3OKKB

Crystal structure of s25-39 in complex with kdo(2.4)kdo
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
217
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okkB01
1WBXB 4ZS6D 2XTJC 2DKUA 2GAZB 1Z9LA 4NRZA 1AGFB 4NWTH 2N7BA 3HE6A 2F58L 3KXFD 1D9KC 3FTGA 2AQ2A 2EDQA 1NC4D 3NFPA 5JNYA 2APBA 4XMLL 4KTYA 4PGCA 2B4CL 1MOEA 3V6ZA 3INUL 4G9FE 1A6UH 1EO8L 5FUZH 1G9EA 5EU6D 3CX5K 3QI9C 1JPGB 5LBSH 1FO0H 1W0VB 1L6ZA 3BAEL 2DWDA 1MIEL 2JELL 2MKWA 3TVMB 3EFFA 3QWRA 5DC4B 3VXQB 1UXSB 2VDPH 3DARA 3DV4A 5CWSA 1GH7A 3VWJC 2YRLA 3QUZA 1FZOB 2UUDH 1KJ2B 1NC2A 4WUUA 5F3HA 3GMNB 1LK2A 3CXHK 1RMFH 4Z78A 1QBLH 4M93C 3RWCA 1FAIH 1BQHG 4GG6B 2X1PA 5FYLE 3ROOA 5IF0B 4MNQD 3BKCL 5CS7A 2F8XC 2VWEE 2BOBB 4XC1H 3JWOL 3L1OL 5JHDD 4Z0XA 2KQMA 4PY7A 4Z0BL 5EIIB 4LKXA 3MOBH 3UPRA 1PEWA 5C0FB 4QWWD 4Q9RL 4RGNC 4Z5RB 2EC9T 4S1QL 2BP3A 3TJHD 3O3BB 5L2JA 5F3BB 2ERJB 2MOVA 2C4FU 3RKPA 5E8EA 2FBOJ 3T0ED 1MNUH 5L88L 1EHNA 4Q58C 4NGHL 3V5DA 4U2YA 1WBYA 1HXMB 4LLAA 4HS8L 3S34H 4JQXC 3MYJA 1V3LA 3ZT6A 4PJDB 4R7DA 2BDNL 4D0BA 3O4LA 1ZXQA 3TM6A 3VGBA 5J1TC 2BRRL 4OLVL 2IALA 1DN0B 4R2GB 5JMRA 2Q7YA 4TUOA 5KVDH 1JN6B 1G7MA 4ZSOE 5C70A 5FXCH 2A38A 1NGYA 1CFTB 2ZKHH 2EDKA 3IS0X 4AEFA 2VSDA 5ILTL 5L9DL 4JFFA 4YDIH 25C8H 5I18H 4OZIB 2UWEE 3VMOA 3NCYP 6FABL 2DQEH 1PKQB 2OMBA 2ZOLB 3FT3B 2Q8BL 3NFNB 4LSUL 5BV7L 1T7ZA 5DK2A 1ZHNB 4AG4L 4NNXA 4UT7H 4HC1L 3CLFL 3MXVH 3DWTA 3TA3A 1H3WM 1JYNA 5IIEA 4U7KA 1WIUA 4J4PC 5C6PB 3BGMA 1O7SA 1UKQA 3HMXH 5I1CL 3CUPB 1SJHB 5FK9B 5DZNA 4A2LA 1EAPA 4PJ8C 1A6TA 3WO4C 1F6LL 1Q8MA 4WJ5B 4YHLH 5F1IB 5A3ID 5HYIA 3SDCA 1PZ5A 1VB9A 2EE9A 5SV4A 3F7VB 2BC4A 3C2AL 4J3OC 4S2SA 1NBZB 4FQHB 1ZK9A 2OL3A 1P84K 4R97B 1CLOL 2FBJH 2J4WL 5FHAH 5B38A 4O2FB 1U8JA 3MA7A 2R56H 3MRMB 4Y8AA 5FUCC 1OGTB 4R4NC 3T0BA 3WN5C 1S78C 4FXKB 3DVIA 2VLKA 3V52L 1FNEB 4KQ4L 2VLMD 1BECA 3TNMB 1SMAA 1MEXL 2IPKA 4X0KB 5C07A 2P5WE 1CD9B 4WO4C 1PW3A 3WUZA 4XPBH 1ZT1A 3EOAB 2VDOH 2IH3B 3RWGA 4KH2A 2Z8SA 3L3JB 3CIQA 1QFPA 5ID1B 4ZUWA 4ELKA 5KVGL 4UDTB 4M6NH 1F11A 3SDAD 5JQ6H 3GZKA 3GSRA 2NY2D 1IBGL 2K1MA 1B90A 4ZO8A 4ZUVA 1YY8B 4B50A 4B53A 2F53E 4NM4H 3E2HB 2NX5D 1DEDA 1JWUA 3F6LA 3RL2A 1AE6H 2H8PB 5ACLA 5C08A 1J86A 5JPNB 1CWVA 3IB4A 2J3SA 2M26A 4JKLA 4XRCB 4P2RA 5I8KH 3RVTD 2VE6A 1BZ9B 2GFBA 1OF2A 3QQNA 4PLJC 2Y1VA 3VFRA 2J1KA 1L7IH 1PX3A 4JREC 3ULVC 3L3KB 1G7LA 4IRZL 2AAVA 4FFZL 2DYPD 4XMLH 4DWHA 4DGYL 4F8TA 1H3XA 1IM9D 3BN9C 1OP5H 2V2TB 4M5ZL 5EOQL 5DUMH 5ICXA 4RMTA 3O6LH 1MFCL 4PV9B 4YBLC 5IHUL 4Y5YC 2HFEB 2J12B 4X9IA 4I2XB 4W81A 5L7XH 3NOIA 2W1NA 4K3GA 4M61B 3X3FL 2X4QA 4J12A 1LQSR 3CXHJ 4ONHA 2HFFA 4OI7A 1MCQA 3VFNB 2OL3H 5FA3B 3O9WA 4MCYB 3MLZH 1I8KB 4ZFFB 3GSUB 2MNUA 3FO2B 3O6FC 1UCBL 3MRKB 1M05B 4KTDL 3U0PB 1N6QH 4Z7VB 4P2OD 4ZXBC 4WDIB 1JVKA 3NCJL 1IKNC 4DQOL 2BVEA 5D71H 4QOKD 2BSSA 4XXCC 5EFIA 1OARL 4NDMA 5CEXB 2QQKH 3NFPB 4HWNA 1OD7A 5JNYB 3P0YL 4ZS6C 1OOAA 4KWUA 5GRXG 1BJ1J 5ID0B 4N1HB 1EX0A 4LASH 4PRID 5IB2A 3G6AA 4JDVA 3FB8A 4MJID 1HE7A 2ZPKH 2DWDB 4WI9A 5C0RL 1LO3L 4BH8A 5J11C 3EFFB 3SKMA 1FYTD 4PJAA 1BLNA 3WKML 1YNLH 4HIJA 3GO1L 3HZKA 4U6XB 1KIRA 4OLVH 5CWSB 4PBVC 5EOTA 4NSKA 3RWDB 3S96A 1NBYA 1NC2B 1NAMH 1LDPL 5F3HB 2NY5H 3PXHA 3SQBA 1ED3B 4Z78B 5IOPA 2WWKO 3O3EA 2A1WH 4QHNA 4PY8J 3HC4L 3ROOB 4UQ3A 3P40A 3UTSE 3T04D 2P45B 4Z0XB 3TEUA 4HHAB 4N8PA 1DQJA 5DD3H 5TDNB 3F7YB 3LRGA 2MQCA 1DUYA 3KWWB 2E3VA 3QUYB 2CQVA 3W0WE 5F7HA 1S9YA 5GJSL 4PRPD 1GGCL 1VFBA 5FYKU 3QCUH 1T6VN 2NTFA 4O9HH 3AB0C 4XZUA 5F6HJ 5L2JB 1BGXH 3QDJA 3DVNA 3QPQD 3QNZA 3SY0A 4QWWC 3X11B 5DJDA 4JQXA 2Y5EA 5I8OL 32C2A 1WBYB 2GCYA 4OFYA 3TJHC 3MYJB 4NN7B 3LDBC 4R7DB 1P84J 3O4LB 2IFFL 1MCPL 2FGWL 2HWZL 3EO9L 3T0EC 3TIDA 2IALB 2GJZA 5T3XE 1DQLL 1E4WH 4AMKH 2Q7YB 3UTTE 3SE9H 1KCVH 5IM7A 1G7MB 5CEZL 1J8HE 1ZLVH 4X5WB 2I07B 4KK6D 4JFFB 3UCRA 2J8UB 2A6IB 2VITB 4NQDE 3FRPG 5BZWA 3D3VE 1UM4H 3V52H 4A6YH 1BD2D 2Q8AL 2DRUA 3PWJA 2VZTA 1FGNL 1MCEA 1TZGL 3RL1B 1LEKB 4ODUB 1YEIL 2D2OA 2R0WH 3I6LD 1GC1L 1ZEAH 5FYJD 4YUEL 3OKKA 3PGCB 2W9DH 3QEHA 3MODH 1VEOA 3D39B 2O5YH 1OP3H 3O45A 1TVDA 4PJ8A 4PJGE 1U8KA 3C87A 3CFEA 5SWSD 4H8WH 1EAPB 1QSVA 4TVSa 4PJ5A 5HGHA 2ADJA 3SDCB 1PZ5B 4U33A 5JUEL 4ZOCA 1PYWA 2A6DA 4S2SB 3OF6D 2EDHA 1WC7B 2OL3B 5E6ID 5I1GL 5B38B 2V5TA 4HH8A 5A3IC 4GMTL 3MA7B 3WN5A 1B4JL 4KJQD 4QRPD 3MFFA 5TDOA 4EUPG 3Q5OA 3LH2H 1ZSDA 2VLKB 4P59L 3LKPA 3MLXH 4ODVH 4M3KB 1AH1A 5MERB 5F7EL 1F3DJ 3UYPA 2IPKB 1X44A 5ADPH 4WO4A 1SY6A 4S11A 3ARGD 3P4NB 2P5EE 1ZT1B 4M7LT 4N68A 1UWGL 4N90E 1MF2L 1OT1A 3QULA 3SHSA 3BZ4A 4MJ4A 1EJOL 4ELKB 4PJEE 4CNIA 4KQ3H 1F11B 3BP4B 4R9HA 3GSRB 4I3SH 4ZUVB 3SE4A 1CTNA 4GBXD 4HXBH 5F7YC 1T0MA 2P48B 4LHUD 3I50H 2OZ4L 4GKNA 1IGIL 4NPYB 1Q1JH 5DHYB 5IFJA 3OKOA 3RTQA 1HI6A 3SDAC 3TBVB 1UB6A 1NAMB 1FBIL 2NY2C 2G9HA 5C08B 4C58B 2DAVA 4MMXC 1TPXC 1QSFB 1CFVH 2WLZA 4P2RB 4PRBB 4HAFA 3JVGC 2K3TA 4DQOH 1T7XA 4GAYA 1HNFA 1PAMA 5GISH 1OF2B 5MHSD 3G6DH 5C0CE 3MLPA 2R0LL 5DUPL 1OPGL 1KULA 1BPVA 3BEWA 3HNTL 2VSCA 4JPVH 5F7KC 3RVTC 5EZIH 5ICXB 4Y5YA 