3OKKB

Crystal structure of s25-39 in complex with kdo(2.4)kdo
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
217
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
total genus 43
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okkB01
1F4WH 4CL7A 2YRPA 2W0KA 3G5ZA 4KDVA 5F93C 2R1XA 2VXVL 3GBNH 3ROLA 1PYWB 4OI9A 1Q9WB 2EDBA 3NOIA 1U8MB 4LRIA 4QHLA 1A7RL 1XIWA 1RD6A 1XEDA 4NO2A 5ISZD 3AROA 4J4PD 5DLML 3KPLA 1LQSR 1IILE 3FJTA 3L9RA 4GRWF 5LJYH 5EO1B 4Z95L 4CN4A 1JHKL 4EZMA 2P8PA 1RV6X 4HX1B 5GGVY 4Z7VF 3K2MC 1V05A 4FQ1L 1JE6A 4HIIA 4RGND 1EFXD 5DQJB 4N0UE 4M8QB 4S1SL 2V7NA 4JE4B 3C60D 3MGOB 1A6VL 4PJGF 2V9RA 3ZDXE 4J3UA 4XMKL 4Y16B 5CGTA 1QRKA 1QLEH 4ENED 4NZTL 1M1SA 3IU3B 2WUCL 3BYTA 2VO5A 4ONFL 2EEBA 3WNMA 4XVSL 4JZOB 1NGPL 4GW4A 1JPSL 2DYPB 3IAQA 1FO0H 1CF8H 1UZ8B 1JWSB 1A2YA 4NUGH 1F58L 1YQ2A 1IQWH 1GC1L 1G0YR 2GSIA 4J3OC 4ONOA 4RMVA 5HDQL 5ABDE 4HCRL 3VMNA 4GRWH 1MFEL 4D9RD 4ZXBB 1IEBB 4GOSA 4HJGA 5DVOA 4UT9H 4LOUD 5I30H 5D8JL 3KPSE 5FGCE 4EN3D 1G6RH 3N85L 4ZPVA 1FGNH 3RIAF 3SO3B 3T0AA 4MGXA 3SDCD 5D7LD 4PBXA 4CAGA 5I19H 4YE4L 4J3XA 1ETZA 2OP4H 3QIBD 1B4RA 1K5NB 4KRLB 4L29B 1UEMA 1CGUA 2PYEA 4WDIB 4EOWH 4KZDH 4I8DA 3EJJX 3TIEB 2ZKHL 4UZGA 1FIEA 1HXMB 2G5RA 4YDVB 1A7PH 1HH6B 2EDYA 3K80A 5F7FA 2ARJQ 4HFUH 4M1GL 3DPBA 2DI7A 1A7OH 5KVGL 3RPKA 5IHBA 4UV4H 2AXJA 1NANI 5JO5B 4LLVA 4PP2A 1CD8A 4D0BB 1TJHL 1DEEA 1XAUA 4NHCH 2FNBA 1DEDA 3LEVH 1NGZA 2FD6L 1CL7H 3V5HB 5HI4C 2MCPL 1P53A 3RL2A 3RKDD 4JRYE 3U9UA 3DURB 1WUNT 4QTIH 1T21B 1D5BB 1FAIL 3NA9L 1EFQA 4LSVL 5A2LH 1VFMA 1B9ZA 4WY7H 3KPNA 1AGBB 1ZHLA 4TQEL 2D0GA 4WJ5A 5C08A 4BA8A 4FQLH 3BVNA 1UWGH 1N6UA 5DWUH 4JVUA 4HJJH 5IG7B 3LKSB 1RHHB 2X10A 1P7KA 2NR6D 4NQDD 3VA6A 1VKXA 2CGRL 4AIZB 2FO4B 3KYKH 1WIPA 4KV5E 1NFKA 1DE4A 4NDMB 3QUKA 1NCBL 3N1FC 2A38A 4WI5A 3QDJD 5FYLE 1UXWA 5MERB 5C7XL 4RGNC 2I9LB 5GRZA 4XPGL 3C60C 3LRGA 1Z0NA 2CMRL 5EUOE 5IB4B 5FO7B 1VEMA 5IB5B 3W82A 3WNNA 5L2KE 1FVDB 3U79A 1UQSB 4ENEC 1L7TH 4I9WE 5LBSH 1F6AB 1OGAD 3CGTA 3W9DB 3IDNB 5T3ZE 4JRXB 1ZT1A 3BZEA 4GRLD 1FNFA 4GMTH 3CVHB 4LCWE 2BX5A 1S5IH 4OFDA 2EDQA 1FL3A 3WEXB 1YEDA 1FNHA 1JGDA 1U8QB 4B5EA 1LP9A 4MLSA 2IANE 3S5LG 2AEIT 5FF6B 1FVCA 3CLFH 2GK2A 2IBGA 4K8RC 1DLFL 1EX0A 2C1PA 2CK0H 3SDAA 4QRRB 5C0FA 3ARGA 1YEFH 4LF3A 4L5FL 4WUUB 1Q0XH 4FG6C 4UINH 2EKSA 3PF2A 1K6QL 1KNOB 5EOQL 3TIDB 5J1SC 1A3LH 4RIRA 3RWHA 4LOUC 3VXUE 5A2JH 5FHAL 3V4PL 1CZ8H 1BLNA 4QXWA 3A6OA 4WHYH 4PJDB 5AWNL 1UB6B 1AR1C 2X1OA 1NAMA 2KKQA 4LQFL 5BVPH 5ERWB 2OLDA 3F7VA 1JGUH 4ZFFA 1TZHA 4ZUSB 4P5TD 4LSUL 2BNQE 4I0PC 4RAHA 4H1LH 1S7SB 4M6NL 1U8NB 4L9LC 2EDNA 2M1KA 3FQWB 5ANMA 1MCQA 3HG1A 4R26H 5B3JF 3FRPG 5DUBB 4DN3H 3MNWB 2R4SL 4LHQB 3L3IB 1JZ8A 4X5WB 2HN7A 3NABL 1ZK9A 3C87A 2WP3T 1NUGA 5EU6A 5GJTH 3BQUA 3D69B 1U8KA 2FIRT 1U8JA 3GJEB 3BFOA 4YR6A 3U9PH 2AEQH 3QFDA 2ZSVB 3MBED 3LN4B 3QCUL 4OBSA 4HPOL 3RKDC 4RMUA 3PWUB 4WO4A 4BSWA 3C8KB 5GSVA 3QUMH 4IOIB 5E08L 2C7UA 2G2RA 3MZTA 5SWZB 1K4CA 2L0DA 1BD2D 1MRCH 1E4XH 1FNSL 1ZEAL 4QHNA 2FIKA 4UT6H 1RIVH 4XP1L 2IWGA 3MOBH 2MKLC 2AQ1A 4M7LL 32C2A 4CMMB 1XGRA 4O2EB 4F37K 3ULVD 4P3DA 1BOGA 3C6LB 3QZWA 3BP5B 4OF6A 5CMAA 2V2WA 4XPHH 4JDVA 4PJFE 2X7LA 4WEUD 3IJSA 3QPXL 1RUPH 1YDPB 5ACMA 4GW1A 1JGEA 4FTVD 4PJ7F 3WFEH 5IB2B 5JR1L 5F9OL 3WE6B 1AQKH 4DW2L 4JFHD 3IKCA 2WIMA 2WLZA 4YHZL 5DJZB 3JTSB 1ULVA 5C0EB 1R0AL 3CFKB 4WHTB 3EYUL 4G3YL 3KPSA 2Z8VC 3BI9X 4TSCH 4U33A 2NNAA 3D18B 1X4ZA 3T4AB 3GIZL 5B4MC 5FKPA 3VXMD 4UQ2B 4AENA 2BJMH 4HZLB 4Z78B 3VGBA 4U2YA 4LSPL 4HIXH 3HUJB 4JKPL 3RTQD 4PS4L 3FRUB 5IMOB 5DJ6A 1QSFB 3ARFC 2PW1B 1KCKA 1H9VA 4O4YH 3KVQA 1B3JA 5HGBA 4WFHE 3G6JB 4X6DB 2AJUH 2YZ1A 4Y2DC 5EU7E 1CDJA 4IBLT 5CGYD 2BVPB 3K2UH 1T4KA 2UUDK 4AEHH 3D9AH 4NC0B 1EHAA 3C2SA 4GFTB 4K71B 3D1MC 1OAUL 1T03H 5DVMA 4LHUG 4PG2C 1N7MH 1WC7B 5I71B 1FFPA 1Z5LB 12E8H 2DTSA 3PWNA 5ICYB 4KMTH 4U1LB 5DJ8A 1OGTA 1JTTA 1YEEL 1ZT4A 2Z8WC 1H3VA 3GO1H 2VLRA 5IFJA 1GGUA 2Y07L 4XNMA 4F7TA 2NY4B 3O3BA 1H5BA 1L6ZA 1SYVB 3DLQR 1VDGA 4M93B 2J6EH 4R2GB 2KDGA 4M6AA 1ZVSB 3MRHB 4ODXA 2X70A 1E4XI 3BESR 3CMOL 2X4PA 1U8OB 4NFDA 1VFAB 3EO0A 4PRHA 4Y16C 1TQBC 3AS3A 3DUSB 4WI4A 1JK8A 3H7BA 4KQ4H 2H32B 3RY4A 3WIHA 2XKSA 4YFEA 5EOCJ 4YPGB 1U92A 4FQJH 1NCWL 3SDXA 2PXYD 3ULVF 1IAIH 1SJEB 5GSRB 3TVMA 3P9LA 4YHLH 1KB9K 1MRFH 4O2CA 1JI2A 4HQQH 4G9FB 4MXWL 1FN4A 5T5FH 3MV9D 5GGUA 4IMLA 5IB3A 3ULUL 2WINB 4QWWD 1V7ML 4PJ8A 4X4MA 3VGDA 2QSVA 3RDTD 2R4RL 3ZKNC 2IANA 5I1KL 3HE6B 3BN9D 2O5ZL 5DHVH 4ZXBC 1GOHA 2VDQL 2VXSH 4L9DA 2ED8A 3KLAB 4P2YA 1NLBL 5IVZA 1I4FA 2BVQB 3JSSA 4PBWD 3UTTE 1RFDL 4JCMA 1MJ8L 4XXCA 4ERSH 1AD9A 3SO3C 4OIIL 4PUBL 5AYUL 1OAKH 4JGMA 4Z76A 3AM8C 5EOCH 5T1LA 4P9HL 1MFAH 3WKNA 1WCBB 3AY4A 1QG3A 1CDHA 4OIAA 5DRNB 4A2MA 1U8PA 3JTTA 3PL6D 2BNRD 1MUJB 3ULVH 15C8H 2J8UE 2X44D 1AFVH 5L6YL 3S7GA 3DX8A 1UH2A 4BZYA 1JPTH 3RTQC 1S9VB 4MDIA 2YPLD 4FQCL 4R7NB 5CKAA 3HZVA 2R2EA 4RAVA 1I7ZB 3HCVA 2ORBL 4LLYB 4FFWD 1S7XA 2MQ0A 4DOHE 5DUMH 1WBZB 3H3KA 2YSSB 4PJXE 4GSDH 5I76B 4XCCH 5DO2D 2EYRB 5IW1B 1MQKL 