4DH2A

Crystal structure of coh-olpc(cthe_0452)-doc435(cthe_0435) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
IHEAETADYILDVLVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFDYNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGSTKKYSLITFGESNFCDFDLKPILAVLKEGKVEIEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome anchoring protein cohesin region
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
total genus 31
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dh2A00
2CCLA 3KCPA 4IU3A 1TYJA 4U3SA 2W1NA 5G5DA 2ZF9A 2JH2A 1QZNA 2B59A 4FL4C 1G1KA 2VN6A 4UYQA 2OZNA 4UYPA 1ANUA 2BM3A 3GHPA 5K39A 4UMSA 5LXVA 4WKZB 4DH2A 3UL4A 1ZV9A 3BWZA 1AOHA 3F2LA 5AOZA 3L8QA 4N2OA 4IU2A 4WI0A 1OHZA 3KCPB 2XDHA 2VO8A 3FNKA 2O4EA 2VN5A 4FL4B 2Y3NA
chains in the Genus database with same CATH superfamily
4HIEB 1GA2A 2WB1A 3VRLF 1P5UC 3PWLB 1CE1L 1NZRA 4WW2A 3ZQXA 1OZUA 1U8HA 1CURA 1MCSA 4JFOA 1KXVA 3Q7JA 3T8MA 2EXWC 5F7MC 5AZ2H 4I9WD 4N86A 4Z23A 5LXVA 3FO1A 4R26L 3FW6A 3UGXA 2ZPKH 1MCBA 3GSXB 3RTQC 3BUYB 5M95B 4LKXA 3QCVH 1E0OB 1AHMA 2VDQH 1L6PA 1KV7A 4RESB 5AVSB 5ELIA 4LCIH 3MQIA 5D1ZA 4LE8A 4DOHE 1CICA 4IMKA 3U0TA 1AOZA 4M03A 4OCYH 1Q9KA 5FYJH 3OLEA 4PWIA 3GSNB 4CN6A 3AREA 3EDKA 3KPRD 2VLKA 4OIBA 4XZUA 3U79A 3BIKA 5DJZB 1E43A 2GY7B 1ZLWH 4A7SA 2FCBA 4HIXL 5A16B 1LILA 1I7UA 1UYWL 1A4JB 4PGCA 4L18A 2YRLA 4R6UA 3S8FB 2ZX6A 4R4BA 2XXMB 4EUPG 2J3SA 5HGAA 4DN3H 1OAXH 1YEKL 3QJRB 3RWCB 2NZ1A 4MA3B 4KO7A 3VTMA 4CADB 1OY3B 3T71A 4E5XA 4WLCA 3VCLB 5EIIB 3GSQA 1YAIA 1ZDSA 5J6GA 1ZS8A 5HYJE 4P23A 1FJ1A 1JPTL 1A14H 3QG6A 4FTDA 3ULUF 2BS9A 2Q3AA 3K4ZA 4JPQA 2NY5H 4RISL 1NSNL 1R46A 3S48A 3D9AH 1C5DA 3BMVA 5ID0B 2AK4B 4LB8A 2GBTA 4I77L 2OULB 4Y2OB 4XN5A 3GXTA 4ZPTA 2WVSA 5ANMA 1Z6JT 4X9HA 4FYSA 4N1CA 1L5GA 2L7EA 2YOCA 3RTLA 4MZ2A 1IM9D 3A6CL 4RMUA 2IVFC 1BZQK 3SDDD 3CMOL 4FG6C 3FHEA 3ZHFA 1F86A 1CGXA 1I7TA 2ICWI 3QQ4B 4OT1H 3FOLB 3U0WL 3OMZA 5A2AA 3QJUB 5TF1H 2Z0UA 2LU5A 4JHUA 3ZL1A 1GW6A 1A6ZA 2M83A 3PWJB 4MKMA 4Z7IA 4G8IB 3ORJA 4MXWH 3VM5A 3MYJA 4KRPC 1OWWA 3BSZA 3UC2A 5BRPA 3MODL 1U8CA 1VGKB 2WXHA 3B3IB 3S0PA 5IFAH 2WINB 3L17A 3AS0A 5T1MB 4Z7AA 5IEKB 1T80A 2LTQC 1MFBH 3WDJA 2QSVA 3FF8A 3SBPA 2F74A 4MD0A 4WVRA 1R3HB 3BWAB 1LO2H 3O6FC 4U1MB 1LJMA 3IFOB 4KI5C 1J1XL 4RX4D 4XRCA 2HFGL 1PX3A 3BAIA 2OX5B 5CF3A 2Q86A 2XLLA 4GT7A 4NP9A 4QEGA 1K3IA 3E6HA 2X6CA 3AB0B 5JIHA 2GJJA 1P6FA 4RMWA 4Q7DA 1DBKL 1GYVA 3VGAC 4NUMA 1E90A 1O9WA 2DQ6A 4OLXL 4BZ1L 2EVFA 3MV9A 4F93B 5AAMA 1KYAA 3MTRA 4OAWA 1MI5E 4BSJA 4XPGL 3ATDA 4FNPA 1AOHA 1PCXA 2NY0D 4W9FC 3CH8A 4AQ8C 1IIKA 4WFEE 4TOYH 1M53A 2VH5H 2XTJE 1CC3A 4TULH 3BOVA 4QGYA 4ZO9A 4FQXC 3C5ZC 3V4PB 2A6KB 1YYMH 4TLKA 3WMSA 4FRWA 4KVPA 1RK0A 4UM8B 5AZ2L 3RJQB 4I48A 4FI8A 2BCMA 2E7LA 2A6JA 4GG6E 2VDMB 4Z18A 5EEYA 5CJ5A 3QCVL 4KROB 4ZW7A 4Y19D 3HVDA 2HRPH 4C55A 1G7LB 4LCIL 4X0KA 5DUPH 4BKLB 1ZHKA 4Q52A 2Y22A 3RE0A 1G7PA 4F92B 2IXQB 2N3JA 3VD7A 2X4PB 3ILEA 1NBZB 4Z7OF 4PWHA 5EV7A 4MAZA 5HDWA 3HS0A 2QQKH 2NZIA 1MQ8A 3DMMC 4XP1H 3MGTA 1S9YA 3SJVE 1KYFA 4R5TA 4OCMC 1PLAA 4RH4A 1F4YH 1G0DA 4KK8D 3KZ8A 1NH6A 1OAXL 1IGIH 3GSRB 3QQDB 2YQBA 3TNNA 1MFCH 2BZDA 3RX8A 4XNZC 1YN6A 1OT2A 3CWGA 3JV6B 4XZ4A 3WLBB 3E8UH 3G6AB 1QSEB 4X5XA 2DYPD 3O8XD 3KS0H 2ADIB 1A14L 4B41A 2XV3A 4JLRA 4HX1A 1NL0L 2NY5L 1OGTB 4BFIB 4FXTA 2DQCL 3D9AL 4BDVB 4LVHC 15C8L 5GRZA 3IB4A 4O2CA 2WXKA 2Y5TB 3DXAE 1E5AA 1IKNC 1YEJH 3H3BC 3WKPA 4BZYA 4Z3JA 3U6XA 3UX9B 1U2CA 3C60A 5MHSD 2RCSH 1Q72L 3MRJB 1JHLH 3NIFB 4HIJA 2Z7ZA 3SEPA 1U8OB 3WTUA 2AVGA 4R3SA 2YSSB 3MVSA 4MXWL 2XPZA 5GJTH 4X6FB 3QPKA 4AENA 4EI6B 1TNNA 4JFFB 2OL3B 3W11C 2YK1H 4FKEA 1J8HD 3TV3H 3KE0A 3FKUS 4A63A 3KYMB 4GPVA 3OWEA 1IVTA 2ZSWA 1E3FA 4HFWB 3L3DA 5I75C 2H8PA 2R2BA 3NACL 2CJSA 1P7QA 4DSYA 4JO2H 4PJDF 4LGRB 5AEAA 1LO2L 5D7EA 2DD8L 2X9ZA 5LAXA 4MNQD 2C1OB 2R15A 3AUWB 5E99L 1KSRA 1RUKH 3QCTH 5T1KD 2Q2LA 2WCSA 1RH8A 2YWZA 3MNVB 1HL9A 1IAII 4OZIF 3T3MB 3BSZH 3OMAB 3FU3A 4WENB 3VWJA 3F84A 2N59A 4NQVB 2Z0BA 2E7MA 3GZOA 2B5IB 3IDMA 3JUZA 4U3CA 1M3IA 1IGTB 3QUKB 4LL1A 1VJSA 2W07A 2NDFA 2K4AA 3RX5A 4D9QE 1KB9K 2LVEA 2JI3A 2YXWA 5DZ9A 4MB1A 2FO1A 5BVPL 1HHIA 1PW3A 2FEDD 2VUYA 1ZWIA 3KVQA 2OSWA 3TBCA 3B8YA 4XXCC 1EGJA 1JV5A 4TOYL 4KVNH 5FO9B 2VH5L 4KGJA 4CN1A 3B7RL 3ZN6A 5CZVH 3S3SA 4LCUA 3KLHC 3BZEB 5T1JA 4RRPM 1NDGA 3T2QA 1KIPB 4Q58C 2XN9E 3UDWC 4OB5H 4RDBA 2ATAA 4NQEA 5DRXB 5ESQA 5I1IL 4PJAF 4UZSA 1UQSB 4B9PA 1PG7W 4KRLB 4DP0X 3OKOA 2HRPL 3GMRA 5DUPL 2GJ6D 2HLFD 5L2KB 3S4SA 2R1XB 4KK5C 3TBBA 2V0AA 2EC8A 2VN6A 1CFTB 3NDZE 4N2AA 4U1KB 4YXLH 1TO4A 4B53A 2JJSC 5BS0A 2OXGA 2APBA 2PXYA 2TRYA 3G7TA 4DK5A 2PW2A 2QQKL 2CIIB 4N2LA 1I8IA 5AYQA 5TTRA 1CFQB 1SN0A 3LKSA 3EHBB 3W9EA 4IOFD 3UACA 1IGIL 4TVSa 2XZCL 4S0HA 2GTWB 4KV5F 4YZFF 4QRTA 1MFCL 4GP8B 3WIFA 3HCVB 3OKKB 1KC5H 3U30C 1EX0A 1P1ZA 3VFNB 5FO8A 1OOAA 5CGMA 2EKJA 3TCXA 1WLHA 4R4NC 1L4IA 2F18A 2V3EA 3ETBF 1MVUB 3ULUC 1DSYA 4Z0XB 3RIAK 3T2PA 2NY4D 3IGLA 1TZIB 2GKIA 4ODXA 4IGBD 3REVB 1G9MH 4DIXA 1YEJL 4UQIM 4L3AA 1KPVB 3PE9A 5KBNC 2A6IA 4Y4KB 3FQXA 