2HRPH 5HHPB 3IAPA 4PP2B 5D70L 3QQ9D 4YX2L 4RFNC 1PBYA 1R24A 4X8XA 5EH1A 4F58L 4PJGF 3DUSA 2XZCL 3HRZA 2HFFB 3TZVD 4IRJD 5EG6C 3VDBA 1NPUA 3DSNA 5E8NB 1PY9A 3OR7A 1AR2A 3O3DA 4J3TA 1MCFA 4TVPD 2IH1A 5I71B 2AJVL 1FIEA 2X5PA 2B1HL 1IKNA 1YPZF 5KZCB 5DDHA 2NY7H 5CHNB 5MP6L 4LCUA 4NQCE 4XXCA 1U8IA 4A6YB 5DQ9A 4LHQB 1SY6H 1D5ZA 4P2OC 5BJTA 4NDMB 4YZFF 5FOBB 1A14L 5I1DB 4OI9A 3KXFA 4QXUH 5CIPA 3RIAF 3WUWA 4PYGA 1JK8A 4CMHC 5IB2B 1UKTA 4JDVB 3FB8B 5I8OH 3CDGB 4X6CB 3VI3E 3SKMB 5EU6A 1R6VA 5T3ZD 5KSVA 1BM3L 4PJEF 2WBWB 1CFSB 4LQFL 4HIJB 1KIRB 3RFZC 5EOTB 4NSKB 3S96B 1IC7H 4UT9H 1G9NH 4X4YA 1ZANH 1NBYB 1BZQK 4M93B 3IJHA 4TTDD 3S5LA 2Z9TA 1W8NA 5GRJH 5IOPB 3JV0A 4Q6YA 4QHNB 4CU7A 1IAIM 3LS4H 1PJ9A 1QFWL 2AP2A 4RBPH 3EDKA 1QFHA 3KYMA 1OTUD 3PP4L 5EPMB 1FGNH 1DQJB 3QXTA 2NMSA 4I9WD 1ADQA 2F19L 5IW6A 4ENED 4ORGB 3TT1L 1CF8H 1CCZA 1DUYB 4I77L 1OAXL 1YEIH 3OKDB 2NY4B 1KYOK 1IRAY 1S9YB 2ZCKL 1CLZH 1TVBA 1VFBB 3LPGA 4XZUB 5F9WC 3HE7A 3QDJB 1NAKL 3MV7D 3QNZB 1B2WH 3SY0B 4G6JH 5DJDB 1UENA 5DD6B 1QD0A 4OZGA 1DUZB 3FFCD 1EH9A 3T0EA 1X3DA 4QKXB 5JW4Q 5HPMA 3ARVA 2AXGA 3QPQC 5IFHL 3SKOA 2GJZB 1O0VA 1CDBA 4M00A 4XP9H 1UH4A 1JNHA 4XC3L 5GGVH 3VXRE 3ARTA 5IM7B 4YEEA 3WIHA 2IANE 3OMZA 1AQKH 2BSTB 2FHBA 3LKSA 3B9AA 1FGVH 1D6EB 2G2RA 3ARPA 4PB9L 2Z91A 1B4JH 2DQIH 2KZWA 5JHLL 3JTSA 2FWOA 5H8DA 4F7EA 3NFSH 5BZWB 3FAWA 1RZGB 2F5BH 4KK6C 4KXZH 5DLMH 4UIMB 2IQAA 5HGDA 1TLKA 4JKWA 4PR5A 1F8TL 3NBNA 4JM2D 4XVSH 1Y18A 5IMKB 5IG7A 3QEHB 12E8L 4RGMC 5DXWA 2P44B 3GMMA 2R0KL 3O45B 2ARJQ 3QPXH 2IAMD 3DTXB 1AO7B 1SYVA 1OD9A 4XP1L 3CFEB 5F89B 1IFHL 3VI3F 4J3UA 2C1OB 1FLRH 4PJ5B 1DN2A 2ADJB 1J1OH 5HI4D 3KYAA 1PYWB 3GMLA 4HK3N 3SGKC 1J0KA 1N2RA 2AEQL 2P49B 4JO1H 1F90L 1FBIH 2YA0A 4WHDA 4G7YH 4J6RH 3VMPA 4TNVK 1JPSL 4LARL 4NQTA 5TDOB 4TUKL 5J12B 1INQA 5E6IC 2VLLB 1ZSDB 3SDDB 1ES0B 3U4BL 5DUPH 1OPGH 1KTRL 5LAXA 4U1LA 1R3HA 2ICWA 4P9HL 1C1EL 3MV8D 4X7DC 1W72A 3OGCA 2XACC 3GSVB 3I6GB 1LWRA 4YHPA 1QLEL 2ZUTA 2ADIA 2X4RB 1CXHA 4MB4A 3LIZL 5KVFL 5D5MA 2GQHA 4L9LC 5LGHL 3BZ4B 5AG8A 3GKWL 3ARGC 1YUHA 4HUXB 1FVEA 2NLJA 4WFGE 1I8IB 4CNIB 3DNKA 4YFEA 3SE8L 4BFGA 3WV0A 4OCNC 1T0MB 3FO1A 1JTPA 1U36A 4TULL 5JIKA 5IFJB 3RTQB 5SWZA 2CLRA 3RIFF 1T2XA 4RMVA 1GAFL 2G9HB 4GBXC 3JVGA 2NX5A 4OIBA 4OCYH 3TF7C 5KN5A 2E7BA 4G8EA 4Q7DA 4U0QB 5MI0B 3O6KH 4FZ8H 4GAYB 2N1KA 1KB5L 5K33A 1KJMB 2FZ3A 4PJXB 3OHXA 2UZIH 4HEPG 5EUOB 4WW1B 3BEWB 1WJ3A 5DMKB 4UI2A 3FAXA 2B20A 1OGAE 4JGMA 2X9WA 3L5XH 3ZSTA 2DYPA 3D2UD 3A6BL 4O2EA 4QO1A 3VXUD 2BY3A 3D25A 4Q74A 4ODBD 2XQYG 3L7EB 1DE4B 5DD1L 3TWCL 3DUSB 3HI5L 3CSGA 4M6OH 4X9GA 1G7JA 1BF8A 1DQQA 1YECH 1MLBB 3QQ9C 2DI9A 1MFEL 3O3DB 3GIVA 3ROLB 1Z6JT 2IH1B 1YYMH 1OSPL 2IC2A 4F7MA 3TZVC 4DKEH 5I17B 4IRJC 3VW3H 1DBKH 1KLUA 3LEVL 1AGDA 5DDHB 1NDMA 2CGRH 4LCUB 2IMNA 4QY8B 2D7PA 1KYOJ 3EOBB 3DX6B 3F7PC 1WZ1H 4JAMA 2XI9A 4OV5B 4I77H 3MBXH 2VNCA 5DQ9B 4XNMB 1D5ZB 2OTWA 3NPZB 3DHMA 5BJTB 1H9VA 1UQSA 1G9MH 2AEWA 2DF3A 1F3DH 1F6AB 4QOKA 4G80A 5I19L 3PWVA 3K8MA 5CIPB 2FH6A 1EO7A 3JBG7 3KPMA 3FQWA 1NAKH 3RZWA 1F97A 1IGJA 4OCXL 2P7TA 4XP5H 5J11B 4NFBA 4OQ1A 3V4PH 5DMGC 5B3JF 4FOMA 3RWHB 4UTAH 2A83B 4PRIA 5L8KB 3LKOA 1WICA 1HSBA 5KSVB 2DICA 4JN1L 4X7CC 2D0FA 4Y19D 1WBZA 3ULUL 1OAKH 1OCWH 1NFDE 3MUJA 3IJHB 3H0TA 2JB5H 2C3VA 4FFWD 3I6KB 2CRYA 4XNZB 5JHLH 4I3GA 1F4WH 2VXQH 2EC8A 4TTDC 4NQUA 3KYMB 3MJ9L 5C0DB 4LQ1A 3VA6A 1TTUA 1ACZA 4LCWA 3HCVA 1UA6H 5HHNB 4BZ1H 3DV6A 5ACZB 1K8DA 3PQYE 1OTUC 5FKAA 2HN7A 1N5AA 1B0RB 3U48A 2R2BA 3HE7B 4ENEC 1KTKE 3KPRD 12E8H 5IESH 3WFDL 1BBDL 5J89A 4PRPA 4L3EE 1WK0A 1Q9KA 4HH9A 2DIBA 4WFED 4YHKH 1CDHA 3WFHA 1FNGB 4MS8D 1H8SA 4OZGB 2MCPL 5DC9B 4AJ0A 4S1SL 5HPMB 2AXGB 8CGTA 1WSST 3SKOB 5D7JD 1B0GA 2AW2A 3C5JB 3VE0A 4KTEL 5TE7H 3O41A 1C12B 1K6QH 4X6DE 2WUCH 3LKSB 1NGZA 4XPHH 1IT9H 4QHUB 2Z91B 4KI5D 3TYGL 4QCIB 3X12B 1OAQH 4FQJL 1BEYH 2FWOB 1S7SA 4TUKH 4EXKA 1HYSD 3WDIA 1A5FH 1NDGA 3U4BH 4JPWL 3WIIH 5GS0L 5DQDH 3LSOA 1CE6A 4LEOA 1AIFB 2IQAB 5HGDB 1BD2A 1HSAA 4OLYH 1BWMA 5JDSA 4PR5B 1S7XB 1QR1A 3WS6C 5JOPD 3KJ6H 1X4XA 5C09B 2B4CC 3UC0H 1Y18B 4ETQA 1FL3A 4R7NB 3IXTA 2YPLB 3GMMB 2Z0BA 1QPXA 4OZIE 1RSFA 4P3WA 2W9EH 4JM2C 4PPTA 3UTPD 5IHLB 1CL7L 1LO0H 3SE8H 3UTOA 1PKQE 2XNAB 3SKNB 1GPOH 1S9VA 2WNGA 3FOLB 3MQIA 3PHQA 2VLRE 4N0YH 2YZ8A 2EH7H 1CXKA 5T1LD 3SGKA 3U9UB 2IAMC 1AGBA 3GMLB 1N26A 1NFDF 3IDYB 5I75B 2X1OA 2RB8A 2B0SL 5HI4C 5A40E 1YEHL 5E6IA 4RRPA 3UBXI 4GKSA 5ESVA 4PJFA 1INQB 2Y06H 3JWOC 4C55A 5CJQH 3QG7L 4QRPA 2ICWB 3CVHL 2VL4A 3OGCB 5GGQL 2DQJL 4RAVA 3OBAA 4YHPB 1P4BH 4L8CA 4KUCD 4L9LA 1RZ7L 3A6BH 3HPJB 5CJOL 5D5MB 1T0PB 4I3RH 4XWOD 4HFWA 1FVEB 2NY1D 5IEKA 1IAKA 1IC5L 3B6SB 4J3WA 2YSSA 3R8BB 5CEZD 2PYFA 4V2BA 1FG2B 1X4YA 5FIEA 2ZUUA 3FO1B 4JO4L 1WISA 2NY2B 2ITDA 4GBXA 4GRWH 2CLRB 3AY4C 5SWZB 1IJ9A 5HYJE 4X6DF 3MR9B 2QQLL 4LNVA 5EULV 2NX5B 1LNUB 1QNZL 7FABH 1FL5A 4G8EB 3K4ZA 4U1KA 3SDXB 2OP4H 1A7RL 1E0OB 1WFNA 4BQ6A 3DUUA 3WJJC 1BQHB 5J1AA 4WFHD 1PFCA 5FCUL 1UM5L 1TVHA 4TSCL 5BV7C 1IGTA 4OCWH 1CVRA 5KOVC 1BVZA 