5BUAA

Lysine 120-acetylated p53 dna binding domain in a complex with dna.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
199
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for p53 Lys120-Acetylation-Dependent DNA-Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 50
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5buaA00
3D07A 4IJTA 2IOMA 4IBQA 3Q01A 1YCSA 3KMDA 5LGYA 2AC0A 3VD2A 4IBYA 2OCJA 1E50A 5AOKA 3Q05A 3KZ8A 2X0WA 1LJMA 1GZHC 4AGNA 3D08A 3Q06A 2BINA 3VD0A 2X0VA 2AHIA 4IBUA 3D09A 3WU1A 4HJEA 2IOOA 3US0A 3US1A 2J20A 5AOLA 3WTUA 2XWCA 4LO9A 4AGPA 3WTTA 1EAOA 5G4MA 4IBSA 2YBGA 4IBWA 4L0YA 3QYNA 2X0UA 2BIOA 3EXJA 4A63A 2MEJB 2PCXA 2XWRA 3WTWA 2J21A 4MZIA 4L18A 3TS8A 1H9DA 5LAPA 2FEJA 2BIQA 2GEQA 3EXLA 2BIMA 5AOMA 2P52A 1TUPA 5AOJA 3VD1A 2J6WA 4XR8C 2J1ZA 1CO1A 2WGXA 1CMOA 4L0ZA 1HJCA 4QO1B 1GZHA 4IBTA 4GUOA 3WTXA 4IBVA 2H1LM 5KBDA 4AGQA 1IO4C 2IOIA 1TSRA 1KZYA 4AGLA 5AB9A 3QYMA 5G4NA 2ADYA 5ECGA 4GUQA 5AOIA 3WTYA 4LOFA 3WTVA 4AGOA 3WTSA 2J1YA 2J1XA 4IBZA 1UOLA 3D0AA 4G83A 4G82A 3IGLA 2ATAA 1HU8A 2RMNA 1HJBC 5ABAA 3IGKA 2BIPA 1EANA 4KVPA 5BUAA 5A7BA 3D05A 4LOEA 1T4WA 2J1WA 1EAQA 3ZMEA 4AGMA 5G4OA 2VUKA 3D06A 4MZRA
chains in the Genus database with same CATH superfamily
4YSCA 4FFZL 1S9VB 1LEIB 2I27N 1JCKA 1NFDE 1BBDL 1RJYB 3I6KA 4G8EA 4MB5A 2Q10A 4CJ0A 4V2BA 4E9WA 5DD0H 3O6FD 5EIIA 1FRGH 1ZDSA 1AY1H 4F2EA 3BP7A 3A23A 1YEJL 1MHHA 1JDDA 2B15A 3I85A 4AM0Q 1MJ8H 4NJAL 2GSMB 3C2AH 1U8QB 1AO7D 3R7QA 4YIQA 3IJYA 3O45A 1C8PA 2HJLA 3BI9X 3NJLA 4M48H 3DK2A 5E8DH 4NI6A 4TVPH 4EI5B 3OLGA 1I7RA 1JSYA 4UTAL 1XGUA 2F54B 2ARJA 5I76A 5D72H 3S5YA 3EBHA 1O6TA 2VDNB 4I18C 2R4RL 4Y4FB 2VC2H 4WHCA 1BXXA 5KZCB 3L17A 2ATKA 1MCJA 5EORH 2WKGA 3T08A 2HJFB 1T83C 4HD5A 3NPZB 1W8NA 3BDXA 4HZ1A 3KEDA 4QHKI 4Q97A 4PJHB 2Z64C 5DCCA 3L5XH 3VTTA 4M43L 2HN7B 4ZTPH 5IB2B 3RY5A 2WGXA 2XVLA 3BZ5A 4NDMA 3SCMA 4A7GF 3G5WA 2C4XA 4X7TA 1BOGB 1QKZL 3MCLL 4L0ZA 4YSEA 4JG1H 4X8JA 1UASA 4K3DH 4Q6IC 1UCTA 3APDA 1S7XA 2FNWA 4G8GD 5C0DB 2OP4L 3HC0B 3F83A 5AWNH 3UAFA 3EYVB 4HKXA 4HG4J 1KELH 2Z6FA 3TBYB 1IO4C 3PJSA 1PZ2A 3L4UA 3H9ZA 3WFBH 2G0LA 3DBXB 3MLXH 2ICWI 1RZFL 2K4AA 2HTKD 2DI9A 3ZLQC 4LF3A 5B7FA 3JVGA 4ZO7A 3FH8A 3QUMB 1YN7B 1OAUL 3GZOA 4PJ5D 1ACYL 4PB0H 4XP5L 3MJWA 1UENA 4TUOA 5DWUH 3F3HA 5ADPH 5F9OH 1UJ3A 2AMUA 4YUEL 5T3ZE 4X5QA 5EU6A 3LRMA 3IDGB 4JW3A 4PPTA 1HU8A 3P9MA 2P80A 1QLRB 4HP5A 3QO1B 4XP1L 4DKFL 1N3NA 5DS2A 3WGVB 3NFNB 1KGXA 4WWPA 4L9LA 5AQ0A 1ZVHA 3V0WH 3UYOD 1YMHA 4Z76B 1P1ZA 4B9IA 2WVSA 2ICEA 1DZBA 1SXBA 2WY3B 3OAUH 4WUUB 2A3TA 4K2UL 1LEKB 1ZVSB 4OZIF 1EXHA 4C83A 4HT1H 2WANA 3O8XC 4KXDA 1XH2A 2NYYC 1XCQB 1ID2A 2CDGB 4OGYH 5E9DE 1WBZA 3U7YL 2VDRH 3KNBB 1BQ5A 2DM7A 1KFGA 3L4YA 4YBQD 5A2CA 4FYTA 2E7MA 1ZPLA 4NERA 2VQUA 3WEXA 3T3PB 2E9WA 2E3VA 2VDPB 2FECI 3KCPB 1CDGA 3SKMB 3BISA 3RZWA 1DR9A 1JXDA 3QDJE 4XVJH 5DMIL 1NCCH 3C5ZC 1MLCB 1Q8MA 1Z5LB 2C7UB 2VO8A 2X4RA 5JOPE 3LZRA 3VFPA 3JV5A 1ZV9A 3S34H 2NQ3A 4E9RA 3CDYA 4LHUA 3WKYA 4MNGB 3BP6A 3FMGH 4BHUA 3QZPA 1ZPUA 2WAQA 2QTVA 1IBFA 3NP3A 2FX9H 4R3SB 1O6SB 5DHVB 1X5ZA 1JK8A 3QARA 4HKBB 4I5BA 3GFUA 3ZHNA 4PVNA 3GI8L 1H6EA 3M88A 4M1DH 1GJUA 1ZEAL 3SDXA 1MW1A 4N2OA 4DJMA 1HHGA 4HSCX 4WI2A 4ZMXA 2EINB 1PY0A 1SJXA 4DHLA 1OY3B 5BPPA 1M9SA 3DSNB 1KTLA 3CE1A 4ANWA 1UWXH 3WOVA 1CD0A 2VLLB 3U0WL 2VDPL 2CMRH 5DD6A 3AXHA 5E2JA 5JW3H 3AT0A 5IJDC 3HFFA 1J5OL 2YPLE 1JDCA 1L6ZA 3BYTA 4LBEB 2Y69B 4F2MB 1IGYA 2UZPA 5EBMA 3WNLA 3BH9A 5D4QA 1HYRC 4EZJA 1KDIA 3TH4T 3PHSA 4UU9B 2VMEA 4WCYL 5T1KD 1W0WB 3WN5A 4BK5A 4FE9A 3HJ0A 2IH3B 4XN7A 2AMGA 1TVBA 4L8SB 3A67L 2YIHA 3UJJH 4KFMA 2V2XB 2DLFH 1ZSDA 3RBGA 1U8KA 1D2PA 4AV5A 5I15L 4JO8A 5TGBB 1GKOA 4XX1G 5I1IL 1G6RH 3CHOA 3GSVA 3RVTD 2OYLA 2VN3A 3MV7A 2J25A 4G9FA 4MASA 2AK4E 1NKRA 2JFCA 2DBLL 4P9ML 3O3AB 4NCC2 4YHLH 3LKRA 5J0BA 2H32B 1Q9OA 4KKBD 4NQSA 5HGGS 2JQMA 5ALBH 4IU2A 5FO7A 2EZ0D 2VW7A 1KLUA 2ZXCA 4PRID 2VN6A 3C5ZB 3CZUB 4NNPL 5E24E 5IVXE 1RZJH 4B9FA 3OWRA 4XAWL 3VSUA 5E2WH 1G1CA 1I9IL 2VQ4A 2D4DA 2ERJC 4ZW5A 4UYQA 2CBMA 4GMSL 5ICXB 3C5ZD 1HZKA 3MLZH 3MRRB 3DV4A 1MVYA 4ZPVB 1J1XH 4LPTA 3RA7L 3SBRA 3OAZK 4OF8A 4BCXA 5F9WB 1HHHA 2CK0H 3G3LA 2IGFL 4PJFA 4MJJA 3QIUC 4LVHB 2V2WA 1FAIL 1AFVL 4AYSA 2BNRE 3O3EA 3FO1A 2ZOTA 5BZXA 3OMAB 4YHMH 5EO0B 4HU2A 1OTUD 5CBEB 1RJZB 4JUSA 4LSDA 3G7TA 4JM2D 3L5IA 4ZYKB 3QDGE 4DH2A 2F8IA 1NAMB 5BZZA 4AQAA 1F3JB 2Z92B 5J6GA 1GGTA 1JXJA 2DQMA 3D4ZA 2EZ0C 4BKTC 5ID1A 3OMNB 4I4WA 5KVGL 3IJHA 4DZBB 4PWIA 1HVXA 1DLHA 2P48B 4FFWD 3EGXA 3CFKA 2N7SA 4GS7C 2BNQB 2V3FA 5DEGA 1T6VN 3MLZL 5C6TH 1YEJH 3H6AA 1G7QB 2KUTA 2APFA 4KKRA 2YMOA 1FIGH 3R4DA 4L29B 1I3RB 2YEZB 1HXMA 4EVNB 3TH2T 2FYYB 2I32A 5LBSA 1RVFL 1C16B 4Z7QB 4AE0A 2PP7A 2FH8A 4P05A 4QT5B 1D7DA 5E4EB 1WO2A 4N0CC 2SEBB 5FGSA 1GW6A 2MPAL 3WLWC 3L2LA 3MRQA 1A64A 3BE1L 1TPXC 3L6FB 3A3YB 5A2FA 4QY8A 4EN3D 1L7TL 3E8UH 1TKWA 3P4NA 3QYMA 3MBWB 1UVQB 2EABA 1WZAA 3KGRA 5ID0B 3Q9PA 2M83A 2VXVL 1CS6A 4K07A 3CHRA 3EGDB 5AW3B 5HHME 5AW6B 1BEXA 1LMIA 4G5ZL 3S3DB 2LTQB 3QPKA 4JKMA 2VGLM 