4ZSOE 2RCSL 3BP4B 5T3ZH 4R0LC 4P48A 4L9LC 4WSKA 2YPLB 5CSBA 1SXBA 1Z5LB 2AGJL 1JHLL 2JCCE 2MOGA 5I1GH 5EIVA 2ATPA 4CGTA 1JMXA 5C0ND 3SKNB 4DETA 1SJHB 2WXMA 1J5HA 1JFHA 1UXWA 1G7IB 1QX1A 3MRIB 3TV3L 4NNXB 2IAMC 2NYKA 1ZV9A 4Y2NA 1C16A 5FGBA 3BFWA 4MX7B 5LQBL 1F0LA 1BD2E 1PLGH 2HP4A 4XNXL 3SB3A 3CDFA 5C8JB 1CD0A 4PJ9D 4JO8A 1F4WL 5F2FA 4AH2A 1T7WA 2CHNA 3QUZC 4QHUA 3LKNA 4U3SA 5CO1A 2MCG1 3ZTNH 1JNHB 1YY8A 2X88A 5BV7B 4M5ZH 1N59A 3CHPA 1RUKL 3OAWA 1IM3A 1WGOA 3J27A 3A0OA 1A9BA 2GEQA 3BSZL 1OXYA 4OF3A 2ZWYA 5IK3A 1SY6H 4HJJH 3ASOB 3TXAA 4HIPA 1S7SA 3DHPA 3NZUA 2CU9A 3EOBB 4XR8C 3WN5B 2F8IA 2FYYA 3SYCA 1BYNA 3BVNA 4HSCX 1D5MB 1G1OA 2IFGA 3HUJF 3V6OE 1A1OA 1A3RL 1B0RB 3D2TA 3BZ5A 1DN2A 2HVBA 3D05A 5TE7H 3KNBB 3VWKD 1JYNA 3U6RB 1P5UA 4N2EA 3SPJA 4YDLC 2XI9A 3DUUA 4F20A 3IXAB 5E5LA 5CZVL 5MEOA 3HG4A 2Y3AA 1U91A 2H6UA 5JTWA 4KJPC 2XG4A 4KH2A 2B2XH 1A6TA 4LLMB 2O26U 3NA9L 4OB5L 2EVIA 1CYXA 1TJMA 5FFLA 3RPIA 1GSMA 3FB8B 3QS2A 4BQBA 1DJSA 4YHKH 4JZOA 2CIKB 1ZDQA 4ODTL 3RHWK 2WLHA 1FZJA 3ZRCC 1OD7A 2SEBA 4AGQA 4LP5A 4YFLF 3QDGA 3IETA 3IRZA 1GJIA 4CVUA 4DP6X 3HB3C 4YXLL 3SE9H 4M9OA 2WIIB 1JZFA 4NPKA 3QR2A 4XVUD 5ESVB 4FMVA 3AVEA 2WXQA 2G5BB 4HCRL 4GIOA 5EU6E 1M42A 4GRLC 4H25B 4P04A 1JYWA 1I8MA 4O51B 3O4OC 2PETA 1R47A 3SYQA 1TNMA 4H1LA 4FKHA 3MTXA 2TSBA 4G8GA 3SY6A 1S9KC 2FO4B 3QDMA 1KC5L 1X6LA 3BD5A 3UC0H 5E7BA 5I66B 5B8CA 4QHKI 2A83A 5I9QB 1X5XA 2XWJB 2Q2EB 3OC5A 1CF1A 4V1DB 3IDXH 3CNKA 1GZHC 2COVD 4LOUD 4OY9A 3H55A 4RGNB 4APQC 4PLNC 1G9ML 4Z7UF 3CBKB 3QEQB 2NXYB 4Q6KA 4I85A 1P4LB 3DBSA 3EFOA 2RA1A 2DQJH 3HE7D 2GY5A 3D2UD 3KWWA 3L1OH 3VYOA 4JDZB 5I8KL 1WFJA 1ACZA 1VZIA 3AMKA 3GBML 4P5TB 3VI4E 4K71B 2BLFA 5I1GL 1M1XB 1PZBA 4X8JB 3QJFB 2WO3B 5IV2A 3P73A 5HGDB 2X3BA 1ZSDB 2NRDA 5DD1L 4XE0A 5F7YC 3ZO9A 1Q0YH 2VJXA 1UUNA 2UV3A 3X1NA 3WEOA 5LDSA 2BNUA 2MNJB 1IGYB 1PLGL 2WOYA 2R1YB 3EO0B 4PV8B 2P4AB 3SE3A 3TVMC 3HKZA 3VQMA 4F7TB 1Z9PA 4B95C 1JG9A 2G3NA 2WWMD 4WUKH 3ZTNL 5DD6A 3O6FA 4AM0B 5K93A 9CGTA 3FOMB 4M5ZL 2VO8A 1Z5YD 1E27A 3RUGF 3QZBA 1XHHA 1LDSA 2VB5A 1UKTA 4F33B 4HOZA 2BSRB 1SY6L 3WEBA 4I1PA 2DJSA 4MNGA 3QPQD 2DH2A 2P8PB 1A1MB 1XVSA 5HDBE 5K1NA 1YZZA 3BN3B 2Z34A 3Q6FB 43C9B 3C87A 5GPRA 3F7YB 5ICYB 2YRBA 4MHHG 3ZKXB 1EMTH 4PW4A 5CN2A 5EU5B 5AOLA 2E4FA 1DQJA 2XQYG 1P7BA 2YGNA 5AKRA 1KPRA 1U3YA 2RH0A 2XXCB 5TE7L 4PJ7B 2OR8A 3TA3C 4HUCA 4ZAKC 4X7TA 5DUBA 4P59L 3ZT6A 2HTLC 4NUGH 4PD4J 4Y4HD 4GRMB 5KBMA 3RP1A 3BAKA 5HGHB 2E9GA 2WXNA 2B2XL 4PCSA 2AS5M 5BO1H 2WXIA 2YLHA 3EJTA 5ADPH 4HJUA 3W3BA 2Z91B 1PYWA 4DQOH 5IVXB 3FSZA 4WWOA 1H15B 4YHKL 2XX0A 5ABDE 7PAZA 2I27N 1B88A 3D39B 3CDCA 2Y7QA 2V17H 4HJSA 3HG1E 1AIZA 2CR6A 3SE9L 4HJEA 4C56D 4JRYA 4XP4H 3B5TA 2E7DA 3BISA 4NM8H 3UBHA 4D0BB 3HS8A 3MAWA 1JZIA 5ICZB 4APXB 5A2KH 5SWZA 3AROA 4WJKB 2H47C 4Y4FC 2GUYA 3N43F 4AIXA 3KWVA 3VYNA 4YO0A 3P9LB 2ED6A 1X5AA 3INUL 3NGBB 3FULA 1GGTA 5I26A 1ZLUK 3UC0L 1KOAA 4W9DC 1LEKA 1VFUA 1XCWA 2WLKA 2VMDA 2R0ZH 3D87B 4HUWA 4WSJA 1XH3A 4FQ1H 2W0KA 3DJ9A 1XR9B 1FNFA 1UA3A 2FX8H 1Q9OA 2H1XA 5DHXB 3SYAA 5F7BA 2D3JA 3L2MA 3IM1A 3OPZH 1G7QB 4ZUTA 1FGNH 4UNVA 1FYTD 1GZPB 3KYNB 3L6FB 4WI5A 2RHEA 1Z9SA 3EJPA 3UZVB 1GVIA 3ZKSD 5FW6A 4HV8B 4KXZI 3OSVA 4LSDA 3FQNB 5EWIH 1LNUA 5LN4A 1BEXA 4WNJA 2ZOLA 4MD4B 1MKFA 1RJLB 4AW4A 3O9WD 1TFPA 3HPJB 1Q0YL 1CTOA 4E0RB 3FF7A 3MRGB 2YD6A 2JQZA 4X7EC 2GB2A 3C8DA 3H56A 1G6VK 1BZ9A 1PKQA 3FRPG 1MCQA 5CSGA 3TN0B 3ZQWA 1DQLH 1XFPA 1KIRB 2NY1C 2Z92B 4IHOA 4WWKA 2LU4A 4X6DF 4AY0A 1BOGA 5DQJB 3SOBH 5D2NE 4WUKL 1T4WA 3QJTB 3VRIB 2R56H 5I24A 3HZVA 4G3YH 1SOKA 4B9CA 4HVBA 1WZLA 3NJNA 1NGXB 4RIRB 5L6YH 3WFHA 1K8DB 5I6KA 4ENED 2WZPD 5AUMB 1VERA 3AABA 1V7MH 3MU3A 3ILPB 3UROR 3JV5A 5AZEL 1RZIB 3BVWA 5FUZH 1PZCA 3FMGH 3DI2B 1NJ9A 3JQOB 1I3GL 2F2HA 4NB7A 3SDDC 1R24B 3SHSA 1TJIL 4K5OA 3BW9B 4R97C 4U1JB 1EMTL 2E56A 3PAYA 4P2RD 1HNGA 3MA7A 3NFPA 4WFFD 3ZVVA 1DQTA 4A2GA 4OV6F 4XXCA 3UTQB 1CD8A 1LM8V 4GH7B 5H94B 1WZKA 3HN5A 3FTGB 4NUGL 5MERB 3TO2B 3RDTA 1AGDA 3MN8A 1C5CH 1JWSB 5BO1L 1MDTA 3UDWA 1KJVB 2VL4A 2JSFA 3MBEB 3U46B 4LEXH 3AQDA 4QRSB 1F18A 1PQZA 2IADB 4DEUA 4WTXA 2V17L 1N8ZA 5I0WA 1SXZA 4YDJB 3EH1A 2AXJA 2JKSA 2QKIB 2ATKB 3APFA 1UZ6F 4B97A 4CSPA 3NN8B 2DY2A 1ADQA 2KT6A 4GO9A 4XP4L 4NM8L 1AR1D 2ENSA 2V2WB 2OCFD 4IRJD 4S1QH 3UTSB 3N1FC 4XCCH 1Z7JA 5EBWA 1O7DE 3BP7B 4FXKC 4A68A 5GZNA 4G8FA 3REWB 4PJBA 4MFHA 2E6JA 2JKWA 4X7DC 3VXMA 2FJHB 3VRJB 4LGSB 3WNNA 3PAUA 2UZIH 4DGVL 2WNWA 4H8PA 4HS6A 4MZIA 5TFSH 2R83A 4MJHA 2NY0C 4PJHB 1GS7A 1SOXA 4ZMTA 1MVYA 3C08L 2VLRA 4MTMA 4LLVA 3WGUB 4PG2C 3T0EB 1T04B 5JA8B 1ML0A 2R0ZL 3VVWA 1Y18A 3FCGA 5T33H 1X4ZA 1EFXB 2VE6B 3NP3A 1I75A 2MQGA 1OM3H 2FX8L 3HR6A 1GYAA 5LCVL 4GKLA 1RZJH 1E5YA 1SNRA 2BOBB 4P3CH 1AVAA 3OPZL 3HKFA 2LAAA 3GKZA 3QUYB 4N8CL 2X7LA 4EZMA 4DPBX 3WU1A 3JV0A 1OGAB 2XIBA 1OCZB 4NO2A 3LX9A 5EWIL 3EYFB 3S6CA 4PR5B 1TDQA 2VIRB 4N28A 1RI8A 3MRHA 2BNRD 3PGDB 3QDAA 4XO8A 2O6EA 4KO9A 4PRAA 4PTUA 2QMKA 2APTA 3FDWA 3LD8B 4FP8H 1YEDB 1AZUA 4KNSA 5BZXA 1F42A 4N22A 3SSGA 4DT2A 4H44C 5KSUB 4QRPB 2DLEA 2C9VA 4G5ZL 5A7EA 