3KLSA 2UV3A 4PRHB 4F7PB 3W81A 4O2EB 5ADOL 5KTEH 3ARFD 4KAQH 5JPMB 1U95A 1KC5L 3VDAA 4G6KH 4JN1H 5MEQB 4XGZA 5JO5A 4M1DL 4A2MA 4OLXL 5B22A 3IU3B 5FYKL 2VR5A 4HBCH 4OM0H 4GAGL 2BSRA 3N85L 3GIVB 3BKYL 4IRJA 1I3GH 1RZJL 4F7MB 5CZXD 5EZOL 4M8QA 1KIUA 1HINH 1BF2A 1ZGLB 3L3OB 4EBQL 1YEFL 2HVJA 2QSVA 1FZJA 4O58L 4MAYD 4W4OC 1OP9A 4JFED 5DHVA 1TNNA 4OSUL 1E4JA 1WTLA 1XCQA 4JAMB 1N7MH 3QISA 1N8ZA 2AJ3B 2DQCH 1TTFA 4WGVB 1I8LC 1UQSB 3VRJA 3LKQA 4Y4KD 4QOKB 4G80B 2LTQB 3L3IA 4NOBA 5I1LA 1JBJA 3PV7A 1JNLL 3KPMB 1RUKL 4K8RH 4NKQB 1OT2A 3LHPH 1BBDH 1HYRC 1FL6A 2P7TB 1MWAL 1YYLH 1XGUA 1QSZA 3LKOB 4K7PL 1HSBB 1XGQA 4S1SH 4QT5A 2Z31D 5KS9A 3QXDA 4ONGL 3TO2A 1WBZB 5EC2A 2APVA 4E42B 5CFHA 5BVJB 3GSNA 2C3VB 2F8VA 2BJMH 3BJLA 2NW3A 3WCYA 4FQCL 4D3CH 3QIUB 1RUMH 5AZ2L 1I3RB 4QRRD 1JNNH 4FHBD 3G5ZB 2AK4D 5BQ7A 4JGUA 4ZAKA 3BOVA 4FFWC 2XKUA 4HEME 2OLDA 1FFNB 3B43A 4LCWB 3QSKB 1A3QA 3CFBB 4LNRB 3NIFF 3LN5B 1NJ9A 3F65A 1D5XA 3DV6B 2I24N 4X80L 2V5YA 4Z7UA 3KYNA 3VFSA 4WUUE 2GJJA 3DYOA 3MSPA 4RGOL 3ESVF 2A9ML 5DJ0A 4K23H 5KSBA 2IJ0C 2VERN 4GRMA 2E9JA 4LSVH 1REIA 2YK1L 4PJBB 1U3ZA 3RI5K 5GJTL 3MV7A 2HLFD 2FJHA 2KH2B 2VDRL 3UO1H 1YQVH 5B3NA 3EHBD 2PCPA 3T4AA 3V0AC 3KPNA 4IRSD 1B0GB 3FONA 3U82B 3FFCA 2JJTC 4QXGL 2VO5A 3VE0B 2EIBA 1NUDA 4MS8C 3O41B 4FABL 1NGZB 3VRLE 4CVWA 3CSPA 4NM8L 3B9DA 4GRWB 4BELD 5D7JC 1YMMA 5TH2B 4CU8A 3MJ6A 2W0FB 1S7SB 4LFHD 4C59B 2Q76B 3MROA 3X17A 1NDGB 3G04A 5MEOA 1AXSB 2VLJE 3MRIA 1CZ8L 5BVPL 3P9WB 3QHTC 4KI5C 1UH3A 1CE6B 5GGQH 4HFUL 4LEOB 3EBAA 3WS6A 3IKKA 1HYSC 3H3PL 3KGRA 3G5XA 1PEZA 1TTGA 5DYOB 5HHQA 1QR1B 4P5TD 1BJMA 3GJFK 5FFLA 2AQ1A 2H6PA 3TT3H 4ETQB 1T1XA 3IXTB 4G6MH 5E8DH 5SX5K 1KG0B 4X9FA 1EO5A 1G6RL 3OL2A 1A6PA 3AU1A 4O00A 1R3IL 4ZOEA 1KSRA 3IFNH 4OQTH 5L8LB 3CNKA 1UACL 3P2TA 1A6WL 3VG0L 1T89C 4ZG1A 5HGBA 3HI6H 2QKIA 4GXUM 5FDWB 1E27A 1XR8B 1N0XL 3JV6A 4GKSB 4L4VA 3UJJH 5ESVB 3NGBB 4D8PA 4RFEA 1GZPA 4PJFB 5EA0H 3K4DA 1WAAE 3STZA 5T33H 4F37K 2UZXB 4DGVH 1ORSB 3ARBA 4EUPH 4I4WA 1MQKL 4TSCH 2IBBA 4RAVB 2WQ8A 3BPNC 5FM5O 4P46D 2GK2A 2VXSH 2R2EA 2X4NA 4GJTB 2ITCB 5DWUH 1Y6MR 1JE6A 2GSGB 3FCTB 1I9IL 4HFWB 4KMTL 3U30C 3MGOA 4GXUN 4XAWH 4OBRA 2ICES 5H94B 1NSNL 5C2UB 4LKCA 2A9NL 4M1DH 4OLXH 4LRNL 1K4DA 3LMJH 4LSTL 4DW2H 4JO2H 1MUJA 3VFMA 4XWOC 4U0RC 5C07E 5IR1A 3LY6A 2FIKA 3N85H 1NBVL 2NY1C 1FLTX 2YN5A 3BKYH 5D1ZD 4KZDH 4WEMB 2J6EL 2ITDB 1LO4H 5CMAA 1FIGL 4EI6B 4KK8D 2FJGB 4CDHA 3CH1A 2YHGA 4U1GC 1SYSB 3VRLF 1WIOA 5KW9H 5EBLA 1XGYL 5C9JB 4L3CA 2AV1A 3MRRA 1AQDA 1DVFD 5ESAA 4OZHB 4U1KB 4Y5VB 4QTIH 4JFQA 1ZWIB 3OKNA 1UJ3C 5J7CC 3QH3B 2UY7A 5J1AB 2ESVA 1QFUL 1N59A 4HXAL 1MPAL 2BVOA 5FM8A 4JZNA 1ZHKA 1TVHB 2RBLA 3E6HB 4WU5A 4OFDA 1IGTB 3HUJB 1PY4A 1T20A 4HC1A 1GC1C 3P9MB 1HIMH 4ZDHA 4P9ML 4JDZB 3T2NH 5JIIA 4KU1A 3B5HA 1S7TA 3QDGE 3R0NA 3D2UA 5FA4A 4K7PH 4CGTA 3VXUA 3TV3L 1U8QA 4U6YB 1I85A 2EYRA 3T8XA 1JRHI 3ARFC 3QNXA 2F5AL 2BSRB 4U7MA 5DD5L 2E6JA 1D5BA 4WV1C 3G6JA 1I9RL 4M8QB 5C0ND 2A6KA 3BZFB 4FTVD 2HVJB 4OB5H 1EGJL 1FZJB 1G7QA 1GGTA 1T22A 1WAAF 3HG1D 1HHGB 1MCDA 1I8LA 5CZXC 1N8ZB 4O02H 2P46B 1Z2KA 4PBWD 2VZ1A 5AYUL 3VDCA 3EOTL 1DLHA 4MAYC 5IEHA 4OCSH 1J0HA 3L3IB 3OPZH 3WD5L 4Z77A 4P3CH 3CFDA 5GZOD 1BJ8A 1UWXK 1SJEA 2VAAB 3VXTB 4JFDD 4PRAB 4X4XA 2M2DA 4G8GA 4G5ZH 3STLB 2PTTB 4O2CA 1FL6B 4L1DA 2FDBP 4F57H 5M94B 2ZUXA 2XTJE 1U41A 5ECJE 4Y4KC 1C5CL 1XGUB 1L0YA 1CFBA 4ZFOA 1IGML 4QT5B 2VUOA 4FZEL 5KS9B 3QXDB 4HPOH 3O3AA 4KDTC 2O61B 3DIFA 1AGCA 2H9GB 4NUGH 4Y19A 4BZYA 2Z31C 4FFVD 2CRMA 3RBGA 4TNWK 2NW3B 2E5EA 4FNLL 2C3WA 3QEGL 1F4XL 2CLZA 2WANA 4H1LG 3VXPA 2YD8A 4N8VG 1DJSA 4YHOL 3RGVD 5D93C 3RX5A 5IK3B 5BQ7B 1VKXA 3NPSB 4R8WH 3MLTA 4PJAE 4ZAKB 1RIVH 3BH8B 4CJ0A 1NJ9B 1D5XB 4JG1H 5E9DA 4Z7UB 1EVUA 3LKRA 4Y2DD 3OAZK 4EUPB 5HHMD 4JRXD 5DJ0B 4ZFGL 2YEZA 4JPKL 5FO9A 5BRZA 3QXVA 2RQ8A 5LCVL 2AJZA 2MQ3A 2V2XB 3MV7B 1R3IH 1NKRA 3MNWA 4NHCL 2P1YA 2PCPB 2H32H 1UVQA 4RGNE 3VG0H 4KDVA 3FFCB 4D9LH 3T2QA 3GUTA 4OAWB 2HLFC 4M02A 5D7JA 2QHLA 3EHBC 1ETZA 4IRSC 3QDJE 1YMMB 2XQBL 4RISL 5IKCB 2NR6D 2YWYA 3BDYH 2DQFA 1JUFA 4ODWA 2ZCLL 3G04B 3MRIB 1PLGL 1CIDA 1S9XB 2LQRA 2GK0A 2P8LA 3MXWH 5HVWA 2DQHL 2FYYA 3N9GL 4KRNA 4GSDH 1GZQA 1MQKH 4H25A 3G5XB 1CK0L 4TUJA 3OJ2C 1OLLA 4K3JL 5T5FL 1BFSA 2OBGA 4XXDA 2Z8WC 5I1HH 1VHPA 1DTUA 3ULUD 1JTOA 4NBXB 2C4FT 4P5TC 4OZ4A 1QBML 3AU1B 3JV5A 5ISZD 5I6XB 1L7TL 2X89D 2B2XH 1T89A 3FO0L 4RAUA 4ALAL 1YDPA 2XN9E 5E2WL 3Q5TA 4ORZC 3HC0B 1INDL 1Q0XL 1MJJA 5T1LA 1SJVA 1TQCB 4DGIL 5IFAL 5A2IH 1CICB 3M45A 3CDFA 5J0BA 1CD8A 3DRQB 4QYOA 4FQ2H 4L4VB 3JV6B 3FQUB 5H2BA 3IVKA 4DVBA 4D8PB 1GZPB 4NZUL 4P2CG 3STZB 1G0DA 5DQJB 1KFAL 2BNRE 1QFUH 4PJAF 3X14A 2E7LC 2BK8A 4HXAH 4OM1H 3O2DL 3ARBB 3BWAA 3DVGB 4Y4HD 2DM3A 3U4EA 5GS2D 4PTTA 5ALBH 2X4NB 4WU7B 5CUSH 2EYSA 2QSCL 3MMEB 5FUCE 3U6RB 1LE5A 3MRPB 1NGQL 3LQZA 4ELMA 1LO2L 3DROA 3A6CH 3C9NB 4P46C 1AJ7H 5D1XD 2JIXA 4LKCB 2O26U 1RVFH 5MENA 3DOSA 2HKFH 1FAKT 4BQCA 2ZSWB 2QHRL 3VFMB 5KSUA 3OG4B 3HFMH 1N3NA 1FZMA 2FGZA 2VABA 4JEGB 5GXBB 4BSJA 3PDDA 2V5SA 4DKAA 