4M6OH 1ZA3B 2DRUA 1ED3A 4WNQB 3VFNA 3QEUA 5HYQA 1G0XA 2B1AL 2YRZA 2CKBL 2AK4B 2E7HA 4GUPB 2FBOJ 3HMWH 3DXAB 5I1DA 3ZT5A 5JXAH 3FQNA 5BZDA 5GRJL 5E7BA 4MNQA 3Q48A 3D85A 1T2JA 1N59A 1R3KB 3OKEB 5BS0B 5F7YC 4NM4L 4MA8H 5IIEA 2NZ9D 3FQTB 3JZ7A 2W60B 2Q76B 2R2HA 4Z5RA 1LWRA 2DQJH 4RGNE 4PJCA 2VH5H 3HZMB 3AGVA 1QA9A 4DUXA 1ZLWK 1KTLB 2XV6B 4RRPA 4PJFA 1KLUB 4QOKD 4S0TD 1IAII 3G04B 6FABH 3U0WL 3LB6D 2R2BB 3VD5A 1RSFA 5D7IB 1NFDE 2MOVA 4OQ1A 1Z9MA 5E6ZA 3QEGL 1MFCL 4NWTL 3BGFC 3M17A 4JFDE 4NM8H 2RR3A 4OZIF 3C5ZD 4JY5L 1ZT7A 5D1XD 2FBJL 2PXYC 2PO6D 3D39A 2VB5A 1KLGB 2QHLA 1CLZL 2D7TH 2BY1A 3S3JA 3K46A 4OFYD 4LPWA 2DQCH 2WBJB 3SKJL 5HHOB 5KN5A 2D03L 4ISVA 1KXTB 4Z18A 3EYFB 5ESQB 1KULA 4QWWC 5C9JA 1F3JA 2IPKA 1WWAX 2XNAA 3BN9C 4NRXB 3L95A 2EYTA 4OUOA 4YXHL 4I0CC 2VKWA 2I9TB 1LHZA 2D7PA 1WTGT 1U8LA 2FECL 5TPWL 3MXVL 3G08A 5EU3A 3OR6B 5DZOA 4Y5VA 2EO1A 1V7NH 2ITDB 1INQA 5TQ0L 1J1XL 3TWCL 4GMSH 3CVHH 5CP7A 5BJTA 4YDIL 4L4TE 5DK0B 5ACZB 5D6CB 3L3GA 4RFEA 4QKXB 5C71A 3GMNB 3OKNB 5DMIL 5HYIA 2Z9TA 3PL6C 2VUYA 4PGZA 4QHKI 4C4KT 5I1CL 4CADA 2VDML 1MFNA 1A7RH 4U49A 1P7QA 1JV5A 1PDKA 1J05B 3MUGB 5D72H 1DQJA 4YUEL 3IF1A 1FZJA 3CXDL 5C07A 5DLMH 3PWPE 5FUCC 2GCYA 1R5IB 3VGGA 3ZSTA 1FO0A 3OKLB 4Z95H 5J11B 1MCWM 4XCFL 1ORQA 4FQ1H 2EYSA 1AKJB 3VXQA 4ZG1A 4S1SH 2X4OA 4X4XA 4U4BA 5TFSL 1A6VH 5DO2C 4XMKH 3LKNA 1WK0A 1S78C 4JY6A 4OGYL 4Z7VA 1SJVA 2EDOA 4NZTH 5KZCB 4UILH 4OZHB 5IW6A 4DCQA 3K4AA 2WUCH 3TNNA 5FECA 4ONFH 4JN2B 1NGPH 3WDIA 1YYML 3FO0L 1AGFA 4PJGA 3DBXA 4RMTA 1G6RA 4Q0XH 3T04D 1EHXA 1JPSH 3LKQB 3KPQB 3LS4L 2FYYB 4POZC 1YN7B 4NHUB 4H26B 1JHTA 2HJFA 2X4NB 4NQDE 5JTWA 3PHQA 3IFPB 3C6LC 1F58H 4U1MB 1Q72L 1GC1H 1T0PB 5HDQH 4JR9L 5K9KB 1CDCA 1QYGL 3DV4A 4HCRH 4PJ9B 3DHMA 3FMGL 4MWFA 3RVWD 3QDJE 3HA0A 1MFEH 3HNVH 1Q38A 3CDYA 3TO4D 4MD5A 4U7MA 1YY8B 2OYPA 3VI3F 3TA3D 5KSBE 3LB6C 3W39B 1EBPA 4FQQB 2W07A 3RBSA 2UZYB 3N85H 2IQAA 4HKBB 4D3CL 4LEXL 1NQBA 3MYJB 1OGAE 4ZD3L 2FJHA 5J1AB 3C5ZC 3GKWL 1ZHBA 4P3WA 4YE4H 1NEZB 2PO6C 4WGVB 3WUWG 5D6DC 4Q2ZB 4ZTOL 3D3VB 3MRIA 2WMPA 5C0AE 1UA6L 3ARVA 1FNEA 3O0RL 1BFOA 1FIGL 2ZKHH 1IM9D 4V1DB 1FDLL 5I73B 4HWBH 4M1GH 5KVGH 3UBXB 4OCNC 4WGWB 1RUQL 3V0VA 1HSAA 1UACH 4H25B 4B41A 3HI5L 2BNUA 4JJ5B 3LZFL 3P4NB 4AT6A 3I75A 2FD6H 3TM6A 1UWEL 2A1WL 2MCPH 4K71C 4JKMA 4QLRA 3OAUL 2XZQL 5I71C 5F9AC 5LKNA 3MLTB 4LSVH 1MHPL 3BOVA 2EDHA 2AK4D 4GKNB 2CIKA 2OQJA 3UJIL 1T5WB 3EFFB 4U0RB 3MO1A 5L0QB 3HZKB 1T1WB 2Q86A 5GS1A 4S2SA 1JGLL 3G5XB 4JFYA 4K3GA 3WBDA 4PJEF 1ZA6B 4YAQA 5BS0D 1OF2A 2NY4C 1CWVA 3ZKMD 3H0TA 3AB0B 2CGRH 4YWGL 5ISZA 3VD7A 3MR9A 1XR9B 4J4PA 5AD0B 4M93C 2HKHL 2N1KA 3HPLB 1NCBH 5AUMA 1KB5L 3DX6B 1I3VA 5C7XH 1KPVA 1QD0A 3P4MB 4XPGH 3EOYG 3LSOA 43C9B 2CMRH 2AXGB 3C60A 2YPVH 2E7LC 1HQRA 3O8XD 3LEXA 4LK4A 3OR7A 4XXDA 4P23B 2IALB 1BD2E 2DJ4A 1P6AB 3N50A 2VABB 4EI6A 3QR2A 3WLBA 2C26A 4ZUTA 3UYOD 2ARJB 2CLVB 4JQXA 3PUCA 3CFDA 4JVPA 4H1LA 1NCCL 3K1KC 1DLFH 1Q8MA 3NIFF 5I1LA 3AXLA 2BY2A 3RVWC 4L5FH 3FN0H 4FTVE 3MJ7B 3O11B 2OK0L 4G43B 4JAMA 1IFHL 4JFHE 5EOQH 2DTML 4N0CC 3WJLC 2K3TA 1IRAY 1WWWX 5FHAH 3V4PH 3VFVB 3U7WL 3QI9B 3T0BA 1U41A 4EN3A 2AV1A 5AWNH 4LQFH 2JELH 2P47B 3WO3B 1V3LA 2B5IC 5DVLA 1HHGA 2ZP0T 4LSUH 8FABB 4NT6B 4QGYA 3SDCA 5D7LA 5IEKA 4U1KB 4M6NH 1YNLL 3QUMA 2PKDA 3E6HB 3QIBA 5JW3L 1OPGH 4L9LA 3ZO0A 1EH9A 2F74B 4M1DL 4H88L 3NABH 4NN7B 1RY7B 1ACYL 3ARUA 4ZPTB 4Q9BA 2CDFA 3E1F1 3O6KL 4HXBL 4NN5C 4MAYB 1HEZB 2E9BA 3ULUD 2NY6D 1MCNA 5BW7C 4P4KD 2JIXB 4HPOH 1FL6B 2H9GA 2P5ED 2ENSA 2OTWA 2B20A 2QR0A 4OF7A 2EDLA 3B9EA 3V6FB 5E08H 1VFOA 1F4YL 3T0VA 5HPMB 5GZOD 4XWOC 4HKJA 1FNSH 1ZEAH 4IEFB 4HWEL 1KT2B 5E8OB 3T3ME 1KCUL 2KQNA 1XCQA 3MRMA 4NKMA 4XP1H 4S10A 1EZVX 2HJKA 1FPTL 4JDZA 3OGOE 1E4KC 4HWZA 4ODHL 4I3SL 4MQ7B 3WIFB 4M7LH 1BQHG 5CWSA 3I2CL 3CDGA 3M8OL 3NBNA 4QRSA 5I18L 5EBGA 4PJ9D 3PNWA 4NQDA 1I7UA 3FT2B 3QPXH 3T8XA 1S7VA 2LVEA 5JR1H 3QDJA 5F9OH 4DW2H 4NJ9H 2GT9B 4PRBB 2HTKC 4HS6B 5FGBC 2ZUQB 4WFFD 4YHZH 4O9HL 1R0AH 5JDJA 3O8XC 1FG2B 1FFRA 3EYUH 4G3YH 5E8NB 4YHKL 4JRXE 4JLRA 3S34L 4PJ7A 3VCLA 5F9JB 3GIZH 5HD8C 1OGAA 4F2MB 1PBYA 4GRLA 1INDL 1S9XB 1WBXB 4LKXB 1QOKA 4F9PC 5HVHB 4XI5C 4LSPH 2H6PB 4JKPH 3CFJA 4PS4H 1G7MB 2C3XA 4X6BB 3O6ML 4QRRE 3QDAA 4N8VG 3CPLB 1DTUA 4WUUE 3TBVA 3O4LB 2XYCA 3IFNH 2DQHH 5J9PB 4F8TA 2HWZL 3LQZA 4NKOB 4P4RA 1EEZA 2ICWB 2AVGA 2QSCL 1OAUH 3C2AL 4AH2A 3DROB 4PJDE 3QIUB 3FT3A 2QV2A 1TTFA 5HHVL 4JY4A 1YMMD 1N2RA 1KBGL 2O93L 3MRLB 1YEEH 3QULA 5SV4A 1JBJA 5ICXB 5ADPL 4JB9L 4P5TA 3L5WA 1EAPB 4CN6A 2Y07H 3OJDB 3D0VB 4GG6F 1CLOL 3T3PE 3P73A 5FUCE 5FGSA 3ULUF 1Q0YL 1FNAA 3H9HA 2CH8A 3C9NB 4XPFL 4U6HA 2AABL 3UYRL 5B8CA 1T5XA 5EH1A 1PJ9A 5D7KD 3KYNB 4NFBA 1C5DB 1JGVH 3EOAB 3CMOH 3VE0B 3VFTB 3RUGF 3QO0B 4P4KC 1B88A 1QFOA 5DMKA 2CDEA 2P5WB 3MBEA 5KG9A 3EO1B 1CFNB 3NCMA 1TVBA 3MCKA 3KG5A 4ODWA 4JPIB 3OXSB 3B6SB 5I2IA 5DHVA 5SWZE 1NBZB 1QEWA 4QTHB 4GLRH 2DLIA 1NCWH 4LAJH 5JQHC 5KSUB 1FCGA 1BD2A 2XN9B 3HS0A 1A6WL 3RA7L 1I9IH 4TSAL 3PWJB 1MCJA 4PGCB 2XRAL 3ESVF 4MXWH 3JV4A 3KPPA 3MRNA 