5BOPA 4KK8C 3HHRB 4RAUB 4KI1A 3KBEA 4FNSA 3RKPA 2JELH 1HQRA 4I5BA 2JKXA 4MYPA 2X4UA 2ED7A 2G5UA 4UT7H 2EDYA 4P07A 4WV1A 1I1FA 2ROXA 2VWEE 3ARBB 4XXWC 3P77A 4M9PA 1DQLL 5A2LH 2YN3A 3O8XC 3SOBL 1KTBA 2AJXL 4LSTH 4JFVA 4Z95H 4G3YL 2OTWA 3IXTB 3SDCD 5FO2A 4Y1AA 1D5BA 1KLFA 3IFLL 4JS7A 3IMUA 2UXTA 1EZUA 4BFOA 1VCBC 4XN1A 3QDJA 3OAZK 3BEVB 3AFLA 1J1PL 4ZOEA 1ZLVH 4BK5A 5FUZL 3FMGL 3BKYH 5IB4A 2XTLA 4LDOB 3CCHB 5FWRA 4L8SB 3LAFA 1EAJA 1PU0A 3FTSA 2E9BA 1GOHA 3OMNB 3FTVA 4JJ5B 4BHUA 3S5LG 4XN8A 4XH2A 3V95A 2DQMA 1MQKL 5FA3B 3WUWB 3HTLX 4K3EH 1WUNT 3SQBA 4RSVA 1S6NA 1CLOL 1QSED 4OKDA 4UUJB 2D7TH 3MV7B 5D6CA 1HNFA 4P49A 4LNRB 3MRCA 1NWPA 2ZIDA 4LL4A 1YYLH 2VW7A 1TETH 3SGEH 1HHJB 4NQDB 4M6NH 2J6WA 1T7VA 3IAPA 4Z7QF 3TPUA 3QYNA 3F01A 4LEXL 5SX5K 1JV2B 1S7VB 1TOXA 4X9IA 4B5ZA 1X7TA 4KZEH 5DQDH 3GKWL 4J2QA 3GDCA 4LL9A 3ZKMD 2ZUYA 2BP5M 5E2WH 3WSQH 4OGZA 4S1QL 4XCCL 3V0GA 3WS6C 1IBBA 4MNHB 5T3XE 4MJIA 5C0CA 5IB2A 1UKQA 4KPHH 4GRLA 2DLFH 1CDJA 2W38A 2VSMB 4JFFD 4TNEA 2PPCA 2UZIL 5EBGA 1BYOA 3CFJA 4BZ2A 4UQDA 3PNWA 5FCUH 4G83A 1MUJB 5TFSL 5KSBB 3NBNA 2YXMA 2RAMA 2FEDC 4Y5VC 2NUPB 5IOPB 4ATTA 5JW5A 5K59E 3FN3A 2IF7A 1F58H 1N12A 3U1QA 1UM4H 5T33L 2CK0H 4Z3EA 1ADQH 3Q1EA 1OM3L 4PW3A 3F6LA 5PAZA 1GZHA 1RZJL 4R7XA 2C3WA 5E00A 2MOQA 4KKZA 4P3CL 3NPZB 5CBAA 5FUOH 3IMVA 2TRHA 2UY7A 2V7HB 2H3NA 3FO0L 4YHZH 3QWRD 2OXHA 3QR1A 1DVUA 5E8NB 2HLFC 3NIDB 4AVIA 5C0GA 1RZKL 2DBLL 2F53E 3DK2A 5F88B 3ZTJG 2JQMA 5TDOA 3W9DA 2AV7B 1S9WB 5T1LB 1R3LB 1ZANL 1X7QA 1KCRH 4PV9B 3ZUCA 1LGVA 1MH5B 4B5EA 4U1NA 4FP8L 1JDAA 1I82A 2CO6A 4K3JL 4QRRB 1P7KA 1TKWB 3JWNG 4UV4L 5JDSB 3F7VB 4LAJH 2CD0A 2CGZA 5JIIA 1MCOL 4IOFC 4HLEA 2JELL 1QBLH 1DL7L 4WWPA 5BUPA 1PNDA 2V2TA 4UT7L 1KPUA 1UD2A 3KAAA 3GHPA 1TR7A 4M29A 4LPXA 2DQHH 1DJIA 2OMVB 5J0BA 3B9KB 1E9PB 4MRCA 1XGYH 4GIPD 4R7LA 4Z95L 5G4OA 2DN7A 4DZBB 5FHAL 4MXVE 4CVWA 3MCKB 2O6FA 2WWNA 3VB9A 1Z32X 1BQKA 3DSNB 2B1OA 2NY4C 5LGJB 2BX5A 1QSFB 1R19A 3HBZA 4PJEF 5GGVY 4OZIA 1JF1A 4CGUB 4XHJD 3SDAB 1QRNA 4NRZB 5BUAA 3RGVA 1DBBH 3BKYL 4OGXH 4TL4A 4NBXB 1DLHB 4RFOL 4N5UA 5BZWA 5EIQA 3HMXL 3D30A 3KXFB 1SJMA 3OXSB 3EHBD 4OF6A 5C0NC 1UATA 4PD4K 5KSBE 3MLUH 2G9HB 3CLWA 1A64A 5ICUA 4K3EL 5IMKA 2A9MH 5E94B 3TA3A 1UOKA 3MX0A 3H7LA 4ZAKA 3PABB 5EEXA 3VXSE 4S1DD 3RX9A 1H9DA 2D7TL 5D7IB 5FECA 1AQHA 4YC2B 2JI2A 2VXQA 1JGUH 2EDOA 2A3TA 2I5YH 4PS8A 1YYLL 4PJ9C 3GNMH 2EE0A 1NBYB 4M6NL 4X5WB 5F3FA 4PJAA 1PEZA 2CLZB 5D2LA 3NPSC 2Y24A 1N68A 1AGEB 3DBXA 2HRGA 3DRTB 4KZEL 3BSHA 5DQDL 3T6XA 3LZRA 5EDXA 4Y4KD 4W6WB 1ZK9A 5DI8B 3PJLA 1AD0A 2EE9A 3L4ZA 5E2WL 3BPLC 1I3RB 2HJFA 4L3CA 4E42B 3ATEA 1JL8A 1VSCA 2HFTA 1S5HA 2BNQB 3KPSB 3TWYA 4NPYB 4YDIH 3TBYB 1WITA 1T5WB 3N9GH 4KPHL 1GSKA 4M8UA 1I8KA 2DLFL 1DBJH 2XV6B 4NNYB 2FNBA 2B3IA 5ERWB 4XPTH 3K2MC 3IJEB 1H3VA 2KKQA 3E9UA 1JK9B 2GUOA 1MRFH 1O9VA 2V3FA 2WQXA 3K46A 2DQEH 4OF0A 5AVXB 4AW7A 4DUWA 2VZOA 3VWKC 4HLZG 1MFVA 2H41A 2JKIS 1IC1A 2CXKA 3M17A 1F58L 3TL5A 1UM4L 1P4BH 2CK0L 1P7HL 1MLBA 2X6UA 3S3BB 2CJUL 2BHZA 2GCYA 2IWEA 3BPCB 3JWDL 1NFIB 5EO0A 3GT6A 3OR7B 5FUOL 5HJBA 1A25A 1BJ8A 4YSPA 4YHZL 4X9BA 2AQSA 2GITB 3OV6A 2DLGA 4Z7VB 5K39B 4B9JA 1NEZB 2FQEA 4YXHL 1G1CA 1G7JB 4KTYA 4LLDB 3T8XA 3BH9A 5J9PA 2A6DA 5MEND 1RJCA 1C08B 1E28B 4RMQA 1KCRL 1QR1A 4PB0H 5BOJA 4AITA 4XVUC 3NEOA 1TCMA 1R5IB 2V2XA 4TS6A 4XCEA 3HS9A 3ISRA 4GW5A 3VH8G 3WXVH 4M7ZC 2HT4D 3S96B 5GQBA 2EDWA 1UWFA 3MCLH 3C5SB 3GINA 3F04A 5TE6H 1NKRA 1FPTH 1QBLL 1FL5A 3CC5B 3DOHA 3EXJA 3HI5H 5I74B 2DQHL 5JHLL 4M5TA 1JWUA 1S7WB 5IMMB 1XGYL 1OWRM 1JZEA 1OIOA 4KHXH 4J2XA 2NR6C 1WWCA 4OV5B 1WS8A 5IW1B 1W9XA 4OZHB 1B3IA 4LOUC 2ZP0T 4E41A 1Q1PA 3VFMB 2CDFB 3US0A 1CXHA 2VN7A 3JWNC 3VDCA 4AXWA 5IQ7H 4WU5A 3UEQA 4PJGB 4OGXL 3HE7C 3KPSE 1HEZA 4GAYA 1IM9A 5EDSA 2OZ4L 5JHDA 1BMWA 5DMKA 4YS4A 3I6KA 2C7UA 4QDGA 1K5NB 3MMEA 2K3HA 2P7TB 2IC2A 1OD9A 4ABWA 1DQQA 4WGWB 4ZNEA 4QO1A 2F58H 3FRUB 3L3OC 3MLUL 5L0QC 4UDUB 1DJXA 3M46A 4HS8H 1CXIA 2A9ML 2Z65C 1OGPA 1HOCA 2JXMA 5IT2L 3Q8AA 3DVIA 2VQ1B 3CV5A 3M8OH 4OTXH 4EO5A 2XBTA 3AU1A 3CFKB 3FT3A 3MKGA 5FKAB 5I5RA 1MPAL 5DU7A 5ITFB 2P80A 4PY7B 4V1DD 2I5YL 3BE1H 4G7VH 1QATA 3ZR6A 2AKRB 3G6JA 3MO1B 3SYOA 5SWSE 3OR6B 1H5BB 4ZX4A 1JWMB 1BLNB 3BUQA 2IO5A 5E8OA 2MNUA 2WWMC 3HRZB 4IDLA 4Y1SA 1OCOB 1SXSA 3QEQD 4WEEA 1UM6H 3QRGH 4M62H 4G1EB 2AV1A 5EIIG 1UOWA 2GW5A 2FECL 2NY7H 4LASH 5CHNA 1BF5A 3L9YA 3B9DA 2XQYA 5E8PA 4Y5XB 2CWRA 4IQHA 3QPQC 3LIZA 1HDMB 5DA4A 1O5DT 3PWPE 4GFTB 2VXQH 4FXKA 1DBJL 1G7MA 4GQQA 4TNVF 5EU3B 3H53A 5GGRB 1MRFL 1ZLEA 3O4LA 2DQEL 2PPFA 3MPCA 4LO9A 5DD5H 4HMCA 3FT0A 5MEPB 2YQ3A 3NSCA 3PIQA 1MW2A 2H26A 2BS8A 1UASA 4PG2A 3SODB 4QMEA 3IS1X 5J11B 5IKCA 4Y4HC 3T3PE 3VFTB 2BVPB 1NAMB 4PVNA 1NFKA 1D5IH 5E2JA 4ODVL 2GTQA 4OZHE 1QPXA 2NTFA 3MJ7A 3VD5A 1PIFA 2X4QB 3VD0A 1RUPL 4Z7UA 4I2XE 4TUOB 1NCJA 4XP9H 1A21A 3DNKA 1UWXK 1ZHLB 3MOBH 4HBQA 3L08A 3GI9H 4JN2B 5B7MA 2H4EA 2QFRA 4GI9A 1JGDA 2IPTH 1ZTXH 4XMXA 1N0XH 3RZCC 1AKJA 1VRSA 3BPOC 2QTEA 3D6GA 3MRDA 3NIFF 4WW1A 1MXDA 1PY4A 3EH4B 5D72L 4NP4H 3ZE1E 1MW3A 3T4AB 5DJXB 3CUPB 3Q5TA 