4DH2A

Crystal structure of coh-olpc(cthe_0452)-doc435(cthe_0435) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
IHEAETADYILDVLVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFDYNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGSTKKYSLITFGESNFCDFDLKPILAVLKEGKVEIEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/protein binding
molecule keywords Cellulosome anchoring protein cohesin region
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 31
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dh2A00
1AOHA 1QZNA 1OHZA 2W1NA 3UL4A 4UYQA 2Y3NA 5LXVA 2XDHA 2VO8A 4IU2A 4DH2A 4UYPA 5AOZA 1ZV9A 4UMSA 4U3SA 3F2LA 3FNKA 1G1KA 5K39A 5G5DA 3GHPA 2OZNA 4WKZB 4WI0A 2ZF9A 2CCLA 3BWZA 4FL4C 4N2OA 4FL4B 1TYJA 3L8QA 2B59A 3KCPA 2BM3A 2JH2A 4IU3A 2O4EA 1ANUA 2VN5A 2VN6A 3KCPB
chains in the Genus database with same CATH superfamily
5FEBA 4UAOC 3WSQH 4WENB 1JWMB 1S7QA 3VFGL 3RWCA 2EE9A 3ML8A 3SDDA 1OQOA 4Z7QF 1G0YR 4JO5A 4UANA 3QRBA 3VACA 3TJHC 1N5AA 3U9PH 1AZUA 3SGKA 4ENEC 3GMPA 3S48A 3OJDA 2EVIA 5GS0C 1I7RA 5HHVL 1XF4B 2LW3A 3ZDWA 1MWOA 5AOKA 3H0TB 1A6UH 2G3NA 5I1CH 1CD0A 2NCMA 3M8OH 2DEWX 3BEWB 2RH0A 1AGBA 2IMNA 1A47A 3MFFB 2NXYB 3MRRA 4YR6B 3ULUH 3GSUA 4QWWD 3BDYL 1MCQA 5DJ0A 3QDGD 3WEOA 3NCFB 4IOSD 4DKDC 5DLLA 1H9VA 1P9MA 5ESVB 1QBML 1XF2B 3NRPA 2VZ3A 4M8QA 5E2UH 5GGRY 1H8LA 2GK2A 1DQQB 1MRFH 2BY3A 2ZX7A 5A2LH 3KWUA 4Y16B 4GO8A 1OGAD 4NHCL 2AEQH 3VW3H 3ECUA 1J0ZA 4NWTL 1HHJB 1HNYA 1NMAL 1X5ZA 1XB8A 4KJPC 5JO5B 5SWSB 3CVCA 3CFCH 4NQCE 4LPTA 1NFDE 1E8XA 2X9WA 1A4CA 2X1OA 3HLKA 3DX8B 3NFPB 3T0VA 1QSED 5EBWB 2W9EL 3IAPA 5IB5A 2YR3A 1KTRL 2VL5B 4A67A 1BIHA 1R75A 1UTDA 4ZAKD 5I74C 1AQKL 3IGLA 2TSAA 4LLAA 1KPRB 3KDPB 1WICA 1YUHA 1GC1H 2IDCA 1CTOA 3MV8B 4WUUD 5AL0A 5AVWB 3FUHA 1M05B 4FZ8H 3RGHA 4K5OA 3RNQA 1J86A 3G08A 4B95C 3OGOE 2WYTA 1CXIA 1BFVH 4F2MA 5H35B 4LCUB 4TXVB 2P45B 1A25A 4JQVC 5DS8A 4EE2A 2H32H 4HFUL 1E9PB 2IWGA 2Z6FA 4GUPB 5DC9B 1XSIA 3GJFA 5FYLL 4JQXC 4G5ZL 4EIZC 1TZGL 5DHVA 1QWUA 2JKWA 2MCPH 2Y7SA 3UAJC 3ECBB 1MW3A 1NFIA 2ERJB 1OAUH 2QFPA 1RULH 3D7PA 3K6FA 3IXAA 2CK0H 2OTWA 2W9DL 4PRAB 1TYRA 1JV2B 2BSTA 5IVZA 3SDXB 1BXAA 3DX1A 5BV7L 1W72L 3CC1A 3VB8A 3V0VA 5BVPH 5JIKA 3SGJC 3VFRA 2ZUUA 4PJCB 3VI4A 4MZRA 1R5VB 3AB0C 1G1YA 4AQZA 5D7IF 1A6WL 1ED3A 1CT8B 1TJHL 5F6IC 3WEBA 5DR5L 4HT1H 2OYLA 2X3BA 4I85A 3GSVB 4NDMB 5D5ME 2DI9A 3TYGH 2V5RA 4ZODA 2EICA 2XPYA 3DUUA 4IBTA 1N0LB 4EBQH 2CJSA 2EDLA 1UT9A 3LXBA 4QD2E 4KOCA 3OXRB 4OCWL 2OKMA 1JZHA 1JK9A 4MJ6B 4F7KA 4EUPG 5K69A 2ITCB 4YSPA 4HIIA 1N68A 2VR9A 1UQSA 4EI6A 5TH2B 1UYWH 2G0LA 5CNHA 3H54A 1U8NB 5C0CB 3MRFB 2B77A 4D9QE 3EZ8A 4HIEB 3WMSA 5FGRA 3CN3A 3FTZA 4J3OC 1B6UA 2J4WL 4APXA 4K8RC 4XZUB 4KKCD 2JV6A 5CLZA 2YIHA 3CH1B 3BP4A 1WO2A 1B0RA 4MMZA 1QOKA 4JGNA 1DQJA 2E75C 4B7IA 2Z92A 3HBPA 4BZ2L 4E0RA 3WLBB 4I4WA 3S8FB 5KVDE 4Z7VE 1U8HB 4PR5A 3O0LA 4HOZA 3BAJA 1JPEA 3FHQA 1XIWD 4YWGL 2HG5A 1H3VA 2UXTA 3TBWA 4DP7X 1GJIA 3DYPA 1MHPL 2X89D 3DIFB 4ZNCD 5CCHE 1X5XA 3VFMA 4MD5A 1TTAA 3WEAA 3LTVA 3B2XA 4OI8A 3IDYC 4LU5L 1NBVL 2VC2B 4PU2A 1IFHL 2G60H 2PW2B 4I9XA 5EZLA 5I8KL 3WN6A 4U1SA 1BJMA 1HILA 1MXDA 4KKLD 3D4GA 4NQCA 4J23A 1LYQA 3AAZB 1NFDA 4OAWB 4X9GA 2Q86B 1QBLH 3OX8B 3U6RA 1LD9A 4B0MB 3JTTA 4ZUTB 3SGEI 1NCBL 3DDGA 4WKXA 4XX5A 2CIKA 3VXMD 3J07A 4A7GA 5IW6B 3ABGA 1U36A 3QIWC 5AW4B 2B16A 5EA0L 5CIPA 4EF3A 4PRDA 4JG5A 4QHMA 2B1AL 5AUMB 3ETBF 3D34A 1QQDA 1NCWL 4G80A 3CK0L 3L3OB 4RZCA 1A1OA 3RVWD 1K2DA 3DO7A 2IDUA 4FN0A 3SCMB 3NZ8B 5CGMA 3RZCB 1ADQH 4XCFH 1NC2A 3R4RA 1KJVB 3ZDYF 1D2PA 5G2NA 5GS1C 3QORB 1Z9OA 3QEGL 2Y07H 1BYOA 4R8WL 2EYRA 1LO2H 5F70A 4LVHB 3NIGE 3FUKA 4MXWL 5I66A 4U1NB 3VRIA 4ODUB 3Q2WA 1WFTA 4FQHA 4XMPL 3O3DB 4U6HA 4DQOH 2EE3A 1AANA 5MEOB 4F93B 4POUB 1TQWA 4X80H 3HAEA 4FQ1L 4JO4L 4K5MA 3SQBB 2R59A 2BFVL 4YHIA 5I0DA 3P4NB 4GIOA 4ISVA 4OD2B 1U91B 4DFIA 5T5FH 5J6HA 3EYUL 3JT0A 3QEHA 5EIIA 1UENA 1D5BA 3E6HA 3FCTA 1RURL 3UTQA 4OFPA 3DHPA 4TVPH 3PWNA 2OSLA 3HTLX 5T3ZL 2F53E 5ANMB 5I16A 2X4SB 3KWWB 3HHSB 1F6AB 3FTXA 3L5JA 1RZIA 5A6IA 3MOBL 3FRPG 2HRPL 2X28A 2SEBB 4DK6A 3L4UA 5F9DC 2BZ7A 5J9PA 2GJZB 2XTLA 5KW9L 4X7SL 4KK5C 1WTGT 1WFUA 3LQAH 5HDOA 4ZD3H 1SHMA 3Q0HA 2IH8A 3SYQA 3L9RB 3LEYH 4Y4HC 5D5MA 2ZOLB 2D4FA 1MG3C 5FFLA 2GPZA 3IMRA 1DN0A 5IMLA 3SDAA 2Q8AL 3RBSA 1XH3A 5C09D 3LNHA 2P42B 3T3MB 4WDIB 3T6VA 3FC8A 4MJID 5KN5B 1PY4A 2KDGA 4JQXA 4FEIA 2OTUB 3N42F 3FT9A 4UQCA 1C5DB 3GBMH 4XWGH 3KPRD 35C8H 3DX6B 2ZKHH 5DEFB 3ISWA 2F7PA 3BW9A 1ACCA 3DSFH 2R4RL 3MRGB 5EPMB 4OZGB 2VDLL 4LEBA 5FYJD 5K9KA 2PNDA 5GIRA 2XDHA 5I1HH 5IT2L 3K72A 4Y8DC 4XO3A 1J9SA 4UQBA 3HNTH 3Q6GH 3NFSL 1HE7A 1GPOL 2MTAA 4LBAA 4XH2B 5ICUA 1EEYB 4XPAL 3RWDB 3MLYH 3FFCD 4S0SD 2CG9X 3I2CL 5HSFA 1H0DB 1BP3B 4J6RL 1BLNB 4A66A 1UWYA 4ZX3A 3P3RA 4L8CA 4ODTL 1UWFA 3ZN6A 1H3UA 3WJLC 1SMDA 5FIEA 2J8UB 5EOTB 1XGZA 2AK1L 4DHLA 3I9PA 4R7NB 4YBQC 4HS6A 4CBPA 1BJ1J 1CGTA 1EHKB 1SBBA 3NSCA 1WPCA 3HVNA 3CSPA 1FPTH 3QFJB 5CEXA 3X3GL 4JGUA 4WK0B 2DM4A 4HJEA 4LSPL 3JWNG 4Z7WE 4P2CG 5ABAA 4P46D 5LCVL 15C8L 1FLRL 2BVUA 2VLME 