4DH2A

Crystal structure of coh-olpc(cthe_0452)-doc435(cthe_0435) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
IHEAETADYILDVLVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFDYNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGSTKKYSLITFGESNFCDFDLKPILAVLKEGKVEIEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
molecule keywords Cellulosome anchoring protein cohesin region
total genus 31
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dh2A00
3KCPB 4IU2A 1AOHA 5K39A 1TYJA 2W1NA 4FL4C 4UYPA 2VN6A 2ZF9A 3FNKA 3F2LA 4FL4B 3KCPA 2XDHA 4WKZB 2Y3NA 4WI0A 4DH2A 1QZNA 5LXVA 2OZNA 2O4EA 2VO8A 4IU3A 4UYQA 2B59A 3UL4A 1OHZA 2VN5A 4UMSA 2JH2A 2BM3A 4U3SA 3GHPA 1G1KA 1ZV9A 3BWZA 3L8QA 5AOZA 4N2OA 5G5DA 2CCLA 1ANUA
chains in the Genus database with same CATH superfamily
1T5WA 1S3RA 2HVKB 1J8SA 1JI1A 3FZUC 1KCRL 2YD4A 3ROOA 1FFOA 3MBWA 2FQGA 1RJYB 3HBQA 1YAZA 4WSGA 4R84A 4U1HA 2BP3A 3U83A 1F2XK 1NAMA 4EN2A 1L6PA 4XO4A 3BDBA 4DP5X 2EUVA 1BIHA 4LP5A 3MV7D 3QHTC 4WNSA 1IBZA 2WUCH 4MZRA 4PJ9A 1CZ8H 1HKLL 3HZVA 3L3OC 3RTQB 4UQBA 5FM8A 4JRWA 3T71A 1M4KA 1P84K 2NY3D 4JUSA 3AT0A 4X5QA 5BNXD 4OGYL 5AAWC 1JUFA 5I9QC 3ATFA 3I9IA 3KLHD 4FJYA 3MJ8B 4M5SA 4P4KC 3OXRA 1M6OA 2FLBT 4Z8FH 4PGZA 4F8TA 1H5BB 1E9PB 5KVEE 3BZ4B 1KLUA 3Q2NA 5AAPA 5K9OA 3TCLA 2ESVE 1LE9B 3UC0L 2Q8AL 3HE6B 1I3RB 4D2NA 2XV0A 3KGSA 1TQCC 1K3IA 2J8HA 2H2SD 1S7SA 2EEXA 3EKCA 1XQ4A 3IDYC 1E9OB 3VFUB 2QHRH 3JTTB 4PJ5E 3C5SA 2XYBA 5JZ7C 5FS5A 3DGDA 4AGLA 2IPTH 3CC5B 3LYRA 4MAUL 2CLZA 5L6YH 2GJRA 1C7TA 4IHBA 3TNMA 1QHOA 1DP0A 1QBML 1PZSA 8CGTA 5DS8B 1U41A 2IQAB 4PP2A 4F5CA 1X4XA 1XT5A 2YD7A 3H42L 3MLYH 2C1OA 1IGCH 5I8CA 3LDBB 4CUCA 2QQQA 3DTXB 5E6IA 1P7QA 4APXB 2Z4QB 4IK7A 3KLQA 4P2CG 3ZSTA 4HV8B 3LDBC 3MRCB 1G6VK 5T1KB 4OGYH 2OXGA 3IDXH 2G0KA 5HVFB 3AB0B 4LKCB 3K2UH 3NK3A 4QHUA 5D1QD 3ZDZF 3O2DA 1E2ZA 2D7NA 3FUMA 1D5XB 3ASOB 4JPWL 3OLIA 4PJBB 1IEHA 3UTZA 4MNQB 4LKXA 2GIMA 3VXRE 4Y5YB 2VCOA 3H7LA 3FT3A 3CFJA 4J2QA 5GGRY 5CHNA 1UEMA 1FH5H 5CLWA 3MRMA 1PL3A 2YPLE 1C1EL 1WWAX 3LMJH 4OZIB 1HNFA 4ANWA 1BVNP 2PCFA 2CIIB 4X98A 5AVUB 4UV7H 3QPXH 4HYTB 5KG9B 3W82A 4PUBH 2OQJB 3K46A 2G5BB 4G7RB 4MCYB 2DQCH 4V1DB 5F1NB 4IMKC 5L2JB 2YK1H 3TH4T 4KKBC 1FSKC 5DXWA 4DKEL 1OP5H 1HK6A 1Q9OA 3ZTJG 3SODB 4GMTL 1PLGH 4ZW7A 3HHMA 1AH1A 3UBFA 3TNMB 3BKJH 2QSQA 5H37H 4KY1H 1ROCA 4GRLA 5FO7B 4M8RA 1CURA 5EBMB 4NQCA 2GBAA 3HFML 3MJWA 1RIVL 3LVTA 1VKXB 4FFWD 4GQQA 5C6PB 1J0KA 4ONFL 4KI5F 3DO7A 1C08B 1BZQK 2Y3AA 4R97C 5LKNA 4YSPA 1ZVSA 3AUVA 1I75A 2BSSB 1VCAA 2VDNB 1BEXA 1E6JL 4RESB 2VDOB 2AMUA 1MCLA 1NM9A 4OCWH 4WW1A 3STLB 5I6XC 2DKUA 2EYRA 3IJ9A 1MQKL 2CR0A 1T03L 4G8GB 1NIFA 4XVUD 1UQSB 3B2XA 3FYEB 4NBYB 1F90L 2AEPH 1MCEA 2YOCA 4R96B 4XXWA 1S7WB 4KUCF 3VQMA 1S7VB 1SHSA 1C5BH 4PYHA 5H94B 4DK5A 1A6TB 2I7SA 3BAJA 4ZFOA 2XYCA 4NI6A 5DYOA 3LS5L 5GPRA 3P0GB 5IB1B 4ODHL 5BO1H 1P9MA 3W11C 1UWXK 1K5NA 3WD5H 2VDQB 5TE6L 1YECH 3HNSH 4PJBF 5I26A 4H4NA 3MSPA 2XPGA 4FXKB 3UTTB 4TQHA 3O3UN 2VQ4A 3MR9B 4ZK8A 2KMWA 2DWDB 4Z7VA 2CCVA 3UJJH 4JAMA 4YQXH 4PJIF 1HAWA 3ALWA 2JI3A 2HLAA 4JFEA 4YSQA 1FJ1A 3O41A 3MRKB 3QK0A 4AKOA 3WJLA 3ZKMC 3BDYL 1C5CL 1IKNA 5KVGH 1EEQA 3BUQA 1EGJL 1PZ2A 1F1DA 4JJHA 3ZXAC 2D0FA 3OAWA 1I8IB 3L3JB 2HRPL 5I66A 2GJ6A 4WUUB 4DN3H 3EXJA 5DVLA 1CXFA 1E8YA 4KJQD 3P11L 4YHMH 3T0VA 4L05A 3WNLA 4UQ3A 1U6AH 4RMUA 5I16B 1IE5A 2ZUQB 2IBZY 1DQML 4NGHL 1OK8A 1DO5A 2ZOTA 1JWMB 1WG3A 2QEJA 3HC3L 4Z23A 2JCWA 5LB1A 3DIDA 2CKBH 5GHWH 5AYUH 1DQKA 4JKPL 5CZVH 3SKUD 3JYBA 1RZFL 3VTAA 4AXWB 3U6XA 4A6YL 3BAIA 4GOSA 3U7AA 5HHQA 1BXXA 2Z93B 4NO3B 4C59B 1ACYL 2XZCL 4X7SL 1EO7A 1E40A 1FG2B 5F7NC 2ZPKH 4X0NA 3JZYA 1MFCH 4Z7WB 3M1BB 2OXHB 1AHWA 1L9PA 1IUZA 2DQIH 2R69A 4Q0XL 2FAUA 3HZMA 2AJSL 2C9SA 2CCWA 3D18A 4UT7H 3NJHA 5CP7A 3F62A 3T6QC 5F7AA 1UD5A 4FQIH 1NLDH 2P8PB 2ZOKB 1WLHA 2IGTA 4I85A 4LSTH 5I17B 2EDRA 2ED9A 3MRNA 1P5UB 3QDHA 2FEJA 1E5BA 1N68A 2FCBA 5EZPA 1ZY9A 3QQ9C 3V9EA 4DCQA 2J6EA 1P5UC 1SGKA 1R24A 4IU2A 4Q9CA 4I3RL 2ICCA 3MOQA 2YPLD 3QW9A 4MS8C 12E8H 4Z0BL 1TXKA 2YD9A 1MFDH 1FDLH 2AQ2A 2V9QA 1OAUH 5CD5C 1Z66A 3U0PB 3P30L 1B0GB 4A7GA 2ATKA 4WSJA 1OKEA 2FRGP 1MF2L 3HNVH 4FQ2L 4LSVL 5FW6A 1O6SB 2GB2A 4AKPA 3MNVB 2Z0BA 1D5BB 5FV1L 3S3DB 1SQMA 3D0VA 1SEQL 4GRMB 3BRDA 2EXTA 2NX5D 3CZEA 3QRBA 1MDAA 1YQ2A 3E8UH 3UDWA 1P6WA 2W38A 5K39A 1X6NA 3US1A 2DTMH 3QUZB 4M6ML 5D1XD 3BUTA 5AWNH 1N3NB 4MB4A 1T20A 4GKLA 4A66A 1R5IB 5MP6L 5EU3A 3FC8A 3UDWC 3BPNB 1PQZA 2YXMA 1K72A 4MMYB 1MI5E 3MBEC 1IKFH 3DBXB 2QPSA 2KPWA 3L1OL 5I19L 1E4XI 4M1DL 5B7MA 4IRSD 2JELH 4UNTA 1NUGA 5E0QA 4J27A 3ZMEA 3UTPD 5ACZA 3AXLB 4P9HC 1LQSR 1T1XB 1IJNA 1EJ6A 4HUKB 1JRHL 3SGJC 3D69A 5AL0A 5IVZA 2ITCA 3PDOA 4DHLA 4RAVA 1A0QH 1WD9A 4BE6A 5CEYB 2D8KA 1RLWA 3F6LA 1F4HA 1IM9B 2KQMA 4NP9A 5FA4A 2B0SH 3RWCB 4S1QH 1CFNA 1TTBA 3TM6A 3VI3B 1MW3A 2WVVA 5JZ7D 4XNXH 1CLVA 4GW1B 2L7EA 3KNBB 3LOWA 2NY1B 2DOCA 4P99A 5HHXL 4OZFA 3UC2A 1XL6A 1XVSA 3E6FA 3EBGA 3IRPX 4Z6AT 3N40P 3RVVD 1KOAA 1NGPL 2YA1A 3LPWA 4NLAA 5JPMC 2CO2A 3SKJL 1RV6X 1B0RA 3ULVD 4RFOH 