4DH2A

Crystal structure of coh-olpc(cthe_0452)-doc435(cthe_0435) complex: a novel type i cohesin-dockerin complex from clostridium thermocellum attc 27405
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
158
structure length
158
Chain Sequence
IHEAETADYILDVLVEGVKAKAGDTVEIPLKFENVPSHGIQSFNLSLYYDSKAIEVLKVEPGSIITDPANNFDYNIVYKDSEIVFLFDDDKQKGEGLIKTDGVFAKLTVRIKPDIFKDSGSTKKYSLITFGESNFCDFDLKPILAVLKEGKVEIEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosome anchoring protein cohesin region
publication title Novel Clostridium thermocellum Type I Cohesin-Dockerin Complexes Reveal a Single Binding Mode.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Cell adhesion/protein binding
total genus 31
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4dh2A00
5AOZA 3KCPA 4UMSA 1OHZA 1AOHA 2VN6A 3BWZA 4WI0A 4N2OA 2BM3A 1G1KA 1ANUA 1ZV9A 3UL4A 5LXVA 2O4EA 2W1NA 3GHPA 1TYJA 2ZF9A 4DH2A 2Y3NA 3L8QA 2JH2A 2XDHA 3F2LA 4IU3A 5G5DA 4FL4C 5K39A 2OZNA 2CCLA 4U3SA 4UYPA 1QZNA 4WKZB 4IU2A 2B59A 4FL4B 3FNKA 2VO8A 4UYQA 3KCPB 2VN5A
chains in the Genus database with same CATH superfamily
2OW6A 2WXGA 4AM0A 3GMPB 2R2EB 3JV5A 3GC3A 1GS8A 4L3ED 5HHOE 1T80A 3NZ8A 3ZTJG 3DXAE 1MCWM 5ICYB 3QUMA 4F93B 1X9RA 2QVTA 3B2XA 2IXQA 5EOQH 4R5XA 3EJJX 1BZOA 3D87B 3UTTE 1FGNH 5GZOC 1QBMH 2OI9B 4FF9A 1XF2B 4PJHE 3GSQA 3MV7D 1NANH 2B1AL 3IJHB 3P11H 3ZKNC 4QOKA 2J73A 4DP6X 5KAQG 3US1A 3BCFA 4N2DA 3MODH 1IC1A 3UTSE 1ECZA 3O0RH 3X1EA 1CE1H 2H0EA 5EBGA 1JXKA 2IAND 4F58L 4H8VA 1O9VA 3AWEA 3FQ4A 1OE1A 2NSXA 1HHIB 1AGFA 1FNAA 1CICA 4MXVE 3PJNA 2BOBA 4AVKA 5G55A 2V7NA 3P0VL 5DJDB 5E6YA 4WUKH 1UFGA 1AYOA 3MRCB 1LEKB 5JOEA 1NSNH 5E1IA 3QQ4B 4CKQA 4HWZA 3IDIB 3MLSL 1P7QB 4GQ9L 3LKQB 4QLRA 2OMZB 3M46A 1N7ML 1CC3A 3GIVB 4XPTL 3NOIA 5A2LH 1YSOA 3T3ME 3NJXA 4OZFB 1IAKB 3KBFA 4BWTA 3UACA 2Z92B 1TTUA 1Z9NA 4GRWB 2WLMA 4IKKA 3LZLA 4XR8C 2AJ3B 1V3KA 1S2EA 4KK5D 4EVNB 3EBAA 4HJEA 5HHVH 2IV9A 5AL0A 3T65A 1QNZH 2VM3A 4HGWB 4JPVH 1U93A 2DAVA 1SYSA 1L5GB 5IMMA 1OAZH 1QZNA 3C6LD 3CFKA 4YWGL 1GYUA 1ZXQA 3D5OF 4NQDB 5F3BA 4M5TA 1C12B 4U1MA 4EF3A 2ZYHA 4LSVL 4GO9A 1CGWA 3W0WE 4AEIL 5DC2A 3O8XC 5K9KB 2CKBL 1P7QD 3ARDA 3LPOA 3TEXA 3AS0A 4MJ5B 5AVXB 5HI4C 1BSIA 3BVNB 3EO1B 4BKTC 1HKLH 4DZBA 1V7NH 2XTJC 2J12B 2YBRB 4EN3A 4JE0A 4DERA 2WNXA 4AC4A 3GRWH 3RZCA 4R7XA 3H7LA 4OI8A 1KFAL 3RIFK 3PWPB 2ITCB 4N2KA 4G7VH 3UXFA 3IXTB 5HYEA 5DK0B 2AI0H 1KJVA 1R3KA 1NZRA 25C8L 