1NCGA 1K8DB 5HPMB 4JJHA 1DBKL 4J8QA 1TCRA 1XZ0B 2D8KA 3GKWH 2EO9A 4YXLL 1E30A 3GXMA 3PFUA 1S46A 2ICWA 5J1AA 1IL1A 4ENZA 3D4YA 5IHHA 4XXDB 2AQQA 4DVBB 1LE5B 3B5TA 3GWJA 1HVXA 1XR8A 4I3GA 4WHCA 1Y6KR 1YUHB 5C3LD 1NKGA 5ICZA 3MUZ1 4DPBX 3T0WA 2XZCH 1F45A 1S9XA 3EO0A 4Y5VC 4BUHA 1X4ZA 4TOYH 2Z93A 3O45A 3WEXA 3I74A 4M1CD 3ULVD 2C3HA 3FUDA 5F0MB 4U4BA 3GM8A 3SE3C 3FQUA 3FN0H 5A1AA 4K2UH 4MD0A 5DD1L 1OWWA 1MRCH 2ED7A 2WNGA 4K3GA 4PRID 3VD3A 3F7QA 5AQ0A 2VO5A 1JDAA 1FGVL 3BWUF 1JYNA 1MAMH 2ZCKL 1N5YH 3U36B 1R24B 3LHPH 4NENB 5A40E 1NFIB 1QSZA 2F53A 3MJ9A 3OMIB 5F1OB 1CLYL 1F00I 3QIWA 4IBSA 3JBG7 2GQHA 3OQ3B 1LEIA 2OTWB 1HJCA 3H9SB 1GZPB 1P5VA 5IVZB 5DLML 2G5BA 1WAPA 3EJTA 4UNUA 3VA6A 5KYWB 5AYUH 4C56E 1OLZA 2EDWA 1J5HA 5EORH 5C0GA 4Y19B 5CN3A 3WKPA 2B59B 3C6LD 4QNPF 1OHZA 3TVMD 5GS1A 4G7RB 1QSFA 4AT6A 2VDOL 4ONGH 2XRAH 1MIMH 5A6LA 4HEMA 3GSRB 1TNNA 4V2CB 1X5LA 3VVVA 3D69B 1T83C 1L9QA 2BERA 2QDWA 1DTUA 3HMXL 3KJ6H 1O9ZA 1WZLA 4GIAA 5C0NC 4K5PA 5I6XB 3UZQA 2FB4L 2JFCA 2CO7B 2R9HC 2XTSA 1JK9B 3ZO9A 1D5IL 4TYUA 2ODIA 1KV7A 1F90L 5BOJA 4H8UA 5D71H 1UB5A 1GR7A 5T3XH 3O3BB 5C0EA 4YIQB 1WBZA 1GY2A 3AUVA 4UV4L 5GRXG 1XSJA 5IM7A 3L5XL 1OCOB 4PBXA 2IBZY 1KEML 4FFZH 5EUOE 1YJDL 4IRSD 2X1QA 1NAKH 1V7MH 4QOKD 2C9SA 2F5AH 3MMEB 4KY1H 2GFBA 4PREB 5FDWB 3GZQA 3RVUC 2WBJD 4WW1B 4Y9EA 3PE9A 3AT0A 4TSBL 1B0RB 1FNSH 3BUQA 2TRYA 1PVHA 4N8VA 3NIFE 2KH2B 3G3LA 3QQ9C 1E4KA 1UM5H 3I6GA 2VRKA 1XF1A 5DEZA 4UDUB 5CEYA 1HEZA 5EU7C 1I75A 2E56A 1J0HA 4HUUA 1MLBB 3MRNB 5DWUL 3ZKMD 3QZWB 4XNDA 2BP8A 3MA7B 4TQHA 3NJIA 4UAOB 1MIEL 1EVUA 1RIUL 2LHAA 1YECL 1MZYA 1J8HA 5D4JA 4BCZA 3H2WA 4MCYB 3B5GA 1EFXA 2JJTA 4F7PB 2VDPB 2IH3B 3QEQB 5AB1A 3HRPA 4ONOA 3HG1E 2FR4A 4QHNA 3F12A 3LZRA 4B5ZA 3FL7A 1CD9B 1UG9A 3EFOA 4UCFA 4G6AC 7CGTA 5MEPA 3GXTA 3EFDL 5JLZA 1MI5D 1WISA 2E59A 1ODAA 2QVFB 2MIZA 3HUJE 3FUJA 4BRJA 1QQDB 5BQ7B 3BIKA 3LIUA 1OCWH 5IJKA 2R8SH 2HXAA 4Z77B 5IFHL 4P5TA 5EN2B 4RAHA 2F19H 1PX8A 2W80C 5DD3H 3ZTNH 1QEWB 4R9HA 1MHHB 4QJ3B 5IF0B 2A3TA 3ULSA 5E08H 2IFFL 2YAQA 1QKZH 1FFRA 3AREC 2OMWA 4CSTA 5EU7E 4Z3HA 2I9LA 1DBAH 3UCQA 3VXOB 3PGFL 4YLCA 3LIZA 1TR7A 1J9RA 4FS0A 1ILUA 1XF3A 3S0PA 4AH2B 2NQDA 3H6JA 2XZQH 2CUIA 3H9HA 2NY6C 2XKSA 1QLFB 1DZBA 3U6XA 3GRGA 3QWOB 3IMVA 2I07B 2OULB 4BJLA 1UT2A 4IRZL 1G84A 5ID1A 3MNZA 1D5BB 3FCTB 1QZ1A 3GMMA 2AAAA 1ZANL 3O3UN 1JNLL 5I1AA 4N8CL 4ODSL 3T3MF 5FV2A 3PP4H 2FWLB 4HMCA 2R7EB 5H2BA 4FX5A 2HZHA 4I88A 2WINB 1A7RL 4KQ3H 4C56A 1ZAGA 1IBDA 3SE4C 3FB7A 3RIFK 2Z1KA 1IILE 5IHLB 4KXZH 4BFBD 3MO1A 4HHAA 1ECYA 3P69A 3Q8BA 1RHFA 4JR9L 4YDIH 3R4DA 1TQUA 2P5WE 1T2QL 4JO3L 4OZGF 5I74B 5EG6C 3QUKB 3GMRA 4QYOA 5AVZB 5SV3A 1MCKA 3MN8A 3QT2A 4ZZKA 1ZV5A 1KB3A 5FM8A 3WAJA 4UT9A 1MWAL 1Z5LB 3M1BA 4XO8A 5J4MA 3SE3A 2HLEB 1ORSA 1T1YB 2R1WB 4QLRA 2I9TB 3H3BC 1F18A 2YMXH 2G5UA 2YGNA 4PWHA 5EUOA 3UZVA 2VDKH 5AW5B 1MHCA 3MYJB 4PWIA 4GBXA 2DYPD 4HJJL 4XP5H 1I9IL 2DQFB 3TT3L 1HXMA 1MRDL 3ARBA 2YBRB 5MHSD 4NPYB 1GA2A 2BWIA 3QIUD 4FHKA 5CLWA 4MMYA 2COVD 1KB5L 5IMOA 1WS7A 5AAMC 4HCRL 3R0NA 2FEDD 3REWA 1IBZA 3DVIA 3Q43A 1LEGA 3LJ3A 4Z7VB 2OSXA 3STZB 2W92A 3MRMA 3U2JA 4BFJA 2X2JA 3AUWB 3AB0B 4L1TA 5L4IA 3VH8A 2MNUA 3JXAA 5E8OA 5F6IB 2ODHA 1OSYA 1DANT 3D3VE 1BBDH 3LB6D 5KZCD 4DKTA 5CKAA 4OZFB 4OM1H 4HG4K 1X9LA 3W39B 4YDKH 5TTRA 4YDMA 1MEXH 4PRNB 1DSYA 1EJFA 4WFGD 3HG1A 4B6ZA 3ALWA 5EO0A 2Q7AA 4NXSA 2GSIB 3S34H 3OB0H 2J2ZA 3ARQA 5M7QA 5C3IA 5KOMC 3HCVB 2WQRA 4KK9C 4FHBD 5F1IA 4MCZA 2X0WA 3VI3E 5I76A 1SYSA 7PCYA 3VG0L 1Z5HA 1RXLA 1BZEA 3MXVL 5KSVB 5ILTH 3NUKA 5C0BD 5K9QI 4Z7NE 4JPVH 3QAQA 4KI5C 4ZS6C 3VMNA 1KN4H 3ARGC 5B1AB 2EC8A 3KLQA 1CJYA 3Q6FA 1DJGA 4ZW3A 4O5LL 1UXMA 2PTTB 1BZ8A 2AQ2A 4AWJC 5EDSA 2YEZA 3HE6B 1G6RB 2VABB 1DVFC 1PZ5A 4NQVB 4HC1H 4AV4A 3UADA 2PCFA 2IG2L 3SOBH 3SE6A 3X12B 2X40A 3O45B 4F3FB 5GHWH 2AK4E 4FQXC 1OTTD 2ZX8A 3TN0D 4K55A 1UZ8B 5HVHC 3IDYB 1ZTXE 5DRXA 4LLQA 4WLCA 1P4BL 1R3LA 4TKWA 3I75A 3EYOB 2WLJA 3II3A 2E9BA 2WLIB 1I1AA 1XVSA 3DI2B 4OV5B 1DQDL 1IAMA 5D7LE 3ARFD 1YQ2A 3NACL 4FCHA 2YZ1A 4IU3A 3EZJB 3A47A 4FKKA 3CVHB 1GL4B 1URZA 2P5WA 2WWNA 2XA8H 4FNQA 4PLJD 4YC2C 2J6EH 4JN1L 4WWKD 5SV4A 1IQDA 5J1TC 1DUYB 3T0EC 1ORQA 3GBEA 3QDME 1TEGA 4UOQA 4KI5E 4QXTA 5D1ZA 2IDSA 4HKJA 1J5CA 4OTXH 2EDJA 3GMNA 3O4OB 4QRTA 1A14L 2Y24A 4FQ2L 3AREA 3HS0B 1OARH 1W8NA 3BZEB 1SJXA 4ONHB 1OEZW 4XI5D 3D6GA 2FNBA 3P4MB 1F0LA 4NQSB 4AYID 1JGLL 3ZIMA 1YN7B 1DSWA 2BNRD 1UA3A 3ILQC 1WA2X 3S3CB 3V0AC 1UD2A 3C12A 2VLKD 4L8DA 3SKNB 3RGVC 3VXUE 2DWYA 2H3NB 3S37H 1KDJA 2DTMH 1IIIA 4P4RA 1AZNA 3TO2B 1KN2H 3FTSA 3WXWL 3CHSA 3V0GA 1EMTL 2BVEA 3WYRA 3OKDB 3MRHA 1HNFA 2C3WA 2GFBB 1WQVT 5D1QC 3JV4A 2QQNL 3G5VA 5C07D 2OMXA 1N4XL 4I48A 4MQXC 5IY5B 1FO0B 1T5WB 5TE6L 2PR4L 2N4IA 2ICWJ 1RVFL 1ZLDA 5I6KA 5IV2A 1YNLL 4XNQA 5HYFA 2BVPA 3PL6D 5CU9A 5AL8A 4M5ZH 2C3VB 3T0EE 5FO9A 5K1NA 4RRPA 4Y4HB 3D3VA 4JUTA 1CBJA 2AMGA 2XY1A 3B6SB 4A55A 1JV5B 1R1CA 1NC4B 4IDJL 3C5ZC 5KYUB 5GGSY 1D5MB 5GJSL 1FORL 4L4TD 4MDJA 4E9XA 1FCCA 2IAAC 5F9WC 4G6KH 4N2MA 1QBBA 2A9CA 4Z7WB 5D7IA 1RK0A 4X5WB 3CC5B 4KZDL 4B27A 