1CC3A 3FSAA 3FT3B 1SYSB 4M7KL 2EYTA 1EXUB 2ZXBA 2EDFA 4HC1A 1UATA 5CIPH 4DKFL 4HJJH 4OU3A 3ARUA 5D2NC 2R1YA 4KUZH 4X98B 4XMPL 3HB3C 4IKJA 1YEGL 4NPJA 3MDJA 4OGQC 4LLWB 1JV5A 1KXTA 2WQXA 2FL5A 2JIXD 5AQ0A 1HSAB 1QWHA 4YFLI 1MAKA 1JNLL 4FTVE 3DO4A 3WXVL 2EYSB 1V55B 4KTDH 3TN0C 2FSEA 2ZE0A 4GKSB 1UZ6F 3GMNA 2NY3C 4M7LT 3EGXA 4G70B 1Q0YH 3NIGE 3NK4A 5E00A 5AOIA 1RERA 2D3JA 2QDVA 5ESAB 4JDEB 1PZUB 1P7QD 3IGAB 3TBTA 3GK8L 5I1EL 1RAMA 2PPAA 2XZZA 1CFNB 5B3NA 4KMQA 1N70A 1JPGA 1IBGL 1BLNB 1MRFH 5FA3B 5LHDA 3M1OA 1AZZC 4LRIC 5K93A 2RGSA 5BO0D 5HJGA 1TFPA 1QLEB 1BWWA 3BFOA 1Y18A 4J3OF 4EDWH 4Q9RH 4Q2ZB 2QQKH 1U8PA 5E2UL 2ZCZA 1FLRH 1MCPL 2ADFL 4PBXA 3RNKA 4I0PD 1ZV2A 2C3HA 3N91A 4LO9A 1FYTD 4LRIA 3F12B 5C09A 1K2DA 1T6BX 4UTBH 3X12A 4R7DB 5CJOL 3HI1B 1JVKA 1TMCB 4JO1L 3JWNC 2P47B 4UM9B 2JXMB 4ILDA 4PRDA 5FDWA 1FV1A 1KY7A 4Z7WF 4KROC 3HE7A 2W81C 2HRLA 5D96C 3U9PH 2JKWA 1XF4A 3C6SB 4LCYA 5C07D 1FYTB 2R1WA 4PRNA 3L4WA 4TNEA 1BZ8A 4N9OB 3SQOL 4YJZL 3IFOA 5F6HI 3ZTDC 4HKZA 2WXQA 1HDMB 3GKWL 3N42F 3IBOA 4HAGA 4N2BA 1AJ7L 3E2HC 5IJVB 3GM8A 1SVBA 4HCRL 4AIXA 4LSUL 4P3DB 4A7QA 1HXKA 3CK0H 4IMKA 3WEOA 2WBKA 3D25A 3G5VB 5FW7A 5F9JB 4M62L 4QGTA 1PG7L 3SKNA 3II2A 4WWID 5KBNC 5T5FA 1JZ7A 5FDYA 1QP1A 3DX2A 3ISYA 3SE6A 3WENA 3ENEA 4BIKA 3L4YA 1X5JA 4OCNC 5TDOA 1JN6A 1PSKH 2CAKA 4PRPE 4R4BB 4ZOCA 4L8SA 1MQ8A 1DE4B 5CBEB 4ODWB 2Z7ZA 4RFEA 3DK2A 3RGVC 4F57L 1ZGLP 2J20A 4NKDA 4OIAA 1UXLA 2W9LA 3ILEA 1MNUL 2BY0A 5MERB 3DUUA 5IB4A 3X14A 1A65A 4YHNB 4WENB 4QHNB 4PS8A 5E1HB 3MPCA 4R5TA 4IJ3C 3QR2A 4WZ9A 4G83A 5CR8A 2X7LA 3RGVA 1XXFC 3FB5A 3TWCL 3QJHB 1F6LL 4QOKD 1DVUA 3VRLF 4B50A 4U4IA 5IMLB 3TVMB 5EU5B 4QXTA 3WUWB 5LNDA 4JZJC 2QBWA 2OMXA 1KFAH 4CDHA 3DO3A 4KI5C 4KRPC 5GS0D 2UWEE 1U8IB 3O3BA 5CP7B 3CFEA 2EIMB 3D18B 2ZWZA 2Y7MA 5AOKA 3GBNL 4NYLA 3MRBA 3KGRA 4N22A 3UEQA 1HHJA 5BRZD 3M86A 5AUMB 4KUZL 2ZQKA 4P5TA 1MXGA 2DQUH 1EXHA 2CHDA 1T4WA 5HJDA 2BH0A 1ULVA 4JKLA 2W1NA 5D7JB 5AVSB 4N5ED 2J57A 1J8HD 2XQBH 4PJHF 3FU0A 4QRAA 4TS6A 4OLWL 1YEKL 1N12A 3BAEH 2ADGB 4O51A 1RJZB 4U1SB 4E36A 2OYMA 4DPCX 1T4KA 2G2PA 2AXGB 2WKOF 3VNYA 4Y7OC 4IQHA 5CJXA 3TZVD 1ADWA 2OSYA 4I77L 2YZ1A 2Y2YA 5IBUB 2IH8A 2VDKL 4XNXL 3E1F1 4N68A 1YMMD 4KRNA 1DVZA 3ZE2F 3I3EA 4DGIH 4ABQA 1X5KA 5I1JH 3BUPA 2YUWA 3ZTNL 1D9KA 3X1FA 2NNFA 1Z3GH 2K4AA 3NJIA 1QA9B 4HMDA 3TO4D 2NY2D 3P77A 3MO1B 1KB5L 3L9EA 5H2BA 5LGJB 4PGDA 4APQC 1T5XB 1ILSA 5JLZA 1H3PL 4KITB 1MFCL 4GAAA 3LXUX 5SX5K 4XE0A 1YNLH 3ZZ1A 4UOJA 2QLYA 2JK5A 2WK2A 1D7DA 2OSWA 4K94L 4NJAH 4JL1A 2PWFA 2DQTH 4BH7A 4QHPA 4YDLB 2W0LA 3QAZC 3ZRSA 3FTSA 2ORBL 3NFNA 3LXCA 4MQXC 4U6VL 3SGKA 4P2OC 2W0KA 1DJGA 1DLFL 4GYBA 2J25A 3EH4B 3SDDD 5TTRA 4MA1C 1SF3A 3KGTA 5AW6B 1EHXA 1HH9B 3BP5A 4XXDA 2WNKA 1UJ3A 2GJZB 4LPXA 4PVMA 3VWJB 5HHME 1FHNA 4WWOA 3PPEA 3SGKC 2ATKB 3NCCB 3BKYL 5DUBB 2PO6B 4HWEH 3ATDA 1H15A 5D5MB 3DARA 3EFFB 3WXWH 4JG5A 1HEHC 3PNWB 4PJXE 2G9HA 1UCBH 3BT0A 1A6VH 4IU2B 4MBRA 4YUEL 2K78A 3OZ9H 4HS3A 4Y16D 2Z4QA 5T3ZL 1OM3L 3MRJA 5DQJA 1DBKH 2A74C 4OKDA 3V4VL 2WO3B 4ZI8A 2CKBB 1JWUA 3ILQD 2OCFD 4IOSA 4NNXB 4OJCA 3CZNA 9CGTA 1RSFA 2VDPB 1U3NA 4LLMB 3VTTA 1XGUA 1TJGH 1FYTE 4UAHA 4CA4A 4KKCC 2J4WL 1ZTXE 2VM4A 4CVZA 4QLWA 2LV4A 3MJ9H 4H88H 2J5LC 3WSQH 4DGVL 2XNAA 1SJMA 2WNGA 1AR1B 3LN4A 4U6HA 4GW5A 1GIGH 4FG6D 4OJDH 4FG2A 3GUTB 3BFWA 3LSOA 4WKZA 5LGKA 2YRZA 2FIRT 2BOCA 2AHIA 2YD8A 3FQXA 3QQ3A 4PJEB 4DAGL 4PV9B 4LEEA 3E6HA 3SDAA 1IZJA 3DJ9A 2D7OA 1XGPA 3VRIB 8PAZA 2EYSA 1OT1A 3MACH 2GCYA 3FO1B 3V0FA 1JFHA 1PBYA 4D9LL 2HAZA 3GMPB 3BQUB 4UMSA 1IEAB 2ORBH 2KZBA 2COVD 4GFTB 1WCQA 4FJZA 4KNSA 5KSBE 3U4KA 1M7IB 2X4NB 1U2HA 2X10A 1C08A 4KKAD 4GEJA 3QZBA 4OF6A 3D4GA 4M43H 5JXEC 3CWGA 1ZANL 2DY2A 4IYKA 4B7IA 4N8PA 4JCLA 3WKML 3HFMH 3ZL4H 4HU8A 3T0EA 4OVVA 2OXGB 4FKEA 4ONOA 3MRIA 4Y2DB 4GS7B 1WSST 4GBXD 2JTYA 2XV2A 2NYYC 3RGVD 1KTBA 3SPGA 3P0YL 3P3RA 3DJTA 1TVBB 1K8IA 1Z9SA 2YPVA 3U7WH 5CLZA 3QJXA 4R7DA 1NDGB 3AWEA 2H32H 3I2CL 1MFAH 5E6IB 3X12B 4ZZKA 5IGXH 2MCAA 4U3XA 4P2RA 4TUJA 3PABB 3D85B 2GYSA 1T0MA 3OJVC 5J1TC 1UM4L 1QO3A 4OGAC 3ORJA 2XPYA 4DFHA 3KM2A 4EI0A 1K5NB 1HOEA 1D2PA 3Q3GA 3IGUA 2R83A 3G6AB 3KCWA 1RJCA 4FEIA 4HJ0D 3V0HA 1ACXA 1KGUA 1YDPB 4LFHG 5AL8A 3FO9A 2R9HC 1F90H 2IDCA 4YE4H 3ABLB 3STBA 3TN0A 2YKLH 2JF1A 4QYOA 1F3DJ 1YNKH 3GMPA 3QUXC 4NQEA 1WPCA 1VGEH 5BRZE 4K3JL 2GUOA 2VNCA 3V9CA 1BOGA 1GYWA 1GZQA 4S0TD 1OIOA 2ICWI 4FG0A 1IC4L 2BVPA 3CN0A 3JV4A 4BHUI 4BV1A 5JTWA 4LLUB 1I4FA 3ZKXB 1KPUB 2D9CA 4ENED 3PDGA 4IOFC 3VQ2C 3WNMA 1ZEAH 2E7MA 3JWOH 4GSQA 3T4AB 2X4OB 3U1QA 4XVTL 5BW7C 1HU8A 3BKJL 3GD1C 1RIUH 2N01B 3HMXL 4I0PC 1NOAA 1YSOA 4KK9D 4QI3A 4JCMA 2R59A 4YXKL 2Y5EA 1AR2A 1LK2A 3MUGB 2HUHA 2YK1L 4JFXA 4AYEC 4Z7OE 3D85A 2OL3B 1LEKA 5HGDB 3NJNA 4JN1H 2NYKA 5HYSB 3OD3A 3RIFF 2HT4C 3NFPA 4GBXA 2WTRA 1R0AL 1WT5C 3P4OB 5HD8D 4K5MA 4XP6L 2OMVB 5ADOL 3R06A 5BRZA 2E4FA 1BREA 4F37K 2G75B 4ODTH 1L0QA 4H2AA 5DMKB 1P4IL 3AQDA 4RMWA 3W5MA 4N0UE 4J3OC 5DUJA 2D31A 1E28B 2NUPA 4YMPA 1J88A 4OFYD 3VXMA 2OJ1A 2VLJA 2PWHA 4JFQA 1WWBX 2FT6A 2N0MA 3DXAB 2FSDA 1BWMA 