4NNYA 2ZG1A 3UO1H 35C8L 3RVTC 3TZVD 2OR8A 4YIQA 2ADJA 3ULUH 2F8OA 1V7MH 1RPQA 1I8KB 4PJ9C 2CUHA 3F5WB 4G7YL 5EC2A 3TEUA 2OR9L 3L3OA 5HVGB 1F11A 4R3SB 1FP5A 3WUZA 4J2XA 5I1KH 4IRJB 4Z0XB 2XZZA 4LASL 3QRGL 4QOKE 1FCCA 1BJ8A 2O5ZH 3CZFA 1CXLA 1WBYA 4I2XB 2VDQH 1BREA 2QKIA 5TE4L 3SN6N 3CFBA 5CBAB 3QFJB 1OP3H 4FTVA 1NLBH 5A16B 4MA3A 4YHIB 4K23L 3D2UD 3L3DB 4K07A 1MJ8H 3VI3E 2HFEB 5C8JB 4PUBH 3HPJA 3IKKA 2BY0A 1NC2B 1QSEB 2BVUA 1DLHB 5AYUH 3UPRA 4P9HH 3VGHA 4ZOEA 3HNSL 3AM8A 3OMZA 1MLCB 2BCKA 4LLWA 4TUOB 5KANG 3IFLL 3VXMA 5F96L 3EJYC 3F12B 4EIGB 5L6YH 3HUJE 4LARL 3RWEB 3UTZB 4HDIA 4IS6B 5E6IA 2ICEA 1BZQK 1QSFE 5C0CB 3FT4B 2EXWD 3WXWL 3RTQA 3G6JE 4X6DE 4R96B 1HH6A 4RAUB 4HK0A 3V6ZA 2ORBH 3SE8L 4K7PX 2D3VA 5IBUB 5JPNA 4NN6B 4F9LC 3V5KB 4P5MA 2D31A 1MQKH 5D70L 5C0BD 2B1AH 1XGTA 3IDMB 1QP1A 4UDUA 4G9DA 3DO7A 3EYOB 1MJ7L 2CK2A 1HNFA 3VJ6B 2DMKA 4U0RC 4XX1E 5L0QC 5DJXA 5IBLD 4LL9A 5HDLA 3TC9A 2P8MB 4NM4H 4TVSa 3BDBA 3H9SB 1DR9A 3QZWG 5DVNA 2NX5B 2YEZA 2HAZA 5T1MA 3VRIB 1XR8B 2WQRA 5CFHA 3WFHA 4GLRI 4UTBL 1M05B 3QEQD 3U36A 5I74B 2WWMD 1ZLSH 4NQVB 2AJSL 1T3FB 1AR2A 3DYPA 4LGPB 2R29L 1J0HA 3U0WH 4N5EC 4IJ3B 3NFNA 3R06A 1GGBL 3QQ3B 1ES0A 3QEGH 4P23C 5JNYB 4NWTH 4PJ5B 1UKTA 4XMPL 4BQ6A 5I75B 3B2UD 4PGBA 3TH4T 3E8UL 1H8SA 5DD0L 3DUHA 5ETUB 4JY5H 2NTFB 4U1HA 1CLZH 4IRSB 3SDDD 5FIEA 2PXYA 1HCVA 4PRIB 3FN9A 3SKJH 3MOQA 1PGRB 3TO2A 1AD0B 4LDEB 1KIPB 1L7IL 2D03H 1A1NB 4UB0L 2HFFA 4OZIA 5DRZA 5TDPB 4MVBC 5HJ3A 1D5MB 3MV9A 3BRGC 1DQLL 4H8WL 4EIZC 2BVOA 1FSKC 5IWLC 3NIFE 1B0WA 1WAAE 3FB7B 3RDTA 4YXHH 5TDNA 5BOPA 5FCSH 5ITBL 5FK9B 2NY0B 5TPWH 3MXVH 5TQ0H 4E41D 1J1XH 3KLDA 1RJYB 3RWIA 1P1ZB 2ADIB 3MLSL 2H3NB 3U1SL 3V0WL 4UQ3B 1O5DT 4YDIH 3PGDA 4W4OA 2EE9A 4FFYL 3AC0A 4UI2A 5HTSA 5I8KL 1PFCA 4F15B 5I1CH 1XF2B 4X9BA 1S7QA 2HMID 2VDMH 1PZUB 1EO7A 1SQ2N 3PL6A 2BNRA 1CD1A 4L1DA 4NO0D 1L4IA 4QF1A 4YUEH 1CVSC 2EXWC 1SYSB 3CXDH 5DUBA 4NN7C 1KN4L 1S5HB 3GUTA 1UT9A 1A1OA 1UB5A 4XCFH 2YPLA 4YNYB 3FFCD 4MAYC 4MNGB 4LDLB 3U4EA 4JQIL 3EJZD 1O7SA 4HCRA 3IDGB 4HT1L 3RVVD 4QYOA 1KCVL 2ZWLT 2AK4E 3DXAE 3GFUA 3BAEL 4K3HA 1N64L 3MODL 1YYMH 2NY3B 3FO0H 4OFIA 3DMMD 2HRPL 4FXKA 1OHQA 2B1HL 5MI0B 3LS4H 3SY0B 4GQPH 2WAHA 5BS0E 1DBBL 4NQSA 5CZVL 3RVUD 5JOFA 3SOBL 1Q72H 4U7SA 4ETQA 2ZCKH 1KV3A 4JR9H 4O2EA 4PTUB 1TZIB 1QYGH 3THMH 5ACLA 1DP0A 4NSKB 5EN2B 1ZKAA 5C6WH 4KVCL 4URTB 5DK2A 1S9YB 5HYJB 4APQD 4MJID 4XP4L 4CU8A 1IKNA 4EDXB 4FXGA 4Z7WF 4M8VA 4DKEH 2HJLA 3ZTJG 2WWMC 1YDPA 2VLKD 1RUML 1O0VA 2AJVL 4NNPL 5IB1A 5D7IE 2FWOB 4QOKA 1AHWC 2LTQC 3DTXB 3DVIA 2ZUQC 3QDGB 4YXKL 4E42B 3GSNL 4K7FB 4LEXH 4UTAL 3PJSB 1TJIL 4UOW0 4DUWA 5E94A 3B2UC 3GKWH 3CFCL 4NQEB 2HRLA 1QR1B 3VGAB 3Q0HA 1R3IL 2VLMD 4GH7B 8CGTA 3C5ZA 4ZTOH 3D18A 5D1XA 5HHOE 2PO6A 4P48A 5D6DA 1UA6H 4R0LA 2VAJA 4OZFG 5HVHC 4OFYA 1KXVC 1IC5L 3TCXA 5C0CD 3WL9A 5JXEC 1PZ5A 1FDLH 2FECI 4MB3A 4HEME 4EUPB 3LKOB 4Y7MA 4R7DA 3BX7C 3FRUA 3GSXB 2GKIA 4L8DB 1BWWA 1RUQH 3X12B 3E2HC 4ZO9A 3OTTA 3HI5H 1DQQA 2RCSL 3LZFH 5EBLB 3VFRA 5CZXD 3QA3A 1JPST 3VXTB 5IMLA 1G7HA 4NYLA 4MJ6B 1UWEH 2EDJA 4BKLB 2A1WH 3BJ91 3C8DA 1GGCL 4WTWA 3DUUA 4JFOB 2UWEF 3B3IB 3OAUH 2XZQH 1MJJA 4LPTA 1MHPH 1MCSA 3KDMB 1X7QB 3NAAL 4P2CG 3VFMA 3BEWB 1PLGL 3KXFD 4L3ED 1DUYB 3BO8A 2VKXA 3ARPA 2HMIC 4JFEB 2DBLL 1JGLH 3ME0A 1TFHA 1BFSA 1KJ2L 2F15A 4PRPD 4YWGH 2HKFL 5ICZA 5JLZB 2HKHH 5DSCA 4QRPD 3QHFL 2Y25A 4YHOL 5INCB 1MHCB 3UYPA 5C0NC 1KB5H 1RURL 4PJEA 1UXSB 3EJZC 4UIMA 1MQ8A 1RZ8B 2YBRB 4JFQA 5D2NB 1CN4A 3DWTA 1EA9C 3RUGE 1VFAA 4DZ8A 1XF5B 2X4QB 2OL3B 4OZHE 1CDUA 2E7LA 4WW2B 3I6KA 1QSZA 2MQCA 3HKFA 4O51B 2FRGP 1CXIA 4LMQI 1IBGL 1AO7D 3TBSA 4KRNA 1RUAL 3DMMC 2JB6B 3W81A 4HUXA 5D4QA 1DBKH 2EC8A 3LS5L 4TVPL 2WW8A 4OZ4A 1HHJA 4L8CA 4ZUVA 3RVUC 3T0WA 3UTOA 3PV6A 3WD5L 2X1WL 1NCCH 3NCJL 1IJ9A 4Y4FB 3GMMB 4D8PB 2G5BA 1OSZA 1WZMA 2IMMA 1MEXL 2GFBA 4RZCA 5KAQG 2OK0H 4NIKB 1A21A 2YWYA 3CK0L 5I8OL 1IFHH 5EU4B 4JFZL 4JFPA 2DTMH 1E27B 4WFFE 3TO4A 1CT8B 5GRYA 4L4VB 3TA3A 5FCUL 3SCMD 3U7WH 1YUHA 2L7UA 2C5DC 4WWKD 4CMHB 2UVFA 3WHXB 5HGAA 5FXCH 2GIYA 1A7QL 2VDOH 4NOBA 1ADQL 2JJTA 4OV5B 3D3VE 2R39A 4LLQA 4F7MA 1FJ1B 1YNLH 4HKXA 1BP3B 5DFWH 3MA7B 1KJVA 4JFXA 1OAZL 3BP6A 1GSMA 3GBMH 4V1DE 2NW3A 5JW3H 4M1DH 1A6TA 4H88H 1YNKL 2K7QA 5E4IA 1IM9A 4C57C 1A1MA 3D25B 4NPYA 3O6KH 4HXBH 1G9NL 3DVGA 4X9IA 2Q3ZA 4TYUA 2VDLH 5F70A 2B2XL 2ZCLL 2BK8A 4OF8A 2VZVA 2YSSA 4R4BB 3VG9B 5F1IB 4KKAD 2IAMB 5M7QA 4JO2H 1F4YH 1W2KT 2XWTA 4GAJL 4J1UB 5HHPB 3KHOA 1F3RB 4OLXL 4HWEH 4ORGA 1KCUH 4L1HA 1FPTH 1FNGB 4MAUH 4LLUA 4I3SH 4ODHH 1M6OA 4HAFA 1I1CA 4S11A 5E8DL 1MH5B 5LGJB 4N0FA 5C0RL 4PJHB 3I2CH 3M8OH 3DSFL 5BS0A 3DX9A 3FQRB 3NPZB 1BZ7A 3HC4L 1N3NA 1NJ9B 5I74C 3F7YB 4KJPD 5AG9A 2EE2A 1FZOA 3ROOB 3IT8D 4I5BB 4IJ3C 4LCIL 1E4JA 3O8XA 4YHKH 5D7IA 1CDGA 1MWAB 3O3EA 3S34H 3PHOB 4X6CB 3U7YL 3MCLL 4NQED 3LRSA 1RIHL 4N0YL 5FM5M 1IGFH 1INDH 2A6KB 3AS1A 4NKDB 1I3GL 5ESAA 1YNTA 1G7JB 4F9PA 3O6MH 4F7PA 4OKVB 2XWBA 1FLTX 3ZE2E 1QKZL 1BIIB 2X1QA 4N5UA 5HY9B 1A47A 4PJIB 1MCEA 1C08B 2HWZH 1CFSB 