3IXTB 4ELMA 4KTGA 2FAUA 3ARBD 5FYKU 4L1LA 2OQJB 5MERA 4LASL 4YJZL 4MQXD 4P2QA 3QK0A 2GG1A 4Q6KA 2ZSVA 4GBXD 4L8CB 3MRDA 4I0CC 3IYLW 4GSXA 4YSUA 1CF8L 3D3VB 3RLSA 5HGHA 4XZUA 1OIOA 5G4OA 1SRDA 4XBGB 3LNIA 5L88L 4HS8H 1J9CT 1FNSL 4IJTA 2B2XL 3UDWC 1DDTA 2QT6A 2WXLA 4KFZC 1PEZA 2BFVH 2H26B 3UZVA 1YNLH 4JM2F 4FZEL 3FQTA 4KH2A 4JQVC 4K4KA 3I3DA 3G9VA 4LGSB 1UA3A 1MFEL 3WBDA 1GMEA 1AI1L 1JMZA 4PJ7B 1DE4B 4HBCL 1CICB 2GTZA 4ODWB 1ZEAH 3VD0A 2Y4SA 1A0QH 2ZWNA 4OV5A 1Q0YH 4OZFH 2CUIA 4S2SB 4JM2C 4DP0X 3QZNA 2DN7A 4PJ7A 3CHXA 4ZUWA 3B7YA 5T1JA 4E0RB 4CU8A 4QRPB 1WIPA 1TQTA 4N87A 3F7QA 1AKJB 3EYQD 3B2XA 5CP7B 2Q3ZA 3GT6A 1JPTH 5CLYA 3TNNB 3ESNA 3VSVA 1OSYA 2H32H 3HE6C 4N8CH 3REVB 4QYOB 3EDEA 4GUPA 4RMUA 4CSSA 3I75B 4RLDA 5CUSH 4YHNA 5IMMB 1J86A 2YEVB 3QR1A 1X9UA 2F7PA 1N5AA 1KLGA 3DMMA 3EKCA 4L18A 1EIBA 3ZQ9A 4W9KC 3BQUC 2GIXA 2FSDA 3NP4A 2OZ4L 2WQAA 5DHMC 2QELA 4DFHA 1VAHA 2QHLA 2ALWA 3CH1A 4X50A 2BIMA 4XNZC 4PJ7E 4Z95L 2ZUTA 3ISWA 5C7XL 1OCZB 2YMXL 4U1MB 3FO9B 2AQPA 2X10A 1ET7A 3EYFA 5HYJD 1ZHNB 3MOAH 3S36H 1CT8A 5CN3A 4KOBA 3WAKA 1NC2B 4XXWC 4ZAKD 5J1TC 1OW0A 3BZEB 1YMHB 5I24A 4HA1A 3C12A 2NDFA 4E42B 1B6DA 3R0MA 4GIOA 4YN3A 1BXUA 2IXQA 1GOHA 4IU2B 2IQ9H 2BOBB 3DDGA 1J5HA 4UT7H 1IC5L 1OK0A 5D70H 1YC7A 3X2QB 1S5HA 2XU9A 5EBLA 3SQOH 2YPLD 3OXRB 4NB7A 1Z9LA 2P43B 3N40F 4G8IB 5E9AA 4F33A 4LGRB 4IKJA 3OLIA 1OALA 3DIFA 2XNAB 3LZFL 2DWYA 4QPEA 2R39A 3CFCL 5H94A 4XNXH 4Q9BA 4Q52A 3HNTH 4ANUA 3TA3A 4HEPG 5B3SB 3IF1B 4MHHI 4C4KT 4TSAH 5CCJA 4J6RH 4Y19D 1D2OA 2PABA 2TRYA 2Z8SA 4F3FB 5LG6A 3AM8C 4UZUA 2VQ1B 2OYMA 1FHGA 5HVWA 2YXFA 1XCQA 2CDGA 4PCSA 3QIBD 3N1MC 2PTUA 5C0IB 4PJBB 2QKSA 2WQXA 4YSOA 3LNGA 4AQEB 2IANB 1PY9A 3FB7A 3TL5A 1CZ8L 2YPKB 2MFNA 3NCYP 2ROXA 4YHIB 4YFLF 3WIIH 5IMKB 1BWMA 4FNQA 4YGAB 1HWWA 3TO2B 3E0GA 3V6OE 5FYJD 3O81A 3ZHDA 3ALXA 5F6HJ 2V8LA 2K7PA 3Q2VA 3CSBA 5TH2B 4Y9BA 2DPKA 3B37A 2TRHA 5HDWA 1JYVA 4O2FB 2KH2B 3VXSE 5IIEB 3BHBB 1I3VA 2LU4A 5CU9A 4N20A 5DA4A 3T0DA 1A9EA 4YX2H 3S96B 2F53E 2IPKB 2XV0A 4PJDE 2P4AB 5C6WH 5HPOA 3U9UA 1O6SA 3MXWH 1CTOA 5CGTA 4R90L 4WWKC 3FQRA 1TYRA 1EHXA 5IOPA 1C9SA 3DJ9A 3GO1L 4HIHA 4ZSOE 1Q9KB 3B2MA 5KBPA 3EOTL 3RKDD 1L7IL 5DO8A 4GG8A 1BSIA 4C8XA 2KDYA 5BXFB 1RIVH 2IFFH 3K80A 3N44B 1KCUH 3C75A 4QXUL 4W4OA 5A6IA 1SPDA 1C5CH 1E5AA 4DGVL 2B3RA 2YKLH 5IESL 3QYCA 3G5XB 3OSVA 4JKPL 3KNBA 1H0DB 4CMMB 1M6UA 1JHLH 1TZIA 1O7VA 2FJUB 5H4YA 3WO4C 3Q8AA 1KCVL 3EG9B 2Q1EA 1T2XA 4QKTA 1A4CA 4JM4H 1GC1L 2MRYA 1ETA1 4L8SA 1GSMA 2PMZA 3O41B 2YUZA 4JN1H 2OMYA 3H9SE 3SGKC 5CGBA 3O2DL 4JGJA 3H7LA 5AYUH 5T5NF 2H2PD 5BVPL 2VSCA 1Z3GL 3KVQA 3N42B 4FZ8L 3VI4F 4P23C 1HAWA 3ZHFA 5JOFA 5KBLA 5CN1A 4KK8C 2ORBH 4FNUA 1XGUB 4MX7B 1T1ZB 2BSEA 1SLVA 4NBXB 1W6LA 5IUCA 4JEGB 3EFOA 3F5WA 4FXLA 3FUFA 4WNQB 4WKZB 5HDQL 1HIML 1VFBB 4U4BA 2X2UA 3A4DA 3CNKA 3GZKA 5DEFB 5EF1A 2P28B 5I66A 1HJBC 5I19H 2GAZA 3NH7H 5D4JA 4OF3A 5B1JC 3X1NA 1X9LA 4AENA 2DTSA 1N59A 4TPRL 1SDDB 1YC8A 4RSVA 1F02I 2FJHA 1E4XL 3UABA 3KYMB 1C7TA 6FABL 3JTSA 4DOHB 5CILL 3L7EB 3SKJL 3GLAA 2H45A 5BRQA 4GMTH 1DHKA 1FFPA 1JXGA 1NUGA 4E9VA 1E8ZA 4QRSB 3D0LA 1ZA6A 1H5BC 4R2GD 4HUMB 1D7FA 5I8KH 2NXZC 1VRSA 2BWQA 3DUHA 4MDIA 3OD3A 3GJFA 2AKRB 2CAKA 2UWEE 4LRNH 1T3FA 4AYMC 1YNKH 4ZDHB 4U31A 4B3VA 3FUHA 4HJ0D 5IT2L 2V5SA 1SLWA 4Q6IA 1TVDA 3ULVL 1FZOB 2VN5A 2PXYA 1BF5A 3MX0B 5DRWA 1IMHC 3TH3T 4KH9A 3FTGA 1JGUH 2A77L 1YY9D 3F2LA 4X7TB 3QR2A 2ITEA 4JMNA 2P5ED 3TEUA 2YARA 3D51A 2GKIA 1BQHB 4K7PL 1MFCH 3VACA 2Y6SD 4PS4H 4RAUB 4DP6X 1QWHA 4TL5A 1VZGA 5D6CB 4V33A 5L8LB 3JVGC 3SDAD 1IT9H 3FT9A 2QQLH 4WO4D 5D72L 4OLXL 3REWA 2Z4QA 4WNJA 2QSVA 2L04A 4TNGA 1HQ4B 2YD0A 2BNQD 1N19A 2CRZA 3Q2NA 3MRCB 4DESA 2ATKB 3AT9A 3I9GL 1E6OL 2C1OB 4LLVB 4N6RB 4Y8AA 4FQXB 2DLEA 2GTQA 3BP4A 4W9HC 3IJ7A 3MCG1 4NSKB 5SV4A 3DHPA 2FD6L 1B4JH 4KROD 4OR1A 1J18A 1RPUA 5J13B 3T1WA 2DQJH 1WFJA 2EH8L 2ENSA 2WBJB 1DCLA 4LAQH 4MCNA 3R7RA 3L4CA 4M5YL 3HA0A 2JTYA 1G7HB 2XDHA 3E2HB 3O8XA 3T3MF 1BZ9B 3V8OA 4P59H 4UINH 4NM4L 2C9RA 1NEPA 3CZEA 4PJ9C 3PWUA 5DLLA 3VRIB 3VGDA 43CAA 4DKAA 3ZZSA 1FIEA 1IGJA 4HIXH 1IQWL 1KWGA 4OZFG 1KIPA 3GBEA 5E6IB 1JGLH 4JRWA 5IBTH 4PJEB 1JVKA 3RTQC 1OPGH 5JHDA 1G4RA 3RWIB 3C5ZA 4P2OD 4POYA 1OD9A 4ZO9A 3SGDI 4U6XB 2OZNA 5DUML 3PF2A 2EEFA 3O3AA 1JF1B 2JKRM 3VXQB 5GGUA 3F04A 1BQLH 1OOWA 4Q2ZB 3N5AA 5SX4I 4IIZA 2PWEA 4TUJA 2Z65C 4XMZA 4P5RA 4GNKB 4DIXA 1DLHB 3CLWA 4L9DA 2QDVA 2D0FA 5AENA 2CRMA 4JRLA 1DFBL 1JFQL 5HP5A 2BP3A 2VZ3A 1BYNA 3RIKA 3U0PA 1HZHH 3L3KA 2X05A 5JHLA 1X5FA 3BKML 1AXTH 2J5LB 5FF6B 4QJ4B 1F5WA 2GSGA 3OJDB 1JK9A 5CCKL 1T4KA 1UHVA 3U9PH 4TSCH 4NKMB 4I3SL 2FX8L 3O11A 3UTZA 3O45B 3GRBA 5E9DB 3WY3A 4HISA 4JFQA 1E28B 1DBMH 4WI4A 4F7CA 2FL5B 3H54A 2EH7H 3IJSA 5E1HB 4MQSB 5DJYA 1OCCB 1BM3H 2PP8A 2NXYD 1OGPA 3BPLB 5K59F 4XNBA 3RKPA 3W3BA 2W91A 4PJ5A 2D31A 2BVPB 4AGPA 1PD0A 1LO5A 3T2NH 2DJSA 3L2MA 4OTXL 5CKAA 4D94A 3BKYL 2Z0BA 5CJOL 2H3XC 2LABA 2Y3AA 4UWQB 1LWJA 4IMLB 4M6NH 4WTQA 4BWUA 4KGJA 2FHBA 4QHPA 3RHWK 4DKEL 4EQ3A 2E9BA 3GXTA 4KROC 3G6JF 4HZLB 4OI7A 3M1CA 4KO6A 