3ALXA 1C5BH 5GS0D 4XBGB 2OI9B 1F2QA 5ESAB 2AV1B 3D48R 3MRRB 1E6JH 1CD1B 1UJ3A 1JPTL 3F58L 1I7RA 4JFQB 3OKNB 1SEBA 1WEJH 4OLWL 4KK8C 5E2UH 2J88H 3MC0A 3CX2A 4TOYL 2VN7A 4K94L 2ESVB 1N59B 4N5ED 2BVOB 1KN4L 3P11H 3NCYS 1DVFC 4JZNB 5SX4I 2XTLA 2PUQT 4UV7H 3AUVA 4OF0A 3DMMD 1KV3A 4PB0H 4KUZH 1XCTB 2AABH 1FDLH 2APFA 2Y07H 3KPQA 4ZDHB 3WLBA 1FNSL 2D7TH 4K3DL 1OTSD 4HGWA 2ZUVA 4WFFD 3D2UB 5FA4B 5CJXC 3ULVE 5L6YL 4FZEH 1BQLH 1RJCA 2FX7H 4O51A 1F6FB 3ARFA 3G5YA 1U8QB 2EYRB 3T8XB 5C7XH 2H1PH 1FQ9C 2H32B 3MBEB 1TENA 4MAUL 1T1WB 3MJ7B 3G6JB 1FP5A 4LSQL 4R96A 1NCWL 5EWIL 4HKZB 4KGLA 4ZS7H 3MO1B 1G7QB 1T22B 4MD0A 4MD5A 4NCC1 3H3KA 1TIUA 1KCRL 4NO5A 4CW1A 4NO2B 4G6FB 4MAYA 1AI1L 2E8YA 1MJ7L 4P9HC 3FN0L 4JFEA 1DLHB 1FFPA 5IEHB 1P7QD 4FXLA 3CFDB 3GSXA 4XCFH 4JR9L 4ZFGH 4XVJL 4RFOH 1EAJA 4JHWL 4X4XB 4G8GB 4QTHA 4Y4KA 3P73A 4O2CB 1K5NB 3RU8H 2XWJA 5KSAD 5F71A 4ZFOB 5GZOC 5LGJB 2AGJL 4R4FL 1P53A 4XP4L 4K2UH 1QUNA 1NGPL 2FB4H 4RZCA 3O3UN 4DTGL 3O3AB 1ZKAA 4HIIA 4JFHD 3DIFB 4G42A 2OZ4A 4ERSH 2Z31A 3KXFE 2X9XA 3T0XA 2WW8A 2B8OT 5IHZA 2CLZB 1ACYL 3X13B 2RGSA 3BDXA 5TFSH 2ED8A 2DBLH 3ZKXB 1D3CA 4G7VL 4U6VH 3PABA 5EU6E 2NY6D 4ZO7A 2DM7A 4FFVC 3BQUD 3RGVC 4OV6F 5E9DB 1DQDH 2FEDD 4OUOA 4NBYB 4YDLC 1T3FB 1FRGL 1Z3GH 5E1AA 2ZUQB 3H9ZA 3UBXG 2YEZB 5FO9B 3JWDH 5BRZB 5FYKD 5TPWH 3QFJD 5FDYA 1QZ1A 1V5JA 1MHCA 2AJZB 1PG7X 5CSGA 4FQQA 4URTB 4BKLA 3MNWB 3ULVF 4MNQE 3LCYA 3F5WA 3DECA 5JHDE 4ALAH 3SO3B 1F13A 1YJDH 1HWHB 3BESR 3MLVL 3PIQB 4IRSA 5HDOA 1MREL 3HAEA 3S8WA 3U1SL 2H2SD 1ETZB 5EOCH 1MFBL 2VC2L 1W2KT 3GBML 1A7PL 3SPVA 2DQFB 5FAAA 1JUFB 4ODWB 4Y5XB 4YHYB 5BXFA 4L8SA 3T0EE 2GK0B 4D0CB 3EZ8A 2P8LB 3CGTA 3O2DH 2FYYB 4HV8A 4JKMA 3BD4A 4DK3A 4IDJH 3AS1A 2NR6C 4JY5L 1KOAA 4U1HA 5F9JB 1JGUL 2QSCH 4LVNB 2FL5A 5IROA 4G8IA 1LO2H 4P5TA 4ZO9A 4KJPD 1A7OL 4XMKL 5IMLA 4XTRD 3MRBA 5IBTH 3ETBF 3H3BC 3HB3D 2VXVH 2D03L 4RAUB 1XF5A 4Y1AD 4LCIH 3ULUC 1YDPB 4P48A 3PWPD 1W0YT 1NLDL 4KHXH 1MJJB 5FYLH 1WITA 2GI7A 2KDGA 3B83A 4RNRA 1IQWH 5F21B 4NQEB 5H2BB 1T4KA 1ZGLM 3IVKB 2APTA 3CU7A 3F58H 4RMSA 2ZP0T 4OLWH 3R8QA 2E7LA 1RK1A 2HFTA 4NP4L 3WDHA 4L8BA 1YEEL 4NO0A 3X14B 1JHKH 1K3ZA 2V7HA 2JJWA 1KN4H 3GJFH 5DMIH 3U4EB 2MJWA 4IHOA 3U9PH 4PTTB 1DBML 1QLFA 2P5WA 3M8OL 3BP6A 4PRDA 1LEIB 1FNSH 3I84A 4P4RA 4JZJC 2JE8A 4P46A 1CFNA 5F70A 4Y4HC 3IF1A 3MCLH 3BMWA 1MAML 2JIXB 1T03H 1RFDH 3LQAL 5MENB 3SCMA 2QLVB 4U0RB 3V6FA 3PGFL 2CKBL 3A67L 1HQRA 4LVHB 4QRQA 4JHAH 5F96H 1N3NB 3QIBD 5D1XC 2VLME 3NZHH 1A7QH 1F00I 3PG2A 2F53A 1BQUA 3C6SA 3DI3B 5J6GB 3QUXD 3FQTB 5D5ME 2KBGA 4NKIH 1CD0A 5D1ZA 2I60H 2KKQA 3GK8L 1JZ3A 4C57C 5D2NC 3EYOA 4PG2C 2HJFB 1I7RB 5DJAA 1Z5LA 4HQQH 3B9KB 1DVFA 3HR5A 5GS0C 5F88B 1TETL 4EDWL 3M1BA 3O11A 1QRNB 5IGXL 3BD3A 5DVKA 4NRXA 1XGPA 3BPCA 4HCRA 4UOW1 5GGTL 3BVNA 2PYED 4N5EC 2NX5E 2D0HA 2R0ZL 5CJXA 1SHMA 1H8OA 3DMMC 4PV8B 5ALCH 4N0UA 3P0VL 1GXEA 5LQBH 1NMCC 4LVOC 1OTSC 5INCA 5F7DA 1MRCL 3U7YH 4GQPH 3QJFB 4P5MA 1U8OA 3MLYH 2HA1A 5C0JB 2OX5A 4R96B 3S37L 2HLAA 4RSVA 2VDKH 4O5LH 2YXFA 2PW1A 3IDNA 1TCMA 2FECI 4MD5B 2R1WA 4FTVA 1FH5H 4NO5B 4CW1B 4MAYB 4HLJA 2VXUL 3BPOB 3CC5B 4QLRA 1U3YA 2R2HA 3HG1A 1CDCA 4DFIA 1CR9L 4R0LC 4LK4A 3P73B 3SOBL 4G9FB 4L29B 2XWJB 4DCQA 4JFDA 2EDTA 5IMOA 3WXWL 4Q9QL 1G7HA 2X4UA 4XPTL 2EXYD 1ZLUH 1BHGA 1KCUL 5JR1L 5DJYA 1XZ0A 5KSAC 4M03A 4QOKE 5IUSA 2JJSC 4OCRL 4JFXA 4OT1H 4AEHL 3R1GH 3VWKC 4BFIA 5IHZB 4GAJH 1T04B 2VC2H 3GBMH 3GMRA 4K7PY 2IQ9L 2E9IA 3ZL4H 3IKCA 4PRIE 4Y4FD 3MUY1 3W82A 5EU7C 2E9WA 4WIQA 2J8HA 4C4KO 4MJIE 2EH8H 5EN2B 4YHZL 4Z7WF 4MSWB 1FYTE 3UMTA 2NY6C 3GJFB 5GSVB 5E1AB 1RUPH 2VKXA 3WE6A 3BQUC 4Y2DA 4IOFD 3FHQA 1MRDL 1CT8A 4C56D 1A7OH 5FO7A 4J1UB 2FEDC 2CR3A 4Y88A 4JKPL 5T5NF 4HIXL 1PSKH 4LIQL 1IAII 3ULSA 1A1MB 1BQSA 2DQTH 4KROD 3NTCL 1ZOXA 1CQYA 2GSIA 3IDGB 4UAOB 4ZQKB 5F44A 4AT6B 3EDEA 5ANMA 4GXVH 3ZT5A 2ARJA 4UQ2A 1RZJC 3H42H 3TIEA 2EDDA 4DN3H 4PRPE 4HWBL 3MRJA 5BXFB 4UB0H 3I75A 4NQDA 4L8SB 2H2SC 3GMPA 4N8CL 4HZLB 4HV8B 1RPQA 4L4TD 1EFQA 1BZ7A 3FQNB 1NLBL 4U1HB 5I76A 4N1EA 5K9KB 3MA9L 5H37G 3LKNA 1HZHL 3L6FA 4APQD 4N0FA 4NQXA 1G7IB 2FL5B 1DCLA 4G8IB 4P5TB 1V7NH 3J7HA 3QEUB 2WIIB 1UM6L 3C5ZD 5GIRA 2D31B 5E00A 2XPGB 5IMLB 2YS4A 3P77A 4HT1H 1QA9A 2DQGH 3MRBB 3UZQA 4UV4L 4KJPC 2AJSH 1BD2E 4UU9A 2GUOB 3KDMA 1MFDL 5ISZA 1HKLL 2X42A 3CDCA 4XTRC 5MEPA 1JGVH 3HB3C 1YN6A 3LD8B 1B0WA 1AXIB 3I6LE 4MHHI 3BXNB 4ZPVA 3ARED 5FYJE 4EN3D 5I66B 1T4KB 3RPIB 1TZHA 1YPZA 5IWLC 2CRIA 4ZD3H 3MV01 1X6NA 1DLFL 1PQZA 3MJ9A 4I48A 4LAQH 5TGBA 5I1AA 1KIPB 1UFUA 2HT4D 5C8JA 4JG0H 1UWEL 1VEMA 2DJSA 2W65A 4NO0B 3D85D 5JA9A 3GHBH 3MV9D 2YD2A 5SWSE 4WEUD 2OXHA 1MHPH 2W0LA 1J05A 5IGXH 4IHOB 2PXYB 5E2VL 2XV6B 2P5WB 1QLFB 1YEKH 1J1PL 4OD2A 3BP6B 4XVTL 1Z0MA 3RWFB 1Z9SA 4JZJA 4PRDB 4KMQA 4Y4HA 1NCDH 2FNBA 3QAZC 1DFBL 2YKLL 4P4RB 1CFNB 1O5DT 1AY1L 1CLYL 4GS7B 4OKVB 4MCZB 4H20H 2NXZB 4PUBH 2WBJA 5FB8B 3P0VH 2IPTL 3SCMB 4HPYH 4QRPE 3V6FB 2DTML 5LGKA 5T3XH 3MRLA 3OJMB 2VXTL 4NNPL 5HYQA 2F53B 1AXTL 1BVKA 4AM0A 5D2NA 5HSFA 3L95A 2OJZH 3VXOA 