1XSKA 1PG7H 2OMWA 2H3XC 3ZE1E 3VXUD 2DDQH 5GRVK 1CLOH 1N7MH 2X4QB 3VI3E 3IPEA 2XT1B 4PRHB 3FOMB 4NRZB 1MRDL 3LZFL 2WBJA 4C8XA 1I1AA 1CE6B 2VUKA 1LJMA 2YAFA 5C0NC 1HH6A 4XN4A 3PHAA 1DN2A 3F7YB 5E0FA 2QPEB 3CN4A 2VXUL 1UZGA 2FZ3A 2VDOH 3LEVL 1DUYA 2BP0B 3LAFA 3D0VB 3OKNB 1UZ8B 1R0AH 3VRLE 4OZFB 4WHTA 2X7LB 1NC2D 3UBHA 3S8WA 3U25A 5ICZB 4DGYH 5JORA 5JW4R 6TAAA 3H42H 3MLYL 4FFVC 5ERWA 3A5VA 4NKMB 1HE8A 3MV9D 1CT8B 5DMKA 1J7VR 4PGDB 1CL7L 5H2BB 1NTDA 4L5FL 2BHFA 2VW4A 4MAUH 4PMFA 4Y5VC 1HL4A 4U1IA 5FUCE 1KYAA 2IXQB 4GLRI 5IKCA 5BOPA 2H8PB 2VAAA 2R69L 1TTGA 3E3QC 1I7TB 1U92B 2JMRA 1L0PA 2IXQA 3L5IA 5EC1A 3E80A 3FMGH 3DTDA 2MKLC 3MJ9A 3WIHH 5J6GB 3UC0H 5AALA 5ACZB 3M1BA 2HWZH 5B38B 3OKMB 5F9WB 2D2OA 1P1VA 1ZHNA 2E3VA 2YUZA 1RK0A 4FE9A 2W9DL 1NSNH 2VR9A 3T2LA 5C1MB 4FI8A 3APFA 3B9EA 2WCSA 4TUOB 1DJSA 3PQYE 1TNNA 4FEMA 2B39A 1OK0A 4NFDA 2N7SA 3IDGB 4YAQA 2IWFA 5I0VA 4GUOA 1JGUL 2TRHA 4XOEA 3T0WA 2R2HA 1HT6A 5PAZA 1TJHH 3VGAC 3EYOB 4WO4A 4F8OA 3P9LB 3A6BH 5CILL 1HZHH 3EBHA 5HDBF 1QA9A 3CIAA 3EJPA 4MXQC 3SDXF 2ZTBA 3KL5A 2Q10A 1ZAGA 3P9WB 4N24A 2P8LA 1JF6A 4XXCA 2QQLL 4M5TA 1HL8A 5IEHB 4E68A 4ZS6C 1F8TH 1FO0L 1JDDA 4FTVA 1JZJA 1DEDA 4MWFB 4ODSH 1O75A 2VWEC 3ARTA 3AWGA 4AMXA 3BPNC 3LRKA 3AJ7A 5JQ6H 2FH6A 2CQVA 5KN5B 1F45A 4K3EH 3RB5A 3HFFA 5C70A 4KPHH 3IGLA 4B6ZA 4Q4EA 5GRYA 3ZY7A 3WAJA 2DS4A 3MV01 4NO5A 2CA3A 1E3ZA 5LAXA 2Z91A 2P5WB 3QAZB 1KTDA 4W9LC 5E08H 3KYNB 4OJEH 3SBWA 3ZQ9A 2YFNA 1TQBB 2Z92B 3NOIA 2D3NA 2EIEA 4MJHA 3KLHC 3HC0A 4JE4B 3QCTL 4FQXD 4H20H 4NQED 1GMIA 4I4WB 3I75A 1GYCA 1IKFL 1WYJA 3G5XB 1S7XA 43CAB 2IG2H 2GTZA 2CNZA 1BQSA 3FK3A 5ALCH 4XMUA 3LKNA 3CCHB 2ZSVA 3CVDA 1A25A 3LEXA 3QUZD 4I1RA 3C9NB 1WGOA 5EOCL 4ZODA 2CXGA 3DHPA 1NPUA 4NJ9H 2YXVA 4PRDB 1NAKL 2C34A 2RACA 2BVOB 2V6HA 3ZDZB 3V0JA 4GW4B 4NNPH 5IP4A 2AKRB 3SZ6A 4N9GA 3TV3H 2OPCA 2V37A 3BDXA 2ZKWA 4TYUA 1JK9A 1KFGA 2FNBA 2ZP8A 4G3YH 3QEQB 4NO0D 1W0VA 3GB7B 2B2XH 3ZKMD 3ARFD 2CSPA 1BX2A 3GO1L 2ENPA 3IM1A 4LOUC 4C54A 2FYYA 5CD5D 2DB8A 3Q6FA 3ARDA 4XNYH 2CIIA 4NP4H 1EGJA 4AC2A 1H6TA 4XB7A 3NCEB 4HWEL 4HVBA 4JO3H 1E2WA 2XY2A 4GG6A 1ADQA 1W0WA 2B2XL 1AOZA 4DO4A 2VH5L 5FYKD 4KHTL 4Y1AA 3W11D 3VWJD 2EDHA 1Y18B 3FN0H 1BOGB 4XPTL 3FQTA 1JPGB 3FSZA 3U30B 5F3BB 4NAJA 4F7PA 8FABA 3T2NH 4XNZB 3UBGA 3MRIB 2R2EA 3NP3A 4F58H 3GMMA 1JZ4A 3QCTH 4H20L 3ML8A 1BJ1J 5J57B 4NWUL 4JFFE 4U6XA 4FABL 2J44A 5E4OA 4YEFA 2VLKB 3CDCA 2CCLA 3L9BA 3SGDI 3TBYA 5CD3A 2ZXGA 2ESVA 2WLLA 1A64A 2Y7NA 3HG2A 3MA7B 4YC2C 2Z3FA 2BMKA 3A67L 4HIEA 4ABWA 4HUWB 4F58L 1L0XA 1WZ1L 3ULUC 4GRWF 5IF0A 5D7JC 1HOCA 1ZHKB 3GGWA 4TPRL 1IAIL 3IS0X 1E4WL 3SJVD 3PXLA 4A39A 2FD6H 5KTEL 5MEPB 1D5RA 5JQHC 2AV1A 4ZXBD 4C83B 3N9GL 3KPRD 3MV9A 3OG4B 3H4HA 2P1YA 2NZ1A 5FO7A 4KHXH 5DQ9B 5DJ8B 3RKPA 1IAIM 1S9WB 5J8OA 3RVUC 3PGDB 3V4PH 3DJSA 5CEZL 1MCDA 1A8ZA 1UADC 5CILH 3FNKA 2CBTA 3IJ7A 1ZTXH 5B1JA 2CUIA 4ODSL 5F7HA 3LIZA 3GSVB 5K9JL 2MQGA 2NZ9D 2ZT9C 3O3EA 4HWZB 1HI6B 2VJ8A 3CFDA 3KPLA 4IRJC 3RLSA 4LLUA 4YVUA 1TZIB 2X42A 1F3RB 4X99B 5CO1A 3WIHA 1MCJA 3VSQA 3QEQE 2DQFB 1AXTL 3DSFL 2XIDA 3CVHH 4PREB 3MLRH 1H19A 5JDSA 5C0GB 3MLSH 4LIQE 4Y8DC 3SE9L 3PNWA 5ITBH 5ECGA 3TBYB 4KDWA 5K5YA 3O0RL 2VWEE 1FL5A 1MFVA 4J6RH 5LVEA 1FRGH 5DRXA 4QWWD 2X6BA 3QORA 3QUYA 4XC1L 1XMWA 2VXQL 2LU4A 4J4PC 3UG4A 3NGBB 4GRMA 4QOKB 1U8LB 2BFGA 3QULB 1VZGA 2BDNH 3BZEB 3Q9QA 4K9EL 2J8UE 1QOKA 2O5XH 4B7LA 3EJUA 3BWUF 4CU6A 1C7SA 2YRBA 4N2NA 1N3NA 2NCEA 2NY0C 2KC0A 1P5VA 2QGCA 3KPRA 4X7EC 5AZEH 3O6KH 3CBKB 3MMEB 1A6UL 5D7LA 1G7PA 5EC1B 3QJHA 2RHEA 4K23L 1Z9NA 2YAEA 5FUZH 3JTTA 4WW2B 2VXSH 3SEPA 1SPDA 3TEYA 4I5BA 3X1GA 2G60L 4TUUA 4W9EC 2ADYA 5F7MC 3EYUL 3T1FA 4FLQA 4I5BB 2CUAA 1V7NH 1OZTG 3ZK0A 2Y36H 1PLGL 1QEXA 5LBVA 2V5RA 2UY7B 3GJFA 1PKQB 5EF1A 1KBBA 3A4DA 1I82A 3FW6A 1IBFA 4TSBL 1TTFA 1NOLA 4B96A 5KSAD 3R0MA 1J5HA 2EH8L 1AKJD 2NQCA 1MIEH 5INCA 3QCVL 1VFBB 4HEPA 4P5TB 3ECWA 2IAMB 2MPAL 1DUYB 2BP0A 4HCRH 1VHPA 1YEIH 2OK0L 4HIPA 4BFNA 3BUIA 4IDJL 3LIUA 1FH5L 4NRXA 1QW9A 3ECBA 1Q72L 3EYOA 4HXBL 2VL5B 5EN3A 4Z76B 4U6YB 3X3FH 4XNDA 1J0HA 1L7IH 3KE0A 4MLIA 3DOSA 3QI9A 4HLZG 4PJXF 2VL5A 4BZ1H 1AR1C 5D4QA 3MBEB 4EN3A 3SPCA 5CFAA 3FYIB 3ILPB 1U3HC 2IFGA 5D7IE 4U1HB 2JKXA 2OCCB 2NR6A 2W5PA 4LSQL 3LZPA 2O5YH 5KW9H 1FAIH 2BP8A 1NIBA 4G9FE 4CN6A 1FZMB 4TTDC 2H1PL 2VAAB 4GSXA 2WWMD 2LVCA 2QZQA 4HISA 3BVDB 1W6WA 1WFUA 1KENL 4PV8A 1AAJA 3UADA 2DQGL 4QRTA 1MCKA 2W07B 3Q8AA 2ADFH 1FZJA 3DETC 3OAYK 4FNPA 2EDLA 2OTUA 4NHUB 2VZOA 5ABDE 5J5EA 3WHXB 5DRZB 3IMTA 1WH0A 3OMIB 4PLKD 1OSZB 3B7RL 3MA9H 4QRPB 1I7TA 1U92A 4RAVB 1DUZB 3NSCA 4QRRD 5DD6B 3I9GH 1MCBA 3IF1B 3F7RA 3NZSA 4QRPA 3TO4A 1PD0A 4NKIH 5FYKE 2XJLA 3OMZA 1B4LA 1E4XH 2DWEA 1DBMH 2ZIDA 3CH1B 2NQDA 1KJVA 3WXVH 4BFIB 1HZKA 3WFDH 4QEGA 4X6DF 3QZPA 5MEQB 3SD2A 2VLRB 3CPLA 3MLXL 3SDCB 4ZFFA 2C9VA 1DQJA 4DUXA 3A21A 3RTLA 5I1AA 5FR3A 2DLTA 2Y06H 3IDGA 1LMKA 2WOYA 2ZUYA 1X5YA 4JKWA 4Y5YA 3MCKB 2VXVL 4AG4H 1O9WA 5AENA 1AZNA 4ZYKA 3SDDB 5I1CH 1F6FB 1OTTD 5CN3A 3HE7B 2J1YA 3QRGH 4HALA 4ELDA 4IU3A 4PJHA 2QTEA 4G1MA 4PRIE 4JNXA 