5BUAA

Lysine 120-acetylated p53 dna binding domain in a complex with dna.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
200
structure length
199
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for p53 Lys120-Acetylation-Dependent DNA-Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 50
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5buaA00
5LGYA 3WTUA 5AOKA 3WTWA 2XWCA 4GUOA 1UOLA 4A63A 4GUQA 1EAQA 2AC0A 5AOJA 5G4MA 3D08A 3ZMEA 5ABAA 2J1XA 1HJCA 2BIMA 1GZHA 4AGPA 2J6WA 3QYNA 1EANA 3WTTA 4IBUA 3US0A 4AGQA 2ADYA 4IBVA 2IOMA 2J21A 3D07A 2BIQA 4IBSA 4IBTA 1HU8A 4L18A 2PCXA 5BUAA 3US1A 4LOFA 3WTYA 4AGOA 4G83A 4XR8C 1TSRA 4HJEA 3WTVA 2ATAA 2IOIA 3EXLA 5ECGA 3Q01A 3TS8A 2MEJB 4IJTA 4IBWA 2J1ZA 2RMNA 4AGMA 3Q05A 2IOOA 4IBZA 1EAOA 2BINA 2P52A 4MZRA 2J1YA 1GZHC 1TUPA 2J1WA 3D09A 3EXJA 4LO9A 2AHIA 3WTXA 2VUKA 5AOIA 3VD2A 3VD1A 4QO1B 2X0VA 4IBYA 5AB9A 2BIOA 1HJBC 4MZIA 3D0AA 1CMOA 3D06A 4L0YA 2GEQA 3IGLA 5AOMA 4L0ZA 2X0WA 5G4OA 2YBGA 2H1LM 3VD0A 3WTSA 5AOLA 1IO4C 3WU1A 1YCSA 4KVPA 2XWRA 2BIPA 3QYMA 1LJMA 1CO1A 1E50A 1KZYA 3D05A 5A7BA 5KBDA 1T4WA 2J20A 5G4NA 1H9DA 2FEJA 2WGXA 4G82A 4LOEA 4IBQA 4AGNA 3KZ8A 2OCJA 4AGLA 3Q06A 5LAPA 3KMDA 3IGKA 2X0UA
chains in the Genus database with same CATH superfamily
3GHEH 4JFOA 2VITB 3ULVH 5BQ7A 3C5SB 1F18A 2JVUA 3FO2B 3SCMD 3IMWA 1KIQB 3IDYB 1TU2A 1S7SB 1KJ2A 5CMAA 1MI5E 3JXAA 2WVVB 5E0FA 1QUNB 1E6JL 2D7OA 2DLEA 3L5HA 3P4LA 4WW2C 5GGSY 4E9RA 1P4BL 1KY7A 4CC4A 2CRIA 1FCGA 4R83A 2FUTA 1KG0A 1ECYA 4I2XE 3WIFB 3VO0A 2X3AA 5D8JH 4HEMA 3K5SA 1F1GA 4AL8C 4UOQA 1UOWA 2VGLM 1DZ0A 1E5AA 4JHBA 3GMPA 3GRWH 1G9MC 4JFWA 1LL1A 4DUVA 3U4EA 5FYLH 1JDCA 3MRFA 4PJHE 4FI7A 3KLHD 2H6OA 3PWPA 2FEEI 3M7OA 4PLJC 4XO4A 5AVZB 1J8HE 1B0RA 1N7ML 5INCB 3UBGA 1LNUB 3L3OA 3ATEA 4LPWA 1BQUA 4LVEA 3UMNA 4QT5A 4HF5H 4B9PA 3SDYL 1NAKH 2FAUA 3VMNA 5ECGA 4CDGC 1RZGA 4R84A 2EXTA 2XTSA 3H55A 5EEWA 3IRCA 4N3TA 4RQQB 3MNVA 1RJZA 1YY8B 4JY4A 4X4MA 1BM7A 3RWCB 2D7NA 1MVUA 2LV4A 5JQ6H 2VLKA 4KNSA 4FKKA 3QDGA 1G9NH 3FHQA 2WWOA 3QFGA 4GO6B 5A40E 4YVUA 5I30L 4HWBL 3RHWF 1ZLEA 4MB1A 3C5ZD 4LLMB 4WV1C 1E3XA 2CNYA 4G5AA 4A55A 2P1YA 1BECA 5L6YL 5JUEL 1OE3A 5ICZA 1T7VA 3NJNA 5H4ZA 4PBWD 2WXJA 3VI4B 4M48L 3FTUA 5CS7A 1XGRA 4N2AA 4PBDA 4R90L 1DO5A 1SDYA 1Q9WA 4CVZB 4XAWH 5HP5A 3HG1E 3TEYA 2YBRB 2AJXL 3SKNB 4IK7A 2AJUL 4JW3A 3T0ED 2ZP8A 3MFFB 1W72A 3UBXB 5LNGA 2VR8A 1EJFA 1YJDL 3OKOB 3VG0H 1FE8H 4R6UA 3V7AG 1M05B 3NGBB 4TUJB 3SDCA 3T6ZA 3ZYIA 3BVNB 3EFDL 1AACA 2ZKMX 2V2TA 1QPXA 3BOVA 3VFMA 5I6KA 1KLUA 3ZE2B 2F9BT 3EJZD 4IU3A 1IC4L 3IF1B 1IFHL 4ODBD 4HOWA 2W5PA 4JR9L 4GAJH 1UVQB 4PV9A 2VR5A 1ZDSA 5CZRA 3QJHB 1B88A 1BFTA 1IC5L 2JKXA 5EC2A 4YVNA 5FF6B 3ZYOA 5DRZB 1E67A 3L5WB 1FF5A 3BKJL 4OIFA 5DK3A 2A9MH 3V6OE 4EUPA 3U0PA 3FO0L 1VZIA 1RZKC 5T5FL 3NK3A 3RIFF 3TT3L 1ZS8B 5I0YA 3BAEH 2VDPB 2X4SA 4M7LH 3IGUA 4BJLA 4QHMA 4OBSA 3UTSD 5FO7A 3WN5A 4WFHD 3FKUS 3M8OH 1QWHA 1D6EA 1J8HB 3GMNB 2YJLA 2Y6TE 1ZTXL 1G9ML 3DJZA 4G59C 5I8EA 5DGRA 4YX2H 3MGOA 1RP8A 1NANI 2C34A 4ZQKA 4PLOB 3UIYA 5IVXB 2FEDC 2DM2A 3EJYD 1HI6A 1HU8A 1XB3A 4NO5B 4N0FA 2FJGA 5CJXC 3D4CA 1F4YH 3ILEA 3KJ6L 1IAII 4WO4A 1A7BA 2F7QA 3FBQA 1S6NA 5D7IF 4U1HA 3TWCH 5FCUL 2GJPA 5DO2D 3R0MA 4KRLB 4OSUL 2EIEA 5T1LB 3DPBA 3WJLA 3PLYA 2PW1A 4IS6A 3LKSA 1KJVB 4JFHD 5E9DB 1SJHB 1S5HA 4OCXH 1DVUA 4MWFA 5J6GB 3BUYA 2VDPH 2PR4L 1PW3A 2WZ5A 3CCHA 1HKFA 4X6DF 2WIMA 4IEFB 2MHAA 3ECBB 2PYFB 4CVXB 3G9VA 1N67A 4QXGH 1D5MB 3OAYK 1BSIA 4IM8A 4X9YA 4XB3A 3WL9B 3UG5A 2AS5M 2CHXA 5JIHA 2VR6A 4LVHC 4DKEL 3M1BA 4Z77A 1V7NL 1UG9A 1WITA 4GAFB 4Y2DC 4FQ2H 1HAUA 2BMKB 3PWNA 4NI6A 2F53D 4J6RL 1DJXA 1L9NA 2Q76A 3V4PH 1EO8H 2L7QA 1WBXA 4C4UA 2FB4L 5IB1A 4WKZA 5HDBE 3S88H 1ITBB 1BVZA 1J88A 3O4LB 4PMFA 3RA7H 2ZT9C 4IRSC 35C8L 3L3OC 3LS5L 5AOLA 3P40A 2WSDA 3IXAA 4MMZA 1M1XB 2ESVB 3WY2A 3WIHA 3DO7B 2BRQA 1IEBA 2CHDA 4J6IA 4YSCA 3SBRA 4PCSA 5HHNA 2VR7A 2OW7A 1VZHA 4MNQB 2E5EA 1FL3B 1QWNA 3J7HA 3CBJB 4PVLA 1QSFA 4PCKA 3B2VH 1OANA 4LOUC 3BPOB 4F8PA 4Z7UE 5D7LD 3VGAC 1U3JA 2ZXBA 5BOJA 2GBUA 2JH2A 2OPCA 1CBVH 1E8ZA 1U8QB 2Y4SA 4CGTA 1I9RH 1A4JA 3FTGA 2YEVB 3TIEB 3CHQA 1HXMB 1ZHNA 3SDAB 4OB5H 4QLRA 4NZUL 3PFQA 5D7JA 1AJ7H 5FYKU 2VERN 4YDLC 1FNAA 2UY6B 3DK0A 1BBDL 1AD9B 4FI8A 3E6FA 1WBZA 1IBGL 3DSNA 1MIEH 5JMOC 4PRDB 2IADB 4Y5XA 2BJML 4E5XG 3RDTB 4FLOA 2R0ZL 4ZOCA 3TZVB 1D9KD 4G9DA 4UUJB 4GBXD 4LSRH 4OJYA 1JN6A 1S78D 1WIPA 3AC0A 1F90L 1RJCA 3A5VA 2C9VA 2WBJA 3AJ7A 4PEEA 3Q6FB 1PJWA 5IMLB 1R5IA 3T6XA 3RX8A 4DIXA 5IQOA 2AV7A 3B2XA 4ILDA 3QUZA 4NQCD 4J23A 4CL7A 3QT2A 4UM9B 3T0EB 4F2EA 1NOFA 1N10A 2VXSL 4TKWA 5L2JA 3WTYA 1YEFH 1S9WB 4G8GE 2L7UA 1FNSL 3QCUL 3ULVD 4OM0H 3KWUA 2IOIA 3ME0B 3MVSA 1HL9A 2DLFL 3KNBB 3ZW3A 3ARUA 5I2IA 1RULH 2R2BA 3PJSB 2XJLA 1JGVH 1S9XB 5TPWH 4CDHA 4MCZB 5ILTL 2LW3A 1KMGA 5I71B 4GKLA 4HZAA 2YPLA 4M6OH 1RJYA 3GJFH 3RURA 1HH9A 1P4UA 5BOPA 5E1QA 3HE7D 3L9YA 1A0QH 4GKZA 1I7UA 3F7YB 2JELL 3FF7A 1VIWA 3STBA 5HHVL 4JKPH 3TZVC 5IOKA 3F58L 3QXTA 3OLGA 1T4KA 4GBXC 1MY5A 5HI5D 4JPIB 2D7MA 3OGCB 4ZW6A 