1AQMA 4EQ3A 3QUML 1JP5A 2HTLC 5EZLB 3HR5B 3LKSA 3O9WC 3HZKB 4G6JH 4KHXL 4MZRA 4CU8A 5D70L 4MCNA 3MTRA 3AACA 3KPPA 1PMYA 1Z9PA 3LH8A 5AKSA 2XN9B 2DLFL 2MOVA 2D03H 3GD1C 4NQDD 3BCDA 4NKIH 4O4YH 3T4AA 1BX2A 1A6TB 1RP8A 3I2CL 1A8ZA 3DYPA 4KVNL 4RMQA 3RVUD 3STLB 3CHPA 4HALA 5DI8A 4OIAA 2OTUA 2R0LL 4AGMA 1W8EA 3SCMC 2F5AL 2DIEA 2QPSA 4R7DA 4E41E 1V5JA 5C0CA 1WIPA 1OAXL 1F6AB 3W2DL 4DAGL 3PGDB 3Q2LA 2P43B 2Q7NA 3F84A 3M1BB 4W9HC 5FYLE 4ZMZA 5I6MA 4FXGA 3ZIMA 2Y22A 3E6HA 4YDJA 1P1ZA 1U8JB 3ETBJ 2GC7C 2PPEA 3KGRA 3MNMA 4NAMA 1IBYA 4HKJB 3WFEH 3MRGA 4NBYB 5E9AA 3BP6B 4G9FA 2WLIA 1JPGA 3QZOA 1OLLA 4FG2A 3UTPE 1TENA 1YAIA 5F7HA 5HYSA 5IP4A 3HZYB 2DQ6A 1NUFA 2YA2A 1JMXA 1PZ3A 3O6KH 3QDHA 3VYNA 2XN9D 2DQUL 1FO0H 4O02A 5IT2H 1KMGA 4FA8A 4GS7C 1JVLA 4KUZH 1S7UA 2FWOB 2AV7B 3IPBA 4P2RA 3M86A 4ZFGL 1NBVL 4P23B 4U7MA 2XV0A 2C3GA 4I2XB 3D07A 1R3IL 2EDQA 1JF1B 2A74B 3SQOH 1KGCD 5LNDA 3UOAB 1NCOA 1C1EH 4P59L 5IFHH 1QI4A 1G1YA 2K4AA 1XV8A 4NNXB 4S1RH 5F7DA 4CNIA 1E3ZA 1V27A 3FSWA 1HQRA 2X9YA 1CIUA 2NUTB 4IGBB 1KCSH 5DQDL 4M48L 1RLWA 1PD6A 4JKLA 4OGYH 2D7OA 4QRBA 5KVFE 1N5AB 2P3YA 1HI6B 4RQQB 4NWUH 5DJ2A 2H8PB 5CCKL 3O3AA 4UIKL 3VXUE 4X6BB 5F9OL 4IHBA 3VFWB 8PAZA 5JW3H 5ITFB 3GSRA 1IEAA 1L9PA 2XWRA 3MRIA 1HNGA 1Q72L 2OMYB 3DJZA 2IPUK 4P23D 3D0VA 1RIUL 3LEVH 4QO1B 5MERB 2Y3NA 4K3DL 3L5XL 5ISZE 5AVQB 4JFPB 1A4KB 5AL8A 4NUJB 2FJSA 4LNRB 5B39B 3ULVF 1TTGA 1F3RB 3WS3A 2YMXL 4LEXL 2Z35B 4IGBD 5CINH 4ENEC 2AK4B 5D4QA 2DTSA 3GINA 4PGEA 5K9QI 3HG5A 2D4FA 1D7DA 4OM1H 5ADOL 3DMMB 1FNFA 2Q2LA 2ZXGA 5L7XH 1MDTA 2AQ2A 4WI9A 2BWQA 3ZE0B 4WGKA 2NXZB 1HHKB 3QFJE 4LKXA 5G4NA 2FJFB 2ERJC 4JB9L 3GGWA 4PJFF 3BKJH 3UAEA 1N6QL 3TWCH 1BD2A 3GNML 4HC1H 4WFEE 5B1AB 1PLBA 3NIFF 3FUEA 1E28B 2O72A 4F8LA 1A66A 4IIQC 1DJYA 5D71H 2R1YA 3VD5A 1AP2A 5CGTA 4NQUA 3CFMA 1N5YL 4MZ2A 3BWSA 4GRWH 3ZK0A 4Y5VA 3ZTDC 4O2EB 4QXTA 3MCKA 4O02L 1WAAF 4GXFA 4R7NA 4J3OF 2DLTA 2AK4D 1Y07A 2VT0A 3FTYA 4FZEL 3ZE2E 3ZHFA 3NH7L 4LLUB 5I8CA 2Q7AA 5EC1A 3QEHB 3DMMD 3QQNA 4J2QA 2F7QA 2WQVA 4M1DH 2F08A 2DWDA 2QQLL 2VSKB 3BAWA 1CL7I 2NXZD 3D06A 5SV4A 1GYWA 3K71B 4OBRA 2IGFL 4XCEA 1J1PL 1Z7JA 2VN3A 3ROOB 2IMNA 4TNWF 9PCYA 4U1KA 2F8VA 4UOW0 1T7ZA 2CBQA 3F04A 1AZUA 1Y18B 1MJ8L 3B2UC 3RFRA 2YD4A 2BSRA 4JK0D 1SBBA 4JG0L 1HOCA 1VGKB 2HP4A 3ARPA 1XGTB 1ULVA 2VH5L 2XLLA 3HEIB 1TZHA 3IGKA 1X6LA 3CBJB 5IQ7H 1BCIA 5ANMB 1MVUB 3SE8L 3WN5A 2DKMA 4NGHH 1P5UC 3C87A 3V4VB 4KROC 1S7XB 5IBUG 