1JXJA 1H5BC 3NESA 4CVXA 5CHNA 1PIFA 2EDDA 5KVFL 5C0RH 3OMAB 4NRYA 5B39G 2G2NA 4S1DD 3VI3A 2X12A 1LO5A 5HYJD 4H1LH 2UWEF 4BWTA 1ZWIA 1I7TA 1CVRA 4W6WB 1S2EA 3HE7D 1M7XA 1I7UB 3GI8H 3QDJB 1E3ZA 5FYJH 3L3IB 2ZG3A 3H6AA 4L3EA 4NP4L 3F5WA 3QCUH 5D1QE 3Q8EA 1MCFA 3A21A 3FQNB 2R4SL 4YO0A 5DDHA 5FWQA 5ITBL 4PBWD 2EIBA 2HJKB 4IMLA 4XNZB 3UYOD 3CLEL 4PM1A 4UWQB 2A5UA 1B0IA 2AZAA 2AK4A 2Y1AA 1AIFB 4P3DB 2EE2A 3MUGB 3S97C 3VGDA 2EH7L 1J5IA 1SY6H 4BUGA 5IIEB 1S7TB 4QHUA 4DGIL 1N3NA 1E4HA 3QQ4A 3TO4C 1WUZA 1SFHA 2QHRL 1N0XH 4Z95H 5F7YC 5C0JB 2NR6D 4Q14A 3B7RL 4XVJH 5IEKB 1ZPUA 2ZCHL 1VPOL 3TBSB 5EUKA 3PWLB 2OMTA 3DJRA 5GRUH 5D7LA 4DP9X 3OB0K 2DYSB 3MJ9L 5GGVL 1U95B 3EGXB 4DK3A 3MV7D 2AJUH 2BNQE 4ZUVB 3RBGA 5I15L 1S3KL 4S1QL 5I1AB 3X3FL 3SB3A 1CLZL 1I8IB 2E6QA 3QYCA 2SODB 1NGXA 2B4CC 2HTKD 4IU2A 4LMQI 2R2HB 3RVXC 2XQBH 4JVUA 4DN4L 1E5YA 3QDMA 4OCNC 5DS1A 4FGMA 1INDH 4JJ5B 2FX9L 1KCRL 2J25A 5D72H 3EOAB 5I6PA 3NFNB 1U8JB 1UKSA 1YSOA 2OMUB 2GB2A 4MA1B 5A7BA 1F4XL 1PX3A 1JZIA 4JFWA 3ZR5A 3OKEA 1I9RL 2KMWA 3BAKA 2O6EA 4Y5VB 2AJYL 2Q76A 3DRTA 3B37A 4MLSA 4FQXA 2NZ9D 2APBA 1PX4A 4IOIB 4HJIA 1B0GB 3ELQA 3RL2A 1AD0A 3LEVL 3GSNA 4P57B 3PGCB 5T33H 3SJVA 3VAEA 2HFEA 3NJNA 4JX0A 3RA7L 4Y1SA 4DGUA 4MDIA 1KELH 2A6KA 4X6FB 4CMMB 2WUCL 4WNQB 4ZTPL 5HGDB 5AAPA 2VLJD 4HW6A 3LPFA 5L88L 5ES4B 3US0A 1NSNH 3GZKA 2HVKA 3JWOC 3FRUA 2BSDA 4OUOA 3WD5L 1PKQB 3ME0A 3O3AA 3FQWB 3T0EA 4JRYD 5T1DH 4JY4B 3WHXB 1KULA 3U7YH 3QEUA 5DJCA 1UGNA 3WTYA 1GOFA 4N6RA 2G3MA 3N3EA 1VFAB 5EZIL 3NCEB 3AQYA 2YQBA 5HHMB 3KPQB 3V7AG 1FDLH 3G04A 4F57H 2WB1A 3RU8L 3VFSB 3TS8A 3QUXC 3WUWG 3FF7A 4CKVX 1OF2B 1RUQL 4LQFL 4HXBL 5HYSB 4RZKA 3ET9F 1JZDC 4XNBA 3PV6B 1ZVNA 1RFDH 1BREA 2JIXB 2IALA 5G55A 3HUJB 5HHNA 3T0DA 3POHA 3LVEA 4E5XA 1SPDA 4XPBL 1OCZB 5D1QA 4NNYB 2WIIB 5DD5H 4OJYA 1I9JH 1ZE3C 1T5KA 1B4TA 3FB5B 4QCIA 4QKXB 3SE9H 1DR9A 4M7KL 2AZUA 4N0CD 1L7IL 1M9SA 4QT5B 3NEOA 3T4AA 4AL8C 2XG5A 3H7BA 3DXAE 3OKNB 4PJEF 1UD8A 1I4FA 4PQXA 1KJ3L 3QUMA 4XZ4A 2ZG2A 4LPUA 3UGEA 4UMGA 3C5JA 4M4RA 4NYLA 4U6TA 3REVA 3WIAA 3CPLA 3K4AA 4JDTL 2XTJD 4N2FA 4KZEL 1IJNA 3VB9A 3QJSB 3VD4A 3LKPA 3LIZL 2ZUVA 3HR5A 4LPXA 5HVFB 4PYGA 1JOIA 4QRQA 3GXDA 5AYQA 1OAZL 4NQDB 1R5IA 3UO8B 4D3CH 1N18A 1DLHB 1G7JB 1WAEA 3CLFL 1N64H 4FE9A 2BNQA 4V11A 2FBRA 1A6VH 2FZ3B 2WC7A 4QRRD 4Y4FC 4U2YA 1ZSDB 3T6WA 5JOPD 1MFVA 2OTPA 1UA6L 4MCNA 1XT5A 2IXQA 4RESB 1BM3L 1A9BA 3MU3A 4MSWA 4XC3H 1Q94B 2NYYD 5H8DA 3X11A 5IQOA 3DTXB 4FYSA 3BSHA 1PZBA 2WZ6A 3GNMH 1ACYH 5ACZA 3BJ91 2I7OA 2OX5A 3BSZL 2F54E 2ZUTA 2LU7A 1XTLA 1E4WH 3GRWL 2OS7A 1HTYA 2H7WA 3TBVB 2L7JA 4NQTA 5FGBC 1I53A 1NANH 4N1CA 3CFIC 1N6QL 3AMKA 2W07A 1MHEB 1R47A 4LHJB 1RZFL 3WFCH 2FGZA 2XN9A 1ZVHA 1C08B 5FECA 5FA3B 3JV6B 3ABLB 4ZSOB 4QYAA 2OMVA 4PG9A 4UUJA 1AI1L 4JFZL 1GZHA 1G9NC 4WJKB 4NKDB 1CXLA 3WL9A 3W5MA 3CFBA 2ZKYA 3HC3L 3SOTA 3WE6A 5ITFB 5B1CA 1HYSD 5L7XH 4NSKB 1GGIH 2XNAA 3RURA 4WEBH 2J71A 5DMKA 2YGPA 1DO5A 1PLBA 2K3TA 3CD4A 2R29H 3NCJH 3TONA 1TYJA 4WRLA 4Z3IA 3I6SA 5LGHH 3GIVB 1JPSH 1OPOA 4M1GL 4YH6A 2JKXA 2R2CA 3JV4B 1EUUA 5SWSD 5IEHB 3UPAA 4C83A 1QFWI 1AKJB 5EFIB 4P2OD 4PWFA 5D1XC 3O9WC 2BIOA 2ZOUA 2FK9A 4LSQH 3AQZA 3KGRA 3T65A 1KGCE 2QV4A 3QPQD 1KXVC 4QO1B 3UTSB 3ZKXC 1Z7JA 3MBED 1LXMA 4M9PA 2HRLA 4N25A 4Q0XH 1B4JL 5F7UA 1GAFH 2ITDB 1BEXA 1VEPA 5IKCA 2V5TA 3DMMD 4H8PA 3O2DH 1L5GA 2CK2A 2VDMB 4MX7B 1N12A 3QZNA 5J11C 4ZQKA 3MXWH 1QI4A 2QMKA 3QSKB 1FN4A 1X7QB 3VFWA 4NQEE 2ZX9A 3CFEB 4QTIL 5D7JC 4B9KC 2MPAH 3QZLA 4GXUN 1RZJH 4BHUI 2NLJA 1TZHA 5E8EB 2DQHL 2ORBH 5JQHC 4JE0A 1ZHNA 3MREB 3HHRB 3INUL 4Z23A 2NY2D 3EOYG 2V2WA 1F13A 1JP5A 4C47A 4YHLL 1UM4L 1OSEA 2XKNB 3CMOH 2Q7NA 3DUSB 4PY7B 1CLCA 5E2VL 4UDTB 4TMPA 1WBYA 3X17A 4ZJ9A 4NFDA 4UBDD 3QQ3A 5D1XE 2J43A 4ZW8A 3HZVA 4ZOEA 3QQDB 3S2CA 1YY9D 4PRBA 3ZZQA 3ULUC 3FTVA 1U3NA 2FIKB 4FF9A 2DQ6A 1WH0A 3WLWC 4EIUA 2AI0L 3NRQA 1FYTD 4FFYA 3QJUB 1RSFA 1IBGL 3EDFA 5CJOH 1ZA3B 3A6CL 3FO2A 1E4XH 1X9RA 4L3FA 2WTRB 2PWDA 4QXWA 2JB6A 4UAHA 2WCPA 1K85A 5FF6A 1ULVA 4XP4L 4F7CB 3W0WB 4KO7A 4L9DA 2H0JA 2K6ZA 1IQWH 1BX2B 1KCBA 2V7HB 1ZSHA 5LQBL 4YHMH 4YSQA 4ZBJA 4EUPH 1AS7A 2F54A 2AANA 3A23A 5DI8B 4AM0A 4WFEE 2ADIA 3STLA 1B9KA 3ARGB 5KUMA 1OAYL 4UB0H 4IM8A 1S4IA 3P0YH 1FAIL 5BS0E 5B1JC 5KVEL 2MNJB 2WSKA 3UBXA 3BKCH 1J0YA 5DZJA 2BDNH 3HNSH 1DVFB 5MI0B 4A1RA 1P69B 1V10A 5JIIA 3BQUD 3QA3A 5F7DB 2ZD0A 1GC1C 1DLFH 1P7QA 4L05A 4CC4C 1JFQH 3I02B 4FQXB 4H8WL 3KBHE 1ZV9A 1E27B 2XKUA 4FLSA 5HVHB 2XVLA 4XPTH 1BF2A 3VXUB 2CLZB 2MQGA 4N0YH 4U1IA 3QUYD 1L9TA 3V8CA 1M1XA 3ZE2B 4GSUA 3U4EB 4DCQA 5GGQH 3N44B 3IFNL 2YD3A 5I8CA 4KJWD 4JCLA 4JO2L 1EH9A 4M7LT 3FQ4A 3HB3B 4I1NB 1H3WM 5L2KD 3VJ6B 4NERA 4WO4D 1LNUA 3TA3C 2OR7A 2P48B 5JW5A 5KVGL 3ARDD 3HFMH 1ND0B 4N0FA 4Q6YA 3RKDC 3MRQB 4AEIH 1BIIB 3KM2A 3UYRL 4YC2B 3OM3B 3VUAA 4WVRA 5FGBA 2QQLL 4F8PA 2DD8H 4I0PD 2FT8A 5AALA 4JW3A 5DJDB 3EJJX 2CKBA 3K91A 3L4TA 2IEPA 3D05A 2FEEI 1BZOA 4MFHA 4R97C 4HMEA 4BFFA 1LILA 3GPEA 3H55A 4P4KC 3IE9A 1OHQA 2JCWA 3V4VB 4AUUA 2IV9A 2JK5B 3BIAX 2AJSL 5FO8A 1A2YB 1DE4A 4NQEA 4PJ9C 4L37A 