3DRTB 1TETH 2QQQA 1QTSA 2X3CA 5DC2A 2WO4A 2C3VB 1A7OL 1IAKB 5F9AC 5BZDB 2CK2A 1M2VA 3DA0A 4ODUA 5AB1A 1FORL 3NABH 3LS4H 4JDZA 3QEHA 2JE8A 3CZEA 3FAWA 3MRJB 1K9TA 3T4AB 2C4FT 1NJ9B 4QTIH 2YA0A 2ICWJ 4LPYA 2HTLD 3J2PA 3PWLA 3H3PL 3M1CA 5KS9F 4G6FB 3HBPA 2CE6A 1CS6A 4BEIA 1DQQB 2KS0A 4NBXB 3ASNB 1QHQA 3CDGB 3C12A 3K2UH 1FWXA 5GRUL 5GZND 1I9IH 3O3DA 4PJ8A 1DDHB 2KLRA 3V5KB 2VXQH 5HYEA 4MCYA 4DEPB 4LVOB 1MAJA 1V7ML 3MLTA 4AJVA 5EBGA 4Z7WB 1NGXB 3C5ZA 4OZHE 1Z0NA 2Y0SA 4X5XA 1Q9KB 1VFAB 5HYJE 2GTQA 3CLWA 2YN3A 1A4AA 2R83A 3QYNA 1G7HB 3QNXA 5D7SL 2EDHA 4N25A 3UJIL 4HVBA 5J9PB 5C07D 2BSTB 2IF7A 4JM2A 2JLPA 4LF3A 1FYTA 2DEYX 5ALCL 4P4KA 5DS8A 3QZWG 4Y7OC 4HS3B 9PCYA 4LDCA 1JDAA 1HINH 3MTXA 4OQTL 1J1OH 3AY4A 4Y2DD 1JBJA 4HSAC 1AZBA 4ZFGH 1CGWA 2P3YA 4ODWB 3D4ZA 2XQBH 1QYGL 3MXVH 4JFYA 1JE6A 1NCJA 4PJ5D 4IRZL 2B5IB 3DVFA 2EDTA 3T8MA 3WTVA 3BRDA 3CZGA 2WQVA 1DJIA 2EO7A 1ILSA 4LP5A 4N6QA 3W57A 3IETB 2WAHA 1FQ9C 3OM3B 2VXTL 4NRYA 4GEIA 2WUBH 5C0JB 2XKNB 4KZCA 3I3BA 1R47A 3OR7B 5CBAB 2UZYB 1HSAB 3N85H 2KKQA 3CZFA 1BVLB 3FB6A 3MBEB 4KJPD 4YHLH 3ULVF 3EJYC 2GB2A 3HZYB 3DV6A 5EF0A 1ROCA 2P8MA 2HX7A 2XA8H 2OMUB 4PP1D 4YHPB 3TH4T 4DQOH 1JV2A 2BSDA 3B5TA 3PHQB 3WO4C 5C71A 5EC1A 3FRPB 3QG6B 5D5ME 5LWYL 2PXYB 1UZGA 1NCGA 1BM3L 1GRWA 5KVEE 4P5KA 3ULUE 1AGFB 3FTVA 1EGJL 1S7QB 4GKOA 5EIIA 2GFBB 4XGZB 1DQKA 5F3FA 1JYXA 4QOKA 5SWZD 4HJJL 5DD6B 3E6HB 1DQLH 1RUKH 1YPZB 3EHBD 4U6HB 2XVGA 3GYRA 4HKXB 2W88A 1SOXA 4O51B 4GXUM 1ZK9A 3APDA 4HC1L 3KPPA 4ZSOA 4LARH 2YMXL 3N1PC 5BRQA 1CLOH 3HUJF 3QISA 1UWFA 3RJOA 3SB3A 4RWYH 3F7VA 5SX5K 2XUWA 2ORBL 1Z9OA 5SX4H 1JF1A 4QF1B 3BH8B 4B50A 5T1DL 4HIEA 2EUVA 1JWMB 1VZGA 5DJ0B 5LXVA 4XC1L 1PLGH 5EZJA 3C60D 2G60H 3BVTA 2R7EA 3HPLB 1XBRA 1M71A 1ZD6A 4X9BA 4JY5H 5DRXA 1N5YH 4UILH 1ETJA 1AD0B 1XDTT 1FN4A 3QRLA 1MUJA 1AS8A 5E2WH 3GHBH 1HSBB 4XNAA 3RVUC 3ZE1B 1Z5LA 3RUGA 2GBVA 4C56A 3WFBL 2LT9A 3RZCC 2ZCHL 4G80A 1TSRA 4I18C 4PP2A 2YGOA 1EHXA 5C2UB 1ZTMA 2YA2A 4QHLB 3PL6A 5D9SB 4F58H 3VGAB 1ZEAH 1EANA 4WFGD 5LGHH 3D6GA 1GHFH 4RGNC 4P3DB 2X6BA 2V2WB 2ADYA 1XVSA 2CBTA 4WHYG 2Q2EB 3BH4A 1JFHA 2X70B 2BNRA 1HZLA 2JKRM 4Y5YC 4N22A 5I26A 2Y2WA 1XGTA 5GZOC 1ZVNA 2RIKA 1QUPA 2ENSA 1OSEA 3LY6A 2Z34A 2TRHA 1XT5A 3T3PF 4M5ZH 3UC2A 3CJJA 3US9A 2QKIB 3OHXB 1NC2D 2YSTA 2Z4QB 1FFTB 5CR1A 4DKFL 3ATDA 2DWXA 1XIWA 3E8VA 3IFNL 3BKYH 5C09B 5ACMA 2P28B 2P8PB 5T1KD 2EIDA 2ADGB 4L1SA 4QYOA 2J8UB 5E2VL 2VR3A 1A6ZB 4KAQL 3VAEA 3QHTC 5DD5H 5JPNC 1PG7H 3ATAA 3ELQA 3ILPA 1EUTA 2X05A 3RWFA 5HPMA 4KZEH 4IOFD 3GKWH 3LKOB 5MP6H 5DFAA 3PHSA 4TRPL 4LPXA 4PJ5A 2CKBA 1FCCA 3VD1A 3OMNB 1Z3GL 4MRBA 1P7QB 3SEPA 3MUUA 5TGBB 1VCAA 3QE5A 1MRCL 5F3HB 2HPTA 1EEZA 2IWGA 3ZHDA 4DERA 3I85A 1W0WB 2WW8A 4HYTB 3TN0A 6FABH 2V3EA 2NY4B 1YNTF 5JW4Q 2GI0A 3Q2WA 1JS4A 4HJ0C 3GT6A 1P5UC 3LRHA 32C2A 3RWJA 2H4EA 3GSNB 4NUPA 5GRVK 4WNSA 3P73A 1RSYA 4I9XA 4WV1B 5AAWA 2Q86A 2NNXA 2JIXB 2XN2A 3QUYD 3MO1B 2I5YL 5JYLA 1DVQA 3SY0A 1OPGL 1CG9A 1E50A 1J1PH 3L1EA 1KTDA 2CGRL 5DURB 4PJGA 1RPKA 3WJMA 1RHHA 2TAAA 4PGDA 1W80A 4GY4A 1F4AA 5CGTA 1NFIA 2GJJA 5FFOA 2DLTA 5HBBA 4OV5B 3IDIA 2CU9A 1X5ZA 4GW5B 1FGNL 2XV6B 2DJUA 1DANU 3RNKA 3EW3B 1QAWA 1ESOA 4DGVL 1LEGA 5LAPA 3EADA 1YLBB 2QLYA 3EJPA 4MAYC 1FGNH 4JZJC 1TTBA 2CM5A 3JTTA 4NCDA 2X9YA 3LKNA 5KG9B 3DV4B 4M1GL 1QFWI 5FGCE 4QRTA 4P2QE 2LGNA 3GBEA 3SSGA 2PW2A 2JV6A 3H0TB 3UJJH 5IMOB 1OARH 3PDGA 3MV8B 5E5MA 3SBWC 4O2EB 3QIUC 3GXMA 2NY0C 2P5PA 5F7EL 1U0QA 2BNQB 2PYEA 4J1UA 3OF6D 4NRXB 3VXRE 2BIIA 3RL1B 1BZ7B 3HAEB 4FQXC 4M03A 4JPWL 1RZJH 3JWDC 1UFUA 5JW4R 1CYWA 1OSZA 5CGBA 25C8L 1ZY9A 3IPEA 3NA4A 3NN8B 5DJAB 2HT3C 4PRHD 4LMQE 4OY9A 4OQTH 3V0GA 5CP7A 4P04A 3H56A 3T4AC 4NAJA 4RNRB 5FYLE 3V10A 1DHKA 3RU8H 5ALCH 3UTQB 2GK2A 4R3SB 1Q4NX 5C0AA 5I15H 3SQOL 1AZUA 2AQSA 5D7SH 2YAHA 4F3FA 1F45A 1KEMH 3MRIA 2E27L 2MQGA 2L7EA 2HRGA 1MRCH 2CDGB 4DGYH 2AABL 2R9HD 4QOKE 4OD2B 3TIDA 1VFBB 3G5VB 4KDVA 5ICXB 1KCLA 4N2HA 5DA0B 2HLAB 3BWZA 3OG4B 3MJGX 3G04A 3WUWA 4N87A 3IMBA 1A1MB 2ITCB 3DVNB 3CFCL 4OCRH 2P7TB 1T83C 1XHHA 5DQDL 5FHBH 3K0WA 3EHBC 3C60B 2G3ZA 4YUEL 3UO1L 1LXMA 3B9KB 3EXJA 3IS1X 3ZKMD 4ZO8A 3QUXC 1VEOA 4ABWA 4NDMB 5I19L 1JSYA 4A2GA 3T1WA 1B90A 4QO1A 3KLSA 4ZW5A 4HHAA 2DBLL 5DJDB 3NIFE 3MA7B 5E99H 4RIRB 5C2BL 2G3MA 3DVIA 3GS4A 4P3WA 4X6FA 2Z35B 3MRPA 3DNKA 5JR1L 2MPAH 2AJ3A 3WTSA 1S7RB 1ZWIA 3EO9H 1CF8L 3E2HC 3WMSA 3FU0A 2H1PL 4PPTA 2VISB 4JKLA 5DJCA 1LWHA 1Q94A 3QGVA 5HHOD 2YD4A 4RISL 3CSGA 5D71H 5D55A 2ZWNA 1L0QA 4PR5A 3V0AC 3HI5L 3W11D 2CCWA 2W0PA 4K8RH 5CBEB 5EB9A 2PP7A 1HDMB 2HFFA 4JY6A 4NXKA 2XYCA 4X98B 5DHVB 1I8KB 3I6KA 4ELMA 2FJUB 1WAEA 2VMJA 1UD4A 1S7VA 4M00A 4AM0B 1A6AA 3STLA 3ELAT 4OT1H 1UEMA 4FLRA 1PF3A 2DBJA 3FFCE 3KMDA 4NFCA 1I9EA 3MC0A 3S5YA 2V5SA 2BP8B 2F1BA 3KLKA 4I48B 4KROD 1BZEA 1IM3A 2WO3B 4UBDD 2HT4C 3DX8A 5JW5A 1XCWA 4RGOH 2WO2B 3TJEL 4YWGH 1RXLA 4UINL 5IFJB 3CH8A 3P3TA 4KUCD 5MHSE 5F71A 5ELIA 1RFDH 3FW6A 3DYMA 4L8DA 3DRQA 1SYSB 1EDHA 1PCXA 5TE6L 3S35L 4AENB 4MQ7A 2B14A 4Y1SA 4BM7A 4CSPA 1RPQA 2X4UB 4AEHH 3MLSH 4OI9A 