1F2QA 4ORGB 1F3JB 2D0GA 1F97A 2ENQA 4C4BA 4QNPF 5E8DL 2GQHA 2WXQA 3A4DA 2F1AA 3IDJA 3N44F 4HISA 4FERA 3UBXG 2A77L 1U8CA 5DVKA 4OZGA 5LCVA 4FFYH 1H6FA 3MGOB 4TSCL 3RTQA 4D9LL 4N0YL 4TQ8A 2EIMB 4CVUA 4QR7A 4EXKA 4KMTH 8FABA 3TN0B 2IDTA 3H53A 1HAUA 1KIQB 2HLFC 5CO1A 3U83A 3S3SA 1KLUA 3PE9A 2X6MA 4DNLA 3O2VH 4LCUA 3UAJA 4X9GA 4XCFH 4KJWD 3TO4A 1YEKL 3U7WH 2YPLE 5LDUA 1JZ2A 1NA8A 5F93C 4APQD 1JGEA 3VXSB 3OAZH 2ENPA 3AW5A 4LSQL 4UV7L 3SDXB 3VI3E 2DBLL 4GUPB 4L29B 5J13C 3ZRSA 1YEIH 1JBJA 4HFWA 2I32A 3CXHJ 3PV6A 4PB0H 4JAMA 3IGAA 5F89A 2E6QA 3G08B 3HI5L 2AJXH 3D39B 3TN0D 3L54A 4KY1L 4EXPX 5ABDE 3FTZA 5HHOA 3O2DA 3O6LH 2G2RB 2HVJB 4UYQA 2AK1L 5DSCB 2V2TB 4CKVX 2BX5A 2BNRB 2Y3AA 2ICWA 1BIIB 2OULB 3KPQB 4HIJA 3T8MA 3VD2A 2C4FT 4OW6A 3IDYB 2Y2WA 4B7LA 4GI8A 3UTTA 4HWEH 4AZ8B 1CR9H 3H0TA 1IKNA 1F13A 1A1OB 4PJHA 4JCWA 1LDPL 2QDWA 3BGAA 3FRPA 4JKMA 4UINH 4KNUA 4YMPA 2WXRA 4AL8C 5I5RA 5E1AA 3VXSD 1FYTE 3CAFA 4ZW6A 3UTSA 4N25A 4QT5A 4G8EA 1AD9B 1IFGA 5J8OA 3LPWA 3UFIA 1R9FA 1ADQA 3GBEA 1IGCL 3QXWA 3MROB 1T0OA 2DMGA 2WKGA 4IRJB 4XWOC 1IBGH 4Y5XC 1PCXA 2F6AA 4IKNA 2CO1A 5ILTL 1FCGA 2KZWA 3D39D 3HLAA 4LCYA 4F5CE 1V3LA 2N1KA 3FO2A 3SDAC 5GRUL 4J7RA 4KY2A 1CG9A 1S9WA 3N0AA 3SYQA 3WXVL 5BW7C 2BNRD 1KLGA 2QVKA 5CBEA 3UZEA 1DVFC 4BK5A 1A7PL 2W9DH 2EEFA 3HG3A 3BHBA 3OSVA 4LFHD 4Y2DB 1O6TA 5DJAA 1H3TA 3D18A 1I1YB 4OIBA 4LCCC 3P4NA 4QHKJ 1A4BA 2C9PA 2KLRA 1TZOA 2BC4A 1QQDB 4TQPA 3SYOA 3N6YA 5LCVL 4N3UA 3WJLC 3S4SA 3HW7A 3SPHA 4KDTA 3IMRA 1DBAH 4NHCL 4IK7A 5ID1A 1YLBB 1MRDL 3QXAA 3L95B 1B4LA 1ZS8A 2P8MA 4HF5H 4TL4A 3VACA 3IJ9A 2H5UA 5IESL 4FQHA 4IRJD 1XZ0A 1WJ3A 3QS3A 3EUUA 2B3RA 2KZKA 3KD4A 4PRIE 2ZCKL 2OM5A 2B8OT 3R06B 3QR1A 3QQXA 5MI0C 1C08B 2ZJSH 4MAYA 3NAAH 4WI4A 3W0WA 3GIZH 1IBZA 4Y2DD 1LYQA 3P9MB 5M7QA 4XPBL 4LLWA 4M1GH 2IAMB 1Z3GL 2KQNA 4FHBD 2XI9A 4JHVA 5HVWA 2J4WH 3WGVB 3SGEI 2VKWA 4NCC1 2GAZA 4XVUD 4ZDHB 1FQ9C 5K9JH 3KDPB 1OEZW 4WFHE 3O2DL 3HE6A 3G6DL 1S78C 3OZ9L 5L2JB 3HG2A 4M4RA 1BMWA 2GBTA 2ZUQC 4FTVB 5ITBH 2OMWB 4N0FA 4MXQC 4P5MB 1IB5A 2I9LB 4JO5A 2CWRA 1RP9A 2WINA 2VCOA 3H2PA 2EH7L 3FOMA 1IO4C 4YSRA 1YEGL 1DANT 2V9RA 4DEWA 3J27A 2MKWA 4H44C 3ISWA 4MX7B 5IW3A 1VDGA 3V5KB 2M26A 4ZXBC 5M95B 3NN8B 3V4PA 3V4VH 4PRBA 2A5UA 2ZNXA 5AZUA 4ES9A 2ZF9A 3BN9D 2IAMD 1F4WL 4AYFB 5HDBE 2PTVA 4E41A 3FO1A 4WI8A 1ADQL 4DK3A 2QKSA 2IOIA 4UQ2B 1S7WA 4NN7C 3ZBMA 1M6OA 1YQ2A 3PPEA 4XNZB 4LZKA 3BLKA 3K46A 2CBOA 3KH4A 4L8BA 5JPNC 