4DH2A

Crystal structure of coh-olpc(cthe_0452)-doc435(cthe_0435) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
b'IHEAETADYILDVLVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFDYNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGSTKKYSLITFGESNFCDFDLKPILAVLKEGKVEIEKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome anchoring protein cohesin region
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
total genus 31
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dh2A00
5AOZA 1AOHA 1ZV9A 4FL4C 4UYPA 4WI0A 3KCPA 4IU3A 4UYQA 2VO8A 4WKZB 1TYJA 2VN5A 4N2OA 1ANUA 2BM3A 2VN6A 1G1KA 2JH2A 2Y3NA 2XDHA 4UMSA 3FNKA 5G5DA 3KCPB 4FL4B 2W1NA 4U3SA 5LXVA 3F2LA 4IU2A 2CCLA 3UL4A 4DH2A 3GHPA 3L8QA 1OHZA 2O4EA 2OZNA 1QZNA 2ZF9A 5K39A 3BWZA 2B59A
chains in the Genus database with same CATH superfamily
1BECA 2A9MH 2HCZX 2UUDH 5A40E 1P4BL 5FKAB 5JW4N 4ZUTB 3NGBC 3PWUA 2X0VA 3TYGL 2AITA 4X83A 2ICWI 5GGRB 2ADGB 3J7HA 2ADIA 1UASA 3GSNL 3UO1H 1MH5A 2EDWA 3U6RA 4E41A 5LNDA 4PWIA 2IDCA 2HFGH 5ICYA 1G5GA 1VZGA 3D85B 3QYMA 2DTML 4TSCL 4EZMA 3O45B 4X98B 4YNYB 4NQVB 1I31A 1MFVA 4LLMA 3W0WD 5FYJE 4KDTA 4O2EB 3CQPA 2K3HA 1TJIL 2K6ZA 3P4MA 4P9HL 4X9IA 3ZE2B 3MR9B 2E27H 2R4SH 2FRGP 1HCFX 3EH3B 3KJ4B 3DNKA 2XZZA 1J1OH 4FJZA 3ULVH 3KGRA 3MGAA 1WIUA 4KKQA 2BNRE 2LW3A 3MA7A 4N2CA 5C2BH 1MHCA 4Y1AD 2YS4A 1TLKA 2DWYA 4QRUA 4OVVA 1NC4D 2WQSA 4M48L 1OCOB 4ZMAT 2AAVA 4ELME 1KXHA 7PCYA 1SOSA 2YPVA 1JGLL 4NKIL 2FB4H 2EXTA 4MJIE 4U1MB 2R1YA 2QQLL 1PZAA 3CIAA 3GK8H 3TIDA 4JQXC 3BWZA 3RKDD 4XPHH 1MFBH 1I1AD 3KW7A 2GK0B 3UJJL 5F1SA 3VFSB 1XZWA 3N41F 3RTLA 1MRFL 1Z5HA 2YN3A 3LKOA 2VKXA 2AEPH 1QPXA 3CXHJ 4TM9A 5E94A 1NM4A 2VXVH 3ARSA 4WAFA 3QUYD 4TTDD 4XH2A 4AEIH 3UTZA 3H3PH 4KVCH 4TNVF 3QEQE 4ES9A 4CMMA 4KXDA 3GJFA 5SWSE 3L6FA 2CJTA 4OQTA 2ZJSH 4TPRL 4N5UA 2WMPA 1C08A 4NDMA 3LEYH 2LE9A 3MKKA 4CJ0A 3BPNC 2UYLB 3FAXA 4NJ9L 3BGFC 4ZYKA 4Z7VE 2CCVA 4AVIA 1KYAA 1G94A 2H41A 1F97A 3HUJB 1YEJL 4QRFA 4JPQA 4JO4L 1IJ9A 2ESVE 5HYSG 1Y07A 3FOLB 4ZDHA 4OLZL 3GHPA 1U41A 4PRBA 3I50L 4CNIB 2GCYA 1SNRA 1KCRH 3AXLA 1S9YA 4XOCA 1R24A 3N42B 4JCLA 3T4YA 5T33H 4NKQB 3W37A 1OP5K 5CSGA 2J25A 2EDNA 4Y8AA 1BQSA 1NWPA 3CDYA 4DETA 2WWKO 2EIMB 5T8IA 1T1ZB 1XIWA 2DEXX 5I8KH 3UEZA 1I3RB 1YN7A 3MNMA 2R1WA 5FB8A 5D2LA 1VEOA 2AK4D 3EAKA 3NCBB 5CBAA 1TZGL 2VW4A 3O3UN 4FI6A 2B14A 2VR8A 4PQXA 5CWSA 3WTXA 4GW5A 3GT6A 1PSKL 3L4WA 4C47A 3MJ7B 2Z91A 1AOHA 3U4EA 2NYYD 1TOXA 3HZ3A 5KN5A 2JI3A 4BA0A 5I1EH 3QCVL 5D7LE 3IJ8A 3SN6N 4ODSL 2Q3ZA 1T7VA 4KHTL 4LL1A 4LOUD 5DMIH 4GBXC 2VL4A 5MI0B 1OO2A 3H7BA 1U6AH 5BVPH 2FO4B 3HBPA 2PTUA 1X5YA 3CSTA 1WK0A 2JTDA 4LLQB 4F8NA 4MD4B 1DBJL 1KJ2B 3L4XA 5JOFA 3APDA 4BCZA 2VN3A 4PGJA 5EIIG 5EN2B 2P26A 3L3GB 2Q9OA 1F11A 3L54A 1DQDH 3OKYA 4P5MA 4PJGB 4CSPA 3W0WA 1XGYL 4I85A 4EKXA 4N8PA 1SN0A 1TSHA 2Z3FA 2GBAA 3MNZB 4ZJ9A 3ASWA 3T8XA 4N8VG 5T1LB 1KGXA 4UB0H 2VDPH 35C8H 5AOLA 2CALA 4RSVA 3WFZA 3LVEA 3GMNA 1E90A 5I75B 1IBZA 5L88H 3QQ3B 4DOHB 4JGUA 4E36A 1Q9KA 3UZVB 4ETYA 4Y1AA 2QHRL 4JDVB 4LEEA 4A67A 1JD7A 4YSEA 1N6QH 1NC4A 2RQEA 4U4BA 2DYPA 2IV8A 4HUUA 3TTSA 1QUPA 1QO3B 4FQXB 2ZYSA 3ARYA 2BSDA 3EUUA 3V7MA 1KCWA 2BNRD 5CCJA 4BH8B 4DFIA 2Q7YB 1QEWA 1KJMB 1WP6A 1YMHA 5GSVB 4UV4L 3M86A 3OGOE 5IBTH 1THCA 2C9XA 4WU5B 3SIKA 3P77A 3CHQA 2WB1A 4TYUA 3L1OL 5TE6H 2OMXB 1A65A 4MJID 4MNHB 1YNLL 3G5XA 2AQ1A 4JG0H 4YE4H 1YUKB 5BMFH 5K93A 4TS6A 5AZEL 1S3RA 3KPPB 3OKMA 3REVB 1NGZB 1O75A 3E80A 4PJAA 4XHJD 3TJEH 2X4OA 3IYLW 3QUYA 4U1NA 4PS3A 1RK7A 3OSKA 5SX4H 3RFZB 1CDIA 1M2OA 2QJDA 4NI3A 4U1KB 1TJGL 3IE4A 3SPIA 2ZOOA 3RIAK 3U9PL 3GDCA 3P0VL 4YAQB 3G04A 3ZHKA 5IVNA 3WGVB 2VZSA 3IM1A 3SPVB 4N8VA 2FO1A 1ET7A 1KTCA 5IJVA 2ZPKH 3CVCA 4R8WH 4GUCA 3ZDWA 5CR8A 1A6WH 4BFIA 2V3DA 2VN7A 2C4FT 2UXTA 3ULSB 1XB8A 4TLTA 2FX8L 1WLHA 5LQBH 1JTOA 4P8QA 4DTGH 5LXVA 4BZ1A 2X4PA 5FLVA 1EXGA 2BSRA 3FN3A 1KIUA 2Y7LA 2OZ4A 4JDEA 4B0MB 1FNLA 2Y07L 3O2DA 4F7KA 5IR1A 2ITCA 2ITDB 2WUBH 2Y22A 4HXAH 2XX1A 2FQDA 3BFQG 4MZIA 1SOKA 2UY6B 1A6AB 2R83A 3PFUA 3B37A 2OSWA 4QHLA 1MHHB 3K72A 3APFA 2EADA 5F3FA 4AYFA 3EBIA 2ESVD 4MVBD 3EOTH 4DP7X 5KS9B 3MYZA 3CGTA 4FQHA 4FABL 2QLVB 1KY7A 5C71A 1FC2D 1UM5H 1AE6L 3H9SB 5DJ8B 3A5VA 3T0EE 1W80A 5I0VA 5IQMA 2P5EA 1UQSA 2KDYA 5F7KC 1E4KA 4PJIA 1D5IL 4O4YL 1NDMA 2AK4A 3VXMB 4OCSH 1NIBA 2P5WB 1UOKA 4GRMA 3RHWF 4JKPL 4PJEB 3N1PC 5T1JA 2UUDK 4DZBB 1FQ9C 5DVKA 1AY1H 1YNTB 2WUCL 5DMYA 2HPOA 1LNUA 2BVOB 4PGEB 1KENL 4LSRL 2KLRA 1W15A 3WO4B 5FDWA 2OSLA 1J05A 4MCNA 4XT1C 1HH9A 2BZCA 2R2BA 3FUJA 3FT9A 2BMKA 3C87A 5G5DB 4WFHE 1KC5L 3VFVA 3DBXB 5D7LD 3UAJA 4M8UA 1A4BA 2P49B 5E23A 4F58H 4XZUB 3IK2A 4IOIA 3JV4B 3ZGHA 4NEHB 3TBSB 4Q9QL 2FJFB 1AZZC 4WV1B 1MW1A 3MHZA 1DEEA 2DQEL 3M7OA 1PZCA 1NICA 2BSTB 4G8GE 1J8HB 4P2OC 1KLUA 3LZRA 4FXKC 3WN5B 4NO2B 3LKNA 4IHBA 1OPGL 3HRZB 5HDBF 1GC1C 3DO7B 3AS3A 2VWEE 3VRJB 1A2YA 4UV7H 5BUGA 1F3DJ 2FT6A 2OMVB 3FTVA 3KL3A 5IB1A 4X6DB 4I77H 3TPUA 2LV4A 3S9DB 4FQCH 4MZRA 1OB0A 2D31A 1URIA 3PU7A 1ZLVK 3QC6X 4WI0A 5CJQL 1D6VL 3HMXH 2JJTA 3KGUA 2EDLA 1T83C 2V3FA 