1TLKA 4P46A 1KPVB 2DL9A 4EZJA 3OM3B 5L8KB 1HDMA 3I84A 3QS3A 1XCTA 3KLSA 3VG9C 1TYRA 3D07A 3U36A 2Y25A 4K3DL 4QT5A 3VRIA 5DMIL 3PE9A 4GAJL 4PJ9D 1KXVA 1WUNT 5EBMA 4S1QL 3WO4B 4D9QD 1X5FA 2PCPA 4X6DE 5GGTH 1G7QA 3ECQA 3GMLB 2IH1A 3DXAE 5I8OL 2NLJA 4XO5A 5BS0B 1KXVC 3H9SB 3B34A 3A47A 3PL6A 2XVGA 2BM3A 4AUJA 1WWCA 4YDNA 5K59E 5E00B 2B5IB 3HI6L 1KIRA 1UWXH 3FTGA 4XBMA 3V7AE 1TVBA 1Z9SB 3S3CB 5JW5A 3FOLB 4MJIE 2OULB 4JZNA 2OI9B 3ZE0E 3V7AG 4OCMC 1MWAL 1OARL 1MJJB 3ARBD 1KCVL 4JFDE 1FGVL 4K55A 3CFNA 2YEZA 2D4DA 2YRPA 3MA7A 3MXWH 2F7QA 4Q6IB 4U1LB 2ROXA 3E2HB 4F7KA 5FYJE 1O6TA 5CF3A 5H94A 1KJ3L 1XF4B 3DMMC 3M6DA 3KDMB 3T77A 5J13C 3CHRA 4AW7A 5C07E 3DJZA 4Z3TA 4OV5B 1N8OE 1DJZA 1AY1H 1UM6L 3GRWL 1CFQA 2FWOA 5JW3H 2Y24A 1C16A 2NDGA 4UM9A 3PWLA 1I7ZB 2VYRE 3QJUB 3TESA 5ISZD 2LQRA 3RDTD 1NGZA 1R5VB 4DQOH 5DURD 2Z1KA 4TNFA 3S35L 5ESVA 2PF6A 5EF3A 2D31B 3VDBA 4URTB 3AREA 1I7RB 2EDMA 4YHZL 3MTXA 5IQ9B 3JV0A 2F54E 4AE1A 4EIGB 3MRDB 1OTUC 2L0DA 3ARDB 3IKCA 4HKXA 4MAYC 4ZMAT 3H9SA 5DWPA 3U0WH 1AQDB 3MRDA 1GS7A 5IJDC 4A7UA 1IFHL 1MHPL 4HOXA 1UKSA 4RRPG 5DJCA 3HKFA 4H8WC 1B0GA 3HNTH 5C7XH 3ZE1F 1A5FL 4UNVA 1TJGL 3T3PB 5IGXL 2VDLH 3V55A 4XO9A 2BK8A 2ZWSA 1V54B 5EPMA 3CZFA 3I6GB 4FQLL 4HUVB 1JIBA 2VRAA 3GUFA 4P57A 2XFXA 5T5FL 6PAZA 1U8MB 1KCLA 2CR3A 2LHAA 2MFNA 3KDMA 2F1AA 3UAAA 3FU6A 5C0FA 4HKZB 3VGHA 5MI0C 5DVNA 5DD5H 1Q38A 3QG6B 1DCEA 3LZQA 1A3LH 4LAQH 4M03A 4MDJA 4FLRA 5TQ0H 5IHZA 1PD6A 5D2LF 4Z7VE 5J0BA 1N0LB 5AW3B 4D9RD 5KVFH 3BP7A 1BAFH 1KB5H 2E9JA 1DQMH 3DX9A 4JDTH 1G7MB 4YXLL 4H8VA 4AQAA 2OW6A 2FT8A 2V7NA 3FU9A 4KI5D 1IGMH 4KRPD 3RWEA 3V10A 4DOHB 4KK8C 3OJ2C 4DGUA 1NBYA 2NY0B 5D71L 4HQQH 3HCVA 1GZPA 3J07A 2V3EA 2XN2A 5I23A 3CJJA 4ZUWB 4LPVA 4B60A 1XD0A 2B1AL 4DAGH 4M7ZC 3NAAL 5EOQH 2O93L 2BIOA 2NTFB 4UNUA 3IETB 4F2FA 1ROWA 1KGIA 2MJWA 4NZDA 4H40A 4XPBH 1WCBA 4XBPA 1GXEA 5I8OH 3SB3A 3VA2C 2Z92A 2XZQL 1CXEA 1RURL 1EERB 4PIBA 3BAEL 4EXKA 3PRZA 3UJJL 2F74A 1ZA6B 1JTPA 3ECVA 2R4SH 4L4VE 4OCSL 3X14B 2GJ6B 4EIUA 3BPOB 3ATBA 5HDBE 3BEVB 3RWJA 4JQIL 4HPHA 1U3HB 2I7OA 3AG1B 1LL1A 4ZSOA 3MLVL 1KPRA 2F6AA 1QTSA 4NNXA 1J0JA 1RJZA 3NCJL 3OZ9L 1QEWA 2D0HA 2GSIB 4G7SB 1VPOL 2C1PA 2W9EH 3ZR6A 5E8DL 1X9QA 4N2HA 1VCBC 5E9DE 4HK0A 5EO9A 3BIKA 2DAVA 3L4ZA 3Q1SH 2P8LB 3N1MC 3FQWA 1Y7VA 4ODUA 1ORSB 3UTOA 3K91A 5D1QC 5LGHH 4K2UH 2XTJE 4X7TB 5LGJA 4LPUA 3GSOB 1S5IL 2NY6C 5KBMA 3C5JA 4ZPVA 1AHWB 1ZE3H 5HVWA 3PWNB 3Q9PA 2VDMH 4JMNA 3GPSA 4L2LA 3OKMA 5D1QA 1LO4H 4YOKA 1E4KA 2MKWA 3COOA 2R1XB 3QDJB 3N3EA 3RP1A 5C09D 1KB5A 4YK4C 3P0VL 1G7HA 5HI5D 4RDQG 5LAXB 3WKNA 3IF1A 4KROD 5KVEH 2UXGA 5I73C 5EDSA 1B9ZA 3KBHE 2YAQA 1TOXA 1FFNB 1A3ZA 1E9OA 1LMIA 1PD1A 2AXGA 3KPPB 2PW2B 4K5PA 4PD4K 4PI0A 5DEGA 2Z4TA 4ZDHA 5IB3B 2PPEA 1I9IL 3EUUA 5AVQB 1UA6L 2K70A 5LNEA 1PSKL 3BAYA 1ZT7A 4DKEH 2AQRA 4PRID 4OD3H 1NMCC 1XGTA 1N8ZA 1D5MB 1U91A 3QUMB 5CZXC 4F1SA 3QZWG 1WAAE 3MC0A 4PLJC 1N8ZB 3DVNB 3SBRA 2Y5TB 4EZLA 1QFOA 4UIMB 1J12A 3DVFA 5IM7B 2XN0A 3JWDL 4JY5H 4K5LA 4JFHE 3LQAH 4AGNA 2FGWL 1TJXA 3QJSB 4FQHB 2Q3XA 1MRCH 4GXUM 4NFCA 3NCFB 1NL0H 1BD2A 5AW1B 2VXVH 3QI9B 3V5DB 5I5IA 4IRZA 3KLLA 2W07A 2ITDB 4N2LA 2X4TA 3P4LA 4FQCH 4L4VB 3MODL 5D1QB 3VCLB 3ESMA 4U7SA 1OO2A 1TIUA 1S5HA 4H7VA 1FZKA 3B9KD 1BMWA 4TVPH 1CG9A 2BNUB 5GGQH 3MLXH 4XPHH 4OZIA 2YRLA 3B6SA 4K73A 5F44A 1FORL 4JO1H 2P42B 3CXHJ 4PLJD 4PS4H 2N1TE 3OKDA 2CDFB 3ULAB 4Y1SA 4YBLB 3HUJA 4MDRA 2H0EA 3T3MB 1DEEB 5HDWA 4WV1B 2DLFH 2E46A 3TO4C 1UT9A 3NFSH 1JFQL 1RUQH 2YFOA 4MS8D 5KSBA 4O9HL 4MASA 3VJ6B 2JQMA 2YGOA 3ET9F 4RWHA 4OBRA 3RVXC 3QG7H 4WW1B 3STLA 4F7EA 1JL8A 1N59B 2H0PA 3QUMA 3ZT6A 3HE6D 2CXKA 2FATL 1C8QA 1KTRL 1A7OH 4NKDB 1ECYA 2G3ZA 1IAMA 3QIUB 5EU4B 2ZYRA 4ABVA 1MVUA 4UZGA 3NSDA 1D3CA 1AYOA 5IBLD 4N2CA 3SY6A 3FULA 2YAPA 1E27A 3LCYA 1CICD 3QNYA 5KG9A 3P4NA 2NSXA 3U6RA 1PY4A 4ZUTA 3ZYIA 2J8UB 3VXRD 5LDUA 1SM3H 2XY1A 2BXZA 2O30A 5D4JA 3CHSA 1X5AA 4XMLH 3FH7A 3NIFE 4J6RL 4R7VA 2NW3A 5D1ZI 5MEPA 1R5VA 1FORH 4M56A 4FL4B 3RI5F 4KTDL 3WFZA 5DYOB 5ENWA 3F7KA 1KCRH 1OWWA 1YUHA 2RQEA 3WJJC 4YIQB 3VSUA 1KXTB 1AD0A 2FL5B 2EADA 2PYEA 1T1YA 1OL0A 4UZUA 4C56A 3GLDA 2AXFA 1R3JA 5BUPA 5I6XB 4PJXA 4JLRA 4ONGH 3GRGA 3MVSA 1HI6A 1G7JB 3WN5A 3T8MA 3BQVA 4CNIB 1C8PA 3RWHB 5D7KD 3WJJA 2Z7WA 4XVSH 2WXMA 2AJ3A 2AJVL 3PL6C 1L3NA 1ZTXL 3A4EA 4Y2LA 5GRWA 1KLFA 2FX9H 2PPFA 4N26A 4GXVH 3SY0B 3T0XA 1ADQH 3TFKC 5GS1A 4UQCA 1IGIL 5FA3A 4YSTA 1UEYA 5FO2A 3TBCA 4ODXB 1JAEA 1E27B 3UTQA 3HLAB 4ENEC 3UYRL 3ARZA 4XRCA 3I6GA 4HUVA 1I8LA 1NBQA 3UZEA 4N8CH 1GHFL 4LVOB 4TSCL 2OL3A 5EZLA 3B1UA 4YC2B 4OKVB 1DE4A 2EDNA 4APQA 1ANUA 5EEYA 1ZPUA 4BGLA 1PZ5B 4Q9BA 2C3WA 2HUEA 3SE8L 3KLAA 5ACLA 3QGVA 1TKWA 4OF0A 4GO9A 3WOVA 5E9NA 3Q2LA 5F71A 4PJGE 3RL1B 2Q76B 5LXVA 2WY3B 3ZKQD 4NQXA 3OLGA 1MJUH 4JLRB 1KBVA 1HYSC 4FA6A 5ICXB 2EIJB 4ELKA 1RIUL 4ELMF 1NFDB 3L1OH 3QO1A 4W4NA 4WKXA 2OMWB 5IJVA 1DO6A 4P07A 4M3HA 4BQBA 4HEME 4HZAA 2IBZX 1S7UA 1PX3A 2JE8A 4JQVC 1EJOH 1X5LA 3ARED 1HTYA 2P5WE 4U3SB 1QUPA 4ACPA 4P2QB 1LP9A 2AQPA 1DQLH 2JSFA 3O2VH 3FB8B 3AUWB 2ALAA 2P4AB 3HVNA 1UXSB 