A 1T1WA 1E5ZA 2YARA 4ONGH 4UTBL 4UNVA 4Y7OC 4QJ5B 4GW1A 1T5XA 1CPUA 5IMKB 1P4BH 3TO4D 3QO1B 3IDIB 2C4FU 3VFSB 4DTGL 1GZHA 2XFXA 1SEBA 1NIDA 1H0DB 1F3DH 1KXVC 2X0UA 1T0PB 2J21A 4IBWA 2ZAGA 1J0HA 5HGGS 4PRBA 2HYMA 3DX9A 5EU5A 1QA9A 1XAKA 2G9HA 5TQ2L 3NPSB 4HIJB 3S7GA 1HHIB 3QUXC 3F62A 3NIFE 1EAQA 2HJKB 1N9PA 3ZT6A 4M5TA 4ODTH 4PJ8C 4PJIE 4NQDA 2DWYA 3VXSB 1QHQA 3P0VL 2ATKA 4MAYC 4Y16A 3E1ZA 2BP8B 2H2SD 4W9HC 1YPZA 2BHFA 2XZAH 3A5VA 4I1NB 2DM4A 2X2UA 4OZ4B 3RZCB 1NPUA 1XCXA 4EIBA 3C5ZA 1MIEL 4MDIB 5JIIA 1Y18B 1UWGH 2Y7MA 3LSOA 1ICTA 2PCYA 5GS2H 1PG7L 3VGDA 3MLPA 1INDL 4HZLB 1PYWB 1S46A 1KN4L 4YSPA 2V5YA 3RLSA 4YHIB 2XWJB 3ULVF 4FS0A 4F9PC 4QHMB 4WTWA 3GBLA 4GS7B 1W8NA 4WKZB 2YXFA 5AWNH 3HEIB 4GSDL 5IEHA 5G5DB 1X7QB 1GAFL 4NGHH 2BFVH 1B4JL 3MJ7B 3SGJC 4OH2A 2UXVA 4KQ0A 4FI8A 2DY2A 3KLDA 4H8HA 3HJ0A 4XTRD 5D7LB 2OZ4A 5I30H 1OQOA 1A6AA 5I1AB 3LNGA 4LDEB 4KY1L 3H7BB 5FYJE 1I9JL 3T08A 4M7ZB 3T1FA 2D9CA 4MSWB 1DQLH 5EEYA 3NIDF 4HJJH 4HUCA 3PWVA 5AVWB 4OV5A 2A77H 2BXYA 3FT4B 1MJ7L 2ZKHL 3SODB 5I76A 1MFVA 3QFGA 3QEUB 3NFSH 4PRDA 5HHME 2PABA 2AQ1A 4YS4A 1S9YA 2E7HA 5LNDA 4F93B 4L9LA 4F20A 4X98B 4FQIL 1FCCA 3DJTA 4AIZB 4Q9RL 3OPZL 5HHQA 4AQZA 2P8LB 3A3YB 4PJGF 4HC1A 1FL5A 5HYJB 5DA4A 3OG4B 5E4AA 1NCCH 1IFHL 1U8JA 1L9QA 2JCCF 1MI5A 3QCUL 1F58L 1FFNA 4GRWF 4PQXA 1FG2B 3GZPA 1JGEB 4JZOA 4BCXA 4KV5E 5JORB 1PDKB 4IBSA 1BPLB 5KVDE 2XU9A 4OLYL 1DJWA 3KYMB 1WUZA 2ENPA 4BWTA 3W11D 1D6VH 3MQIA 5F9JB 1Q9KA 2YUZA 2JCWA 1WZ1H 3FAWA 5BNXD 1CF1A 2HFTA 3KLQA 5C2BL 3LOWA 5JQ6L 2DH2A 3OF6D 2BC4A 2RALA 4AEHL 4KNQA 4NHUB 3SDXA 1M9SA 3IFOA 1YUKB 2B4CH 3B8SA 1KN2H 3MRFB 3BAKA 3FXIC 5DO2C 3VE0B 4YSDA 1F1DA 1W6WA 4XO5A 4R90H 4HFWA 2FECI 3QQ4B 3PWPD 5BQ7B 43CAB 1MF2L 4QRQB 4X6BA 3TA3A 4PB0L 3HW7A 1OP3H 2C8NA 2O4EA 4KNSA 1VZHA 2HKFL 2IDSA 2Z35B 4LBEB 4O2EB 4FQLL 2KBGA 2ZQKA 3GJEA 4N2AA 5HHOA 