4R8WL 4OUUA 3BW9B 4LHUD 2QSCH 3C2AH 2PYFA 1BVLA 2NY0C 2VIRB 4M7LT 2X4UA 5KS9F 1G1YA 1AE6L 5HHVH 4E5XB 3PGCB 1OP5K 1I85A 1MRDL 1NBYB 3BWUC 1KBGH 3PP4L 1NPUA 4Q9CA 1NFIB 1QUNA 4LDOB 5ADPH 4EBQL 4MJ2A 4JB9H 4JFFA 3CU7A 4XZUA 2AP2A 2HT2C 2FZ3B 1CLOH 1EV2E 1Q0YH 4NRYB 3T09A 1GZQA 4U0QB 3RGVB 3K74B 4X9HA 5D96B 3IYLW 4XPFH 3WLWC 2AABH 4LMQE 3UYRH 4KH2A 4GG6A 4F7CA 1C16A 2Z35B 3BSZL 3W11D 4P4KA 4HXAL 1W0VA 1PG7X 3BP4A 5C0BE 3MLRH 1EEYA 2XPGB 4LU5L 4KKAC 2P5EA 3C6SB 1FRGH 5KSVA 4IMKC 3RUGA 2OXHA 5EBMB 3H3PH 2MJWA 3S9DB 2NY3C 1B2WL 1IL1B 1A6WH 4OZGF 3RA7H 4Y5YB 4YDLC 4WHYG 5MI0C 2VZUA 4TSAH 2ERJB 4RA3A 4P0DA 1X5ZA 4MQXD 2XRAH 5IGXL 1F2XK 3R1GL 1B0GB 3ARED 4ZODA 35C8H 5J12C 3MFFA 4Y4KB 2X4NA 4MXQD 1S3KL 5DC0A 5EPMA 5JUEL 2BFVH 3KYAA 4PJ9A 1I1FB 1WWCA 1I9EA 3QRGH 5BXFA 1MSPA 3GSWA 2VAAA 1BQSA 5B39B 2AI0L 3CZJA 4U6XB 1Q1JL 2WZPD 5TE4H 4KJPC 3GHBL 3UTSD 1FYTD 2BP3A 4K23H 1X5HA 5IV2B 2AEWA 3ZL4L 2W91A 3I3EA 4KI5C 3HNSH 1QPXA 3VGAC 3BGMB 2JK5B 2DAVA 1NMAL 4Z0BL 3IFLH 4X7DC 4XP6H 1HIML 2C3VB 4QT5B 2EECA 1VFUA 4LARH 1RHFA 2ZOLA 1CK0L 3D5OF 1RIUL 2CKBA 1IGIL 2VLJB 3O2DL 3QDMD 5MEQB 4XT1C 1BZ9B 4LKCA 2AJXH 4Q74A 1X6LA 3LIZL 3REWA 1IQDA 1ZV5A 3GMPA 1GOFA 1M7XA 1AGCA 3WXWH 4AQ1B 3O4LE 3QUZD 4NO3B 1F97A 4IDLA 1BPVA 2MSPA 2OMBA 1CFBA 5FDYA 2N7BA 4H5SB 3TESA 3SE8H 3I3DA 1XH3B 2Q8BL 1UM6L 1SEBB 1XGPA 1EXUA 2OZ4L 1I1RA 1ZGLP 3E3QC 5BO1L 4X0KB 2X9WA 3IETA 5D70H 2EXYD 4CW1A 1ZHKA 5GGSY 3NIGF 4PGEB 2R0WL 3WS6C 1J11A 4MD4A 1VENA 1X3DA 2UYLB 1G84A 1M7IA 2HFTA 3R8QA 3FO9A 1MJ7H 2ATKA 1YMMA 3OKDB 1LGVA 1FVEA 2VOTA 2X1PA 4ONGL 4EUPH 2D4FA 3ZDYE 3T2PA 5C0GB 1DQDL 1QO3A 3HZKA 1U95B 1A64A 4HGWA 2W65B 2L7JA 4BUHA 2ESVB 4ZO6A 5CCKL 4K2UL 3CUPA 1V3MA 3SQBA 2GJ6D 2Y36L 3S36L 1RZ7H 4DUVA 4UTBH 2NY1D 1D6EB 5FKAA 2AJSH 2DS4A 4GAGL 1AXTL 1AI1L 5D2NC 4P46D 4DVBA 1B0RA 3W11C 2V7HA 2AXGA 2IH1A 4TULL 3FTGB 4XMPH 1J87A 1J8HD 3E8UH 5HHXL 5DD0H 3W0WB 1WT5A 3GMQA 2XN9E 4Z77B 2F5BL 3GSOA 5IW3A 4JZJB 3L3JB 1L7IH 4UB0H 3M45A 4LP5A 2NXYB 1U58B 3KPRB 3AREC 2LFGA 5C0IB 3L5XH 2AEPL 3O6FB 3VXOB 4CVUA 1QRND 1DQLH 2UV3A 3QQ4B 3TZVA 2R1WB 3TJEH 4XBEL 1KPUB 3RWFA 4P2QB 3ISWA 4P99A 4QXUL 4ZNEE 4I2XE 4PRAA 1E6JH 3KS0H 3QFJE 5IWLA 2OL3H 1QBML 1A6ZA 1RMFH 1GZPB 4NCC1 1AXSA 3U1SH 3V0WH 3D2UA 4PV8B 4CMHC 1IAOB 2BHYA 2ZNXA 2VQUA 4FFYH 1T0NA 2VLME 3L6FB 5I6XC 4ZFOB 5I8KH 2JB5L 2DQUL 5HYSA 1OAXL 4MA1B 1Q9OB 1M71A 5TDOB 3GGWB 5D2LF 3EOBA 5C0CE 1VGKA 2JJSA 4NQCB 4L8SB 4HUVA 4HC1L 3MRCA 3HRZB 4WFGD 2F74A 4TVPD 5HHQB 2CPCA 3RGVD 3BP7A 1MCDA 2WUBL 5J13B 2RFXA 4HGMA 5FM5O 3SO5A 1CQKA 2Y5TB 4OD1L 4JQIH 4P2OB 2ZSWA 4L3CA 4UOJA 4N8CH 1NH6A 2NTSP 5C09B 4XCEB 1XF4B 5JOPD 4G80A 4HT1H 5EOTA 1KCVH 2H45A 3PQYB 5M94B 3WHE1 5F1NA 3CSGA 3IDJB 5C0BA 3BAEH 1N64H 5DQDL 1HOCA 3MODH 3IAGC 1DDHA 1JN6B 2HRPH 4GRMA 2Z31B 4GW5A 1J0IA 1JIBA 2B1HH 1DBBH 2CIIB 1GVIA 2VSDA 3H9SE 3Q6GL 3VXRB 2H8PA 1X5XA 3IRZA 4KGLA 3LD8B 5IOPB 4KVCH 5C0JB 3IAPA 1U2CA 4XP4H 1EBAA 2FEDD 5CBEB 3W9EA 1C5CL 2NY1C 4U1IB 4XNZC 3RU8L 3FT2A 3QT2A 1RUMH 3TF7C 2AJVH 3QEQA 4NNPH 2OTUA 4P46C 1KELL 3CX5J 3E0GA 4YXKH 5DQ9B 1AHWA 3GSNH 4WV1B 3EYVA 4PJ5E 3SKNB 4UTAH 3DNKA 1TJIH 4Z7WA 3FOLB 3OWEA 1SY6L 4RQQB 4LPUA 3SGKC 5JW5A 1V8HA 5EFIB 3CFCH 1CU4L 2YKLL 1R3IH 1T1ZA 5FUZL 4PRIE 1JNNL 4DK3A 1RJZA 3IVKB 3GB7B 2Q8AL 2IH3A 3SDDA 5F3BA 1A0QL 1IC5H 3PWVA 1BM3L 3WN5C 2VQTA 4F3FB 5DURB 3V4VL 5F6IB 4CVZA 2P24B 3WFDL 1F45A 2RCSH 3CPLA 5FOBA 5JA9A 1ZGLB 4MX7B 1MCCA 1XGQA 4YFDB 4XH2A 3QISA 4KRPD 1GGCH 1IC7L 3GJFA 3NCBB 1KB5A 5ID1B 2GQHA 4E41A 1PVHA 2I26N 3AU1A 1MF2L 5E1AB 5IFAH 3VH8B 3NAAH 4KU1A 1PLGH 1SEQL 2VQ1A 4Q6IA 3MRPB 2UWEA 1MI5B 2A9ML 2DBLH 4YDJA 3G5YB 3OAZH 2Q6WA 2NYYC 1HQ4A 3WO4B 5E2JA 4NO0A 1KJ2H 1NBVL 4OGXL 2HYMA 3PG2A 4GQ9L 2D7MA 2HKFH 4PY8I 3RGVC 1VEPA 5KVEL 2IPUG 4MNGE 5SWSD 3MX0A 4YHOH 2JJUA 1RURH 2F54B 4R4ND 3MRDA 2FR4B 3FFCA 1W8NA 3MFGB 4JM2B 5ENWB 5F44A 2A83B 5J06A 5EO0A 3OKMA 3VFTA 3N1MC 4M1CD 3RGHA 3ZE1E 5E5UB 1IBGH 3B6SA 1RUAH 1T2QL 3LPFA 1FV1A 4WTZA 1H3PL 1SHMA 3OHXB 3U6RB 1P84K 2ITCB 3TFKD 1A4KB 3DMMA 3LS5H 1TPXB 2GITB 3CC5B 4TVPH 4KK9D 4Y5YC 3BUYA 5KTEH 3K4DA 1ZWIB 2ERJC 4JGJA 2W0FA 4KJYA 5DD5L 3WD5H 3KPRD 1I1AB 4ODUA 5IHUL 3NCJH 3T77B 1TVHB 2GAZA 1NAKL 4M7JL 5FYLL 1ZOXA 2X9XA 2FEDC 3FFDA 3KYMA 3ARDB 1JZ2A 3CK0H 3MRKA 5I8OH 4APQA 4MJIA 3CSYB 4JFZH 1YN6A 1Z3GL 1R3LA 3EHBC 1G9NC 3QDGE 1A4JA 2VLKA 3RIAK 4IOFD 2DWEA 1Z2KA 5JIIA 5FCUH 2WIIB 4OCRL 1KIRB 3BPCA 1NGXA 4KI5E 3GSRA 4M48L 1XCTA 4YZFE 5T3ZL 3WS3B 1CI5A 3VWKD 5FB8B 4NQEE 3N9GL 1ADQH 2XFXA 3WV0A 4BFIA 5IKCA 4BH8B 2HG5A 3FZUD 2I27N 1WEJL 3MV7B 3P0VL 1KSRA 1U8IA 2QSQA 1OAZH 5I15L 3F12A 2FGZA 4NQCD 4LP4A 3NGBB 1YNKH 4K3DH 3LKPA 1E4WL 1CG9A 2E6JA 1G9NH 2R9HD 3DV6B 4Z7QE 3VGEA 2B2XH 1LO5B 2DQFA 4IDJL 5IJKC 1DVFD 2DN7A 3JUZA 4KRPC 5FAAA 3QNXB 1RQ5A 1V3KA 3OXRB 3PWLA 4HV8A 1S7RB 2W9LA 1I1YB 2X4TA 2JCCB 2HLFD 4KQ3L 3WNKA 4OLXH 4CNIA 3GSUA 2DWDA 5E5RB 4AEIL 4JFEE 1LDSA 3KXFA 4L3EA 2GTWB 3UEZA 5E8DH 1LO0L 2Z93B 1D5XB 1MY5A 5C0RH 3QUYD 2EDFA 5TF0A 4HUWB 4XTRD 1EEUA 1YEGL 3DSFH 