3CFCL 3DOHA 5EU7C 4UBDD 4LEXL 1I7UB 1KGCD 3HAEB 5FYKL 3VI3A 2B7DT 4UM9D 4DETA 2OZ4A 2HN7B 3IJEB 4YGVA 4ZUVB 3NJKA 2QV4A 4R4ND 5DC9B 3V4PL 4O58H 2VLMD 3PWJA 5A43C 2AQTA 2F7RA 2PCXA 3VXRA 4K8RL 4DN4L 3WN6A 4FG4A 1IGJA 3C6LD 3R8BB 2FD6L 1OAUL 4IIQB 2OMZB 5BQ7A 4YS4A 4L29A 3TV3L 2XZQH 2EO1A 3QWRA 1JPSL 4IIQC 5C08A 4MD5A 3JWOC 4M48L 1IB5A 3B9KB 3H9ZA 5B8CA 5B4MD 4S0HA 3L8QA 4UB0L 3S5LB 1JRHH 3WFBL 1UD6A 4EXPX 3FBQA 4HCFA 3HHSA 2B1OA 2D3VA 3EF4A 5T1MA 3BP4B 5GQBA 1T22B 3GSQA 2XZCH 4PV8B 4ZMVA 4Q89A 4HSQA 3ZIMA 1CGSH 1OT2A 2WWNA 3VACA 5F1IB 1TQTA 5D70L 4A6YH 1DANU 1R3LA 4BCXA 1JVOA 3DIFA 4WJ5B 4PGJA 2A83A 1XGYH 5J89A 3JBG7 3BQUA 3L5XL 4EZMA 2DQIL 4B97A 1BZDA 3F64A 3OMNB 4X8XA 1I3GH 2WLYA 3BN9D 5D8JH 1P7QB 4LPCA 3ABGA 1WC7B 2BSED 1GVIA 3PNRB 3RKDC 3RFZC 1HINL 3GLEA 1ACYH 4R4FH 4HH9B 3VSTA 4F8LA 3HB3B 1G0XA 2AEQL 1W80A 4J12A 4M29A 4L4TA 4FZEH 1HVXA 3LX9A 4HMEA 4OLYH 1UCTA 5F97E 5FC9A 1RK7A 3TPUA 5IFAH 3E6FB 3IJYA 2VJ0A 4JZNB 5KVGL 4OIIL 5GISH 3DVNA 3T3MF 2JIXB 4JG1L 1JPEA 1KCUL 4NO0A 5F8QC 2YAMA 5F70A 5JPMA 5F96L 2LABA 2OFQA 1SUJA 4KZDH 5F72S 4KVPA 1Z0NA 4P06A 2WWOA 3LD8C 4IMLA 3NJMA 1JV2A 2OYKA 3WD5L 4Y89A 3IFPB 4YLBA 3QWRD 4IMLB 5HBBA 3K7UA 5D1XE 2PNDA 3GPEA 4PHXA 2BHZA 5IVXE 5TGBB 4TMPA 4LSTL 3SDXE 4HKJB 1NC4B 4BHUA 4AENA 1FFPB 1M05B 1BSIA 4JG1H 2X1OA 5DFTA 2OMBA 3FO2B 1ILUA 1T7XA 3OKDB 4N2MA 3SYCA 1G87A 3DTUB 2IDUA 4JVPA 2I5YH 5KAQF 1P84J 3WLWD 3T4YA 5JW3L 2NYZA 2GJ6E 1G7IB 3F00A 1A7QH 3NFNB 3AB0C 1KZQA 2R27A 4HS6A 3UZQB 3WFCL 2XWTA 1QFPA 2YARA 4G1EA 3DRTB 3RTQD 5BW7A 5DJ0A 3APMA 2DKSA 4U3HA 5D8JL 4YXHL 4PRAB 2DN7A 4YNYB 1XF2A 5EUKB 4EBQL 2PUQT 4L4TD 2Q7YB 4NGHH 4U2YA 5DR5L 1NKGA 1BXVA 4OBSA 4Y4KB 1CS6A 1P2CB 3ZVVA 4HV8A 3WG7B 1IC7L 4IGBB 2EVJA 2YSTA 1RVFL 3CPUA 2Y7OA 5JPMB 5JHAA 4N20A 3JV6A 1E90A 4U33A 4DF9A 4GT0A 3VFRA 4YDJA 4JUTA 3W0WE 1YEHH 3ZKXC 3SPVB 2FNWA 3QPXL 3Q1EA 4G82A 4XMXA 3A24A 3F65A 1INQB 1DSYA 4KV5F 1YMHA 2QSCH 3NG5A 1IFGA 2CO1A 7FABL 4HWBA 5F6IC 3LIZL 3QCUH 4FI6A 4YQXL 1DDTA 3BGMB 3ZUNC 4FXTA 1K8DA 5IFJA 5ESAA 4S2SA 4AZUA 1I3RA 5IQ9A 1OXYA 1TCRB 4D94A 1TTCA 4OCYH 4MAYB 2VAJA 4XNZC 1WAEA 1J8RA 3W39B 5FLVA 3AREB 3L81A 4R5XA 3JVFC 5C3LD 1I1AC 4AJWA 1LYQA 3RE0A 1SJVA 3X1BA 3MV7E 3UPRB 2DLIA 1NSNL 1XSJA 4YBLC 3PL6D 3BH8B 3CMOL 2AJ3B 4ZNEE 2CGZA 5HDBB 3G6JF 4CU8A 1AZRA 1OAZL 2OM5A 4XVSL 4ZW6A 1FPTL 1IAKB 5H4YA 5F9OL 5JIIA 2LT9A 1P6FA 1QYGL 3UTSE 3PHOB 2EXSA 3D3VD 1PAMA 5AFAA 1MQKH 1T6WA 4W93A 1MWAA 4QHKJ 3ZJAA 4XP6H 4MFHA 2FWUA 1G7LA 4K7PY 1OAYH 4GXUN 1W72L 5E9AA 5I1KL 1AQKL 4MMXA 1PX4A 3S4SB 1LWRA 1YQVL 2WNWA 1Q4NX 4YFDB 1OQOA 3BE1H 5IHUH 4G7YH 1OV8A 3DOIA 4XN5A 1VZIA 2VDQL 4AGPA 2G75A 5IIEA 1IIIA 2QPFA 2XXCB 3DUHA 4MQSB 5DURB 3VH8G 3S2CA 4UQ2B 4O2CA 2YAHA 3P4NB 4XP1L 2FJGA 4L8BB 2AK4A 3DGGA 4UQ2A 1U95B 2NXZC 3FS9A 3GZOA 5F3BA 2WB7A 2VLME 4LRNH 4TSCH 2OV0A 4N8CL 3WTXA 1JYXA 5IBUG 4MCNA 1SFHA 2DQGH 1K3ZA 1BBDL 2HT2D 5DC2A 2HX8A 3KPMA 2AJUH 5HPOA 2GW5A 1MSPA 4E9WA 4ANVA 2NY7L 1WRFA 3SCMD 1N7ML 3ASWA 3FOMA 2BVQA 3HIZA 1D5IL 2YA2A 4AH2A 3A23A 4TQPA 3HMWH 3PWUA 3KBPA 2G4GA 1YC8A 4ODVL 2BMKB 3PFQA 4KFMA 3QDAA 1YEEH 3X3FL 4PU2A 4QXUL 1P7BA 3QNZA 5D1ZD 4BZ1L 1I1FA 3RIKA 2R29A 4M62H 3SO3C 4NRYA 3RGVB 2OK0H 3B7UX 4PJIB 4PRBA 1AJ7H 4GAGH 5E4EC 1EEUA 4OLUL 3S34H 2CPUA 2EH8H 4YSEA 1O7DC 2P80A 4TNWK 4P3CL 1LILA 3GS4A 4QGYA 1QBAA 3ARPA 2V8LA 4R0LB 2EUWA 2DYPA 2YQ3A 2EQDA 4UDUB 5HDQH 4QRRE 3HR6A 5A7EA 3LH9A 2X0WA 1GCFA 4NQVB 5EORL 5T1LB 5DJ6A 3GBMH 4FX5A 3ZYJA 2I60L 2WSPA 4DVBA 4X4ZA 1T0PB 1U21A 4PJ7B 5DJDA 3TWYA 1J05B 5E6RB 3LRLA 5JIMA 2VISB 4ZUWA 4HIHB 4JY6B 2OZNA 2IADB 1MCPH 2EC9T 2VR5A 4X9GA 4LMQE 3KPOB 2BRRL 1YY8B 1BEYL 3FHQA 3O6LH 3WNKA 5M95B 2WNXA 3EG9B 4ZDHB 5I6LA 3S96A 2F7PA 4RBPH 2RIKA 3SO5A 4PG2C 4NRYB 4NERA 1EJ8A 4I0CC 3NFSL 4XI5C 4R8WL 2O6FA 1CYGA 4P46D 5D6CA 5AB1A 1AC6A 3GEFA 4I3SH 3T8VA 3T0EE 1IC1A 4OZHB 1EHNA 3DOSB 43C9A 2AP2A 1PG7W 4JQIA 3T6WA 5HI3D 1QNIA 2NY6D 3SPJA 2V2TA 4F33A 2VUOA 2YZ8A 2Y0SA 4HJ0C 4ZFGH 2J1XA 1BVKA 5CUSL 3WLBA 3IFNL 4QRRA 3QHZL 1ZLVH 2YJLA 1UM4H 1SOKA 2AXHA 3DYOA 4Y16C 3WFEL 1SMOA 4AT6B 5AAMC 3KGUA 3NEXA 1DCLA 2H9GA 3C8KB 3W0WD 5B8CC 3PAUA 3OQ3B 4AVJA 4J8RA 4BBWA 1SEBB 1L9OA 1TUPA 3LNFA 2WW8A 3B9KA 3DX7B 5A1AA 3OKKB 1IGTB 3ZL4L 2FB4H 3NJJA 4K5OA 5CN1A 3NIDE 4YHOH 1R3KB 1UKQA 3E1ZA 5FFOA 2LLNA 5FIEA 1JHKH 3GQFA 2MSPA 4BE5A 3SOBH 3HI5L 5CSBA 2VMFA 5FF6B 5C0AE 3AGWA 2ARWA 3D30A 4YH6A 3TBSA 2EH7H 3BFQG 4DCQB 1EXGA 3RJDA 4ZT1A 4IBVA 3TPUB 2Y6SC 3QC6X 5SX4I 3IN0A 4XPFL 3SQBA 4ZG1A 1C12B 1NMBL 2CU9A 1BFOB 1BQKA 5F7EH 1Z7JA 2BHUA 5CLYA 3CZUB 5KSAB 5AW8B 3GTNA 1J5IA 1PZDA 4XWGH 4BUQA 3ZZSA 2V2TB 2A9AA 3KM1A 4M93B 4XNQA 3F04A 5KSAA 1YMMA 1QKZL 5C2UB 3U1SL 1L9QA 4M1GL 2KQNA 1K6QL 5HGGS 3L3DB 1YN7B 2ATPA 2R0KL 1EJFA 2G3NA 4OLZL 3S48A 1BAFL 4YXLH 4K2UL 4CILA 4DGVH 2NY5C 1K4DA 2HFGH 3ILPA 4QRFA 3SKOB 2VITA 4K71B 3KPTA 2XKSA 4EOWL 3S3BB 1A3LL 4LAQL 3Q1SL 4ZQKB 4IRZL 4JR9L 2VH5H 3QDJD 4ORGB 2VDKH 3FQUB 3LD8B 4FTDA 3KPSD 3ULVF 3UGUA 4EZKA 2AI0L 5BRZB 4W6XB 2R8SH 4YHOL 3VFWA 3OKKA 5AG9A 3TO4B 1EANA 1EA9C 