5DK0B 1Y1UA 2Y4SA 3S5YA 4AE1A 5IQ7H 1KOAA 3FQTA 4PGBA 2CBMA 1UCTA 1CO1A 4AQ1C 2XN0A 1NTDA 3VD5A 4HWZA 4BKSC 1N70A 1ITCA 4U1JB 3RGVB 2BMKB 1CDHA 1CE6A 4PSPA 3B1TA 1F42A 1SDAB 4NCDA 4CW1B 1A6ZB 4FXLA 3GFUA 3FT2B 4RLDA 4D7BA 4G42A 3RGBA 4G8AC 5HJ3B 4C55A 2BW5A 2LGNA 1QI3A 2APXA 2FBJL 3C60C 1NCJA 4ZO9A 3JVGA 5I82A 3ESNA 1OCCB 2D31A 4CNIA 4JLRB 5BO1L 1Q0YL 4XOCA 5D1XA 4XODA 4GKLA 5F0LB 3IETB 1HSAA 4G9FD 1UA7A 2EC9U 3L54A 4EQ3A 2WSPA 3OPZH 1QTYT 4OLZH 2XI9A 2NNAA 3G6AA 1KXVA 1QG3A 4M1DH 3ZTDC 4O2EB 5GGTH 1SJHA 2A9NH 1IGFL 1S78D 4TLSA 5DTFA 3C5ZB 3R06A 3D2UB 4KQ4L 4X0NA 3U7AA 5E00B 3WNJA 3DYOA 3FUMA 2I26N 3HEIB 2W0FA 4AYFB 1K3ZA 1SN0A 1R5IB 4NWUH 3W3BA 1FL5B 1H5BB 2C3XA 4AY0A 4M5YH 4HFWB 5D7JA 3LKSA 3APNA 4G43B 3QJQB 3FCSA 3WV0A 1IM9A 2FYYB 4MWFA 4DH2A 3PWVB 3ZMNA 3SDDD 5JNYA 2XACC 2IXQB 4MSWB 3WBDA 2X6BA 2XG4A 4XNMB 1NBZB 3KPOB 4G6ML 5DJZB 4R4BA 2JJSA 4LARH 2DI8A 3LHAA 4XBEL 3QARA 3ZKND 4HP5A 1BQLL 1UGKA 4YLQT 5BS0A 3S5LB 2E8YA 5AW8B 1NUGA 1PZDA 2VSDA 1RK1A 4J6IA 2X4UB 3FT3B 1NINA 4HGKC 5F7WC 1P84J 5FECB 3QGVA 5F1NB 5F8QC 1DANU 1WC7A 4H0GA 1L9PA 4KXDA 2NRDA 1U3YA 5DUBB 3BKYH 3ZDXB 3IVKA 2B08A 3MACH 4OLYH 4WWNA 4XN8A 3TO4B 2FD6H 2VOTA 3CZFB 1QA9A 4JFEE 4Y1TA 3WY1A 1JZ3A 1ET8A 1U3JA 3PDOB 4NI3A 3LKRA 1UWGH 4JVPA 5TDOA 4XAWL 4YGVB 3UJTL 2BFGA 2JELH 3AT8A 4PJDB 4BFIA 1I8MA 1OT4A 3US1A 3RWFB 5F88B 2PO6C 3VFGH 1OE3A 2Y5QA 4J1UA 4GUOA 1EAPA 3JWNH 4FZEL 3UERA 1N6VA 5BO0D 1JXDA 1A4JA 1TLKA 4IIZA 3BP5A 3ZGHA 4JFDB 2HVJA 2P8PB 3F84A 2ADJB 4OV6F 5AKTA 2DY2A 4KFMA 5BUPA 2XSKA 4XNXL 4DW2L 5HHVH 4AYBA 4WCYH 1DSFH 1HQRB 4MS8C 4UIKL 4HH9A 2G5RA 4JRXE 2VR5A 2PP8A 4OUUA 3LQAC 2D2OA 5HHOB 2WVVB 1KJ2A 3T1WA 2LVCA 4YHOL 4CC4A 4X6CE 4XGZA 2WHVA 4KMLB 4OLVL 3C5SB 3VFPA 1DVQA 2G75A 4YXKL 3NGBB 4ZUSA 3BDYH 1U42A 4A2EA 4G7YL 4DGWC 1IM3A 4PV8B 1HHHA 2QVTA 1MFDL 3O11B 3WNNA 4P07A 3CFTA 4OQ1A 2H32A 1CK0H 1QBMH 1SEBA 3TTYA 4FNTA 1HL4A 1AP2A 1SOQA 1U8LB 4LHQB 2NY3C 2XLLA 4WI6A 2NY0D 3PAZA 2OL3B 5LDSA 5E4OA 3AGVA 3UMTA 4XTRD 1F11B 2XQYG 3AC0A 4WI8A 4NHCH 2EP6A 1JPTL 2E86A 1LLAA 1NMAH 1V27A 4TVPE 3DXAB 1SM3L 4M43L 3D8MA 1LEKB 2XV6B 1EERB 4M61B 5B7EA 4L4JA 3I84A 3V55A 2IWFA 1UXWA 3J2PA 1ADWA 4OCYL 4APQA 3MBWB 2X4TA 4LFHG 4M48L 3GJEB 4NRXA 4OKVA 4LOFA 3KPTA 1FE8L 1J9QA 5CAYB 3H53A 2OZ4A 4I8DA 1MCSA 4PN6A 1KYAA 2ZPKL 1KLGB 1AQKH 4HLZG 3KEHA 5DFTA 1PBYA 3QUXB 4G8GE 3AQDA 4NFBA 4BBWA 4FMKA 5JDSA 4MXVF 3TNNB 4AQ1A 2E7HA 5DCCA 3L81A 1KMGA 4AGNA 1SHXA 2E7DA 3VM5A 1V3KA 1R3JA 5FF6B 1UZ6F 2E0PA 4CDGC 1BPLB 2AXFB 2ID5A 5FC9A 1P1ZB 1FVCA 3GSWB 4FFTA 3JQOB 3N55A 2HH0H 4Z0BL 4HFUH 1EBPA 1CCZA 4UQDA 3ZE2F 3UTZB 3K6OA 3N44F 5BZDB 4G5ZH 1NGZA 2UWEA 4AQ8C 1H6UA 4UIMB 1KY7A 1HOEA 3K6IA 2XV3A 4PGCA 4OZ4A 1ZK5A 1MJUL 2JTYA 1T1XA 1QACA 3UEZA 1IGTA 1S6NA 2L7UA 4QRUB 2XVGA 4PJXE 4GRMB 4LCYB 1P7KA 1HINL 2R69A 3OL2A 4UV7L 5CJQL 5GZNC 1UC6A 1SVBA 5BV7H 2ARJA 3ZXAC 3AY4C 2J88H 1FFOB 5CJ8A 3FAXA 5DJ2B 4NRZB 4W9KC 3W2DH 2YUVA 1SJMA 1T0NB 3DNKA 5G5DB 3MTXA 5CS7A 2WYIA 1BD2E 4AOFA 4M6AA 5KBLA 4M8VA 2X0VA 3DI3B 1CD1B 2CWRA 3D85A 1FIGL 4KZ0A 1A6WH 5EN3A 3T71A 1TJHH 1BVKA 2EIEA 3GPSA 5DR5H 1RK7A 3ZMRA 3RQ3A 4ELDA 1UHVA 4Y4FB 4NNXA 2DF3A 3TEWA 4NQCD 3N40P 5D70L 1BXXA 2DBLL 4AQEA 2P7TA 2QADD 5FDYA 3TJHD 3F2LA 2MQCA 4BUQA 2VXSL 4QKTA 5HVWA 2VISB 5TF0A 5GS0D 3HKZA 2B14A 1IJ9A 4H2AA 2DWEA 3AS2A 4JRXA 2Q7YB 3U0PB 4W6XB 5TF1L 3PQYE 2HJLB 3PXHA 1R3KA 5D2NC 2J4WH 4EDXB 4R6UA 4X6CA 5D93C 1OGTA 1D3CA 3ROOA 1NC2D 4Z7AA 2WO2B 4FJ6A 1XB3A 2XXFA 4WSGA 1BF8A 1FFNB 1TEFA 1UACL 4OCSL 5BVJB 3V6ZB 4BZ2H 5HI5C 1S5IL 4R0LC 2FLBT 3SEPA 4P9HL 3CHXA 3OD3A 2IBGA 4F7TB 3KXFB 3PJNA 3Q13A 4JCWA 4J7RA 2YPVA 1MHPH 4YSAA 3WS3A 2ARJQ 3VRJB 1DJZA 2BM3A 2Y2YA 3ESPA 1XF5A 4LU5H 1LDPL 4OFKA 5CJXA 4F8LA 4HKBA 3WIHA 4PHZA 4HJGB 2P24B 4U1LA 5JW3L 1XGRA 2WPGA 5GGVY 4EI0A 3RB5A 4BSJA 3U30C 1NCBH 1MLCB 5HHQA 3O9WB 5HTSA 3GHEH 1HSAB 5ISZB 1NL0L 4N0UE 3KPLA 2NY5L 1PYWB 3RZWA 1KJMB 3FOLB 3NJJA 5EA0H 2CDGA 3MCKA 4MA8L 1MAJA 2K1MA 2B1AH 2H0PA 2BHUA 3MUJA 2H5UA 5D2NE 1NCWH 1M2VB 3OKKA 3UBFA 3WIFB 1RPKA 2XWXA 4NZRL 1R3IL 1S9VA 4FFYL 4G8GA 3ZQWA 1YMMA 5J11B 5DVLA 2YJLA 2F58L 4NEHB 5DK2B 5F6HJ 3KBPA 1GYWA 1KACB 5ACLA 4R8WH 4GAGL 1Z6JT 3SDAD 2X3CA 3P0VL 4PS3A 5I1IH 2BSSB 2YAPA 1LO4L 2VZOA 4IK7A 5HGHB 1FZOA 2VZVA 3ASWA 3BVVA 4JVWA 5K9QG 1VCAA 3ZDXF 3F7YB 5FUOL 5E0QA 2VMEA 3IKCA 4B9ZA 2BOBB 4JZJA 4K3JL 4JO4H 1HZHL 3QO0A 3FO9A 4B41A 3CBKB 1YEJL 2YPLE 4Y4KC 4NOBA 3CVIL 4D9QD 4NQXB 3QS2A 4R7DB 4LSTL 2JTDA 3BEVB 4DT2A 1U8MA 4HS8H 4PJDF 1U58A 43C9B 3EYUH 3FFDA 4DAGL 2NW2A 4PJXA 2C4XA 5JW4Q 3QUGA 1AY1H 5CCKH 2WUBL 3QCTH 1JWSA 3BKJL 1MFEH 2NUPA 4XPHL 4NM8L 3IJEB 1FZMB 1HZKA 5E5MB 4QHLA 4N8UA 2HAZA 2YQ2A 3F01A 3S8WA 1T0MA 1TTUA 4BZYA 1LQSR 3MOBH 3BWAA 4IRJC 4LLVB 2HRPH 4LVNC 5JMRA 4QWWC 4A37A 2JE8A 5D4QA 1AGDB 1BD2A 1CG9A 4GSRA 5CP3H 5KW9H 2H8PB 2FIRT 2IGFL 3MKKA 5CZRA 2Q2EB 1ZT4A 5K59E 4KAQH 3QHTC 4A2GA 1FAKT 5IBLD 3CDZB 1CTNA 4F92B 1CL7I 4P04A 4JY5L 2VYRE 1QFWL 4CGTA 1FVDB 4LOUD 4BH7A 3DROA 4UYPA 3HZYA 2Q8AH 1DL7H 1ZLSH 3VFTA 1U8OA 1Q9OA 1NAML 2FX7L 1FHNA 2F9BT 