5D1ZB 3KNBA 3VGHA 1T1YA 3GI9H 3EYOB 2FJFA 2A77H 3QIBC 1IM3A 1DZBA 3HC3H 2WAHA 4P4KA 3ARDD 5DJAB 5IVXA 3B2VL 3FQRA 1UYWL 1OLZA 1Z5LB 3WS3B 3QUXC 3HR5B 5C71A 4M7JH 3O11B 5DR5H 4QHLA 3ZHDA 2BY0A 3T08A 5F9DC 1U8LA 2LV4A 4NRXB 4LPWA 1XGPB 3IFPA 4WGWB 3BPCB 4YDVB 5IMMA 1MFNA 1Q0YL 5GS1B 1P1ZB 3RA7L 4KPHH 3DMMA 1CU4L 2R23B 4LLVB 3H7BA 4HK3J 3WXWH 5DURB 4Q9QH 3PGDB 3MLUH 4JFYA 3RWEB 4N0UB 5B39A 3MCKB 5AZEH 5INCB 2X41A 2VIRB 1VPOL 3DX7A 5J9PB 5MHSE 1FPTL 1DSFH 4P5MB 1U8OB 3MOQA 1S7WA 4OJFH 4AEHH 3WSQH 1PGRB 2DI7A 4GRLD 1MCRA 2PO6D 2HLAB 5TE4L 4GG8A 4NKOA 1CGSL 3OB0H 4KVNL 3JTTA 1AP2A 2IQ9H 2YBRA 4LLDA 2ATKB 5CILH 2XKNA 4K3HA 2PW1B 4YPJA 2C26A 3ISWA 2R1WB 3GIZH 4PREA 3CVHA 2CMRL 4NKDA 5GPRA 2HH0H 3U0TA 5J6HA 4Z7OE 3QNYA 4Y16A 2R2HB 3WNPA 3HNSH 3ZHKA 3U7WL 1P69B 4CVXB 5GHWH 3P30L 1R3KB 1MRDH 3UTZB 4P49A 1RZFH 4ODTL 3NH7L 4TVPE 5DRWB 1VFOA 2GHWB 4DCQB 4JFDB 3UJIL 3WFEL 3MV11 4JKPH 1A9EA 2X4UB 3NVQA 3BJ91 4X83A 1L9MA 1S9KC 4LLWB 3BP5A 4FP8L 2JJSA 5DJYB 1IEAA 1IC1A 5C3LD 4OD1H 2WM0A 1M4KA 1KCSH 4JFZL 1A1NB 5GGSA 4OIIH 3OZ9H 2EXYC 5IJVA 4BFIB 1P4IL 2ADFH 1QLRA 3KS0J 1X5LA 4MQTB 3VJ6A 3BMVA 1A22B 5DJXA 3IKCB 1KIQA 1J10A 3UTSB 1EUUA 5TE6L 3HNVH 4N8CH 4H1LH 1IL1A 3VI4E 2X4OB 4GH7B 1KNOA 5T3ZE 3W0WB 4Y4FC 1M7XA 2B1AL 3GSWA 1A2YB 2OR7A 3BQUA 3QFDB 5IQ9A 1LDSA 1GGIL 4XNUL 4RMQA 2Y36L 5C0GA 4Y2DB 1A3LL 1MVUA 3GI8L 1CT8B 1MCOL 5GGUB 5I15L 3K8KA 3ALWA 5H35A 1M71B 2OM5A 4IOFC 3ULSB 4MQ7B 4AZ8A 4O4YH 1MCBA 1JF5A 3AS2A 1MFDH 2HFGL 4I9WE 2GSIB 3MYZA 3UTTB 5JLZA 5KSBE 5ANMB 1J8HB 4UQ2B 1VEPA 4KROC 4PTUA 4K71B 3S35H 2ZCHL 3V5HA 3MRJB 5EIQA 5FGBA 1Q9WA 1VACB 4NQDB 4YHMH 3MV7E 3D3VB 3GMPB 5D1QD 1JV5B 1HOCB 3P3YA 5I1IH 1KXVC 1FN4B 3FFCE 5I76B 1GSMA 3EYQD 2O5ZL 4XVTH 1ZS8B 3BW9B 3LKNB 2APWA 5CP3A 1MCWM 3NZ8B 4N0FB 4F2MA 4NQXB 2YKLH 4M9OA 4XMPL 4ZOAA 2MHAB 2HP4A 3BIKA 1MWAA 4Z7QE 1QHPA 2EYTA 4JJ5A 1FFRA 3O2VH 2OR9L 2BNQD 2I9TA 1MAJA 3FFDA 2R69H 4APQC 3P77B 4WCYL 5AYQA 4PJGB 2QBWA 4B7LA 1R3JA 2DTMH 1X6LA 1OAZH 3RHWF 4UU9B 3C5ZC 3LZFL 3KDMB 3VG9C 2V17L 5ISZB 3ZYJA 3QG6A 4Y1AA 5GGRY 5E7BA 3TPUB 5CSZA 4ZTPH 1JGLH 1XIWD 1Q72L 1ITCA 1EJ6A 5IWLA 2ADGB 2VQTA 3PWLA 1VGKA 1TZHB 1YPZB 2KQNA 4X7SL 4HUVB 3B2VH 4I48B 1XGRA 2EDOA 1B3JA 1IILE 2W65B 3MLWH 5IBUG 3VI4F 1ZA3A 2FX9H 3AREC 4EN3C 1AKJA 4NFDA 4HS3A 4MXQD 5LWYL 2QADB 4OD2B 2HT4C 5F9AC 1W0WA 5DEFA 5EBMB 3QUMH 3D0LA 3NA9L 4CKVX 1Q0YH 3HS0A 4Y4HB 5GZND 1DQML 5ETUA 5F9OL 4LAJH 1IEHA 1YY9D 4JB9H 4WUKL 2Z93A 4UNUA 2VTFA 4FMFA 4KK5D 2WBJB 3VD3A 3B8YA 4PJEB 4I0PB 2AK1L 4ZFZA 8FABA 4HWEL 3MRLB 4YXHL 4ISVA 4X7FC 2DQUL 3WFBL 2DKMA 5D7LD 5HYQB 2PF6A 2ZJSL 3MV8E 2ZNXA 4KJWD 5D2NB 3QRFM 3L95B 1KT2A 5KSBF 3V4UL 5JW4R 1OP5K 1T1YB 1T5WA 1P5UA 3C09B 1IM3B 2ZUWA 4P4KB 3WNNA 3FQRB 2VRAA 2NY0B 1IE5A 3NAAH 3W9DA 5E08L 2BSED 4TRPH 3DVFA 5C0CB 1P6FA 4EOWH 3C6LD 3E3QC 5CP3H 4H1LB 2LE9A 5E4EC 4GW4A 3RY6A 2R2CA 3GBNH 4N8VB 1KJ2L 1R0AH 3ARDC 3W2DH 4F80A 4WHTB 4JM4H 3IYLW 4RWHA 5IMMB 1DDHA 4Z7QF 3H7BB 1V7MH 3UJIH 1G6RA 2MPAL 4OLUL 3QXUA 4JFYB 5DC0A 1OW0C 5L8JB 4OLZL 5C0IB 3OX8A 1DBJL 3DX7B 5D6CA 3WHE1 3BWUC 4LSSL 1T83C 3PV6A 4JGJA 5T1KA 2WWKT 1U92A 3QCVL 1IAOA 2EIZA 4TTGA 4GG8B 4NKOB 1E28B 3Q6FB 2GTWA 3JTTB 1AP2B 5I1KL 1SBSL 4LLDB 4XNXL 4JM2F 2XKNB 5B4MD 2MFNA 3EYVB 4NZJA 3KPSD 3CSYB 3VXUE 4NQCB 2PO6C 4PREB 3VH8G 3IJYA 4KKLD 2D9QB 4OLEA 4M5YL 5CEYA 4Y16B 1P6AB 5IT2L 5CBEB 2FIRT 1TJHH 1MJUH 2X10A 2AXJA 1FZKB 3P4OB 2Y36H 2R29L 3MNZB 1FNFA 2WUBL 4WTZA 1T5XB 3FT2A 1MCOH 4IOIA 2GITA 1PG7H 4U1SA 2FX8L 2VDNH 1BFVH 3BHBB 1MCWW 2C5DC 3JZ7A 2R1XB 5C0AD 3WL9A 3PWUA 1FSKB 4JJHA 2BFVH 3TFKD 2G75A 2HJKA 4YXKH 2HFGH 1IEAB 1Q9LA 1IKFH 4JPIA 4MWFA 5GGSB 1NFDA 3IGAA 4MA8L 3BKJH 2C7UA 4XNQB 3V0VA 5ITBH 1RZKH 1ZE3C 2NXYB 2VWEC 5DD0H 1IL1B 2X1QA 3K2MC 4Y4FA 1KNOB 3C08L 4QRTB 3EFDH 4K94C 3U0WL 3GMQA 3RVVD 1D5IL 4YGVA 4Y19E 5EORH 4H5SB 5IQ9B 3K80A 4PGJA 3WO3B 3DUHA 3QUMB 1MVUB 4XBEH 5E94A 1JYXA 2I25N 3K8LA 5H35B 5T1MA 3NN8A 3RWJB 3IDJA 1CQKA 3QO0A 4KJYB 1GGBH 4NWTL 3GB7A 1VGEH 3CMOH 4XCEA 3QEQD 1FC1A 5FV2A 2IANB 5JLZB 5FGRA 2EDBA 4PRNA 1NFKA 1LMKA 2YD7A 4PTUB 1A6UL 5D8JH 5FUZL 2OTUB 1G0XA 1J0JA 5LBSL 5J13C 3KPRE 5HY9A 1P7KA 1OP3K 4WFEE 1T1ZA 2YWZA 3O2WH 2VDPL 2HJLA 5HI3D 3JUYA 4MJ5A 1QP1A 1RUQH 4JQIH 4CMMA 2L0DA 4NUJA 4L4TA 3SGJC 4F2MB 4YNYA 1D5MB 5D1QC 1DQMH 1RMFL 1QBLL 1K9TA 3BIKB 5E4IA 5F7LB 2EYTB 4JJ5B 1FAIL 1MCIA 4M62H 4APQA 1EXUB 3EYQC 2I9TB 3QDMD 2HMID 3FFDB 4KI5E 4WHYG 4XC1L 1A1OB 1R3JB 1YN7A 4IJ3B 3WUWG 1XF1A 4HWEH 2NYYD 3MOBL 3CFJB 3EYUL 3GHEH 5C0BD 1H15A 3NMEA 5CSZB 2AEPH 5JOPE 3PWLB 2CKNA 4HX1A 1MNUL 4M48H 2CIKA 4M4PA 3S5LG 3AREA 4LVEA 1XIWC 3SGEI 3ELAT 4HKXB 4E0RA 3UTPE 3FT4B 1AKJB 2HVKB 5LXGH 3TNNA 2DLFH 2XXCB 1W0WB 3D85A 5DEFB 1C08A 1CXIA 3D0LB 3GRWA 5KVDL 4LCCC 1HXYA 4JCLA 4NN6C 5ETUB 2ZKHL 3RVXD 2Y6SD 4MXQC 2QJDA 3WJLC 2XIDA 3LN4A 3ZDXE 4F9PC 2Z93B 4OLUH 1NANI 4MNGE 4OKDA 1X7QA 3BZEA 3ARWA 5FO8A 3IU4H 4ZFZB 5GZNC 3L3DB 1DBJH 1QO3A 3H6JA 2DM2A 2DQEL 3S98A 2YMXH 4ISVB 1ZA6A 4ODXA 1YY9C 1QVOA 4KK5C 4YHIB 4Q0XH 