1FUNA 2B8OT 4CDHA 1XIWB 3AACA 5TE6L 1FPTL 3RU8L 4ANXA 5AAWC 1HI6B 4HYTB 4FXLA 4L5FH 3S8GB 2P24A 1KT2A 5ITBH 2DYPA 4JM4H 1ZE3H 3MREA 1K6QH 2WQUA 3T1WA 1PVHA 3RUGA 5HHOB 3L7EB 1EDHA 4BH8A 3D39D 5DJ8A 4JFSA 5DRNA 4WHTA 3T3MF 2XACC 2UYLB 2G3XA 3L4UA 4GSDH 2AXGA 4PRHE 5JUEL 4PMEA 4BINA 1B4RA 5D1QE 3O3BB 1LE9A 1FZKA 4DP9X 4FNRA 3FFCE 2YAOA 5AVZB 4DVRH 5C0BD 5J5EA 2BW5A 2EEAA 3CN2A 3IDNB 4MQ7B 5FM5M 3H0TA 3KLDA 4IRSD 2JIXB 2F58L 3DTXB 3RNKA 2F54A 1OTTD 4HS8L 2CJTA 4GUQA 3O9WC 5LVEA 5G4MA 3FFDA 4G80B 3BZDA 4XT1C 5D6DC 3HPLB 3R18A 1J8HA 4HHWA 1BYPA 4C57C 4O58H 2BIQA 3UTTE 1ZOXA 3E3QC 3MKKA 2K6YA 4LESA 4OR1A 4OTXL 2PYED 4LLAA 2WGXA 5D7HA 4G7VL 5EC1A 2P9RA 1MW1A 4HUNB 3RB7A 2ITCA 5IB3B 4Z3TA 1BXVA 1E3ZA 3D34A 4NQSA 2DMKA 2O6PA 2EVHA 4MNQA 1UM6L 2CHWA 3N2JA 2W5PA 3QRGL 4M62L 3U2SB 5T1KA 3CFCH 2NY7L 4JCLA 4LASL 1TYJA 4PGBB 1HL8A 3KPTA 3LKPA 1YPZE 3QO0B 1J8KA 2JLLA 2YUZA 2ZOWA 3KYKH 4QTIH 4UQCA 4M6OH 2DWSA 2FJGA 1G9NH 4L3EB 5F9WB 1BZ7B 2IBZY 35C8H 4K3GA 4A67A 1JOIA 3T2OA 5BRQA 3JVFC 5GGSY 5B1KA 43CAB 4KNQA 4MCNA 2IDFA 4PG9A 1IGMH 1UD4A 3WLWD 1E5ZA 4QKTA 1SJVA 4OLZH 4K7FB 4YNYB 4QNPF 4RNRB 1VGEH 4LCWD 4Y5VA 2WLLA 5KOMC 2R1WB 2UZXB 4I4WB 1KCBA 1CK0H 4XCYB 1O6SA 3CVHB 4M48H 2DMHA 5DTFB 5FYLE 3QI9A 5KOVC 4W70A 1SRDA 4ACPA 1G94A 4OGQC 3FTYA 3VXTB 2KQMA 2JQAA 3GJFK 3VXOB 4D9RD 4GG8B 4BV1A 1M6UA 3ARQA 3BEWB 1A6VH 2XKNB 3QXWA 4XP9L 1CI3M 4K9EC 3MOBL 4JG0H 3GI9L 2IPTL 2VZVA 4YUEH 3NJJA 1ZTXL 1ONQA 1N0XL 1Z3GL 3E6FA 3FTZA 4U4IA 1FLRL 2HJKB 1ECYA 4AQEB 1AR1C 4LVNB 1D5XA 1F3JA 4FQQA 4NP4L 3V5HA 1KLGA 4M7JH 2F15A 3JV4B 4NN7C 5CJ8A 3CDZB 3L2NA 5GSRA 1FG2A 4NXKA 3LPOA 4L9DA 3WYRA 5EUOE 2KDYA 3LKOB 1CZ8H 4KVCL 2J2ZA 2VDPL 5DC4B 3GRWH 3RKDD 1SDDB 3PQYB 4XOCA 2QADD 4QXUH 3PHQB 4XBMA 3WKYA 4L5FL 4A2HA 4FHBD 4X6DA 5EO9B 3TCLB 5ITBL 2GK0B 3MBED 1K6QL 4LBEB 1NFDF 4NZUL 2YD9A 3STLB 2EIEA 1RJZA 4X42A 2ZTBA 4YWGH 3QXDA 3AB0C 2R2HA 2CA4A 4Y2DD 1A6WL 4LPWA 5F0LB 1R0AL 1RHFA 4F57L 3LPPA 4L3EE 3UTSD 1E5UI 4NFCA 3ULVD 3FU0A 4DESA 1RURH 4TMPA 4X9FA 2I07B 4QOKE 4DVRL 5IESH 4WUUA 2X4NA 1BX2A 4JAMA 3BP6A 3MOAH 3AY4A 3G9VA 2VR8A 1QLFA 1XD1A 1ES0A 4HCGA 1HCYA 4FS0A 2NUTB 4BSWA 2A9NH 2HVJB 3T0ED 5JIPA 1AMXA 5JQHC 4HIHA 1SDAB 1EFXD 5I0VA 2ZNXA 4QCIB 1QUPA 4JZJB 1Q9WA 3GI8L 3K8MA 3NJLA 4WHDA 3DPBA 3UPCA 5CCKH 2ALWA 2VSKB 1I7RA 3SDCC 4KROC 2FHFA 4KKLD 1TFHA 4YHMH 1OGAD 1WIOA 2AK1L 3KR3L 2FQGA 3NFSH 3Q8EA 2DH3A 3KPMB 2WNXA 4WFHD 2WM0A 4HWBA 3JYBA 3PHAA 3KYKL 4QTIL 3LZNA 4M6OL 2EYRA 4Q6YA 1G9NL 4X5PA 5FLVA 1FFRA 2P3YA 1U4EA 5FA4B 1H3PH 1HCVA 1O75A 5KEZA 1MIEH 3A67H 1MREH 1TCRB 3ARFA 3F8UB 3RI5K 2DWDA 1IGML 4IMLA 2EZ0D 4GW4B 4OZFA 4P4RA 3BXNA 1RZKC 2VDRH 4WSGA 5F9OH 2WPGA 3VSUA 1VGEL 3ARBD 3FUIA 5LKNA 4PRNA 3VWKA 2ARJB 1OALA 1W6LA 1CK0L 3HW7A 1W0YT 4M48L 4HJGB 1BJ1J 4ZFGH 5DZPA 1OE1A 3BJLA 2BFVL 4PRIB 1FFPB 3FCBA 4EIGB 4F7MA 5HHXH 2BY1A 3WEAA 2HRHA 3JT2A 5FYJE 5K1JA 5IQMA 4HIIA 3AS3A 3VI3B 4NI3A 1D5ZA 2VOTA 4HU2A 1A6VL 1ETZA 2HWZH 5FDYA 3GMMB 4BGDA 2IWFA 5IJVA 4JG0L 4AG4L 3OKDA 2NNAA 4M93C 4IBUA 2F7QA 1IL1A 3EGXB 4YUEL 4YPJA 1RERA 3MJWA 3ARGA 3ZKMC 1BFOB 1PTZA 3JXAA 4YIQB 1AAJA 3U9WA 3GSVA 4R5XA 2QSCL 4GQPH 2R7EB 1P9MA 4M7JL 2AQQA 2A2QT 3BUPA 3ZMNA 1ED3A 1IUZA 2HTKC 3Q2CA 4LDCA 4UTAA 3SGEI 2CK2A 1CZ8L 4M4RB 1ZLSH 1A6PA 4N0RA 3MV7D 3GRWL 4QXUL 2MTPA 1T5XA 1T0OA 5DZAA 5IROD 2CAKA 5EC2B 4ENZA 3HZMB 4LGPB 4GT0A 1E2VA 2NR6A 5LGKA 1WUZA 2AABH 2VSCA 1EH9A 3NCCB 2EDLA 4K5PA 1XZWA 4N2NA 4NT6A 4QT5A 1Z0NA 2N0KA 3HI1A 5F7KC 3VFWA 3FCSB 1EERB 4K0OA 1IVLA 2CO7B 3MRFA 2VLJE 3RWGB 3PV7A 3B7UX 3CC1A 3RWDA 1HZLA 1ZTMA 5CS7A 3CLFH 2PP8A 2B5IC 5C71A 3UAJA 3HZ3A 2K8MA 3BWUF 1M7IB 1OQOA 3UYOD 1JK8B 1FL6A 4EIZC 3MOAL 2VLLA 5BW7C 1N6QL 2C1PB 2RQ8A 5MEQB 4NCC2 5F70A 2IPUG 1JNLH 1B0WA 4PJ7F 1HHKB 2QPFA 3DHMA 3X17A 4KKAD 4NKOA 1RAMA 4MAYB 5FOJA 3BT2L 2RGSA 3QAZC 3U0PA 3TYGL 4MMZC 1R3IL 3WFDH 1QACA 3MLSL 1YMMB 2VGLM 4MJ2A 5IVXF 2X44D 3UZQB 5E6IB 4XGZA 3VFOA 4OFPA 4UQ2A 4XVTL 2ZCZA 3LRHA 3S36L 3V5KB 4WI3A 4ZQKB 3NFSL 4XNDA 2BS71 2PYFA 1OCCB 4K8RL 1RFDH 1J87A 4YSCA 4U2YA 4XHJC 2YA1A 5FCUL 4QJ5B 2F5AL 4N9GB 3CX5K 4JRLA 3WL9A 5IHUH 4OGYH 3ARSA 1H3PL 4QRRD 5K9KB 1MIEL 3A67L 1MREL 4L4JA 4MMYB 4WO4A 2B14A 3EHBC 1IC7L 2VDRL 2DIJA 3QFDB 4WHYG 3FTXA 1Y0LA 1QPKA 1T1YA 4PGEA 1K85A 3L5IA 1I85C 2ITDB 4S1DC 3B2MA 3B9KD 4JO1H 3UP1A 4GMTH 4HWBH 4ZFGL 4L29B 3HHSA 3D5OF 1H3XA 3QZWA 5I30H 2B4CC 2DLHA 5BQDA 5HHXL 3U9PH 3EYOB 3CDGB 4L8DA 3D25B 4WK0B 1BLIA 2APFA 5CEZH 2J6EH 5L88L 3JZYA 5DVKA 2JTDA 4ZUWA 4GLRI 3SDAD 4DJMA 1T4KB 4DK3A 2ZUQB 2BP8A 1QLEH 4OZFH 4TSAH 1NC4A 4Y4KC 3VDAA 2XVBA 4F9PA 3PL6B 1T1ZB 2ADFH 4JFPB 5JXEC 2N1KA 1FFNB 3EOTH 3MLXH 3RZCA 3DGGB 5C08D 2OQJA 3SDXF 4OFQA 3KXFD 4P9HL 1KN4H 3MRLA 1ASPA 4AKQA 1BIIA 5EB9A 3STBA 2J8HA 2P5EB 4U1SB 3WHE1 5EMYA 3UPRA 2VRKA 5DK0A 1ORQB 1W0WA 3TIDB 1TIUA 1ZLUH 3JVGA 3AG1B 1FVEA 3MCYA 3LV3A 2VLKE 2XIDA 4N2MA 1L0PA 4LOVA 2OW7A 1A7OH 3VXRD 2XWDA 3SGDH 3FUKA 2Z64C 3FCTA 1YMME 5IBUG 5KVDL 1NIEA 2FECI 3LDBB 3OXRB 5IG7B 3SY0B 2BZ7A 2EABA 5I2IA 1BVKA 3TYFB 2C9SA 2BP3A 2YJLA 3NZHH 4ECNA 