3HBGA 5FDYA 1QG3A 2HJFA 3E0GA 3ZR6A 4M8UA 4Y4FB 4U6XA 5IB3A 4LSRL 1EGJH 2HZHA 5CJOH 4FQJH 1B0WA 1LMKA 4JFDA 5DD1H 1S7XB 3L4TA 1AO7A 3N6YA 3S37X 1JGLL 1HE8A 2AJYH 3KCPA 3OJVC 1AGDA 3LD8C 4NN5B 4M02A 1ZT4B 3UTOA 1FJ1B 2K45A 1NL0L 4JZJA 5JXEC 1COBA 3BZEB 5MEND 3BHBA 4PRHE 3UERA 5IBLC 1RMFL 3ZE0F 4X9IA 4YPGA 4JZNB 3QP3A 4NQDD 1VRSA 2ATKB 3GDCA 2LU4A 3FT4A 3LQMA 2HSIA 3EO1A 4X6EB 2PO6B 2F54E 2OI9B 3JV6B 1N2RB 4HCGA 4WW2B 4H88H 1KEGL 3QJFB 5ETUB 3D18B 4RMTA 3VXUE 1I9JL 2EXYC 1KPRB 2JJTC 2WN2A 2F2HA 4EUPG 1KXTB 2KT6A 4OZIB 1Z5YD 3CMOH 5KYYB 4JFSA 1T1WA 1VACB 3X11A 4LKCB 1CLZH 5CJQH 3SOBH 3LNEA 4JDTL 5EEVA 4KX9A 3TPUB 2WXKA 2Z64C 3OXRA 5JHAA 4FFYA 4P5SA 3L3IB 1B9ZA 2HTKD 3LH8A 4G42B 4FFVC 1ID2A 4JJOA 1GGCL 1XF3B 4MS6A 1CXHA 5DUML 3SDDB 1J5IA 4LLQB 2H1LM 3BQUA 2C1OB 3X13B 1SUHA 1YEDB 2G9HA 3A67H 1MDAA 4XCYB 2EE9A 4LHUA 4FXGB 4KRPD 4UTBL 4OF6A 3U1QA 4QRRA 2L04A 4RA3A 1F56A 1GH7A 3QAQA 4TSCL 2V9QA 1AY1L 4L0PB 4OW6A 2ZYSA 1G7LB 5GS2H 1HXYB 3RWEB 4J6RH 5JDSB 3W5NA 2OR7A 3NCJL 2Z31A 2XTJE 4OGZA 4Q2ZB 4NCC2 4XMUA 3T2PA 3H4HA 4HV8B 1XCTA 2BLFA 3F01A 4LLWA 1WA1X 4G9FD 2ZG1A 3TCLB 4JDEB 3FCBA 1KCBA 2NY3B 4MMYB 3ZE0E 3E80A 2ZAIA 2NSQA 3PQYA 3MREA 3LSOB 1T2JA 2ADIB 2AP2A 3RTQA 4NQTA 3L9RB 4OFIA 2JJWA 3JWOL 5EDXA 1XX9C 3AADB 5JOFB 3IDNB 3MFGB 3L08A 1GCFA 4TXVB 3BT2L 2WCSA 1WZLA 3EFFA 3FUMA 2O5ZH 4XCNB 4UT6H 2OQJB 3BUQA 1OHZA 4JKNA 1S78C 1GJIA 4RRPA 3J8F7 4XO9A 2VM4A 1WCBB 3WY3A 4B7IA 3NYKA 4GRWH 4J2XA 4XE0A 4PD4J 1TVHA 4PS8A 4ZYKB 3HMXH 3KPSA 4Z7UA 3B7SA 1G0DA 3RDJA 4BWUA 4I77H 1N6QL 5ID0B 4WY7H 1M6OA 1WRFA 4KKLD 2P44B 4G8IA 2QSQA 5FAAA 2Y07H 2CJSA 4XXCA 2EKSB 2YD5A 2OYPA 2WOYA 4JFQA 3KBHE 5GIRA 1ZSDB 5F7AA 3NT0A 1PSKH 4OLZH 4D0DA 3DBSA 3F7PC 4R8WL 3OKNB 1A8JH 5DZOA 4YQXL 1CFNB 4KXAA 1QABA 5FO9A 1RIVH 4GUCA 1OP5H 1IGIH 3ARVA 4W9HC 1T0OA 3SGDH 4G7YL 1JGDB 5ERWB 1ZXQA 5JHLH 5FYJU 1FIGH 2D31B 2VN7A 3UTPD 7TAAA 4UOZA 3FQ4A 15C8H 4H20L 4ZW7A 1FRGH 4FYTA 3WS3B 3LZNA 2EYRA 1MVYA 5IW6A 4KMLB 3KXFA 3BPNB 4HDIA 1SOKA 1C5CL 2I24N 4PHXA 4PJCB 2P5EA 5D4HA 3D9AH 2XZCL 4WQOA 5CWSB 5KJ4A 1IGFL 3APFA 2GEEA 4Z5RB 4H40A 2DQGH 1R5VA 4F1SA 1N5AA 2P24A 2JF1A 2BP0A 3H7BA 3HG5A 4GKSA 4I5BB 4ZBJA 4QXTB 4OGXL 5CM1A 3UTTB 1AQDA 2DDQL 3FSWA 2AJXH 5FGRA 3V95A 2VKXA 2EIZA 5DUPH 4CW1B 4ZPTB 2ICEB 3N55A 1UXLA 2WVUA 4V1DB 1KWGA 3CFUA 2NUPB 3MCKA 2R8SH 4HS8H 1NBYB 3FOMA 3HJ0A 1HEZA 2VNCA 3MX0B 2XG4B 4WI0B 5E5RB 4QDGA 5D4IA 2XFXB 3BZ4B 3PCYA 1QR1A 1IM9B 2CLRB 2PPEA 5H2BA 3F8UB 1QFUH 5TH2B 1T04B 1JXKA 3IDJA 1TTRA 4NS0A 4ZTPH 1UQSB 4R4FL 5AVTB 3QUMH 4WRLA 4M4PA 5IOPB 2YC1B 1A64A 4KO9A 1QSFE 3KPRE 4MDIB 3ZTDC 4PP1C 4IW4C 5L9DL 4Q6YA 1YHPA 3UEQA 2HRHA 3HNTL 2PO6D 2D0GA 3M86A 5GZNC 4KJPC 2BVOB 1ORSB 3L3HB 3RNQB 4M7ZB 1PDKB 4JVUA 3X1EA 5I17A 3EBIA 4AQZA 4KTDH 4ZO7A 1CT8A 3ALXA 3C6SB 3IGAB 4LCWD 5EO0B 4Y2DA 3DROA 2P9RA 4BFOA 1TVBB 3UMTA 5I1CH 1Y6KR 2AK4E 4FHKA 4IBVA 4GRLB 3SODB 3T1FB 2B1AH 3GXNA 5SX5H 5CIPB 1OGAE 4AUJA 5KS9B 1JYVA 3TX4A 4Z7OE 4MAYA 1F8TL 1XZ0A 1OSYA 1V3LA 2FJFA 4UDTB 4Z1PA 4F7MA 4HUKB 4MMZC 5CCKL 3ZOAA 4N0UB 2XT1B 1KBBA 3LZRA 4E41D 1BQLH 2D0HA 3LIZL 3OQRA 3V0VA 4MJ5A 4FTVB 3ZE1F 3I6GB 1MQKL 2C3HA 3HB3D 3PXJA 1J0IA 3S3BB 4P2RA 4BZ1L 5C07E 1VLXA 3IJ7A 3SOTA 5BQ7B 5HGHB 1CL7I 2OTWA 3Q6GH 1S7SA 3BO8B 1NMCB 4R4ND 2WVVA 2FL5B 3TL5A 4WLCA 4H1LB 1JZ6A 1N59A 3ARED 1BV8A 1H3UA 4N0UE 1CN4A 3L3JB 5IG7A 3PL6D 2QKIC 3KWTA 15C8L 1IAMA 3II2A 3MKKA 4MJ2A 4F91B 1QI4A 3VRLF 3FTZA 1BEXA 3HRPA 3B7UX 5JLZB 4PTTA 5DRWA 4M8VA 4YDIH 1RIVL 2FATH 3Q5YA 4PAZA 4K8RL 1PSKL 3EH5B 1AZZC 2CMRH 4LCYB 1TPXC 5C8JB 3KPLB 3RVTC 3T0VA 1NIDA 4DPAX 4OZFG 2Y24A 3UJTL 1MSPA 4PWEA 4MD0B 5F0MB 3U4KA 3MGTB 1HZKA 3K80A 2DM7A 2GIMA 3IFPA 1TFHA 3PPEA 1EBAA 4OKVA 4QT5B 1U8CB 3HG2A 5HHME 3I2CL 1P2CA 2H7WA 1A3LL 3EYQC 4M4RB 3NCBB 1TCRA 2X4OA 2VDNL 3RRQA 5J12B 3AVEA 3OJDA 4NPKA 2EAEA 2VLKB 2C9AA 2K9FB 1P84K 1BOGB 3BIAX 3QCTL 3HE6C 5JXED 3ERXA 3FCUB 2IAMD 2QELA 3L95A 2EYTA 4LOEA 1W0YT 4AEFA 3PY9A 1A7RH 5EZIL 3VWKC 1IVTA 1Z9PA 4MJ4A 3KLHC 2NDFA 1PX3A 4NKDA 2BC4A 3VRLE 4KJWC 4IGBD 1FLRH 2MCPL 4C54A 1SM3H 3EO0A 4XMVA 4PLNC 1Z5HA 4L3FA 5DVMA 3ZRFC 2X4PA 1M7DB 2PR9A 2VDKL 2HG5A 2MOQA 4F2MB 5AW4B 5I66B 3NCJH 3CSBA 2E27H 2Z3FA 1GZHA 3AITA 3VFPA 3POHA 5F93C 3BPLB 1JUFB 2DYPA 4I88A 4L8BA 3FO1B 1U8MB 1U8KB 2MRYA 4JO1H 4TTDD 4N24A 4UIKH 4LDEB 4GG6F 2VZOA 2H32A 1JZIA 4N1CA 3ZMRA 2IPKB 3JT0A 2VQUA 2AEIT 4G7SB 1BFOA 4XPBH 3P2TA 1KBGH 4AEIL 4P4KD 3I3EA 3MYJB 4N0RA 5L6YH 1HK6A 3HPJB 5ID1B 4G6KL 1Q72L 3SPVA 2NLJB 1T21A 2WP3O 2WM0A 2A73A 1C5BH 4ADIA 3TV3L 3UIZA 4OD3L 1I9JH 2ROYA 2KDYA 4EUPB 1FNGA 1NANH 2B16A 3H9HB 3VACA 4WHTA 2O5YH 1T66C 2CRMA 4H88L 4JFFB 4G7VH 4HUWB 4OAWA 5FO7B 2JJVA 4J4PA 1GC1H 5TJWK 5LNEA 1J8HA 3LNDA 4X5QA 2CDEB 2BSEA 2OJZH 2OMTA 3FT1A 3C6LD 3CDZB 1RMFH 5D2LE 4PB9H 1A6UL 4PJ8C 3SBQA 4PYGA 3X12A 5DZLA 2HMID 4TL5A 4I0PB 3X2QB 3HI6L 4HC1A 4LKXA 1BQHG 2J8OA 1NEPA 2Z8WC 3EBGA 5D96B 2ZXQA 4YDJB 5E6IB 4YLBA 5DSCB 1YMME 3PWVB 1GTFA 4OVVA 5FYJE 4FD0A 4YS4A 2MTPA 3VQ2C 5T3XD 3JWOC 3U0WL 4QJ4B 4XWOD 3RIAK 1JNHA 4XN8A 