4FQQB 1UD4A 1HT6A 1RHFA 5H4ZA 2PYEE 2NY7L 1ODAA 3QAZB 1NGYB 1T21B 3H6JA 4Y5YC 3VI3E 5HYJB 5F6HI 4F7TB 3U6RA 1KXVC 1TPXB 3MR9B 4L4VB 4Z7QF 4GJTB 3CU7A 2DICA 4RRPA 3ATEA 4JKNA 2R0WH 1HSBB 4MMXB 1O5DT 2HFGL 4NAQA 1FZKB 4Y2DC 1BZ8A 2E4TA 4FABH 3ETSA 1V7MH 3SE6A 1JWSA 2CDEA 4JHAH 4PJXA 1J9SA 3ZKMC 3P2BA 4FXGB 4AGQA 4UNVA 3G6AB 2GUOA 4HOMA 1NM4A 3WFDH 1W0WA 4OKVA 1YDPA 3OKMB 3B9AA 1U4EA 3HNTL 3GIZH 1JN6B 1I7ZA 3HS8A 3HUJB 3MV8B 1BWWA 5EU5B 1NMCC 2CPCA 2VAAA 4FFVD 3TP4A 1MHCB 2N01B 3QIUA 1JE6A 3D2UB 2FEEL 1IFRA 3O0LA 3ARGB 1IKFL 2PF6A 1JWMA 4F1SA 2L7EA 4WI6A 5JOEA 3PHQB 2XY1A 5F7LB 1XF2B 3P4OB 5KUMA 4R4FL 3HAEG 3ZZ1A 1A3RL 2IALA 1HCYA 2A9MH 1CGVA 1IIKA 1NGQL 4I0PD 3KXFD 3PHQA 3Q13A 4NHCL 3R8BB 4CRPA 4JPSA 3HC4L 3MLYL 4KK5C 3M8OL 3ARGA 1E40A 4IS6B 3RY6C 5K39A 3V0GA 5GZNA 1GZHC 1UA6H 2X5PA 4FFYH 2VDOH 4LVHC 3TIEA 1S7TB 5FW6A 5EIQA 2QMJA 4JE4B 4FQLL 5C7XH 2UWEF 3W2DL 1PKOA 1UT9A 4FNSA 5F3BB 5IEKB 1F8TH 2V5YA 4FP8H 1E7UA 4KVCL 5I1HH 1YY8B 3DX3A 1E4JA 1QR1B 4F7PB 1PGRB 2VIRA 2BNUB 3EUUA 4P2RE 3CQPA 1UM4L 2BMKA 4Y4HB 1JGDB 3EOBA 1VEOA 3UC2A 4ACPA 1IJNA 1CTNA 4AMKH 1S7XB 2BIIA 1ONQA 1MCQA 1U8HA 4DAGH 3HRZB 1HTYA 1CF1A 4Y4HA 4DPBX 5I0VA 3QHFL 3WKNA 3HKZA 5KVDL 3AC0A 4F7PA 2AJZB 4IBLT 3MC0A 4PTUB 5E8EA 2WB7A 3WO3B 2OSLB 3ULVD 4Y9FA 5HYJA 3NJJA 4K9EL 3BMWA 2Z31C 3C5JA 3U83A 2Q6WA 1XEUA 3KYAA 1TZAA 3QJQB 1NFAA 5TF1H 3THML 1WZ1H 3ZT6A 4BKSC 1P6FA 4MZIA 4AH2A 3TO4C 5DYFA 5TE4H 1OAYL 4CDHA 4NT6A 1QABA 2R29L 4Y5VC 4IMLA 3IPEA 3GBNH 3LS5H 2APBA 2QADD 1D5XA 1P69B 1UUSA 3GIVB 4OLUL 2YBRA 4X98A 5F1IA 2ENYA 4ZPVA 1DQLL 2YFNA 3HMXH 2KS0A 3MREA 2B2XH 3P73A 5AW2B 4PV8A 2F58H 5D1QD 3QJOA 2KLSA 2VAAB 3V52L 3MJ6A 4KKLC 3KPOB 4MMXC 3OMIB 1OOAA 2A9CA 3NIFF 1CLVA 2VDML 1PBYA 1U8HB 1TQVA 1YJDL 3GMOA 3R19A 1KPVA 5KANG 5FUCE 3ME0B 5AAWC 2HJKA 4K55A 1NQBA 3EYQC 1SEBB 5E6IC 3T6XA 1BCIA 2VXTL 3WHXA 5JPNB 4GUQA 4MDJB 5F3FA 5CHNB 2F68X 5FR3A 1TJGH 1GIGL 2AI0L 3E9TA 1A9BB 2EE2A 2EO7A 3WFEH 3S3CB 3BSZH 3BKMH 4IKKA 4EI5D 4JM2A 2H8PA 4LXFA 1NCBH 2OTPA 4OZHE 4G82A 4I1PA 1YEEH 2DYPA 3VXUB 2VISA 2VLKD 5ITBH 4UIKH 4OCNC 1MHEA 4G43B 5AZEL 4LDOB 2FT6A 5AVRB 3IWVA 1P9MC 4GFXA 5L9DL 4OZHB 4EZLA 1P5UC 4O02H 2QTEA 1GOGA 2EDKA 3BH8A 5GRZA 2ZCZA 1A4AA 2YC1A 4M1GL 1I8MB 5DFVD 4MJ6B 5E8PA 4A66A 1A7NL 5TJWK 2J88L 1HKLH 5ACLA 4URKA 4IEFA 4NN6C 5GISH 4HIPA 1WFMA 1T7ZA 3P73B 4JGUA 5GGSB 3WL9B 5AW8B 5B7MA 3QDJB 4OCRL 2B1HL 2Z3FA 2XPGA 4WUKL 1OSPH 4WWKD 3DOSB 5FGCE 1T0MB 4OW6A 3D08A 5D7IB 2AJYH 1CE6A 2BINA 4XXWA 4PRHA 3H55A 3HAEH 2YD8A 4K3JH 1JF6A 3KLAB 1VA9A 4XPGH 3WTTA 1FZKA 1QQDB 2UX7A 3LRHA 5DHYA 4DW2L 1KEMH 3U36B 1UZ6E 3S2CA 1QNZH 3BO8B 4FQ1L 3TGXA 3EJSA 3GLZA 2FD6H 4UAHA 1KJVA 1BECA 2NX5D 1IBDA 1MIMH 3QCUL 5F70A 4N90E 3RVVC 3IDMA 1XF4A 2WWKO 4YMPA 1FO0H 4BFBD 4HXBH 2NXZD 1TTGA 4N2NA 5HYSB 3RDTA 3H7BB 3QCUH 5IHUL 2WBJD 4PRIA 1OP5K 5F7EH 3FF7A 5C0CE 1FLRH 3C60D 3ESPA 4KMTH 4TLTA 5MEPA 3IGAA 2WLZA 5CZVH 2QZQA 2CHNA 5CJQH 1IX2A 4C83B 1G1YA 2OBGA 4JPIA 2EYSB 4P4RB 1AFVH 1BXAA 3ULVC 4BK8A 2ATPA 1FZOA 4NQEE 4UIMB 3D6GA 2DQHL 2XI9A 4FXKC 2VH5L 3NIFB 4F20A 2DTMH 3MYJB 4GSDL 3E8VA 4Z3JA 5I74C 1LDSA 4AEIL 2E7CA 2Z7WA 1MCWM 1T1WA 1A5FH 2C3VA 1F3DH 4I48A 4MJ2A 5ES4B 1UA6L 1M1XA 2IFGA 1FV1A 2EIEA 3PL6D 3QC5X 2XQ0A 4WI3A 5IKCA 4PJGA 4TQIA 5HYJE 1JD7A 2ZCLL 3IRPX 4DCQB 1OSEA 4GKSA 5I71C 5C08A 3TN0A 1J1OL 5EZOH 1IGJB 5CILH 5DFVC 1DDHB 4LEOA 5JIHA 4QXWA 4Y4FC 3V10A 3VXSA 2CCWA 1WLHA 2FT8A 3FUMA 5FCSH 4F8TA 1NAMH 4NWTL 1SXZA 1K5WA 1SYVA 1A7PL 5HVFB 4PWKA 5DEFA 5D55A 2YXVA 4PY8I 4U1NA 5EBGA 4U6VL 4HMCA 1V8HA 2RGSA 3GJEB 1D5ZB 9CGTA 4Z3TA 3FU5A 1ZD6A 4PRAB 1NCGA 3QEUB 3HAEB 2BWIA 5FW7A 4UQ3B 1EEZA 4Z7IA 5JYLA 3MRJB 1BJ1J 2VDLB 2WQWA 1A7QL 4MD4B 3ZU8A 3CFJA 1CG9B 1HE7A 2DMCA 5CLXA 3GRWL 4XWGH 4F80A 5DRWB 2MWCA 2P8MA 5FYJU 2NSQA 2Z93B 1VB9A 2CKBH 2BS8A 3EJPA 3DHJA 1KB5H 2AJSH 3KBEA 3V55A 5A3IC 4PVMA 5HY9A 1PPIA 3GSXB 1BQRA 3SGKA 4IBSA 1KB3A 2H47C 2DWTA 1PG7L 1W72A 2K6ZA 3LD8B 4RNRB 5HYSG 1GCYA 1E43A 1T20B 3D39E 3N85L 1TQSA 4ZFFB 1SJEB 2O5XH 4P3CH 5CEZE 5JHLH 4HMEA 5FUOH 1XH3A 1EERB 5D1XC 1S9XB 3FB6B 2P8LB 2R2HB 3HCVA 1VFAA 5BXFA 5FGRA 3GTVA 4KTDH 1BHGA 3VFWA 3ULUL 4HDIB 1BIIA 4BZ2L 1SNRA 5I5MA 2O5XL 3D85A 4P3CL 5C1MB 5JHLL 1N5YL 2YAHA 5ENWB 3SGJC 1UATA 3SDCD 3NAAL 1JZDC 2HVBA 4PWFA 5CGYC 1OF2A 4X8XA 4YWGH 4PVBA 5L2JA 1H3PL 3MJ9L 3DVGA 4QF1A 1OV8A 2RFXA 4C56A 4KMQA 4A2DA 3KPNB 2B4CH 3ZE0F 4I2XE 2EH7L 4PRNB 4RDQF 4B6ZA 5CR1A 2E8ZA 4HAKA 1LP9A 1OM3L 5J57B 1AZRA 1IAIL 2CPUA 2A1WL 3GMPB 4KO7A 1RUQL 2ZXQA 4A7SA 5LG1A 3MLUL 4O2FA 4F8QA 4LCWD 4ZFOL 5I8EB 1DVUA 4AL8L 4PGBA 1HCFX 2X28A 1AAJA 4E41E 1GS7A 1PS3A 2X4UA 3X14B 5DTFB 1PF3A 1CDHA 2EDJA 4PJDF 5IMKA 1QG3A 2AEPL 1TITA 2X4PB 3QG6B 3QZOA 1E5BA 5EIVA 1FNFA 4G7QB 2QADC 4JFPB 1CGWA 2W9EL 2A6KB 3IFOA 4QTHB 5GGRA 1CXKA 2W0FA 3ESVF 4OM1H 1CE1H 2H4EA 3HPJB 4PG2A 4HCFA 3ZOAA 4P2CG 3VFRA 1RZGB 2P80D 3QWNA 4JNXA 2J4WL 3QWRA 1VERA 4OIIL 5LQBH 3DX7B 4FGMA 4Y19B 5GJSH 1V3MA 1WJ3A 4K0OA 1FVCA 2XZQH 3PNWA 3KBPA 2OMNA 4DO5A 2C7FA 1U8OA 3KYOB 1AD0B 5CZKA 5E08L 