3TYGL 4RDQG 1OQXA 1SXSA 1IGIL 4OAWB 3U4AA 2UWEF 4JKLA 4B7IA 2AZUA 5CP3H 3V4PB 2AQTA 4KQ4H 3O3UN 2Q7YB 2FEDD 5I66A 4ZX6A 4ORGA 3KPRE 2PO6C 1QSZA 3RAJH 5BO0D 1BZ9A 4QRAA 1R19A 3T1WA 3N43F 3PPSA 4GKNA 3EH4B 4WJ5B 3ZRCC 4L5FE 3EFFB 2BRRL 1VKXB 2AXGB 2XWBA 4P07A 2Z91A 3O2WH 4JPVH 1VENA 1FIGL 3QFDA 4XMUA 4QTHB 4HCIA 4JHAH 4GG6A 1BZDA 5C92A 1O9ZA 4RMUA 4MMXA 5EC1A 1CDJA 2ZXDA 4GKSB 4L8DB 4HC1L 5SWSD 3VSTA 4OGYH 1YMME 5DVOA 2YKKA 2C1OB 2QBWA 5DLML 3RILA 1MOEA 2P26A 4L4TB 4WO4A 1KPUA 2UXGA 4LP8A 4B96A 3B9EA 1N5YH 3ZDZB 4OZFB 1ZV9A 2EDYA 3L5XH 1OP5H 2D7TL 3FB6A 3TZVA 4CVWA 3HZYA 2H9GB 2M8XA 5BRZE 4LDCA 5T3XE 2I32A 1DQJB 1XFPA 4KH9A 5EOQH 1KNOB 4KNUA 1EJ8A 2IGFL 4H13C 4M3HA 4X7TA 2MJWA 3TBBA 3ULVE 2IIJA 2H1XA 2YXMA 2OS7A 4N2KA 2VH5H 1D7DA 5D7IB 3OF6A 3MRJB 3UAFA 1G6RL 3OXRA 4PV8B 3BUYB 2MQ0A 4F2ME 1IAKA 1KYDA 4NUPA 4AV5A 1AO7D 1EFXA 4OF5A 1NBQA 1L6PA 4EXKA 1SM3L 4BZ1H 1YJDL 3DGCR 4X7SL 2ITCB 3AAZB 3WTXA 3KWVA 3NIDE 1NCBL 4R5XA 4HAFA 3FCTB 3S48A 3L3GB 4ONHB 1YN6B 4IU3A 5IHUL 2RJMA 8PAZA 1FCGA 2ZX9A 1AD9B 4IKLA 3KGTA 4XX5A 1V54B 1OAUH 4Z7IA 2H3KA 4PH8A 3QXWA 2R39A 3SEPA 5C6WH 5IQNA 1YCSA 4F3FB 2JELH 2XVGA 1UM5L 2IPKA 2CM6A 1NOAA 4NJAH 3F6JA 3U9WA 4UWQB 1EXHA 4PJGE 1C1EL 4MMYB 4J8RA 1JK9A 3DKHA 3EHBC 2AZAA 4XHJC 1MREH 3CVHA 1UACH 4ZUUB 4AC2A 2JCCE 5F1KC 2WKOA 4PD4J 3U4EB 2DWDB 4GRWE 4G1EB 2F7QA 5HDWA 1C08B 4G59C 1L0XA 4FA8A 3SDDA 4GFTB 3FN9A 2X88A 2F2HA 4L1LA 1BWMA 1I53A 1I7RB 3DIFB 3HOGA 4HS6B 1A25A 1P2CB 4MNGB 1PZBA 4Y5YC 3U7WL 2OJZL 1MCHA 3D07A 4KZ0A 1UFUA 2VSCA 2G2PA 4LCUB 4FABL 3ARFC 1TLKA 3SO3C 1LQSR 2VR8A 2H6OA 3B3BA 1T66C 5IBUB 1S3KH 2IDQA 5E4EB 3UBXA 4PY7B 4H0LC 1KCBA 3JYBA 3IDXL 1KJ2H 4O5LL 5E6IA 3ZO0A 3NFNA 3KYNA 3X3GL 1BBJA 2CR3A 1E2ZA 4NCDA 3TPUA 3SY6A 3GSRB 1WA0X 4LCWE 4UIKH 3QJVB 1HZKA 1UKSA 1A6WH 1QNZL 2JB5H 3MO1A 2JJTC 1T20A 4HMEA 3RWDB 3M1CA 3KL3A 1KB9J 