3ZKND 4B41A 4U1HB 2H32H 2GW5A 2VIRA 3UCQA 5L7XH 3S7GA 3UAEA 4HUUB 3QO0B 1DSFL 3DBXA 5JIMA 1NKRA 2PW1B 4HMCA 3BPNC 1KJVA 1HNGA 3T2NL 1SJHA 3BIKB 3MODL 5L2KB 3R8BB 5J6GA 3D69B 2XOTA 1AC6A 2DQCL 1WWBX 3ZE0B 2VDML 2C4FU 1GOFA 4ZMWA 4CNIB 4KO6A 1WS8A 1J12A 1LLAA 2A99A 3IPBA 3P0GB 4UINH 3WL9A 4XBEH 2CO4A 1Q1JL 5FECA 1XIWD 4XPFL 5AVYB 2OL3L 2XTJB 2IH3A 4KKAD 2J8UF 1HAWA 4Y19B 2FO4B 4E0RA 4TS6A 1NC4D 1UJTA 2LHAA 4KOCA 3NFPA 1CGTA 2Q76B 3SZKC 4NQED 3TF4A 3CFJA 2BDNL 3H9SE 4ONGL 2F6AA 4XHJC 3GDBA 1JAEA 4LHQB 4H5SA 4YXKL 1JVLA 1U30A 1QACA 4RRPG 1GYUA 5L4IA 5FDWA 4OFDA 1GGIH 2ZKWA 3QFDB 1TTUA 4Z78A 3U6RB 2N7BA 3OZ9H 1JWSA 3G5YA 2VRAA 4L05A 1I8IA 2BH0A 2WUCH 1P4LA 3HFML 1DE4B 1MELA 4MNQA 4XZ4A 5K9QG 1DVFB 4X0KB 5HY9B 3ULUC 4GS7C 1NBZB 1SQ2N 2BIQA 3O0RH 4WTZA 3LX9A 1FSKC 4W9DC 3T3ME 4F20A 4P59L 1T1XA 1KYDA 4NQCA 1A4JB 1G5GA 3FMGH 2DS4A 4NP9A 2FEDD 3FUHA 4TUOB 1OM3H 2W91A 4EI5D 4N2GA 2ZCHH 3WMPA 2W65A 3LQZB 1ZJBA 3V0WL 4EI5A 3SKMA 3VTTA 4P07A 2K3HA 1ZHLA 1SPDA 1NCNA 4NSKA 5TQ0H 5E2WL 1ZLDA 2XWXA 5CKGA 5H37A 1BF2A 2ERJC 1YSOA 3E6FB 3EUDA 4WUKH 4XPGL 4B97A 3IKCA 3LD8B 4YGVB 4Y5XB 1GZHC 3L4YA 3QR0A 3WIHH 2QSCH 3BWAA 5F89B 3CFMA 1PG7X 2IBBA 3S5LG 3ZYZA 3HHRB 4G9DB 1CI3M 4TOYL 1JWUA 2VDOH 4JFVA 4K0OA 5FUOH 4BZ2H 3PP3K 5C0CD 2DWEA 2ICWA 4WW1A 1JHTA 4FNTA 3Q43A 5IJKC 1E8WA 3G08A 4XO3A 1R5IB 4MCNA 3CFEA 4K7FA 4NQVB 1SHWA 3D39A 1F2QA 5IVXE 3BH9B 1CE6B 2Q1EA 1F0LA 5IHWA 3T0EA 2APFA 1QRKA 1OE1A 5F96L 5FCSH 4Q9RL 1VKXB 5I15L 3FH5A 1JTPA 4AIZA 3HJEA 5DVOA 1S7TB 5HGBB 4TQEL 2DJMA 3KVQA 3V0FA 1BM3H 2B1HH 2VKWA 1YMHB 2H2SC 4M7LT 5K9QI 1G6RA 4ORZC 3CZUB 3BYTA 5F7EH 3CPUA 1OARL 4NWUL 1REIA 4PW4A 5T1KB 4QPEA 1MREH 3NG5A 1JMXA 3PNWA 2J88H 3ILDA 3VX1A 2CDFB 1L7IH 3NDZE 1IL1A 2APTA 1KUMA 1D6VL 5E8OA 3CHSA 4BZYA 2YJQA 4U1SB 3VW3L 4A2DA 2MJWA 1I7ZB 4QTHA 1WC7B 4PIBA 2CO2A 5SWZE 5IJDC 4Z3GA 2Z6FA 3ARBC 2ZWSA 3NOIA 3V55A 4ZAKD 5FA4B 4AYFA 2Q8AH 1FFOA 4B3VA 1IBHA 2OXHB 3D08A 3VB8A 5CCJA 3VUAA 4ODUB 1K5NB 3K8KA 3U82B 5E4OA 5IVXF 1AGEA 3VQMA 2DYSB 5C0NC 1A3ZA 3VE0A 1OPGH 4JDZB 4P2RE 5C07A 3WTTA 1J1OL 2DTMH 3HZMB 1MNUH 3LKQB 5ESVB 1QQDB 1DJWA 5J0BA 3QUYB 2YLKA 4WJ5A 1LD9B 5EIVA 4WI3A 3DUHA 3P77B 1EO5A 1HVXA 5ANMA 1A4KB 2OMYA 2BOCB 3RIFK 4AX3A 3ZVVA 1QZ1A 4NQUA 5EZPA 5CJ8A 3LPGA 5HYSB 4HBCH 4KXBA 3S98A 3V5KA 5E6YA 1JZDC 4ZO6A 1NM9A 4JCWA 4PGCB 1FZMA 5SWSE 4BGDA 3OVUB 1KCSH 3TN0D 1ZGLP 2UX6A 1VCBC 4O58L 4P2OB 4FQXB 3ZPDA 3GKWL 4W1TA 5TDNB 5I75C 2NZIA 1NUGA 1Q9KA 1T7XA 5IP4A 2DB8A 4F7PB 4PYHA 5GRUH 4F80A 1YMMB 3IE9A 3GTTA 3G6AA 1O6VA 2N56A 1JHKL 3CZKA 4BE6A 2X53A 3AWFA 3QNXB 3D85A 4Y4HB 3N04A 1E28A 1H0DB 4S2SA 3H3PH 5IROA 4NJ9L 4B53A 4ELKB 2BNQD 1U3HA 2CO7A 1HXKA 2X0VA 4HIHB 1T03H 1HYSC 1INDL 1IC7H 2IXQB 1EJ8A 3WAKA 4HBCL 4P9HH 1CVRA 5DC9B 4M5ZL 5CCGE 1EHNA 4NC0B 5FM8A 3HAEG 3VM5A 1DJZA 2QQLL 2AJVL 4DPCX 2FD6H 1G7QA 4P3CH 1A5FH 4ODHH 2B3IA 4R0LB 5DHXB 2A5UA 2BRRH 4O2FA 3VI4F 1NFDA 4BFBD 4H8WH 1JZ8A 1L0YA 3DX0A 2WYHA 2Y5EA 2A0LC 4LGPB 4Y9GA 3QYMA 5EWIL 2E9IA 3X3FL 3HN8A 4BA0A 5I24A 2DV6A 1I3UA 2H8PA 2M26A 2X5PA 1XTLA 4GQQA 1RJLB 1J8SA 4Z8FH 1D5ZB 2XETA 1HSAA 4G43B 1X7QA 3QULB 4XP4H 2F8VA 5EA0L 1N6UA 3MV9E 4OZGA 5A7EA 5HI3D 4YBHA 5AEAA 3FJTA 2CAKA 4HJTA 3DXAD 1CK0H 2G60L 3FRPA 1RURH 1EV2E 3QG6A 3KXFE 4XH2A 4DVRH 4F2ME 1O7DE 4N1HB 1OAYH 1XCXA 4NPJA 1DFBH 4JCLA 4P5KB 2UWEE 5AOKA 2ODIA 3CC1A 3TA4D 1K6QH 4NWUH 5CKAA 3QUXD 2VC2L 3MLRL 1AOHA 4HG4K 2ZF8A 1RIUH 1Y1UA 3QUXA 3O9WA 3E6HA 4Y16B 2GCYA 2H6PA 4DHLA 5F9JA 4I3RH 1QEWB 4LL9A 2E6QA 2Q20A 1NCDH 4KJYB 3EOYG 4PJIA 1JYNA 4MB3A 3QHZL 4HZLB 4LLYA 3K4ZA 3CN2A 3RPBA 2QR0B 2R9HC 1UA3A 1ZLUK 1NPUA 3SYAA 3PAUA 1IGYB 5F96H 3SO3B 3WNPA 1BAGA 4U1JB 4CA4A 4L9LB 4PCYA 5C0BA 4QHNA 3GM0A 3QIWB 4YSUA 4DPRA 5K9JL 4IMLB 5I18L 1W0VB 3AGWA 1YNTB 3MLVH 1KTJA 5F9DC 1HSBA 5TF0A 4ACTA 5J56B 1SRDA 1YN6B 4GW1A 3MBXH 5IR1B 3EXLA 4OB5L 2D7PA 3CXDL 3I50L 3CE1A 3QO1A 4B95C 5I5RA 1OE2A 1FYTD 1GY2A 4BK8A 2IGTA 3LH2H 1AKPA 3DI2B 1KYFA 1RZQA 3AQYA 1F6AA 3DC0A 2XXMB 1KN2H 2P45B 1YPZE 5D9SA 4U6TA 2IBZX 4YHNB 1UURA 1ZKAA 2DQTL 2YZ1A 4MJIE 4UT9A 3E9UA 1N3NA 4W4NA 1KSRA 4W81A 2NSXA 5CINH 1DQDL 3FUFA 4LBEA 4IRZH 4RAUB 3ECWA 3MXVL 5HI5C 1OK0A 4PV8B 4ZO9A 1BX2A 1Y0LA 5B8CC 5FYKL 1XGTB 2YOCA 3ZHNA 3GSVB 4JJ5A 2HKFH 4U7KA 5C9JB 5EZOL 5DYFA 2KDGA 2BX5A 4HJ1A 3Q9QA 4LLUA 3TEUA 5K9OA 1ZT7B 2F19L 2WIIB 4PWGA 5C09A 3G5WA 3NCWA 2UYLA 2A38A 2Z8RA 2EILB 1LEKB 4F2FA 4N20A 1QSEA 3LN4B 1YEHH 2B0SH 4NLHA 1NDMB 3QUYC 4Q4IA 2EUWA 3UBXG 2IPTH 2FJHA 4RGMB 3V0HA 2E8YA 4ETYA 2EIMB 4PJ5B 4HUVA 3ETBF 1RUPL 2ZKYA 4U0RC 1JHKH 4MYPA 1I9IL 3ISRA 2OULB 1DSWA 1QASA 2HFEB 4I9WE 5AW3B 1AR1C 5AKSA 2PTTA 3GSRB 3K6IA 3SDXE 4OV6F 5DZPA 3QJUB 4B5EA 1BQKA 4DZ8B 3ES6B 4O5LH 3P54A 4KX8A 4KITB 1ZK5A 5FGSA 3FZUD 5F0LB 3C60C 1IGJA 1XB6A 4L3EE 1CICD 2AQ2A 3VWKB 2A83A 1C16A 1WD8A 3KJ6H 5CZVL 3RILA 1S3KH 1CG9B 1FORH 2X28A 5IMKB 2HVJB 3T2NH 4WU5A 2HH0H 3DSFH 2CHZA 2K4WA 3FU6A 5J1AA 2CQVA 2VMFA 1BCIA 1UUSA 4M1CC 4R5TA 5L7XL 3AS3A 2AV1B 4GLRI 2E3VA 4RAHA 3RHWK 5MEQB 1LMIA 3PJLA 5E4IA 4AYMC 4DCQB 4Y4HC 