2OI9B 3T2LA 3OR7B 5F7HA 2Q86B 1F2XK 3MRHB 5ETUB 3VFUA 2VR5A 2FQGA 1YEKH 2UZXA 3MACH 1NLDH 4AJWA 1ET5A 1XIWA 2AXGB 4EUPA 3I3BA 4IBYA 4P0DA 2EDOA 1CFTA 1OGAB 1INEL 3K0WA 1ETZA 1AZCA 4PGBB 2V5MA 4OLYL 2APSA 2NY2D 2OMWA 1DJZA 4XPHH 4KQ4L 1BVLB 1KYOK 3AS0A 1EVUA 3TZVC 1HOEA 1I7UB 5G5DA 4ENZA 2HRPL 4WEBL 2MHAA 4YOKA 2Q6WB 4RAUA 1QFPA 5DRXB 4J3VA 3DVGB 4I9WD 3MBEA 5G5DB 2EYTA 5BS0B 4R6UA 3CTTA 3LOWA 1OAXH 2MEJB 3OKDB 3MRFA 4CSPA 4CN4A 3TEXA 1FWXA 2FJGB 1QWNA 2QBWA 5F9AC 5C09D 4JB9H 1SN0A 1VGEH 1F11B 1OVZA 3BCFA 4RDQG 2KLTA 1KTRL 3UJIL 4MNQB 2KC0A 4RWYL 1NOLA 2ZKHH 4OJEH 4HIEA 2C3HA 4Y1SA 1H3WM 2P5EE 8FABB 4NO3B 1X7QA 2JI3A 3N43B 3MV01 5L4IA 3QPQC 4MLIA 3QIBA 4JO4H 4Z7VF 2LLGA 5LWYL 2BPBA 4G6MH 1TZGH 4RCAA 5F96L 4DPAX 1OT4A 1OWRM 4H0LC 5JW5B 4C4BA 2DYRB 3KR3H 4AYBA 5I18H 4ZX3A 2QPEB 2AXFB 2Y1YA 5DJ0B 5B4MC 5IHWA 1XD0A 1WBYA 4AIOA 5DEZA 5EO1B 3IDUA 1S5HB 5CLWA 2X6UA 5IZ7A 3MXVL 1I1FA 2CCLA 2BHFA 4OCXH 5LGJA 4MXVE 3O3BA 3UZQB 1N7MH 4H25B 5AB9A 2NY3D 4FEIA 4LSQH 4ODUA 1IGTA 3HBZA 4U7MA 2JLPA 4CMHB 2A9DA 2MQ3A 1NDMB 1QEWA 4IBZA 3C6SA 4FERA 2WN3A 1CPUA 3KL3A 5GGTL 3QNYA 5K5YA 5C3IA 5DT1L 4L8CA 4YXKL 3MRDB 3V4PA 4MJHA 2R8SH 3CVHH 2KI6A 2FB4L 2NTSP 4RMSA 1XBRA 2VZUA 1MCPL 4Y1AD 5BV7C 5E9NA 1WZMA 2K9FB 2ZUVA 4XH2A 3CFBA 3ALPA 5SWSA 4U1SA 5E23A 2X2JA 5I73B 4KQ3H 3ATDA 2I69A 4NKOA 1XGRA 3X13B 2JKIS 2BNRB 1IL1A 1MH5A 3H85A 3ZY7A 1E2VA 3QUYC 4Z7UF 3GMNB 4X5WA 4PREB 3VXNB 4XNQA 3VFGH 3HNSH 1PNDA 4DGIL 3D2TA 1TTUA 1CN4A 25C8H 1A6UH 1S7UA 3MLWH 5AYUL 4HXAH 2BY0A 3IDJA 4R5XA 3O8XD 4LLYB 1KXVA 4Z7WA 4FMKA 5ENWA 3TCXA 2VM3A 4HPOL 3HOGA 4I2XA 1UFGA 3UBHA 3LQZA 1MCOH 4QUOA 4R26L 3NAAH 4FFVC 3VGGA 4ZZFA 1QBLH 1L9QA 4GKLA 4JPIB 5DJDB 3ZDXE 4EUPH 1ZK9A 2A9BA 3TLRA 5TDOA 5F72S 5EF3A 3KVPA 4ELKA 1Q0EA 1U6AL 4JO3L 1COBA 4G6ML 4KTEH 4MS8D 3T2QA 3NSXA 3EJYD 5I0YA 4E5XA 2LTQC 3FU7B 4N8PA 4IHOA 2XXFA 2C4FU 2CHZA 2HKFL 1PL3A 1OAXL 3TS8A 3AMKA 3PQYB 3T65A 4U1HA 3SPCA 3CZFA 2WZ0A 2NNRA 4GRLB 4I9XA 4KVNL 3FQTB 1J0ZA 1EQWA 4HLJA 4L3EB 2R56H 5J1AB 1HWGB 4FQHA 4UTBL 3ET9F 2NY6D 1AR1B 1DUYB 3FO0H 1RZQA 2XA8H 4OUUB 4GEIA 2H2SD 3JWDL 4L37B 4EKXA 4GAAA 5BRPA 3BAEH 5FPIA 1TTAA 1BPLB 3P3TA 5DJAB 4Q0XL 4FOMA 4GIPD 2IANE 3T77A 4WTZA 4F8OA 1TSRA 1O7DC 2I7SA 1EVTC 1K85A 4MXVF 1NAML 4NWTH 2VITA 4BZ1A 4TNWF 1P7BA 2B77A 4FAAB 4LZKA 4AYFA 2NT0A 2J1XA 3QFJD 4XRCB 5ERWA 5E08H 2G3NA 3IEAA 4HCGA 5D7JD 2ZYRA 1U3HD 3AUVA 1SOKA 3GSQA 4XBGA 3JUYA 3LH2L 1QFOA 5ABAA 3UCRA 3VTMA 5KYNA 3A4AA 4ZUVA 5HDRA 3TCTA 1G5AA 4LLYA 1PVHA 3NZSA 4MA8L 1LO3L 2MNWA 2VISB 4UQIM 3ZX1A 4AEEA 5F88B 2OQJA 1DBJH 1MWAH 5E5LA 3HS0C 1DBBL 2Y72A 4MCYA 3S8WA 3I6LD 4LKCB 3PNRB 2Y3NA 5BVJA 1L6PA 4KC3B 2IPTH 4NQDE 4XVOA 1FBIL 4JVPA 4MRBA 3TJEH 4R97B 4RFEA 2JCCA 5SWZB 3AQZA 2X3CA 3QXAA 1HH6B 3DETD 1AJ7L 2NUPA 3RAJH 2AQRA 2B39A 3MLVL 4PP1C 4QY8B 2CR6A 3KXFE 2ZOUA 1QNIA 1NMAL 2PCFB 3K7UA 1FG2A 1SXSA 4ANXA 3HHRB 4AQ8C 4JO2H 4L3FA 2HFFB 4MSWB 1IC1A 3C60A 3QXAB 3O6FC 3MRIB 3FRPB 2HX9A 5AKTA 2VWEE 5T8IA 1S7WA 4PB9H 1T22B 2YPVL 4OIBA 1ZAGA 3H9HA 3DHMA 3BRGC 4P2RD 5KVMC 2X4SB 2X42A 1VF5C 2J5LC 3ZL2A 3O0RL 4M5SA 5JDSA 1R3JA 1HN1A 2L0DA 2Q7YB 2YAQA 1TTFA 2WBWB 4IOFC 1IM3A 4IRZH 3ZKND 2PTTA 3HS0B 3DV4B 2XZZA 1CL7H 3A47A 3CC5A 3F7KA 1TFPA 2ADFL 4ZW3A 2HLAA 4ZXBC 2BVQB 3N0AA 2I5YL 1S7UB 4XP4H 1KOAA 3AITA 4G3YH 1S7QA 2CKBL 4LBAA 1AP2A 2FJFB 4JRYB 5IR1A 5GPRA 1OQXA 2H2PC 3TZVD 1G9NL 1RIUH 4ZAKA 4U6YB 5GSRA 5DC4B 4X0KB 3BH8B 3PJNA 4YQXL 5KN5A 1RZPA 5FWQA 2HH0L 2HZHA 1XGRB 4XO3A 3FCBA 4H26A 2CWRA 1MZZA 4XWGL 1FF5A 3VXPB 2ROYA 4KQ3L 2P26A 4Y4HD 5IFAH 5MEQA 5HYQA 1GYVA 3GSVB 4XTRC 1ZGLM 4PD4K 4CBPA 4AGOA 1A3ZA 1F3RB 4D2NA 2YRPA 5L2KD 2Z1KA 2I60H 3EGDA 1ZT4B 3GS4A 2FWSA 4AC2A 1X4YA 1P1ZB 5D1ZB 2OK0L 2OTUA 1RZ8B 1ZV2A 2YA0A 4GUCA 4PY8J 4X8GA 1JFQH 2BSRB 2I07A 4KRPC 3WY1A 4HG4K 1M3JA 1CGYA 2CLRA 1OEZW 4KVPA 5AYTA 1E65A 2DQFA 3IKCB 2JLLA 4EF3A 3U1QA 5EU6B 5F3HB 4TNVK 4HWZB 3V7AG 3BKCH 4UDUB 3ZKXB 4DTGH 4OZGE 3MYZA 2XHNA 3MJGX 2PWFA 3KWXA 1B0GA 4XNXL 5INDA 1YJDH 2VDMH 4UQ2A 2NLJB 3OSKA 3UO8B 3FT0A 4PGCA 4J8RA 3SGEH 3Q0HA 3SEPA 3EOAB 1EUUA 3NIGE 4G6AD 2G2PA 2EEXA 5IJKA 2QFRA 4GG6B 4OLZL 4RETB 3MV8D 5KAQG 3Q5YA 4NO3A 5D2NE 5CJBA 1PX4A 3VXRD 1FE8H 3OGCB 1K2DA 1HXKA 3RGVA 1NFDF 2E56A 3C6LA 2I9LB 3LCYA 3MZGB 4JZOB 4OU3A 3TT1L 3PDGA 1PLCA 3MRNB 4R96B 5C0CB 3SKMA 1B0WA 4H20H 4FXKA 1YUKB 2ED6A 3ILPB 1F3JA 2Z92A 1U8CB 3OZ9H 3QORA 5GRUL 3ZKMD 3ARYA 2XBZA 4JKKA 4ZD3L 3OKDA 2A38A 4XXCC 2BOCB 4ODSH 1JPSH 1S6NA 2APTA 4RWYH 4N5EC 1H6TA 1JV2A 5D6DC 3U46B 4LPYA 5EU7C 5JIQA 4B5ZA 3QC6X 1Y0LB 2A73B 5TDPB 1QRNB 1I7UA 4ES8A 3TEYA 4WI7A 3U2IA 4U3HA 1JTPA 1LQSR 3MLVH 4IJ3C 1MRCH 3JV4A 3GSNB 3UL4A 3NFNA 1IARB 2J3SA 5EORL 4MJ5A 4F5CE 2JJTC 4QRRB 1INDH 4OLVH 1P5VB 2NT1A 4XE0A 2UZXB 1OARL 4F15B 1MY5A 5DJCB 3LH9A 1ILSA 3LIUA 2V4LA 3LPPA 5BV7B 1X3DA 1U6AH 5HGBA 5I17B 5IHZB 3ECQA 2A5UA 2OV0A 2Q86A 3CQFA 2ESVE 2ISDA 4AQ1A 2MPVA 1NAKH 4HKJB 4W81A 3EFDH 5EOCH 1ADQA 1TMCB 1XR8A 3WDJA 4PRHD 5KZCD 3VA6A 4S1SH 3S8GB 5CJ8A 2W07B 4LT7A 4YS4A 4KY1H 3ALWA 2RJMA 3G08A 4J39A 