1G7QB 1FAKT 5E51A 3P73B 3O6FD 1U8QA 3MLVH 1FVCB 2AERT 1UA3A 2NW2B 1UXWB 1ZPLA 2CNYA 4FD0A 5DRZA 4BZ2A 3AXLA 3QR1A 5CU9A 1QHQA 4O5LL 2AJZA 2BP5M 1GS6X 4FXKA 5A16A 1NFAA 1M2OA 1XAUA 5IW1B 4IBZA 2B9BA 4LGSB 1O7SA 3KWWB 4BFRA 3V6ZA 3UTTE 2NNXA 3RRQA 1L6XA 4DZ8A 1F4XH 4L8CB 4GFXA 1BLNA 1I1AB 4YNYA 4NNPL 3QNXA 1TSHA 4XPBL 3TBTB 4QXGH 3QORC 2AI0H 2B3IA 3BYYA 4EUPB 3L3DA 3UPCA 1N64L 4YO0A 4J4PA 3PAVA 3INOA 3T4AC 3B3IA 1G9NL 2PXYD 2D7MA 1QSED 1RZIB 4EOWH 5I15H 2W65A 3GSUA 4LVEA 5F7EL 2HFGL 4BWUA 3VDCA 5DYFA 2IG2L 2KERA 3FQNB 4PP1C 2EE6A 2XG5A 4UOZA 5C71A 1HXMA 3VWKD 1K6QH 4OI9A 2EZ0C 1QG3A 3MGTB 3KWVA 1Y6NR 1KV7A 3C6EA 1FL3A 2DMGA 3CLEL 3DX8A 3RDTC 4LAJH 4HUUB 1QLFA 2XV6B 4X42A 2IBBA 4ATTA 2X70A 1AO7D 4PI2A 4C4BA 2HFEA 3T0ED 4N5EC 1PLAA 2ZUXA 4KX7A 3B9VA 3HC2A 4KRPB 4WAFA 4HJSA 1CR9H 1KXHA 3WUZA 5IROD 2A73B 2F54D 4F3FA 4K7PX 3ARBA 1NCWH 3JT2A 2CBOA 2XBDA 5KYYA 5LQBH 5KS9B 4OM0H 3DXAD 3QUXD 1YHPA 4M3KB 4JFEB 3R8QA 5B1CA 1JCVA 1ZV9A 2K6YA 4HJUA 4ZNCD 3D39D 3NJVA 4GG8B 4NC0B 3FQRA 3SDYH 2JCCE 3QISA 4ZFQA 2D3LA 4ODXA 2JNZA 1AGDA 2DIEA 4OIFA 4Z78B 4R4BA 3SYPA 3ARWA 1QI3A 5CUSH 2V5SA 1HXYB 4MSWB 3GKWH 5HVGB 5C92A 4WI0A 4V11A 4ZMXA 1LHZA 1MLBA 4U6XB 4HDIB 5EN2B 3ZDWA 4WU5A 1WIOA 3V4PB 4NZTL 2J6WA 3N40F 1RUKL 5FLUA 4R5VA 1EFXB 3NABL 4FTVD 1MFBL 4Q6IA 2ZUTA 5FDWB 4JRXE 2DM7A 1CFBA 1OLZA 3PAYA 1X5XA 1GL4B 1D5IH 3Q2WA 4W9KC 1N0LA 5CINH 1Z5LB 1A6AB 2W9DH 1CQYA 4U1KB 4ZAKA 3ARDD 2FT7A 3OVUB 2Q20A 4L48A 4GKNA 1A7RL 5I1CL 1BOYA 1C5BL 2NUPB 3VWKA 4FNLL 4I3SL 2Z6FA 1CGTA 4M9PA 4PJDB 3LPPA 4EI5A 2P5EA 1TO5A 3L5WA 2FECL 4PTUA 2FATH 5I8EA 3VYOA 3MYJB 2A5UA 2VISA 3N06B 4NWTL 3PIQB 3SYOA 5KS9A 1P4BH 4XMWA 1MAMH 3PS6A 1NUDA 1X5MA 3LQAC 4HOWA 1HWHB 1AGFB 3EO0B 1TZOA 4QKXB 1QPXA 4UQDA 5D7LB 2YGVA 2FJHA 4LESA 3TIDA 1LO2H 3UAFA 1LDPL 4ONFH 4Y9FA 3EIFA 1S9KC 1URIA 2R39A 4G8EA 1G1CA 2NY4B 3ELQA 2VM9A 3PV7A 1GR7A 4WI7A 2XTSA 5FYLL 4WW2C 4HOZA 2ENQA 3H9HB 1AQKH 3BW9B 4XHJC 3IJEA 4YGVB 1G9EA 3DMMD 4K7FB 1R4XA 4KXZI 4MNGA 1Q0XH 2AAVA 4CSSA 4PJIA 5BOJA 1EFXA 3HJ0A 4JFZL 5GSVB 2C4FU 3BSZA 4HDIA 5IBLC 1X9LA 3MODH 4FFTA 4X4KA 4LASL 2JTDA 1T20B 3ZDYF 1BZEA 3O6FC 1DZ0A 1PVHA 2PO6C 4WDIA 1WEJL 1ZIAA 5DVMA 4H0GA 1RMFH 4HP5A 2VXTH 2B20A 4P46C 2O6PA 4QHMA 1WIPA 4PJEA 2HP4A 4OFPA 4F92B 3TNNA 4PJHB 4JFPA 4KO5A 2XWCA 1CLOL 2YMOA 4U1JA 1BQRA 4EPSA 2AK1L 3CSBA 2W0FA 4C55A 1R5IA 2EINB 2RALA 3KL3A 1NEZB 1ZHNB 5I74B 3K71B 3KPSE 1YUKB 4NO5B 4X83A 4O2EA 1GGCL 2QQKL 3U9UB 5DEFA 4MA3A 3D05A 2DM3A 1FF5A 1O7VA 4NOBA 5J6GA 4MYWB 2VLRE 1AGFA 3EO0A 1M2VB 1NGWB 2WO4A 2VN7A 3CC5A 3GMQB 4JG0L 3WNJA 4R7LA 1KGWA 5FYLE 3VGBA 3TBWA 1NCNA 4WHDA 4N0RA 3VFPA 1ZLWH 3RWIA 2P24B 2Z91B 1JXGA 4HCIA 5T3XH 2I07B 3AROA 4TSBH 4PG2A 4BFEA 2JB6A 1WDAA 2X4SA 2ZKHL 2NUTA 1ED3A 4XCEA 1LDPH 2I07A 5DHEA 1UJ3B 5FA4B 1LO2L 4YXKH 3VWJA 3WDHA 4BZ2H 1OAYL 4KQ4L 2G3XA 3EYUH 5IB3A 1UOVA 3HMXH 4WI5A 1ZEAL 2VDRB 3PV6A 3DMMA 4X5XA 4ETYA 3HRZB 1FG9C 1OB0A 4YDKL 3ATAA 5F7WC 2R2HB 5SV3A 2ESVB 2YWZA 4G42B 1OAJA 2OR8A 3EW3B 4Y0GA 3WGUB 4CN4A 2P52A 4H8WL 2I26N 1OAZH 3IXTA 4HAFA 4P46B 4XCYA 4YZFF 3SGEI 3J27A 1NEZA 4G8FA 4E42A 2KS0A 2KH2B 2AGJH 4GI8A 4YLQT 3AMKA 4W9HC 5T3ZE 5D5MF 5SWSE 3KYAA 1NGXA 5D7KE 1ZDQA 2PO6D 2XBTA 4RMQA 1S7RA 4QJ5B 5F1SA 5I1GL 3IMBA 2YKKA 5JA9A 4MAYA 4POZC 15C8L 3QQ3B 4MDIA 4FFYL 5GZOA 3BGMA 5IFJB 1ZA3A 1KG0A 1HEJC 4Z3EA 2Y1AA 3RJOA 2MRYA 4YR6B 1BZ7B 3EHBD 4OJAA 4M5ZL 4N8VB 5HYJB 1HNYA 1ZJAA 3GSXB 4AYDC 4PJAA 5JOFA 1E42A 4Z3GA 5GZOC 3KWWA 1M05A 3VGDA 3VE0A 3OHXA 4M4RA 3RUGF 1YAIA 1QFWL 3D39E 1MCCA 3KWUA 4KOCA 1CLZH 3RB7A 1C5DB 1OCOB 1G1YA 3LIZH 4X6BA 5JHBA 4NS0A 1AHMA 3DNKA 4FYTA 4PJIE 1MLCA 2HB0A 5D1XC 1WGVA 2H6OA 2WXNA 3HG5A 1XB3A 2DQDL 4N90E 4Q2ZA 4Y4KA 4HC1H 4TRPH 2HJLB 2M1KA 1PDKA 3PWPA 2PPDA 3BSGA 3QQXA 5JIKA 3UL4A 2ZPKL 3KG5A 4R90L 2X6AA 4XCYB 3H7BB 5DZLA 3GJFK 3EH2A 4UINH 4OGXL 3L3IB 3SYQA 4F7CB 4BGDA 2WYTA 4R96A 2OL3H 5FGBC 4WV1C 4XVOA 4S1RH 4YHLL 1E4WH 3UIZA 1NGQH 3IAGC 1XL4A 4NN7B 4EBQH 3TEXA 4MHHI 1XGYL 1F02I 1MY5A 2P80D 3QFDA 3IFOB 2X28A 4L9LB 1OP3H 2WPGA 4FQ2H 5FGBA 5GZND 3RUGE 1UWYA 5HYSG 4PS7A 1G9MC 4JFSA 3SPHA 1A5FH 3N1QC 1A1MA 5HGBB 1D5ZA 2DLHA 1EO5A 3WIIH 1YLBB 1SXNA 5EBGA 2ZAIA 4WTZG 3I3BA 2BVQB 1LDSA 4FXKC 3HC4L 4OI8A 2WKOA 3DURA 4JRXA 2OZ4L 1U8QB 5D9SA 1WFJA 1SDAB 1R9FA 3RUGA 4BM7A 1FJ1B 2IPUK 3MKKA 4LCVA 5KSVA 3GSWA 5E94A 1U3ZA 1BVOA 1C5DA 4H88L 4PJDF 3TBVB 4G9FD 4Z18A 4H25A 2BZCA 2ICWB 4NUJB 3EGDB 2P5PA 3RX9A 3L3JA 3CNKA 3WL9B 5CWSB 2EC9U 2H6PB 4PJCE 4BXSV 1B9KA 5DJ2B 5IJBC 1PGRB 5FM5M 3VXTB 2AJSH 2B14A 3QIUC 3WNIA 5ICZA 4O4YH 5FKAA 2ZKYA 2UZYA 2ADGA 2GPZA 2AQSA 4HUXB 4KH9A 4L4JA 4OLYL 1CXIA 3ARFC 3WIIL 1QD0A 2ADIB 2IQ9L 3OMAB 5FHBL 4LEOA 4OD2B 4HUWA 4CC4C 1WZAA 5FUOH 3L54A 2HLFD 1NH6A 4BFGA 3ZE2B 1ZVHA 2E76C 1M42A 1NBYB 4KI1A 1MREL 3HC3H 1R3JB 1EHKB 4F2EA 1YEDB 4I87A 5AVWB 1ZCRA 1CFQB 2FWOB 1XGRA 5FKPB 3TA3B 2Y07H 4OCWL 1QVOA 2D4FA 2OL3L 4EQ3A 3BC9A 5HXMA 3EUDA 1B0IA 1TDQA 2EDOA 2ZX7A 2FDBP 4PFEA 2BSRA 5F1IA 4N2OA 5BOZG 3WNPA 3FTZA 3E3QE 3KPMB 4FABH 3WS3A 4GPVA 2UY7A 4P5RA 1DJWA 1PAZA 