1B0GB 2JSFA 3OLDA 3QFDA 1KJ3L 4OLXL 4D9QD 3ATBA 1XBDA 4FTVD 4Z23A 5EIIG 4ZMPA 4RNRA 1SY6H 1XGPB 3HUJE 5LXGH 3RRQA 4KU1A 2Z8WC 3WOVA 4X8XA 3V0WH 2A9AA 3NCMA 4YH6A 4LPCA 3QG7H 5LN4A 3MFFA 1C5DA 4FG4A 4AIZA 2EH8L 2F7OA 2MOQA 3CH1A 2ZP9A 4NRYB 4QTHA 1JYNA 4YHKH 3DX1A 3INUL 5HDRA 5CCJA 1Z6JT 2H1PL 2QMJA 3IDGA 1YEFH 4HULB 4NLAA 1NFAA 5F7NC 3O81A 1NC4A 1Q0XL 2AJZA 2ZXAA 2QZ5A 3AZUA 4G8AC 4UT9A 1AKJD 4OD1H 1QSFB 3P3SA 3STBA 5D1ZB 4I85A 3I6LD 1UADC 1NBZB 2V2WA 3IJEA 1KELL 3I50L 1SFDA 2R0WH 4GBXB 4YSOA 2CPUA 5TQ2H 1KXQE 2VWEE 4X6FB 1O7DE 4EZKA 4J1UA 5KW9L 4IHOB 4WU7B 1IGFL 1BFTA 3SOBH 2EDJA 3WKMH 4F7EA 1QLEL 1MNNA 3VFGL 1DN0B 4UCFA 2WTRA 5D6CA 4E9TA 4EKJA 3ECWA 3LKPA 4BXSV 3VXUA 3B2DC 4JY6A 1PCSA 2OR8A 4PREA 4ZTPH 3VFNB 35C8H 1SOQA 1UVQB 4MJ6B 4DN4L 1BZ7B 3QIUA 3C5ZB 1T22A 2KKQA 3APMA 4X5WA 2OJEA 2IPTL 4LT7A 1A4CA 4YBLB 4B9GA 1UT9A 1BM3L 1KXHA 2YXMA 3IDNB 1DQKA 1H8NA 3ARGB 2CDEA 5ISZA 4TNEA 4NDMA 1QSFD 2RJMA 3ATEA 5D1ZD 4LO9A 4K5LA 5HGAA 1CTMA 1DQJA 3GBLA 4O51B 1T5WB 4GBXD 1G7HA 2IIJA 5TK2A 3ZHKA 3D48R 3FOLA 2OXHB 3BLBA 5H37H 1CYGA 3QC5X 3L9YA 2N7BA 3QUYA 4N26A 3WKNA 1YMME 4RX4A 2QKIC 3V4PL 3QFJA 1AGDA 3TO2B 2X4PB 4OJFL 3CHRA 1TLMA 3CMOL 3DUSA 3O3EB 1UOLA 3GXFA 2MWCA 1QVOA 4H8WC 3C5ZD 4LLYA 3RL2A 3UTQA 3VFTA 1CLZL 1DO6A 3FQTA 4FP8L 5FYLL 4KI5F 1QR1B 3S96B 3QCTL 2BRRH 3ARGD 4KX9A 3N42B 4WW1A 3OXSB 3O4OC 2YD0A 4EI5A 1I7ZB 2FEDD 4OZHF 3RPIA 4KNTA 3MUJA 4N2IA 3WEOA 4MASA 2W92A 2ADFH 4P46A 2VLRB 2AQ1A 3QUXC 5CEXA 3CV5A 2WIMA 3K7UA 3DO7A 4YHZH 2GKIA 2KDYA 3D4GA 1FN4B 1CF1A 3JWOH 3ZO9A 5ICZB 5IZ7A 3F01A 4NZTH 2IG2H 4RFOL 5HGHA 5E2TH 3OR6B 3A0OA 4WV1A 1A6UH 2J8UF 3TXAA 4N2LA 4DZ8B 1RJYB 4ODSH 2CJUH 4OF0A 4RAUB 4QXUH 4UT9L 5DO2C 3N43F 1N2RA 5KS9E 2ZYSA 4FI7A 1VHPA 3G6JF 1MAML 1X5IA 1UH2A 1D6EA 4TLKA 1T89A 3MRBA 4C55A 1I31A 1KCVH 3MNWB 5KVEH 2ZT9C 1GGIL 3SY6A 5GIRB 5DYOB 2X7LB 3EHBB 5KVFL 5TE6H 4KC3B 3KWXA 4GG8A 4IJ3C 5I1EL 2VLRD 4WI0A 4TUKL 1LJMA 1A0QL 1MIMH 4ERSH 1BVOA 2R4RH 5J0BA 2EILB 5IBTH 4E9YA 3B7SA 4WKXA 2FIKA 4NUQA 4IBYA 4NN6C 2DI9A 1XH1A 3KVPA 5BOJA 2D3JA 4HCRA 4L9LB 2UXVA 5CJQL 2BS8A 3B43A 3VTAA 3PNWB 1A02N 3OD3A 1K85A 1JDDA 3AS2A 3DVGB 1OGPA 1S5IH 4AV4A 3NCJL 3S88L 3QDJD 1TVDA 3CFQA 1LEGB 2WWKO 2RTTA 1SEBA 4MMXA 4R0LB 4XVTL 4XXCC 2FQDA 4HH9B 4ZFFB 2F0CA 1J5OH 5E2WH 3UDWC 1WICA 2D0FA 1A7RH 5DUML 4PP1C 1U2HA 5HDLA 3EHBD 1DSFH 4K7FA 4AH2A 2F74B 2NNCA 2DM4A 4JFFB 5F7LB 5IWLA 5T1DL 4LMQE 5D2LE 5F9DC 3ZKSD 