3QZBA 3S0PA 3VG9C 3HE7C 4JZJB 3PDOA 4HYTB 4NC1C 1CQYA 3WI9A 5I1AA 3JWOH 2PWGA 4BH8B 4JZNB 1OK8A 2X4PA 4TS6A 3QG6A 5A2AA 3V5KA 4DPRA 4KJWD 5KYYB 4PJHA 3ZW3A 4JY4A 2VZVA 4YPGA 5I1GL 4PJFE 4QAMB 3MRPA 3TBCA 4WHTB 2XT1B 2W0FB 2Y5QA 5HDQH 3QSKB 2WKOA 1UGKA 5TTRA 1BZOA 2QSQA 4LSTH 2EQDA 2R83A 1S9WA 1QBAA 1LO0H 1DEEA 1QBBA 2NNCA 1LP9B 2C34A 4QMEA 32C2B 1AGFA 1XD1A 1DZ0A 4JQIH 3U7WL 4GP8B 2FATL 1U8PA 3S4SG 2R0WL 3MRMB 1YNTB 3AJ7A 5CJXA 3SDDB 3KH4A 4F2ME 3SKNA 1KTJA 3QDME 4D0CB 1UZ6F 1HZLA 3FH5A 2CA4A 2F5AH 4J3XA 4L3EE 5IB3B 3VFMB 3MOBH 2BSSB 4ICWA 2O6DA 1YQ2A 2WP3O 2EDTA 5KSBB 2O61A 2DQUH 2F7IA 2IMMA 2L3BA 4PRNA 2RCSL 1X6NA 2ADFH 1P4IH 1CL7L 1NC2D 4Z18A 3O4LE 4OI9A 1KN2H 2OJ1A 4M6NL 3NRPA 3V0DA 1HL8A 3O9WC 4UV7L 1L9OA 4Y4KC 1MHPH 4JPWL 4JO1H 2FX9L 2R2HA 3DX0A 1J0KA 4V2CB 5LAPA 4HGKC 2GITA 4CW1A 3J8F7 3GHPA 3LRSB 4ONFL 3FMGL 3K71B 4G8GE 3NCYS 3QUHA 4LL4A 4OD2B 5FFLA 1JGEB 2PW1A 4TLUA 1CXLA 2Q76B 2R9HD 2W80C 4M6OL 4OY9A 2BVOA 4N0UB 2CR3A 1EZVX 2DQCL 1EO5A 5TPWH 4QHMA 4CW1B 2K45A 5D2NB 1GXEA 1UM4H 4NCC1 4UCFA 5LBSL 3KWTA 4Q6IB 2X1WL 4J12A 4KDTA 3MRGB 4B96A 4NWUL 3WJJA 3IDIB 3HG4A 3K4ZA 1JRHH 3AXIA 5EOQH 5D2LE 4BRVA 1MRDL 2EEBA 4I18A 1MW3A 3AU1A 2YJQA 2ZXGA 1ZLEA 3FQNA 4X6BB 1JGVH 1RQ5A 3H2PA 3JTBA 2RTTA 1KIPB 4G83A 1CGXA 3I9IA 2EXWC 3ZYIA 1EEUA 1U8IB 1MREL 2R0ZL 2ZG2A 2B0SH 2VB5A 2WUBH 4V11A 4OCWL 5HYIA 2RMNA 3GXFA 3DX4A 3MFFA 4HUVA 4I18B 3FT2A 2J56A 4Y8DC 3VFNA 5L6YH 3OAYK 2QVKA 3SDDA 1NEZA 1F1GA 4OIIH 2BVTA 2X9WA 4DN4L 3LZFH 4S1SL 4NN5C 3GTTA 5D2LA 2R4SL 3ZL4L 3UYPA 3KL5A 2VH5H 1U3YA 1SDAB 4L4TB 1U58A 4XN2A 3U4BH 3VQ2C 2DQHH 1AD9A 5T1MB 3MODL 1F3DJ 4Y9EA 2OL3H 1I3RA 2XTJD 4MD5A 1NUFA 4MHHG 5FC9A 5F1OB 5CZVL 3MJ7B 2NXZB 3HE7D 3N04A 5GJTL 4J3SA 1JI1A 2MSPA 1A66A 5CZXD 2ZKHL 3ASWA 1B4JL 1E9OB 2EACA 4ESKA 3O2DH 5I6XB 1U30A 2H9GA 2A74C 1DQTA 5IQMA 4ONFH 4PRIE 4YAQB 1Y07A 1NBCA 2PNDA 4IGBA 3U6XS 2ZXAA 3KPSD 4P57B 1J05B 4JFDD 3PDOB 2BCKB 5LGHH 5AFAA 1KF9B 1W16A 4RGNB 4MDJA 2HRPH 2D7TL 1YEGL 1W6WA 3EO9L 4WEBH 4HUKB 3MROB 4G9DB 5C08D 2DKMA 5MEND 3SOBL 5AB1A 3DROA 4WEEA 3UTSE 1UJTA 1XB3A 2PCYA 2ICEC 3W39B 2VRQA 1KCUL 4HS3A 2J2ZB 4S0HA 5GIRB 1RIVL 4BXVA 3RVTC 4ODTH 1TVHA 4RMTA 1JNHA 2FH6A 3UTPE 5A2BA 3IU4L 2FO4A 4W9ZA 1YYLL 3VXSB 3BIAX 4KNUA 8PAZA 2YAOA 1HINH 5HHPB 5DJCA 4H0GA 5D7IF 1SFHA 2RCSH 3BIKA 4MCZA 5IROC 5A43C 4KX7A 1UYWL 3CD4A 2Y6TE 3MOQA 1FFRA 3O3DA 4ZODA 2W81C 1ED3B 1UM6L 4ZMZA 3JYBA 4PJCF 4F57L 4Q58C 4UQ9A 2WO2B 1IE5A 2HT3C 1X5YA 1U3HC 4CU6A 3GSWA 3KE0A 1R24A 1AKPA 3VWKB 2JELL 4UZGA 3DX2A 4YGVB 2PO6C 4JJOA 4Z78A 2XKSA 5HI4C 3H4HA 5CCKH 2GI0A 3RB5A 5ESAB 1BZ7B 1MJ7H 2OJEB 4ORZC 1V3LA 3ML9A 5TGBA 1MFDL 4JZNA 4LMQE 2AK4A 2CHDA 3VWJD 3S35L 3BPNC 1L3NA 2QSCL 4YPGB 3MRPB 3HI5L 2I9TB 3KWVA 5B21A 3UJTL 3NIDE 1UWEL 3CCHB 2NY6C 2BP0B 2ZSWA 2P7TB 1FNLA 4R9HA 5A6MA 5I28A 1NCJA 1HXYA 1CFQA 3M1BB 4LU5L 5ALCH 1T1YB 4Z7VA 1M9WA 3QXDA 4PS8A 2P5WB 2A7BA 4XVSH 5F0MB 4TTDC 1I7TA 1XT5A 3W82A 3VVWA 3V52H 1C12B 1RHHB 1YECL 1SY6H 3CFEB 5EUOB 4AVJA 3TXAA 1C5BH 5F8RC 4XMUA 4NLAA 3HMWL 2CO3A 1KNOB 2ICCA 4XAKE 3MNWA 1DO6A 2IOOA 1BG9A 1U42A 2BERA 5D2LF 4YC2B 4H5SA 4JB9L 1JV2B 2DQDL 3U46A 3IFNL 5D1QB 4NUGL 2DWEA 2GY5A 2IPKA 3MTXA 2AAVA 1A1NB 3D69B 3G04B 2LQRA 3HBPA 3GSNA 1SN2A 3MXWL 2AVFA 4U3SB 4PY7A 1SQMA 3VJ6B 1NJ9A 2EEDA 1E5YA 5BJTB 1XSJA 4E5XG 2JJVA 4QO1A 1UH3A 1BLNB 1MUJA 1UT1A 2X2IA 5JXAL 2N0MA 3U30C 4KK9D 4AQEA 1VADA 1JPTL 2WNGA 2YQ3A 3PWPB 5C0BA 2PTTB 3HS0A 3QRFM 4APQA 4XOCA 1HH9A 4YO0A 1KENH 3K72B 4XO9A 3C6LB 4LRNL 3VFSB 1T66D 1WAEA 2H1LM 2YAMA 4OLZH 3SBQA 3MQIA 5L6YL 5CMAA 5HHMD 1XCWA 3OGCA 2VLRB 3E6HA 3I6GA 5HGAB 4BFRA 3ULVH 3U4KA 1DBBH 2ZP8A 4Y2NA 2OYPA 2WB1A 2D73A 3FQXA 5EFIA 3GMOB 5MI0B 1AHWB 3UADA 5HTSA 3WXVL 3B6SB 4OCRH 1N8OE 3CG8A 3UZVB 1PJ9A 1VPOL 5D7SL 1MKFA 5ILTL 3RU8H 3FJTA 4CC4C 5D1ZA 1IC4L 3W56A 4RMVA 5GJSL 4NYLA 4OM1L 4P8QA 4AQ8A 4HULB 4OFKA 5TF0A 3M1BA 5FUCC 1SYSA 1HQRA 4JGNA 1FCGA 5EN3A 1I9JL 4BBWA 2PCFA 5E0FA 4DO4A 4FA7B 1AHWA 1B3JA 5F89A 5ALBL 4U7SA 4YR6A 5KBMA 3SODB 4YDIH 4TULL 1XF2A 3DRTA 3EJCA 3DYOA 3D8MA 1A1OB 3EH2A 43C9A 1U92B 1LYQA 2Y2WA 1RZ8A 4QXGH 2IG2L 2BSRA 3BSZL 2XWBA 2RQ8A 4N8UA 5FF6A 1ETJA 1NBYB 4MMZC 1Z3RA 2ICWA 4AYGA 5ADOL 1AHMA 3GXDA 1HNYA 1CDCA 1PAZA 2C8NA 3P30L 4LPVA 4I3RH 1FNEB 2DWDB 2R0LL 3QFJE 4O51B 3MUY1 4FEMA 1T0OA 4X8JB 5F6IB 5HHQB 4D3CL 4GP5B 1G0DA 1IUZA 2A1WH 3OHMB 4LFHD 2XWTB 4ZT1A 1XBDA 2A6JA 1ROWA 3P69A 5EC2B 4LSQL 5AB0A 1U33A 2QV4A 3QHTC 4F8PA 1QFWI 4KPHL 1EJOL 1R3HA 4NPKA 2WYZA 3CHQA 1MJJB 4GW5B 4HEPA 1S7QB 2FJFA 5K9QI 2X38A 1LWRA 1MCWW 1ZT7A 3QT2A 1MHPL 1TOXA 3CDZB 2IDUA 5HJGA 4BFFA 2GCYB 3L3JA 3K6SA 2DAVA 5FYJE 4G1MA 5HVGB 1PLGH 4KTDL 1XGYL 3EGXB 1RUKH 5EZJA 4AUJA 3LV3A 3MV9E 5T33H 1KT2A 5JDSB 4I4WB 2BWDA 1TNNA 2PN5A 2Q0ZX 3CMGA 5EOTB 4HHWA 5EC1B 4HXAL 4DEPC 1EDHA 4XXDA 1N68A 1QHPA 2P5WD 1BGXH 2VLRE 2FSEA 1KGUA 4CVZA 2WQSA 3OXSB 1DSWA 1K4CA 3IDXH 1MLBA 4KBPA 4G1EA 25C8L 3MLWL 4BWTA 1FG2B 2O72A 2X53A 1KTCA 4PSRA 3EO1A 4LKCA 5DU7A 3RUGE 5HHOB 1NFDA 2BP8A 4KDVA 1SBSL 2AZAA 4HAGA 4LLDA 