3GM8A 4J8RB 2I9LA 3MLZH 3MRDA 1EFXB 1D5BB 1NFDE 1XGPA 2Z91B 4L37A 3CU1A 3JTTB 1G7PA 3FO0H 3ULUD 3KBPA 2EDOA 1PKQA 1DVTA 4POZC 4AY0A 3QDGD 4U1NA 2EVGA 3B7TA 2PW2B 3MLWH 1VEMA 2AGJH 2FSEA 4KXCA 4Y1AB 3VA2C 1P5VB 4E9SA 1PZUB 1K85A 2GJ6E 3Q9PA 2EEFA 2FLMA 1MCIA 1BZ7A 1FFPB 1TUPA 3L3KB 3NN8A 4A2EA 4ZAKA 3E8UH 3CHOA 1YNKL 5FW7A 4X9GA 4OM0L 4KK5D 1UC6A 1FNEA 2V6HA 3BVDB 4OLXL 3WLWC 5IHBA 2XVKA 3DPDA 3RJDA 1YQ2A 4HLZG 3V2AR 3RY6C 4UU9B 5JO5B 1JZ2A 1PD1A 4FADA 4N86A 2IVFC 2OM5A 3QDMD 3K1KC 4P46D 4IJ3B 4OUUA 2YEQA 4BELD 3N40P 1N8ZB 1EAJA 1A6WL 3BP6A 3OB0K 1MQ8A 3C8DA 3HC3L 2R1YA 2G5BA 3MJ7A 3ARDA 4MB4A 1A1MA 2ITCA 3VDBA 5DHYA 1E4JA 5DS2A 3EUUA 4EE2A 2DQHH 3D2TA 5E23A 4A04A 4GBXA 1NICA 4LRNL 4KKAC 2X4QA 1I3GH 4PWFA 3V4VA 4HKZA 3E9TA 3NSDA 4DVBA 2J6EL 4K7PX 3QWNA 4TOYH 1FLRL 1USZA 2WNXA 5IVNA 3HR5A 4ZMOA 5E00B 5I9QC 2QSCL 4E2OA 3PYCA 3L4CA 4HHAB 4MDJB 4YBQD 4OQTA 1U4EA 1HHKB 3HG1D 5D2NB 2E7LA 4LP8A 4CSZA 2NZ9C 1S7UB 4MZ3A 1MLCA 3QR2A 2NUTB 2QQKL 5LUMA 2HMIC 2YQ3A 3I9IA 5ITBL 12E8L 1RLBA 3RYMA 3FT2A 1K8IA 4YL4A 1WTLA 1OL0A 1KPVA 1K3ZA 1J5HA 3CPLA 5EORH 3RZWA 1A3LH 3VXSB 4H13C 4WI8A 2D3JA 4Y88A 5CGYC 3K91A 5I5JA 1HHIA 3CUPA 4OF3A 4ERSH 4JO4L 4A68A 5DK2A 3U30C 1QSFD 4V2CB 2APXA 3WFHA 5EN3A 3UH8A 1FL5A 4OU3A 4EOWL 1AI1H 4KZDH 3GB7A 1KCUH 5HHXH 5ISZD 1RIHH 3WE1A 4FQ2L 1ZVSA 4AT6A 4C8XA 1BVNT 2L7JA 3K5RA 4S11A 3Q8EA 4HJIA 4WHDA 4XR8C 1LDPH 1SUJA 2MOVA 4PY7A 1IM3B 4DKEH 1HHGA 3R18A 3PWJA 1U2YA 4YDIL 2PYEE 4L1LA 3RGVD 3V5HB 3QJQB 1ACYH 4CADA 2ZWYA 1EAPB 2X3BA 1HESA 5CEXA 3ZL2A 3GXUB 3R0NA 5DJZB 5JHBA 5JPMA 2O1AA 3EGDB 3ZIYA 5IT2H 5B7MA 5F6IB 4M6NL 3AU0A 3N1GC 5JIPA 1HOEA 1SXZA 1GL4B 4XCCH 3T2LA 3GO1H 1GJUA 3OJ2C 1T22B 4MA3A 1PTZA 3BP4B 4Y4FA 3S36L 4PD4K 3QHFH 1OSPH 5E1GA 1CZ8H 1OWRM 1A21A 1BQLL 1QATA 3TTYA 1X6LA 1TJHH 5B38G 2FECL 5ENWA 2NYKA 3QRBA 4QWWD 2XBZA 2K8QA 3VWKD 4EN3C 4KK9C 1JXJA 2XPGB 4Z7NF 1X4YA 4XI5C 3SBWA 3RKDD 2EXSA 5ITFA 1UB6A 3CVHB 2CLVA 2EO1A 3D34A 1E4WH 5JNYA 3VFNB 2X4NB 2WB1A 5BV7B 1ZVHA 2M8XA 3PUCA 2XV3A 4NENA 5CEYB 1CO1A 4KY1L 4FTVD 4YSTA 4QXUL 1IKNA 3QEUA 1OAQL 5HDBF 1QO3B 4DTGL 2PO6A 3TCXA 1AHMA 1N2RA 1NKOA 5F72S 1R17A 2CLZB 2EDNA 1QHPA 4OGQC 3BAEL 5SWZA 4WWNA 2CUAA 1IAIH 2PUQT 4F7TB 1A6UH 4BH8A 4LSPH 2NXZB 5B3NA 3SJVD 1GAFL 1IKFL 2NX5E 2EE6A 4PLJD 1ROWA 3Q13A 2R1WA 1NGWB 5KBLA 4YSQA 1JNLL 4Y0GA 5C6TL 3OXRB 2DQFA 4M62L 2YD0A 4ZTPL 3O4LE 4LLVA 3QWQB 3BQUB 4Q9QL 4PVNA 4YDKL 1EHAA 4ZFFB 2FO8A 3QI9A 4XNQB 3MXWL 1UWEL 4KK9D 2F8OA 4QRRB 4A67A 2ALAA 1C12B 3QJSB 5C0RL 1YJDH 5D7LE 2NTFA 2VJXA 3O2DL 3ZN6A 1K4CA 4L3EA 1A6WH 4LLWB 5BRZA 4E9YA 4HFWB 2IBZY 1J0KA 3V6OC 2F5BH 2J4WH 4NT6A 4IBSA 2ZG2A 4I18A 4OGXH 3MREB 5G2NA 4OM1L 3EFOB 4K3GA 3M88A 4ORGB 3GUTB 2ICCA 1FNLA 4OZIE 2Y7NA 4LOFA 1MCQA 2VZUA 1O7DC 2VM3A 3EH1A 1BREA 4ONHA 4TVPL 4X5LA 5E94A 2V9UA 2VAAA 1NIFA 1F2XK 4GINA 4ENEC 2OQJA 3ATFA 2CD0A 4NKMB 2XN1A 5HDQL 1RUQH 4XPTH 4HAFA 5KBKA 3Q05A 1W9XA 1C8QA 1FRGL 3UCRA 1MJ7H 1OCCB 4NPYA 5EG6C 1A7RL 2B59A 5BO1L 3NUKA 1SLXA 3ESUF 5I8OL 3VFRA 2J55A 2O6FA 5DC4B 1NZRA 1RZPA 1DQTA 3HG1B 5EHFA 3MLWL 4FQQB 4IHOB 4NP4H 3NZ8A 3QCTH 5D2LA 4HF5L 1TF4A 2EYSA 3W2DH 4YQXH 2Z9TA 5E6UB 3EIFA 4Q6IA 3MLZL 4OZGE 5EO9A 1R6VA 4TSAH 5JPNA 1FPTH 2Z93A 4YBQC 4ALAH 1DLFH 4ZS6D 2Y07L 3R4RA 3OMZA 4KY1H 1TMQA 4GI8A 3I2CH 1TZHA 4Q4EA 2IAMA 5GGRB 3QAZC 4X80L 5D1ZD 3W38A 3QORB 4JKMA 1GJWA 1IQDA 1M2OA 3EBAA 4OCWL 3BFQG 5DHEA 3ZBMA 4O4YH 4A7VA 4POYA 3KW8A 4EZLA 5L8JB 3CZNA 1TQSA 5B39A 4OF8A 3S2AA 4FFWD 4NO2A 5DXWA 1P4BH 2BK8A 1P5UA 3BMVA 3ZO0A 5KSUB 3CGTA 1J9RA 1MF2L 5B8CA 3KXFB 4RFEB 1CR9L 2FT7A 4J7RA 1UD8A 4J3OD 4PJCA 4LL1A 1U91A 4PWKA 3Q1SH 1MWAA 2LTQC 4JLRA 1GOHA 1PLCA 2A4ZA 4M6NH 1MCPL 1R5VB 2UVFA 4RMRA 5I16A 5EBLA 1NC2A 5B38B 4QXTA 1A1NB 4YR6A 1A2YB 2V37A 2YGQA 1BYOA 4HAKA 4F92B 3EOTL 1A1OA 3AS2A 2R2EA 2BOBB 2Q7YB 5FK9A 4MNGE 4PJIE 3ZE2F 5KSVA 3DARA 1DLHB 1RIHL 1NBYA 3LIZH 2JKSA 3O8XB 2ERJB 4QHUA 3W39A 3LKPA 1U8OB 4BV1A 3NAAL 3TBTA 4UOW0 3O4LD 3QZNA 5A2FA 1L9OA 1JXFA 3KYKL 4BBWA 4N8VA 1FVCA 2F19H 5KANI 1IM9A 1LK2B 2CLRA 5LLIC 5PCYA 5DCCA 4D9RD 4OFVA 1INEH 5A6MA 1JVKA 4GT7A 5IBUB 5LBSL 4BUQA 2HKFL 3C09C 4FFWC 1J86A 1AMXA 4TV3A 3NQKA 4KGJA 4DZBB 4X7DC 1RD6A 4WI5A 1T1YA 4MQXD 5CJQL 3L3DA 3K72B 1PCSA 5B1KA 3AACA 3SOBL 4OZ4A 3AMKA 1JF5A 2E6JA 5ITBH 2WXQA 3C6EA 3VFVB 2QQKH 1S9VB 1KB5B 2ZONA 1UA6L 3MNWA 5HYJA 2K6WA 1CL7H 5C3IA 1OT1A 2XV0A 5EO0A 4PJAB 4PRPE 1GOGA 1KELH 4DN3L 3QUML 2ETWA 2AXGB 2BW5A 2IDQA 2YRZA 2EJ1A 2O93L 3DURA 4EIBA 3NACL 5F6HJ 2WQWA 4HEPG 2B08A 3HLAB 1M7XA 3CWGA 4YHML 2DQHL 2QDWA 4L4TB 4QOKD 5JZ7C 1P1VA 2XWEA 1SHMA 5DJ6B 2VL5A 2Z92B 4UTCA 1U8IA 3CN1A 3IU4H 4XN5A 3V0VB 1FC2D 3ETTA 3MRGB 1MHEA 4R97B 3HC3H 4UCFA 3GLEA 2ATPB 4X7FC 2Q87A 2FUQA 5LN4A 2ZXCA 3PGFH 5GISL 5FUCC 4YEFA 3MLSL 3NIFF 1GKOA 1XGQB 4P5TA 2E7MA 2HFGH 4ZDHB 1WA2X 1YC7A 5KSAB 4EEEA 2DQDL 4NC1C 2XI9A 5G4NA 2Q3ZA 1SYVB 3LRKA 4RDQG 3DXAA 3HNSL 4I13B 4DP8X 2X44D 2YEZA 3FSAA 1IEAB 2L4OA 3D39E 4LEBA 2DEXX 4N0CC 4P2QD 2JK5B 3P0VL 5HHOA 4UAHA 1UD3A 1MWAH 2BP3A 1BW8A 1C5DB 4H20H 1X5GA 