2VOTA 4KNTA 1RZQA 3VRIA 4YSPA 5I1JL 1AD9B 1YYMH 1QMUA 1UZGA 5E8EA 2JWYA 2J8UF 3CFUA 5A43C 3SPCA 4BZ2A 1XAKA 2BNRA 2ORBL 1XF2B 2ZWNA 4R4FH 2BIOA 2AEWA 3RVUD 2H6UA 2ZKMX 2PCYA 4HCGA 1B0GB 1C7SA 3U0WL 4JR9H 1JBJA 3HCVA 5FM8A 4MJIA 2NSMA 3GSQB 5DGQA 3BD5A 3EYFB 3BIAX 3KHQA 5DRWA 3SJVB 1KJVA 4LAQL 1YO4A 5B1CA 4IMKA 5HI5D 2EABA 3NCYP 4JFEE 4PJ9A 4LCWE 4P5SA 4QYOA 1KULA 1LWHA 3P2TA 3RB5A 4AM0Q 3FMGH 4PUBL 2IAMC 4PVLA 3KJ6H 4BSVB 3MX0B 3SGEH 2NNAB 2R0WH 3BIBX 4XPGL 4ZW7A 5JIDA 3QGVA 1MW2A 3AW5A 1W0WA 1Q94B 3R1GH 2AMUA 1JRHI 1D5MB 2VZVA 3KM2A 3FT2A 1LM8V 1PL3A 1S7SA 2IBZX 2JJVA 4APXA 2IQAB 4HIEB 2UZPA 4P05A 5HY9A 5EZJB 5FYLL 4AM0A 5HHQB 4EI0A 3VQMA 4A6YA 1KBBA 5I9QC 1F4WL 4NZTL 4Z7VA 3QNXA 1JPST 3CTTA 2VJ0A 2J7LA 4YDLC 4JKNA 1U3HB 1U8JA 1IQWH 4DEWA 1BVZA 2ESVA 2WAHA 1UT1A 5I8CA 1ADQL 1G9NH 1WD8A 4NN6B 3SDYL 3SKJH 4EE2A 3DJSA 4K94H 3VX1A 3L81A 2XVKA 2OJZH 2UZXB 3MJ9H 4U1SB 3VXTA 4HKJA 3W39A 3US0A 4WNSA 3DURB 1MIMH 3POCA 3HZKA 2MNUA 3V0GA 1XR8A 4BFGA 4PAZA 4U1IB 4XP5L 3D0VA 4GRWE 4XO9A 3ARBC 2Q76A 1S7UB 1IM9D 1V55B 2Y7NA 2YEQA 3K2UL 2B9AA 5C0GB 4NKMB 3NIDF 3T0ED 2WO2B 2BIIA 1RV6X 3ECWA 5IJBC 5JW3L 2XHNA 3PGDB 3ES6A 1M2VB 2J20A 5GGQH 5DSCA 5JIMA 3EJZC 1RHHB 3BAJA 4GXFA 2EILB 1XAUA 5HTSA 4FFWD 3RWCB 5JPNC 1KSRA 1ITBB 1G7JA 3EGSB 2NY5C 1AGCA 4KKCC 5IHZA 3TNMB 5JPMC 5I5MA 3DSNA 7FABL 5I6OA 5J89A 1FCCA 1YEGL 1CG9B 5D7LA 4QTFA 5FHAL 4NKDA 4G83A 4ZOEA 1V5JA 3UTPE 3MOAL 2EIBA 4OY9A 1R3JB 3AY4A 4FI7A 5B39G 2CR6A 1EIBA 2E86A 4WFHD 3S3JA 1SY6L 1MPAH 1IC7H 3GDBA 5T3XL 4GAJL 4ORGA 4Y9EA 3NCXA 1ZLWH 4ETQA 2ZONA 3PCYA 3BKCH 4GSDH 2B1AH 4AMKL 1IKFH 3L2LA 5F7DA 1UB6A 4WGKA 1X5MA 4CMHC 2SEBB 3Q9PA 1ETZB 3FQ4A 1AQKH 4G8GD 4U6VL 5CP3H 5H37G 5C86A 1M3JA 3IMWA 1IAMA 3GS0A 1MVYA 5EC1A 2PW1A 3WTSA 1IAIM 1ZWIA 1GMEA 2E74C 1JPSL 4FP8H 2BXZA 2J6EA 3KYKH 3TZVC 1RHFA 2A9NL 4QXGH 2RHEA 5HYJE 4OVUA 1MDTA 5KVFE 3T1WA 3TWYA 4N22A 1DBKL 3UC0L 1JGIA 2IQ9L 5DMGC 1OCZB 4DW2H 3NCWA 3ARFD 4Y2DB 2FHCA 3FB8A 4P9HC 2VDPB 3MXVH 2R9HD 2DWTA 4M7ZC 3FUDA 3LOWA 5KSBE 2PYEE 4OJYA 3QI9C 2XZQL 3WIIL 3GINA 1MJJB 4PGBA 5B39A 3IDMA 5IB2A 3B2VH 3L1FA 3QIWA 4F3FA 5BUPA 3AS0A 1BZ9A 3UJTH 1SDDA 3ULUE 1DQIA 3VFNB 4ONGL 1A0QL 3EO0A 3MGTA 3LN9A 4FXGA 3EFOB 3SDCD 2OXGA 4UQAA 2YXWA 4FNLH 3STZB 1AKJD 1UH3A 4HIXL 4JFED 4LCWD 4NZRL 2OJ1A 3DVNB 3ZKMC 2AABL 4NJAL 3BWSA 1I8KB 1EDQA 1VPOH 1WFUA 5JUEL 2X9XA 3O4OB 4NZDA 1LO3H 1OAZL 3OZ9H 5L4FA 1F1AA 1E9QB 3WFEL 1FG2A 1S46A 4M7LL 4XCFL 5TDNA 1CVRA 1DVFC 2X89D 2Y9RT 5H35A 1JPEA 4DPBX 4XPBL 2WTRA 43C9A 1XD0A 3LEXB 1CWVA 2WPGA 4JN2B 3V0AC 3EYUL 3V4PH 1ACXA 4JFPB 5L6YH 2GTWA 5KBNC 5E5LA 1CQYA 2I27N 1ZV9A 5DC9B 3MGOB 1ID2A 4A66A 1HL4A 1NCAH 5D7SL 4HIIA 4UTBA 4Q56A 2FSDA 1K8DA 1V05A 1TFPA 5A3IC 1HKLH 1OTSD 2X4UA 4YPJA 1OCWL 1YEHL 4C8XA 2BY2A 4GFXA 3J2PA 2GJ6E 5DLMH 5BXFB 1JHLH 2J72A 2L04A 4K23H 1IM9A 3NH7L 2EECA 3UOAB 4JM2D 3SY0B 3T0EA 3ZQXA 2BLFA 3CSYA 2ATKA 4PWHA 2A6JB 4FTVE 4I87A 4X9FA 3T6XA 1RZFL 1GSMA 1L5GB 4LLUB 5AOZA 4MSWA 3NAAL 1MY7A 4W4OA 5B1KA 5EU4A 3SKMA 1XH3B 2DQCL 3N1QC 3A47A 3Q7JA 2I69A 2WQRA 1EV2E 4NKOB 5ANMB 1UENA 2V2XA 1UZ6F 1CD1A 2WC7A 5GGVH 2V7NB 4I9WE 4YBLC 2YKLL 4OLUL 5AVRB 3JVGA 2GC4C 1KG0A 5KSVB 3WY1A 3D4YA 1KYFA 1UCBL 3FFCB 4LCYA 5BCAA 1PTZA 1HKFA 4GAFB 2HJFB 1AR1C 3W81A 3WXVL 4ELKB 1BQHG 4PMFA 3VWJB 2I5YH 3L3IA 4PWKA 4E9QA 5ACLA 3IJ9A 5J6HA 3UTPD 1X6LA 4P4KD 3D2UB 4MXWH 1J9SA 1KCKA 3AT9A 2H2SD 4UM8B 3OR6A 4XB8A 3REWA 2I9TB 4MQXD 1WG3A 1HESA 4G8GA 2CO3A 1I7RB 3QIUC 3WFDL 1WZ1L 5TF0A 1AXTL 5DVPA 4WO4B 3I2CL 4BE5A 1AGEB 3D3VE 4IMLB 2EDMA 2F1BA 1ZHLA 2IMMA 3RL2B 1NBYA 5DJDA 4DZ8A 5HDOA 3QDAA 3A6CH 4WUUE 5DU7A 3WY2A 1A3LL 2BW5A 1TCRA 3BO8A 4N8CL 4QO1B 3Q06A 5F6HJ 1CFMA 4FQPA 3ZE2F 4YBQD 3DGCR 4JVUA 2P8MA 1JNHB 2B4CH 4IBZA 3RWFB 2WXRA 1UB5A 3QUHA 3QRGL 4XNYH 1RUKL 3T8MA 4NHUB 4ZZFA 3ARFA 5C9KA 5IJKA 3MV9B 5KUMA 3CLEL 2E7LC 5I1DB 1TZIB 2EZ0C 2ZP9A 4ZNEE 5JHMA 4G70B 1I9IL 4Y88A 3A21A 4KXCA 5GS3A 3I9IA 3ORJA 4GAYB 4GQ9H 4HDIA 1L6PA 1T66D 4NHCL 2JQMA 1AYRA 2R56H 3WSQH 1IILE 4H1LH 4JG1H 2BWIA 3FULA 4NCC2 3QUGA 1UD3A 3B7SA 4PJFB 1A4CA 1MFDH 1LO4H 3IMUA 3ZTEA 3KLHD 1O6SA 4H0GA 5BS0E 2JJSC 2PYED 2H0FA 3IDIA 3MLUL 1F45A 4OFPA 3SDCA 1M3IA 3D0LB 4UUJB 2NY6C 4X7TB 3WFBL 4M61A 1AKJA 4JFEA 4HUMB 4LCWA 3ULUD 3VRLF 3DSFH 4Z95H 1GGYA 1RIVL 4YVNA 1LP9E 4RMBA 2GFBB 3MTRA 4IKNA 4OB5L 1P6AB 1U8OA 2Y06L 2X89A 3WEAA 3T08A 2A77H 5FV1L 1TTRA 1SXNA 3FCSA 5KW9L 3I6SA 1XF5A 4ODVL 4JQVC 4QRBA 5KANG 1JHTB 3HZYB 2H8PB 4C4KT 1T1YB 5TGBA 1ECYA 1QLEL 3QDME 4RRPG 3HUJF 2D2OA 4UIKL 5J06A 1T0MB 1KIPB 2AEIT 5EIQA 3FYEB 4P5KB 3M17A 5BQDA 5F1IA 4RAUA 5I18H 2AERT 5CZXD 3NIGB 2VDLH 1FLRL 3U46A 3MUUA 1E4XH 4EQ3A 3QJSB 4NO5B 5D7JA 3SZKC 1HXMB 2DL9A 3N42F 1KB5H 5ICXA 3ERXA 2ZF8A 1AVAA 4K3EH 4GUPA 1EJOH 2JQAA 3GLDA 4JM2A 1RK0A 4OIIH 3DX6A 3N1MC 4HV8B 1CBVH 2C34A 1MRDL 3JTTB 1HH6A 3MLYH 4QNPE 3D07A 4CDGC 1SVZA 4FNRA 4M56A 1VGEL 4RA0C 1J1OL 3C5JA 3KPSD 2A4ZA 3TYFA 1TTBA 2M83A 3DI2B 4FTVD 4PRAB 3ULVL 1D5BB 3TFKC 3FRPG 3MA9L 4HPHA 1RULL 2XTJB 3UGUA 4WNQA 3UX9B 2R23A 3DECA 4AV5A 5KUKA 4H88H 