1NMCB 3WG7B 3HI5H 4P4KA 3VXPA 1T4KB 2ZPKL 2CALA 2Q2LA 5IB1A 5TE7L 3VAEA 3VE0B 1R19A 1IGCL 4LRIC 4U1IB 4RFEB 1KC5L 2XJLA 3ABKB 3MJ7A 3WNOA 2GBUA 3DSFL 1A9VA 3ZE0B 5I2IA 2HFTA 3GSQB 4ZNEA 5AD0B 4BE5A 2AK4B 4Y19E 4PRBA 3UTOA 3T4AB 4HT1L 2QPSA 5EA0L 1LE9A 4PJEA 3T8VA 4OFIA 3JWOL 1TTRA 3S37L 5IQ7L 3VRJA 2VSKB 2FZ3B 3GJFK 3L5JA 4OFDA 5BRZD 1XX9C 2OR9H 4EJ1C 4UILL 2Y5TB 4HOXA 1KLFB 4J7RA 4JFVA 1NH6A 5DRNA 1N4XL 3S35X 4F58L 4R4BB 4N8VA 3QAZC 4HZLA 1SMDA 2UVEA 3SJVA 2K8QA 4GAFB 4MMZB 5ISZA 3BDYL 1W0VA 2R51A 3N1PC 4GQPH 3FK3A 4PBVC 3DPBB 4JK0D 1MJUL 2VR3A 4WRLA 2WWMD 3TURA 4D0BA 3G5VB 5K1VA 2ZKYA 4LARH 4YDZA 4V1DE 1PZ5B 3MNZB 1UQSB 3P3YA 4NBYB 2AF2A 4NNYB 5LCVA 4OFQA 3SKUD 4AY0A 2CIIB 2FO8A 4NZFA 4ZI8A 1SDYA 4FNPA 2FO4B 3CFUA 1AACA 3T0AA 1FVDB 2JKWA 1MRCL 4LP5A 5JHAA 1FAKT 2ERJB 3V7MA 2EVHA 4OCSL 2G4GA 3LHPH 3KVDD 2CLVA 3IDIA 3X17A 2VLKB 2UXTA 2MMXA 5CBAA 4UAOC 2A0LC 1RJLB 3O11B 1GPOH 3FUEA 4WKZA 1S3RA 1WC7B 2F2HA 2Y7MA 5HVHB 3RGHA 3ZPDA 4KKZA 3DXAA 3S5LG 4HWEL 1BVZA 3PWVA 4DNLA 3L7FB 1EO8L 4G2AA 5IW6B 1T5KA 2CO2A 4GAYA 1FGNL 5HGDB 3U2SB 4JFTA 1IAMA 1SJVA 2XXGA 3CDGB 5DVMA 3QUZD 2GFBA 1MFCL 3PQYA 4O9HH 2JK5B 5IK3B 5DUJA 2GJ6A 3ZRFC 5FCUL 4KXZI 1FPTH 3QBTB 2HX8A 4YE0A 5C2UB 4N2BA 1X5GA 4G6AC 5CNHA 5DJ6B 4DKEH 3RX7A 3EXLA 3ABLB 3MV11 1NCHA 4EN2A 2X6MA 3GJFB 4WJKB 3BIBX 3QUZC 1UZ8B 1ZA6B 3HZKB 4ALAH 4BSWB 2HAZA 4NJAH 4GG6E 5L4FA 4NZDA 3TFKD 1CGUA 3BVUA 1FNGB 1ZSHA 1PIFA 2AV7B 4CAGA 4PCYA 4TSBL 1QBMH 3WE6A 2FJHB 1UXWA 4F9LC 5T1LD 2EXWD 2QSTA 4WFHD 2X7LB 4WFED 3SY0B 1NEUA 4FZEH 4YK4C 5IVXA 3TU6A 1E4XH 3G6JB 5EDXA 1DUZB 3SKJH 2LW3A 3B3IB 3SCMD 2A74B 2VLJD 4FTVD 4G7YL 1KTBA 1BA9A 3F5WB 4WNQA 4ERSL 5BOPA 2G4EA 4YXKH 3HHSB 2UY7B 1M6OB 5IIEA 2E6QA 4MA3B 1U0QA 1L9RA 2JI1A 4L9LB 4G7YH 1CWVA 2YN5A 1OAJA 4PJ6A 3AQYA 4PLKD 2ZE0A 2FHFA 1ZLVK 4HLEA 4YZFF 2X6AA 4A2FA 5CS7A 1EEYB 1GR7A 4JY4B 4MAYD 1Z3GH 4PJ7F 3FONA 3SE8L 4LVNB 1M6OA 4IM8A 2COQA 2EJ1A 3I02A 3QR0A 3V6FB 1T03H 3MA7A 2HH0H 1SFDA 1NDTA 3NSFA 1P84K 2ILLA 5BZWB 3SYQA 2Y24A 5IG7B 1NEZG 1BD2B 2NNXA 3BT2H 1KTDA 4GFTB 1XEDA 1I1FB 2NY7H 2OPCA 1GGBH 1XIWD 1JJUA 3X12A 4P23A 4FXTA 4MNQD 4NQVA 4NQCD 3EGSB 1EHLL 4H0IA 1CFNA 4K94H 2VMDA 1E8XA 1N8ZA 3HC0A 3BAXA 5DEJA 1KGIA 1J8RA 3T5WA 3KDMA 1ZS2A 3QZWB 2E27L 2V7HA 4L3CB 1ZVNA 3EJTA 3D2UD 4V1DA 3B9KC 3CJJA 4XMWA 4AV4A 1EAOA 4M1DL 1PG7H 3BUIA 2EE6A 5B1JA 2DIBA 1DQML 1CDIA 1FIGL 3HHMA 3MBED 4YHOL 4K15A 4DETA 4XBEH 5B8CC 4GYBA 5BJTA 2PTVA 1JZGA 2ZYSA 1WITA 1PFOA 3RPIA 1R0AL 4AEHH 4GG8B 4HXBL 4JREB 4BA8A 4KRMB 3SE4C 2QKIA 1PQZA 2CLZA 2MJWA 2J44A 3WEMA 1MN4A 2DI7A 4AT6B 1X5AA 3KJ4B 4X6FA 1RK1A 5FS5A 5I0DA 4G7VL 3VYNA 2W0KA 2CLZB 3PGFH 3TA3D 4ZMAT 1FAIH 5LXGL 3MNWB 3ZL1A 4XP9L 1A4JB 4XO5A 2CH8A 1J0HA 3APFA 4FQJL 4HWBA 1NICA 1DVFA 1BQLL 3RGVD 3BP7B 5CR8A 4A6YH 2ODIA 1U3JA 3KJ4C 4Z7VE 1KZYA 2CO6B 2E0PA 2P3YA 1OSPL 3QXVA 1T20A 1VGKB 5KTEH 4JPKL 1MCDA 1AKJA 3QORD 4BUHA 4AM0A 3NUKA 2A74A 4JREC 3PYCA 1T89A 1J1OH 4YDVA 4IYKA 5C70A 2ZKWA 1H0DA 1ORQA 4LVOB 5IQ9B 1VGKA 4YXHL 1OCOB 5AW5B 5IB4A 1RD6A 1KLFA 3GWJA 4FG4A 2JJUA 4Y1AA 1L0YA 1KXTB 5M94B 3BUDA 1P2CB 4K8RL 4U49A 4IOSD 4UQ3A 5AZEH 1QA9B 4LP8A 1V05A 2Y2TA 3DIFB 3FTYA 3K91A 1HEHC 1K3IA 3UG4A 3GI9L 1YUHB 3HLKA 4K7PY 4Q4EA 3MA7B 1ZHNA 3IDNB 1OLLA 1CT8B 3FCUB 3BUBA 2HTLD 3C2SA 3HLAB 4XOBA 4BEIA 1NC4D 2V33A 5E95B 3MV7D 5DQJA 2DLFL 5DTFA 2WYHA 4YQXH 2EYRB 2KHAA 4M7LL 2YPLB 2IXQB 3RX9A 2A0LD 2W1NA 2XBDA 4MCMA 3UTTB 4XX5A 4NN7C 2K7QA 4NX0A 2P8PB 1AIZA 3QQ3A 4UV7H 2ZX8A 1N64L 3NJGA 4ANVA 4LCWB 5C0ND 3GMRA 4BDVA 3O3DB 1B6UA 1S9XA 4J3TA 3L7FA 1VEMA 4A7TA 1GYAA 1YEIH 2WWKT 2XTJE 4U1GB 4I48B 2PO6A 1T1WB 2I25N 5EU3B 2EE9A 3FTZA 1KY7A 5IB5B 3W38A 1JGUL 1R5IB 2A77H 5CP7A 4LDLB 3ZTJH 3JXAA 1EEQA 4R26H 4U6HB 4TRPH 4K3EL 5C9KA 2AEOA 2J2ZA 5E5MA 3F7RA 2HG5A 1UA7A 4ZUSB 4MAYB 5FLUA 4JFOB 1TQCC 3ZR6A 4ZTOH 2CBQA 1FL6A 3PCYA 5F21B 2ED9A 2XBTA 3OBAA 4Q7DA 1J8HD 5I0WA 5B1CA 1IKOP 35C8H 1TUPA 1L9PA 1UZ8A 4BSWA 2BSED 4NBZB 5D1ZD 1AQ8A 4AVIA 3PG2A 1QRKA 1BD2A 3FSOA 4HIJB 1LO0L 4XN4A 2M1KA 3QGVA 2LR4A 4XBPA 3SPVA 5KBNC 4MZ2A 2EDXA 1FUNA 1KXQE 3QUXC 1VLXA 3WTXA 5B38G 3MDJA 4X4XB 4K23L 3UJTH 5DK3A 1QSEB 3FONB 5SX5H 3CFJB 4XCFL 2DMKA 3RX8A 4IGBD 4JHWL 4YIQB 4D9LL 4UM9D 1OP3K 4ALAC 4PN6A 5T5FL 4TULH 3Q6FA 3UAJC 3WIIL 4ODVH 2Z1PA 1MJ7L 3ERXA 4XMKL 1G7PA 2NY3C 4AYDC 5IW1A 4YVNA 3VXRE 1A3QA 2GC7C 1T5WA 1WS7A 3DOHA 1TYEB 3ZKQD 4KHTL 5CIPH 3D0VA 3AG1B 1MXGA 4N9GB 3EFFB 3WFEL 4NJ9H 3QHZL 4XNUH 1RKRA 4XWOC 4EIUA 2HTLC 2VZ1A 2GBVA 2VKXA 2PXYD 1YRKA 4KO9A 4RFOL 4Y5XB 1ZHKA 3TM6A 3VFWB 4F7MB 1I8LC 5HYEA 3GXMA 3K46A 5E4IA 3QQ4B 1RK0A 1BLIA 2IOMA 3GXNA 5LWYH 2EYSA 5ADPL 1C1EL 3MBWA 3T9WA 1SVCP 3GDCA 5D70L 3MKGA 4BUGA 3MLXL 2A6IB 1MFAL 1KJ3H 2BVQA 1PY4A 5D8JL 4B53A 4R4BA 1UD5A 1T5XA 2YWZA 1ZCRA 3SCMC 1L0PA 1A7OL 2WO3B 2IFFL 4ZRGA 3I6GB 5TE4L 3FN0H 4Z0BL 3DTXA 4APQC 3RWFA 2AQ1A 4HK0B 1ZHLA 1GJWA 3NTCL 3Q8BA 5ICZA 4PGZA 3DX9B 4L4VE 1EMTL 4UUJB 4ZO8A 5F7UA 4JHAL 2NY4C 1UOVA 2EIMB 1VSCA 1JTOA 2FWLB 3ESUF 3VI3B 2F8XC 3CDZA 4ODSL 3C5XA 4K3DL 1XL4A 