2NNAA 4UT7L 3ZTNH 4WRLA 4ELME 5ESQA 3MXVL 3ALPA 3RVUD 3JWNC 4LCYB 1NCTA 4KRLB 4LSRH 5L0QC 3TN0D 4ESKA 5EO1B 2FLBT 4KJWC 4P23A 1YMHA 5GRWA 2XZAH 4GW4B 4YHLL 4PJIE 5E5MB 1S9WA 1H5BA 5CEZE 4XNYL 2DL2A 1OGAB 4LP4A 2FBJL 3I02B 3QXWA 3C6LC 4MA7H 5FHAL 3TCLA 2KPNA 1P2CB 2R56L 4PJHA 1J11A 4KI5F 2QQQA 2I9LA 1AHWB 2YPKA 3K81A 1N4XH 3UBXB 3OX8B 1T83A 1A4KA 1A6AA 4BK4A 4M7ZC 3PL6B 4F9LA 1RY7B 1NCCH 4GQ9H 4OFKA 2EKSB 1NCAH 5HTSA 5T1KB 3O8XD 4WFHE 4YHNA 2FR4B 1U92B 3KYKH 4JKKA 4Z95H 2EIZB 4KRPB 3ZKQD 2GTWB 4XPBL 2VDOL 4YQXH 1U91B 4NN5B 3L9RA 1ZVYA 4GRLA 2JCCA 1BX2B 2V5MA 2PKDA 3C08H 4M6NL 3IJYB 5JQ6L 4OGXH 5CEYB 2AJXH 2OK0L 5B4MC 2Z8VC 4U1IB 5E70A 4NM4L 4NZRH 4ZNCD 4KKLC 3T0AA 1I1FA 4FN0A 1AE6L 5JXEA 4IOIB 1N0LA 2GITB 4U1SB 2UY6A 4J3XA 5I8KL 3ZDXF 1KEMH 2RAMA 1WTGT 3S36L 3WL9B 3LQAC 1K3IA 4CAGA 3PWUB 1KCLA 1IGFH 2G75B 4R3SB 5I74B 4RBPK 1L7IL 4JFEE 4MJ6A 1Q9LB 4V1DD 1NFDB 3IGAB 1BIIA 4HJJH 2J5LB 3EO1B 5DUML 5CD3A 5ICYA 3TFKC 3O6LL 5ENWB 2C7UB 4ELMF 5FF6A 2B39A 2EEDA 5A1AA 5L7XL 4IEFB 1BAFH 4KUCF 3VFTA 5TQ2H 2ICCA 2VZOA 5HGGS 4UNVA 4Y4FB 2B5IB 3OAYH 3M17A 4YGVB 3MRDB 3REWA 4P57A 4PJIF 2OL3L 3MLZL 4MHHG 4HS6A 5T5NG 3PQYB 4GUPB 3QCTH 5JXAH 4Z7NE 4YE4H 5KG9A 3TCXA 4M7KH 3L3HA 4HUNB 4LDLB 4L8DA 3RVVC 5D96B 4YC2B 1N6QL 4NT6A 2IWGA 3PDOB 3HN3A 4L3EB 4K9EH 3GSQA 1U3HA 3B9VA 1IEBA 3NN8B 4QRRE 3IDJB 4CN1A 2EEBA 3QO0B 3KLAB 4S10A 5D71L 3UEZA 2AK4E 3EYUH 3GB7B 5DUBB 5C2BH 2BZDA 2GTZB 4LL9A 2QQKL 3X3GH 1S7RA 4PRNB 1KPVB 4X6DB 3TESA 3BP7A 1KELH 5IB1A 4LASL 1J9CT 1EFXD 3LRHA 5F8RC 4DUWA 4HK0B 3WHXB 2ZPKL 4OF3A 1ZMYA 2AI0H 1WWAX 2Q6WB 3LEYH 2VLJA 1P7KB 3BUTA 5B8CC 5AWNH 1XMWA 1YNLL 4NZDA 3O4OB 3G9VA 2SEBA 4MJ5B 5D1QA 3KPOB 3VXSD 4CMMB 5J3HD 4NUJB 1IGYA 1NAML 2NY5L 4FMKA 5DJZB 5I73C 1JP5A 1UJTA 1YNTA 2A1WL 5HI3C 4PGBA 5I8CA 1FJ1B 1GIGH 4U1JB 1YNKH 5DD3L 3BH9A 2A73B 2VLRB 2HMIC 1BVLA 3L5WA 4G8FA 3AMKA 1ZHBA 1II4E 2NYYC 3QCUL 3KJ4C 4O9HL 4PYHA 4MB5A 2VDMH 1BGXL 4HX1B 5DJ8A 4LGRB 2CIKB 1EERB 3BSZL 1RD6A 5TDPB 4BZ2L 1I1AD 1WAAA 4NKMA 2G60H 3H7LA 1LO5B 2ZG1A 4QRUA 4WEBH 3HPLA 4BSVB 4XNYH 1QSED 4LCCA 4AMKL 1E4WL 1JRHH 2COQA 4PLOB 3SE9L 1KCVL 4RMUA 4Z7NF 3PNWA 1MI5D 5DJ2B 4F9PA 5CCKH 2BVYA 3C60D 3QWOA 3KR3L 1BIHA 3G5VB 5J56B 4U6HA 3BZEB 5FO8B 1UM4L 4PGDA 4A6YL 1QO3B 5I9QC 2F8OA 3RVXC 2Y6SC 1KPRB 1ZA6B 4ODXB 3SJVD 4J3VA 5E0QA 3RX8A 3HI1B 2A6JB 2BOCA 2ENYA 3W9EA 1JF6A 1QVOB 3ECBB 2HYMA 2R0WL 3K46A 1UGNA 1ZEAL 3D1MC 4AK1A 2KL6A 3MACL 3OKLA 4ZYKA 5HYJB 3BIAX 5ESQB 3ZDZE 4QGYA 5F1SA 4EI5A 2W9DL 2ED7A 3MODL 3EDDA 2DDQH 2O5YL 2CJUH 1UEMA 4P23B 4EIZC 1YMHB 4H8WL 2WP3O 4M43H 1HN1A 3RVUC 2OK0H 5JTWA 1S9WB 3QIWB 1H5BB 3TN0C 3WIFA 4KC3B 2XZQH 1K8IA 5EUKB 3R0MA 5F1NB 1G7PA 4XPFH 2X09A 3TCLB 5JMOC 3VXMD 4R90H 1K2DA 3PXJA 4GKOA 3QDGA 3RZCD 3S36H 4NO3A 2OS7A 2YPKB 2I9LB 1YEDA 1P4LA 3LH2L 1IQDA 3DXAD 5JW4N 3VFUA 3MLXL 1HH6A 4ODVL 1DQTA 3STBA 4OUUA 3CX5J 3D6GA 5ADPL 5EU5A 4QRSB 4YHNB 2E6QA 4PY8I 4GKZA 3ZKSD 4LLUB 3FQXA 4LRIC 4AENA 3V5KA 3L9RB 4GRLB 4X6FB 3O8XC 1AD9A 1A64A 4JZOA 4N0UE 4WWKD 4KQ3L 5KVMC 3BGFC 5D9SA 3N50A 4I3SL 1OAYH 4RRPG 1NGWA 3H9HA 4HXBL 4MA3A 1U3JA 5F6HI 1I75A 5IJKC 4XP6H 3I50L 1HHJA 3H2WA 1Q1JL 1MY5A 3G08B 1I1FB 4L1HA 3QWQB 4WNQA 1R5WB 4OD3H 1M1SA 4XWGH 1CFVL 3QJHB 4J8RB 4YO0A 4FTVE 1QKZH 1CBVH 1D9KA 4I0KA 1R3LA 2CKBA 4NRZB 5GISL 4ETYA 1DEEA 2HKHH 3HE6B 3FTGB 3G6DL 2NW2A 5I0DA 3HG1E 3DLQR 4HSQA 5C0AA 4Q2ZA 3OJDA 2XY2A 4JPVL 4PGCB 1BIIB 5EZIL 3TVMD 3V6ZB 5ICYB 2HRPL 3QI9A 4KZEH 5FF6B 3ZDZF 5LKNA 4UTBH 1ZHLA 4JFDE 5E8PA 4WW2C 3TBYA 2YD9A 3CFIC 4I18C 2BXYA 1S7VA 2QSTA 2ICEA 3VWJA 4LHUG 2P8PA 5AD0A 1NGXA 3DV4B 4EDXA 4Q6IC 5C6TL 3REWB 3QUZB 1N64L 4ODSL 1KJ3H 2HAZA 4Z76A 2X4TA 1IGCH 5GGTA 4MNHA 4WUUB 1LK2B 1JZ6A 5KG9B 3RWCB 1EDQA 5D7SH 2UZYB 1NCBH 43CAA 1CXLA 4NT6B 2DQDH 1E4XI 2ORBH 1B6DA 1U3HB 2C3GA 1KEGH 1IEBB 2NY7L 2V9RA 4L3AA 5D7KD 4PY7B 2DIAA 4LKXB 5I16A 1MVFA 2UYLA 3UPRB 2PN5A 1SY6L 4NOFA 1F3JA 1QFWI 3A6OA 4QXUL 5IB1B 5HHME 4JRXE 5K93A 2LU3A 4W4NA 5E8EB 4EJ1C 1N5YH 2VKWA 3V5DB 4R2GD 2CSPA 2NQCA 3BSZH 4BZ2H 5B8CA 5BO1L 1K4CA 1OQXA 1CS6A 2VLJB 5CSBA 4D0BB 2DLIA 2XYCA 4G3YH 1FFOA 5IB4A 3BEVA 2SEBB 4IMLA 5HHVH 1IC7L 4MD4A 1G9NL 4UT9L 4TUOB 1ZANL 1IGYB 1RJYA 4DKFH 5ANME 1NGYB 3VFVA 4AH2A 5GRJL 1YNTB 2Q86A 5C6WH 2W60A 3KR3H 5J3HC 3LS4L 5I8CB 2RFXA 3CK0H 4NC1C 4TQEL 3MRFA 3ZTJG 1VSCA 3BH9B 3QDMA 1OSZA 1UH2A 5SWQA 1CF8L 1BVLB 4G8FB 1JPFA 2XN9A 5DK2B 5CGYD 5SX4H 4NNXB 4LLMA 4NNYA 3MACH 4GO6B 3NCBB 1CLZL 1ZHBB 1KTLA 4J4PA 5C0BA 4AQ1B 3TA3B 4NWUH 3ZE0E 5IIEB 4TYUA 3BGMB 1B2WL 4G6JL 5F1KC 1ULVA 4RX4D 2BVTA 5DSCA 4NKMB 1HHIA 3ULUE 1A6TB 5INDA 3GGWA 1S8DA 2BNRA 2VDLH 3HPLB 5ISZE 4MDJA 2BC4B 2VR4A 4XP9L 5GGVL 3WKNA 1I1AC 5A2JH 2H2PD 1VADA 1PVHA 1B4RA 1AQKL 2FD6L 5JW3H 3VH8A 1FGVL 1U8JB 1HNGA 1OL0A 1YPZE 3C8HA 3I85A 2DQIL 2IPUG 3E0GA 4DEPB 2ICWJ 1NCNA 3NFSL 4PG9A 4U6HB 2F5BL 1HHHA 4H88H 4YZFE 4YK4C 2GEEA 3C60C 5DLML 2BOCB 3KHQA 2GY7B 5C07B 1ZT4A 1BFTA 6CGTA 2VL5A 4LF3A 4ZYKB 1CDIA 4XVSL 5L0QB 4U3CA 3RWGB 4HWBA 4EI5B 4JN2A 3ARYA 1SMOA 