4PJBA 5EO0B 3BH9B 3P9MB 3RWEA 5I1JL 3QA3A 4NRYA 1WYJA 3AWEA 3EDFA 5AL8A 3U1SH 3UJJL 1AC0A 3NZ8B 1UVQA 2UWEE 4TQPA 2XN2A 5EZIH 2GC7C 3QDHA 2R69H 3IDMA 3L7FB 1LO4L 4NUMA 5LJYH 2BVPA 4TVPE 2AJUL 3DHPA 5BMFH 3D69B 1ITCA 2CR6A 2B59B 1HXMA 2RA1A 4R7XA 4NZTH 5LBVA 2RAMA 1R3JA 3GSQA 4UDTA 2Y7NA 1KBPA 4OR1A 4RIRB 4U1JA 5HVWA 4FF9A 2OMWB 5CBEB 4FXGC 4KVNH 1HH6A 4FNLH 4ODVL 1KTRL 4L3EB 2NY5C 3V0GA 2V9TA 3B2MA 5AW6B 2CO6B 3P30H 4P3DB 5J89A 1ZT7A 1Z5LB 2B1HL 3QS3A 4G7SB 4PMEA 3FUMA 4TUOB 4RBPK 5ECGA 2FATL 4YUEL 4X5WB 5DUPH 1QLEL 5TQ0H 3BI9X 3O9WC 3RNQA 1NKOA 2VZ1A 1G7HB 2P5WB 2BERA 3PE9A 4MAZA 2VUOA 2CD0A 3LH8A 4HUNB 1PEZA 3D5OF 4JB9L 1DQVA 1TCRB 5E94A 4D0CB 2Y24A 1UQSB 1X6LA 2X4RA 2YSSA 3H85A 4RGMB 2EDFA 4EJ1C 2QQKH 1OT1A 2QGBA 3KPTA 1I8KB 3MLWL 3PGFL 2CRZA 4ZMZA 3STBA 2OTUB 3JVGC 1ORQA 2N4IA 3IAPA 4LHUA 1OCCB 1FNGB 5DJAB 4FAAB 3GSWA 5DJ2A 3TBSA 4JRLA 3UTZA 1ILUA 1WT5A 3T0VA 4XT1C 3VXUD 1L6ZA 5BV7C 5MHSE 3LEYL 3HNTH 1JZ2A 4GQ9H 4A7UA 3BP5A 2PUQT 3QORD 3MTXA 3HS0C 1M3JA 1MVYA 4XCNA 4F7TB 5L4MA 3MRRB 4NWTL 4H8UA 1ZPUA 3L13A 4YDJB 4PFEA 3HHMA 4D8PA 2OV0A 3IKCB 3S5ZA 3NDYE 3KPSE 4A2MA 3WLBB 3N04A 1RHHB 2HX9A 3HKZA 4JJ5A 5FV2A 3KXFE 1F4WL 3D25A 3KPQB 4Y2LA 2BNUA 4NNXA 5HY9A 5JO5A 1SXBA 2WXOA 4HZAA 2WXJA 4L4VD 5DVNA 1J0IA 3VXQB 1OY3B 1J7VR 3T0AA 1WISA 4MA3A 2WLYA 2VQ4A 1FN4B 2V2WB 3S35L 3NSDA 5ERWB 2ZT9C 3DX6B 3V5DA 5EORH 4FFVC 4Q97A 4M93C 3DNKA 2BMKB 5CO1A 3HPLA 2ICWA 3ABMB 3SPHA 1LO5A 4N4YB 3RJOA 5HP5A 1M05B 3HIZA 3WTVA 2H8PB 2BCMA 3ZJAA 3GWJA 5A7BA 1YY9C 3F7VA 4PRAA 2P24B 2NY2B 3WL9A 5DC9B 3LHPL 1VACA 1DVFC 5T5NG 1M1SA 5AZEL 5FX3A 1QSEA 3J07A 5BZZA 4BYHA 2FQDA 3SPVA 1BFSA 4NC1E 2TSBA 5BVPL 4QCIA 4ZFQA 4HJGA 4FFYL 4Y2OB 2B39A 1S7UA 2OYKA 3NOIA 1S7TB 4BQCA 3MV9D 2YOAA 3BEVB 1TQVA 2J20A 3L6FB 4ABUA 3U2JA 4DQOH 5F9OL 1I85A 1U8MB 5C9JB 1KB5H 4Q9BA 2XYBA 3QHZL 3VG9C 5LAXB 1L6XA 