1RKRA 3DV4B 1QFWH 3QZLA 2WLKA 1AZVA 1LK2A 3U9UA 1WA0X 1EFQA 6TAAA 2QSQA 2H3NA 3MRQA 4J2QA 1AG0A 5T3ZH 5ITBH 1UA6H 1K4CA 4RRPM 4L1DA 2XTLA 5DF0A 3AXHA 4K7FB 3SO5A 1PU0A 1NTDA 1P7KB 2CK2A 4P4KA 3KYNA 2R39A 2AEPL 4G6JH 4HIJA 4LO9A 4ONFH 5J13C 3PAYA 4O51A 4Y4FB 1E5UI 4YHPA 4BQCA 3S6CA 4LOVA 4V2CB 1NGQH 2IH9A 2WVVB 1KLGB 1FPTH 3MJGX 4PJGF 3SE9L 1DFBL 1WAEA 2W0PA 4EXPX 4PJ7A 3D25B 2MTPA 3MFGB 3DI3B 3IKCA 4GKZA 4YC2B 5TH2B 4DKFH 1HCVA 1SYSB 5JIIA 2APFA 4W9CC 5E2TL 4UQ3B 3GM8A 4B3VA 3ARRA 3D3VD 2J5LC 4UT7H 3CFJB 2VDQH 1VGKA 3LN5B 3KWTA 4WUUD 3CPUA 4GI8A 5MHSE 3CFMA 3FRPA 2CMRH 4KKAD 5LWYH 5EF0A 5GGRY 5HYJA 1GYAA 1ZA3B 2W0FA 3DGGA 3QJUB 5F7LB 5EG6C 4ES8A 5B8CC 4KZEH 4GSQA 4XWOD 5EU6E 1CUOA 3WTTA 4JY6A 3STLA 1N8ZA 4JRLA 2EKJA 1OE3A 2OMTB 4OJFL 3LQZB 2DDQH 1GOHA 1JYNA 1KCRL 1RURL 1TQCC 4OR1A 5L2KE 1DSFH 5KSBA 5J8OA 4IGBC 4U0RC 2PYEA 5KVDH 4M4RA 2CPCA 4P06A 3OC8A 4AT6B 3ABMB 1FBIH 3ZL1A 2VISA 1CFVH 1Z2KA 4V2BA 4G9FE 1IVTA 4OCXH 2VXTL 5G4NA 5J11B 2A6IA 4APQA 4MMXA 1U58B 4HBCH 2DQFB 3LDBC 4N6RB 4NUGL 1A1OB 3PABA 3FB5A 4PLOB 2XV0A 3DROA 1U8LA 1ULVA 4CW1A 4LEOA 2YMOA 5K9QG 1TJHH 3NSDA 3KEDA 4U6YB 5D6CB 4S1SL 2F8IA 2N0MA 3O0RH 4TVUA 2MRYA 4MA8H 5E1IA 5IVXE 5DJ2A 1VIWA 3HR5B 4MHHG 4FYQA 5A2BA 5C09E 5MEOB 5I1EL 1E3XA 2Q8AH 3LS5L 4YXHH 2FTAA 3HJEA 1LEKA 1IKNC 4DEPC 3C5SA 2OX5B 5FM5M 4Q58C 1NGXA 2VUKA 4F7CB 1ZA6A 5HI4D 3S37H 3QWOB 1NIFA 4QY8A 4WTWA 2Q2LA 1INEH 4PYGA 1TPXB 1XCWA 2CO6A 3DX1A 3LZQA 1DDHB 2FECI 1FCGA 3QDMD 1DANT 4NSKB 3BZ4B 4KVNL 5F7HA 5JW5A 3UAEA 4K5MA 4YBHA 3ZBMA 4G3YL 5KS9F 1E3FA 4F2MA 1DQDL 2H6PA 3EO9L 1ODUA 4X4XB 3TA3C 4K3DL 1YA5A 4FQ1H 1H8NA 1ZPUA 5EF2A 2NUPA 2N7BA 3BIKA 3Q6GH 4UQIM 3V4PB 1ZMYA 3RY6C 5JQ6L 3FTGA 3Q3GB 4HXBH 1I82A 3DX2A 3T65A 3G5VB 4YX2H 3LKQB 3DXAE 1F56A 5F3BA 1NAKH 2PNDA 3IJYB 3BCDA 3KPSA 5EO9B 5EIVA 1RUAH 3DHPA 2ZD0A 4FTVA 5F1KC 1FL5B 4PJEF 1QVOA 2HLAA 1SEQH 1YNKH 3KXFB 5F7NC 2E76C 3MOBH 1N6QL 3U2IA 1YNTF 1HHHB 1JWMB 2E8YA 4Q9CA 3P73A 3VYNA 4GKNB 3ABLB 1BZOA 1WBXA 2FJHA 2A6KB 2FIRT 2HB0A 3MNVB 5ETUB 3SCMB 3KPLA 5FIEA 1S9WB 3VAEA 4AEHH 5IIEB 2QPFA 3OHXC 5K33A 2FD6H 1OPOA 1LLAA 3GI8L 4PV8B 1NBZA 4XPTL 4QTHA 4U6TA 2R8SL 1J1PH 3SSGA 5CJ5A 4G2AA 4JG0L 1JL8A 4A63A 2A74C 1DFXA 5BMFL 4PRHB 1HI6B 3LJ3A 5C0CB 5IFAH 1PBYA 2CAKA 4TQEL 1A6ZB 4DCQB 3AGVA 5F9OL 4OZFH 3ROLB 4PJ8A 2YFOA 4FF9A 3CK0H 2ADFH 4L3CB 4Y16C 3WTUA 1AC6A 1J10A 1NBVH 3LN4A 2ITFA 1D9KB 1HIMH 4N26A 1M1XA 4PY8I 4TVPD 3U7WH 4JFSA 4X5XB 3W82A 4V11A 1XL4A 2MTAA 3D3VA 5FO8A 1MY5A 3F05A 4R8WL 2EYSA 4RSYA 3EDKA 4UIMB 2TSBA 4X6DF 1NMBL 1ZS2A 5BVJB 4J12A 4AYMC 3QARA 3DJZA 3ZDZE 4AQEB 1EK3A 4WUUA 3C60B 3S96A 1ZJAA 1HHIB 1NAML 4WHYG 1DR9A 3KM1A 3WHXB 2CO2A 4PS8A 5HDRA 2ZG3A 3SGJC 1FZMB 3HC3L 3ZK0A 2NY4B 4FQLL 2Z93A 4G7RB 4HXAL 1L4IA 1OKEA 3SKUD 3BP6B 3MRMA 2WANA 1P4UA 1CFSB 4L9DA 1LYQA 4OTXH 3RGBA 3SE6A 4A68A 4JO1H 4I4WB 1QHOA 5EU6D 2FZ3A 3EOTL 2G4EA 5E5MA 3RNKB 3S36L 1JXKA 2CLRA 2OBGA 3BN9D 4D0BB 5E51A 3QIBD 1FRGL 3UADA 1OB1B 2R2CA 4UOW1 4W9ZA 2AI0H 2HG5B 2JIXB 2YD0A 3IDJB 3LRSB 2UY7B 4GQZA 5L2KD 4K9EH 5BS0A 1ES0B 3IJHA 3F84A 2FLMA 1IAOB 4K07A 2VERA 3RUGB 3SBRA 5DFVC 1JPTH 4H1LB 5K9OB 3ECBB 1ZKAA 1ML0A 4G9FD 4HGWA 3VCLB 3CZKA 3QQXA 4OQ1A 1RAMA 3HS9A 5E1AA 4I3SL 1LP9A 4R4BA 2GB2A 3MRJA 5AG9A 2YGQA 4HKBB 1CGUA 2X53A 3BH4A 1MLCB 1O7SA 3BSHA 4TKWA 3HOGA 3IXAB 3JTSA 4GAAA 4HCFA 4NBXB 5K9KA 2J73A 5MI0C 4LZKA 4AMXA 2YAHA 2ARJB 4ZMPA 1NCTA 1IC1A 1QQDA 1ZTXL 3UTQB 5CCKH 1A4JB 4TUJB 4N1HB 2YGPA 2PP8A 1WWWX 5GGTH 5A6IA 4MWFB 1FVCA 1IGJB 3A4FA 1OAQL 2UWEB 3ARGC 3QDMA 5I16B 3I3BA 4RVBA 1AJ7H 2YGOA 1S7TB 3KL5A 4UOJA 5JO5B 4JPSA 2H45A 3V5HA 4DP8X 2YRPA 1OGAE 5IHUH 5EBWA 1GGIL 2CSPA 3OLEA 5EEVA 4QRRE 2X2YA 1N6UA 2Y7OA 4JPWH 1TQUA 3WBDA 4XVSL 2X09A 3UO8B 3AM8C 5FYKE 4AQAB 1S7QB 4P4RA 1FNHA 2F7OA 1P6FA 3TX4A 5CGMA 3LX9A 2EICA 1T0NA 4N24A 5B3SB 3U48A 1LE9B 3MV7E 3GSRB 3QZBA 4DGWC 2VIRB 3I74A 5E6YA 2VDLB 4URKA 5DD1L 1D5ZA 2DQDL 4Y2OB 2HVJB 5BZDB 5KVEH 1HAWA 1YECL 3DXAD 1KB5B 1SEBA 4XCCL 2D7TH 1ECZA 1JV5A 2FBJH 4X42A 4FQXC 4YSUA 1LDPH 1U8NA 4G1EB 3WV0A 1MEXH 2IADA 2X4QB 1WS7A 2XIBA 3B5GA 3HVDA 5A2KH 3EOAA 2IFFL 2PXYB 2QQNH 5J3HC 5L0QB 3V6FB 2FX7H 2NQDA 4YHYC 4KMLB 5IKCB 4DIXA 5I8EA 4E68A 4Y5YB 1KTJA 1Q9OA 4BWWA 4RQQA 1MF2H 2Q86B 2OQJA 2KERA 2Y7MA 3IFPB 4MJJA 3MU3A 3WENA 1CFBA 1N59B 4HLJA 4NM8H 3PNWB 4OFDA 3WELA 5I76B 1ZT7B 4NQDB 4LBEB 2DLFH 2XFGB 3B43A 4LDLB 2BW4A 1YMME 2JJUA 1OIOA 1G7HA 3UAFA 1F3RB 3V9CA 2G60L 4L5FL 2Q1EA 1WCBB 2PO6D 3R1GL 2OMZA 4RFNB 1ILSA 2CK0H 4JQIL 5EZIL 1BG1A 5JXAL 4HETA 2RMNA 5FA3B 3U36B 1I7ZB 4M5TA 4LSUH 2Q7AA 2QVKA 3UBXB 3TCTA 2WP3O 5TE7H 4XAWL 5I30H 4F57H 5AVVB 4PLJD 1DLFH 4FXTA 4J3OC 4KXAA 5D7HA 2ZQKA 4IBVA 3MRFA 3VXOB 4GW4B 4LCVA 1NEUA 3AROA 3H3KA 1UFUA 1EVTC 4XOAA 4NWTH 1CL7H 5E5RB 1JOIA 5G4OA 4LLYB 4L1LA 2X38A 2VDQB 4K7PH 1XGUA 4JG9A 4PR5B 5EU6A 4MQSB 1UYWH 3WEXA 3IPFA 3QIBA 5C0AB 2WLIA 1NSNH 4PJBE 1SOQA 2Q3XA 1FNFA 2VLRE 4L9LC 5L2KA 3H6JA 5T5FH 4PRNA 1T3FB 1U92B 1ZGLB 4WI2A 4UTAH 3X3GL 3LMJH 2Y5TB 4G9FA 1XF4A 1JK9B 1JCVA 1ID5I 3VQ2C 1EGJH 3QUKA 1OT2A 