5GRUH 1MIMH 3QPXL 1NL0H 4ZUWB 1X5KA 2ATPA 3L5JA 2XKSA 4U2ZA 5D2LA 3BUYA 3CDYA 1FLRL 2FRGP 2VISA 5JA8B 1J1OL 2AEIT 1K8IB 1SVCP 1G7PB 3S97C 1JWUB 5D2NE 3FHAA 4JO1L 3RL2B 5EO0A 3IS1X 4D9RD 2GYSA 4G7YL 1EMTH 4J6RL 4JFPA 4LDOB 5ICZA 1H3TA 4EVNA 1K2DB 5KAQF 5IVXE 3QDGB 2VE6B 2GFBB 4NO3B 1YEDB 1P4LB 5CZVH 2FHCA 3VFRB 3VGAC 1VFAA 2P8MA 1HILA 3NA4A 1G7LB 4OUUB 3BKMH 3QXAA 1C5DA 3RZCC 5EU5B 4KVCH 3O6MH 1L0QA 1QYGH 4GKZB 3CFCL 3FQXB 4UDUA 3S3SA 5IHBA 4D9QD 5EIVA 4AENB 2VJXA 4JLRA 1MHHA 3V5KB 4YBQD 3O8XA 3WXVH 3ZE0F 3DX9A 3FB6A 5JZ7D 5D72H 4MXVE 3CCHA 1AD9B 2EXWD 3FB7A 3BE1H 2X4QB 4WFFE 3ULUF 5D9SB 4ONHB 5C6TH 1ZLSH 4PGZA 1WFTA 3H9HB 5IJKA 1N64H 4ODSH 3O6FA 3O9WB 4MA3B 1FVCA 1MCSA 4F7CA 2D9CA 4WWKC 1F58L 1HHJB 4CU6A 3AM8C 4OFIA 4E41D 3MRGA 4NHUA 4ZXBA 3KPLA 4CL7A 2XTJB 4OCYL 4LLYA 4YO0B 1D9KB 4LBEA 3O6KL 1R3LB 4FZ8L 1DEEB 2NW2B 2BSSB 2CH8A 5EFIB 2UZIL 5B21A 4Q2ZB 5DMGD 4FQLH 5AEAA 3QI9B 1NC4A 3L5XL 3G6AB 4I18A 3QZWA 1Y0LA 1ZHLB 4OI8A 1J0ZA 1I7TA 3TBYB 1S5HA 1OB1A 2YPVH 5BO1H 1NC2D 4BH8B 4F7TA 3TVMC 3OAUL 4FXGA 2ICEB 4OTXH 3VWJB 4PJAB 1BLNB 1CXEA 3HZKB 4M6OL 4BFBD 1NGXB 4EDXB 5CJ5A 5HHXH 1YECL 2CO6B 4KY1H 4Z76B 2X4TB 4MNHB 5HHOD 3RBSA 4JFHE 4PJ7A 4N0RA 1WZKA 4K07A 5IBUB 3WNKA 3O3EB 1YYML 4BA8A 1U8HA 43CAB 2DS4A 4DKEL 3QUYD 4GW1A 5EU7E 4UQ3B 3VW3L 2AVGA 1DBKL 4R6UA 3ULVH 5IVXF 4CBPA 4TQEH 2CGRL 1YEGH 4MNQA 2CDEA 1WZ1L 3RNKA 4KHTH 4BQ8A 2UYLB 3MBXL 4RGNB 5JHDA 2MMXA 4ZUSA 1G9ML 1F3JB 1UEYA 4AEIH 4NJ9H 2NTFB 3AVEA 3O4LD 5AG9A 2O5XH 3DVNB 1XF3A 3QA3A 4XP5L 4TN9A 32C2B 2GCYB 3V7AE 3V4PL 4MXVF 2XFXA 5FYKE 4UTAL 1K4CB 1EPFA 1EFXA 3QFJE 3TIDB 2FEEL 4JFFD 1EBPA 3IXAA 1LP9A 2EDRA 4R2GC 1OAKL 1OCWL 4BQBA 4MD4B 2CR6A 3B3IA 1I8MA 2FD6H 4LDEB 3VFVB 2JB5L 4JO3H 2Q86B 2RR3A 2W60B 3TLRA 1P9MC 4UINH 3B5TA 1F4WL 2VXQL 4NIKB 5IW1A 5DJ6A 3MRFB 3PWJB 2LU7A 4YGAB 1HWGB 3IFOA 3KYOA 4PIRF 5T1DH 1UA6L 3D39D 5CIPH 4WHYH 3U7AA 4BZ1L 3CXDH 4OF8A 2XN9B 1U8PA 3P4LA 4PJCF 4LLMB 3KJ4B 3OKKB 1JHTA 1KTLB 1UXWA 5C0BB 4J23A 2R4RH 1XT5A 3PJSA 4YWGL 4NQVA 3SDCD 4K55A 4AIOA 5IESL 5C86A 1X5ZA 5CGYC 4PJ8B 3WO4B 1VA9A 4YDJA 1U8KB 4YHKL 3UDWC 5DSCB 4MDIA 1HHIB 4JHZA 5INDB 1S8DB 5HGHB 2BNRB 3E8UH 2NZIA 5DI8A 1I1AA 2A6DB 4B7IA 5HJ3A 3EJJX 3QHFH 4Y1AE 4R97C 2VLKD 5TE7L 3PWPE 1CL7I 1K6QL 1VFUA 2WUCL 3VH8B 4XPHL 1IT9L 3IDUA 3WN5B 3MFFB 3JV4A 1OAQL 1BEYL 3T0WA 4PG9B 1ADQH 1GGYA 2H2PC 4XBPA 1A5FL 1HHHB 5DA4A 2AJUH 2CXGA 5AUMA 3LKPB 4UT6L 2Q7NA 3WIIL 3C60A 5DQDL 1J1XH 3W5MA 3U46A 35C8H 4MLSA 3ZYOA 2XA3A 3UJTH 4WO4B 3DURA 4OLYL 3CFCH 3ZSSA 2VL5B 3SJVA 3KJ6L 2E9BA 3TBWA 3UC0L 1HH9A 3ARSA 4Z8FL 4G6AD 3AFLA 4GLRI 5CBAA 5B3JE 3QULB 1GL4B 2WINA 1XAUA 4OIAA 2GIYA 4XCYA 2W9EL 2ATPB 1LO0L 1S5IH 4HJGA 3BUYB 4Z7WA 5C08D 2VISB 3WIHH 1GPOL 4N0YL 1YA5A 2EH7L 5EZLA 1QSFD 4P2RD 3SDAA 4GKNB 1XF2A 3E2HC 1F58H 3OKOB 1HI6B 4QXTA 4TNVF 1UB6B 1WIPA 5EO0B 4OCMC 2E27H 4EVNB 4AQOA 1IVLA 4L5FH 4JREB 2P24A 2Y06L 3PHOA 5CJQL 2P8MB 3RZCA 4GFTB 3N06B 1FG9C 3DXAA 4YBLB 1CIUA 1P4BL 4Y5YB 1MY7A 4UDUB 1PG7W 2AXFA 2CLVA 4JLRB 1MHHB 3QUKA 1DR9A 2ZOKA 3GSOA 3O8XB 1IM9A 3DX9B 3FB6B 4I3RL 3AS0A 2CIIA 2IF7A 1QACA 3CCHB 3FB7B 1R24B 3OAUH 4DN4H 4OFVA 2OR8A 3NABH 1NUNB 3HRZB 3HTLX 4YBQC 1SEQH 3C8KA 5JZ7C 1PZUB 3O6FB 4WWKA 1IAIH 1FVCB 3AM8A 2EXWC 4DFHA 3OR7B 4F7CB 5KZCD 4R26L 3IT8D 1JHLH 4DOHE 5EO9A 4ZXBB 3NACH 3KPLB 1WBXA 3FRUA 2Q1EA 1CGVA 4LLYB 7FABL 1AGFA 4HKBA 2OP4L 1V3KA 1W72H 2MCG1 4P2OA 2Y25A 1U8IB 4M4RA 3KXFB 2DWEA 2I26N 4OCWL 3WUWB 1NC4B 1JK8B 3F6IA 4F33A 2EDLA 3K0WA 3LV3A 5F7WC 1JFQH 4HWUA 1FE8H 1XGTA 3T09A 4J2XA 1CGTA 3TVMA 4JVWA 1S5HB 3S3PA 5KTEL 1OB1B 3WEXA 4KAQL 4FXGB 5EU6B 5IQ7H 4G6KL 4MJIA 5HVHC 1FZOA 4HGMA 1KJ2A 4GAFB 2M1KA 2CK2A 4HBCL 4X4YB 1RI8A 3CZJA 1FYTA 4OM0L 3O0RH 1YEJL 4GG6A 3S5LB 1K85A 5HYSG 2YC1A 1YZZA 1I3GL 2X9YA 3NCFB 2BOBA 3UZVB 1HINL 4UOW0 1UT9A 2NY4D 1NCUA 2J8OA 3B4NA 4MNQB 4ZUUA 2CDEB 5C0FA 5IW6B 3QUYC 1N7ML 5E5UB 5JHDB 2XOTA 2DQCL 3O3BA 3E6FA 4OFYD 5J8OA 5F3BA 3AB0B 1U58A 1RULH 2DJ4A 3THML 3BZDA 4H26A 2YD4A 1TVBB 4X4MA 4XT1C 3N1QC 4YWGH 5TQ0H 1A7NH 2IEPA 4K8RL 1E6OH 1XF3B 3QA3B 3LHPL 1HXMA 4FA8A 1WF5A 4N0CD 4WI6A 1FC2D 1T21A 1YYLL 3WNLA 3LDBB 2XFXB 4NN7C 5JOFA 1S3KH 3T0EB 5KBNC 1DN0A 4ZNEA 5C9KA 3T3PE 4M3JA 4MQXD 1TXKA 2QQNL 1JNHB 3T77A 2PW2A 1WCQA 1I8MB 1S7QA 5DFVD 2G2RB 3IFLH 5F7MC 4NJAH 1FV1A 2BJML 3VFGH 3L5HA 4D3CL 3JTSB 1M7DA 2VH5L 4F7EB 1INEH 1RUML 5FGCE 2WQRA 1JNNL 4XI5D 5CKGA 5DJ6B 4UT6H 2KZ1B 3ORJA 3NFNA 4YDKH 3IFOB 3VA2C 1AO7D 4L4TE 1U8PB 3DJ9A 4F3FA 4JY4A 3SGDH 2YUVA 1UXWB 1GHFH 4Z8FH 4PJ5D 4K23L 5IG7B 1EBAA 1SJHA 4QF1A 3GNMH 2EZ0D 4HMDA 4LSVL 1SYVB 4YDJB 2DLEA 5F1IA 1O7VA 2EE2A 3UO1L 1AD0A 1YQVL 4RX4A 3SDCC 1NBZA 5DI8B 4FQHA 3S88H 5SWSA 2F15A 1C8PA 2WIMA 1N2RB 3T65A 2FLRT 1MFAH 3SDDD 3MRMA 3OF6A 1JGDA 5HI5D 4AL8H 4LPXA 4FXKA 3JV4B 1OVZA 1FNEA 3AS3A 4XBPB 3HLAA 1NMBH 1I4FA 1EV2E 3IETA 5I0ZA 5LAXB 4X0KA 4U1LB 1R3HB 3WMSA 1Q9OA 1W72B 3U46B 2FH8A 4PS4H 3DURB 4ONFH 4Q97A 1U0QA 3EOAA 3MV9E 1HKFA 1T80A 4FS0A 3TBWB 3ZYIA 1TJGH 2ADIB 1HH9B 5ID1A 5DGQA 3ARGA 