5HYJA 2AABL 4HKBB 1NCNA 3R7QA 4IS6B 1UD8A 3FT4A 3WAKA 4TNWK 3FU9A 3POCA 5I6NA 3CFBB 3CHQA 5I6PA 2OJ1A 1XF4B 1X5LA 1X9LA 5EPMB 5F0PB 2BIPA 2VR7A 4ES8A 3CLFL 5INCA 5IGXL 5B39G 5SX4H 1RPQA 1I8UA 2O5XH 3WN5C 2BVQA 5ANME 4EZLA 4H2AA 1CXEA 4GP4B 4LARH 3P4MB 2MIZA 2ZT9C 3ZTJH 3MHZA 2HT4C 5AVYB 3R0NA 4XXDA 3UZEC 1JNLL 3CPLB 5F21B 4QI3A 5D6DA 5IQ9A 5H35A 4KGLA 1FAIH 4HIEA 1CTMA 3RBGA 3PWLA 3HAEB 3OAYK 5BQ7A 1NOLA 3G5VB 4LRIC 1CG9B 5D7KD 2VKXA 5EUKB 4D0DB 2BVOA 3APMA 4NZ8A 1YEHH 2FT8A 1XSOA 2A5UA 3D09A 1LEGB 3CN0A 1FP5A 4FKKA 1N0LB 2QVKA 4YPGB 2BERA 4WI4A 4ZS6D 3EJZD 3GSXA 3TJHD 4Z3GA 3BUYA 5DUMH 2G2PA 2ZOUA 3J8F7 2IH1B 5I73B 1RFDL 1LO3H 3OZ9H 1XF2B 1J88A 1YDPA 2X2YA 5DA0B 1OVZA 4TL5A 3PWUB 5D1XB 2D3VA 2Z6FA 1BF8A 1F4AA 5EOTB 3LZOA 5IHUL 3ULVF 5DJZA 5HHPA 4X7CC 5A16A 2WHVA 1A4JA 1KJ2B 3L81A 4JR9L 2PO6B 5E4OA 5IJBC 1MCLA 4MMXB 1AYRA 1FZOA 1MI5A 3F00A 4FNLL 1AQKH 4NZRH 3RWCA 2ID5A 4MA3A 4PJHF 5AKSA 3ZDZB 4CADA 3MV9E 3I50H 1TU2B 4P57B 4U3XA 3VCLA 4JO1L 5EIIA 4GMTL 4HWBL 1PX4A 1QA9B 5I9QC 1XTMA 5DHMC 1UXSB 4MQTB 5I30L 4H5SB 4CMMB 3U9PL 4PJCB 1INQB 3FO9B 5CEZL 2J6EL 2IWGA 5I0XA 2WKLA 4N25A 2XT1B 5ID0A 1AQDB 2AK4A 4Y2OA 3WIHA 1JZ5A 2NXYC 3CFQA 5KBKA 1QLEL 4OFYD 4TSAL 1BWWA 3MV8B 4G8AC 2ADFL 3CIAA 2HLAB 5JHMA 2JKTM 3H3KA 1EHLL 4JKNA 3QQ4A 2R0WH 4U7MA 4K71C 5J57B 1KN4L 4LCVA 5JHBA 2R0LH 3D48R 4UOW0 1WA2X 4JB9L 3FQWB 3L2LA 3OPUA 3PWJA 4K9JA 2ENJA 4G8IA 4DEPB 3SJVA 1TQBC 4J4PD 2ZKXA 3MLTB 2CPUA 3HE6B 4OCSL 1AI1H 4YOKA 4ZFOB 3QUHA 2X4SB 2YAPA 4CBZA 5IEKA 1BVLB 1S9VB 2P26A 1NCGA 4OLYH 3FXIC 2VRAA 4EI5B 3K2UH 3L4TA 4DP2X 2HFEB 3NZHL 5DHDA 1R3HA 3BWAA 4OSUH 4U1MA 2AEWA 4JKLA 5IVNA 3IFOA 3ECBB 5KYUB 4N85A 2VDKH 5KANG 5T3ZE 3DTDA 5JOFA 2OX5A 3NESA 1XEDA 1I8LC 2X12A 1EK3A 2VXSH 2ENQA 2QQNL 2NZ9D 3CHRA 2XU9A 4R8WH 3UBXB 4U7KA 2NT0A 2AXWA 5LGYA 5D1XE 2N7BA 2YBRA 5GIRA 5I8CA 2O93L 4XX1G 4WDIA 3ZL4L 4XOAA 2EEBA 3BWUC 3I6GA 3ZKXC 4GRWB 1EZLA 1MF2H 1UWYA 5BRZB 5KBPA 5JNYB 4G7QB 3TWCL 2ZQKA 4TQIA 1UFUA 2VQ4A 4BA0A 6PCYA 3UJIH 5C0AB 3BH8B 3BWSA 2G60H 3G5WA 1FAIL 1PSKL 4N1HB 4G5AA 3EJRA 1H8LA 3V4PA 2R4SL 5GGTL 1OM9A 2QGEA 3ZZ1A 4UM8A 3APNA 1QYGH 2KH2B 4R2GD 4OCWH 3CZUB 4ZTPL 2Y2WA 4B9ZA 1DEDA 2A1WH 5TDNA 3WTVA 3QUGA 4EKXA 1D2PA 5DUML 5DVMA 5EOCJ 3EUUA 4RRPA 2HKHH 1G7LA 2I24N 4BKLA 3OAZH 4JVUA 1I9RL 1LO3L 2OSLA 5HYSB 1TTCA 5F9JB 3OZ9L 2IXQA 4PYGA 1MFUA 1TZGH 2B9BA 2E0PA 5GGUB 2ZYIA 2X4PA 1CTNA 1NBZA 1PG7H 2OLDA 3C5JB 4J1UB 1W72B 3WNPA 2W1NA 1DVQA 1DUYB 1GAFH 3L45A 3HNTH 5LG6A 4Q6IC 3EJSA 1JTTA 1Q94B 5GZOA 3DROB 4IRSC 1MCPL 3GSRA 3QQDA 3I9GH 1OTTC 2EO1A 4NZRL 1AQKL 4O5LL 4OUUB 5F6HI 5LNDA 3NGBC 5FPIA 2E9IA 1UD6A 4YSEA 3ALWA 3JV6A 4O02B 3I50L 3G6AA 1M57B 1QSEA 2CBOA 2XV2A 4LHUA 5DC9B 4RGOH 2ADIA 2X70A 1NCDL 3OAUH 4RFNB 1OGTA 5SX5H 4BFIA 4BDVA 2XN9A 1U2YA 2E76C 1F3DH 5KN5B 2Y5TA 5EA0L 5GS3A 2OMBA 1WFNA 3GMOB 1HNYA 3KW8A 3NIDF 4XWGH 2X1WL 3VSQA 4R96B 3SKMA 3PFUA 4NQEE 3MRJA 4PJXE 4QXWA 2R0LL 1WSST 4I1NB 1NOFA 2JIXD 2YSSA 5KVEH 1SYSA 1FYHB 4X6FA 4EI6A 5JIKA 2JJWA 2YLKA 3OC8A 4JFFA 1YMHB 2OL3A 1MG2C 1XBDA 1XBRA 4ORZC 1S7UB 3MNWB 2Z7YA 5CCJA 1GMEA 5BS0E 5AWNH 3WLWC 2JI1A 2WYTA 3KYMA 3QHFL 3WIHH 2Y9RT 1A6UH 1NLBH 2XBZA 4GJTB 4HFWA 4K9EH 3WFZA 4CN4A 2Z7WA 4OLYL 5GRWA 3TN0C 3N44B 5AW5B 3K2UL 3SYPA 4GUPB 2KC0A 4FLRA 4OSUL 2PW1B 1FSKB 5KJ4A 4OH2A 5J12C 3SPGA 5FUCC 2VDKL 4LHJB 5I6OA 1EHXA 5KANI 2C1OA 3MYZA 1DE4B 1E6OH 4P3DA 3I3BA 1TZ8A 5HHVH 2VXSL 2ZUWA 4MQXD 1Q38A 3IDGB 3NT0A 2KBGA 4R8WL 5E9AA 2AMUA 1MLCB 1PD0A 4JO4L 4NQVA 5GRJL 3GBNH 7CGTA 1JNJA 5GGVH 1AHWA 2JJTA 3QSKB 4NS0A 1IGTA 3QUKA 1FL3A 3RTQB 25C8L 4XVJH 1T83C 4KZ0A 2X4OB 4U1HB 1KACB 1N7MH 1U93B 4BFFA 3UJIL 5I8OH 3QNYB 1RMFL 2VM4A 6TAAA 1E4HA 4OIFA 1CDCA 2OK0H 3RG1C 2G60L 4J28A 2PN5A 5FO9A 2N01B 5FW7A 3K1KC 4Z6AT 1PF3A 4Q9CA 2KPWA 5D7IF 1UEMA 3RKDC 2QADC 4MCZB 2FT7A 1BD2A 5IFJA 1QYGL 3BZEA 4OCWL 1KIPA 2HG5B 4W9HC 2NX5B 2A1WL 2P5WB 2WKGA 4JPVH 2O6CA 3NRFA 3MBEC 3ARRA 5DRXA 2FATH 1UQSA 3ENEA 3LHAA 4MXQD 1B9KA 4OZGB 2IPKB 5L2KA 2R1XA 4LLQB 3ZE2B 4JFZL 4Y2DC 3FQRB 3WEXB 5I5MA 1T89C 2VMEA 4U1KA 1PG7L 3F2LA 3KJ6H 4Q56A 2CRYA 4U6HA 2NYYD 4KHTH 3TO4D 5J6HB 3ULVC 2CIIA 1SLUA 2W9EH 1GAFL 3HNTL 5TE4L 4W9KC 1CLZH 3V4PH 3WG7B 2MPVA 3UIZA 1CFQA 5IJDC 1L3WA 3CN4A 1KY6A 3A5VA 4KMTL 3I9GL 2GTWA 3WFBH 4F8NA 1VIWA 3HCVA 3OKKA 3PQYD 4FG2A 1N6UA 3B2XA 4N8UA 3VFNA 1CI5A 4GKNB 5E0QA 5AQ0A 1SQMA 3T0EC 4RGOL 1C5BH 5LNGA 2YMOA 2AEQH 1MVUA 1U95B 4F15C 1FO0L 4W9GC 4Z0XA 2F7OA 5GGRY 2R9HD 1TZIA 2Y7NA 4UANA 2DWXA 3TEWA 4Z78A 4KKLC 4W68A 4Y1TA 3SO3C 3ZHNA 1DQIA 4Z7VF 1KPVA 1IFGA 3W0WB 2X38A 4XWGL 2G30A 4Y4KA 1HSBB 4OJFH 3V6ZB 3BP4A 1L9MA 4JANB 5AVTB 5JXEA 3DRQB 4LMQI 2YPLA 4AQZA 3HJ0A 2Y1VA 1Z5LA 1HH6B 1F97A 2ICWB 2LFGA 1LQSR 1D6VH 4WI0B 3KLAA 1IIIA 2JF1A 4QD2E 3SKNA 2YGPA 3EBGA 2ZICA 1SJHA 3RWFB 3QDGE 2CQVA 1G7IA 4W6XB 1J9TA 1T21A 4Z9KB 3MRIA 4NNXA 5AWNL 1CL7H 1P6WA 4LF3A 2GIXA 4YK4B 5CZKA 3VGAB 1A6UL 1NLBL 5B4MD 5JYMA 4MYWB 4MX7A 4TRPH 4I0PA 3ARBC 4WFGE 4Z0BH 1XL4A 3MRBB 3TH4T 4ES9A 5E5RB 1JNHA 1U8KB 3R06B 4OZGE 2Y07H 2CO3A 3QXAA 5HHVL 4N20A 