1S7RA 1QSEE 1SQ2N 3KLSA 3AGWA 1UZ8B 4XNMB 4Y2LA 5AVWB 3LPOA 1MFEL 4EI5D 5IJCC 4R7DB 4RDBA 1FO0A 3WO4C 3BQUB 4YR6A 2HJLA 4PJDB 2WY3B 4Q74A 4DGYL 4CJ1A 3IAPA 2V2WA 4HUWA 5KYYA 5IVXA 1I9RL 4WWKB 5E4EC 3FO9B 1H3GA 2NW2B 1X7SA 2DKSA 3OKDA 3B7RL 1DL7L 1PJWA 5I71B 1H19A 3ZUNC 2UX6A 3ZE1B 1S9VA 3NK3A 4PJCA 4WV1C 1V8HA 4FULA 4XMVA 1L3WA 2BNQD 2X5PA 4JVPA 4F3FB 1MPAL 1IC7L 4FHJA 4LRNH 3EH5B 4YZWA 2OMNA 3LRMA 4GSDL 3WN5C 1QLFA 1IKFL 1IEBA 1EJ6A 3EHBD 3JV6A 1OGAD 3ME0A 3WFHB 2WSKA 5HHME 1YPZB 3SQOL 2RTTA 3F6LA 4OF5A 1JF5A 3DUSA 4MD5B 4FA7B 1N0LA 2HT2C 4MD0A 2XY2A 1S78C 1QFPA 3T3ME 1CT8B 3F62A 4AZUA 2XKSA 3N06B 5FYKD 2XZCH 4WDIB 4LVHB 1TO4A 4I0CC 3KYKL 4I3RL 3ZUCA 4QXGL 2CXKA 2F54D 1CICC 3DXAA 5DLLA 4AMWA 4YHML 2WXPA 4A2HA 1I4FA 3MV7D 5GS0H 2DQTH 4AK1A 1P5UA 4K2UH 1YDPA 4J8QA 3GZQA 1T22B 4B60A 3UJIL 4H8WH 1QD0A 5JIHA 2VL5B 4AQOA 2NY2C 2CA3A 3OB0H 4GJTB 4OZ4B 5BPPA 4AZ8B 1CLYL 2ZCHH 4IKIA 4NQCB 3AUWB 1JXGA 3INOA 1PS3A 3ULVC 3LB6C 5CLYA 4PG2A 3NQKA 1WICA 2XYCA 2AV7A 3MROB 2M26A 4J1UA 2VDNH 1URZA 4HCRA 1EAJA 3O2WH 3C9NB 3UYPA 4NBYB 1CXEA 3N6YA 1NCCL 3O2VL 3FONA 1T5WB 5T5NF 1MWOA 2HTKD 5AWNH 1EO8H 4HG4K 1LD9B 2NY0B 3C2AH 1I7TA 3OG6B 1X4YA 2XQYG 1XL6A 4NQXB 2PPDA 3DMMB 4ODXA 5TE4H 1A66A 4OCYH 2W92A 4A38A 3WD5L 2NXZB 4MMZA 4DAGH 5DUBB 1C12B 3QHZH 1M6OB 1EDYA 5IB5A 2VLJE 4RBPH 5I17A 1WISA 4P57B 1RPUA 5FPIA 2V17H 4OZFB 5DJYB 2CBOA 3P3RA 3FN0L 3GKWH 2A1WH 2A9BA 3DGDA 5CILL 4Z7NE 1XXDC 5IW1A 3THML 2E47A 3CFQA 3VMPA 5DQ9A 2AQ2A 3VXNB 2WBKA 4YFDB 1BW8A 5KYWA 2EIZB 4OLEA 1JS4A 2I60H 2F53E 1H3TA 1SMAA 4OGYL 3DC0A 2O5ZL 4UDTA 1U8QA 3QZOA 4B9FA 4NN6C 1CIUA 5A16A 1CGSH 4CGTA 5KJRH 1WAAF 2PWFA 4FFZA 2XN9E 4KJQD 4QRSA 4Y4KD 2O61A 2QL1A 4LSDA 4NUQA 1EPFA 4PJFF 2F58L 1HKLL 1HE8A 2C3VB 2ZKYA 4LESA 4JM4H 3A4DA 1E40A 2WIIA 5DLML 1JHLL 2XWZA 4XMXA 4IHOB 2IH3A 4GMTH 4TSBH 5C0BB 5I6MA 5ACZA 1YY9C 2VLRD 3FH7A 3GEFA 4FLHA 2XQYA 5FV2A 3PE9A 5DD0H 3DIVA 4HJEA 2P1YA 4OM0H 1W8NA 3T0XA 3FT0A 1UCTA 3IE9A 4NO0D 5BJTA 2D3NA 4G6FB 1QSED 2CO1A 3P40A 1T1XB 4XNZB 1KLFB 4FKHA 5D1QB 5CEZH 1IGIL 2XV3A 2DI9A 1BPLB 3SPJA 4JKLA 4JPIA 4FFVD 5IF0B 1SVBA 5EUOB 5HBBA 1QYGL 3RWEB 3HLAB 2OJEB 3TNNB 3WIHH 5FC9A 4K5PA 2Z7ZA 1J0YA 2C9PA 3ALWA 1WBZB 1IC4L 2VC2H 4FMKA 2OMWB 2MCPL 2DH2A 4MS8D 3Q8BA 4P0DA 5E9DE 5DMKB 4ACTA 5KAQG 4C83B 1K4DB 4Z78B 3NIGF 4UT9A 3FFOA 3AFLA 3P0YH 1OGAA 3NPSB 2OL3H 3MC0A 4G7YH 4N90D 4UAOB 3CX5J 3LXCA 3DA0A 5T1MA 3NP3A 1YVLA 4QWWD 3PGCA 2R4RL 2YEZB 2HH0L 4PEEA 3VFWB 3VFOA 5L8KB 5I0XA 5L7XH 2Z31D 3BMVA 3A6CL 4FZ8H 4J23A 2EIKB 2IC2A 1OZUA 2F54A 5HHMD 3MV7A 3HI6H 2RA1A 3WLBA 1OALA 4ZOCA 3VGHA 4XMKH 2WXHA 1I7UB 3OGCB 4E9LA 3IS1X 1DJXA 2H1XA 3B4NA 1L7IH 1MWAL 4Y2DC 2P80D 1RJZB 2RBLA 2V5SA 5GSRA 4NPYB 4UQ9A 3D4GA 4RGOH 3RIFK 3WKPA 1QRKA 1M71B 4TN9A 3CVHH 4NUJA 1PFOA 4FN0A 5HGBB 3QFJB 4R3SB 1KDJA 4D7BA 4A2EA 3DOIA 2O1AA 3BEVA 4ZXBD 3V52H 5SX4I 3KPMA 3G7TA 1MFDL 1LO4L 3IJ7A 3S3CB 4AL8L 5AOIA 1E50A 4PREA 5DFAA 3RGHA 4Z7UB 3LPGA 1IEAB 2GAZA 2VXUH 3I9GH 3NFNB 5DD3L 3MRIB 3C08H 3DPBA 1IVLA 2NLJA 2BP5M 2Y36H 2CUMA 4H8VA 5HDLA 3FT3A 2ADJA 3OXRA 3B8YA 4AGOA 1YN6A 3ZRSA 1YMMA 3WTVA 4JHUA 1Y6KR 3O4OC 3AT8A 3BE1H 4TQIA 3ARDB 2AJ3A 4WO0A 1VFBA 4EBQH 1MJ7L 4TV3A 1HJBC 1GOGA 4GRLD 4LSPL 1VHPA 3EO1A 3HN8A 3MBWA 2APBA 4YHZH 1X9QA 4HOZA 1UATA 4QIRA 4QF1B 4JZNA 4OH2A 5FUZL 2NXYB 4GI6A 1FFTB 3T0BA 2FT7A 1WVZA 2E4TA 3AJ7A 4JFWA 5HYQB 5EBLB 3PWVA 3RBGA 1F1GA 5CJBA 5IMMB 4I89A 2A83A 4Y4KA 5LDSA 3LPFA 1CFQB 3WJJC 4EUPB 2DQUL 3CXHK 1XSKA 1TKWA 4HHAA 4WJKB 1R4XA 1P7QB 1NEZG 1FJ1B 5D4QA 4KO6A 3MLTA 3G6AA 4H25A 5D70L 1JYWA 2Z35A 2BJML 2J88L 1KB5L 2WINA 3DX9B 2XN9D 5DJ0A 4PTTB 2X4NB 3HE6B 4FNUA 4PJBA 4FKEA 4K3EL 1CLOL 1QWUA 1EJOL 2VLRA 2WAQA 3KCWA 1AQMA 1ZS8B 2WM0A 3CZSA 2ZOTA 2NUTA 1JPFB 2YPVH 5AUMA 1XV8A 4F27A 4X4KA 5FR3A 2DMGA 1K8IA 1HEJC 1A9BB 5C0IB 4ABUA 4NO0A 3GMRA 2WGNB 2P3YA 3K4AA 2BNUB 2FLRT 1MCDA 2H0JA 1M7XA 1QSEA 2DJSA 2NDGA 4XBMA 4XN9A 1FHGA 1NCBH 4D9RD 3P0GB 4ADJA 5IFJB 4AQ8A 4TOYH 1QFWL 3KPRB 4M8QB 2H47C 5I1CH 5FW8A 4L8CB 1KN2H 1A1NB 1KELL 2B1HH 2OS7A 1UA6L 1SJHB 5AYUH 3RWIA 5KZCB 3GRWL 3B1UA 1ZXQA 5HHNB 1OF2B 5LG1A 3TLRA 2P28B 5FECB 5GHWL 4JZJB 1ETB1 3GJFH 4P2QB 3BVNB 4G80A 4JRYE 5LG6A 1AIFA 1QR1A 4OQTH 1E4HA 3RVVC 3BZ5A 4G6JL 1NEZA 4OD3H 5DVOA 1X5AA 4IIQA 3U0PA 1Q1JL 1HILA 2FL5A 4WO4C 1OSZB 2IO5A 1FPTL 2TSAA 1F4YL 5E9DD 4JO3H 1S9KC 2Z31A 2JH2A 4YDVB 1NLDH 3QEGH 1Q0YL 4B9CA 5J1SC 3V4VB 2J4WL 2AQPA 4WHDA 2A38A 1OF0A 4O2FA 1U8MA 5I6XC 4EJ1C 2ROYA 3BGMB 5LCVL 3FCTB 3EFDH 2P80A 3VD4A 5LWYL 3MBEC 4YSDA 5CINH 4QXUL 4XXCC 3F64A 1NCWH 4KZEL 5GRXG 2FK9A 1X6NA 2WXKA 2M1KA 3ZL4L 2CO7B 3OJVC 5IK3A 4ZXBA 5FW7A 1S7WA 4DPCX 2I9LB 3L17A 4DP9X 3D2TA 3VTMA 1FAKT 3EBGA 2E6QA 3C6SB 4B53A 5D71H 3SGEI 3FQXA 3RVWD 3ABZA 1FBIL 1QATA 4M6OL 3GSWB 3X1NA 2P46B 1IM3D 4JGJA 4OCXL 5G55A 2XC8A 4PN6A 3O3EB 2ZWZA 4GUQA 4LHUA 3FUIA 4HBCL 4JFZH 4QRPB 1P4IH 2ZOKB 3HS0B 2QQKL 4UT6A 4O5LH 4WTZA 3MRGA 4OGAD 4WI8A 1Z5LB 4YDNA 5HHOB 1PX3A 3ELAT 1SBBA 2BFGA 2AV1B 5AAWC 2VDNB 4ZFFA 4GRLA 5E2JA 1PKQB 2D3VA 5J9PA 4AYBA 4MA8L 3GMMB 