4NUJB 1MFBL 4IW4C 1N2RA 3IF1A 2A83B 4C59B 4BWUA 2VXVH 2W60B 1S5HA 3BUYA 4AQ8A 2BIIA 2UY7B 3BP5B 3PQYA 4NO2A 3IJYB 3T3PB 3FSVA 4N3UA 1VFOA 4JHWH 1LJMA 3IT8D 2R4RH 1HEJC 2AJ3A 5B4MC 3TXAA 1CFTB 3MLVL 4FYRA 3DTUB 1XGUA 1S7VB 3R8BB 5IT2H 5BOZG 2J3SA 4EQ2A 2ZWZA 2B0SH 3NFSH 5KYXB 2R23A 1JHTB 1GPOH 4NM4L 3WN5A 3AXIA 3I2CH 3LKNB 3VFPB 4ZZFA 4GEIA 4ODTH 2UY6A 3FQXA 1W9XA 2FUQA 3IMTA 3Q2NA 2C7UA 2X4RB 3EUDA 1WAAF 3WFBH 2DM7A 3AADB 1GMIA 4WHTB 5HGBA 2XWEA 4LE8A 2AQPA 3DJZA 4K3DL 1BQUA 3IMSA 4UQ9A 3MRJB 4F5CE 1XH0A 1ZXQA 3N06B 4TNWF 1DHKA 1OGAE 2VKWA 3TA3B 5DJXA 1XCXA 2GT9B 4LSPH 4XMVA 2WSDA 2ZOKB 2F53D 1I9EA 4HKZB 4KGJA 15C8H 4PB0H 3QIWD 4L1BA 4MD4B 4LHUA 4L2LA 1EZSA 5F89B 4G1EA 4DOHE 4GW4A 3CZJA 1WZ1L 4YXLH 1FVEA 4O02B 2PYEA 1AFVL 1XGYH 4R97B 2DDQH 5DGRA 5DSCA 5B8CB 4P4KB 3TNMA 1KIUB 2VRQA 1XHHA 1JGDA 3JT2A 4LEOA 4PJFB 3QVAA 1HWHB 2D7QA 3T0BA 3QG6B 1QSFD 1ZJBA 3QXAA 4GI9A 4EOWL 4XCCH 3R1GH 4PJ9B 1FNAA 4FA8A 4F9PA 3KPNB 4F7MA 1SXCA 4IMKA 2AV7B 2BPBA 3LEXA 3IU3B 4KROC 3WS6C 2W91A 2KLSA 2D3LA 3DX7A 4NXKA 2VUOA 1B90A 3G6DL 5BRQA 1JVOA 2YPLA 3Q2CA 2ZOTA 3GS0A 1W0VA 3OF6A 1S7SA 2QPSA 4J8RB 4E68A 4S1RL 4EN3C 1BFOB 3B3IA 3C60B 2G0KA 2ESVE 3FQ1A 4FFZA 4YEFA 3CFDB 4TSAL 1AZCA 4UINL 4TN9A 2ZCKH 1T0OA 2VJ0A 1MCRA 1JPGA 3H2PA 2QR0A 4FLOA 4X7FC 5IJVB 4K0OA 3HHMA 1CLYH 1IGTB 1T80A 3SDYL 2AXWA 4HUVB 5K9JL 4HPYL 1WF5A 4KXAA 1AQ8A 4L8SA 4U6YA 2VIRA 3NIDF 2GSMB 2ATPA 5EH1A 1NDMB 3IJ9A 2GSGB 1NJ9B 4JFEB 1AVAA 3L9BA 3RPKA 1AAJA 1XIWC 4X6EA 1IFRA 2FVNA 5SWZE 2E74C 5JZ7D 3QO1B 3ABZA 2IGLA 1VACB 2VDOH 1XXDC 4AKPA 3IJHA 4G72B 4OLXH 5BPPA 3B9AA 4LSUL 4AK2A 1ONQA 3RPIB 4D0BB 1CC3A 5FM5M 2D7PA 3HMXH 1J8HD 4HLEA 5ETUA 2DQIL 2EIZB 4KKLC 4OR1A 2VLMD 1EFXD 4JKKA 1EEZA 1Q0XH 2FB4H 5KBPA 4JFPA 1CIDA 2BY0A 3OAUH 4FA7B 1I85C 1RZQA 2FEEL 1F90H 3KYMA 4JFFA 4Y4KA 4X8JB 1B3IA 1FQ9C 4CSZA 1TKWB 2ZOWA 1NGPL 3VM7A 3L2LA 2B20A 3D2TA 5K1JA 5IESL 3L5XH 4NLHA 5FXCH 1GH7A 1KEMH 2XXCB 1YJDH 1N8OE 4DETA 2Z7UA 1IZKA 3RVWC 3G6JB 4PMEA 2IAMA 1MFUA 5C6TL 5IR1A 2DQGL 4P5TD 3P4OA 4ANKA 2F68X 3F7PC 4JG9A 1ZEAL 4TSBH 4IRJA 5EC1B 3MRIA 2AABL 1R4XA 1KCSL 1P4LA 1DDHB 1MKFA 1NCHA 3ALXA 4N20A 3VA2C 3DTDA 4CC0A 3BYTA 3KL3A 4DKEH 2KT6A 2N3JA 4QHKI 4G9DB 3PYCA 3S7GA 3DK0A 5E0FA 5K9JH 5DWUH 4LSDA 1TETL 4F5CA 5E8NA 3FO0L 2Z4TA 4X4YB 2V9UA 5L9DL 2PO6B 1MIEH 1PLGH 1RIUH 1YECH 3HR6A 1NCNA 4Z7UE 2OM5A 1OOAA 1EXUA 1R5WA 4DUXA 4AIEA 1FFTB 1KG0B 3O4LA 1MJJA 2P43B 1QLRB 3VXNB 3L4YA 1CF1A 3W5NA 4XCNA 2X7LA 1OE1A 1TVDA 3MJ8A 4RETB 4C56D 1DUZB 3IJ8A 3EFDH 2YXVA 5C70A 1YC8A 2M1KA 4YFLF 2GYSA 4LKXA 3X2QB 1YY8A 3MRKA 5I18L 1WHPA 1SMOA 3BI9X 2FECI 5E5LA 5IFHH 1F1AA 2R51A 4ZMZA 2JJUA 2OZ4L 2FH6A 4YZWA 3TFBA 2AV1A 3K0YA 3KPMA 3O6KH 1PZSA 1BMZA 1Z3GH 2X1PA 5LN8A 2ZYRA 2BJML 3II1A 3ULUF 2IFFH 4RDQF 2VERA 4WV1C 5A2KH 1UH4A 2F7QA 4N9OB 2ESVA 3QNYA 2NY3B 3L3KA 3NN8A 4U31A 2FATH 4BSVB 2GJ6E 1MY5A 1NUDA 5EO9B 3TZVB 1IE5A 4JL1A 4RGNE 1EJOL 4XOAA 4LVOC 5DHVH 5F3FA 4GBXD 2Z35B 5E6RB 4ZDHB 4IRZH 4OIFA 3ARBD 1W8EA 1K5NA 3S96A 2Y69B 4L8BA 4N8CH 4BIKA 4ODSH 3CX5J 1C16A 1T21B 2LOEA 1A7RH 4TPRL 1BQKA 4CADB 5CP7A 3T3PF 2XWBA 3J7HA 4JR9H 3F7KA 5SWZA 1ZA6A 3CFJA 2J73A 1C5BH 1M7DA 1T2QH 4JO3H 4U6VH 1ZHLA 4R5XA 4GUQA 3JV5A 3ES6A 1FZKB 2X53A 2VTFA 3L6FA 4ODVL 4NZJA 4M7LL 2GIMA 3UJIL 2DJUA 3G5ZB 3UAAA 5IB1B 4RIRA 1QVOB 1JWUA 4NO5A 4P59H 1MWAH 3WTTA 3ECWA 1PDKA 2O61A 2BY1A 3HG1D 4L3AA 5T1KB 4JN2A 3LNFA 4EN3A 1G7PA 3IF1B 5IOPA 1SVZA 1V7NL 2BX5A 2BVQA 3WFZA 4JDZB 4AJVA 4LLYA 3Q3GA 4I0KA 4PW9A 2E7LC 4AZ8A 2JKJA 2PYFB 4D0CB 4P9ML 4Y5XA 5EOCL 1I9IH 5FYJE 3TT3H 1KLUB 4NN6C 5CF3A 1FNLA 1JAEA 1KB5H 3K71B 2XY2A 4TL5A 3TWYA 1I3VA 3L5WB 4E36A 1C1EL 5C0AA 4HC1A 3TC9A 1T66D 2AP2A 4MBOA 4U33A 3DOHA 4PBDA 3AU1B 1DYZA 3MJGX 1A5FL 4WSJA 2M2DA 1GW0A 3MR9B 4N2DA 5EO1A 1CDIA 3CLWA 2WTOA 5GGRA 5SWQB 4PJFF 4FXGA 1BZ9B 4IEFA 4W9HC 2ZYIA 2CDFB 3MLRL 3LY6A 3TH2T 5D2LB 3LQMA 2B3IA 2EEAA 4U3SA 3OR7A 3ZOAA 4E9VA 3FN3A 4P23A 3GSQB 4GW5B 4NKOB 3HZMB 2V2XA 1NBYA 1I1AD 4YVNA 5AENA 1GTNA 1A1MA 1HX0A 2LAAA 3GBLA 3ZUCA 1T22B 4S0HA 1V3JA 4N0UB 4B9JA 2Y7OA 2ZUWA 3FH7A 1F4YL 4FOMA 4W4OC 3UEQA 2FJFB 4MYWB 5I0XA 2WQXA 2EUVA 4ALAL 4GW4B 3I85A 2J6EA 5CIPH 5D2NB 3DX0A 3VG0H 3F3HA 3VRLF 4E9WA 2DLIA 2P5WD 3PLYA 3LH8A 5KVMC 1U8IB 1SBSL 1HU8A 2MMXA 3MXVH 5D93B 2DIAA 3VXQA 4X5QA 1N10A 2NT1A 2ZKXA 3UPRB 2CHXA 2FJGA 3C6LC 3ARZA 4HALA 3RFRA 3S88H 1BXUA 4OF7A 5D1ZD 4K8RL 3PWPA 4FA6A 5ENWA 5I0WA 1Z9SB 3W82A 4R0LB 3BVTA 4O5LH 1USQA 3ARED 3OHXA 4FXTA 3VFUB 1TPXC 5EC2B 3GHBH 4M7JL 2NZIA 1CFNB 3V95A 2IG2H 5E23A 3FSWA 2AAVA 2WK2A 3T8MA 3QS3A 2GJ6A 4H26B 1ACXA 3NP4A 2JKSA 2NY6D 3EJQA 1S7SB 2AEOA 2FWSA 1EHLH 5IROC 4PRIE 3TBCA 5IP4A 4JDVA 1YG9A 1P4BH 2CLVA 3C2SA 5F96L 3U30B 3VSVA 4IRSC 3A4EA 1NPUA 1JPST 4GAJH 4BINA 2EXYC 1DQDH 2P8LA 4EI5A 7FABL 2YC1A 2WBJC 1FL6B 2BOCA 1T89A 5I5JA 2XICA 3AS0A 3B43A 4FQLL 1FNEA 4JPWH 2JKIS 3ZJAA 3UXFA 1SF3A 5GS3A 1K4DA 2OXHA 3WELA 5IB3A 2XC8A 8FABA 1V3MA 4JPIA 4QRPB 1J1OL 4JN1H 4ZX5A 2ZF8A 2Z91A 3EBIA 3NVQA 5C7XH 4Q9RH 1MZZA 3RWHB 3D3VD 3CVHL 5IREA 2Z4QA 4F2EA 3ZKMC 4W9ZA 