3Q1SL 4OD2B 2ESVE 5MERA 1TKWB 2GTZA 4G6AC 2APBA 3HFMH 4OCWH 3QUXD 4NUGL 3UJIL 1BEYH 4PJ8D 5C0BA 4KK5C 5DQJB 4MBOA 4MAYD 3PHAA 1EZVY 1A3LL 1NCWL 5FHBH 3VI3B 4AYGA 4WTZA 2VZ3A 4YXLL 1DUYB 1KFGA 2QTEA 2VSDA 4IHOA 4X6DA 1PQZB 2VDMB 5E6ZA 1OAQH 4LPCA 4WI3A 3KNBB 4LSSL 1ROWA 5GGRA 2C9UA 4B9KC 1BVOA 1MLCA 2ICEA 4X80L 2ZSVB 5LN8A 5IIEA 5JXED 1N59B 1R3IL 1URLA 4Z0BH 4JCLA 3N1GC 3BH4A 4E9XA 1JZ5A 4TSBH 1NBZB 2CKBL 2XNAA 3ARXA 3BZEA 3EXLA 3F6IA 1Z9PA 5DD0L 4XNXL 3A6CL 3SGKC 4OLWL 4ZDHA 2DQEH 2LABA 1R9FA 3UERA 4POYA 3TYFB 4GXFA 5DEFA 3GMQB 5FS5A 2F74B 2R56H 1JE6A 1CTOA 3MCLH 4LPXA 4YDVA 5JR1H 4P5MB 4KDWA 5E2VL 3LRKA 2ADIB 4DAGL 5IFAH 4Y4FA 3WUWA 1BZEA 1RLBA 2PCXA 4ZZKA 4RGNB 2QPEB 1A22B 2BW4A 3MA7A 2HG5A 1A6ZB 1RIUH 2ZOKA 4G8EA 4PJAB 4KFZC 3SE4A 3AQDA 4GW4B 2BWIA 2VDRB 1FZMB 4G43A 4NKOA 5FUOH 3QQNA 4LBAA 3WFDH 5I0WA 4M29A 3U9PL 1PD0A 3WEXB 3X1EA 4Y4KC 3MRQB 2J2ZB 3QEGL 5IFJB 1Z9SA 4J6IA 3L7EB 4PJFF 4O2FA 4Q52A 5KOMC 2R2HB 2X7LB 5I75C 5T3ZL 2GB2A 3MBEB 4NRXA 3ZE2F 4HJ1A 2H6PB 3QUXA 4ZPVB 2IADB 3IGAA 5DT1L 1CURA 1G7IA 3CZEA 3KAAA 2YRZA 4P2QD 5C8JB 3I50L 3BT2H 3FN0H 1ZT1B 3W2DH 3T5WA 2R2EB 5GS1B 1FNEA 3O2DH 5L0QB 3VQLA 1ED3A 1Y1UA 2VL4A 4BFKA 2A4ZA 4XAKD 1JERA 1NDGA 4M62H 1FLRH 2BNRA 2XZCH 2A9CA 3CU1A 3KPNA 1BOGB 3Q6GH 5E8EA 3OKEA 4WNQA 5F96H 5E08L 3T3PF 1TETL 3P11H 1FH2A 4FKHA 1KEML 4QD2E 3JV4A 2GUYA 4RQQA 5CHNA 5DO2D 3SGDH 1U8KA 3A22A 4KMTH 5JOPD 2JLLA 5BPPA 4N5UA 5CJOH 3FSAA 3VWJA 1JZJA 1GGBH 1OSZB 4OFYA 1DP0A 4ZUTA 3K6IA 4QO1A 5DS8A 3BPOB 4FYQA 4WF7A 1SLVA 3FQUA 1PSKL 3C8KA 3OLIA 2YHGA 3GBEA 1A7RH 5TE7L 5L7XL 2BOLA 4JFYB 4ZFFB 2XPGB 2OKMA 1UCBL 1FNSH 2VISB 3TCXA 3PV6B 3GXTA 5HGDB 1O5DT 2AK4E 3MXVH 4DGVH 3C09B 4L0ZA 3FUNA 4GRLC 2PO6D 2XI9A 25C8H 3BSZA 4KRNA 3NJLA 3ZTJG 4L8SC 4PIRF 3VXRA 1HHGA 4CVZB 4XP4H 5CEXB 1PZCA 4J3SA 5IUSA 1BA9A 1NC2A 3DX8B 3DGGB 3OKMA 2QSVA 2VDPB 