2WXOA 2CDEA 3DK0A 2EDBA 2VLJA 4QJ4B 3D4ZA 2IANB 4O2CB 3PY9A 4BRVA 3WDIA 2DIEA 4LDCA 2KZWA 3L4ZA 5AVQB 2R0KL 4PW3A 1XMWA 2X4SA 4Y9FA 5AL0A 5J5EA 4R5VA 4HSAC 4PVMA 4Z3HA 4KK5D 1D2OA 1I9JH 4ODHL 5IQ9B 2NY7H 5FFOA 4L4TB 2AVFA 4DVRH 4DGIH 1JERA 1IBGH 5H94A 4UWQB 4OKVA 1QI3A 5C6TH 3IDXH 5J57B 1JHKH 3VXQB 2GW5A 2XN9A 2NY3D 1R75A 1EMTH 2YA2A 3VQ1C 5BZXA 1FFPB 3QUXD 1E2ZA 1JWUA 4C4UA 2RJMA 3Q01A 5C0JA 4EZJA 5LAXA 3RWDA 3GSXB 4LAJH 1G9NC 5AAPA 5DEFB 1OV8A 5SX5K 1C5CL 1FE8H 2XXCB 1MN4A 1X5IA 4G9DA 1E4WH 4G42A 1N70A 4UNUA 4NNYB 3VFPA 1YNKL 2XTJC 1TU2B 3CVDA 3DRTA 5JQIB 3QUMB 4LPVA 4NAQA 5I74C 1MVUA 4TQPA 4HAGA 1QBAA 5B3NA 4EIGB 1HHGB 1TITA 4P2YA 4D8OA 3WHE0 4PGDA 5AW0B 3J27A 4KHXH 2R27A 4KK6C 2UWEF 3AU1A 2BFVL 2YGVA 32C2A 3L3OB 4HMCA 3V0EA 4RMVA 4A7GA 5JMRA 3R7QA 3VA2C 4AQZA 3MBXH 1R3LB 2JXMB 4Y4FC 3UYRL 1RQ5A 4D9LH 4M6NH 1S7VA 4BZ1H 3ILPA 2VLKE 3N9GH 4YWGH 2ICWA 2OZ4H 2PCFB 5E9DA 1H5BC 4FS0A 3FUHA 5ECJE 2J1XA 3V7AG 2AXFB 5GRVK 1XF3B 5GS2D 3IU3A 2FH8A 3KDPB 3LKSB 4DH2A 1MIEL 5GJTH 4XHQA 1OHZA 1X4ZA 1Z9NA 1JSYA 1A6UL 5GZOC 2VC2B 1LE5B 4G8FB 4RDQF 2VDOH 4JQXA 1HNFA 3UTSB 3OB8A 1R33A 1G6RL 3SGDI 4PJ5D 1WC7B 4B6ZA 3UG5A 5TJWK 5JZ7D 4U4IA 2H26B 5JA8B 1FNSL 4QXTA 5C9JA 1MUJB 1F6AB 3ZSTA 3KYMA 2X6AA 3KNBB 4JBSA 1KPRB 2RIKA 1EHKB 3ECVA 1R5VB 3VI3B 3BVXA 3HFML 3EGDB 7TAAA 3MLXH 4OTXL 15C8H 4RNRA 2E6PA 3WE6B 3WJMB 1NLBL 2AQRA 1RI8A 4MA7L 5C0DA 4JB9H 3BDYH 3BX7C 4JO1L 1T03H 2XNAA 3FQNB 1W91A 1M42A 5CSBA 1SGKA 3FO2B 1BZ7A 4R90L 1BOYA 5LDUA 4W9IC 1EUTA 4XCNA 3PPSA 2AK1H 5IB4B 2EYTB 3W9EA 1IM3A 3DIFA 3S48A 1DN2A 2G3XA 3MRKA 4IBTA 4ZFOB 2F5BH 3ARPA 4OCWL 2VXQL 1VESA 1RVFH 1MCEA 5J11C 1PLGL 3CVHB 1F58H 3D69B 5BOJA 1A7NH 1AO7E 1L9TA 2HT4C 4LP8A 5ILTL 5GRZA 5EZOH 1KPUB 3I6GB 2Q5BA 1H3XA 2YSSA 1G1YA 3FB7B 4PY8J 1BAGA 1RPQA 3CG8A 3S34H 5IQOA 1GTNA 2N59A 1R9FA 3LRGA 2B59A 3TTYA 5ID1A 2WKGA 5AVSB 2YQGA 3PIQB 2VABA 2A9AA 3JWNC 4D0CA 5BRZE 1FFNB 4F7EA 3NCJL 1KEGL 5GGVY 3WKYA 1TPXC 2HMID 1HDMA 1AQ8A 1BZDA 1J86A 2CM5A 2F2HA 2E75C 3PWUB 5IBLC 5LAPA 2C4XA 3VH8A 1NL0L 1R6VA 4L3EE 4PCTA 2ADIB 5DCCA 5IHUL 3U6RB 2BIPA 4G82A 3BHBA 4E41B 4JPVL 3ECQA 4FFYA 5ICYB 5C0EA 5B7EA 3QUXA 1OK0A 2MOGA 4H0IA 4O00A 2CLZB 1B2WL 4E9RA 3FQUA 3R8QA 3CFDA 3BD3A 2N4IA 3LHAA 4LLMB 4BZ2H 5IG7A 4I0KA 4TVSa 4TNWF 3TJHC 4KMQA 3VB9A 3P4MB 2LVEA 4PP2A 5CZVL 4P23D 3T2PA 2X6CA 3QULA 2C8NA 2JELL 4F1SA 1GY1A 3VJ6A 3KD4A 3MA7B 2B16A 1MHCB 1UM4L 2FBJL 4PJXE 2AHIA 4HGKC 4QRUB 2Q6WA 3TF4A 4JFTA 4PJDF 1DE4A 4QRQA 1H6FA 2J57A 5F9WC 3V0WL 3M1BA 3ZE0E 4TUKH 3WL9A 1FUNA 3NESA 1OSPL 4H8PA 4AITA 3TIDB 2R1YB 2FX7L 1QTYT 1T04A 3AUVA 2IWKA 3NCFB 2MOQA 3PLYA 3SHSA 3UC2A 3ZE1F 5L2JA 4QDGA 2NY1C 5KBMA 4ZFZB 4ALAH 3V8CA 4F2FA 4HC1A 2HAZA 1UKQA 2KKQA 1THAA 1UUNA 4IKLA 1U0QA 2MNJB 2DLFL 4XH2B 4KQ3L 1D9KC 3CE1A 3UTZB 1FC1A 2NW3A 2X42A 4A6YH 3CLFH 2VLKD 1YPZF 3GJFB 4LNRA 4CMMB 2VM4A 1IKOP 3LSOA 1BEXA 3KG5A 4YHNA 3QG7L 1EDHA 3FK3A 3C60C 1P69B 4IW4C 5DUPH 4LSUL 2WMPB 1UEYA 2WNKA 3QBTB 4FX5A 4PI2A 5TE7L 3EYVB 1MRCH 2IH1A 3AVEA 2P45B 2NY4C 3COOA 4LSSH 4NFBA 1Y18A 5A2AA 2KUTA 1A7PH 1LEGA 3FU8A 1F86A 4QGYA 1SYVA 4KO5A 4M5ZL 2X0WA 3T77A 1TQTA 4ZTOH 4N0RA 5HGAB 4NWTL 5AW9B 4S1QH 3WIFA 1B3JA 1JMXA 2JQZA 4PRBB 4JRXD 2B4CC 4K7PL 4NBZB 4TQ8A 2GCYB 1H3UA 4FFTA 4Z7OE 2FVNA 1KB3A 3AXLB 1S9YB 3BWUC 3HTLX 1R24B 2XX0A 2NRDA 4MJ6A 4ZTPH 3T4YB 1EHLL 2JKWA 1G0DA 3GBDA 1WSST 4A7UA 2G2RA 5TF1L 1IARB 3AC0A 3CXDH 2MFNA 2KI6A 1MJ8H 3VO0A 2X1OA 2ZKWA 3LMJL 4RFOH 3ZW3A 2ATAA 2R1WB 5T5NG 2FBOJ 5FB8B 3OAYK 3VG0L 1G7MA 2EAEA 4AL8C 5CBAB 4ZOAA 5TFSL 1NM9A 1QW9A 5DWUH 1AO7D 4GW5B 1OVZA 3K6DA 4LCIH 5HDBE 3QJRB 2Z91B 5KN5B 1W6WA 2YA1A 2FGWL 4OT1L 3GIZL 3CZJA 2YOAA 3QQNA 1BA9A 4HEME 3T0WA 4H20H 3S98A 3TBCA 1W72A 3H7BB 1KFAH 1DQLH 3HHMA 3HBQA 2JI2A 1ZD6A 4IS6A 1E4XI 3AY2A 5HGGS 5HYSB 4AENB 5BRZD 5EOCJ 1OTUC 3BDBA 3GBEA 1IAIH 3MLVH 3TT3H 4KZDH 5JOFB 3ARBD 4J3SA 2J8UE 1B0RA 5AOJA 5DK0A 3L48A 1F11B 3CVBA 5C2UB 2V8LA 3I3EA 4N4YB 4P5MB 4FEMA 3NDZE 1E65A 2X7LA 4L3ED 3W0WB 1W9XA 2H1PH 3G08A 5IIEA 4F9PC 1S5IH 1KJ3L 3D18A 2QTEA 4WI9A 2HZHA 3T8XB 3ESPA 4CN6A 3IFNH 4OU3A 2XYBA 3FU3A 1QFWI 3EYSH 4QHPA 3LS4L 1Q9KB 5GS0L 2DQTL 1Z32X 3AU0A 4Y1AB 1HL8A 1EJ8A 4FNPA 4HUUB 3TV8A 4ATWA 1PDKA 3ATDA 2EP6A 5LN8A 4P2OA 1BM3L 1UWGH 4FXKA 5C97A 1QEWB 1YMHB 2G5BA 2HXAA 1EEZB 3S3BB 3BLBA 3P77B 1I1AB 1NOAA 5EUOF 3UBXI 1O9ZA 3WEBA 4S0SD 2GJJA 3H42H 1BDYA 4CVUA 4S0HA 3G5XB 1F2QA 1JZ8A 1S3KH 2F5AH 3OKMB 3BUDA 1B4JH 3QC5X 4PJAB 5ALBH 2X4OB 3K6IA 3QFGA 3QUYB 4U1NB 1T83A 3TZVD 3S8WA 5HD8C 3C2AL 2MPAH 3JSSA 3FU7B 2VLKA 4JJ5A 2FO8A 4N8VB 2G5UA 5TE4L 5DMGD 5IJVB 3QPXL 3MLZH 4DAGL 4PJHA 3BH9A 3QHZL 4BFIB 2V17L 1BYOA 5K39A 4UTBH 1QLRA 2X4PB 1E9OB 2BSRB 1KIUB 3QI9D 3D51A 4JDEB 5DJZA 5HPMA 3B9KC 1DUYA 4X2UA 3D34A 1U8HA 1UC6A 5IR1B 2ITCB 2I60L 3CZGA 3NA9L 1L9NA 4OLXH 3C8DA 2EVFA 3ECUA 2VW6A 2H3KA 4JRXA 4OUUA 4QHLB 5E99H 3K72B 5GS1B 1CGSL 2VDOB 5KJRL 4LGPB 1N12A 4AYFB 3S2AA 4MYPA 4FQHB 4S0TD 5AZ2H 4W93A 3ZRCC 3ZKMD 1JZ7A 1ZIBA 1DZBA 1YEWA 2AGJL 5A2IH 1BMZA 2CUIA 1A7RL 1UD5A 4Z7UF 2NMSA 5D6DC 2WQVA 3LH2H 