5DTFA 3L3KA 3VXRD 1HHIB 3A0OA 3PGFH 4PRPA 4BSJA 3HC4H 4Y19D 3BEVA 4YX2L 1L0XA 2CRZA 4X98A 3MRBB 5DJAA 1PKQA 4R4NC 1W0WB 2YUWA 1BVZA 4QRPA 5D2NE 3SKUD 3O45A 4PV9A 5H94A 1OD9A 1HH9A 1K8DB 5FA3A 1PQZA 3IS0X 3B2VL 3BKYL 4U1SA 1PAMA 5D1ZB 1CLCA 3UX9B 5BVJA 5IVXB 4LCIH 4XNXL 4G42B 1F5WA 4QEGA 1I7RA 5DJYB 1MIEL 3GI8H 5EZLB 3U7YH 4LCYB 3CXHK 1FE8L 3QXWA 1HXYB 1RIHH 1CICB 4PR5A 1AO7A 4N0YH 1MHHA 1HHHA 1Q9LB 4UT7L 5C2BH 5DJDA 3OB0K 1I3GH 1HINL 5HDBE 3TBYA 2NXYC 1AD0A 5EC1A 5CSBA 3O6FC 1JMXA 2P48B 1QKZH 3RWGB 2H41A 3QHTC 3ECBB 3MRJB 2YWZA 1P2CA 4R8WH 1HZHL 4MCYB 3IJHB 3TPUB 4L4VE 1VADA 4ZO8A 1U93B 1KCRL 4ZAKB 5TE6L 1NDMB 2DD8L 1G7QB 5F6HI 3O9WD 1AE6H 4L4JA 2BDNL 4KTDH 3SCMA 1MRDH 3VWKC 4W81A 2R1YA 4QCIA 3PP4H 4WWKA 5F72S 1J86A 4GO6B 4U7KA 2DKMA 5J0BA 4EBQH 4NKIL 5KS9A 3FZUC 3MV8A 5D93B 3WYRA 1XF2A 3FRPA 5CSZA 1XGUA 3FB6A 1IAKB 1WZKA 4JGUA 3P11L 4XX1G 3SEPA 3RY6C 4KZEL 1S8DA 5DJCA 1HDMA 1OWRM 5GGTL 1CBVL 1HSBB 5E9DD 5F7WC 4P2OC 3SQOL 3ZLQC 4DFIA 5B38A 4JPWL 4XCNA 3P4OA 4ZFZB 4MD0B 4BM7A 4D9QD 3FN3A 4PLOB 1AP2B 4HXAH 4D0DB 4XVTL 4LU5H 5E70A 4NQXA 3IDGA 2FL5A 4H0GA 3KLSA 2H2PD 3RPIB 2HLFC 2EIBA 5IHZA 3DHJA 4KKCD 5IMKB 1OARL 4F37F 3AS0A 4GKZB 2Z31C 3ZHKA 4YHNB 2NXZB 1I7TB 2NY2D 3OF6D 5BZWA 4LBEB 1XFPA 3QUYC 5I1AA 3VDBA 3R1GH 1G7LB 1CF8L 4ZOBA 5C6PB 1IAMA 4KAQL 5KSAD 1IQWL 3LD8C 1NC4B 3HC0A 4OZGA 1S3KH 3TPKA 5JW4M 5JUEH 4MXVF 2A6IB 1BVKB 5E8EB 1FFOB 4NSKA 1TCMA 4C83B 3MACH 1S9YA 2AI0H 1Q1JH 2XWJA 3P9WB 5BRZD 3GHBH 5EO9B 1T2XA 3JXAA 5IM7B 3VFWA 2ZUYA 5JPMB 4NRZA 3HE7D 1DJSA 4ELMF 2COQA 4Z7OF 4M7ZB 4WV1C 4XCYA 3U2SB 4X6CE 3ZL4H 4P2RB 2GW5A 4PJAB 1NMAH 4Z0BH 5I19L 1HIMH 2D7OA 4AM0A 1H3GA 1CK0H 1RIUH 3P0GB 1IGIH 3O2DH 5ESVA 4CN1A 4EVNB 5CIPB 2VZ1A 3LIZH 5E8PA 4EOWL 1K2DA 4PLJD 3QNYB 5C9KA 4JCLA 5F6IC 3TN0D 5E2UL 4FS0A 3MYZA 5DGRA 4PJIE 4X7CC 4Q9QL 2V2XA 3DX7B 2X5PA 5F1SA 2Q8BH 1UM6H 3U46A 3JV6A 3QG6B 4MMXC 1TETL 4CU7A 1CL7L 1ZLUK 2VISA 3SGDH 4C56A 5BO1H 1MAKA 4LHUA 1EGJL 5DFVD 1QLRB 5F7DB 5I9QB 3SGEH 2R0WH 5HHNA 2PF6A 3MRFA 4JFOA 5E4EB 2ED7A 4KDTC 3MREA 4PB9L 3WS6A 1HKLL 5D7JB 3MMEA 5GGRA 3G9AB 4PY7B 4WY7L 4BFBD 3HI1A 4O58L 3K4ZA 4BH7A 4X8XA 3BPOC 4Y88A 1GIGH 3S88H 2V6HA 4TVPE 3WO4C 4MDJA 2AV7A 1CQYA 4ZNCD 5CCKH 1WZ1L 2UUDH 1R5WA 2Y36H 3S36H 2NLJA 4ZQKB 2DJUA 3LN5A 1QTYT 4YGVB 3P30L 1AI1H 2CLZB 1NUNB 5CD5D 1FH5L 4Y4HB 4EJ1C 2B39A 2YPKB 1C5BL 4XGZB 4RMRA 4XNYL 4TULH 1YJDC 2H2PC 5BV7B 4B0MM 1OAQL 2DIBA 5C1MB 5HHXH 2GUOA 4KKCC 4NBYB 5T1KD 3V6OC 2F5BH 3LAFA 4FZ8L 1KB9J 3RWJB 5IJVA 3HFMH 4IIQB 4ZSOB 1BWMA 1S5IL 3VMOA 5F3HA 5LCVH 2NY2C 1LEKB 2OI9C 4GBXB 3STZA 5KVMC 4M61B 1I1AC 5EBWB 1VFBA 2AEPH 2NQCA 3VRLF 4DZBB 1URLA 3AREA 3CLFL 4XBEH 5JIHA 4E0RA 5CHNB 4QXUH 1YEFL 5AAMA 4HHAB 3ARDC 1Q0XL 3GNML 4HIEA 3EZ8A 1YPZB 2OJEA 1QBMH 3WKML 2LABA 4OF3A 3ARSA 3EAKA 1A3LL 3UTSA 2NW2B 1SMOA 3HE7C 1FYTA 5K33A 1CT8A 4JRYD 4WU5B 4UBDD 3QXDB 1UWXK 1IGTB 4WVRA 5EU5A 1WTLA 2DLFL 3WHXA 2UZXB 5BVPL 4G8EA 1T1XB 5FO8A 1MHEB 2JB5H 2DQUH 4MHHG 1OAXH 3DETD 1U3HD 2VLJE 4HW6A 4LCUA 1A6UL 3LRHA 4WEMB 2YHGA 4K8RL 1I9JL 3VI4E 4R26L 3SGDI 4HC1H 3QDMA 1IM3B 2WUBH 1AGEB 2R23B 5A2FA 3KNBB 4JDTL 3QUZA 4OD1H 5D2LA 3KJ4B 2YD5A 1U91A 1H8OA 4O2FA 4WHDA 5HI5C 3RIFF 3ZDXF 1I8IA 5FYLD 5L2JB 3NZ8B 1RZIB 4QRQB 5DHYA 3STLB 5DFVC 5C92A 1P4IL 5DUPL 3MXWL 3G5VA 4I4WA 3EGSB 1C7TA 5L2KD 3KPOB 2VRAA 3MRGB 1EERB 4I9WD 5DQDH 1QZ1A 3UDWA 3FO2A 3O3AB 3X3GH 5T3ZD 4XNUL 1U2HA 1YECL 3GSNA 4UT6L 2NXZD 5L8LB 1F02I 1XF3A 4LCWD 1LO2L 5DR5L 1BX2A 2ESVE 3QEHA 5CEXA 1KG0A 3MNVB 5DRXA 2FJGA 3Q6GH 3LQMA 1OQXA 1GGYA 1WFUA 1UH4A 1K8IB 2HLAB 5DDHA 2DM4A 3DARA 4KUZL 1C5CH 3RU8H 1I8MB 2GJ6A 3BE1L 1TCRB 2V9QA 1MVUA 1KELH 2DLEA 5CD5C 2V17H 3GHEL 4OM0L 4P46A 4LSSL 5D1ZC 1G1CA 4PLKC 4AG4L 3U4BL 3S96A 3VXUD 1UVQB 4A6YB 3W0WE 1LNUB 1SY6H 1T89C 3TNMA 1KJMB 1CXKA 2ID5A 3T1WA 1CU4H 1CICC 4UUJB 1EJOL 5FUZH 1J8HA 1JNNH 1YMHB 2PCPB 4OLEA 1KXQE 4G8FA 4E9LA 2Z91A 2Q8AH 2BNQD 1NEZG 2I60L 3KPRE 1RZGA 4J8RB 1A0QH 4XNQA 1BM3H 2VZ3A 3CCHA 2GSGA 4EI5D 43CAA 5E5MA 3MV11 3WN5A 5E00A 3S37L 3UTQB 4P2QE 1ZLWH 3WFDH 4O4YL 1QRNA 2FCBA 1CTNA 2AJUL 4OD2B 3DIFA 3SPVB 3UBXG 3SE9L 5CD3A 3A6CH 1KJ2A 2F53B 1AC6A 3PIQA 4WHCA 5IQ9A 1X6NA 1HI6A 1IC7H 1F4XL 4OFPA 4OJFL 4XB8A 3RJQB 5C70A 4UBDC 1S9KC 1MF2H 3CVIL 2EDRA 3A6BL 4RFNB 4ZUWB 4M5ZL 1JPGA 2A9MH 4O5LL 5F88A 3DETC 1U3HC 4QRUB 4JANA 2X4SA 4NQCE 5D93C 3SKMA 3GO1L 5I8EA 3MLYH 4S1DC 1NBVH 4LLDB 4OGXH 4GQ9H 3T1FA 3DVNA 1NMBL 5KANI 4KV5F 3K0WA 5KVEH 3AVEA 3HZYB 2VE6A 2W9DL 1H0DB 4K3JH 3RGVA 2BY3A 5CEYB 3GBLA 2J6EL 2C1OB 2QLVB 5C09E 2H26A 5EUOF 5D5MB 1S7TA 5SV3A 2E3VA 4P9MH 4UU9A 1ORSA 4PJBF 1V5JA 3PQYE 5IT2L 3BH8A 3ILQD 1KUMA 3VWJB 2D7QA 5D1QD 5F9WB 4NUJB 1T2QH 1U9KA 4JZNA 4OM1L 2KPNA 1H3PH 4TSBH 3OQ3B 4M3KB 4X5LA 3X11A 2NXZC 2YD6A 5LAXB 5DD5H 3VXRE 1ADQA 3P77A 4HQQL 3DOSA 3KAAA 3OGCB 4GBXD 4M4PA 3SKOA 5IHUH 2AXFB 2AJ3B 3L3HB 4A2LA 5FYLH 1NAKH 4M7JH 2CDGA 3GSVB 3ZT6A 2MQ3A 4FQPA 4WFHD 3DGGA 1Z3GH 4Y1AB 4LHJB 5F9DC 1I9RL 3V79C 4U1NA 3GK8L 4JN1L 4HF5L 2I5YL 1S7WB 1Y6MR 2A73A 2W0PA 