3F8UB 4HGWA 4NPYA 4PRNB 3V9EA 2DQUL 3LRGA 4N86A 4JPIA 4RNRB 2EDMA 1FA4A 4LE8A 4FTDA 4U7KA 1SDYA 3EDEA 4P4KA 2H0PA 4HLZG 3H9SB 2ID5A 4ZFGH 3D0VB 4U1IA 4K7PH 3RVTC 4XPAH 4HUVA 4OLVL 3PJNA 3ZHFA 1N8ZB 3OLGA 4RWHA 3UAJC 1KTLB 1P4IH 1FFQA 2WQAA 1T1YA 1CYXA 4K9EH 3Q01A 2VWEC 4NQXB 3G5ZA 3FQNA 4JMNA 4X6CB 2XKNB 3IS0X 4LLQA 4UNIA 4H40A 3C8HA 4JR9H 2P7TB 4HV8A 4PRIA 2P1YA 4ZMOA 1N64L 1X4ZA 4HK3J 4MD4B 2YPLE 1IKNA 1O5PA 3CK0L 3CTTA 4FMFA 1OB0A 1YEDA 2F5BH 3QR1A 2ADGB 2CU9A 3O6MH 3MROA 3QIUA 1LEKB 2GJ6E 1QFOA 1HNFA 1S2EA 2IALB 3GLZA 4LAJH 3W37A 1MCIA 1N6VA 2R7EB 1S9VA 1CDGA 3E0GA 4JZJA 5CN1A 3R0NA 1AHMA 3G5XB 1LEIB 1AQHA 4ISVA 4O02H 3GBML 4DO5A 4YEEA 2AEPH 3GSNL 4XN2A 2LFGA 4HD9A 2YZ1A 3CGTA 3D4CA 3DPDA 4W9FC 1PNDA 4TF4A 1NFDA 3F7YB 4DGYL 4CSSA 4BZYA 4PR5B 4CMHC 2C26A 1PX3A 1RZ8A 2C3VB 4UANA 4IKNA 4PJFE 5SWZD 3GUTA 3WS6C 3IXAB 5L8KB 3QJOA 3DHUA 3UCQA 4LSQL 4XHJD 3ZE2E 2BDNH 5IEKA 2DKUA 2KZBA 3MRMA 4YR6A 3IDJA 5FO7A 6FABH 2AJYH 4PREA 4FX5A 1JXFA 1I7UB 3SZKC 1EVTC 3FT9A 4J4PD 3IJEA 3D4GA 4LVOB 1MZYA 4N2LA 1U8PA 1S7VB 1E9OB 2X4TA 1TOXA 1VSCA 4AGLA 4Y19B 2VLJA 5I26A 1F02I 4HH9B 1M1XA 1IQDA 4NLHA 3IRCA 4DGIH 4HIEA 4OZGB 1Z9LA 2UYLB 4M5SA 3GTVA 5JW3L 3QUMB 5IR1B 4ABWA 3C6LB 4X9BA 3HVDA 3KVDD 1IM9B 4RFEB 1T66D 4IRZH 5EUKA 2D31B 1E50A 2EJ1A 3J2PA 4X5XA 3T3PE 3C6EA 4LHUG 3TNNA 5I8CA 1IARB 5I16B 1K2DB 3O8XB 3GJFH 5H94B 4XNMA 3NT0A 1XBDA 4OUUB 4UU9B 2F53A 4FI7A 4K3DL 2Z0BA 1MNUH 4JDZB 3ZMRA 2HVBA 5TTRA 1GGYA 5D1XA 4JM0A 4U4BA 2CM5A 5IQ9A 3MRKB 3WUZA 2G5UA 2MEJB 5AYQA 3FU9A 4MA8L 4UM9D 2FBJH 3KBHE 4XCYB 2FNWA 3RL1B 1DBKL 4CSZA 1X3DA 4QR7A 3X17A 4J3XA 4BV1A 5KVDL 2R29A 4HZ1A 1CFSA 5LGHL 3HZVB 1BM3H 5FKPB 5B1CA 5D71L 3X1FA 3LTVA 3QNZB 5MI0B 2O5ZH 1NUGA 2F6AA 3P2TA 1VIWA 1FZJA 2B2XL 5IHBA 3L4ZA 2P5EB 3GPSA 3HRPA 4HCRA 4OZHF 1N10A 4H26A 4X99B 3AQXA 5FCUH 3VFUA 4MNHA 2VZSA 1PG7X 5DJZB 