3ZE2E 3IMBA 4LSQH 3WTWA 4FI6A 5I16B 2COQA 1ZT7B 1P1VA 1TZHB 2E9JA 5K1VA 4E9VA 3H4HA 4PJGF 5I19H 2Q10A 4OLEA 1JXGA 4PJFB 3GBNL 5GGVL 1XGRA 5JIDA 3ECQA 4AQOA 4UQ9A 2Y4SA 3DVGB 3B2PA 4L8SC 3EOBA 5CR8A 3WN5A 3O2VH 4AQ1A 4D9QD 4XVJL 4OLUL 1EXGA 3PAZA 5DJ6B 4RBPK 3BFQG 1N7ML 1D5MA 1FRGL 1HT6A 2YAMA 4UIKH 1AHKA 3LEYH 4PMFA 1B0RA 2OK0L 1XSIA 4XTRD 3KNBA 3U6RA 1I9IH 3GFUA 4F7KA 2K8QA 4PEEA 3L3KB 2GSMB 3HC0B 5C9JB 5CZXD 1PPIA 3IXAA 4KKNA 1PMYA 2ESVB 4A2MA 4PRID 5D96C 3DO7B 1SHSA 1U8IB 5DJDA 3P02A 4M02A 5T5FA 4BEIA 2FEEL 4ORGB 4J7RA 5IROC 4LLMA 4JPVL 1NGPH 2PLTA 4G9FB 1BECA 2WXGA 2QJDA 3FB8A 5E5MB 3PV6B 4L2YA 1QBBA 3IMWA 2CIKA 4R7NB 3KVDD 3VGDA 5KBLA 5JA9A 1RHHA 2YMTA 3B2VH 4MBRA 5IHLB 1UM5L 3RVXD 5FFOA 2C7FA 3LB6D 4KI5E 2BHYA 2WIIA 3U83A 3H1ZA 4X5LA 5ESVA 2XWEA 2W9EL 1F1AA 1CCZA 3V4PL 1CLZL 4LVHB 1UWGH 2G5BA 2QLVB 4J3XA 4H25A 3OB0K 4Q9BA 1NEZG 3H6JA 1QNZH 1NCCH 3A6BH 4PVLA 5B3SB 3RVVD 3WFBL 2RACA 4EUPB 2K6WA 2FO4A 4XAWH 2XYCA 5DMJB 2X4TB 2WO2B 2MJWA 3FUEA 4FQJH 3HNVL 4P9HC 4P5KB 4RMRA 4UOW1 4KKAC 5KYYA 5GRYA 1K2DB 5ALCH 1KJ3L 4DKFH 4XI5D 4NXSA 3W37A 2XWJA 2FGWH 1MEXH 2CLVB 1M4KA 2IFFH 3T65A 4AX3A 3K4DA 2AJYH 2LLGA 1DBAL 4G11A 3MI6A 2K4WA 3PNRB 1GS8A 1P4LA 3PPSA 5E2TL 4AVKA 2ZD0A 2B1HH 2CH8A 2CLRB 4OJFL 2J55A 3MCG1 4JDZA 5DLLA 3C8KA 4P5TA 1EHKB 2QPDB 2GSIB 1UUSA 4OQTH 1OPOA 1BAFL 2BVEA 1D6VL 5E9DE 3BQUB 1KLUB 1HINH 1NBVH 3QJFA 1C7TA 4ACTA 3BKJH 1ZSDA 3QUXA 5CXPA 4DNLA 3PXLA 4A55A 1VFOA 4OD1H 2WXFA 3X11A 4YDKH 4DGYH 4MAYD 4TRPL 3DETD 5I1EH 1IGYA 4PV8A 3L16A 2R1YA 3EO0A 4Z0BL 3UCRA 3QQNA 5SWZE 1GC1C 4F7TA 3GK8H 3B9KC 3VFSA 4EQ3A 1QRKA 4NRXA 1X9QA 3P4OB 3F64A 3TPKA 4AM0A 2NSQA 1WFTA 1CVSC 3FOMA 2Y07L 3OSKA 1QOKA 5I1HH 1ADWA 4L4TB 3L3IB 1CXLA 1UWXH 4LSQL 3LVTA 5DD0L 1LO4H 1R75A 2PR9A 3O45B 2DBJA 3LNGA 4RZCB 2XZQH 3SDAC 4F33A 1J5OH 1MJJB 3S37H 5I19L 3BD4A 2BSRA 4HEPG 1MJ8L 5JOPE 4JNXA 1BEYH 2P8PA 1KEGL 1A1MA 1OZTG 4B0MB 3QDHA 3Q6FA 1OPGL 3O2VL 3F7YA 3ZZSA 5ICYA 3MXVH 2DMCA 1E4KC 3SBWC 1P0SE 3QJXA 1HAWA 2JKRM 4QAMB 4K3DL 4UIKL 5BV7H 5FCSH 3KDMA 4XOEA 2EIJB 5EEVA 1SVCP 3M7FB 4PJ7A 1I9IL 3FSOA 3HEIB 2X1QA 3S88H 2X9WA 2ZAGA 1KCLA 4LLWB 1KZQA 4UDTB 4YC2C 1QLRB 1Z3RA 1RZFL 1FE8H 1AO7B 3OQRA 4GRMA 1GGIL 4LSUH 5HGHA 2DW5A 3HBQA 1NGPL 2YN5A 5DO2D 4EEEA 1N4XH 2Z91A 5IVXA 3O2DL 1A7BA 1WCBB 4WJ5B 4KY2A 4QGTA 1H15A 3V6FB 3DX1A 1GGUA 1ND0B 2ICEC 3L1GA 1WK0A 3P69A 1KFAH 5K9QG 3V9CA 2Z35B 4QUOA 1YAZA 3C6EA 2X3CA 3EADA 3ZDYE 1CR9H 2DF3A 4JPIB 4MGXA 3VXPB 4ZFFB 5L8KB 1T20A 4D0BA 2IMMA 5TF0A 3O6LH 2WD0A 3AGWA 3FU8A 3B3BA 1UWGL 1OB1B 4NLHA 5ICZA 4AQAB 5F7UA 5T5FH 2F7PA 4APXA 4JFTA 1QNZL 1NCCL 2RB8A 3A6BL 1THCA 1XCTA 3KG5A 2XNAB 4OZ4B 5H4YA 2WCGA 2J21A 2MKLC 4CU7A 4WI2A 4TNFA 4HULB 5J3HD 1JD7A 3Q2VA 3P9LA 4XAWL 1B6DA 2CKBA 2GJPA 4FQJL 4NZTH 1MWAB 2DDQL 3QWOB 5ALCL 1OP4A 4DKFL 4POZD 3D3VE 3MRMB 1MEXL 4Y8DC 3SOTA 1XR9A 5IVZA 4L4TE 2K7QA 3N1MC 3VRLE 2QEJA 5HHNB 5SX4I 1G7QA 3ERXA 4ZS6C 3TJHC 2OR7A 3EJZC 1GZPA 2H0FA 3CHOA 3KYNA 3L6FA 1YVLA 3KPNB 3UAAA 3UZVA 2B1HL 4ZOAA 1IBFA 3FUMA 4ETQB 3L9BA 3QORB 3FQNA 4KMQA 1HFUA 4XBGB 1KB3A 4OQTL 4BFJA 1OHZA 5HY9B 5DYFA 4MD4A 1HINL 3ESVF 4N26A 1RJLA 3BKJL 3L4WA 5D7LB 4M6AA 1MHCA 2B7DT 4KKQA 5E51A 1V3KA 1SYVA 5BZDB 2E27H 3MRGA 4YDKL 1L9TA 4U3HA 3P2DA 1YHPA 2DQTH 1KELL 5I1EL 3ARDB 3AM8A 3PDDA 1AO7E 2H32A 2YR3A 3W56A 5DD3H 1KTLB 3TN0A 3TF4A 5ECGA 1VADB 3GK8L 1KIRA 4R4FL 1IKFH 2Z92A 2FT6A 5B1BB 3VXME 5KVGH 3VRIA 5DQJA 3GJFH 1H6UA 2CSPA 4WGKA 1WFUA 2J8UB 3C9NB 3MLRL 4HP5A 1AY1L 5I1HL 1YNLH 2NXZB 4JY5H 2VC2B 4B0MM 2H3XC 1K8DA 3O81A 1LQBC 5ACZB 1S7XB 3S37L 3U4BH 3ILPA 3RL2B 3KPQB 4OF5A 1BEYL 1RZIA 3HG5A 5DRWA 3ULUE 1XGPB 4FJZA 3QEGH 4JFEB 5F3HB 3CMGA 3L7FB 1R24A 3MXVL 1IEAB 3BW9A 4P2QB 4U1JA 4V2CB 2J44A 1MRCL 1T83A 4E36A 5C0RH 1L6XA 4KU1A 2WTOA 1WWBX 5BV7L 5D55A 2PO6D 2VAJA 4PJ5E 4KTEH 3O3AB 2ZP9A 1OB0A 3PUCA 4J4PC 4HQQH 3HB3B 2RTTA 4UNTA 3UTQA 3S88L 3D85B 3EBAA 2KDGA 4N87A 5I18L 2Z93B 1SN2A 2W0PA 3FTGA 3ECVA 5MERA 1FE8L 3F3HA 3Q6GH 1JWSA 5J13C 1KJVA 1N4XL 4PVMA 1JCVA 4FL4C 3DGCR 3MBEA 3HRZC 1L9OA 3TH2T 2LVCA 3U46A 3EH2A 1XZ0A 5J1AB 4DVBA 3DX7B 3PXJA 2IADA 3O0LA 4HWUA 1KFAL 3U1SH 1KCUH 4C83B 3MV8D 3MRNB 3HG1D 4FQIH 4YDJA 1NCAH 2QKIA 3THMH 1MHPH 2ATKA 1T89A 2NZ9C 3NN8A 1CR9L 4Y5XC 3S34H 4PRDB 5GRUH 2C9XA 4Y1AE 1QFPA 2V2WA 4ELMF 4FZEH 3BP7A 4GO6B 4ZMZA 4NWUL 2ZYRA 3HA0A 5T5FL 3REWA 3QEHB 2WMPB 2FJHA 3VRJA 3QDJE 1PZ5B 2JH2A 2JKNA 2A9AA 4DUVA 1WC7B 2XA8L 1HX0A 4H20H 3HE6D 4HFUH 4ONHB 1JZHA 1HIMH 5FYKE 1GS6X 4DFHA 3ATAA 4NZTL 1FNEB 5CLZA 4EI5D 3NQIA 2ADGB 3T0EA 1DJHA 1T04A 1UGNA 1RY7B 4H0GA 1RXLA 3CZFA 2CM6A 2X0UA 4A6YL 2VE6A 1EFXA 2DEXX 4OFDA 5C07E 3GXIA 1ZHNB 4R2GC 3WFEL 1HHHB 3WTSA 3RIFK 4BRJA 4HUVB 1NGWB 1XGQB 3VI3F 3S2CA 5C2UB 3QUYA 1MHHB 3EFDL 3WIIL 3N50A 2OW6A 5AKTA 3EG9B 1YLBB 1HILB 3FHAA 3EYVB 4K5NA 5IR1B 4PR5A 4S0TD 2CKBH 2VIRA 2Y36H 4XODA 4N24A 2O1AA 1OL0A 2MH4A 2FX7H 5BRZD 1WV7T 5F7FA 1YEDA 3FFOA 3IDJB 2A74B 1BM7A 3T4AC 4QRPA 4AEHL 5C0AD 5E6SB 4M1DH 1HXKA 4AL8H 2HN7B 1XIWC 4Z7OE 2E27L 4X2UA 4XVSH 1AS6A 1M6OB 5C0DB 3QH3B 5DDHA 