3PREA 3B1TA 4QKXB 5I2IB 4DKDC 5GRUH 4KZCA 1HHKB 1R4XA 4U1JB 1UT2A 3PXLA 3D33A 4I85A 1BXVA 4CSZA 5J6HA 4O2EA 2HJKB 3LXUX 5BS0E 1N2RA 3F7VA 4DZBA 4ILDA 2VDKH 2Q20A 1TCRA 4JY5H 2V2WB 3OKOB 4ZOAA 5GZNC 1Y6NR 2JKSA 1M1SA 1IEAB 4OI8A 2LFGA 1TJHL 1SYVB 4R4NC 1JPEA 3E6FA 1HL9A 1KEML 2IAMC 1AHWC 1T0NB 2WOYA 1AVAA 5MERB 1MFAH 5HBBA 1KBKA 3MNZA 4MA1B 3IFLH 3DX8A 4NNYA 4BFNA 5ICXA 5KYUB 3VA2C 2JJWA 3U4BL 4TUUA 4D0BB 3SGDH 2FVNA 3ELQA 4X9GA 4PJGB 4X7EC 2EDLA 4AKPA 5BVJB 3ZN6A 2K8MA 3TESA 5E8DL 4LLAA 4PM1A 4HPOH 1U92A 5FUZH 4XO8A 3V4VL 4JRXB 3CSFA 1EBAA 3KGUA 4IQHA 3VMOA 1MPAL 2K4WA 3BPCB 3KDPB 4YSPA 3IPBA 3UTTD 4HIIB 2NY0B 3QEQE 4XAWH 1IKFH 3TBWA 1SY6A 4JFDA 5IQLA 2J6EA 5SWSE 3MV7B 1F42A 5ICUA 5FYJH 4A7VA 4LNVA 4FYRA 2MTPA 4BQ6A 2EIKB 1QO3B 2BM3A 5IREA 2AEPH 3VI4A 2IDFA 1MF2H 5CZRA 5MENA 3KH3A 4K8RC 3WEBA 3INOA 4OZHA 2JNZA 4PJCB 3KCWA 3DYPA 4AG4H 3TBSA 5AKRA 3UZEA 3QQNA 1OAKH 1PD6A 5EU7E 1OE1A 2A9NL 4YC2C 3UTSA 4L8DA 1P7QA 1MY7A 4ZQKA 5AW0B 4NJ9L 2YAFA 5KVDE 3AU0A 1WVZA 3Q9QA 1KIQB 2NSMA 4LQ1A 1LDPL 2VTFA 1INQB 3BUPA 3QWOB 1ZLWH 4HMDA 4X9HA 1FL3A 3DXAE 5BVPH 4FG2A 4Z76A 2YUWA 1NCAL 2P5WE 3LPGA 1OSZB 5DZ9A 1Z0MA 3PQYD 5TDNA 5F1IB 5EOCJ 1ZJBA 4XCNB 3B2VL 2EUVA 5C0BE 4YBHA 4N2AA 4BE6A 3INUL 2BRQA 3U1SL 3ZRSA 3SZ6A 2WTRA 2JB6B 3LB6D 3DIVA 4GW4A 1WBYB 4NXSA 4HEMA 3RPKA 4CBZA 4QXUH 4HGMA 1MFBL 5CINH 4AZ8A 4MTMA 1NMBH 2AV1B 1BMZA 5IESH 1K8DB 2YPVH 3BVTA 3W81A 1HYSC 4L0YA 3FZUD 5TF1L 2Y7QA 3IDYC 3UEZA 3DO7A 2G0KA 2DM3A 4J3WA 4B3EA 4DQOL 2EDWA 3ZTEA 1VCBC 4DP5X 2WXNA 3H42H 5E1QA 5E1AB 1BQSA 4GAJH 1QLFB 1KLUB 2N4IA 4X6CF 4GRWH 2BS9A 3GRWH 2FWOA 2XETA 3AXLB 2OXGB 4AIZA 1Y0LA 3CFQA 3BEVA 4Q14A 3SO3B 1DBML 2O1AA 4A6YB 4KKCC 4Y16A 1NUNB 2H3NB 3RVVD 1A14H 4FA8A 3FB8A 4R0LB 3T2PA 3HNSL 4BV1A 2IPTL 5E8OA 2WLLA 1CL7I 1FNSH 5L8KB 2XN9A 4NQCE 5IEHA 2VXQA 3TJEL 4F9PA 2BY1A 3DBSA 4PIBA 4NO0B 2C26A 2P47B 4H8UA 3RTLA 3DTXB 3SDYL 2QDWA 1GJIA 4FL4C 1BVNT 2BMKB 2R2EB 1XHHA 2O93L 1RURH 1FJ1B 4UNTA 5T1KA 4PJIB 1QI4A 3QI9C 2OSXA 4PW9A 4AK1A 5ACZB 1H19A 1R3IL 5J11B 4KV5E 2Y7QB 1EDYA 5EBMB 4NGHH 5GZND 4A2EA 5B39A 2D03L 2DL9A 1NIDA 4TSAL 3OB0K 2Z8VC 2IV9A 2K70A 2YRBA 3X1FA 4Z0XA 3CBKB 5FHAL 4O02A 3VXOA 5EDSA 5A2KH 3WIAA 3U79A 1PG7W 4IOIA 1WEJL 1Z66A 3BAKA 4GKNA 4DKFH 1F1AA 1KBBA 1OAZH 1MCLA 4D9QD 2YFOA 4KJYA 4PRPE 4DGYH 4HUXB 2WHVA 3RZCA 4IRJA 4I89A 3L95A 3N91A 2P5WA 5C0DA 5M7QA 3NJXA 3L48A 3HI1A 2K6YA 1P4UA 4NQXB 5GHWH 4N25A 1HSBA 4WCYH 3C8DA 2WBXA 3WKPA 2ODHA 4KVNH 4D8OA 1MCFA 3RWHA 4YLBA 1MG2C 4YEFA 3B8YA 4OVUA 2EXSA 3ZE2B 3UAJD 2ZWYA 1DANU 4R83A 2GUOB 2OP4H 1IFHH 2Q8AL 5I6OA 5DSCA 4P4KD 3EYVA 4GAGH 1F58L 3ESOA 3IAGC 5T1LB 1PDKA 4N2HA 1E8WA 3UBXI 1GYCA 3OKEB 4LOUC 5B3NA 4XOAA 4XWOD 2C5DC 1TEGA 4WFEE 1F4AA 3S3PA 4JS7A 4K3GA 2AP2A 2DWSA 1NC4B 1BZQK 3WXWL 2CDFA 4JCWA 2DY2A 4NI3A 1NPJA 4OT1H 1FH2A 1KSRA 3VXTB 1S2EA 2YLKA 5I6LA 2AV1A 3S5LA 4PV1C 3UIZA 2XWRA 1WWAX 1R75A 2RHEA 5LDSA 3D39A 4XNAA 3CLEH 2FK9A 4TVPL 2K9UA 3EW3B 4YDNA 1B9KA 3QH3B 4EUPG 5I8KL 4KI1A 4AMXA 4G8FB 1BBJB 3S4SA 1BOYA 1YNKL 2G5BA 3MAWA 4GQRA 3OJDA 3ZYZA 3B8SA 3BSGA 1JZEA 5HHPA 5ALCL 1XO8A 3UYPB 3L3OB 4FC3E 1T1YA 4WO4A 2AABL 2ZWZA 2RH0A 3KLQA 1S9VA 3GSXA 2GK0A 4EOWL 5GISL 1KB5A 2Y07H 1OB0A 1SLUA 1HKLL 2E6JA 4UOQA 4UDTB 3T8XA 1V3JA 3WIHL 2VR4A 5F1SA 2IOIA 2NX5B 1IIIA 1XDTT 1NKGA 2RALA 1S7SA 5I8CB 3MFGB 2AQTA 3WCYA 1DO5A 4UT6A 2Q7AA 1OF0A 4FXGA 4ETQA 2GSGB 3PV7A 5TFSL 1EH9A 3KBFA 5FKAA 4JFXA 5IW1B 3V95A 4GO9A 1NLBH 1DFBH 3AABA 1YEFH 4POZD 5F44A 1ND0B 2YXMA 1FH5L 1J05A 4BZ2A 4G72B 3VFOB 4RISL 3L3HB 1VJSA 3QEQD 3K1KC 4FI6A 1YEWA 2ZJSL 4GQ9L 1K5NB 3AS3A 4CKQA 4U1GC 5GGUB 5AVXB 3EJRA 2AGJL 2EXTA 4LFHG 3FTSA 5FKPA 2H6OA 2V5TA 3FT2B 1KTKE 1AGEB 1S9YA 2ZOKA 3UYRL 3JV6B 1M4KA 3MSPA 5D71L 3VMPA 5FEBA 3V5DB 4C54A 2BS71 3BQUA 4BKLB 3ETBJ 3VDBA 1UM5H 4Z7NB 5C92A 1AGCA 3MZTA 2ZCKL 4N24A 2LAAA 3EIFA 5EF2A 1BEYH 2WLHA 1IKNC 3F64A 4MNHA 4W4NA 2DQJL 2EH8H 2NX5A 1N59B 5DC0A 1OF2B 1EHNA 2HKHL 1XGTB 2XN9E 4B9PA 5DJYB 3WNPA 1MAMH 3CVBA 1NCWL 3AG4B 3H3BC 3JYCA 3TVMA 1WP6A 3DECA 4IBUA 2I26N 4DGUA 2KERA 1KPUA 3LS5L 4CMHC 1I1CA 3DROB 4UAOB 3VXMB 1T7XA 3V4VB 1ACZA 3KPSA 5C0JA 4Z0XB 2PO6B 4UT6L 3K81A 2YBGA 4HQQH 4UQDA 1HE8A 1TZ8A 1KY6A 1E6OH 1W72B 1X44A 3D4GA 4RNRA 4DUWA 3EXJA 2RBLA 4QHLA 2BCKA 1ZWIA 3GDBA 4KMLB 1XGPA 1B2WL 3LZOA 3PWJA 3WO4B 3QNFA 1HSAA 4HLZH 2EXYD 3AS1A 1JNLL 3BRFA 3VXTA 2FIKB 4ORGA 1JZIA 4TUJB 3RVUC 5IWLC 1DL7L 3PWJB 1JDAA 3IRZA 2R15A 3SJVD 1GGIH 5E8OB 3RNQB 4LLUB 3B9EA 1FC2D 1KGCE 4KXCA 3BWSA 5DJZB 3RWDB 1MCRA 2EVJA 3L9EA 3QISA 4U6VH 1M05A 4M6MH 1KZQA 3FFOA 1ND0A 2JCCF 4MJID 4PV9A 3PXJA 4JJHA 4PGDA 4AKOA 3BGFC 1GPOL 3SHSA 5DSCB 3LQZB 1DJYA 1KPUB 4HJTA 3ETBF 2X1OA 1M71A 2COVD 3FN0L 4NC0B 3MV9A 4NC2B 3VQ1C 1IGFH 2W9EH 1KYUA 5HHVL 4RMBA 4QRBA 3PHAA 2EDQA 4P5TA 4TOYL 4R4FH 3WL9A 2L7QA 4W9LC 2YHGA 1CLZH 5IP4A 5ESVB 3H0TB 3FCSA 4OJFH 5ICYB 4C4KO 2LLLA 2WTRB 2EXYC 4GW4B 1N0XL 2OMUA 3FN9A 2C9VA 1CR9L 2DQTL 4DT2A 2YUXA 3UPRA 4LKXB 3P11H 3QRGL 4HS6B 2C1OA 2OI9C 5MP6H 4FZ8H 5CWSB 2ADIB 5EUKA 1V7ML 3MRCA 4DEPB 