3VMPA 1WIUA 2E6PA 4OCRH 2AJZB 4YK4B 4M48H 5T3ZH 5K9OB 5F7NC 3N9GH 5EOCL 3QJHA 1RZKL 4YO0B 3WUWA 1KIQB 4R90L 2ATPB 1WEJH 3P0VH 15C8L 4JO3L 3VRJB 5HYSG 2IADA 5J6GA 5I15H 4BFEA 2XKNA 5MENB 4M7KL 3CMGA 1JNLH 2BMKB 3QPQC 5BQ7B 4ELKA 3BMWA 1Q9KA 3V5DB 3LV3A 1FQ9C 4MQSB 1QFHA 3WFBH 4IDJH 2XA8L 1D7FA 3RL1A 1JWUB 5IJKA 2FB4L 1ZHNA 5I9QC 4XBPA 4XP5L 1QLFB 4FXLA 1T0MB 4X0KA 5E4EC 2AJYL 3LEYL 2A0LC 4KQ3H 2YK1L 4TNVK 2A77L 5EZJB 4CVXA 3MGTB 4AEIH 4AJ0A 2YC1A 1MI5E 3DRTA 5GHWL 1F3DJ 1FC2D 5MP6L 1AJ7H 5I0ZA 3TT1L 4HZAA 1JUFB 4MJ5B 2UVEA 3QUXB 1LO0H 3R0NA 2GJZA 3MBXL 3QG7L 4I18A 1IKFH 3FQUA 3DRQA 1CFQB 3MGAA 1YEGH 4HGKC 4YX2H 4FQXD 2F54E 1RJLA 2Y7QB 4BQ8A 5I1HL 2OTPA 1MLBB 5SWSA 4D9QE 1TDQA 4Z7UF 2V2TA 2DBJA 4GS7B 1X5AA 3GMLB 2X2YA 5GGSB 3ES6B 3FB5A 5A43C 1OOAA 5GS0C 3ILPA 1QQDB 1L0YA 3BKYH 4QXTB 5F7LB 3ILQC 2BSSB 4F7EB 2DMBA 2Q1EA 1MIEH 4NNXB 5D1QC 1MCRA 3S37X 5BV7C 3UTTD 5K9QG 3FHAA 4LPCA 1E28A 1FE8H 3FTGA 4C59B 4ODVL 4GAYB 3TP4A 4XHJD 5HHMB 4UT7H 4Z77A 2FX9H 2D9CA 4ZYKA 4Y5XA 3F58L 1HINH 5KAQF 2Z4QB 1CDYA 1LDPL 4LEOB 4AL8L 2ZUWA 4X5XA 3I6GA 5FDWB 4JHWL 4C55A 1T1YB 4GBXC 4NJAL 1NMCB 3KPRA 5C86A 5C0IA 2X4RA 5HGDA 3BD5A 1IZJA 3MRQA 3VRLE 3IFOB 1FZKB 4PRDA 1T20B 4X6EA 2EDWA 3D48R 1HZHH 3VXPA 5BV7H 5HI4D 4LNRB 4X99B 3FO1B 2UY7A 5TE6H 1ZSDA 2DD8H 2FSEB 3B4NA 1QSVA 1ITBB 1A14L 2BDNH 4WW1B 1FBIL 2DIJA 1RK1A 4GMSL 3CVHL 3BZ4B 3U0PB 3UAJC 3VWKA 3OBAA 5CJQL 2Y72A 1GHFL 1PX4A 4ORZC 4NKIH 1IEAA 4G8GB 4YXLL 1IE5A 5SX5K 4XP9L 1G7PA 3QJFB 2I07A 3BIKB 5D72L 2IFFH 4LNVA 3P11H 2R0LL 2BZDA 1HILB 4KZEH 2BVYA 5JHDB 4MNHA 4QY8B 5INDA 3RY6A 5E2WH 5CJXA 3ZYZA 5GGTH 5LWYL 1CBVH 3KJ4C 3QWRD 5GPRA 3SQOH 5F89A 4JPWH 3T65B 3QIWD 2W0LA 4XVTH 1DVFA 1P4BH 4HBCL 3VWJD 4AZ8A 2JCCE 4YBLB 1LE5B 2BOCB 2VLLB 4QRTA 1M7DB 4UILL 2RB8A 3NZHL 1OARH 1P9MA 3RWCA 4JFDD 4WTZG 5DEFB 1FG9C 4Q0XL 2CUMA 1JN6A 4PD4K 3IGAA 2DM3A 4R9HA 4OD3L 1QVOA 5IR1A 1BQHA 2BSRA 4X6FA 4KAQH 3QUYA 1KENH 1AQDA 4K8RD 1UZ6E 3VXRA 1E0OB 2DL9A 4FQXC 3O2VL 4FQIL 3O2DA 1HHKB 3HNVL 4Y19A 4PFEA 3EZJB 4FG6D 2Z92A 4ZFGL 1R3JB 1EK3A 4JHZA 3G6AB 4Y1AD 4NP4L 1T04B 5IVXE 5MHSE 4Y89A 2JKXA 5DQ9A 3RNKB 1A6AA 3QO1A 4GKSA 4JO1L 3U4AA 2OZ4A 1AR1D 5JORA 2J8UF 1K85A 4L4TD 3SJVB 4I0PD 1LK2A 1OQOA 4XHJC 3QHZH 4ELMA 2AERT 3UC0L 4HKZA 3MRRA 3H7LA 1CFTB 5MEND 3R4DA 1ONQB 3ZSSA 5E2UH 4HWBL 1OB1B 4N8VA 4CU6A 1W72B 5D9SB 3NN8A 1Y0LB 2SEBB 3PWPD 4Q9QH 3EOTL 4MB5A 3ARBD 3G5ZB 4NBZB 3UZQA 2Z8RA 1UACL 4G8IA 2R1XB 4R4FL 4PJXF 3ROLB 3MUZ1 1G0DA 1TETH 1GL4B 3B9DA 2GY7B 4QHLB 1ZVYA 7FABL 1XIWB 1EGJH 3CLEH 5IBUG 1HN1A 4CDGC 5L9DL 4NO2B 1DSFL 2AKRB 1X5YA 4PB9H 1HKLH 1T83A 3O9WA 3KPLB 4HH9A 3LH2L 3L9RB 5FM4A 4OT1L 2VJXA 4JREB 2P8PB 1HE7A 2BSTA 4O58H 1A7NH 4HIIB 4AIXA 2V7NB 5GIRA 4MYWB 3HLAB 1WZ1H 3RRQA 4RNRA 2ZUSA 4FQHA 4ODTL 1FZMA 5ALCL 3REVA 5E03A 4GW4B 3P30H 3QIWC 5E9DA 4HPYL 5HPOA 5JDSA 2P7TA 1NFDF 1FH5H 2OXGA 3ZKXB 4RSVA 4WU7A 4XAWL 4YBQD 5DMGC 2YPVL 3VWJC 1C5BH 4XNYH 4PG9A 1JFQH 3VXSD 4HS3A 1A2YB 1OAQH 5F9WC 4PJBE 4GXUN 2GSIB 3QP3A 1VA9A 4FZ8H 3EYSL 3IXAA 1YZZA 5GS2D 5B4MD 5I66A 3V6OA 3LHPL 1QBBA 5H35A 1IMHC 1U8HA 4HJGB 1DUZA 4J6RL 1FYHB 5C0AD 3OF6A 1ND0A 5F71A 4ZPVB 3ARFD 4LVEA 4HG4K 5KSAA 4YHPA 4Y2DD 3BZFA 2AXHA 3FN0L 3IDIA 5IQ7H 3GNMH 4HC1A 2YN3A 2BHUA 1ETZB 3WKMH 4Y8AA 3IU4L 3C09B 2P46B 5BRZA 3LKRA 3QWQB 4WI6A 2PYEB 3NFSL 2W92A 4DVRL 2GY5A 3MROA 3L7EA 3HE7A 4YK4C 4P2RE 1EVTC 1DANU 4PYGA 5EUKA 1OAYH 3QH3A 4MS8D 2YA2A 2DLFH 2JELL 4PJAE 2FHBA 3RWDB 4PP2B 3ZTNL 1DEEB 4P5KA 1A6UH 1NGZB 5T5NG 1U36A 4K8RH 1I9JH 4LCCA 1CL7I 3RL2B 1OPGL 1BGXL 5DI8A 3EDEA 3D0LA 3U9UB 1KYOK 1SJXA 4OKDA 3TN0A 2FLBT 1BBJA 4JDTH 3ARBC 4N1HB 3KPNB 5LG1A 1ZHLB 1L6XA 3QQNA 3RZCA 1OTUC 5B38G 4WJ5B 5C08B 4JJHA 2E9IA 4YQXL 2JJVA 3BVNB 2E9WA 5SWQA 1P4IH 3DGCR 1T7YA 3ZKSD 5DUPH 4Y16D 4N0UA 3KWWA 3MXWH 1N6QL 4G6FB 5L7XH 1P7KB 1VKXB 4G7VL 1VPOL 1IGYB 1RZFL 3MJ8A 5F7HA 1DE4B 4XNUH 3QUKB 1YECH 2DYPD 2GEEA 1UXWB 1I3RA 2GTZA 1LO2H 5DR5H 1MIML 1SY6A 3VDAA 3PABA 3KYOA 4K94L 5AZ2L 3GEWB 2YXMA 3IDYB 3QXTA 1AGDA 4KUZH 3ZKND 3PP3K 5KSBF 1ZT1B 3BE1H 3LPGA 3BZEB 3MRBA 1NDGA 4ZXBD 4GS7C 2CUIA 1FL3B 4NJ9L 2J12B 3HR5A 3GHEH 4Z7UE 5FYJH 3KPMA 4OM0H 4YBQC 4LSSH 4AG4H 3WCYA 3U4BH 1JGDB 4UDTA 3UROR 1LP9B 3FCTA 3JV0A 1FVCB 1VACA 2C1PB 4PGDA 3SDAB 5C0FB 2CSPA 4ZSOE 4PTTA 3ARGB 1EJOH 4LF3B 5CLTA 1JNHA 5T1KA 3V2AR 2EKSB 1GAFL 2I60H 1I8LC 2OX5A 4RIRB 3HAEH 5GZND 3RWHB 1P4LA 1BLNB 2EIZB 3DYOA 3RY5A 3S37H 1TNNA 1K4DA 2CLRA 4U31A 5E6YA 1J1OH 4EUPG 1NAMB 1YPZE 3SE9H 3F7VB 3IFNL 1N5AA 2DQHL 4Y0GA 4ZFFB 1TZHB 1UJ3B 1IGJA 1F4XH 4OJFH 5ANMB 3HG1B 1YQVL 3S3PA 3MQIA 3KGRA 5GS2H 2HN7B 3H6JA 4MCZA 4N9OB 2LVCA 5AAWA 3CVIH 4JRYA 3A6BH 4DAGL 4DQOL 4MS8C 5K9JH 5EU6B 4YEFA 3BQUB 4OSUL 4M5ZH 4UIKL 1MCFA 1YC8A 2D4DA 4KKBC 4HUUB 4O5LH 4GT7A 4YR6B 3QFDB 5IF0A 2KQMA 2UZIH 1U3HA 3X3FL 3T4YA 4WO4B 1NMBH 4GJTB 3OJMB 4BSWB 2DLGA 3KJ6L 2W9DH 4G6JL 2G2RB 4GXUM 2VZTA 4KJWD 2Q7YA 4W70A 4QHNB 1JGVL 4RGMB 2FIKB 3TBWA 3MSPA 5IT2H 1Z9LA 32C2B 1XGRB 3SE4C 4K55A 4P3DB 1BOGB 2NMSA 3OKKA 3QZWB 3SE3C 