3TT3L 2DMKA 5CBAB 5DA0B 1FO0A 1YUHB 5EC1A 1JL8A 2NLJB 3HZMA 4G6ML 5E8DL 4XCYB 4PD4K 3HAEG 3RTQD 3T0DA 4Z7WB 4G6AC 3IFNL 3T3PF 4OQTL 3SDAB 4R26H 1JI1A 1XF2B 2XQYK 4NFCA 1CE1H 4IOSD 3I9GH 4LFHG 2NY5C 1QOKA 1TPXB 1J88A 4XRCA 3ZYZA 4LHUA 5FM5M 3HI6L 1BZ9A 1WZMA 5J4MA 3TO4D 5KN5B 1RIUH 2X05A 3UJJL 1FORL 2EE3A 5EA0L 3E3QE 1CDGA 1GOHA 3L3KA 2FZ3B 3CMGA 3K2UH 3PHOB 5T33L 3OHXB 5CINL 3NIFE 3RZCB 1OTTD 4DGVL 2GT9A 2GW5A 2HFEA 2CUHA 4MMZC 1EVTC 5FYJH 2VB5A 2VXSL 2DYPB 2CLVB 3QUKB 4RFNB 3ILPA 3GSOB 1IM9B 5DWUL 4PJHE 3WYRA 3D25B 2CIIB 1F4YH 5KVEH 4MGXA 4XAWL 1A3RL 4WY7H 3LMJL 4MCYA 1NMAH 4NZTH 4N9GA 2RHEA 4DW2L 4CVUA 1G7JB 4ZFFA 1DQQB 3C8KB 4JO2L 1KXQE 2P47B 4WWKB 1YEJH 3MRKA 3IDIA 4X8JA 3TZVA 4Z7VA 2MSPA 5DRZA 1AFVH 4KZDL 5I71C 1LO4L 3KPPA 1MCLA 5EO9B 1J7VR 2YA2A 1KLUB 4MX7A 5KW9L 1WZLA 3FRUB 5IB5A 1A6ZA 1AGDB 4E41A 1NDMB 4MB3A 4HKBB 2JCCE 4QTIL 2FATH 4P2OB 5CEXA 1M6OA 2OTWB 5SV3A 5M95B 5FHBH 5ID0A 1ZLWH 4Q9CA 4F8QA 3V0WH 2IBZX 3PWVB 3PDGA 4CMHB 2DWEB 3THMH 2XWTA 2AKRA 3FQWB 4LEXL 1HIML 4F33B 4DZBA 1MLCA 2FO4A 3LV3B 5D7IE 1IGJB 3T2NL 1XGTB 3N1MC 5M7QA 3HMXA 4N1CA 3WEXB 2Y72A 4PRIB 4U6XA 3RWDA 2R4SH 4MJIB 3F7QA 4H8WC 5DZLA 3VGDA 2QQNH 3CVIH 1ED3A 1CGWA 1SJXA 4GW5A 1FYTB 1KBGH 1EA9C 3H0TB 4QHKJ 1U8MA 5E2TH 4RCAA 2YC1B 1RURL 5HHOA 2P42B 2VH5H 4KK9D 5JORA 4HHAA 4OB5L 1I9JH 2YUWA 5TDNA 3F7YA 3I3DA 3QUYA 3KWWA 4ZUUB 1RIHH 3HE7D 3HCVB 4O02L 1H3PL 2NY4C 3E6FB 1K8DB 5CZKA 5F9WB 1U58B 1GRWA 4OCSL 5FKAB 2HN7B 3OPZL 1N5AB 3CSBA 4H26B 4P3CL 3WFCH 3Q1SH 2R2BB 3X11A 2VZVA 4G5ZL 4PRPB 4F57L 1Q9KB 1T21B 4HH9B 4PJHF 3WFHB 5JOFB 1TJIH 3SQOH 4HPOL 4N0CC 3ARZA 3FOMA 3T77B 3ZE1E 2PW2B 3OKEA 1ZTXH 4X5WA 2I07A 1QQDA 1S7QB 4NUGL 4W70A 1RHHA 2J8UA 2A6IA 4BH7A 3I2CH 4TVPH 1FV1B 3VD5A 2VITA 4MQXC 3S7GA 2ZSVA 1M7DB 4I13B 1ZV5A 5DHVH 2DD8H 5L2KD 5DFVC 1QEWA 3RL1A 5C09D 1LEKA 2ID5A 2JCCF 2DOCA 4R8WL 4ODUA 1RIVL 2W9LA 3LSOB 3MZTA 5FKPA 1EEYA 4WTXA 2YPLD 1BD2B 5GSRA 1HSAB 5JDSB 4JG1L 3ZTJH 2DMCA 4XI5C 3PGCA 4F3FB 4JY4B 2XT1B 3D39A 4MZ2A 4RGMB 3U83A 4HWZA 4PD4J 4HF5H 4LPCA 3RI5F 4X6BA 1FL3B 3ILQD 5D7IF 4JM2A 4QF1B 2C4XA 3SN6N 3CJJA 3HKFA 3BI9X 2BNQE 5T3ZH 1AD0B 1S9VB 2IAMA 3PHQB 5TF1H 1WC7A 5JDJA 3GSNH 5SWSB 2EZ0C 1SM3L 5I1JL 1AGBB 1WWBX 4D9LL 3T65B 4GMSL 5E56A 2PR4H 1JGDB 5E6IB 1FORH 5J12C 3NCMA 4YXLH 3BDYL 3VGGA 3DSFH 4EQ2A 3HLAB 3SDDC 5MERA 3D5OF 5EZJA 1I4FB 5CINH 3IETB 4QRPB 4AIXA 4G9DA 5HI5C 1Q9OB 5GGVY 3MXWL 4GSDL 3P4NA 1KENH 2H45A 2YRZA 2LVCA 3K1KC 1AR1D 5I30H 4L8CB 2X40A 3MV8A 4L9LB 3EYFA 3OXSA 2RJMA 3LS5H 1Q94A 3ARGB 5FUOH 3T2PA 4ZFOL 1FO0B 5I1HL 4Y2OA 3BP4A 4LPYA 5EC1B 5E6ZA 3HZMB 2OTPA 5IEKB 1A3RH 1B88A 5SWZD 1IAKB 2EKJA 5DS8A 1DANU 2YSSB 1V3MA 3SE4C 2PYFB 1PDKA 4NPYA 5DHYA 2B2XL 5KAQG 3AY4A 3TBVA 1NAMA 1A4JA 3R06A 3ZE1F 3RTQC 1G9NC 5KJRL 4GBXB 2BY1A 2XXMB 5D7LE 4ODHH 1QSFA 4LHUB 4PRBA 4C83A 3N0PB 5A2KH 4FQ2L 4F37F 1FL5B 2UWEF 5MI0C 2F58H 3MNVA 3TJEL 3WJJA 4PRHD 3DUUB 4L4JA 2B4CH 2YA1A 4OM1L 3TO4C 2APXA 3INUH 5HHPA 1N6UA 1EO8H 4PP2A 2GT9B 4CJ1A 1EZVY 5E7FA 3ET9F 5ALBL 4LEXH 5F7FA 5CUSL 3BAEH 5E99L 2JELH 1MIEH 3ILPB 1OTTC 3VXNA 3A6CL 4C4KT 3TH2T 1U95B 3HZYA 1AJ7L 4XGZB 5JO5B 1RVFL 3MREA 4N9GB 5E8NA 2DL9A 5EDXA 2HKFL 3WNOA 1ZLUK 4B0MM 4P5KA 3HFML 3IDIB 4X8JB 3TZVB 5DRZB 1RURH 4IRJB 1EEZA 3BKCH 2WMPA 3KPPB 1CYGA 4U31A 5EOCJ 3JWOH 3L1OH 5CHNA 4MX7B 1C5BL 4W4OA 5IB5B 4Z0BH 1A6ZB 3KAAA 4E41B 1E6JL 3EDFA 2VDQL 4AIZA 4A6YA 1WEJL 4W6WB 5DHVB 5E2UL 2J88L 1XCQB 4X7TA 4Q9RH 5FOBA 1EEQA 2N56A 5I1DA 3KPSE 4S1QH 1M6OB 1G1CA 1H3PH 3RGHA 3VRJB 2I27N 1X5FA 3LKQB 4IS6A 3P11L 4M1CD 1ODAA 4UV7L 5I1LB 2XWTB 5L88H 4NGHH 2AKRB 1MSPA 3QQ3A 5ITFA 4P3DA 4PB0L 4KUZL 1MLCB 2AABL 4DZBB 2FO4B 3CDGA 1FDLL 2Y07L 4HS8H 4X6CA 2F9BT 3P0GB 2D7TL 3IJSA 1C7TA 1U2HA 1CFSA 2BDNH 5DFTA 5HVHB 2BRRH 3S9DB 1XGQB 1J87A 4UUJA 5JW5A 1BQLL 1CXFA 1HEZA 3TO2B 2FX7L 1ZGLP 1X5XA 5EC2B 3QIUD 1IARB 5C0AE 4U1MA 5C7XL 2H1PL 4GW5B 2EICA 2IBZY 5ILTH 3GSNB 2OQJA 5L9DH 2AS5M 1U8MB 2H3NA 4FG6D 1EHXA 4LCWD 4XNZC 5HHOB 4OBSA 3KG5A 4PLNC 6FABH 4HULB 5JORB 5EPMA 1RUAL 4HBQA 1Z0NA 3W39A 4ZS7L 4ORGA 2Q8BH 4LSUH 5BV7H 2EDJA 3OKDA 4POUB 5LG1A 4AG4H 3SGEH 2JF1A 4KK9C 5HBBA 5JIHA 4HC1H 3CLFH 3KYNB 3VFSB 5GS3A 3V6BR 3WHE0 2BRQA 5CLTA 4XCFL 5B39G 3BYTA 4K7FA 3HE7C 4RFOL 5KSBB 5I1CH 4FQPA 1JJUA 4GRMB 3W5NA 5DD6A 1DUZA 5CP7A 3RU8L 1GOGA 4D94A 3KPRA 2FJHB 1NANH 1TQBC 2X4PA 3AGVA 4K2UL 3C2AH 1Z9OA 2FB4L 3T4AB 2JJTA 3KPNB 1CTOA 1SM3H 1CLOH 3FONB 2J4WH 5I1JH 3FOMB 3RVWD 4TNWF 2BSTA 3MLSL 3OKEB 4GMSH 1MCJA 2PETA 4ERSL 1D6EA 1QQDB 1RHHB 4BH7B 3QEQE 3RQ3A 1RZGA 2ZSVB 1P7HL 4KQ4H 5TFSL 3MROB 2DBLL 4MLIA 5MEOB 1QEWB 1LHZA 1L9NA 3L5IA 1MEXH 4U6VL 4D0DA 4UIMA 3VCLA 1MRFL 5FKPB 1FNLA 1EEYB 5GSRB 2XRAL 2EDFA 5HHQB 3AROA 5IMKA 1DQDL 4RMRA 1Z3GL 2H6PB 4HWZB 1URLA 3DTXA 5BS0D 1AO7A 4X6BB 5KVGH 1T1XB 4JM2B 5F89A 3JWDL 2W0KA 5DO2D 3L7FA 5TPWL 2DN7A 1IBGH 2C1OA 3QDME 3B5GA 2IAMB 3ILQC 2Z35A 5E24E 2ZUSA 5KJRH 3DYMA 3LPWA 3IDYC 5I75C 1YJDL 5HGBB 2AJYL 2DJUA 1CVSC 1G6VK 4PBXA 5C0BE 2QKIB 1A6VL 4YEFA 1E27B 2VLLA