2XA3A 2DEXX 1G1CA 2YPLA 2PCFB 3Q8FA 5CIPB 1A4AA 2XXFA 1QEWB 3CTTA 3KNBB 4UQ3B 4FQJH 3MNDA 5HDQH 3K6DA 1JDCA 1MCPH 4OJCA 1T0MA 2CLVB 2WLHA 4ZSOE 4FJZA 5CSBA 1KG0B 5TE7H 1N6UA 3S35H 2QSCL 4YBHA 4Q4EA 3WNPA 3Q5OA 3VI3A 4OCMC 4G1EB 3WNNA 5I82A 3TVMA 2CO2A 3MR9B 3EYSL 3X12B 5I76A 2DQJL 4MS6A 5CU5A 3BAIA 4CC0A 4PJXE 3EGSA 3MUGA 4E5XA 3DPBB 3KGTA 2XWTB 3C2AL 2CO6A 3UYPB 4HD5A 4EI6B 4F27A 3CIAA 3KVQA 2MOGA 2W80C 4MBRA 3UCRA 4AQOA 4X7FC 2VZVA 1EHNA 3T77A 5IHWA 4R4FL 2BSCA 4QHMA 4XMLL 4BINA 5AW4B 2FJHB 1I85A 4PLKD 1E9QA 1ZV9A 1QFWL 2HVKA 1BQKA 2DWTA 2WUCL 2APXA 1QSEB 1FYTA 4XAKE 4YSCA 1OGTB 4PRPB 1FIGL 1JV2B 1H8LA 1NCIA 5F9WB 3GWJA 3HC3H 3A21A 1ZK5A 3QNXB 3MRFB 3IF1B 3ML8A 4F5CA 1MF2L 2A9DA 5CGBA 5DFWH 5JW5B 3AG3B 1MCQA 4QRUA 4WTZA 4JGMA 2EP6A 3QUZB 1F8TH 5I16B 4JR9H 3WTSA 1UA7A 4LKCA 2PYEE 1CT8B 3FU5A 3H3PL 1YPZF 4HCRL 1H0DB 2RH0A 1TJHH 5GGTH 1JZFA 3HR6A 1TJGH 3RWJB 2X1QA 3SE9L 5GHWL 1AZNA 1UZ8A 4QCIA 5B8CC 2WBJC 1QSED 1BLIA 3ARBC 2NNAB 5GS1C 1VADA 1DQLH 2C9XA 4WHYG 1F4YH 4CUCA 4EUPB 4PRPD 1MRCH 1OHQA 4AQZA 5F1IB 4ZD3L 3AMLA 4AGPA 3UPAA 5F1KC 2WZPD 4PRIA 2R2BB 4LRNL 1NCWH 4ZFOA 4IBSA 3THMH 1E90A 3CFEA 3HHSA 4UNVA 2RAMA 3DWTA 1S5HA 2MSPA 3QUZD 2YARA 5DHYB 4KH9A 4GP5B 4V2BA 4Z7OF 3FH8A 4U7SA 4GKZB 5G5DA 4N9GB 2BZ7A 3EJYC 1KPUB 1MFDL 1NGYA 3CLFH 3NJNA 2DW5A 1FLRH 1IGML 3NESA 3AROA 1OTSD 4ILDA 3GKWL 1JN6A 4LPUA 5D2NC 4DWHA 4Z78B 3FQUA 2JLLA 3VXTB 1H6UA 1UJ3A 3BDXA 4Y4FC 5CU9A 3IMWA 4L3EE 4DO5A 2HN7B 5HPMB 4CMMB 2YD1A 3FO0L 5HGBA 1AANA 2EEXA 5LBVA 4AUYA 3CN2A 3FCSB 3EYUL 2MCPH 4LDCA 4RMWA 4GW1A 4MD0B 4R7LA 1UZ6E 2IH3A 3DHUA 3MTXA 3UC0L 1O7SA 3OQRA 1KV7A 3QS2A 1CTOA 1NDGB 3DTXA 3MV7E 1GZHC 2EADA 2X4RA 5FYJD 5KEZA 2C9QA 5E8PA 5F44A 2VR3A 1LDSA 4YSUA 4U2ZA 1WFIA 1YNKL 5DD1L 2IANE 5FM8A 3OR7B 3NA4A 2YQBA 2OYKA 2EDRA 3IMSA 4KVCL 4MHHG 5KYXB 1NAMH 3REWB 1ZXKA 4TNVK 1ACYH 3EH5B 5A2IH 5EO1A 1E4XH 3N1FC 5A6LA 3D69B 3ATDA 4MJIB 3QRBA 3RIAK 2G75A 1JFQH 4FG6C 3GMOA 1V7ML 3SQBA 5L2KA 5EN2A 7FABL 4P4KB 4S0SD 2B1HL 4J8QA 4XP4L 5C07B 5HI5D 4I0KA 1B6DA 3NRQA 4N2OA 5LGHL 4X80H 4L37A 3HI1B 4OLYL 2QR0B 4ZUVA 2OK0L 3MJ6A 3H9HB 3T6WA 4QLWA 3BWUC 4G8FA 2WM0A 5CIPH 4NB7A 1HXKA 1AZZC 1GVIA 3MJ8B 4YHIA 2DQEH 1SMOA 2VR9A 5LAXB 4AVIA 4Y16B 2KUTA 5JNYB 5I1CH 1ZPUA 1ZIAA 3NZSA 1FFQA 1KB9J 1G7IB 4CW1B 1I9RH 1KXQA 2B59B 3U7YL 3DDGA 3QDAA 4UOJA 4ZFOL 1JNNL 5LQBL 2BFGA 4IEFB 3TT3H 3P02A 1BPLB 1EBPA 1Z9SA 1WH0A 2X38A 4MJID 4JHZA 4OZIF 3IAGC 