1V5JA 2W95A 5GZOD 4Y2OA 2UX7A 4N2LA 4NQXB 1FIGL 4KRPC 3W0WD 4OGYH 5ANME 4PS4H 4IRJA 3OBAA 5ADPL 2IANE 1HEJC 3QUGA 5T1MB 2I7OA 4XO8A 1FBIL 3QH3A 2CUMA 3MJ8B 2NY6B 4M8QA 2WXIA 4UANA 3S3SA 1I7TA 4XNUL 5AZEL 4BCXA 4F7EA 2X88A 4AH2B 4EDWL 5CD3B 4DP1X 3BKML 5BS0A 3P11H 4Y16C 3L1OL 4LSUL 2IQAA 3UZVB 4F24A 2VJ8A 4Z3IA 5BS0D 5D7KE 3QORD 1CD0A 4X6BA 4N5ED 4UQ9A 3DSFL 3L8QA 1E4XI 2RCSH 3HMXL 4HGKC 1NAMA 1ZAGA 4FLQA 5C2BH 3ZL4H 4P4RB 4Q9CA 4EIUA 2QT6A 1G7IA 5I0VA 3B2MA 1NCCL 1G6VK 2BIHA 3CZSA 4G70B 4L29B 4I2XB 2BC4B 1Q8MA 5JHDB 5I19H 1SOQA 1UT1A 4UT6L 1JK9B 2VW4A 4LEOB 1I8UA 3BT2H 4KKCC 3KXFD 2CJUL 2DLHA 3DX6A 1OGSA 2Y5QA 3VXME 5I66A 1AZVA 3VXQB 1BMZA 1I3RA 5DQDH 3UGEA 3VFPB 4L2LA 1FVDA 1KGIA 1Z7JA 5AD0A 1TZOA 4Y9EA 4XP1L 3S4SB 5HYQA 3FCSA 5IFHH 3MR9A 5HHMD 5C3TA 3TJPA 4FQ1H 4O58H 4DO4A 3BFWA 1MCOL 4WUUD 3QI9D 1C08B 4XWOC 3CMGA 3ZKNC 3V4UL 2OBGA 2BNUB 3TP4A 1BFVH 2ZKXA 1M9SA 3FAXA 4PREB 1ZPLA 1ZHBA 4UV4H 5IBTH 4YE0A 3TURA 1T2QH 5F88B 4A6YB 5IROD 3O45B 1TSHA 5E2JA 4C47A 3RPIA 3A67L 3WEOA 1MJJB 1WPCA 3HS9A 3DMMC 4PJDE 2GI7A 4FXTA 4FQHB 1EQWA 3N1MC 4PI2A 1VAHA 5JW3L 4LU5H 5DMGD 5AVQB 4OAWB 4NO3A 4EDXA 4Y4FC 3GUFA 1R75A 5H8DA 5C0BD 4XVUD 1NCAL 1NGZA 3CDZA 2DJSA 5AKRA 3SQRA 3BEVB 1XTMA 3P9WB 4G2AA 2C1PA 5J1SC 2W0FB 1QA9B 4GG8A 5TFSH 1XBDA 3FYEB 2OSLA 3IJ8A 3AREB 1BXVA 4QCIA 3IJYA 2ENYA 1Z6JT 1JPGA 3O3AB 4YAQA 4XO5A 4JRWA 1QLFB 3C5JA 4UTAA 3B8YA 5DT1L 5FGBA 1MVUB 4GMSH 2PO6C 4HUUA 4JM0A 1RK0A 5I18H 5IROC 4P5TC 1UT2A 1DO6A 1MPAH 3VSUA 3MJ9L 2EIKB 4QRUB 4RMWA 1I31A 5CN2A 1MFBH 3D69A 4LLMA 5GRVL 4CSSA 1KC5H 2W8CA 4GSXA 5KOMC 4CNIA 2L0DA 1IAOB 5LXGL 3VI4A 4Y1TA 3ZKMC 5L4JA 1TQCC 3IDMB 2IH3B 5ESQA 2HKAA 3FOLA 4M43L 1AKJA 3GD1C 2EDRA 3QUKA 1SVZA 4NGHH 3BDBA 3MJWA 1X5LA 3UBXA 4N2MA 5IMMB 1G94A 1R3KA 1RU9H 2F58H 1THAA 3OXSB 1N64H 2VW7A 3ZLQC 1RURL 2XNAB 3DJ9A 4TUKH 4K2UH 3H42H 5FDWB 5C0ND 4MYWB 4IU2A 4MJ6B 4PJBB 4ZOBA 3QFDA 2F0CA 3P3UA 4WUKL 4XB7A 3V6OA 2V5RA 4GSUA 2E9JA 4W9CC 5TQ0L 3JV0A 3SO3C 4K3DL 2KPWA 2ZXWB 4YHIA 1XZWA 1DE4A 4LP4A 4Y16D 5GPRA 3V0WH 4AQ8C 4DKFH 5HY9A 3U4BL 3VD4A 3ZKQD 4UMSA 5FW8A 1KJ2H 2FCBA 1BQHA 3L5WA 1YAIA 1EXGA 1FNHA 4LNRA 4RESB 3HG3A 4WVRA 3ZQ9A 2OZ4A 1LO2H 2DMKA 2V8LA 3EO9L 4BH7B 3Q2VA 2I27N 3ZO9A 3NIGB 1YVLA 5JR1H 2R4SH 4EIZC 3CBKB 2FD6L 5EOCJ 3WFDH 1CTOA 5E03A 3T3MF 5DEFA 4F58L 4XOAA 4KK6D 3QFJD 5DRNA 5B39G 4ZQKB 1D7CA 4H0HB 4GKNB 1INDH 1IC7L 1VJSA 2J71A 4K9JA 5C0CE 4OJFH 2D7QA 4DP2X 3GMRA 4BK4A 4L23A 4NZDA 4K3DH 2EVJA 3CFNA 3MNDA 1SNRA 1THCA 3GJFB 4K15A 4NUJA 5SWQA 1RUAH 4ECNA 3ETSA 4ABUA 1A02N 2IQ9H 2WLNA 2A74C 5FFGA 2XTLA 1BYNA 3VG9C 4W6YB 5I1DA 3CFCH 2YD6A 2F54B 2NW3B 2WNGA 1S5HB 3ORJA 3WHXB 2EDEA 5C0FB 2ZX5A 4MWFB 3CCHB 2FEEL 2XXCB 3DMMA 4JFED 4AIZB 1JZ4A 4GRLC 1SJVA 2YMXH 1FG9C 2DQCH 3WXWL 4EXKA 5AB2A 1B4TA 1I1AC 5A3ID 1YJDC 1ASOA 3KVPA 4UQAA 5JHLA 2HKHH 1BHGA 3EYSL 1ZS2A 2Y22A 3PWNB 1DSFH 4HJJH 5I1KH 4N8VG 1EXUB 2X89A 5SV3A 3U0WH 5DQJA 3F7KA 1PY0A 5E8OB 5B22A 4WTZG 4DETA 5I1IL 1HCFX 4MFHA 3MA9H 1MPAL 1OT4A 2HJKA 1T0NA 2YSSB 2YKKA 3BAWA 2ZSVB 4MDRA 4N2NA 3TF7C 3POCA 3OZKA 4PRID 5GGTL 1CQYA 4FFVD 4RGND 5EF2A 4W9IC 1AIZA 3BWSA 4S0SD 4MQTB 1RZ8B 1AC0A 3QW9A 5BNXD 3K7UA 4L8CB 1NC4B 4JN2A 4ZD3L 1OTSD 2XJKA 1Y07A 3D52A 3GSUB 3QUHA 4HG4J 1U8QA 2EZ0D 3LKQA 2BWQA 4GAYB 2KUTA 4MGXA 5ESVA 1PNCA 1UA7A 1G1OA 5J3HC 1FV1B 1NLDL 3FTGB 3TIEA 5EDSA 2XU9A 3P77A 3NVQA 4TNVF 1ZHNB 1Z66A 2BHZA 2DYPD 2Y7SA 3D0AA 1KXVA 3TO4C 5I1IH 3CG8A 3GBMH 1YN7A 5HYIA 2ICES 4I4WB 4TQEH 5CP3A 4QRPB 4PGCA 4FS0A 3FQXB 1DVYA 1N4XL 3PIQA 5EPMB 5DZ9A 2X1WL 2WLHA 4P2OA 1TTCA 3EYSH 5B4MC 2BPBA 5KSAC 4TQ8A 4KRMB 1JN6B 1NCOA 3ARBB 3QDMA 4WFGE 3VWJC 1KZYA 2X2IA 3O6MH 1A9BA 3H1ZA 1MH5B 3OAUH 1OCOB 1BFVL 3ASWA 3G6AB 1HHHB 1CFQA 3HE7A 4HPOL 3BEWA 2AV7B 4U1IB 3EAKA 4Y4HA 1KIRA 2NNAA 5M95B 2DQIH 4KH9A 4M5YL 3MAWA 2AXFA 3QNYB 1WICA 5L2JB 2P5ED 3BPCA 3N42B 4IIQC 1J87A 5MP6L 3B7RL 4AQ8A 1QKZH 2WQXA 2ED7A 1NBQA 4JKKA 1PG7L 3TA3B 4KZEL 1JZGA 5ICUA 3SGDI 3Q06A 1B3JA 4GUPB 2VAJA 4R7DA 4XPGH 5LGJA 3IGKA 3RGVA 1JRHI 1GSKA 3QZMA 3S37L 1G7QB 1XFPA 1OTUD 1JDDA 4B96A 4OJFL 3HE6A 1QX1A 2B4CH 4O2FB 4S1SH 4C56D 3AG3B 3DOHA 5J6SA 1IE5A 5C0GB 2WLIA 2ESVE 3L45A 4ZS6C 2PWHA 5D1QC 4P46B 3RL2B 2MNJB 3N5AA 4GRMA 5AG9A 3FYIB 3QPKA 1TPXB 1NGYB 5E1AA 4RDBA 3C6LC 5FKAB 1ANUA 3HFMH 3KL0A 5HD8D 3KL5A 1U2HA 2GSIA 3HI1A 4Y4KB 3VFWA 2XY1A 3OZ9L 4NO0A 2FZ3A 4OZGB 3DRTA 3BW9A 2R1XA 1M42A 2A74A 3F83A 1L3WA 4YDZA 5EEUA 3GJEA 3NCFB 2Q6WA 3X14A 2JB5L 3CLEH 1T6BX 4GQPH 4LESA 4IDJL 3VXNB 4LK4A 1E9PA 4YFLI 3K8LA 1MFMA 3H9ZA 3Q3GB 2BZCA 2WN3A 2OMZA 3IKKA 4ADJA 3STZA 4Y16A 2BZ7A 3U9UA 2XQYA 3TBYA 1DBBH 1YYMH 4MD4B 2WLJA 3Q8CA 5I76A 3UBXI 3JWNH 1CGXA 1M53A 4KJYA 3U83A 3V8CA 5AAPA 2E7LC 4PJIB 4G6AD 3O3DB 3RGHA 3H85A 2ORBH 4LLYB 3T8XB 1MQKH 4X6DE 2AQTA 1URIA 2VDMH 4QEGA 3BVWA 3GSQB 3OC8A 3DUSA 4AJ0A 4U1JA 5FXCH 5KW9L 4M43H 4X6CA 1B3IA 1NCUA 2EVHA 2VRQA 4K3JL 3SKOB 4BDVB 5FM4A 1OP5K 3IDXH 4CGUB 3I02A 5F7DA 5DMKA 2ZCLL 2F1EA 4N0YH 4OF0A 4ZMVA 3UPCA 3U7YH 1I75A 3VM7A 5EV7A 1QLRA 4P48A 1SEQL 4J3OF 