3ARBA 4L4VD 4Y9FA 4C4BA 1IKFL 3ASWA 4X50A 5GRVL 3QZOA 3NSDA 2VR3A 1EAOA 3N55A 2CRMA 1ZVSB 4NOFA 2BIHA 3IXTA 1FC2D 1THAA 1YQ2A 2PTTB 1YNLL 2HT2D 4JY5L 5KYXA 5H2BA 4RVBA 4N90E 4UZGA 3T04D 4XO3A 2CDEA 2ZYSA 3IMSA 3U4BL 2ZXQA 2EDDA 2AJVH 5I76B 3BEVA 3BAXA 1DR9A 3FQ2A 5HDRA 5DC2A 3P40A 3RDJA 1XEUA 2H32H 4W4NA 1ZXQA 3BVVA 4ONGL 4NQCB 1VESA 1TF4A 4RAVB 4EE2A 4JJ5A 5C0RL 4CDGC 1R5VB 1MIMH 4KTEL 5IEHB 5FA3A 3WUWA 4EN2A 3MSPA 4HQQL 4XC3H 4YAQB 5DJ2B 3ZK0A 3MLVH 4UUJA 3TF7C 1FH5H 2JB6B 3MV7A 4G72B 4LNRA 2IQAB 4BYHA 1Q90A 3LQZB 3Q6GL 1G0YR 1JFQH 2JE8A 1J05A 3K6NA 3ZPDA 3NG5A 3QC5X 1HHJA 1RVFH 4NQDA 4Y4FB 2K6ZA 3F7PC 3WE6B 1JV2A 4FQHB 1S7VA 2WQ8A 4PJDE 5HD8D 1NQBA 1GTFA 1QASA 2RALA 4B27A 3K2KA 3CVIL 5ESAB 2VQUA 3SDYH 2DKSA 5GRUL 1KEMH 4OFVA 1S7QB 5IF0B 1VKXB 3CSBA 3QQXA 4FZEL 4DHLA 4MNHA 1MOEA 3AQZA 4JDVB 4KTGA 3C12A 4OZIE 2ZWKA 5IOKA 4QRUB 2H6OA 1LO0L 1U3NA 4G6FB 4H20L 4HFUL 3S2AA 3L4XA 1MUJA 3LNIA 4JZNB 4P4KB 5KSBA 4OBSA 3ZXAC 3KW7A 3DO3A 4AC4A 1R4XA 2NUPA 3D4YA 2RMNA 3QISA 3HLAB 3VXSA 4DPCX 3KL0A 1PGRB 3KPRB 5TK2A 5HYQB 4ANKA 2VXTH 2OI9C 1WS7A 4Q9QH 1PDKA 3FTWA 3D0AA 2OBGA 4WJG3 1INDH 4BFEA 1X6NA 1S78D 3ULVH 3TM6A 3NJFA 1DEEB 2V7HA 3LOWA 4MXQC 3LEXB 3QZNA 1ZT1A 2AEOA 3DX9B 3F62A 5E8NA 3TEXA 4H0LC 4NZJA 1T1WA 2ZUTA 1UB6B 4I88A 5C09D 4YJZL 5KSAD 2YAHA 5GSVB 5F88A 1NCWH 3IFPB 2CKBL 2Y36L 2AV7A 4PJAE 3DECA 4HZ1A 2UZYB 1R3LA 5T1LA 2EDQA 2E86A 4L8CB 4PV9A 1MH5A 4IBTA 5DQ9B 2NYYC 3TO4C 5JDSA 1ZXKA 2YO3A 4BUQA 3F7VA 3S36X 4FADA 2P47B 4LAQH 4M1DL 3DX2A 5HGGS 4AL8L 3MR9B 2WXPA 2A77H 2ZKHH 2OTPA 2FEEI 2GTZB 4XVSL 2Q9OA 4DGWC 3GTVA 3ZOAA 5CEXB 1GW0A 3L5WB 2OCJA 4B6ZA 2AEIT 3SDDB 2OMVA 2IGFL 5EU7E 3B9KA 1Z5HA 1E9PA 1WCQA 2NX5D 2P5WD 4HKJB 2KL6A 1PBYA 4A2DA 1Z9OA 1OAJA 3BN9D 4DZBA 3HUJB 4KV5E 3MCKA 4YZFE 5D70H 1DBMH 5HJGA 1OSZB 3DSNA 5CBEA 2VABB 1L7IL 2C3VB 4O2EB 4PI2A 5LGJA 1Q0XH 2C3HA 1QSFA 3SDAA 2AJVL 4P46D 5HHMB 4NRZA 4DPAX 4ERSL 3IU3B 2DWYA 1DLHA 4I9WE 4URKA 1H8SA 3QIBB 3IEAA 2W0FB 3T1FB 1BVZA 4LP8A 3FUDA 1F2XK 3KXFA 3SBWA 2OFQA 2J4WH 3TBTB 4CW1A 4LNVA 2UWEB 4JM2A 3OXSA 1S2EA 1JGIA 1IKOP 1CD1B 2JK5B 1DZBA 2G9HA 3DHUA 3RA7H 1ZVYA 3FUJA 3GS4A 5E94A 2YJQA 1B2WH 4GW1B 4PW9A 4IBVA 5AVVB 3PABA 3MLVL 3QFJB 5D7IA 3DA0A 1FH5L 5B4MC 1XCXA 1U4FA 2YUVA 1SUHA 4N0FB 1JFQL 1UA6H 4Z7WB 1U8JA 2BCKB 1RVFL 1NBYA 4AMKH 2R69L 4ZMPA 4X5WA 4ZYKB 1JZ3A 4J27A 1SHXA 2CLZA 3LPFA 1U8QA 4UM9B 4YGAB 1AGEA 5IMOB 1XH0A 4KAQH 2NY0B 3DARA 4N2BA 3IPBA 3W0WD 4UOQA 3X14B 1G87A 5E4EB 4JE4B 5DI8A 5EEZA 2A99A 2QPSA 1A4KB 3SDYL 5K33A 1BQHG 4E42A 1R5WB 1CL7I 3KPSA 1NAKH 5T3XD 2BNQA 3CSYB 3KCWA 3FQYA 4KXAA 3TBYA 1BFSA 1T5WA 2V9QA 4S0SD 3D18B 3O41B 2XXFA 4NNYA 4WIQA 5EN2B 2G4GA 1G7HB 3IJEA 4FNUA 1JK9A 5TDPB 3WJLA 5LWYH 4FG0A 1LP9B 5IIEB 1ZA6B 2B0SH 3OAYH 3V5DB 4XTRC 4NCDA 5H37G 5I1AB 3ZDZF 3DI3B 2EDRA 4ZNEE 5CZXC 4J23A 2CA3A 2HAZA 3HUJE 1URIA 1IZJA 1WRFA 1ET5A 3NCYS 2P1YA 4PJCF 2GSGA 2N7SA 1VCAA 7TAAA 3OR7A 1EEUA 3UO1H 4TUKH 2KS0A 2BM3A 5B1JA 5K39A 1NEZA 3CK0L 4AIOA 1G7JA 4LLDA 2XIIA 1NCWL 4W9JC 4M6ML 3RVXC 2H0EA 3O8XB 1E28A 2F9BT 3LB6C 2PTVA 1QNIA 3WV0A 5FYJU 3NCJL 2CM5A 5BNXD 3N5AA 1TEYA 3S96A 4LAQL 5HSFA 2A77L 4NFDA 2HFFB 3BVDB 2XQBL 3C5SA 3TV8A 1GR7A 2M8XA 3CC5A 3KYAA 3RVVC 2OMXB 4JKKA 2BWIA 2FTAA 2EUWA 1J12A 1WBYB 3PWVB 4AE1A 4GKZB 2F8VA 4DK6A 3VAEA 1TZOA 2QVTA 4Q4EA 4CJ0A 4UMSA 1BZDA 1S7WA 1I1AD 3CXFA 3FRPB 4XI5C 1MFAH 5D5MB 4FA7B 2OKMA 5D70L 3GUTB 1JPGA 1XMWA 2WN2A 1NMBH 1DBML 3ZJAA 1HJCA 5IW1A 1C9SA 1MZYA 4OZHA 3VFMA 2CDFA 5T3XL 2KERA 3KM2A 4PIRF 3Q2NA 4ETYA 3AXLB 3ZLQC 1JVOA 1WDAA 2BY2A 4PJGA 3V0VB 4OFYA 1M7UA 2FLMA 1KXHA 3C6LD 4N0UE 4XNUH 3L5JA 4B7LA 3HBPA 4ILDA 5ICXB 3UYPB 4Z7UE 1K5NA 5JOEA 2LU7A 2J4WL 4Y19E 4GRWF 1QUNB 2AFNA 3OBAA 4DW2L 5KYWB 5E1HB 4UDUA 1IX2A 3MLYL 4GY4A 1F00I 4RSYA 4OM1H 1B2WL 1AXTH 3EYQD 1A3LH 1J7VR 4HH9B 1J8SA 5FLUA 2DQIH 4FDWA 4Q14A 3VGHA 1ILSA 2VQ1A 4MAYC 3CFKA 3DETC 3QQ3B 5FKAA 1I7UB 5ITFA 2KZWA 3OKNB 4UU9B 4PY7A 1UA6L 1QZNA 5DDHB 4R4BB 3LH2H 3OR6A 1H5BA 1J1OH 1BLNA 2VR5A 3HRZA 1MN4A 4F5CA 4QTHB 4KAQL 1VDGA 2YD8A 2R27A 5CD3B 4G1EA 4G1MA 1XH1A 4JK0D 3QNZB 3ROLA 3K74B 4AIZB 2NY3B 2W91A 4NDMA 2J72A 3EDEA 3RUGE 1HDMA 5D1QA 4EN3B 5I71B 5GS1A 1S3KH 1HU8A 3CZSA 2G2RB 2Y6TE 2YKKA 1AS8A 4PPTA 5EU3A 3O6MH 4PFEA 5GGRA 3V6OC 5LWYL 5MHSE 2HMID 2B0SL 1QO3A 5MEPA 3INOA 3PDGA 2BINA 1FFOA 1N5AB 4L2LA 4QHKJ 3W39A 3MJGX 1OP5K 1KXQE 4BIKA 1NIDA 3VFTA 2BVPA 1NAMA 3L5XH 4HOXA 2VDLH 1DCEA 4PRBB 5DO2C 5I28A 1J8HE 2X4QA 5KVFE 5E6RB 2WVTA 4TUKL 2ZWZA 4TUOA 2Z4TA 3G04B 2ZUQC 5FKPB 4LIQE 1A1NB 5A40E 3AC0A 3PL6C 4MD0B 3VFUA 1FF5A 3C75A 4WCYL 1J18A 1YPZA 4X5QA 1NC2D 4XRCB 1YUHA 5HXMA 4MNQE 3AGVA 4QLRA 4IBWA 2NY4B 3D1MC 4OI8A 3T4AA 5DJXA 3UBXG 4IGBB 3CUPA 3CFMA 4FYQA 4C58B 1RIVH 1XIWA 3BI9X 3L3JB 3BD3A 4P5SA 1F8TL 4UIMA 4TM9A 5J3HC 5E1AB 1XGZA 1HI6A 5JPNB 5AW6B 2BMKB 3N44F 2DQDL 3AADB 4NUPA 2VDNH 4POZC 1DVTA 4JDEB 1MFAL 5A2IH 4NN6B 1NMBL 3V52H 3S8WA 3SCMD 5LHDA 2DQUH 5KS9B 5HHOA 1DQDL 3L7EA 1WEJL 1UT2A 3LRSB 2IDUA 3SZ6A 4GFXA 5BMFH 3ZIMA 3BFOA 1YNTA 2UYLA 3CIQA 4CL7A 3P9WB 4PJ9B 