4S10A 4FMVA 4W4OA 1IGYA 2Z64C 5DD1H 3V79C 3K6FA 4HFUH 5JUEL 3L5XH 2WKGA 3BPOC 2HKFL 4FI7A 2VR6A 4HSCX 4FA7B 3H2QA 5E24E 2WBJD 1TZIA 5JDJA 4DPBX 2YD3A 3FN0L 3BW9A 1CBJA 3TT1H 1XZWA 4GI9A 1CLZL 5F1OB 3ULUD 5DZVA 4GAJH 4Z7QB 5I2IB 1XH3B 1G0DA 3HI5H 5CAYB 2R29L 2K7PA 4I18C 4P59H 3VFNA 2FK9A 3FUFA 3OKNA 1CE1H 4KDTC 5DWUH 3H8NA 3QDME 2LU3A 1S8DA 2IV9A 4MNHA 3O4LD 5E2WL 5HY9B 5IG7B 4M8VA 3S88H 4QOKA 1TZ8A 4BCZA 1DQLL 3EHBC 1H5BC 1UOKA 2ZAGA 4AG4L 4LL4A 4PY8J 4TQ8A 3V4PA 4IEFB 3HS8A 5JHDE 2G3MA 4A6YB 2EABA 1FC2D 1R3IL 4AK1A 4G8IB 4G1MB 4LSDA 4CRPA 3Q2VA 1XGRB 5FKPA 3HN3A 1H0DB 3IPBA 4PH8A 3AS0A 3TA3A 1WS7A 3WIAA 4ZAKB 2RB8A 1E8WA 3ZDYE 3NSYA 1UVQB 3PWVB 2GSGB 1OP4A 2DJMA 4ZFGL 4KKQA 2F5BH 1HX0A 1NMAL 4YWGL 3WIFB 2ZYIA 1YY9D 3M45A 2P5WD 3OKOA 1VFMA 2FJSA 4CBPA 3QRFM 3RL2A 5E1AB 2F53E 4W9GC 4ZTOH 3TWCH 1IM9A 1Y07A 3SE8H 1AFVH 3RFZB 1HS6A 3ROOB 3RTQC 1AS7A 3FHEA 4M93C 4YZWA 5I8CB 1IEBB 1NLBL 3UERA 2CE6A 1FNAA 4F57H 3L2MA 1PG7X 1KLGB 1U8KA 1CD1B 2WWKO 3KNBA 2KLSA 3DI3B 4Z7UA 3OZLA 1SYVB 1E3FA 1TJIL 4P23B 2AKRA 3GHEL 5E70A 5ECJE 4PLNC 2HG0A 2FLMA 3HBPA 4S1DC 1ZLUK 3O6FA 2VIRA 4H44C 4K71C 3C60D 1R17A 5KW9L 5FXCH 4CVZB 5GRJH 1SEBA 4H0IA 3GXMA 1CL7H 3G08B 1FO0H 4FGMA 1FNEA 1S2EA 2DL2A 3HAEH 3D0LB 4JHAH 5AD0A 2P3YA 2GSGA 1MFNA 4Y2DC 1YG9A 2IDTA 3ELAT 1IJ9A 2G2NA 3L17A 5C0JB 4YFLF 4YSDA 2EDWA 2IFFL 1T1WB 1TJHL 4M3JA 5HJ3A 4FZ8H 1U33A 4UILL 3KYNA 1N5AA 1KIPA 5JPNC 5BV7B 5DJXA 2JKRM 1QSFA 5EULV 4JHAL 2BNQD 2ZKMX 3AY2A 4JFZH 2R56L 1ETJA 3CGTA 3EJCA 1A4AA 2G5RA 2IFFH 2VT0A 4ZUUA 5H4ZA 2B3RA 1T83A 2FIKB 3VFGL 1CPUA 5JPNA 3UMNA 4AYMC 2BOBA 1JXDA 4UT9H 2YHGA 3R7RA 1OF2A 4L1SA 4L4TE 5IK3B 1B2WL 1I1YA 1WF5A 1BBDH 1ED3B 2FVNA 4JO2L 4P4KA 5B4MC 4J3UA 1KCBA 2KZ1B 5B3JF 5IMMB 3FMGL 4BDVA 4P2OD 1KDIA 3QPQD 1RUPL 3GBEA 4ALAC 1MRFL 5C9JB 1XGQB 4LPTA 1TU2B 3SKOA 2H0JA 4QRBA 5E5MB 1U3YA 1EHLL 4RCAA 1L0YA 5TF0A 3TTYA 1CGVA 2BNRE 3PFUA 4H1LG 4G11A 1FN4B 1Z9OA 4D0BB 3ESUF 3MGTA 1B2WH 1CDHA 1F41A 4LL1A 4UNIA 4P5KB 3S0PA 3QYMA 4NDMA 3OWEA 1A7RH 1JP5A 2ZX5A 5IROA 2FUQA 1INDH 2Z7UA 4L9LA 1YO4A 3JUZA 3R1GL 4YR6A 1T1WA 4XN2A 1P7KA 3CVHL 4PJEF 5I1IH 5J13B 3LKPB 3JWOL 1SJHB 5A2IH 1DDHA 2BY2A 1P0SE 3CHXA 2A6KB 1I9JH 5LN8A 1GJIA 4Y2OB 4ZUSB 1DDHB 1Z32X 5DD0H 5EMYA 4L3CA 3OSKA 4EUPA 4DKFH 3P4MA 4FZ8L 4V2BA 1UWGH 1T6VN 3ETTA 4E0RA 4NYLB 4HFWB 5ACMA 4ZZFA 5JW5B 3WEXB 1I8IA 3UIYA 3HG1B 4Z77A 4LHUB 4HA1A 3CIQA 2OSXA 1VGEL 2O5NA 2XETA 4JZOB 1SVCP 3B5HA 3L1GA 1E67A 1XHHA 1IQDB 1T89C 4Y4KC 4IKNA 1HJBC 1G9MH 1K5WA 4KV5E 5CJQH 4IIQA 1G9HA 1LP9E 4PEEA 4F8QA 3FQ4A 5JORB 2ENYA 2V3FA 4MXWL 1P4IH 2KZWA 1R3HA 4PJHE 4N2AA 1A4KB 3CVIL 3S88L 4JJOA 1HEZA 2ZF9A 1G84A 1LK2B 5F3HB 1T89A 3IDNB 3C2AL 4U31A 3FDWA 1CF1A 5LDSA 5F7FA 5EWIH 2V5TA 5IEKA 4P05A 3FSWA 4QTFA 1H8OA 5GGVH 2GJPA 4XH2B 4XAWH 4UDUA 4ZD3H 5EZLB 3HR5A 1M7DA 1SZNA 3RFRA 3S37L 2NX5A 3EYVA 3V8OA 3OGCB 1Y1DA 4P2QE 5C0BE 4GT7A 3FBKA 1WVZA 2PXYA 4J3WA 2CO6B 3NACL 3DV6A 3OWRA 4TSAL 1PMYA 2BWDA 4ZQTA 3S3SA 5TE7L 4J3OD 2WXGA 4KXBA 3EAKA 2XC8A 1JPST 4AYSA 1KYUA 4EKXA 3B4NA 1A22B 2VLJB 3VXUE 1UFUA 1OTUD 2P7TB 3D5OF 1A1NA 4HCRA 2MQCA 2B4CH 4HZLB 1WBYB 4QHLB 3FB8A 3HKZA 1NCDH 2CDGA 2DTML 2GHZA 4M6MH 5FECB 2Y6SD 4F9LA 4DKTA 2ZSWB 1WBYA 3KL0A 4QHLA 4R83A 4NRZA 2F53D 2VKWA 1AI1L 4WI0B 3WJMB 2W9EL 4XXWC 3UABA 3Q6GL 4HGWB 4DZBA 4CKQA 2PR9A 3SQRA 3AMLA 2PR4L 5LGHL 4R0LC 3WTSA 2AQQA 1QEWB 1SOSA 1TFHA 2OMTA 3FN3A 4NQCD 2GABA 2FEEI 3AS3A 2WXIA 4EUPH 5C0RL 2A0LD 1QR1A 1INEH 1CT8A 2AV7A 2E9IA 1AZUA 1KNOB 1QFUL 4YK4B 4X8JA 4HD5A 3DRQB 4I13B 2WZPD 3X11B 2HH0H 4N86A 4LCUB 1EUUA 3EYVB 4RGMC 5FHBH 2EDYA 2NX5E 2OX5B 4OAWB 5IB5A 4I1PA 4I3GA 1SRDA 2WYHA 4PN6A 3IU4L 1BQLH 4NQUA 5B39A 3MJ9L 1BQUA 1BAWA 3GXIA 4HPYL 3MFFA 5A2BA 3CN2A 3BZ4A 2LAAA 2J4WH 3UMTA 1TZGH 3THML 3ZT5A 4HQQL 2RCSH 1HHJB 1XEDA 5TFSH 3U7WL 4A7SA 4A7TA 1MI5D 4Q0XH 3TBBA 4OLZH 4JKKA 1J9CT 4ELKB 2LGNA 5FCSH 3QAQA 4JFFD 3WJMA 1WHPA 3CUPA 2HX9A 5TQ0L 3O11B 1JF5A 1BQ5A 3AZUA 4KAQH 3BN3B 3S3JA 3T8XB 1M1SA 4ZX3A 3U4EA 3QVAA 2N1KA 3WO3B 1V3KA 5E6ID 2DMCA 3MXWL 3W9EA 1X7TA 3AGVA 2IQAA 2GIYA 4PP2B 1AYRA 1B0WA 2VDPL 4MRCA 1RZFH 2Y07L 3LZRA 3S96B 2KYIA 3MBWB 2R51A 1DVTA 2FHCA 1GYUA 2KL6A 3WDIA 5KVFL 2SODB 3TOPA 2VQ1A 5IHBA 4GS7C 3VFMB 3DYPA 1AHWC 2IBGA 1DYZA 4BFIA 2NPLX 2YIHA 3BIAX 4GUPA 4R26L 4FLHA 2X1XR 4OR1A 1T5XA 1JK9B 2DQ6A 1B0RB 2FB4L 4WFFE 1RUML 2YLKA 4G6AC 4LLQB 3AC0A 1H5BA 2VMEA 2J8UA 1ASOA 1I8KB 3ULVE 4A7VA 5T1DH 3GSNH 5ALBH 5DEFB 1GH7A 1F3JB 3T3ME 5C0DB 4MWFA 2DLEA 4FYSA 2F68X 4JFOA 5EBWA 5C0CA 4L0YA 2ZUUA 4NHUA 1AD9B 4P48A 5K69A 4MX7A 4BCYA 4HPOL 4L0PB 4I77H 1PCSA 5LGYA 3ZRFC 1IFHH 1MHPH 2J8OA 2YN5A 5JO5A 3C8DA 1T0NA 5CJ8A 1QUNB 3GZKA 3HNSL 1EZSA 1KN2H 1XTLA 1HQRA 4RX4D 4HEPG 4XTRC 3BKML 2BCMA 3LS4L 3UAJA 3WXWL 3GRWH 4PRAA 4W1TA 3LQZB 1G7HB 3DHJA 1JSYA 3PAZA 4YDVA 3BKYH 5IVXF 1L9SA 4RZKA 2FWSA 4XMKH 1J0YA 2X1WL 3QWNA 1YNTB 5I1GH 2IPKB 4M8QA 4J1UA 5C0BD 2GBUA 2A9NL 4PJGB 1IBYA 3QJVB 3FO0H 1PDKB 1G6RL 3MAWA 5GGSB 4A04A 4M6NH 3KPQB 4P5SA 4RDQF 3RZCB 5DRWB 2W65B 2E6JA 2DQTL 4LB8A 2GITA 1Q94B 