1F02I 4JQVA 4LQ1A 4W4OC 4WFFE 2HWZL 2EO9A 4HCRL 2HLFC 1AXSB 3UG3A 1F6AB 3OKDB 4KTDL 1WZAA 1IZKA 3C9NB 3GSNL 4OJEH 4GMSL 5LCVL 1N3NB 3NACH 3D51A 4DESA 2HAZA 1SN2A 4N2BA 4EIGB 2AXWA 2JXMA 4E9WA 2OSXA 2K70A 5D70L 3EF7A 4PV8A 2HLFD 3IM1A 2NR6A 1KB9K 2D03H 4FMVA 2MCG1 3T04D 1VERA 4AQ1C 1UATA 1MCRA 1W6LA 4GQRA 3HBZA 4D2NA 4L4VA 5LGYA 1Y18A 5JIQA 2PWEA 3SHSA 2KH2B 2VL4A 2XN9A 4OD3H 3KGUA 1FZKB 3FUIA 4Y5YB 1QFUL 1UOLA 3EDJA 1JERA 5JQIB 5K9OB 3SGKC 3L7EB 4ZUTB 1HQ4B 2XKNA 4LE8A 1Q9OB 3CX5K 3OR7A 3CLFL 5CBAA 4ZXBB 3X1GA 4ZW3A 3NBNA 4WI7A 1WF5A 3UYRL 1BVLA 2Z1PA 3MBEA 1CB4A 4PRHA 5BOZG 1QSEB 4M1DL 4XOCA 4NQEE 2VLME 3UL4A 4AKOA 1DBMH 4FF9A 3H8NA 1AO7E 1D5XB 2YFOA 1ETA1 4NKIH 5AALA 2QADC 1J5DA 4ZRGA 4HUVB 2XQYK 1T0MA 1HQRA 3WEXB 4ATTA 2W1NA 1U33A 2D2OA 4F27A 1OM9A 2CIIB 3HZKB 2PTTB 3GSRA 3HUJA 4L8SB 2YHGA 3RGVC 1BYPA 2HRPH 1IGFH 4WNQA 3O9WD 4DZ8A 3GXPA 1MCOH 5HJ3B 1T1ZA 1V54B 3ZQWA 4AL8L 1S4IA 3KLAA 3KPPB 4ZSOB 2E76C 4M6AA 2MCPH 4K9EL 5BVJA 1E8XA 4GLRH 3DO3A 3OSKA 1ZA6B 1D9KC 1WFNA 2Z0UA 3PV6B 2VXQL 3BH8A 3AXHA 3O2VL 4PBXA 4OQ1A 2OR9H 1X9QA 1KTKE 4WHYH 5HVHC 1SEBA 5EZIH 5D1QA 2APSA 5EUOF 3TA3D 3HIZA 1DN2A 1NAMH 2XYBA 4A2MA 1P9MA 2ZXDA 5FYJD 1IGIL 2JCCF 1N8OE 3ETBJ 3PHOA 1SXNA 3FFCA 2HVBA 4MX7A 2O5XL 5FCUH 4QTIL 3R06A 4G8GD 4IOFC 2DQUH 4K3EH 1HFUA 3WSQH 3D06A 4C56B 4Q8BA 5GJSL 1A66A 2RCSL 4PP2B 1XF5B 3P9LB 3U2SB 2NX5B 4MCMA 2FBOJ 2O26U 3GLZA 2BS8A 4XWGL 1OTUC 5DMIH 2MKWA 1M7IB 1PKQB 2OMNA 1QMUA 3P11L 2OMXB 1CFSA 5F9WC 3VXUA 1WUZA 2EE2A 3P3SA 4FG6D 4P3DA 3D2UB 1DBAL 4R9HA 1DLFL 3GSOB 5IVOA 4KO5A 1WJ3A 3U6XA 1TIUA 4K3EL 2CMRL 1H3VA 1CDIA 1JK8A 1PZ5B 3M17B 3QIBA 4AQEA 4DW2L 1Z1WA 3N3EA 3OL2A 1FYTE 1V10A 1F1DA 3G9AB 3VX0A 2CZNA 3VDAA 4Z7QF 3RWHB 2VLLB 4JZOA 5I8OH 1F41A 4L5FL 3BZ5A 4X99B 1AIFB 5AVXB 1NUNB 1ED3A 2YN5A 1BBJB 3AQDA 3PDOA 3AAZA 4HH8A 1R3LA 1RZIA 4LCVA 4WSJA 4OUUB 3AGVA 1F3DJ 3ZQXA 3BUBA 3KD4A 1M7UA 2DWSA 2R29L 1OB1B 4HEPA 4GUQA 1F11B 2NXYD 5F6IC 3BP6B 2SEBB 3JZYA 1JZJA 2HRPL 3VCLA 1BVKB 2G5BB 2FE0A 2EUZA 5A1AA 4JAMB 4YHOH 5T5FA 2CKBB 4OM1H 1CTMA 3ZTNL 4PJXF 1B4RA 1TVDA 4ZXBC 4BE5A 1J0YA 2J4WL 1K4DA 3PGFL 3QQNA 2ZQKA 4DVBB 3BWUF 3QYCA 1LQBC 3U48A 1NH6A 4X8CA 1OTTC 3HW7A 4G8EB 4ODVH 3UYRH 1HN1A 5C0RH 4PU2A 2NT0A 1RZFH 4BZ2A 1KTLA 4WK0B 1IBGH 4H0GA 4ZNEA 1CLZL 3I75A 3A47A 1MLCB 1U9KA 3SPGA 4U1MA 2K6YA 1N9PA 4MA7H 3SIKA 1LE5B 2NCMA 1N12A 5EBWA 4KHXL 4OZHB 4PRAA 2MEJB 3LB6D 4TNVK 3WFZA 1KELL 1OD9A 4DN3H 1NSNL 4IOSD 4Q58C 1KPVB 2OCCB 1PS3A 5L2KE 2VDKB 3P4MA 3RWIB 4NIKB 2V4LA 4G7QB 3MBEC 3VXSA 1SLUA 3D09A 2BO0A 4ZFOA 4L4VE 3PUUA 3O6FD 3L2LA 3H6AA 3O2WL 3MRNA 4IBYA 2JCWA 4XC3L 2R4RL 2IGFH 2MKLC 1FL5B 2HWZH 3H0TA 1E5CA 4L0YA 2XZZA 3CDYA 5IMOA 4L1HA 2A6DB 2VMCA 3GMQB 4XTRD 3NEOA 1E42A 3FCGA 4FQJL 5F1OB 2PYEB 2ZCLH 1U8PB 4J1UB 3BJ91 4NRXA 3UX9B 1QW8A 5FW6A 1FFQA 3RL1A 5IQ9A 2Y25A 3PWJB 4JHWH 4U1GC 1CDUA 1AQMA 3PWUB 1Q90A 3ZK0A 1EO8L 5D1QE 1S8DA 2XIBA 4BFIB 1OZTG 1SF3A 4R3SA 4ZNCD 4Y2NA 4HKJB 3C8HA 3DIFB 3AT9A 1E6JH 4X7TB 1H3PL 4FERA 4B3EA 1OLLA 2APVA 4M5SA 3TJEH 1KXVC 3TO4A 1T22A 1TEGA 1M56B 2R15A 4Z7VB 2FYVA 5D7JD 5FYKD 5KTEH 3HUJE 4HLZH 2QPUA 5MI0C 1MCPH 3K46A 5KSBA 4S0TD 3Q1SL 2CIKB 2P7TA 2HFTA 4IYKA 3E7JA 4WCYL 1CR9H 3IDGB 4OSUH 3VVVA 2H5UA 4WI6A 1LDPL 2CLVB 1JNNH 2O6PA 1YA5A 2X9XA 3PGDB 4TYUA 4X5RA 3ZU8A 3O41B 4E41E 5I1LA 2ZG3A 5D71L 2G4EA 5IWLC 2MOGA 2PPAA 3NFSH 4ODSL 4F5CE 1YDPB 1IX2A 2GJRA 2LU5A 3G6JF 1EIBA 2YZ8A 3H7LA 3UAJC 4P23C 2Y3NA 1XB8A 3QFJA 1LK3L 2YS4A 1F6LL 3SQBA 3T0EE 1ADWA 4XPHL 1VADB 3SKJL 4WI9A 4F7TA 3EJTA 3C87A 2Y5TB 4BK5A 3MRPB 3FQUA 3BWUC 2AJ3B 2RFXB 5TF1H 1I1RA 1UZ8B 3R1GH 5EUOA 2YPLE 3GC3A 1NGWA 4K7PL 2DQUL 2FX8L 2E4TA 4ANXA 2B4CL 2HN7A 1WP6A 3R8QA 5DEZA 4NOBA 1B2WH 4POUB 4RAVB 1Z9MA 3ABMB 4WNJA 3S37H 5EOTB 4YUEH 3UO1H 4N9GB 1F86A 5CBEA 2W81C 1ORQA 4GAJL 4C56E 3QUMA 4ELMB 3O2VH 3RVTD 1AXTH 3JBG7 2NTFB 1QKZL 2G2RA 1A6AB 3MLXH 4BQCA 5H94B 3JYBA 4C4KO 2UXVA 2Y6SD 5GSVB 2CGYA 3S36X 2XCMC 3OB8A 1X9RA 5GSRB 1J8HD 3DX8B 4WDIA 2D2CC 2NXYB 3D0LB 2A6IA 1FNFA 5LAXB 1F4WL 4ETQB 1CUOA 5I1GL 5IFJA 3LXCA 5ALBL 3T65B 5GS0C 1KACB 1KIUB 1KBPA 1R33A 5C7XL 2D4FA 4X8GA 4NN5C 5E94B 2PWFA 4PJ5E 1NDGB 5J12C 4R90H 2EE3A 4B5ZA 2OTUB 4M1DH 4FA6A 4HIXH 3W0WA 1AQ8A 3WU1A 3IVKA 4HCFA 2NYYC 1SFHA 2OAAA 4CKVX 1KCKA 1BOYA 5B1AB 5HI3C 5LHDA 2LAGB 4J3TA 3ZDXB 5DZAA 1RVFH 1CD8A 5HVHB 4GSQA 3SO5A 1NMBH 3MROB 4TNWK 4HWBH 4JEGB 2XG5B 5AVUB 5F8RC 2EINB 1CFTB 4JO2L 3KCPB 2V7HB 2UUDK 5DI8A 5DEJA 3WCYA 4CC4C 4AGNA 3HS0C 5HHPA 1BD2B 4XVSH 4NQQA 4A37A 1LEIA 3WV0A 5HXMA 5JW4M 3MV7A 2ATKA 4XBPA 4JG1L 4WUUB 4F8LA 3IDUA 1NAKL 4DK5A 5HJGA 2PNDA 4FRWA 3TESA 5K33A 2ADFH 4F8OA 3MCLL 2V33A 4XVJL 2IWFA 4JO3L 1BP3B 3NSCA 4FE9A 5AKTA 4HULB 2AERT 1VACA 3X11B 1SEQH 4LDLB 4OGAD 4LKCA 2OX5A 1XCQB 3F64A 1R34A 3BT0A 4KH2A 4W70A 4W9GC 4N0YL 5KSUA 3KM1A 5E2UL 4PJAE 4PRPB 3GTVA 5GRJH 5F1IA 2MQCA 3MMEB 3ZHLA 3EG9A 3EJSA 5CZVH 4FXKB 4LHUB 3H9SD 4ZG1A 4R5VA 4KKCD 1CZ8L 5ICYB 1MCWW 3CZLA 1A1NA 1NM4A 1J10A 1DZBA 3BXNB 4U0RB 1EPFA 1FH2A 1NCWH 4N2CA 1G5AA 3GO1L 4BINA 3F65A 