4ZUWB 4KX7A 3WNIA 3CZNA 4M6OL 4FN0A 2WIIB 4MNHB 2Z93B 1ILSA 5C07D 1MVYA 2D0HA 3JV4B 2J43A 5I73B 2XG4A 4DO4A 3JXAA 1IQWH 3EUDA 5E00A 2HB0A 4L4TB 4OAWA 1TG8A 2NY2C 3IJYB 3L3HA 3QWOA 1CDYA 2ZCZA 1EA9C 4Z3TA 3BVXA 4KZEL 2YAPA 3EJTA 4PI0A 3GXPA 4Y16D 5ELIA 4B60A 1ADWA 4BE5A 2BY2A 4YGVA 4JL1A 4MCMA 1QHOA 3SE4A 4AKQA 2IALB 4TUOB 3BVTA 1PPIA 5EULV 4X8GA 3T6ZA 4YJZL 4NQDE 4HHAB 3OKNB 1F6LL 4L0YA 2WLYA 4PTTA 4L05A 2X4OB 4LHUB 2ZPKH 1TR7A 1YMMA 4OFQA 4Y1AB 2Y7QA 2R2HA 1WP6A 5FUOH 2Q8AL 1ID5I 1RZ7H 3G9VA 2D4DA 3QFGA 2CH8A 1V3MA 3LQMA 3C5SA 3B7TA 3DSNB 4LLDA 2CZNA 4U4BA 3AREC 3L3IB 3POHA 1PZUB 1Q94B 5F7YC 4L4TD 4DW2L 3CXDL 3PWPE 3QHZL 3BRGC 3HBPA 2VDKL 4H8PA 4OZHB 4KKBC 2A9NH 2ZX5A 2BDNL 4MCZA 4NO2A 2GIXA 3MRDA 2GK0B 3QCUH 3U1PA 4P5TA 4CVXB 5EUKA 4JN1H 3P9LA 3VFSA 4EUPH 5LLIC 2X4TB 2XN9E 1JXFA 5F7FA 3CC1A 4HUVA 2MHAA 2QHRL 4P57A 3AQXA 3SB3A 3O0LA 5E6RB 3GSXA 5A2CA 4LBAA 5CMAB 4MSWA 1CL7H 3PABB 4MAUH 5GGUA 5CM1A 4KPHH 1RZ8B 4ZPTA 2Z7YA 1KPRB 2VE6B 1IC4H 4LHUD 3ABKB 4M43H 5DZPA 4Y1AD 1ZLSL 1LILA 4J4PC 1AXTH 2HWZL 2J8UB 3NIGE 1S8DB 1JGDB 3EJSA 3DURB 2V2XA 4OLZH 3HHMA 2YD7A 5KS9A 5MENB 3ELAT 1A6AB 4W6XB 5DJZB 4JUSA 5FYJH 5AZ2H 4BFRA 2FQFA 4R96B 3BW9B 2VISA 4KI5D 1E7VA 3NTCH 2D3VA 4XHJC 3QZPA 4KKQA 5BV7L 2P49B 1HHJB 3LH9A 1IFHL 4ZNCD 1UM5H 3V0FA 2WJ7A 3EJZD 2IOOA 5EZOL 2ADIA 2F5BH 2FNWA 1QO3A 3L17A 4K3EH 2QQKL 3JUYA 3LN9A 4FGMA 1XGZA 3O3DA 3RY6A 1P7HL 1ZK9A 4OJYA 4MRCA 2AEQL 3Q2WA 4JVWA 3TA3C 3WENA 1FH2A 1AO7D 2XV2A 4KK6D 4ZMQA 5CEZD 1IBBA 1U8NA 2Y9RT 4AJYV 4RISH 2Q6WA 2OZ4H 4I2XE 1D5RA 1CFNB 1IKFL 4JO2L 5MEND 4QRRE 2F8OA 5E5UB 1BEYH 3D85A 2OMXA 3INOA 4NAJA 4Z7VB 1GAFH 1VA9A 1KGJA 1ZT7A 5DUJA 3UPRA 2G4GA 3S4SG 2EKSA 3BZFA 1XO8A 1EAQA 1I7RA 3QJVB 1T04B 1WQVT 4PJ8A 3T4YB 5ESAB 3BZEA 1PNDA 4J8RA 4NRZB 5ACZB 4LAQH 3KPLA 5FUZL 1HDMB 1LO3H 2DJMA 4OCRL 4AK1A 3TF4A 4JPWH 3RQ3A 3GFUA 2OR9L 3O3BA 5GSVA 3OVUB 2XZZA 4M6ML 5GZOD 1IC0A 1MFAH 3PFUA 3ZKND 5C8JB 4AUUA 2P52A 5DLML 4ZSOA 5HDWA 3SKJL 3FL7A 4WGWB 1SMAA 2UZYA 5AKRA 2V9QA 3OKDB 2YD2A 1OAYL 1J0IA 3Q8EA 1NCAL 2AEWA 1GL4B 2FRGP 4OV5B 3Q1EA 3OMAB 1UH3A 2JCCB 2FSDA 1D5XA 2XICA 3QDMB 4GSQA 3LIUA 4XCYA 4QTIL 3SKOB 1PLGH 2VZUA 4JLRB 2AK4E 2UY7A 4LSTL 1L6ZA 4AGLA 2Y2TA 1BBDL 3MV11 2K7QA 3QB7C 1X5HA 1ZJBA 2DJUA 3B9KA 4XNBA 3OWRA 1BG9A 3ZE0E 3P0YH 3RWGA 2GSGB 2HRPH 4AM0Q 2XTJB 3RVWC 3Q43A 4AQEB 2H1LM 5IFJB 1SHSA 1VF5C 4FKHA 4QYAA 2H7WA 4HXAH 5KUMA 4O58L 3FPYA 3NRFA 5E2JA 3WXWL 