4ANKA 4H8WH 4DFIA 1CI3M 4FQCH 5E2TH 4JDVA 1HEZB 4NKDA 2WGNB 3CBJB 2CUHA 4HH9A 1IEBA 5CSZA 2AITA 1H3PH 2RIKA 2EICA 1Y1UA 4QGYA 1RY7B 2X44D 4L8DB 2CA3A 1U36A 2FCBA 5JW4M 5I5IA 3GF8A 2AJ3A 1E50A 1YY9C 3VNYA 4PRPA 2YD6A 3FTGB 3T0EB 2ZPKH 3W9DB 3KXFA 3HN8A 5T1LA 4G7SB 1SBSH 1BREA 1WFUA 3SDCA 3FRPG 3QUXA 5AEAA 3OVUB 1JZJA 3PWLA 3Q3GB 1GY1A 4DVBB 2VR8A 1G1KA 2H1XA 3APNA 5DK0A 1A3LL 4PJHF 3UIYA 1IAOB 3RFRA 1PCXA 3NIDF 1BX2A 4HPHA 3IMRA 1P5UB 1W91A 2XZCL 2N7AA 2NY2C 1I1AC 5K1JA 4LPWA 3BUTA 4WEMB 1UH4A 2F08A 4KRPB 4E9YA 3S88H 4LCUA 1GZQA 1DEDA 2OXGA 4NP9A 4AIZB 3BPOC 3W1ZA 4URTB 3T4AC 4AZ8B 2UUDH 4TN9A 1R1CA 2WJ5A 3TC9A 3TWYA 2EIJB 3II2A 3QDGB 4FMFA 1WT5A 1U93A 2WVVA 2R1WA 1TCMA 3T0BA 1R3LB 2ADGB 2ZXEB 3P0VL 4NIKB 1ZT1B 1SUHA 3NJMA 1UUNA 5G2NA 1F13A 1PLGL 5KYUA 1OGTB 1LM8V 3KWWB 4D3CH 5DQJB 4BFJA 1K6QL 2NYKA 1JVOA 4QRRA 1I8LA 1FL3B 2CHWA 5C0BD 3LKNB 5BRZE 2AJZA 3HNVL 4PTUA 3BAJA 3LKOB 5E4AA 3BGFB 4N2GA 3S3SA 1CFBA 4MJ6A 2JI2A 5E8PB 5C0NC 4P23D 4IDJH 3KGSA 4K2UH 1GOFA 4MFHA 3CSYB 4E9XA 1OGAA 4N86A 2W38A 1FVDA 4BIKA 4WSGA 3RGVB 1XB8A 2IBZX 4MXWL 3TCLB 3LZNA 5H35A 1A7PH 2CRYA 5B4MD 3MUGA 5CSBA 4QHNB 4JRFA 1CD1A 3QORB 2PCPB 2H0EA 2PO6D 4AYID 3DK0A 1NGWB 3FBKA 2W92A 1YA5A 4UQ2B 4YBLB 4LCYA 1CURA 1B4RA 1YN6A 3QPQD 3RWFB 3VWKD 3JT0A 2F74B 4UQEA 3RZCB 5DMYA 1DQDH 3VXME 1KEGH 5HD8D 5C2BH 4XNMA 2OR8A 4NP4L 5BV7L 2QZ5A 4LCWE 5DWUL 1CR9H 2O26U 4WY7H 1IC0A 5BZWA 1KMGA 4JFPA 4OJCA 4LPXA 1J88A 1B0GB 1F1DA 2VXQH 2ZXBA 3FQWB 4WKXA 3WJLC 4E41A 3KLHD 1LILA 4YEEA 5HHNA 2HLFD 2NY5C 2DYPD 5C0AD 3L5WB 1DLFL 1PZSA 4E9SA 2D03H 3NK4A 5LCVL 1AR2A 4J3OD 2PR4L 2VZSA 3ETTA 4UTBH 4POZC 4RQQB 4PJIA 1LP9E 1BIHA 4ADGA 1T0NA 5E4OA 1YDPB 4HJJH 3T3PF 4JGMA 3WDIA 3EO1B 2ZD0A 3HBGA 2DQEH 2XTJC 3BZDA 4MQTB 3US1A 4JR9L 2QQLL 1G7PB 3IFLL 3U2SA 2YQBA 1F00I 3VI4E 3KJ6L 3LN5B 1AKJD 1T22A 5K9JH 2F6AA 1L9SA 1K6QH 1HHKA 3BKJL 1T2JA 1VESA 4QTFA 3HR5A 3V4PH 1OT1A 1ZJAA 1BMGA 1WCBB 2XWXA 1A14L 4H1LH 4KTYA 1OL0A 2AJUL 4HFWB 3TT1H 5GS1A 5HDBE 3OKOA 4AYEC 4EMZA 4BXSV 1INEH 2VL5A 4R7NA 3F6JA 1G9NC 4QYOA 1Q0XL 2G2NA 4BRJA 3I75A 3OHXC 2XQYA 1ZOXA 2WP3T 1G9HA 4ADIA 4AJ0A 4GG6A 1T5XB 4X7DC 4PBWD 4LLMB 4RAHA 3WENA 2HP4A 2YAPA 3G9AB 4LP4A 4GRLD 3O6LH 1AGDB 4P04A 4X5LA 3RPBA 3QFGA 4HK0A 5FYKL 5IUSA 1WFNA 1UD3A 2VNCA 4I9WE 3PS6A 1A6ZA 4TQPA 4YDKL 5I1LB 5L2KE 2J4WH 2B14A 1BJ1H 5D96B 2WLJA 3OPZL 4ZUUB 3ULVE 1E4WL 5AW7B 3EJJX 3PV6B 5LBVA 3LTVA 2E7HA 3PQYE 4EIBA 1M42A 4XC1H 1HI6A 5KSAC 3W11C 2QGCA 4FHJA 4KY2A 2ESVA 2DBLH 4E36A 4XHQA 4JFHD 5ELIA 3AAZA 4J28A 1T5WB 5I15H 3F58L 3IXTA 5HI5C 5E94A 2ZIDA 4WTXA 3QQ3B 4PW3A 3VYPA 2DKSA 3V4UH 5HDBF 3AAZB 3GLDA 5ID0A 2ATAA 4YFLI 4P2QB 1THCA 1FFOA 2F0CA 3OX8B 4YHPA 1HOCB 3PPSA 1EK3A 4LSVL 4RMRA 4E9LA 5HXMA 4PJCA 3AY4A 5FDYA 1A47A 2EDDA 3CLFL 4OCXL 3HUJE 1J8HA 3MV8E 4B9CA 2ZWKA 1YEDA 2FECL 2R69A 5EIIG 4ZAKC 1ZLUK 3C6EA 4CVWA 2QR0B 5GGVH 1GC1H 1E3ZA 1L7TH 5J1AA 1CLZL 5EF0A 3SJVB 2Z7ZA 3W0WD 2XV2A 3D5OF 4Y16C 3RVXC 5EH1A 2RB8A 1ZLVH 5HHVH 3FAXA 4PMEA 3LX9A 3ZYOA 4XC1L 3QCVL 1NIEA 3K74B 3LN4B 3W11D 3EHBD 1EXGA 3B9DA 3RI5F 4RVBA 1QSFD 1LJMA 4Y2DA 1PKQA 7PAZA 3TBVA 1ML0A 3RKDC 3UERA 3WIHH 4HC1L 3FFCE 5JZ7D 5IV2A 4N6QA 1CDBA 1UZGA 3HE6D 5KYXB 3H1ZA 3KPPA 3LN4A 1U21A 3OAWA 3PWNA 4LLWB 3FH7A 3BJLA 1JERA 3DXAD 4M6AA 1FHNA 1R5IA 1WH0A 2OMVB 4B9KC 4LGPB 5CZXC 3VMNA 3LIZL 1UH2A 4ZUTB 3HVNA 3BPNB 4OAWA 3KPQB 4JMXA 4N8VG 5D9SB 5C97A 3RWGB 1ORSB 1OHZA 1T0PB 1XF4B 4P06A 3WFCH 5BMFL 5C9JB 1NCOA 5GS1B 2XV3A 3TX4A 4L37A 4AQZA 1G6RB 2F54E 2XC8A 3CLEL 4NUPA 3GB7B 2J73A 5I6PA 3NQKA 3VRLE 5E00A 1AS6A 1KXQA 1NGPL 4U1LB 3TEWA 1F4XL 3A6OA 3KLLA 3PE9A 1O75A 1BJMA 1OZUA 1G0YR 2G2RA 3FSWA 2QR0A 4HD9A 4JG9A 4AT6A 3RZCC 3EH4B 1I8KB 3P3SA 3C6LC 3QCTH 1JZFA 1MFNA 1GZHA 2I24N 4WFFD 4XH2B 3VDCA 3BC9A 1A1MB 1RUPH 5CKGA 1GAFH 2X1PA 1AR1C 1Q9LA 4K7PX 4ZDHA 1ZTMA 2YLHA 1U8MA 3U4AA 3MRQB 4AGLA 3S8FB 3OC8A 4DUXA 3LXAA 4LOFA 3WTYA 1I85A 4LIQH 2D0HA 2ZNXA 4JQXC 1YMMB 3O4LA 2DD8L 2GIMA 4DVRL 1XSIA 2OL3L 3NA4A 2XICA 4LCCA 2NY4D 5F9OL 2P7TA 2FQFA 1G6RL 3QUXB 4AM0B 5JIPA 1P2CA 4HCRH 5D71H 2ZX6A 1EA9C 2P24B 3B34A 1JRHL 1JTTA 3GUFA 3ATAA 4XNMB 2RACA 1MI5D 4PJGF 2AZUA 1F4HA 4MB1A 1N4XH 4UTAA 4G9FB 3NN8B 4I0PA 4NRYB 5A2LH 1KGCD 5H2BB 4MAYA 1K9TA 1CVRA 4FABL 2FX7H 4Y16D 3WY4A 1UC6A 3GSRB 3LPWA 3IMUA 5CSZB 5LAXB 2WBKA 3ARDA 4ONHB 4XNQB 1RPKA 2Y1AA 3ARBC 3VH8G 5ANMA 4OUUA 1JYXA 4ISVB 2XWDA 2IH3A 4ADJA 3K6OA 5JW3L 4CC0A 3WY2A 1ASOA 4PH8A 4LL1A 3GMQB 1MFUA 5GQBA 1QVOB 1AIFA 4Z7UA 1R24B 3ZUNC 1AC0A 4AK2A 4D9QE 3BWAA 5I75B 4HHGA 4LBEA 2CXKA 4J4PA 3NIDB 2ENPA 1JHLL 4FRWA 3UTTA 4GSUA 1HHHB 2CGRL 3WKML 1W15A 3GSOB 3MRKA 5I1CL 3WTUA 4OZGF 5INCB 3SOTA 1BF8A 3SE9L 3ZTDC 4ENED 3QUMA 4K7PH 2MHAB 2NNAA 1M7DA 1BMWA 1XZ0B 2V7NA 4E9QA 1DBKH 4EDWL 4FX5A 4ELKB 2WVVB 4FNLH 2D2OA 1HHGB 4LPUA 2VXSL 4ZTOL 4R7NB 3ZE0E 5IBUB 1CLOH 2ZP9A 3OF6D 4GKZA 3KPSE 1WHPA 1D7CA 2DEWX 4GRLC 2V9TA 5L7XH 5DJZA 5I1DB 1Q4NX 1I7TB 3LXBA 3UG3A 5GZOA 1X5XA 4ZTEA 1BLNA 5HHXL 4O4YH 2C9PA 4LLQB 1FNEA 4YXLL 3SO5A 3B7RL 5CINL 4GG6F 1FORL 4RZCA