3O3EB 3C8DA 4XVOA 1TJIH 2YA2A 1H15A 3JUYA 4NO0A 3DHMA 1A14H 1S8DB 4HA1A 4FQ2H 1ONQB 2XPGB 3T5WA 6PAZA 3BPNC 3IRPX 4FULA 4BKTC 5DJAA 5HJDA 5JPMA 1ZGLB 1VLXA 2EKJA 3A67L 2Q6WA 4J4PD 3DETD 2X09A 2NYKA 3OLIA 5AOIA 2HLAB 5F7MC 4WWID 1WZAA 5CU5A 2MCAA 4H1LA 4GT0A 5LBGA 1AACA 1U21A 5GS2D 5EZOL 2A6IB 4NCC2 3NJFA 2EZ0D 3GJFK 2ZXAA 3FU7B 2NUTB 3AVEA 3DV6B 1HXKA 4KX9A 1K72A 1YMHB 2Y25A 3X13A 3WXWH 3WXVL 5JHLA 1LO0L 5JXAL 2X3AA 4HS3B 4QOKE 2K70A 4IBVA 2X9YA 4L3ED 2DS4A 2DZEA 4K15A 4UM9A 1KNOA 1U92A 5H37G 4PTTA 2QQNH 2H2PD 2EO1A 3WIIL 1CGVA 1QUPA 2BW4A 1YNTF 4PY8J 5CSZB 4LVNB 1CICA 3FU0A 1N19A 1RVFH 3QDGB 4KXCA 4F80A 5EBMA 2AK4D 3ATBA 1SY6A 1MFMA 1U8KA 1GRWA 3CDGB 1FO0L 3MA9L 3EBGA 3IFLL 1NCIA 2VLLA 5KSBB 2HTLC 4HG4J 3SPHA 3V0DA 2RAMA 1KTBA 2VUKA 5F3BA 1FORH 5LAXA 3TX4A 3D18A 1OGAB 2EACA 3IJSB 1G7IA 2UZPA 4JHUA 2HKHL 3K4ZA 4GQPH 4HPOH 4N85A 4KZDH 3RI5K 5D7LD 4KK9D 3DVNA 5AD0B 1WBXA 3GSOA 5KVFH 1AC6A 2MHAB 1TTRA 4DOHB 2EYSB 1EHXA 3LN5A 3KHOA 2ZAGA 1LE9A 5JHAA 5BUGA 2OJEA 1QSEB 4ZUWB 1HHKB 4GKZB 5KBMA 3QDMD 1MELA 4Q6IC 4KI5D 4ZS6D 4NP4H 4HIJA 2GITB 4ZAKB 3QXUA 2R4SH 3V5DB 5CGBA 4K5LA 2RQ8A 1VADA 4WUUB 2FJHB 4PRHE 2PPFA 2Q3ZA 3B8YA 1J48A 1NM9A 2P52A 3FTGA 5EU3B 5K5YA 4FQXD 3WU1A 4ZFOB 5D96C 2E8ZA 2WXGA 4ICWA 5FW6A 4GAYB 3K6DA 3DYMA 4K9EL 4JS7A 4AC4A 1KCWA 1RZJC 4DGIH 3L3KB 1TMQA 3SJVD 4TUOB 1AMXA 3FXIC 4JG0L 4A7TA 2QHRH 2WKOA 3H56A 3QUZA 1UVQA 3QRGL 1B0WA 1NEZB 4FQQB 4LNRA 5HDBB 3ZYIA 1EEQA 2YMOA 2QVIA 3DOSA 1T1WA 4HIHA 2ZCHH 3QZWG 3S4SB 3RFZA 2IBZX 1NIBA 3KYNB 5E2JA 3BGAA 4H25B 4NJAL 3UC0L 4DEPC 4W4OA 2G2RA 3MJ9H 2NTFB 5GGVH 1DJXA 5AYTA 4CL7A 3DPBB 4HD9A 2WLMA 3FB8B 5I26A 3Q8AA 5I15H 1S3KH 1JF1B 4YSTA 1TXKA 2VAAB 4KTDH 3UGUA 3OR6B 3AM8A 3HI1B 1AGEB 4JZNA 3CFQA 3QWQB 4CJ1A 1CL7L 2NYZA 3RIFF 2WQSA 3T0ED 3RNKA 4DN4H 1RUML 4Q4EA 3CN2A 5IUSA 5EEVA 3GF8A 3MZGB 3ARWA 2FX9H 1KCRH 2Z8WC 2E9JA 3NSXA 4UT6A 4JPKL 4WAFA 4Q97A 3D1MC 2GUOB 4NUGL 2C34A 2GTQA 1T7VA 1I9RH 5E8PB 5D6CB 4P5SA 2FX8H 2PW1A 1SOXA 5DO2C 2HYMA 3KPSA 3QJOA 3D0VA 3AG3B 4GSXA 3H9ZA 3ILQD 3GBNL 4Y9FA 4B9YA 3X1BA 2QLYA 1UCBL 4PVNA 5IROA 3PABB 5I1GL 2XBDA 1LDSA 1V55B 1BBJB 1J18A 4LLMA 4X5XB 3LZPA 2CHZA 3B2VL 5C0FA 2M26A 3OJMB 1YEEL 4WW2B 2FEJA 2VXQL 2XVKA 5D2LF 3ZTEA 5D1QD 4OIAA 5DUML 1XBRA 1JVLA 4KKBD 3B2DC 4H20L 4N1HB 2Y1YA 1AG6A 5DJYA 5FLUA 3HBQA 3OAWA 3WO4C 5LBSA 1RZGA 2BCKB 3L4VA 4ORGA 2OV0A 4QTHA 1XZWA 5AZ2L 3OPUA 1IFGA 3RWGA 3WY4A 1WCQA 2V37A 4L4VE 1XIWB 2CIIA 4IGBA 4UZUA 2OLDA 1WDAA 1PD1A 1J1XH 2VXTH 1QASA 2BS9A 5DJ8B 4UTBA 3IU4L 1OTTC 4O9HL 2B1HL 2V2TA 4WTZG 3JYCA 4GINA 3TIEB 2OMBA 3ZIYA 5TQ0L 5T5NF 1CFQB 4YZFE 4Z7UB 1OSPL 2VQUA 4Y9GA 2C9AA 4GFXA 4K7FA 3NSYA 1OAXL 1RUQH 2BNQD 4XPFH 4KHXH 5JQ6L 4HXBH 2GK0A 4BSWB 1IGIH 4G6FD 4YFEA 5FKPA 1CXKA 1CZ8H 2DLFL 1O6SA 1ETA1 1Z32X 1I8KA 1YZZA 2H3XC 3QPXL 2DTSA 3SBRA 3VXMB 1R0AL 3PHSA 1JPFB 2QKIA 3DRQA 4Q4IA 5K9OA 4OSUH 4UTCA 5F21B 5F7LB 3MRCB 2VW4A 4R7VA 4DZBA 2O26U 1Y6NR 4WWKC 5C0BE 1SDDB 3CSYB 3P11L 2YGOA 2Z9TA 4JO8A 4YJZL 1JTTA 4JKPH 4PRHA 5HHPA 1MVYA 4M7KH 3E9UA 4XVTH 1L7IH 4JFQA 3OXSA 2XN9D 4X4XA 2Z64C 4AX3A 1KJ3H 1TQCC 1HAUA 3H42H 3SKOB 1CWVA 2IPUG 5IBTL 4Z78A 5DRWA 4AKQA 5LLIC 1T04A 1W16A 2IPKA 3CFKA 1G7MA 4XI5C 1MY7A 1TTGA 1UFUA 4JDTH 4L5FL 1MFAL 1X9UA 5HHXH 4KZEH 1CR9H 3UACA 4AIZA 1WWWX 2GI7A 2LU5A 2AMUA 4S0TD 3LIZH 4J28A 5I2IB 3P4LA 4NUPA 1ZPLA 4F8NA 3E3QC 1OAZH 2OQJB 2R29A 3EDJA 4I7ZC 2AXHA 5L4JA 5GZOC 1J5OL 3TBYA 3HN5A 2W88A 5D7KE 2OMZA 4OZFG 1JMXA 4RSVA 4ZW5A 4HYTB 4L9LB 3NOIA 1BM3H 4WU5B 3QHZL 4DP6X 1TJXA 4HBCL 5C71A 4ANWA 1FNEB 4BRVA 1CFVH 1P2CB 4GLRI 3BGFC 4OM0H 1LGVA 2XWDA 5IB3B 3GRWH 4LIQE 3APDA 3KAAA 3MGOB 4IHOB 5H4ZA 4J3OG 1U6AH 2KERA 4CMHC 3AROA 3P9MA 3T2OA 2X2HA 2AW2A 1RZFH 3W1ZA 5TJWK 5F7KC 3UAFA 2CNYA 1MREL 4BE6A 1KTDA 3BOVA 3E6FA 3CUPB 3EHBD 2ZWLT 4AENB 1IV8A 4UT9H 1AI1H 5AVSB 4WV1B 5C09B 4JFZH 5F1KC 4MJIB 3KPPB 1YDPB 2BH0A 3HC3H 4YFLI 4WI5A 4H1LB 4QRSB 2BNRE 3KDMA 4R4FH 1D5RA 1LMIA 1OOWA 3BAEL 3KPRB 4S1DC 1UUNA 2VLKE 4JM2F 5CILH 2O93L 4LVOB 3VNZA 1A66A 1TUPA 1TITA 4X4KA 1JSYA 3BKML 5DC4B 1P5UC 3V7MA 3MLTA 2Z31C 1X5KA 4FD0A 4HUXB 4M1GH 3SPGA 3PXJA 1LHZA 4XBPB 3MRDA 5C07E 1RJLA 3V9CA 3FFCB 4P3CL 3INOA 1SYVA 1ZT1B 3KBFA 3FSOA 3LN4A 5ADPH 3IXTB 5BOPA 3EOBA 4L4VA 5I1LA 1I1FB 3L3JA 3H4FA 1S7UA 3BE1H 5JDJA 1RJYB 3LPGA 4Q52A 3NYKA 3PWJB 5KBDA 5EBMB 4JANA 2EO7A 2F8IA 4OGXH 1U8KB 4B96A 3NTCL 4N86A 2GTWA 3U7WL 3WFEL 1BDYA 2R2EA 2VMFA 4BFGA 3CSTA 4JZOB 2RB8A 3EH1A 4HLZH 4L4TE 1RLWA 4Q2ZA 43CAB 4GJTB 1EHAA 3VVWA 4M6NL 4NBXB 2F8XC 4P46B 3F7VB 3FCGA 4GRWH 2VR8A 4O2FB 3K4DA 4QTIH 4ELKB 5TQ2L 4YDLB 2VDML 5HYJE 4EUPA 4ZPTA 4OJCA 3JWNC 4KRLB 4GW1B 2R27A 4OF6A 1AO7A 1LE9B 2DQHH 3FS9A 1ERNA 2F54D 4GP8B 3EW3B 1JRHL 2HTKC 3BZ4B 4NN6B 2MH4A 1XGPA 3INUH 3DURB 2L04A 3AMLA 4NX0A 5G4NA 1A0QL 5HDBF 2ENYA 2Q8BL 3S3JA 1D5ZB 1UM4H 5KSAC 4NKQB 2IO5A 2PP7A 3GLDA 4J12A 32C2B 4RAUA 2WD0A 5CGTA 5FS5A 2MOGA 3BPCB 4FADA 2ROXA 1ECZA 4W70A 1DP0A 3VX0A 3C09C 4HLJA 3EJPA 3SSGA 3IPFA 4QRFA 2A6JA 1P7QD 1SJEB 4ECNA 4UQAA 2NZ9C 3AFLA 4N2NA 2DWSA 1UXSA 1YHPA 