3VG0L 1BQLL 1WCBA 1P4LB 3FCBA 4U6YB 3MHZA 3MUUA 2E6JA 1PFOA 1D5MB 3TU6A 2IAND 4ICXA 4G80B 4R8WL 1PGRB 1LMKA 4YDZA 1XB3A 3ZW3A 1HL9A 3VGHA 3VXTB 2WLIA 3O9WD 3GMMB 1JXDA 2I26N 5DZLA 4ZMNA 4WK4B 4HOMA 3OL2A 5I0VA 3RX7A 2YKLL 5F7WC 5IMMB 1JPFA 5DJ8A 2BOCB 5LWYL 1AG0A 3ARFA 3EBHA 4WUUA 1EJOH 1YNKH 1XEUA 3E9TA 4P2OB 5GGVY 5ID0B 3VD9A 3CBRA 2NDFA 5A16A 3MBXH 5BXFB 2BCKA 3WNPA 1TQSA 3MKKA 4M3JA 4X4XA 2QJDA 3STZA 2IBGA 1PKQA 3P69A 1ZKAA 3HUJB 4MAUH 3NJNA 4NC2B 1CGSH 4AEFA 3S8WA 1DTUA 4FEMA 1DQML 2DQTH 4NUQA 5MENA 2QR0B 3FYIB 3KHOA 5DRZA 5ESQA 5TDNA 3ZMEA 3AXIA 3DX2A 1A64A 1YNTA 5AVYB 2JJTA 2GJZA 4HU8A 1AQKL 4WTZG 2Z4QA 1QBLH 2VE6B 4YBLC 2ZSWB 4KI5D 1P6WA 3RJDA 2XN9B 3I9PA 2WWOA 2EC9U 4U1GC 4XO4A 4G5ZH 3BP6B 3L3IB 3S36L 4JHVA 1FV1B 1LGVA 1RL1A 1XCWA 3AABA 4Z78A 5F6IC 4E9YA 3GI9H 3CDFA 3UZVA 3PXHA 3N5AA 3QE5A 4JFED 4LGPB 3U83A 1CS6A 2R29L 4I4WB 4X0KA 5IHZA 4Y9EA 1HXYA 4NZJA 1VCBC 1XB6A 2G3MA 4IKIA 4Y1TA 4Z3EA 1R3HA 4L3CB 1IBZA 4R6UA 3RTQC 5F1IB 1LLAA 5IF0A 2QSCH 3CX5J 4PM1A 5A2JH 2X6UA 2KC0A 3PWPE 4HWZA 2ED7A 1AR1B 4NM8H 2GBAA 5DK2B 3D0AA 4FXGA 4AQOA 2FLMA 4Q8BA 1Q4NX 3IMRA 1AS8A 4QYOA 4N0UB 4PJ5B 3EJZC 5CIPH 2X40A 2YPKA 3WUWG 1KTJA 2PWHA 4FQJL 4K5LA 5GIRB 5JOEA 4G82A 3HLAA 4NN5C 1YY9D 4HWEL 4P5SA 2OQJB 3HNSL 5HYIA 1ZLVH 5AENA 1GCFA 5IUCA 1DVFD 4U1MA 4FHBD 2IXQA 3R7RA 1AS6A 2VDKL 2ZZUT 4JM2D 3L2LA 1JZEA 3TOPA 2F7IA 5E5RB 2JB6B 4AEEA 3TP4A 5GS2D 3MV8D 5AAMC 5T1DL 1CFQA 2OSXA 3BPNB 3O4OC 2WSDA 4LASL 4XB8A 5K5YA 1JV5A 1V8HA 4J7RA 4AQ1B 4UT9A 3NZHL 5BVJB 5B1JA 3VM5A 2VC2H 2CIIB 2JJVA 3CHRA 3GIZL 4G6AD 3IBEA 1HE8A 1K4CB 2GT9B 1CXHA 5SWSE 3RYMA 4L1TA 3GMOA 1Z7JA 4N2OA 4DPCX 4J6RH 3T0DA 4FQXB 2XRAL 4Z3JA 2XACC 4GOSA 5DK3A 5I0YA 4KK5D 2WN3A 3LPOA 4G9DB 3RIAK 3PU7A 1F0LA 1JP5A 3S9DB 35C8H 2JKLA 4PGDA 1WHOA 3POCA 3LEXA 4Z0XB 1HHKA 4MZRA 1E30A 4XP6L 4OZHE 4X8JA 1AYRA 3UX9B 