4UQ3A 4EBQH 5IVZB 5K39A 3S6CA 3EYFB 1FH5H 5F8QC 3F6JA 1T6WA 4NHUA 1BJ1J 5C92A 1OO2A 5IB4A 1NGQL 2CWRA 1OT2A 4MMYA 1YEIH 3OMIB 5CHNA 2X41A 3JYCA 4DH2A 4OJDH 3A24A 4BFKA 4ZMPA 4PG2C 3W1ZA 1EZLA 2X1OA 1Y6MR 4N2IA 1UZ6E 1PEWA 2YAQA 4XCNA 3VJ6B 4IMKC 5DZNA 2BS9A 3DMMD 4JFEA 5DYOA 5AW5B 3G7TA 4MNGB 4HHWA 7FABH 1MFCL 5DLML 4M93C 4QKTA 2YBGA 1D2PA 2JSFA 2BSCA 4UOJA 1TVHB 4M56A 3X3GL 3LDBC 4XOBA 3BZDA 2LAAA 1QR4A 2FX9L 2GTZB 5CEZD 2BIPA 4TVSa 5HYJB 2VLRE 4AWJC 1ZA3B 5ID0A 2GIYA 5E4AA 1I4FB 4AVHA 4PJHA 5IKCB 4PJAA 1KNOB 3ZDZB 2PCFA 2KZ1B 1OY3B 2AXGA 4U3CA 3RKPA 3UBHA 3CX2A 1IUZA 4KTEH 1PL3A 3T0XA 4AXWA 3MRLB 4UNUA 1NWPA 3NIDF 1QFPA 3LZQA 4LMQI 1Z3RA 3H42L 4BKTC 2Q8BL 3KWWA 4NQSA 2WC7A 1J18A 3EYVA 1WEJH 1K2DB 3I50H 4F9LA 3MRGA 1SFDA 1X5KA 3QJXA 4M3KB 1H6TA 1MW0A 2TSAA 3WS3A 4R7NA 4XAKE 1A6PA 4K5PA 4NAMA 4RWYL 1YO4A 2WJ7A 4YGAB 3WO3B 3QIBC 4LARL 1FA4A 2FGWH 2QZ5A 2UY7B 4HC1H 3O6LL 4YFLF 2VDQB 3NCMA 2KZBA 2WTRA 1ETB1 4MA8H 4Z5RA 1N0LA 2BERA 1N5AB 2P24B 4FFYH 2W0LA 3UAJD 1AHWA 1IJ9A 4P5RA 4YFDB 1S7WB 2ITDA 2YEZB 5A16A 4MMXA 2AFNA 1GYAA 4UQ2B 3MV7D 3T6WA 2JK5A 4JPWH 4V1DD 4X7CC 4DUWA 4ZX4A 5IV2A 3HS0A 3CFKB 4KI5D 2YXVA 1LWJA 1WISA 3L1GA 4LCWA 2NT1A 5GS3A 4XP9H 1O5DT 4OLXH 2KPNA 1CXIA 3HMWH 3PGCB 4OIBA 1Q0YL 3U25A 4WI0A 4JRYD 1ULVA 4X5WB 3UYOD 3MUGA 2O4EA 2XFXA 1PY4A 2WLLA 3NIDE 3P1VA 3RLSA 3ZDYE 1OZUA 4CUCA 1MRDL 5BCAA 2VLJA 3T0AA 4FZEL 4D0CB 4L8SC 5TQ2H 1D2OA 1H15B 1Y1DA 4F7EB 2AGJL 4BUGA 5DQ9A 2LR4A 2HVKB 3LN5A 2DH3A 3JWNE 4KI5C 4R2GD 1UXWB 3VH8B 4AV4A 4GG6A 5D93C 5KOVC 3GS7A 2X4TB 3L6FA 1L3NA 1QYGH 3KLQA 4PJXB 3T3MB 4E9TA 1TXKA 4NM4L 4OIIL 4NNYB 2E8ZA 3FUJA 3L3HA 1HWHB 3RNQA 3CXFA 1MW1A 2OTPA 3RB5A 4MJHA 4W93A 4U3HA 3C6SA 3IGAA 4I2XA 4DPBX 3U46B 4Y2DB 1DN0B 5JZ7D 2FX7L 4J12A 2HH0L 5GJTL 2AJVH 4HHGA 1SN5A 1OGPA 4ZFQA 3ET9F 2W94A 6FABL 1WV7T 3Q2NA 1IB5A 1S3KL 1SJXA 5IBTL 1HS6A 3NPZB 1GYWA 1WSST 3RVXD 4OD1H 3BD4A 3C5XA 5PAZA 3L5XH 4FQ1L 2M1KA 1JNJA 2OZ4H 1J0ZA 1H3GA 5IFHL 1C08A 3ROOA 2EDWA 4G8GA 3ZDYF 4N2EA 4P2RB 1T89C 2BNUA 1O75A 3GSWA 5HGHA 3P0YL 4BKLB 1TJIH 3DIDA 2ZF9A 43C9A 1TZ8A 2CJUH 5F88A 3G5XB 4A6YA 1A6TB 4MQXC 5CCHE 3MBED 4ZJ9A 4QR7A 4MSWB 3RPIB 4PTUB 1OAKH 3WTWA 5TE7L 1RAMA 4YHKH 3WLBB 1WHOA 2UXFA 3MI6A 4Z7VF 1WTGT 4UBDC 5IHZB 1I1YB 1B0IA 5FOBA 4F33A 2OJ1A 2C26A 3QC5X 3ZRSA 2BXZA 3VGDA 4DWHA 2PMZA 4QRPD 3I9AA 4LPCA 5AQ0A 1DL7L 1QNZL 1MCFA 4E9QA 4EDXB 4N8UA 3KPLA 3PP4H 4GW4B 3BKCL 1T03L 1UENA 1XO8A 3L1OH 4LSUH 5GRWA 5D4JA 2OLDA 3SE3C 1KXHA 4MD0A 2RH0A 1YEKL 4XB8A 1MNUL 2WVSA 4NI3A 2QZQA 5EU7C 1NIAA 5IQMA 2VQ1B 1H3XA 4IRJD 1QA9A 2OMBA 3KBEA 5AVWB 1CGSL 2GKIA 2J2ZB 5KAQG 1GS8A 3AREA 3VWJA 2G2NA 4HKBA 2BNRD 1A65A 4F93B 5EFIB 1U95B 3KPQA 2I07A 2KC0A 1AG0A 3K6NA 4HOMA 4HJEA 4PRNA 5CINL 3M1OA 4M6OL 3F12A 2H1XA 5KN5B 2XZQH 3TS8A 4ALAC 3FONA 3O3EA 4NM8H 5D6DA 4IBWA 2IDCA 1RK0B 4BKSC 2ENPA 4J3OC 4XN2A 1NFDF 3TFKC 2UZXA 4E9XA 4TUKL 5FA3A 1YEJH 1KDJA 4QLWA 1D6VH 4LEEA 4XODA 1S3RA 4WI2A 1YC8A 4JPQA 1N64L 3P30L 4K94H 3MBXL 5E8NB 3JZ7A 5HGAA 5C0EA 1MREL 1R1CA 2XN9D 2Y7QA 4WKXA 3MLVL 3DLQR 3CFBA 1JHLH 4L1BA 5ESQB 2DQDH 3EO0B 7PAZA 2I7SA 2EH7H 2FHCA 4RZCB 3D33A 2XPZA 3D39D 4KKZA 3P4OA 3DXAE 2G3NA 1G9EA 4U6VH 4HWEH 5GISH 4F5CA 5DF0A 5LXGH 4ZMNA 1IGML 1P1ZB 4GG6E 3GZQA 1JUFA 2MWCA 1A3RH 3OXSA 1NCDL 4J27A 1KLFB 3O11A 5LWYH 2XNAA 2IJ0C 1EH9A 3P4NB 5L88H 5J1TC 1Z9SB 2ZX6A 4JFOB 3SE8L 2H32B 4FMFA 3HC4L 3KPOA 4AEEA 2IAMC 1JPFA 1DUZB 3BZFB 3EGXA 3GI9L 4X4XA 1KJ2B 1LO4H 5CMAB 4AIOA 5KEZA 5BMFH 4YZWA 2P4AB 1GA2A 3CVIL 4IKJA 1DFBL 2WUBL 4HFUL 3PQYE 3HPJA 2OJEB 4JL1A 5T1LD 2NLJA 2K9UA 2A73B 2BCKB 2QV4A 4N90E 4MD5B 2RHEA 3H9HA 2SODB 2BFGA 5F0JB 5EA0H 2O30A 2N7SA 3T0BA 4HUWA 4OFYA 4B6ZA 4Z8FL 3C8KA 4WO4C 1I82A 3ABLB 3C6LB 2D0FA 1YNLH 2Z8SA 3CFDA 2F68X 4YDVA 4EN3D 2VWEC 3DHJA 4ODXA 2J6WA 3MKGA 1MLBA 4HXBH 2WGNB 1VFOA 2YKLH 1Y7VA 2NY3C 1J05A 2R29A 3MACL 4IBUA 3FU7A 3WO4B 1XGZA 2E6PA 1R3IH 1YEKH 3ZDYB 4PJIF 3IPFA 1RZGB 3BD3A 3RX9A 5D1XD 2XV2A 2ZUSA 1ES0B 4APQC 2GK0B 4TUUA 2MCMA 1QNZH 3MUJA 4NUQA 4JY4B 1MW2A 2PCXA 3MV01 4MNHB 1IKOP 1G1YA 3HCVB 3NSYA 2ZCZA 1QP1A 2AF2A 5D2NC 2VO5A 3VXSE 5IEKA 4HUXB 2F54A 3OJMB 2XBDA 5L2KA 3SDDC 3H53A 4WEEA 3N1QC 5BJTA 2E9WA 1J11A 3EOTH 2VXVH 3I84A 5I73B 3Q01A 5E1IA 3BJLA 3DHMA 1C7TA 1DYZA 5IF0A 2X4RA 2F7OA 1JZ5A 3D8MA 1TJIL 3D50A 1SLVA 4LCIL 4UT9L 3WN6A 3ZE1E 4Y19D 2YFNA 3E1F1 3PABB 2VDRH 2IH8A 2VLRA 4FXLA 4P57B 1Q9WB 5C7ZA 1J5CA 2PETA 4LO9A 4UMGA 2EEBA 4AQ1A 4ACPA 4XPFH 3NFPB 2X2UA 1CICB 2F8XC 4ZUUB 2B15A 3V7AE 1DJHA 2DIBA 2NW2A 3EGSB 1NCCH 3CH1B 4BXVA 1M05A 3SDCB 4WWKA 3HZVA 3LS4L 4FFZA 4NYLB 3GXFA 5IIEB 4B9GA 4JFEE 3BVNA 4JFFE 4YC2C 1H3WM 2NY0B 2X2HA 4LIQH 4QWWC 4IU3B 3QS2A 4JHAL 2DAVA 4D8OA 2ZUQC 2DIEA 1P4LB 2YXMA 1UVQA 4HS6A 1OP3K 1BXXA 1DVFA 2YPVH 4S1QL 1X4ZA 3KWVA 4TSAL 1UJ3A 1FBIH 3EDDA 2C7UA 3FN0H 3GSUA 3U0PB 4HP5A 5F3BA 1YYCA 1ZS8A 2X4SB 5DJ2A 4F7CA 4IMKA 4NP4L 1FV1A 2EDFA 5FPIA 2F7IA 1GC1L 2MMXA 4S1DC 1B9KA 4RFNC 2VITA 2X0UA 3FT0A 3P0VH 2AJZB 4QI3A 1KIQA 1MN4A 2WSKA 1TU2B 2DLFH 4EXPX 1HOCB 4J3VA 1R9FA 2FLBT