4C4UA 3OJ2C 1KV3A 2ZICA 2JCCE 1SMAA 1U8CA 1KFAL 3L7EA 4PRIB 1LK3L 3MRLA 4RX4A 4JFYA 1IBGH 5D7EA 4Z76A 1UURA 3A6CH 1AGCB 5IVXE 4PFEA 1FF5A 1FBIL 5DRNA 4YX2L 2ED6A 1CGYA 3W9DA 3MV7E 2EH8L 4PG2A 3JWNE 1DN2A 2VDRH 2D7MA 2CGYA 5DMIH 5FYJU 2P8MB 2LV4A 2ZXCA 2OYKA 1KXHA 5LQBH 3FOMA 3GLZA 3WFDH 3FYEB 1RUPL 3NAAL 4I5BB 4WW2F 1KGJA 1X7SA 3C6LB 1ZXKA 1YEIL 2QVKA 3HS8A 3TVMB 2Y23A 1PG7X 3MJ7A 1HS6A 2WM0A 1OAYH 4WNJA 5IW1B 1FZJB 3U0TA 3U79A 1FAIH 1XEUA 4PIRF 4Y1AE 5KVEH 4DGVL 4LEEA 5IBUB 1YYLL 1KTLB 3W81A 1IZJA 4RGMC 1TSHA 1NICA 1TPXB 4HCGA 4NN5C 2YD4A 1N59B 1MNUL 3F04A 4DPCX 2A6DB 3O41A 4NQED 1D9KA 4IJ3C 2DIBA 4XE5B 4H8WH 1F3JB 5MERB 5C0IB 1GS6X 1KBGH 1YAIA 4LSVL 3P9LA 2YD9A 4M29A 3RX5A 4F37K 5GZOA 3FJTA 1OP9A 4X0KB 3KM1A 4IRSB 4JPSA 3NP3A 3V4PA 3IFNH 4QOKB 4B3EA 1A9EB 2AXGB 4HSQA 4MNGE 4ORZC 4JO2H 5C07A 1OY3B 2KLRA 2WBJB 4AYSA 3B2MA 4MB5A 5KVGH 2DLHA 2R83A 5F7FA 3SBWC 5C86A 5AWNL 5D1XD 4QTHB 1F6FB 2DQJH 4ZOCA 4P49A 3FRPA 5GGTA 3FT0A 2BO0A 4DP1X 3BP6A 4NHUA 3ZX1A 4ETQB 3HOGA 5BV7C 3NZUA 5EEWA 1KCLA 3M17B 3GTTA 5FA4A 3HG3A 1MDAA 4CVZA 1KUMA 4LPVA 2XTJC 2EABA 5E2WL 3ZL4L 1OAKL 1VEMA 5IFJB 1TU2A 3WY2A 3BPNB 2E9WA 4K3HA 3RTQA 5FO2A 1XSOA 4LLWA 4WWPA 2ICES 1YYML 5G4OA 2AJSH 3OKYA 2K6YA 5D7JD 3L95B 2X42A 2PN5A 1BVZA 4PJBB 1SEQH 1ZHBB 1IM9D 3W9EA 3V4VL 5LG1A 4X4ZA 4CU8A 5GS2H 2J20A 3MYZA 4QXUL 2NYYC 4YS4A 2VLRE 2YFOA 1L0QA 2G9HB 3UYPA 1D6VL 3FZUD 2VERN 1MI5B 3BWSA 3N91A 4WFED 4I87A 5BRPA 2HRGA 2Z31A 5K9OB 1UWXK 2FHFA 1ZT7A 4LRNL 2PCPA 1K8IA 1SXAA 5BS0D 5B22A 5GSRB 2C9RA 3MOAL 1Q0YH 3EF7A 3OXSB 3GUTB 3NCMA 1Y7VA 5CBAB 1BFTA 5KWYC 2AKRA 4BELD 4R4ND 4YHNA 1C8PA 4F58L 5DRWB 3MGTB 3WLWD 3BRDA 4YDJA 3NEXA 3WKQA 1IGFH 5ALCL 3WJMB 3BH8A 1J9TA 3RWJB 3BMVA 1ZTXH 5I23A 4IDLA 4PI2A 4KQ4H 2W0KA 3BO8B 5IVXA 1YLBB 4OGAD 4D8PB 4EEEA 3K46A 1CDBA 4KOBA 1QX1A 2A73A 1LK2B 1U3HA 1QRNE 2BC4B 1INQB 1MJ8L 1TQBC 4PJ5E 1KYUA 3HIZA 1KB9J 2DQDL 2AC0A 2NQ3A 1F1DA 1A3ZA 4GXUM 1FV1A 2BP0A 3T8XB 2I85A 3ULAB 4OZIE 3PP3H 5LXVA 1OAQL 2HT3C 1L9RA 1CE1L 3LPOA 4H5SA 4NBYB 2Z65C 1E9OB 4G59C 5F0PB 5HYSG 4Q6IB 1GGCL 3TPUA 2WNKA 1TVBA 4XBEH 5KSAA 5B3JF 4Y1AA 4AW4A 3V4UL 3U9UA 4I2XE 4AZUA 3QPQC 4FJZA 4Y2OA 2J1YA 4OKDA 4X8CA 4MQ7B 1WFJA 2BINA 3TGXA 1S3RA 2JB5L 2FGWH 4JFXA 1UM6H 2X4OA 3DMMC 4FDWA 2DPKA 4JY6B 5DD0L 1AD9A 3WNPA 2CJ3A 4QJ4B 1GY1A 3KWTA 2R2BB 3OKMB 4LBEA 1IM3D 3QH3A 3V5KB 3VTAA 4X6DB 4ANVA 3GSNH 4ONFL 3D08A 1AE6L 1AG0A 1WWBX 4G8FB 4YHKL 2DBJA 4MNGA 1QNZL 2DYPB 1WEJL 4DEPB 5IB2B 4XN9A 1BZDA 3M88A 2L8AA 3IDMA 4O58L 1O6VA 3KVPA 4FZEH 5LBSL 4X9FA 5I28A 1U2CA 1KENL 4YSEA 3FFOA 2ZWNA 5KYYB 1BW8A 2JLLA 3ZTCC 2R0ZH 4MHHI 4Z5RA 2R0LL 2XWJB 2JI1A 4APQD 4UIKH 3C6EA 2YZ8A 2CBTA 5C08A 3T2NL 5KZCB 2P9RA 4GP5B 5J6GB 4X6BB 1HSBA 2AF2A 5DYOA 3V0JA 2KKQA 2KI6A 4YHOH 4NZFA 3VYOA 2A1WL 2Q3XA 5I19H 2XXMB 1IB5A 4OLVH 5BRZE 5C0DA 5EU5A 4EVNB 4KK8D 4HH8A 3ULVF 4G7YH 2NNCA 1IKNA 4OBSA 5BJTA 1Q9WA 2A77L 1JXFA 3QNXB 1MFDH 2VLRA 1NFAA 1PD0A 2GC4C 2QT6A 3ISRA 3SYCA 2DQEH 1RP9A 4OF0A 1UB6A 2QPUA 2YUZA 1MQKL 3LRSB 2QQQA 5KOVC 4N2OA 4Q74A 5C0BB 4O00A 1Q4NX 4N8PA 3ETSA 3ECQA 4JM4L 2PCXA 1HYRC 2R15A 1HK6A 3RRQA 3PAYA 1JPTH 4PB9H 3SBWA 2OYPA 2ZXDA 5J12C 3H2QA 4M43H 1W72A 5T3ZE 2Y72A 4FNLL 2WKLA 3QUMH 1N7ML 3S3DB 3BQUC 3JWOL 1VZIA 3I9IA 2A6JB 1YNTA 4OCYH 5HGGS 1RSYA 4M48H 2C1OA 5EF3A 1WLHA 4BA8A 1GCYA 5DQDL 4F7EA 3MROB 4QEGA 4XVSL 1AHKA 1FYTE 5LN4A 3WMPA 4ZS7L 4M00A 2XN2A 3QUYC 1QRNA 3D85D 3BHBB 4M93C 2BIPA 4PJ5A 2PUQT 4Z3FA 5TDNA 4LLDA 2EE0A 1E5UI 3LCYA 2ALWA 1KCVL 2UZIL 3H7LA 3OG6B 3BCFA 3HLAB 4OFVA 4F24A 4OZIA 3ARFB 1OSZA 2YBGA 4FKEA 1JBJA 2X1WL 4RFEB 5GRYA 2ALAA 4R90L 3GXIA 5JXEA 3UZEC 3KJ4C 2YSSB 2X44D 4Z0BH 1FG2B 1E43A 4GT7A 4WWKB 2B9BA 4UQ2B 1F02I 4RBPH 4JRXD 1ZVSA 4I0PC 4X8GA 4P3WA 5J8OA 5IZ7A 1J12A 2BVYA 1U4FA 4N2GA 3UJJL 2FSEA 3MTRA 1MJUH 2B8OT 1TQCB 1YPZE 3C8KA 5CJQH 3T77B 2WNWA 4PGEA 1HINH 2RIKA 4UV7H 3F58L 2GEQA 3DV4A 4Q9CA 3L3HB 5INCB 5IMKB 3K5RA 1ASOA 1D2OA 2RCSL 3IDNA 3BUTA 2BVTA 1O7DC 2CKNA 1FFPA 1ZCRA 5KG9B 2FO4A 1J05A 1A7BA 2BNRB 5IB4B 3MODL 4NZTL 2VLKB 4NT6A 2VRAA 1AR1D 2ENQA 3IGAA 5MEQA 3UBHA 3S3PA 3TCLB 1FIGH 3N1GC 2A38A 5HYQB 1AQHA 4YE4L 1YEDB 3L3GA 1OKEA 1HZLA 1FA4A 3ZTJG 2D9CA 4GO9A 5D9SA 1BQHB 4JGJA 4TVPD 5C07B 2VN6A 3I6LD 5D70H 2DBLH 1AH1A 1F1GA 1J10A 2CBPA 4PJBF 2N01B 5ESAA 5DZNA 2BHFA 5BZWB 2VXSH 3BGFB 3C9NA 2EYTB 3LH9A 3TIDB 1SVCP 3VWJA 3QI9A 4KVCL 4MS8D 3PL6B 2VE6A 3AWGA 1NWOA 2BZCA 1A8JH 3PJSB 2WBXA 3BP6B 4ZW6A 3IDIA 4U1KA 4ZPVA 3TJEL 1ACZA 5I17A 1HI6B 3QWNA 4CMHB 4HDIA 1OF0A 3SGDH 4PBVC 4GFTB 2UZYB 3ESMA 4G8GD 4L4TB 1L7TL 1MCPL 2JI2A 2UUDK 4BXSV 5BRZA 5I30L 1YMMD 5DMGD 4AV5A 3BH9B 4PJGE 12E8L 4HX1B 1UACH 4C8XA 4OCSH 1AYOA 1IAIM 2Y36L 5JPNC 3AXLA 5LNEA 4QGYA 5HYJB 3FT4A 4P9HH 1T1ZB 1G9NL 1NDGB 5FGCE 1HAWA 5FOBB 2JQAA 2OR9L 1YN6A 3CG8A 1MG2C 3HE7B 1IAOA 3FHEA 4WI7A 4JQIA 1MSPA 4NB7A 1IC7L 3LH2H 4GXVL 4QI3A 1P5UB 2A74A 1B6DA 1FGNL 3FULA 3SGKC 1E28A 4KTYA 1LDPH 3U2SB 4AUYA 3IGKA 1ETZA 1QSVA 2AEPL 3EFFB 3EYVB 1YJDC 3V6FA 4ABUA 5JW3H 1I7ZB 2AGJH 1ZY9A 4EDWL 5CD3A 3GUFA 4ETYA 2AVGA 2FYVA 