2CCVA 3P4OB 3V6FB 1BAFL 1IC5H 4L8BA 3BWUC 5DJYA 1RVFL 3LKNB 4XPBL 4U49A 3QXDA 1YEIL 1AO7E 4PJEF 1CQKA 3Q13A 5ICZB 5I1KH 5FAAA 3UBXI 1XGRA 2W0KA 4GMSL 3TFBA 1BQUA 1QP1A 3IGUA 3WNMA 3DRQA 2I9TB 1ETA1 2HLAB 1BXUA 2V7HA 2VR4A 3LPPA 4Q89A 5FDWA 4M7JL 4YEFA 4ONFH 1IT9H 4AGMA 1T7XA 5FPIA 5HJDA 5L88L 1FNHA 1EDHA 3H9HB 2AK1H 2GAZA 4LCIL 1CU4H 3K0YA 3DV6A 1OP3K 3TLRA 5TF1H 5ILTL 3X12A 1U91A 4WQOA 5ENWB 3OKDB 1JHTB 5TE4H 1HHHA 1I9RL 3A24A 1DQTA 3FRPA 4GAFB 1A7PL 1DVFA 5MEQA 3K2KA 2EILB 5IQ7H 1FO0L 4MJHA 1W0WA 3LH9A 5C0CB 4TVPL 1BD2B 1FAKT 2F54A 3QXAA 3MV8A 3QDMA 4ZMWA 4HK3N 3WIHH 1DJHA 2L7QA 4RRPM 1J5CA 4FTVD 2EUWA 1AE6L 4M5ZH 5JUEL 1AI1H 1U92B 2X9XA 2XIDA 4S1RH 1HXKA 4HF5H 1I8IA 2E7MA 1L5GA 1NAKH 1XF4B 3DV4B 2F8OA 1DBJH 1KCVL 3LKQA 4FMVA 1BWWA 4G1MA 1MCOH 1JGUL 1NPNA 3D30A 5SWQA 3ULUL 4P9MH 4ZOCA 4DNLA 3VRJB 4RX4D 5F0MB 4DJMA 3WJMA 2JF1A 4IOFC 5CGYD 5LVEA 4FLQA 3BIKB 2Y06H 1P5UB 4JLRB 3QJHA 5AAWA 4X6FB 5CJXA 2TRHA 2F9BT 1E27B 4AVIA 1T03L 1A6TA 5EU7E 5BOZG 1OCWL 5D6DC 1OP5K 1T2XA 4B27A 2X4QA 5GISH 1D9KC 2Z9TA 4WK0B 3BGMA 3A67L 4PG9A 3SD2A 1VPOH 3IF1B 3VFMA 3VD2A 2X1QA 1G9MH 4DN4H 1N0LA 2QGDA 4XOBA 1SYSB 1JYXA 1XSOA 3AXLA 3G6JF 2P4AB 1SFDA 4G7YL 1J5IA 1XGTB 1I75A 2FYVA 3HC3H 3HZ3A 1LDPH 1FL6A 3ZL1A 5IQOA 1WAEA 2ADJB 4RZCB 2J12B 1OSEA 4F7KA 2VDOL 4XCEB 2ZCZA 4WO0A 1IGYB 2UZXA 5IBTH 2KKQA 4W9IC 4GT7A 5DMJB 4CAGA 4HOWA 1ZVHA 2YAEA 1UURA 3ABLB 3QR0A 3AS0A 3OD3A 2CAKA 1K8DA 1IVTA 3DI2B 4QRPD 4PS4H 4NNYA 3BWZA 1IAOB 4ODWB 1RUML 2PPFA 5L8LB 4QTIL 2AW2A 3UYRL 4ZO8A 3SE8H 2W1NA 4K9EC 1IIKA 2GJPA 5EIIB 3I3DA 5T5FA 4GRLD 3FU7A 2IOOA 4NLAA 2DQGH 3IWVA 1T1WB 1ZTXE 2BIIA 3D7PA 4Y4KA 2FR4A 4G7VH 4XZUA 4GW1B 1T5XB 2CBPA 3IDGB 1QYGL 2CJUH 3R1GL 4FDWA 4GG8B 2X6VA 2KI6A 1E67A 4JPWH 2XFXB 1J8HD 1AKPA 5E99H 1OSPH 4GMTL 1AQ8A 4HISA 2QQLH 4L37A 3NP3A 2HKAA 3SY0A 3DXAA 4PRBB 4RX4A 3RBSA 2X1WL 