3GT6A 3MUHL 4K07A 2CMRL 4NO2B 4OKVA 3FOLA 3L5HA 1TYJA 4PRIA 4TL5A 3VFRB 1WFMA 4JFHD 4MJ4A 5B3JE 1MDTA 1G6RB 1U42A 2BOCB 4E9SA 1PJ9A 1J9SA 1E43A 2EIBA 4MMZA 4AY0A 1HSBB 4GW5B 4L8BA 4IGBA 3CE1A 4U1MB 1YEFL 3VI4B 1R46A 2O72A 4G6KH 3BO8B 2DMKA 5KWYC 5DSCA 3VI4A 1W0VB 2VC2B 3GB7A 1GW0A 5BVPH 2G9KA 5AEAA 2L8AA 2QZ5A 1JGLL 1GGCH 2UYLB 4PW9A 4JAMB 1QFWH 5C8JB 1BMGA 1SOXA 4G9DA 4N2DA 4PWFA 3UTSB 1UT1A 1E4HA 4TQEL 4ZXBC 3FPXA 4Q56A 4D3CL 3U30C 3QUHA 2CPCA 4WO0A 3LZFH 2VDNH 1FC1A 1BCIA 5JOEA 2FIKA 3D2UD 2ZXEB 5BZZA 4HLZH 3HJEA 1AD0B 4FADA 1ZT1A 3LMJL 3BH9B 4ZX5A 3QQDA 4JHZA 2DQHL 4M6OH 4E0RB 4C47A 4Y19D 1TQUA 2AJVH 2X6UA 4U1GB 2B9AA 4KMTL 2VSMB 3GMRB 5DEZA 1R33A 2A6JA 4KNTA 4E9LA 3JV4B 3MGOA 4PRHA 4Y2NA 4ANXA 3P3YA 1ZWIB 5CCGE 4NM8L 4WTXA 3UZEC 1JNJA 2VDNL 2JKSA 2QFRA 3QUGA 4UQ3B 4AL8L 3VFSA 4KGJA 3PXJA 1X44A 1TG8A 5HI4D 1ZLUH 3TH3T 3UXFA 3QEHB 4JN1L 5L9DH 5DI8A 3HG3A 2FR4A 3UTTD 2YD2A 4PG9A 2APFA 1NBZA 3OR7B 2WD0A 3O2DH 3MV11 3BSZH 4W9IC 4H26A 5ESQB 2WB1A 4K9EC 4QOKE 5CR1A 4KTEL 2WM0A 4L8DB 4ZPTA 3WI9A 2EEDA 3D48R 4DP6X 4H26B 5ESQA 4DOHE 1GC1C 1MXDA 4L23A 5GS2H 3DA0A 3VFWB 2UYLA 4NNYA 3I6SA 4KJYA 2J8UF 5FYLH 5I18L 2PPCA 3RVUD 3ZYOA 3OAUH 3KPRB 1YQVH 4I0PA 5EO1B 4MD0A 3DVIA 4NUGL 1A7OL 1XR9B 1CBVL 5I0WA 4GJTB 5L8JB 2R15A 1IGFH 4EDWL 1F4WH 2APWA 1G0YR 3RAJL 3BT2H 5C0EB 1OANA 1BM3L 1I7UA 3FRPG 4N8VG 3NRPA 3V6OE 1PCXA 2JKIS 3I74A 2ZG1A 1QI5A 2F53B 5E6UB 1QYGH 2PYED 5MHSD 1JFQH 4Y2OA 5C0AA 5DHXB 1QBBA 3CFTA 2Y2WA 4A68A 1FPTH 1VFUA 5E4EB 4CMHB 3NIDB 1OCZB 2WUCL 3CMGA 3FONB 3CFKA 4Y19A 4KTGA 3RA7L 1CFSB 1DVYA 2VXQA 2DQHH 4F2MA 4AMWA 4RNRA 1DBJH 2QGBA 5IVXA 2UVEA 1ZLWK 1BVKB 3MNVA 3LKQA 3VXPB 4IJTA 1AXTH 3VH8A 3JTSA 3DLQR 4HHWA 1UC6A 2XFXB 1Q9WA 3B37A 3BEVA 5IQNA 1SLVA 1XWVA 4K3GA 2Q2EB 3U2SB 3BP6A 3HMXA 2WQAA 4KKRA 3HHSB 3O2WH 2C8NA 3IMWA 2X9ZA 5KVFE 4RSYA 2QL1A 1Q0XL 1AO7E 3R06B 4EAEA 2Q3ZA 3MOBL 3VDAA 1ZXQA 3QFJB 4NQDB 1AP2B 3TVMC 1LEGA 3V0WL 1A9EA 2XTJC 1MVYA 3ALXA 3EF7A 4L8SC 4FQ1H 2I32A 3DJRA 4X4XA 2P5EB 4DWHA 1PIGA 3VD1A 2Y36L 4ZW3A 2A9BA 2G5UA 5IMOA 4AIZB 3KJ6H 1QBLH 3RFZA 3EYQC 4L4TB 5DQJB 1WZ1H 2BDNL 4GQZA 3L2NA 5E1AA 4GKOA 4WU7B 3GSRB 1E5AA 5HDOA 4FXGB 1H15B 3X13B 1FRGL 2ZNXA 2ZSWA 1ML0A 3BZFA 3OJDA 2BNQA 2EDXA 4OFDA 1UD3A 1NFIA 1RL1A 1Q9WB 1JGDB 3IXAA 4X6CA 1G9NH 3TIEA 1A7QL 1NGYA 3IMVA 4G42A 4J3OG 4FDWA 3CHPA 2BLFA 4GKNB 3MRFB 4IBQA 5C0IA 2C1PB 3MFGB 3SDCD 4AKQA 1EMTL 4W6WB 4I0KA 4PJAE 1BD2D 1GIGL 5F9WC 3IAPA 3MRFA 3UBXB 4LLDB 1NEUA 2N4IA 2VXQH 4N4YB 1ERNA 3LN5B 1FZKB 3RY4A 3VFNB 3NP4A 3FCUB 3O0RH 2WZPA 4D7PA 3VXSB 5JNYB 3ULSB 5E56A 1IU1A 1J1OH 2RH0A 3K3QA 4P5TC 5I73B 2YQGA 2OMYA 1BQLL 1PNCA 4M1CC 4Y5VB 3Q13A 1BD2B 2ZP9A 4OCXH 1LEGB 3Q8BA 1JTTA 4H0HB 4W6YB 5SWSA 5KBDA 3D09A 5T3ZH 3GJFH 3MO1A 4S1SL 4DP8X 3U4AA 2FHFA 2H9GB 4WEMB 4CVXB 3IEAA 5CN2A 2DWEB 1Q9OB 3ZOAA 1T04B 2I9LB 4O2EB 4N90D 4N1HB 3BAWA 3RJQB 2WANA 1A7BA 5FYKU 2FJUB 3UBXI 2XVLA 1X3DA 1T2XA 1QLEL 4JFDD 4OIIH 5GISL 4LF3A 3EO1B 3MGAA 3GI9H 4HIIB 3VE0B 2WAQA 3N2JA 1UWEL 1X9UA 4FNUA 5GRUH 3BZ5A 2JH2A 1NGYB 2IPKA 2CHXA 5DEGB 4GRLD 2FEEL 4OJYA 5LWYH 2DBJA 4JDVA 2BNQB 1W15A 3RX7A 2GJZA 4AMKL 4P5MB 3BRFA 1E50A 5CZKA 4XBEL 1A21A 4QY8B 1REIA 2V2WA 3LKRA 3KEDA 5B38G 3EZ8A 1G7LB 1NAMB 3D12B 2EYRB 1JUFB 2FQFA 2JLPA 1IARB 2JQZA 2CZNA 1RK1A 4WI8A 5DUPH 5EZOL 4LHUG 4GO6B 3MRCA 4PMEA 2LTQB 2CO7B 3L13A 3L3IA 1NQBA 2X4UA 3OR6A 5ELIA 5G55A 5CJBA 3SDDA 2FE0A 5I9QB 1F1AA 4X7SH 4ODUB 4BFOA 4P2OA 3K1KC 1CQKA 3SE3C 4CDGC 1U3JA 2F61A 1FN4A 4M6AA 4S1DD 2DYSB 1NC2B 1S7TB 5H8DA 5E1GA 4X7DC 1SMAA 3F5WA 1UYWL 4YGAB 1MW1A 5F8RC 3REVB 1ZLEA 2XV3A 4NP4L 3T3PF 5JXAH 1ZOXA 2K1MA 4XT1C 4HT1H 4F9PA 1FO0A 4G9FA 1UGKA 3ZTEA 3UTSA 4BH8A 4P23D 4L8CA 2AV1B 4C83A 1QLEH 4ZO8A 1KTDB 3RURA 4G6JL 4OFYA 4YHML 4XP9H 4Q58C 4UV4H 4FOMA 4CVWA 1I7RA 2A74A 4YHPB 3X3GH 4J5VA 4ZNEA 5GS1B 2V17H 1I9RH 1SLXA 3N6YA 5F9AC 4XE5B 4XNYL 2GFBA 2QADC 2F54B 3L1FA 4FS0A 1TQWA 4H13C 3KDPB 4JRYA 4NI3A 1BBJA 2PYEE 5ID0B 2PYFA 4NJ9L 2E8YA 4AIEA 4DPRA 2BC4A 4QXVA 3WS6C 2VM3A 1RZKC 1LVEA 4LNVA 5D5ME 5CSGA 3L7FB 2BWQA 4N0FB 1QZNA 3H7BA 2OYLA 1J8KA 4KI5E 1EO8H 4EI6A 5C0ND 2WSKA 4H5SB 3NIFF 2DI7A 4X6CF 1ZVYA 3NTCH 3R19A 2X1QA 3P54A 3W0WB 4AYID 3DSNB 4D0BA 2EDJA 5HHOE 2WLHA 3W39A 2X4TB 2PXYB 4FNTA 4M7JL 1CF8L 5SX4H 3KH3A 3OF6D 4XAWL 2JCCF 1BPLB 1LO5B 4MAZA 1P7KB 5GHWL 3Q6FB 2FJGB 4N2KA 2YXFA 3KJ4C 5GIRB 4J39A 5BJTA 1MCSA 1OTSC 2CIKB 2Y2TA 4M7ZB 2H26A 4XHJD 3ZKND 3V4LA 2XKNA 1WBZA 1XR9A 3RIAK 1SJXA 3U2JA 3WE6A 3ZDXF 1FIGH 3NCBB 3IB4A 3G04B 2QVMA 4MNGE 4IBLT 5TQ2H 3ZUCA 2KLRA 3HI6H 5DS2A 5C8JA 1BJ8A 5HYQA 2R2CA 3D87B 1BZ9A 4I1NB 4PWGA 4UT6L 4IDLA 5HYFA 3US9A 4M4RB 5AVVB 1ADQL 3VXRB 1EGJH 4JRXB 4BRJA 3S34L 1F11A 1RHHB 3T1FB 4TVSa 3U1PA 4JZOA 3HPLB 3BIBX 2WZ0A 3K1DA 2YPKB 4TM9A 4Y4FD 4LSUH 4OZIE 2IWKA 2R7EA 4Q97A 3UTSD 5ERWB 3AVEA 1RCYA 1V3LA 3WEMA 5EIIB 3SQOH 3II1A 4HUMB 1KPUA 1Z0MA 4XB3A 1YEEL 5EU6B 4WUUD 4UILH 3VM7A 5IESH 3FL7A 3MTRA 5ETUA 1UQSA 2WAHA 5I1IL 3TNNB 1BD2E 4ZOBA 2OCJA 5E7BA 4U1KA 3FB5B 3R1GH 2HLFC 3DV6B 1OE3A 3QRGL 1IFRA 4XNBA 2DQJL