1KLFA 1XIWA 1BVKA 5F9JA 5GGVL 4HLZH 3IVKA 4YGAB 3TV3H 3UO8B 3O9WB 1RZIA 2E7CA 1F4AA 4G80B 4CILA 1BWMA 3QDMD 4S1SH 4I3SL 2WXIA 3APFA 4I13B 1IM9A 3Q48A 1U3JA 3ZHDA 2GI0A 3LSOA 4DPRA 4GNKB 3MCLL 2WLKA 4G3YH 1UXWB 2O6CA 2EC8A 4YHMH 5HYQA 2O5XH 1NOAA 1OSZB 2PYEA 3GRWA 3BT0A 1L3WA 2PPFA 1GOFA 5HI4D 3LRSB 2ZZUT 4HS6B 2ICWJ 2XTJD 4I3RH 4NM4L 1U8PB 2YWZA 3TNMB 3MJGX 1QTSA 3MHZA 3A4AA 4U1JA 1LVEA 1SF3A 1RQ5A 2CLZB 5FO9A 3VFOA 3BZ4A 1UGKA 4JFQA 5HGDA 4BM7A 1QA9B 4FQXA 2J1KA 5G4OA 1AQKH 5EOQL 4EEEA 2IQAB 2WLLB 4RAVB 4O9HH 3TBBA 2AXFB 1KXTA 3QPQD 1FGNL 5H2BB 1EHKB 2HTLD 1QBML 3O9WD 4QAWA 5AW2B 4C57C 3JZYA 1Y6NR 4NWTH 3VWJA 5DC9B 3WCYA 3P77B 1M71A 5ANME 4BD4A 3C5JB 3P11L 1URLA 2VXTH 5FB8B 4ETYA 3VX1A 3MODL 1TCMA 4BHUA 4GS7B 5F1SA 5C86A 2IADB 3O0RL 1YYLH 3GYRA 5LNGA 4FA7B 4JGNA 1CE1L 3ELQA 3V52H 1KBPA 5ENWB 3EOAB 1NOFA 1FV1A 2O5NA 4L4VE 3K4AA 4UDTB 5FYKE 1SXCA 3FT4A 2QV2A 5DMJB 3NQIA 3WDIA 4Y2NA 1HHHA 4ZO7A 1A8JH 1WA2X 4ZW5A 4NO5A 4AYSA 3S3JA 5DJYB 3ZT6A 4RGNC 4WUKL 1AIFB 3D1MC 3LKRB 1GRWA 1NSNL 3ZR6A 3HC0A 1XR8A 4L3EA 1A21A 3KYOA 4WGVB 2VQ4A 4IS6A 5EDXA 2DYPB 3LQAC 5G2NA 2X4UB 4HPHA 4Q8BA 1HZHH 2G0LA 2VR4A 1AHWC 1EIBA 3CFIC 3VG0H 4N87A 3MV7A 1Q0EA 3RDTA 2ZUXA 1NFDF 5A7BA 3HG1B 4OJEH 1UC6A 4DTGH 5HHVL 3VXSE 4IJTA 2BCKA 4XVOA 1QNZL 4JPVL 3KDMB 4MMZA 1OAZL 4FNUA 3CC5B 2AW2A 1UUNA 2IANA 3AG2B 4IU2A 4TSBH 5D7JB 4NT6B 4MVBC 2NMSA 3DI2B 2D2OA 3GPEA 3SPCA 3DHMA 2FIRT 3MUY1 5D5ME 3D39E 2R2EA 3GMPA 4H5SB 4WEMB 4X7SH 5CZVH 4WW2C 5T33H 4PR5B 5ICYA 2QADC 3HPJB 1MN4A 2BNRE 4XBMA 4GRLC 1HKLL 1V7NL 1J86A 4YIQB 3GRWL 5HI3C 2ERJB 4I77H 2IWEA 4G7VL 1XF2A 3KL5A 2AI0L 3IJHA 4A7UA 3HG1D 3OKKB 4KQ0A 2MKLC 4PBXA 1OK0A 1OP9A 4G6JL 4IIQB 5FV2A 4MB1A 4ZUUB 1TQUA 4B53A 4DQOH 4FJ6A 1ES0B 1RJCA 1FCCA 5HGGS 5EF1A 5D7JD 4YSAA 3IPEA 2D03L 1FNGB 1KYFA 4YAQB 4NKIL 4O4YL 2NYKA 1FL6B 1HHIA 4M7LH 3T2LA 3C6LA 1Q9WB 5DJDA 4ENED 3BE1H 4HUWB 3WL9B 1IU1A 4Z7IA 2P28B 3WELA 3MRCA 5IUSA 4OBSA 2BINA 4JPQA 1LEKA 1JPST 3N3EA 2NNXA 4KV5F 3QQ4A 4HC1A 4FXTA 2K8MA 3IDIA 1P7QA 2K7PA 5DHXB 4LU5H 1H3WM 1PAZA 3IMBA 4OLUH 5I66B 3LKQA 3WFEL 2PKDA 3DARA 3V0VB 2OMZA 2C1PB 2H3NB 4R90H 3FT2B 3GIVA 3RURA 4CC4C 3BD4A 1KN4H 3A3YB 1ZDQA 1IAKA 4OZFA 5AVUB 3O41B 2Z92A 1USQA 2FUQA 3O6KL 1IGIL 2AJ3A 1E4KA 3RZWA 5IT2L 3Q1SH 4EVNA 4P4RB 5GS0C 4I9WD 4KUZL 4HGWA 4BQCA 3QJUB 1GGTA 1L5GA 4EI0A 4KROB 1C8QA 4NQDA 4Q52A 3LRKA 1HHGB 2N4IA 3PIQB 4HCFA 1C12A 1J18A 1O5PA 4N8PA 1NCCH 1CD0A 