2A6JB 1TSHA 3O3BA 2X2UA 2EYTB 2B1AH 3QG7H 1CUOA 4UT9L 4XBEL 4MQ7A 1ZHKB 2GJ6E 3DTXA 5HYSG 4K2UL 4J3OD 3X13A 4OM1L 4G80A 1AXTL 3HPLA 4GXVL 4FE9A 5HDOA 1ACYH 4DP4X 1CGUA 2DQIL 1H3WM 4H8WH 5IJKC 4HUKB 1S9YB 1E5CA 1NCTA 5SWSD 3LH2L 3GS7A 3TH3T 1EANA 1J1OL 4ALAH 2AQ3A 1IGCH 3BKCH 5CILL 1L0QA 2VZUA 2EQDA 3U2SA 4OZGF 1DANU 1EJ8A 2XZZA 3MRPB 1VA9A 5I73C 4X6DE 1IAOB 3QORD 3P9MB 4PGBA 5DK2B 2R2EB 5AW9B 4HX1B 2GI0A 4L3EA 2C9QA 1IBHA 3CDYA 3H42H 4A7TA 4Y9EA 2YKLH 5D7LD 4ZUUB 4QOKA 1S3KL 6FABH 2OA9A 3LQAC 4X4ZA 2RR3A 4KOCA 2V9UA 43CAA 3O6ML 3C60B 2PO6C 3GIVB 1B2YA 4IK6A 2FQFA 4YNYA 1OAUL 3ARDD 4NJ9H 4RNRA 3A47A 3TFKC 1G1YA 4D3CL 4HIJB 4WUUE 3V2AR 2R1WA 2UZXA 3EUDA 3KWTA 4AJVA 4R3SB 2D0GA 4XCYA 3DPDA 4ZO7A 5DTFA 4POUB 5FXCH 5LBGA 3ARUA 3L5XL 4AENB 3UYRL 4F8LA 2VDLL 3VXTA 2QL1A 2OSXA 3VXOA 2FBOJ 4GG8A 1VZHA 3S3PA 4J12A 4PWJA 2ZSWB 4WKZA 1W8NA 3BEWA 2XKNA 1BSIA 1JI2A 2Q76A 2UUDK 2R4RH 2VXUH 4LSVH 5HVGB 3UCQA 5KBDA 2WJ5A 2G0LA 4W93A 4IIZA 4JFED 1IC5L 3N85H 4P2QD 2FD6H 2HJKA 4TVPD 1ZJBA 1CYWA 4AYSA 4C8XA 3WJMB 3BHBB 3ML8A 1OOWA 4YLCA 5T5NF 3ZIYA 3JV4A 1YEGH 1UZ6E 2VMCA 4Z5RB 3NIGB 3CDZA 1M7XA 4N2IA 3D85D 4TSBH 3HE6C 3D2UB 2FVNA 2D03H 1IE4A 1PG7X 1JF5A 2YPVH 4GAJH 2W07B 1SDDA 3PQYA 1C8PA 3OHMB 4DO6A 1REIA 1OK8A 4EI5C 2VDNL 3GLZA 2DMGA 3TCLA 4Z7NB 5TK4A 5DEFB 4PWKA 3V52L 2Z7UA 5L0QB 2XWBB 3A23A 3GHEH 1CFNB 3IJYB 2DQUL 2DTSA 4Z8FH 3STLA 2YD0A 1IC0A 3IRCA 5DS8B 4M00A 3EZ8A 3IDUA 5BMFL 3TOPA 4NQTA 4PQXA 4PRHD 1HYSD 2L04A 2EE3A 2K9FB 3LN4B 4PJFF 1E5BA 1TJHL 5D4JA 2B1AL 3CSFA 3FFCD 4JMXA 2NNFA 1XGTB 2I07A 3I6LE 4AM0Q 3GMRB 5HTSA 3BKMH 4GSXA 1SXNA 1FWXA 5FYLH 4YHLL 2D4FA 4WTZG 1BFVL 5DYOA 3ZT5A 4KMLB 2NUTA 1JHTA 3NJGA 1BOYA 4H8WL 2HVJA 4U6XB 3ATBA 1LHZA 1M1SA 4U1LB 4FFWC 1GHFH 3BIAX 5BUGA 1KG0B 4QCIA 4ANVA 1INEL 4ALAL 4D2NA 4XPFH 4JZJA 1ZJAA 3PP3K 6PAZA 4JO5A 1IGCL 3BKCL 4RMSA 1CJYA 1FVDB 1X44A 4CNIB 4F3FB 3ZTCC 4B9FA 2HT2C 5C7XL 3PF2A 3BPNB 5GS0H 1HN1A 2EACA 3ABZA 2VZTA 5FIEA 4FGMA 1QI4A 3KL5A 1RZQA 3EJUA 1MCJA 4RBPH 2YKLL 4PJIB 3KPOB 3JWNE 4KQ4H 1TCRA 1A7RH 3H2PA 4ABQA 2HUHA 4JY4A 2CBTA 2A6IB 2W81C 3CHXA 4GW4A 4LSSL 3ZHDA 1N6VA 3EYSH 4NJ9L 5E4IA 5KYNA 2QGCA 1WICA 5EULV 2ARJA 2Q7AA 1E30A 1ZVHA 3ULSA 3CZLA 3K1DA 4HJGA 4MJ6B 5J7CC 5F72S 3VQ1C 4PRIA 3ROOB 5JMRA 2W92A 1UXWB 4PP1D 1VF5C 3GBDA 4G59C 4PLJD 3BESR 2AI0H 2XQ0A 3IRPX 1RZ7H 3JSSA 1G5AA 1TTAA 3LZPA 1C16B 3VI3A 3WELA 1T03L 2R4RL 2W9DL 1KY7A 3MFFB 4WTWA 1L9QA 3O3DB 3CG8A 4ICWA 5HD8C 3ABGA 3A3YB 3BUBA 4QHUB 3LKNB 3IMTA 1JGVH 1YY8B 4YIQA 4Z7QE 2FD6L 4XPAH 1AC6A 3GLAA 5D4IA 4AZUA 4NQCD 1MJ7H 1AE6H 3OB0H 4ADJA 1D7BA 4NN5B 4UBDD 4NIKB 3W5NA 2R7EA 2WY3B 1P6AB 2PR4H 1NIAA 1YEGL 4PJEB 3TNMB 3VH8B 4I87A 1FYTB 5EO1B 2MMXA 1NCBL 5HYFA 2YD3A 3SGKA 1UT9A 4TSBL 2BSSA 4M4RA 5E95B 2D03L 4ONFH 2EH8H 2YPVL 2Q8BH 1V55B 4GAJL 3P4NA 4JHVA 4TSCH 5I0ZA 2V5MA 4IJTA 1SJEB 2X1OA 3HZMA 5F1OB 2EXTA 2AMGA 4ZX5A 1NTDA 1QI3A 4X98B 1FSKC 4P3WA 4V2BA 3GHEL 2QZ5A 1SBBA 4K4KA 1R3JA 4LEEA 1S78C 4AYFB 2IOOA 5E6ZA 3DUUB 1RIHH 2CO7A 5EOQL 4OCRH 2WOBA 3RWGA 2B59A 4EXKA 4IEFA 4EIBA 5KSAC 3RFZB 1YJDC 1J0YA 3N3EA 1WAAF 4XPBH 4NO0B 3ZL2A 4TXVB 1F11B 4MA8H 3LSOB 1M7IA 3BKML 3T6WA 1JK8A 2K7PA 2SEBB 1NANI 5FYLL 3B1TA 3U7YL 1HC1A 2C1PA 4G6FD 4ZMXA 1YG9A 3DDGA 5MEQA 4XAKD 4IRZL 1EAQA 1UD3A 4P4KD 1QSVA 1Y7VA 4C56E 1KWKA 1HHKA 4MKTA 1FNHA 3ZYOA 2YEZA 3ESMA 1U9KA 1ZT4A 4MAYA 4TYUA 5CSZB 1GHFL 4S2SB 4LLYA 4BRVA 1YMMA 1U3JA 1ZGLB 4P2RB 5DJ0B 3DOSB 4JHZA 3BN9C 4G8GB 3UZQA 4Y7MA 3BDYH 1GIGH 5E6IA 3FN0H 3QDMB 2DLIA 3V5KA 4IBQA 4XMKH 3ZHKA 5B8CB 5GS0L 1VFBB 2H9GB 4KDTC 4OJAA 3L9RB 4P46C 5KUMA 5MP6H 2I60H 3OKYA 1HZKA 3K0WA 4QXTA 4N9GA 3F12B 1A7QH 3M1CA 5JHAA 1JZ6A 2HX7A 3BVTA 2D3LA 4PJEE 1TTGA 2L0DA 2X05A 1FYTE 4MMYA 4XWOD 4K7PY 3BYTA 3QFDA 3LQMA 3F65A 4J3OF 3WE1A 5DVLA 4TPRH 2K0RA 1UENA 5CP3A 4Q97A 1DVYA 3MJ6A 2ITDA 4IRJB 2Z1KA 3VNZA 1AR1B 2LABA 4AYBA 4AUJA 2EDBA 4L29A 5LB1A 3P73B 2X6MA 3WS3A 3TA4D 2Z3FA 3EYOA 1T1XB 3CDGA 3MUGB 3D25A 5FYJD 4NN7B 2AI0L 1KCVL 1RZ7L 2EKSB 3E3QE 3UADA 1V54B 2YAQA 1T4KA 5HHMD 4CU6A 3M1BB 4XMLH 3FQTB 4D94A 3VXUB 2A0LC 4P9ML 4YQXH 3PL6A 3BYYA 1MG3C 3QIBD 1JGVL 4DZ8A 3DGGA 4DH2A 3LS5H 4OJDH 4XPAL 5H37A 4K94H 4FQ2L 1JDCA 1BBDL 1AE6L 4UOZA 1OTSD 5ETUB 3ETSA 3M07A 2PR4L 2OYPA 4LSRH 2C4FU 2P5EA 4U1SA 4DP8X 1A02N 3QBTB 1ORQA 2FDBP 4MNGB 5AB0A 1DJZA 1EHAA 2QVMA 4HEMA 3TIDA 4FI7A 4ONFL 4YK4C 2EH8L 3QFJD 4JO3H 2R8SL 4PJ8A 3BZ4A 3L95B 4N68A 3V0WH 1UC6A 2C3XA 2ROYA 4TSCL 5DS1A 5FGSA 2BNRB 3LNDA 2ZOOA 3OXRA 5IG7A 3SY0A 4P2RE 3TYFA 3QK0A 4WFFE 4B60A 2DICA 4HKBA 1M05B 4IS6A 4UM9D 2J8UF 3KPPB 1S7TB 3WJJA 3CFBA 5DUBB 1RIHL 2XDHA 2VLJD 1KULA 4OCRL 2CZNA 4JQXA 5KVEE 1HOEA 5EPMA 3TTYA 2BIOA 1K4DB 4V33A 4XE5B 2VUKA 3MLWH 4XBPB 3V55A 4XPBL 3IJSB 5AAPA 1TITA 2ZPKL 3D0VB 2AK4E 3ILQD 3SDCB 3LS4H 1WA0X 2VDQL 2VUOA 2E6QA 4TLSA 1TTFA 5LGHH 3U25A 1CO1A 1KB5B 3CPLA 3ZDXB 4OCYL 3FO2B 5FYJL 4JGJA 4FAAB 3HAEA 1Z2KA 5IJKA 9PCYA 1YO4A 2DV6A 4PLKD 5DFVD 1CG9A 1DQVA 2WNKA 5EUKA 4D0DA 1DFBH 1I1AC 2MKWA 1LEGA 4J3OG 4YPGA 1N0LA 4DN3L 3BDYL 3HMWH 1IARB 3FN0L 4EJ1C