5EUOA 3C8HA 5CMAB 4OM1H 2V2WB 5L2KA 4MSWA 4JDVB 4JRXD 2X7LB 4AY0A 3IJSB 4PJBA 2XICA 4GW1B 1JGEB 1HKFA 1OW0A 1RZKC 1TITA 5DVKA 2B0SL 2VMFA 1I9IL 3NPSB 3FHQA 1SJHA 1PY9A 1QBLL 3IKCB 4LCWA 4NGHL 3UO1L 4ZDHA 4DN4L 4FHBD 4WCYH 4QRRD 3KPSB 4WUUD 1RULL 2NNAB 4Q6YA 5F7UA 1BVKA 1IGML 5FKPB 3ET9F 4AENB 1I9RH 3GK8H 4JN1H 4HF5H 3LMJL 2I5YH 5DD6A 5DJ6B 4OAWA 1YEHL 3VXUA 4OB5L 4LSRL 3BPLB 1RZKH 2YD9A 5HGBB 5FA4A 1R5VA 4KROB 4R90H 1VSCA 1EHNA 5ID0B 1T4KB 3PDGA 4JO3H 3WMSA 4CVWA 3UP1A 4OZFA 2BNQA 1TMCB 2O61A 3HRPA 3MUY1 5GZNC 4FFZL 4M7KH 4EVNA 2IGFL 3GJFK 4H0HB 1DBML 1FFPB 4YLQT 5FV2A 3PWNB 4EI5A 5J6HA 4XWGL 3UPCA 1ZLVK 5DJ8B 2NY5L 4U1GB 1OGTB 1NGYA 2F53E 2ZOKA 4NBXB 1DANT 1T22A 2ZG2A 1ZT4B 4M43L 3FQXA 2XA8H 3L5IA 4H20L 2VDKL 2VLRB 1XIWC 2FB4H 4FABL 5IFJB 3MNZA 3QNZA 4XNMB 4XP5H 3FB8A 4YBHA 1VESA 3TH2T 3BT2L 2C3HA 1S78D 1T66D 5TGBA 2AJYH 3LEYH 3BWAA 2ZUTA 1H5BB 3S35L 3T3MF 3HC3L 2YK1H 2A77H 5SWZD 3EDFA 5GHWH 4NC2B 5MP6H 4JREC 3KLHD 1QACA 3BIAX 4ODXB 3TT1H 1UYWL 2X70B 2X4PB 3MBXH 3IJYA 3QG7H 4POZD 1UM5L 1TNMA 5MEPA 5T3XH 3EO0B 2E9JA 4LGRB 4TUJA 5IROA 1AIFA 5TE7L 1MCWW 2P8LA 3C6LD 3BISA 4PRHB 4DTGL 1WIOA 5DJ2A 1JK8B 3H7BB 2A6JA 5I1HH 4HIJA 1U92B 4DWHA 4KJWC 5D5ME 1GGIL 3SDXB 4D0CA 3CAFA 1ZLSL 4F33A 1CXEA 3TVMB 3P9LB 3ZE0E 4O2CB 3ULSA 1BIHA 1FN4B 3O3UN 5GGUB 4IMLB 5IB3B 2ADGA 1Q94A 4Z7UA 2J7LA 4XGZA 5D1QA 4PJ8B 1LE9A 4BSVA 1D5IL 2FDBP 3BIBX 4ODVH 2IANB 2VXTL 2Z0BA 1WV7T 3F58H 1LDPH 4AL8H 5TH2A 3ESUF 1N0LA 1EAJA 4JHWH 1JMZA 4NJAH 1I4FB 1R6VA 3V9FA 1RZJC 3GMOA 2VITB 4GBXA 1QSFD 2VDNL 1AD9B 4Z76B 5CILL 5T1LB 3BHBA 4JPKL 3CH1A 4Y1AE 1U8PB 2NCMA 3JTTB 3LQAC 4PJDF 3B9VA 3C09C 2DQIH 3DX8B 5H2BA 2EE3A 4DKFL 5GGTA 1NBQA 1A14H 5MEOA 1LD9A 4MDIB 3BGAA 1FBIH 4U1JA 1YEKH 4QHMA 4WU5A 3NCYS 5CJQH 2R2EB 4RAVB 1GHFH 3HCVB 4YXLH 3T3PF 4OIBA 1BQUA 1S7XB 4XP9H 4HMDA 2Q7NA 1N8ZB 5MENE 2FGWL 2R0LH 2EDTA 2NY4D 1ED3B 3IRPX 1CE1L 3VFNB 1BJ1J 4ZUUA 3QEUB 5HYQB 3VXNA 2P45B 3QCTL 5LWYH 5DRWA 4R2GD 2VDRL 1AGEA 4Z8FL 5I1DB 3FQNB 5BZDB 3K8MA 4MNQB 3V8CA 3D85B 4HBCH 1N59B 1ZXQA 2CO7B 1S7UA 1DN0B 1FL5A 1RZIA 5DYOA 4QRQA 2FJFA 5FYJE 2EEDA 1T66C 4LPXA 1R24B 5IIEB 1DQML 2KZ1B 3L7FA 2BSED 3EGSA 3NZHH 1J8KA 3GMRA 2R2HB 4Z5RB 1H3UA 1XZ0A 4PJCB 3KLHC 3QXAA 3TBTA 4HWNA 1QA9B 4GG8A 4OD3H 4PJFB 2J1KA 3GSQA 4G9FD 1ACZA 4P57A 1MNUL 3ARQA 1D5ZA 1RU9L 4LVNB 2ZCKL 1OCWL 3IDYC 3THML 3M07A 1A9EA 1G7IB 3O2VH 4FQIH 2CQVA 2HVKA 2WBWB 2OSLA 3M17B 4FQXA 2R8SL 3HE6D 4U6YA 1ZT7B 4ZFGH 3D39B 4DKEL 4NP4H 4N0CD 5B39G 1X4XA 3Q6FA 3VXSE 5KN5B 3L1OH 2I25N 2XKUA 4IM8A 4ISVB 5IEHA 4H0IA 4JO1H 4KMQA 1CGSL 2CRIA 3GRWL 4XRCA 5C9JB 3SDAC 1F3JB 3UTTA 2IPKB 3ARGC 1EGJA 5HHME 3HUJF 3C5JA 2IQ9H 4GAFB 2XNAB 5F7MC 2VERN 4XC3L 2E27L 3L95B 4MJ4A 2EYTB 3UC0H 3JWNC 1J88A 3G6JF 4X6DF 2J8UA 3E6FA 3G08B 5EU3B 4QHUA 4Y5VB 1INQB 1F42A 3BH9A 4TTGA 5CP7B 5DS8B 4OFKA 3EOTH 5BJTB 5FHBL 3L3GB 1C12A 4RFEB 4R4FH 3BDYL 4BQCA 1ZS8A 5J89A 1UJ3C 2CRMA 1XGYL 4CADB 7FABH 1P7QB 2DF3A 3KPTA 4GXVL 1JV5B 2H2SC 5L9DH 1DQJB 3IF1B 1A5FH 1DSFH 1FZJB 4PJXA 3OKOA 2P42B 4LPYA 5C07B 2GCYB 3LH2H 3NIDE 2OJZL 4ODSL 4XWOD 4OT1H 1ZE3C 1BEYL 3G6DL 3BQUC 4G8GE 3BXNB 3DXAD 1ORQB 2DQDL 2EYSB 4XBGA 3VXQB 2X4OB 4X4XB 4QRUA 1LILA 4GRWB 1NAMH 3WJJC 3N0PB 3V95A 4OCWL 3LKNB 4JY6B 4Z7VB 2VZOA 4ODTH 3PDOA 5ALCH 5JZ7C 5IW6B 4HLZG 4P59H 4DCQB 5FECB 3TNNB 2OBGA 3HZYA 4R2GC 2B4CC 4NFCA 2AW2A 3O3DA 4PJGB 1AGFB 3RI5F 3DBXB 3QWRA 1G6RB 4RGMC 2O5XH 2FH8A 4HPYH 4LLMA 4MLIA 3JBG7 2WK2A 3VFPA 1OP5H 3QIWA 1EFXA 2HTKD 4XAWH 4LFHG 2G60L 1JHTB 2HJFB 2FLRT 2VC2L 3JVGC 5D71L 4HMEA 1JZ5A 1ZTXL 3PHQB 4OV6F 3VWJA 3FONA 3DV4B 4MWFB 1NFDA 3EYSH 4NUJA 5HD8D 1J0ZA 5FO9A 4YHMH 4HIHA 3LHPH 1K9TA 1DBKL 4NQUA 4JFDA 3X13A 2QQKL 3T0EB 3HMXL 4MD5B 2VR5A 2WBJD 3MUHL 5HHOD 1U6AL 3UJJL 4J6RH 4XI5D 5HI3D 1CYGA 4TTDC 2B4CH 4PREA 3GKZA 4Q7DA 1NGWA 4BZ2H 1WAAF 1BQLL 1T6WA 2FJHB 1B6UA 1NUDA 5ITFA 3M1BA 3HE6C 4S1RL 3W2DL 1AXIB 4CKVX 3IU4H 3MRIB 2H32H 1FNEB 3NFSH 4DVRH 1BFOB 5CJ8A 3SJVE 2IPTL 2VDOL 3V0VB 1HSAB 3H42L 3Q3GA 4L8BA 3ZTNH 2BNUB 2GK0A 4AT6B 4L4TA 3I75B 3ZYIA 4I0PA 1R3HA 2FATH 5L8KB 5GGVL 1N6VA 3GBML 1RK0A 1BGXH 1KGCE 5T3XE 3STBA 4DGVH 2G75A 3QB7C 1WFTA 4K94C 2CIKB 2OQJB 3PWPA 1QFUL 2A74A 3ARBA 1JPFA 1AKJD 2XZCL 1KTDA 4JKWA 5C0DB 2VDLL 2VL5A 3MO1B 4YQXH 2FX7H 4F8QA 1FHGA 2Q86B 5GS1B 4S2SB 4JFYB 3TYFA 4KPHL 4YAQB 1Y18A 2PW2A 1N6QH 3PV7A 1OF2B 4JO2L 1QNZH 5KZCD 3H0TB 4G7VH 1VPOH 5DJ0A 5ISZB 3JV5A 3MR9B 3BRDA 4IHOA 1RZFH 4HFWA 1NUFA 5DFTA 1P5UA 3NMEA 4G5ZL 5AUMB 4X4YA 1TTUA 1KPVB 2VN7A 4MAUL 1MIMH 3CSBA 4M9PA 1JF6A 1JUFA 3LSOB 4RGNB 2EH7L 3C5SA 2YS4A 3MUJA 4K94H 5AZ2H 3C60B 4C4KO 1HQRB 3RVTD 1QPPA 3LEXB 3UCRA 1RVFL 3P9MA 2G9HA 3OR7B 3NH7L 4XXDB 3Q1SL 3RNQA 1JF1A 3HAEA 1A9BA 4EI6B 1EHLH 5D7IF 3NFPA 4J3VA 1F00I 3K8LA 2ZPKL 4ZUTB 3TVMC 5I8CA 2YUVA 3CFDB 3X17A 3VFOA 5KSBA 1QFWH 4H1LB 3VXSA 5I17A 4PJ8C 5I1LB 2XXMB 4WI2A 1JRHL 3AXLB 2AS5M 4RMWA 2F9BT 1MVFA 4JAMB 1IGFL 3D3VD 1GAFH 3EJYD 1LEIA 4P49A 3OSKA 2WBJC 5GQBA 2HP4A 3GI9L 5HI3C 3WIHH 4V1DD 4LIQE 5C0AA 3TJHD 5IMMA 4XXCC 