3IN0A 1DVFD 1A64A 1UQSB 4YDJA 1XQ4A 2CU9A 2R59A 3OAZK 4PJIB 2MCG1 2AK4B 3K91A 2W65A 3TO4C 4GRMB 3IGAA 2BK8A 3U0TA 1OLLA 1F13A 5BV7L 3SOBL 1AO7A 1C16A 4UU9A 4U1JA 3BQUC 3MV8E 4MXVF 4N2EA 1LNUB 3EJYD 1X5KA 2JV6A 1JE6A 5FDWB 2OSLB 2PPEA 1J05B 4AYSA 1HH9B 3VFTA 1UXWA 2R2BB 2ZWKA 5LBSA 2BMKB 1UWXH 3O4LE 3VFVB 4HEPA 2DI8A 1ZPLA 4KKRA 1AQDA 4R97B 5BRZA 1CF8H 2HPTA 4EVNA 1N5YL 4KWUA 4IOIB 3V79C 4MAYB 3WIHL 4M8RA 4ANXA 3ARBA 4IRZA 5BZWA 1DEEB 2VC2L 1QA9A 1DLHB 2ZCLH 3L16A 1NC2D 2AF2A 4M9PA 4OZHA 2PWGA 3GO1H 5CBEA 3VD3A 1KLUB 1BZEA 4L3EA 1R1CA 2OL3L 3LKNB 4UDUA 4NOBA 1QZNA 5TPWH 5EF1A 4FI8A 1TQWA 4MA3B 2SODB 2Y4SA 5JPNA 1BJ8A 1A2YB 5E00B 2EDJA 3B2XA 5GGUA 4CC4A 1N64H 5IB1B 5FO9A 4D0DA 5L7XL 4FZ8L 2YAPA 4LVHC 2D31B 1WPCA 3CSFA 3U2SA 2DQGL 3BSZA 1DCEA 3NFPA 1FZJA 4MTMA 4PLKD 1INDH 4WI0B 1YEDA 4WW2C 3VRIB 1CE6A 1NUGA 5DD5H 3VVWA 2FEDD 1T4KA 1AR1D 3D0AA 5GRVL 3GBMH 2NTSP 1RZ8A 3ZMNA 2BNRB 1BMGA 4IJ3B 3HC4L 4PJXA 4F33A 2BVYA 3EF7A 2OR9L 1R3IH 4Z6AT 3N44B 4DP6X 4YQXL 4KY1L 4EN3D 5I66A 2ERJB 4MNGE 5DRWB 1X7QB 3FDWA 3GSNA 1KJVB 5ERWA 4G5AA 4QYOB 4Y9CA 43CAA 3TZVA 5CJ8A 3C08L 2R0LH 3ELQA 5T1KD 1SJXA 3IFOA 1IQDA 1ZLSL 4LT7A 1OE1A 1JGDA 2ZUTA 1L6XA 1A7OH 2CKBL 4KI5F 4N20A 3N5AA 2WN3A 4PH8A 2PW2A 2EZ0D 1YSOA 4BCXA 3BE1L 3FT2B 4ZS7H 1S7SB 1XCTB 4KZ0A 3WNMA 2VM3A 4PSPA 2G3MA 3QI9A 4APXB 1Y0LA 2F7PA 5I0ZA 4QJ5B 4KXBA 5JR1H 1C5BL 3H85A 1GZQA 4G5ZH 3T0AA 4OM1L 1U8PA 1RL1A 3CZLA 1EAQA 4A6YB 1OW0C 1I85C 2AQSA 4KKLC 5CAYB 4Z7VB 2GSMB 3QNXB 3BP5A 4ZO8A 4ZUVA 1EA9C 2VSMB 3HE7D 2ZUWA 4HT1H 2ESVB 2D03L 5I8CB 4PW9A 1JZ4A 3ZO9A 1OQXA 4ZOBA 1UZ6E 5GJSH 5DJAA 3FC8A 2GABA 4L0ZA 3QQ4A 5IB4A 3VXTB 1V7NH 3W39B 2ENPA 3K2IA 1VFAA 3JUYA 1G4RA 1GA2A 4GQQA 3HZKB 1KMGA 3W5NA 1C5DA 1DVFA 3ZLQC 4YO0A 1C1EL 1LK3H 3D0VB 3BUTA 1BVNT 1J9RA 4HUXA 1CE1L 3AG3B 1UT2A 1MZYA 3ES6B 3VFMA 3DX0A 3QQ9C 2Q8BH 3RA7L 2ARWA 4QLWA 4KGJA 4UYQA 3D12B 3BAXA 5FYLE 4XNZC 4OBSA 2XWCA 1JF6A 1AGCB 3BDXA 4MCZA 4TOYL 2ID5A 2IGFH 1NOFA 3DSNB 3MV8D 5IVZA 5I1CL 3L4YA 2IALA 5D7LB 3WY4A 1EXUA 4NKDB 4HEMA 4YXLH 3TC9A 4Z3EA 4K8RL 4W6XB 2KLSA 5LNGA 3O4LD 4E2OA 1F2XK 3BLKA 1O6VA 1NC2A 1UKSA 2YIHA 4ORGB 1NANH 4ETQB 5JHAA 3PJLA 3X14A 1C8PA 3NPSC 2A4EA 4HS6A 4HOMA 5F7DB 2J8UA 3RY4A 3UROR 1UB6B 2BP0A 2WWMC 3T2NH 3DX7A 1SPDA 4KUCD 4I48A 1MW0A 2UZIL 4JO3L 1UWYA 4Q2ZA 1KTKE 3DBSA 4E9VA 5KVFH 2J8HA 3GTTA 1BQUA 5EC1B 2PW1B 3QEGL 5K69A 1XGPB 2KLTA 3MRPA 1OP4A 5DWPA 3LIUA 5FGRA 5FGBC 1QACA 3NP4A 3O8XC 3CFCH 5DDHA 1KCVH 2FX9H 3WLWC 4H1LG 1AH1A 1QBLH 1N5AA 1EEUA 4MBRA 2HKHH 4FMVA 4KH9A 1BJ1H 4B9PA 1CU4L 3F7LA 1HOCA 3FBQA 3FB8B 3ULUH 3MXWH 5E8OA 4C55A 3MCG1 1J0KA 4LCUB 5T3XE 2PR4H 3QORC 1LO2L 4L23A 1BBJB 4PGBB 5B39B 3WEMA 5JHBA 3IDMB 4QHNA 4X80H 5IB2B 5EOQH 3ILQD 4Y1SA 1HINH 3FQYA 1RMFH 2W9EH 1BZ9B 5D71L 1SDDB 2AZUA 4NT6B 2KBGA 3EO0B 4MB3A 3M8OH 5T1KA 4Y5XC 3MGTB 7CGTA 5B38G 4HK3N 4FXGB 1ZHBA 4KMTL 4YHLL 2OYPA 3N0AA 4XE0A 2OXGB 1H0DA 4NNPL 3HFFA 1QKZH 1EXHA 2C1OB 3HNVL 2MKLC 3LH9A 4JFZL 1P4IL 2E7LA 5ISZE 2JE8A 3DPDA 3FRUA 3LNHA 4X50A 3J8F7 2WBJD 1FFQA 4EDXA 1ZDQA 3CPLA 1FG2B 3BAYA 5TDNB 5H35B 4DERA 4EN2A 2O6EA 4AXWA 2V5YA 2YLKA 2VDKH 2DQMA 5E6IC 2WTRB 3V5DA 43C9B 1OTTD 2H6OA 5C0RL 1QR4A 3C5XA 3V4UH 4IGBD 2C9UA 1YEFH 3UPAA 3VXUE 3TEYA 4M4PA 3BZFA 2Y2YA 1NGPH 1OWWA 3WOVA 1I8AA 1I9JL 4YK4B 4TULH 3VI3F 1CD8A 3BH8A 4DGIL 4OLWL 4HIIB 4DN3H 1GGBL 4W1TA 1WUNT 2WXJA 2NZ1A 4TSAH 3QXDA 3EJPA 4AG4H 1VB9A 2GYSA 2X4UB 4FG4A 2QGBA 1Q90A 2YD2A 3DHMA 4G59C 3A6BH 4D9QE 5B38A 3IGLA 1IM9B 3P4OA 1KTRL 3SE3A 5BUAA 2WLMA 2WZ0A 4JQVA 1D7CA 1MREL 2IFGA 3CHSA 4PVNA 3T0EB 1AHMA 3CSYB 2XWEA 1OAXH 2N01B 4G6KL 2ATKB 2EDFA 5F9DC 4ZFGH 1MAMH 1YAZA 2MSPA 2Z8VC 4MSWB 1K5WA 1U2CA 1E4WL 3SKMB 3FQRA 3WNOA 2L7JA 3BKMH 4L18A 4JW3A 2V2XB 1BVKA 3CNKA 4NIYE 4OIAA 4PJGE 1CD1B 1D3CA 4GKSA 3MV8A 2HLFC 4P99A 1UJ3C 2XU9A 5CF3A 2FNBA 4BFNA 1CLZH 2I85A 4RWHA 1IU1A 1SDAB 1KG0B 5FYLD 5KYNA 4LCYB 4MKTA 2QV4A 4NQSA 3TA3D 3L2MA 3O4LA 4OKDA 2NSXA 5BW7C 3L3IB 1DN0B 4HW6A 1D5XB 1J8RA 5J6HB 3V6ZB 2Z92B 4OW6A 4BD4A 1VF5C 2A9CA 3MBXL 3OR6B 2W60A 3REWB 4D9LL 5KYXA 1CDCA 1NFKA 4G8GB 1TVDA 4DPAX 1ICTA 5ALCL 4YWGL 1IAKA 4KI5C 4RGNC 2JKNA 5I1AA 4NZUH 4W6WB 3VU2A 2V33A 3RE0A 4ZPVA 2N56A 3RI5F 1ZHLB 1MFCL 4GG8B 2ZKXA 5DJDB 4DZ8B 2K7PA 1TCRB 1QSZA 3BO8B 4HS8L 5JORA 4ZUWB 4J6RL 4KRPD 4F93B 1JF1B 2P8MB 5FO2A 3QWNA 5DK2A 1UB5B 1PZ5A 2EXYC 4YN3A 4JLRB 5GRJH 1XZ0A 3BVUA 4M7JL 4E9YA 3CFIC 1QUNA 3ARFB 3QWQB 5ES4B 3NZHH 4AW7A 3MLRH 1X3DA 1PQZA 3UFIA 1NMAH 1FVEA 3A67H 3IKKA 1R3KA 2Y1ZA 4HDIB 3HN5A 2ZZUT 1J5HA 3MLXL 3BKYL 3E2HB 3LIZL 1OSEA 5MEQA 5LGYA 4Y16D 3HBGA 5GS0C 3BDYL 4D8PA 3VDCA 2Y5QA 1BQHB 4G6MH 4LVEA 5C7XH 2X2IA 4IBYA 1ONQA 1O6SB 4H8WC 2XWBA 2BSSA 1E9PA 3IDIB 1KPVA 4YDKL 2WO3B 2DBLH 1IGCH 3SDCB 1U3ZA 4MNGA 1MCCA 1T21A 2W9LA 3K6FA 4XVUD 1DP0A 2F5BL 4M61B 5L4IA 1AKJB 2NTFA 4JFEB 4WHYH 4LCWB 3CN4A 2NR6C 3IJEA 1F58L 2QEJA 1SXZA 5CD5C 3G9AB 5DUMH 1VDGA 1ZE3H 4BYHA 3BN3B 1UHVA 2J43A 3FN9A 5F7UA 1F8TL 4BXSV 2X1PA 4HULB 1MCBA 1U8OB 3SOTA 4IOFD 3UTOA 5KS9E 1HK6A 1Y7VA 4JFOA 2LFEA 3S34L 5ISZD 2VO8A 