5EIQA 2DYRB 4NPKA 4H8QA 4NO3A 1P84K 3ABKB 4HJ0D 4HJ1A 7TAAA 3WTSA 4CN4A 5DFVC 1XCQA 5TK2A 4DGYH 1XDTT 2WXRA 4RA0C 1NL0H 3LS4H 5BXFB 2NY5H 4XP1H 3PCYA 4IIQA 1U3ZA 4H8VA 4MA3A 3JTBA 5CP3A 1IKFL 5F72S 1AXSA 4BDVA 5J6SA 4FL4C 5DHYB 2JCCB 1BD2D 1VFBA 2Y7QA 1MCCA 3CZUB 2COQA 4LSSH 5I8EB 1R3IH 2EEXA 4FFYH 1P9MC 3DSNB 4B3VA 4OW6A 3ZE0B 1UWEH 2F58H 2QSCL 2G4EA 2X70B 1URIA 3PHAA 3FQRA 1CN4A 5IWLC 2KBGA 1CGWA 1VIWA 1QUNA 2BZDA 3MV7B 4XPGL 3VCLA 4F33A 2OW6A 1A1NB 1EX0A 1LO4H 2ITFA 2O6FA 1UD6A 2RJMA 3EO9L 2F74B 3PRZA 3DECA 5IQ9A 5FUOH 3V0WH 3WSQL 3EJZC 1Q9KA 1NGWB 4X6DF 4GRLC 5IHZA 2VGLM 1G4RA 4K3JH 8CGTA 4RCAA 1MDTA 1ZV2A 4DZ8B 1T3FA 1YEJH 1ZE3H 3PQYD 1NH6A 2HFFA 5CWSA 5T1MB 5CBEB 3CVIH 2W65B 4DAGH 2PETA 4GQQA 4DO6A 2I5YL 3BKJH 1MCWM 2FQEA 5D7SL 2CSPA 3LRGA 1FJ1A 5AVVB 3PNWB 3FU5A 4MVBD 2EADA 1JDCA 1AD9B 2WN3A 3STBA 4UILH 1HH9A 2NDGA 2RD0A 2ZYHA 1NCCL 3VD1A 3WNIA 3ULUL 2IGFH 3QJHA 1MCDA 1TOXA 2A0LC 1NCDL 2ZNXA 1HDMB 5C9JA 2MQ0A 2YKLH 2A9DA 1SOKA 2CDEA 4PI0A 4JY5H 5CZKA 3SO3C 2VLJB 1QFWH 1TJGL 2PABA 1KTJA 4WHDA 4CA4A 2NY0C 3B2UD 3SDCC 4YPGB 2YRLA 3GMQA 1N8ZB 4XTRC 3PGDB 1NAMH 5LCVA 4XBGA 3EO1B 5CCJA 5FHAL 3NBNA 4YHPA 5TPWH 2GAZB 4KDTC 4CU6A 1JUFA 1FI8C 1X5IA 4OIBA 5HGAA 4JRYB 2BXYA 4LHUD 2WMPA 3CFCL 1OB0A 5DA0B 3AITA 3BWZA 4RBPK 4BH8B 5A2AA 5CEZL 4XCYA 2GBUA 2PYED 4FTVD 2FE0A 3T2LA 3RUGE 4JFOB 4BFEA 2OBGA 3MLVH 3C6SA 4FNPA 4CU7A 4D0DA 2YPKA 4MNQE 3QWRA 3BGMB 2JKTM 4PJGA 3KHQA 3LAFA 2B1OA 5GGSB 2YSTA 3FN9A 1HXYB 4NM4H 3S5LG 3EG9A 1QR1B 3QIBC 1A6AA 2BSRA 1LO3H 1OP4A 5DZVA 3VXRA 1X7TA 1INEL 3HC0A 1DEEA 4CC1A 4J2QA 1DVYA 3WHE1 2E47A 3SIKA 1SNRA 1VB9A 4LCIH 4DESA 2O72A 2FT7A 4YNYA 2YPLD 3OF6D 2VDQB 4R96A 1PLAA 3QZOA 4K3DH 4GG8A 4PJAE 2WQVA 2UYLA 5ICYB 3APCA 2ADFL 4JM2A 4OI7A 2EECA 4S11A 5E6IA 1PQZA 1PZCA 2H41A 3WAKA 2P5EE 3RIAF 3WENA 4BZ1L 2K6WA 4ADGA 4LAJH 5E8DL 5C8JA 3LQZB 5BV7B 1DJWA 1J11A 4N2LA 2ICEB 3IDJA 3LXUX 3V10A 1RULL 3ZDZB 3L3DB 4MMZC 1WZ1H 1IAKA 2W9LA 4P2QE 1AFVH 1JF6A 2XTJB 3D0LB 4HPHA 4YVUA 5K39B 1KPVA 2R0WL 2NW3B 1U8PB 3VI4E 5KTEH 1P6FA 3SY0A 3WFHA 4F7EB 1WITA 4O51A 1XCTB 4O02L 3MRBB 1A3QA 2WW8A 1SLWA 1XR9B 4GG6B 3HMXA 5GGUA 3TBTA 2UZXB 3V7AE 3CH8A 2GHWB 4QRRB 1BVNP 4KTEL 1EA9C 2I7SA 3PIQB 3HG0A 4PWGA 4HT1L 5B39A 2EKSA 5PAZA 1RIHL 2QADC 2VSMB 4LF3B 1KZQA 2WIMA 4JFFD 4Y4KD 1ZLWH 5IFAH 3AWFA 3HFFA 4U7MA 4L29A 4S1RH 1CVSC 3ESUF 4JAMA 4KUCF 4DN3L 4B9PA 1GVIA 5B38B 3GGWB 2CUMA 1VGKA 4UINH 4I2XB 3ROLA 3SKMB 1CYGA 3OLGA 4Z0XA 4PJ7E 3RYMA 2IAMD 3BT0A 3EUUA 1HKLL 3SDYH 5E94A 4AMKL 5C2BH 1BGXL 4IRJD 4HPYH 3QHFL 9PCYA 2OPCA 3M1OA 4KX7A 2VZUA 2WOBA 3ERXA 5DUPH 1AGFA 4ELME 4KBPA 4P5MB 3I6KB 4YAQB 3AW5A 3FUFA 3QAZC 4N2IA 2ENSA 3VGHA 1ML0A 1NOLA 1AQDA 5MEQB 4PJHB 4PGJA 1CLVA 3MOQA 4ZFZB 5IWLA 3TYFB 1TQBB 1PCSA 4LSUH 4U1MB 4ZG1A 1YA5A 5D9SB 4A6YA 3VFVA 3UG5A 2Y6SD 2DQIH 4LKCB 2HSIA 4GRLA 3O4LD 4P2OB 1BV8A 5EU6E 1ASPA 1KPUB 1QBLL 1UJ3C 5E9DE 5B4MD 3JV0A 3RUGA 5IESH 3ZSTA 4AXWB 1CFSB 2DICA 3LZLA 4N5EC 4QF1A 5DYFA 3VE0A 3OTTA 4MNQA 3MBEB 3IDGA 5I17B 1MH5B 1EXGA 1Z0MA 4IS6A 3DMMB 4X98B 2DQGH 1KIQA 2D0GA 3BN9C 1KJ2H 2J44A 1ZEAH 2CRZA 2JQZA 4AYDC 4MB4A 1VGEL 4GH7B 3VDCA 1NCTA 1FL3B 1JDDA 2AABH 4PVLA 1V8HA 1KCSH 3ZMEA 1S7WA 1ADQL 1JGEA 4ZO8A 3ASOB 4PJ8A 3SDAC 5DZOA 2WLLA 1KIRB 1XGTA 3GLAA 3JTSB 2NY7H 1GTFA 2NSXA 3S35H 2Y07L 1BG1A 1H8SA 1LO2L 3IFOB 3ZYJA 1QATA 4K94H 4K7PY 4PJAA 1TETH 2ESVD 3G9AB 4LCCC 2MCG1 4X99B 3SDCA 2QELA 1X5HA 3ZE0F 2NY2B 4AQAA 5L9DH 1DVXA 4OU3A 1E28B 3BX7C 4X80L 5E5RB 4IRZA 3TCXA 4TUJB 2P5EA 5JHDA 2AQ3A 3P3SA 3KLAA 2VM3A 4KDTA 3FU6A 2HRHA 2GCYA 1AS6A 3D4ZA 5KS9F 1M71A 1GMEA 4ZOAA 1U9KA 4OZHB 1V05A 4JUSA 4P2QA 2PXYA 2NY1C 2EJ1A 3T2QA 1C7TA 1XD0A 4FLRA 1VRSA 3MNWA 1OK8A 1ETJA 4KKAD 3SKJL 4DEWA 4HUWB 3GMLB 2C8NA 4XOEA 5SWZD 2OI9C 1FYTB 4HEPG 4ODBD 5AAWA 1BVOA 4QHPA 5I18H 4LP4A 1GCFA 3A6OA 2ZSVB 3H3KA 3QIBA 1J0JA 2OZ4H 3I9GL 4JDEB 5IBLC 3T0AA 1DBBH 1MWAA 1IVLA 4KROD 5AOZA 3L7FA 3LEYL 3WUWA 3JWDL 4LOUC 4I18B 1A6TA 1WGOA 1M6OA 3IMWA 2BXZA 3NH7L 3LDBC 4Y7OC 2QSTA 4ZFFA 4GI6A 4R83A 4EN3D 3BDXA 4LDOB 1I1RA 3F65A 3IBOA 2R1XB 3KH3A 1QW9A 4PJ7A 4XAKE 1EJOH 5AB0A 4IKJA 4W9LC 3NQKA 5DD6A 1KB5A 35C8L 3LKOA 3A22A 1YPZB 3OLEA 4HCRA 4F1ZA 3OSKA 2IADB 2ZUYA 2FWOA 3HZKB 3QR1A 4F2FA 1NMCC 3BQUB 2R69H 3AZUA 1S7RB 2ZSWA 2NX5A 1ZHKA 2W38A 3BLBA 3Q6GL 4ELMA 5C0AD 4YUEH 1D5XB 4Z7OE 3GD1C 5LO7A 3CHPA 3QDHA 3QUYB 4WZ9A 4RAVB 2OJZL 3QFDB 4M93B 1JZ8A 3SE8L 4U6XB 4KJYA 5L2JA 3KCPB 3S3BB 3FF8A 4M7LH 4KY2A 3UJIH 1G0DA 4K73A 3GT6A 4IOFD 1EDHA 5L8KB 5EBLB 2NT0A 1QFOA 3MRPB 2HVBA 4WKZA 5L2KB 4KVNL 1KEGH 4P23D 2H1LM 4Q9BA 4WO4B 1RHHB 4ABVA 4PV9A 1QNIA 3ARDB 5EU6A 4QJ5B 5H94B 2VMDA 2XX1A 2D03L 5E9DA 5KVFE 4HV8A 4YHPB 3PHQB 1V7NH 4KZCA 1P4UA 4G1MA 5F9OL 3VSTA 1TZIA 4I0PB 2WMPB 1GZQB 5E2TL 5FK9B 3X1NA 4FXKC 5ERWA 2VQ1B 4P9MH 5EOCH 1X6LA 4ZMWA 2GTZA 2RHEA 4MASA 2QQKL 5KSUB 3DGDA 4PW4A 5F3HA 1TF4A 1MUJA 4OJEH 4RA3A 4LT7A 4W9DC 3OKOB 5CLYA 3FMGL 4KHTH 3HNVL 1KXTA 3PWPD 3G5XA 2IVFC 1JS4A 2IWKA 2C1PA 1JN6B 3QNZB 1CFMA 5EMYA 1OWRM 4KDVA 1DVUA 1GOGA 3I3BA 3O6FC 3OZ9L 4O2CA 3ZDZF