1MCOL 2BC4A 4EN3B 3PDDA 2AV1B 4RA0C 3ARFA 1JZ4A 1KTKE 1VERA 2LV4A 2RHEA 3IXTA 1MCPL 3OX8A 4Y2DA 1HHGB 3VFSA 1EZVY 3SDCB 5D7LB 5IEKB 3QUMB 3GIVA 2WV3A 2J6EA 3QIBB 2Q87A 4L9LB 1YQVH 5EZIL 3Q2CA 5BMFL 2APTA 4PG2A 4NO5A 3RHWF 3X14A 4DAGH 4DQOH 3U0TA 2LU3A 2CDFB 4OSUH 4UIKH 4ZMAT 5E7FA 1T7ZA 2DQGL 3VH8G 2Y6SD 1PYWA 1OT2A 1Q9WA 4I48B 3I84A 3SHSA 1U8MA 4M6MH 3X3FH 2XQYK 4UNVA 4NWUL 2H9GB 1ZANL 5HDOA 2OTWB 4XVUC 2QR0B 3KJ6H 4G6JH 5J11C 3CU1A 4HKJB 4X7TB 5C08E 5EO1A 1GJIA 2N4IA 2DQEH 4HX1A 1KOAA 1U42A 1XCQB 3MRMB 2NY7L 4NKMB 2HJKB 5KJRL 4JDZB 5JW4R 4OZHF 4HWZB 5DQJA 4M8QA 4N5ED 3MGOA 3BRFA 2X09A 3MLRL 3UPAA 5CWSB 1FRGL 3UZEA 4Y16A 4P23D 4QRSB 2ZJSL 3QAZB 3PNWB 4NQDB 3V8OA 4FMKA 3SE3A 3H3PL 3IU3A 3MJ9L 1I7UB 3ABZA 3T8XB 4KGJA 1S7VB 4JZOA 4BK5A 4UAOB 3T0ED 1TZGH 2B0SH 3QDJB 3V4UH 2DYPA 1A3QA 5TQ2L 1QBLH 5K59E 2QTEA 4NGHH 4MVBD 4DN4H 1CR9H 1UZ8A 4LVNC 1JWSA 3LOWA 4JLRB 4PJ7B 3VCLB 2BFVL 1RULH 4KKLC 2C3GA 1IGMH 1HHKA 2EO9A 2NY5C 2PTTB 5JA8B 3DYMA 3Q5OA 4GRLB 1JJUA 4ZXBA 1IEBA 3LMJH 5IVNA 1UADC 2DI8A 2HVJB 3CFJB 1FFNB 3QI9D 1YEHH 1CE6B 4I3RH 4OB5H 4LSRH 3TBVB 1OL0A 3H8NA 4KK5D 5DC4B 4XP6L 3LQZB 3O2WH 4P4RB 1EEZB 2YD2A 1WGOA 1K5NA 2AJXL 4AH2B 4FFZH 4L29A 2IGFH 4WDIA 1DBMH 4Y5VC 3TIEA 5I73C 3TJHC 3FT3B 1GGTA 1HXMA 4XWGH 4YDVA 2NY5H 4HK3N 4JY4B 1OB1A 1N2RB 4MAYD 3RAJH 3QULB 2SEBA 1YC7A 3UMTA 5JO5A 1JTPA 4M43H 4DGYH 4J3WA 4H20H 4D0BA 2VDKH 4FZEL 4P5TB 5ANME 3HG1E 2JIXD 3L5WB 4FABH 3RZWA 3V5HA 2I24N 3P73B 3BT2H 4W68A 1REIA 3DURA 1DBAL 3S35H 5EU6E 2J3SA 1T21A 3HC3H 1D5BA 2J2ZA 3H9HB 2AKRA 4U6HB 5B8CB 5EIIB 5DMJB 1T5XB 1AGBA 4CUCA 1P69B 1UYWH 2Y6SC 2VR4A 1UM5H 5DMKB 5CJ5A 3OKYA 2CDEB 5TE7H 3MBEB 5KG9B 4DTGH 1TVBB 5IG7A 3LKSA 1RHHA 3MCKB 4MHHI 4ODWB 3AB0C 5I2IB 5IESL 2CR6A 3HLAA 1TQBB 5DHVB 4KFZC 25C8L 3TV3L 1QEWB 1X5JA 5HGHB 1LO4L 4AIZA 2FO4A 1RZ7L 4ODBD 1GGIH 4MZ2A 4NDMA 1BD2B 5ALBH 3HS0B 5MERA 4WIQA 3UTPE 2MCG1 2I9LA 3H3BC 3EFDL 3JV4B 3KPPB 3MRNB 2MPAL 1NGQH 4NNYB 5IB4A 5FO7A 2EKJA 4YIQB 2ADJB 5IB5A 1P84J 1FVDA 1UQSA 5EC2B 1D5IH 3L3OB 1F11B 1F6AA 4K7PY 3W9DA 3IDNA 4JRXA 2VXTH 4BFGA 3CZFB 1WBYB 4XPAL 2H1PL 2QKIB 3CVHA 4G9FE 3T0EC 2EC9U 3CFBB 4FTVB 3WEXA 3ZE2F 5JXED 4MA3B 2VDNH 3L5XL 1U8QA 3HPJB 3A67H 3UPRB 2R69H 5CILH 2M26A 3TJEL 5FF6A 3O4LD 4JPKH 2E8YA 2DKUA 4ZS6C 4NZRH 4QRRA 4YHYB 1E6JL 3S98A 3OZ9L 4BQ9A 2BCKB 4LLWB 4WUUA 4Z7NE 2R0ZL 2OL3L 2CJUL 3VXMB 5IFHL 1RMFL 1KNOA 4DKFH 4HDIB 5E6IB 3TIDA 3QIUD 2ICEB 3QI9C 5E99L 3RTQB 4PJDA 2MTPA 3OL2A 1UB6A 4TUKL 2IJ0C 4HK0B 3V6ZB 5ERWA 3RWDA 4KK5C 4ZUSA 4JHAL 5JPNB 1S7SA 1U8NA 2FGWH 4P5MB 2D31B 3FQWA 3MNWA 3L3IA 1CE1H 4X5WA 1D6VL 1A22B 5CS7A 1FGVL 3QCTH 1XGTB 2VDRH 4FN0A 4O00A 4UDUB 4G9DB 3DO7B 5C0ND 4Z8FH 3D69A 1OM3L 1YEJL 5EORL 4HEPG 2VLRE 4N8CL 3D87B 3GJEA 1NKRA 5DJXB 2ZSVA 2YD4A 2P5WD 3LN4A 5GS1C 3UBXI 3PWUA 1DQMH 3C8KA 3S3SA 4IOIA 2YEZB 4J4PC 5T1MB 3WFHB 1IGYA 5SWZA 1KLFA 1GYAA 2XN9D 3U36B 5EDXA 4RISL 2A6DB 4PRHE 3C08L 1MNUH 5HBBA 1RU9H 3NFNB 4CMMA 1HK6A 5LVEA 1OCWH 3R06B 3C6LA 4D94A 1ES0B 2VUOA 2D0FA 2X6MA 3BP5A 1MAML 5JOEA 4OLUH 3SDXE 4PGBB 4Z9KB 4IRJD 2R8SH 3BGFB 4U1HB 4WRLA 4XPTL 4HWBA 2PXYB 3QFJD 3TO2B 5IB2A 4JQXC 3WE6A 3CXHJ 1GRWA 1JNJA 2HFFB 4CBPA 4OZIB 5DRZB 1CGSH 4X4ME 5DJZA 3GRWH 1NC2D 1QSED 3JTSA 5HJ3B 5C0EA 3CFKA 3MV9B 5GRUL 4KI1A 4WHTA 2BVOB 2DJSA 3B8YA 3LVEA 4XC3H 2E27H 3T4AA 3RDTB 5TDNB 4UQ2A 5K93A 3ZHDA 1EVUA 4HZLA 4Z78A 3B5HA 3O4OB 1EEQA 3HUJA 3RWIB 4EN3C 5IMOA 2P1YA 3EDKA 2EIZA 1QSFA 5FHBH 2PW1A 3PGDB 5GRVK 4PB0L 1SBSH 3BDYH 5J7CC 2ICWJ 5L88L 3G6JA 4X6DA 5DZNA 3SDCC 1PX3A 1S7QB 1XGYH 2BVPA 1UJ3A 3PL6B 2BNRB 2FO1A 4GXVH 5AZEL 1MWAL 1CD1B 3QIBC 3QIUC 4QF1B 5KVFL 1CCZA 1WC7A 1Z5LA 2OJZH 4ODSH 3GUTB 5ICYA 5IFAL 3OB0H 1A1OB 1UB5B 4U1LA 1BEYH 3G6DH 4P3CL 2YPLB 5KOVC 3ZDYF 2DQDH 2X89D 3I3BA 3U4EB 3VW3L 4HUUA 2MNUA 3WNPA 2JJWA 4N68A 2WWKO 3CDCA 3EKCA 4OCWH 3H9SD 3VD9A 4QYOB 3WJJA 2NX5D 1DBJL 1SYVA 1A6PA 3BJLA 5ILTL 4MNQE 4FXKB 1ZVSA 3MRHA 1U8OA 4NQSB 5JOFB 1BF8A 2G60H 3LCYA 2VC2H 5D71H 1ZTXH 4ETQB 3JVGA 3DUSA 5CEZD 4PJ5D 5EZOL 3QAZC 4PJCE 2NR6C 2BVTA 2H32A 5DK2B 5EG6C 4YPGA 3NACL 4FXGB 4IRSD 4RMQA 2HJLB 4MB4A 2QQKH 4PRID 3HMXH 3JWDC 1SJEA 4UAOC 5DK3A 2DL2A 2LU4A 1U6AH 5T33H 3UJJH 5KTEL 4M5YL 4YGAB 5GSRA 5IB1B 4G6KL 4QOKB 2XTLA 2X1XR 4RBPK 4G9FA 1BQLH 2WINA 4PBVC 5E94B 1MCHA 3D39E 4IRJC 2RJMA 4S1RH 3W2DH 3HE6A 3C5ZB 5GGRY 5D1XB 1T7WA 4GRLC 2PO6B 3RJDA 2NY0D 4R0LB 1WAAA 3WJLA 3KLAA 5E6ID 3F8UB 3FAWA 3WL9B 1PZ5B 5F8QC 2BVQA 2EC9T 4R7DB 2IPTH 3JWDH 5F7EL 1UJTA 5A1AA 3H42H 1WCBA 1DQQB 3VFRB 3MOAL 5DRNA 3QA3B 5K9QI 2VNCA 5IMLB 1G7HB 2F19H 4NYLB 1MUJA 5GGVH 5ID0A 2HT2D 3DUUB 4K3DL 1JP5A 1MJJB 1S9VA 5D7SL 2E7BA 1OT1A 3WLWD 4R7NA 2WLYA 3O41B 1NCAH 3VFMB 1QFUH 2XZCH 1I7ZA 3BO8B 4LLYA 5BW7A 4P5TC 4NN6C 1WBZA 2VWEC 4KPHH 5C07E 1PG7W 5I76A 4TRPL 2EYRA 5IW1A 3N1PC 3VU2A 2IG2L 4TN9A 5FGRA 1ZA3A 2N56A 4WNQA 5ICZB 3OPZL 5DSCB 1UKQA 1T80A 2NY3D 3DO3A 2AK4A 4UOW1 4G5ZH 3VG0H 2ICWI 4GUPA 5E0QA 5B8CC 4PJEB 4UIMB 3DXAA 1B4JL 1VGEL 4JFQB 5CLWA 4GRWE 1E4KA 2EH7H 3MBEC 4BZ1L 1R3KA