2XFXA 3FCSB 4CU7A 1D6EA 1EZUA 1XF5B 4Y89A 4BKSC 3HG1D 1SXCA 2YBRB 4IGBA 5AW4B 4FA6A 5IW6A 2ENSA 4H2CA 3QDGE 4NGHH 3HI1B 3ESUF 2Y7QA 1EEYA 2I32A 2CCLA 2P5WE 3B3IA 3V0JA 5A2LH 3OKNB 3VXUD 3M17B 3MNDA 3KVPA 1IGTA 2WQWA 4RAUB 5F1IB 3CV5A 3F58H 5HYEA 2DTSA 2AKRA 2Y23A 3MODL 2C3HA 1SF3A 3PHOA 4HFWA 2CH8A 3AAZA 3DUUA 3NACH 3HW7A 3MRBA 3Q05A 3WKMH 4PB9H 4GUPB 3RYMA 4JM2B 5CGBA 3QK0A 1RK0B 2XZAH 5AW7B 4DEUA 4D7PA 2A9DA 1IKNA 4KX7A 2YZ1A 4Z8FH 3IF1A 1GGUA 1HH6B 1RFDH 4D9QD 4X6CE 3EXLA 4OGXL 3E9UA 3C5JB 1Q4NX 5EDSA 3TYFB 1F90L 5I24A 4MYWB 4BQ6A 4KTDH 1FYTD 4UOZA 3N85H 2IPTH 3ARGD 4HWNA 3S37X 2R23B 4Q6YA 4I8DA 2DWDA 5F8RC 4UBDD 4W68A 3E38A 1LK2B 1NKRA 4R96A 3U9UB 1N3NA 2H3NB 2VITA 3AWGA 3MRQB 4YNYA 3TA3A 4GXUN 1K4CB 4TVPH 2LTQC 4ADIA 4XVTH 5ANHA 5E70A 3C6EA 3ZYIA 3KPQA 4P4KB 1ADQA 1XCXA 3KYNB 5T1LD 3L3OC 5AENA 1GXEA 3TBVA 4ALAL 3VGAB 3AWFA 4HIJB 1G9ML 2DWSA 4PMEA 4O51B 1GIGL 4MDIA 2OP4L 2GHWB 4YHPB 2XCMC 1XGRB 1KGJA 5CU5A 4AW4A 1MJUL 3APCA 2E7DA 5LGHL 1BLIA 4PJ7B 1IZJA 3RL1A 4GKZB 3IRPX 1TO5A 4WFFD 3PAUA 3LQAL 4RMSA 1NMCC 1YJDH 3ULVE 4KFZC 3FU5A 3OHXA 3SJVE 2AJZA 5DR5H 3L7EA 2LAGB 1J7VR 3U1QA 2ZUVA 5EEZA 1VGKB 2GK0A 3GFUA 4ZX3A 3FRPB 4MDJA 3MRHA 3ZKXB 3E6FA 1ACCA 1PLCA 2A74A 2W0FB 3DGGB 5CJOH 5HVWA 1GZHA 1A7PL 1OL0A 5F1OB 5DHMC 3ZL2A 1Z0MA 1KGCE 1BEYL 4FJYA 3GC3A 3AQXA 2QKIC 4P5TD 3STLB 1N8ZB 4J4PD 4Y16A 3TFBA 3O9WC 1I3GH 4N5EC 4CADA 1M53A 2AJUH 4U2ZA 4X8JB 1SF5A 1SY6A 2K4WA 2PYEB 3JBG7 4FQJH 4M4RB 2PCXA 2X9WA 3VYPA 4WWNA 2YUXA 4WTXA 2VISB 2DQJH 4JJHA 2NX5D 1W2KT 4PJAF 3BP4B 3WY3A 4QRAA 1K5NA 2A6IB 4Y4HC 5AZUA 4MMXB 8CGTA 3SGKA 4RFOL 3OKOA 1BYNA 4R7VA 3SGJA 5C6WH 4KBPA 4XE5B 3PABB 2FQEA 3FB5B 3DROB 1U8LB 4CW1B 1CR9H 3B7UX 4J3OD 4LEOB 2AMGA 4X9BA 1X4XA 5ISZA 3ZY7A 5DJ2B 4WHTA 3B2PA 5D1XE 2YXFA 1AHKA 1YQVH 3K2MC 1HYSD 1LEKB 5I1IH 3EJJX 3LXUX 4H20L 3GLZA 3C5SB 3H56A 1NGXB 3NFSH 4FLQA 4H0HB 4DK5A 5KJ7E 1ZA6B 4QY8B 2C3GA 5KVGH 2AVGA 3VXUA 2CO6B 3NN8A 2EJ1A 3QDGD 1IAIL 1LO0L 2V37A 4U49A 3HZVA 2GJPA 1MFMA 5E2WH 3KZ8A 5DHVH 4YJZL 4UZUA 4KJYA 3NTCH 4CL7A 4WUKH 3SDAD 4F2MB 2H6PB 3MJ7A 3H2WA 1SN2A 1ZANH 3NSCA 4GIPD 1A21A 3MRNA 1QASA 4G43B 2NUPB 4O9HH 1F1DA 3BIKB 2AW2A 4OLYH 4HJJH 3GXNA 3FTGB 3QJVB 1S5HB 2R2EA 1TIUA 1J0JA 2KL6A 5F3BB 3IFNL 3TVMD 2FE0A 3KPSB 4PJIF 2G3ZA 4J3VA 2WZ6A 4FTVB 5K9JH 2QADD 3EYSL 1IIIA 1QVOB 1QHPA 2HLAB 2UXFA 4MCYB 1SM3H 3ARGA 4KKZA 4JN1L 3P4NA 5IESL 4OF8A 5KYUB 3HLKA 4HCRH 4IBSA 1F6FB 4KKBC 3P73B 4YDZA 2F8XC 3L3GA 3CZFA 5GGSA 5I6LA 5DTFA 1WBXB 3RHWK 2FJHB 2XN2A 1UWGL 3KPLB 5CGYC 2ALWA 4X8XA 3B9DA 1FSKC 3MNZA 5F8QC 1NPUA 2ATPB 3FOMA 1NBZB 1KIRA 4PGCA 4I18C 5T1LA 1U8CA 3I02B 4P5RA 2BVTA 3H6AA 1S78D 4JK0D 4J39A 3QQ3A 3TBYB 5F7FA 1BGXL 1HZKA 1NDTA 1TTGA 4K3HA 1VKXB 1IZKA 3KS0J 3VD0A 4EUPG 2YPLE 1U33A 4Z0BH 1CICD 4LL4A 1RIHH 1ZT4A 4OV5B 3HC2A 3LN4B 4K8RC 5DT1H 1FFRA 2MPAL 1QO3A 4FQXA 1M1XB 2GUOB 3MVSA 3S8FB 1B0IA 1M05A 4N85A 1WBYA 3D3VB 3P3UA 4R9HA 1HT6A 3MRCA 4F2EA 2EYSB 2NY2D 1BAFH 2DICA 1SMOA 3ETTA 5DJXB 1R19A 4WUUB 3NEOA 4K3JL 1JZ5A 2BOBA 3EDDA 1FH5H 2DMCA 3VNZA 5BNXD 3CZUB 2VRAA 2YO3A 3ULVD 4CBZA 4ERSH 2O5YH 3D1MC 3BWAA 1ZDSA 3E7JA 4P5TA 3DHJA 1HS6A 4FQQA 2WQUA 4OLXL 3MRMB 3A24A 3ARXA 3UAAA 4XNXH 4YAQA 3S5ZA 1WZKA 3OMIB 2DQHH 5E99L 4FCHA 1NGWA 5HGDB 5E5MB 3N44F 2CLRB 3SD5A 2C9SA 2ROXA 3CH8A 4LEXL 3NZ8A 2X12A 5EEYA 1BF5A 3CX5K 3GMPA 2EIEA 1F0LA 3IJHB 2WJ5A 1JIBA 1F4XL 3LH2L 3QYCA 4PP1C 5ADOL 3BVVA 1Y1UA 1X5LA 3F2LA 1CURA 4E9TA 1EO7A 4HGWB 4DWHA 3HN3A 5ECGA 3HNTH 5E1AB 2QR0A 1LP9B 4R4BB 5HGHA 3RLSA 2CR3A 4FZEH 5E08H 5DEZA 3BZEB 1EUUA 2R29L 3L5WA 3WFCH 1SHXA 3ZTNH 3JTSB 4N0YH 5CFHA 1M7IB 2Q7NA 4B7LA 5ENWA 4LARH 2EC9U 2MQ0A 4K7PX 5DJ8A 3WN6A 1GJUA 1QQDB 1ZT1A 4L9LA 4XP4H 3QNYA 5D1XD 5E8NA 1FVCB 3GI9L 4Z7VF 3QDGA 1NFDE 1UGNA 5DZ9A 3QDMB 2QSVA 3IU4H 4HUKB 2P5WA 1W16A 5LJYH 2WXLA 5I2IA 5ANME 3SDAA 3ZKND 2OKMA 3MO1A 2CQVA 5INDA 4EDWL 5HHXH 2DS4A 1I75A 2A5UA 2MNWA 4PFEA 4Z7QE 5DVLA 2VQUA 3ARTA 3QDHA 4P4RB 3B1TA 4R26H 4ZT1A 4ESKA 1T0NB 5G5DA 3E8VA 1ROWA 3TVMA 3RJOA 4X0KA 4G6AD 5GIRA 1D5ZB 3TBSA 4X6CA 5FUCE 1MCOH 3OZLA 1ET5A 2WXFA 4WV1A 1SEBB 2JKJA 3MJ8A 3O81A 3OPZL 3GBML 4MZ2A 1ZTXE 3GBNL 1U8NB 4IK7A 4NI6A 2AC0A 1BXUA 2IADB 4LSTH 3WN5A 3MLSH 3RKDC 4DKTA 4K73A 4P04A 3EOAB 4M1CD 3X3FL 4K4KA 1I1AC 1NUNB 3QXAA 1R3IL 3IGFA 3ZTJG 3K80A 2OMVA 2VMDA 1ND0A 3K46A 3QWRD 5ICZA 1JFQL 3U4BL 3CC5B 2AJSH 5GPRA 5HVFB 2VMFA 3D6GA 4RQQB 4XRCA 2OQJB 3LTVA 2HWZL 3DTXA 3QUYC 2J55A 1E8WA 2AEQL 1CICA 3MV9E 4QD2E 3WUZA 4IBWA 1AD9A 1E6JL 1MXGA 1HEZA 3LKPA 1MNNA 1N8OE 3UYOD 4XI5D 1PG7H 5DZPA 2YD3A 1SBSH 2E6JA 3CN2A 4JZOA 1TNMA 4PBWD 2W5PA 1ACYL 2YPLD 1I8IA 3JZYA 1GPOH 1I8UA 1GR7A 1RSFA 4ZS7L 4PJFE 4YHKH 1E4JA 1HWHB 4N2MA 2XOTA 3FT1A 3EDEA 3VB8A 1G0YR 1KCLA 2ZX8A 4M43H 5D4IA 3GSQA 2Y1YA 3SJVA 3KW8A 1XX9C 4NUPA 3PP4L 1U8IB 4TUOA 2ZAGA 1E6OH 2RGSA 1R0AH 4KTYA 4WU7A 1KJ2H 4AYEC 1EWHA 3W9DA 5GS1C 3MX0A 2NNAA 1S2EA 5D2NE 5EU6B 1XGUB 2CGRH 1RUPH 3QIBB 3DVIA 1TF4A 3I75A 4JCWA 5PAZA 5L2KB 3CUPA 4P46C 4PRNB 3EW3B 4N0UE 1M7UA 5TDOA 4KTEH 3IVKA 3GMOA 4AQ1C 2O5XL 4L5FE 