1PZSA 3DX9B 1UH4A 3IEAA 1QA9B 2G9HB 5EU5B 2K9UA 2FYYB 1JPTL 4KGJA 2YR3A 2ICWI 4JREC 3ARWA 3OPUA 4NQDB 1D5IH 3RVTD 2AI0L 1V55B 2YUWA 2ATKB 3NAAL 4WI4A 4XBPA 5FCSH 1WAAF 4Y16B 2HN7A 4ALAH 1YPZB 4IOIA 4KDVA 5CKGA 4PJEE 2YUXA 4OIBA 3C5ZB 1BHGA 1HX0A 2DEWX 3V8OA 2KERA 15C8L 5I1GH 1KY7A 3LSOB 1U8OA 4AMKL 3Q06A 5KBPA 3QHFH 5BO1L 3VXUE 5C7XH 3QPXL 2A9NH 2RACA 4F58H 1AZCA 3H54A 1U6AL 2ZD0A 4CU8A 1BECA 3MXWL 1CXEA 2NPLX 1NJ9A 1L9NA 2WBJC 5IQLA 3LVTA 3S5LG 3QDJD 2V3FA 3AS2A 5IEHB 3VSVA 1A8ZA 2IWEA 4LEEA 1J8KA 3CZSA 3L4UA 3SOTA 4Z7QB 1JZ4A 1GZPB 1JZDC 4HALA 2FSEA 1YNLL 5GHWH 3MV7A 3MUHL 5IB5A 1IQWH 1QBMH 5A6IA 5DD5H 1T0NA 5F0PB 3ZZLA 1QI4A 3EUUA 2IGLA 3B7YA 1QD0A 2F61A 3T1FB 5KUMA 2YD0A 2EDHA 4FEIA 4L4VE 4MX7A 4F9LA 2D3JA 1JRHL 2HRPH 3ES6A 1LD9A 3BESR 4OV5B 1MVUA 1QSFA 3EBGA 1TPXB 2ZWKA 3GXPA 4DKFH 3RVUC 4OT1H 1NEZA 5GGQH 5I76B 4PRDB 3TJPA 1U95A 5T5FL 3WMSA 3EYFA 2QLYA 3BP4A 1S9YB 5AW2B 3KYKH 4L9LB 4OF7A 4XP9L 1QRNB 5AAPA 2WQWA 4U33A 5HHQB 1O7DC 4OB5H 2P47B 3S35X 3HPJA 3ALXA 1FL5B 3MACH 4DFHA 5IJVA 1LO3H 2QFPA 1H3GA 1BEXA 1Z0MA 1M71A 2K6ZA 5LGJA 4TV3A 3F12A 3PGDA 2Y3AA 1J1OH 1MI5B 2X6CA 4QKTA 2LVEA 1FFNB 3MV9E 4JZOB 4R7DA 3UAJA 1QWUA 1C16B 1G9NH 1MCKA 1PZAA 1ECZA 3G6JE 5IW1A 1HINL 4WIQA 2Y7LA 1IBBA 1I31A 3KJ4C 5DSCA 2UZPA 2FHFA 2WXKA 4TQHA 1Q9KB 3OAWA 1E6JL 3S34H 3UTPD 3ZQWA 5E00A 1G6RB 3HI6L 3SE9H 3WTTA 3BPLC 3U7YH 2BC4B 5HPMA 2CHWA 3SDXB 3VDAA 2ORBH 3IFOB 4TNWK 5ID1A 4GUQA 1CF8H 2A0LD 1LNUA 2GHWB 3AREA 4O58H 2IPUG 3TN0D 1R1CA 1JZGA 3LQZA 4KQ3H 1LK3L 4HFWB 4QT5A 4ZMVA 2IH1A 4Q6IC 2HX7A 2VYRE 3ZL4H 1A6UL 2IV9A 3TA3B 2BNQD 3MRBA 2YPVL 2A1WH 3RPKA 2LU3A 5IV2A 1OAJA 1QACA 5A3IC 2Y5TA 2ZJSL 3GJEB 5I8OL 4RA3A 5HHOB 5L6YH 3GGWB 2L8AA 5AVQB 3T3MF 4E2OA 4DH2A 2NNXA 4RAHA 2A73A 1RXLA 1U8QA 1LE5B 1P9MA 3WS6A 4TKWA 5TD4A 5I9QB 5I66B 3EJCA 1DBAL 3H1ZA 4XODA 3UROR 3V4VL 2WUBL 3CSYB