1Z5YD 3R06A 4NRXA 2DJ4A 4KK9C 4NIKB 3JT0A 1MG2C 1XF4B 4G9FB 2R2HA 3RDTC 3GHEH 2I07B 3QHFH 3QT2A 3QUKB 1S7RB 4LBAA 1A6VL 1SXSA 4LXFA 1T2QH 3KLAA 4W81A 3OSVA 3LRHA 3FTUA 2Q8BL 3NIGE 4PPTA 4ISVA 3V0IA 1V54B 4ODUA 3MCKA 5AOMA 4HU2A 1HHKA 4YR6B 5F7WC 1RZPA 2HJLB 4LOUC 4ZMNA 1RUQL 2UZXA 4CGUB 2Y2TA 2UVEA 1B9KA 4HUWB 5KYYB 2EDTA 5IVXB 2IGFL 4HJUA 2E9IA 5FHBH 1V7ML 1Z3GH 5D1XA 4AIEA 4ZMLA 2N7SA 4R97C 2WWOA 2Y25A 1HTYA 4MAYC 1BHGA 3TESA 3PL6C 1S9VB 4PJCB 1AKPA 1E28A 1ORQB 3POHA 1QNIA 4W6YB 3GLAA 2YUVA 5AW2B 3ZMEA 2Z64C 5AVTB 1M2VA 3B9AA 3HB3C 5GRUH 1QLFB 4HF5H 2XTJE 3A22A 4OSUL 4HJGA 1OAYH 1RHHA 1HX0A 3T2NL 1IEBB 1YZZA 3JV6B 3RWCA 3ME0B 4YDIH 5F71A 1MNUL 1U3JA 4WEBH 4DEPB 3TNMA 1AD0A 5B1BB 3DUSB 1N0LB 5DC2A 4JFYA 3O6MH 3OWEA 4A04A 1T5KA 4W9DC 5EULV 5DHVB 1JXFA 1BBDL 1DVYA 3DXAB 4BFOA 1XH1A 4XWGH 4Q6KA 3PQYE 1KCVL 1I4FB 2FX9L 2XKNA 5I1GH 1U3NA 1P5UB 1TTFA 1YDPB 5HHPA 4DUWA 2GITA 4XBGA 1UTDA 4IJ3C 4LSQL 2E8ZA 5HYIA 3K7UA 1OT1A 2XWTB 4LCCC 1K9TA 4OCRH 3N1GC 3QWRA 4DO4A 3O0LA 2PR4L 3GSVA 3F7YA 1GAFL 2ERJC 3ML8A 2R69H 4UT6H 2BVPB 2OI9B 3P3TA 4X80L 1DTUA 3D09A 2AV7B 4J1UB 4IMKC 2YWYA 3EFFA 3FPXA 2CUHA 3PV6B 1DVXA 3UYPB 5CD3A 4ACPA 4B41A 1T6VN 4PVBA 4UQ2A 3FONB 2CDGA 1MCLA 1OP3H 4E9SA 2X88A 5ABDE 3QAZB 1I7TB 1MCRA 2ZXCA 3MACL 3NSJA 3WIAA 2PO6B 2J44A 4HJ1A 4ODXB 2YPLA 4Y2DA 4RISH 3CSBA 1OARL 3MBED 4P3CL 5AOKA 4MMZB 4ALAC 5C3TA 1G9MC 2BH0A 3KPTA 2AXHA 4NP4H 4XBEH 3IAGC 3P2BA 1XIWD 1ZEAL 2VDKL 5IW1B 5HVGB 4NN7B 4NZ8A 3ZDZB 3KVQA 5F96L 5DQ9B 3VFNA 1UG9A 2FYYA 4JO5A 5KYWB 3TA4D 1TVHA 2WXIA 2LU4A 2P9RA 5FM5O 1KF9B 4HP5A 5I73B 4UDTB 1U8QB 2EKSA 4MVBC 1KGYE 2QKSA 5A16B 5IVOA 1ORSA 3D9AL 4L1BA 4OD1L 1H3PH 1UWEL 1HOEA 4DN3L 5F7EL 4QRSB 1H6EA 4X4YA 3QO1B 2O61B 2EO7A 4AG4L 4WWPA 4ENEC 1A22B 3OPUA 4QKTA 4AKPA 4ZNCD 4BUGA 2J2ZB 4IRJD 4HAFA 3LKRA 5KBLA 2WIIB 4LRIC 1PCXA 3CBKB 1U2HA 3JWNE 2X3CA 1BF2A 1WT5A 2UVFA 3LPWA 2HKFH 4WI6A 5ACZB 3CMOH 4J28A 1N4XL 4YHIA 2NDFA 3QCTH 2ENYA 2XQBL 2CBQA 3RGVC 1QNZL 3BKJL 3RY5A 1ZVYA 2X9YA 4EI5B 4DGVH 3U82B 3QNFA 1DBMH 2V5RA 4Q0XH 3PHQB 3GB7A 5BJTB 3UZEC 2EQDA 4ZMQA 3BKML 1QHQA 1WFJA 5EORH 5LNEA 3WJJA 2W9DH 1BFSA 1NAMA 3MREB 3B9VA 1IAII 3DETC 1LO5A 4JPIB 5F1NB 3ENEA 3AY4C 5CMAA 1AFVH 4OF6A 2BNQB 3SY0A 3BT2H 3RAJH 1NGYA 1H9DA 2DYPD 2IPKA 1AACA 1L5GA 2E3VA 3OAWA 1NFDA 3KXFE 5J4MA 4I2XE 2F8VA 3RKPA 3EHBB 1OGAB 4WK4B 3X13A 2BO0A 4L29A 2KZ1B 5DZOA 5IB3B 2ZAHA 3NVQA 2E0PA 4NZUL 5T1MB 2V7NA 1VAHA 3PGCB 5DQDH 3VFOB 1PX8A 1VFMA 1FAIH 2YRLA 3KLQA 4JM2F 4NX0A 3RBSA 1Z66A 4ZAKC 3DDGA 4RGMC 2F54B 4KAQL 3LZPA 4IDJH 3KR3H 3FF7A 3MV7B 2HJFA 5C0CE 4H13C 3BAEL 2FJSA 3VACA 1FZOB 4KK6D 2ENQA 3MLRL 5GSRB 3PQYD 3RIKA 1NMAL 5K59E 1QTPA 3A67L 2NPLX 2VCOA 3JTBA 4NUJB 1ZVHA 4WO4A 1PYWB 3QR2A 2O6CA 3VWKC 4F91B 3NSYA 1S6NA 1FDLH 3RL2A 1RZJH 5HI5C 5C7XL 4YDMA 1XR9A 4PREB 5D96C 2ZXEB 2GAZB 1EZSA 1NIAA 2OTWA 3QO0A 3KWUA 1JNHA 4FXGC 5GZOD 5E2VL 3DPBB 1U91A 2NLJB 1JGEA 1EZVY 2QSCH 1OCRB 3RU8L 4YPGA 1KEMH 4JPKH 2ZXBA 1HZLA 4DO6A 3MV9A 2C4FU 3FT3B 2ADJB 1TZIA 2VR5A 3OXRB 4I9XA 3MBEA 4OV6F 1YN6B 4OCNC 4PJ7F 4XXCA 5D9SA 5C8JA 3C09B 1SJEA 2AJ3B 4BZYA 5KTEH 4M3KB 1VFBB 4NWUL 2HT3D 2P5ED 2Z9TA 3EO1B 3MBWB 4AE0A 4PJFA 1N68A 1SFDA 1CPUA 5D93B 4FFYH 5SV3A 1L7TH 1USZA 3BVDB 3QPQC 4ABVA 3OJDA 4DUVA 3RUGE 2AXGA 2BVQA 4YK4C 1WD9A 5E8DH 3PWVB 4N2HA 4R2GD 2V4LA 2L7EA 3T8VA 4BK4A 5IQ7H 2A83B 4Y4KB 1ZSDA 3ZTDC 2QTVA 3M6DA 4HHAB 2GHZA 4JFQA 5D2NA 5I1LA 2LLNA 2JB5L 2HT4D 3MLTB 3ZDYE 4H25B 1B6UA 5AD0A 4IRJA 2P48B 4M1GL 2WINB 5DJ0B 3UAJD 3NACL 1ET8A 4W9GC 2YUZA 4PJBB 4PB9L 1FV1B 3HG4A 1P1VA 2VLRB 3RB7A 3T0EC 3MCLL 4XCEA 4K5OA 1TCMA 3FUFA 4O02L 2NUTB 3ULUF 5I1HH 4N0UA 1RIUH 4ABQA 5AUMB 1R5WB 3DV6A 1FNAA 1RFDL 1K8IB 3QCUL 4G7VL 4TNGA 2FJGA 4MGXA 4W4OC 2WXGA 1A25A 4NO0B 3GMRB 3VXSE 3K8KA 4JQIA 2EXWC 2OR7A 4ZG1A 5IV2A 4E0RB 1K2DA 3I85A 1QSEB 2FWSA 2WKOA 4XNAA 3WS3A 3WCYA 4A7VA 5IBLD 2YAEA 4NO5A 4R4ND 5FYJD 4HC1H 1HXMA 5FUOH 1EVUA 1XBRA 1XSOA 4Z3GA 3MZTA 3NJNA 5HDQH 5GS2H 3RWIB 5C08E 4QT5A 4AVKA 1IFGA 4XVTL 3ZZLA 4BDVB 3L9YA 5IW3A 2RFXA 4FE9A 4HV8A 2DQIH 4LIQL 1RH8A 2X1WL 4G80B 4ZI8A 5C07B 5EEXA 1AIFB 1QR1B 5FX3A 4LLWA 4ZODA 2WTOA 4KDWA 2IG2L 3TJHD 4A2DA 3TV3H 4XN4A 3GIVA 3MSPA 1NEZB 3U0PB 1A7QL 4N1EA 3B3BA 1HILB 2FL5B 3GM0A 3NABH 4E9WA 3V95A 5C0NC 3FF8A 2DLIA 2R0ZH 4L1HA 2HG0A 3DV4A 3NK4A 1YHPA 2Z31B 4O58L 4HWEH 1GH7A 2YLHA 5I8OH 4HFUL 1VRSA 4RWYH 5IROD 4LGSB 5AYTA 5HHMB 4BGDA 3X2QB 4PJ9D 2AJYH 1SUHA 3IDGA 2ZKHL 4NQEE 4AI7A 4O2FB 5DR5L 4KUZL 1U8MB 2QFPA 4HD9A 1DCLA 3SZ6A 5HJDA 1R46A 3NIFE 2XA8L 2WZPD 3GMLA 3RNQA 3TN0C 5IJKC 3Q1SH 4NQDE 2O72A 3PQYA 1IE5A 4BUHA 4BV1A 5GISH 4AEEA 5CJOL 5C0CD 2NY1D 1YG9A 2P8PB 3KBHE 2ZOLB 4U1LB 4Y4FA 5CKGA 5F7AA 3QEQD 2FWLB 4HS3B 5IWLC 4L37A 3E2HC 1OP3K 5EOTA 3LZFH 1RPKA 1I1FA 1H5BA 1MCHA 3PXJA 4LPCA 4WVRA 5SWSD 4ZXBB 3AB0B 3L45A 1S7WB 1BWMA 2WCGA 2AJUL 4N2DA 3OMAB 4ZS6C 2VH5L 1OSYA 2Z0UA 5JHDE 1OM3H 3UDWC 4UQ3A 3U4AA 4FDWA 1HNGA 4CVXA 1I9EA 3GLEA 5GZOA 3MPCA 3FQXB 4HHGA 3HNSH 2FATL 2WJ7A 3NJGA 5H2BB 4F8LA 2DQJL 3C60D 5LGKA 2ADYA 5CHNA 1GS7A 3O6FC