3Q8AA 5IFHL 5K9KA 4S1RL 4BUGA 1JPFB 2DWYA 4MJ5A 4ELMF 4N2FA 3U4BH 3B7UX 1SXAA 3BVNA 4G6AC 3EO1A 1OP4A 1KCSL 2YBRA 5KVEE 1GJIA 1VRSA 4OGYL 3LPGA 3B2UD 1TQCB 2ITCA 5DWUH 3IXTA 4NWUL 1R5VB 3EDFA 1QRNB 4K55A 4O2FB 5DK0A 2B14A 3JT2A 4D9QE 5JW3L 4FTVE 5EZLA 3HR5A 3HZKA 1AR2A 4MB3A 2Y69B 1IBHA 2F8IA 1LGVA 2XN9A 5I8KH 1RZKC 3FRUB 4KROD 4L4JA 4PG2C 4RBPK 4PW9A 1MCDA 3LEVL 4X9HA 5IQOA 1WA1X 1A6TA 2ZUVA 2BVYA 1IT9H 5JW4Q 4PRHB 4FFYA 3ULAB 3STLA 3NYKA 3ZGHA 2YOCA 3HC4H 4HZAA 1RK0B 3I6LE 4R97C 5CINL 3DX9B 1F6AA 2Y6TE 4FNPA 3PGDA 3B2VH 1BXAA 3E8UH 3M1BA 3FQWB 4GP4B 4OM1L 2GJZB 3WUWG 4Y7MA 5L7XL 1U8JA 1OL0A 2V9UA 3CD4A 3EADA 5CN3A 5IEHB 4HKJA 1QRND 1XAUA 3BP6A 3CVDA 3N06B 4BXVA 2Y06H 1MCSA 2I24N 2AQQA 2WO3B 3BGFC 1YEEH 1ZY9A 1MI5B 1CVRA 3BKJL 3HZYA 4HC1L 2A6KB 1CXKA 3MRKB 1GGCH 4XAWH 3F00A 4NN5C 1M1SA 1ZGLB 4QJ3B 2FWOA 1S3RA 2AV7A 5D71L 4FTDA 4ZK8A 2CCVA 1U8QB 4DF9A 4PRHD 4QKXB 2CBMA 1CD8A 2ZKHH 4P23A 5E03A 2OW7A 3ZTJH 4JY5H 3OJVC 3LH2H 3L4VA 2VN6A 4I2XA 5FFLA 1XCQB 1C7TA 1JF1A 1QSFE 2A74A 2HLEB 3L2MA 2WXLA 3HS0C 4FCHA 2APSA 4DP9X 4Y5XB 5JXAH 4NNXA 4RMUA 1J88A 1KDJA 4ADIA 4M1DL 3P69A 4XNXH 2NUTA 1A9VA 4IGBA 2H45A 2VUYA 3SDAB 3BPCB 1NCHA 2FJGB 1KNOB 3FFCB 2ID5A 1N5AA 1DVFB 1ZLEA 2QLYA 1BYNA 1HI6A 1MI5D 5FS5A 1ILUA 4RQQA 2H8PA 1R46A 2DQDH 4X6BA 1L7IL 1A2YB 3VFWA 1FZOB 3G5WA 3NCWA 4LCCB 1U8OB 2DI7A 5ITFA 1SLVA 1N67A 1FF5A 1BMZA 4YPGB 2DLGA 2OMYA 3V9EA 2ZX6A 4YC2C 3VU1A 4RZCB 4F3FB 1I4FB 1EXUB 3GSVB 3ZDXB 1KBGL 1SZNA 2GBUA 4QO1A 5IQ7L 5MERA 5CKGA 4B41A 3ILQC 4G1MB 4KUCD 4NGHL 4W9KC 4JFPA 4OKVB 1A4KA 1RUMH 2E7MA 4LNRA 4XWOD 5B39A 2HVBA 5EEWA 3W11C 5JHLH 3DX7B 2W60B 2Z35A 2EE0A 2FR4B 3I74A 2X10A 3BEVB 3TP4A 4ZX3A 1YRKA 2AK4A 4IDLA 3SDAD 5CFHA 4H26B 1OP5K 1QWUA 5MI0B 4UI2A 1WZAA 1U4EA 3DMMA 3FFCD 1NTDA 2GSMB 3PL6B 1DVFD 3ZXAC 3L08A 1TCRB 4FFYL 3TIEB 1EZVX 5IVNA 1HHKA 4WO0A 2G2NA 4OUUB 5BZDB 2FJFA 4W9LC 3GBDA 4KMTL 4CN4A 4ZUSB 1A3QA 3L4XA 5EUOF 1JERA 5IOKA 1UM6H 3LJ3A 2WXMA 3R19A 4BGDA 2BVOB 2DL9A 1OB1B 1XTMA 3K72B 4FQCH 1E28A 1TJIH 3PGFH 1AY1L 5BMFH 2CHXA 3I75B 4XCFL 3U9PH 3U7WL 2ZUQB 3MLXH 1YO4A 1SJMA 5A2KH 1SN0A 2LHAA 4JBSA 2VLRE 2WP3T 1JCKA 2YJLA 4O2EA 2WSPA 4BFKA 3SBRA 4WDIB 3OLIA 1WAAE 1ZT4B 4KXAA 5CCGE 3QJXA 4LLUA 2CMRH 1A4JB 4NC1C 1J5IA 1YEIL 3PL6D 4ZXBB 4JREB 1RI8A 4UILH 5FO8B 4PB0L 4U6HB 3K71A 4YHLH 4ZTEA 5IBUB 4KX8A 3ROOA 3LDBC 2AJXL 3SSGA 1N4XH 2A6JB 4NN7B 3TYGH 1Y18A 3B1TA 3FXIC 4RDQF 4P49A 4WWKC 4Y8DC 5KYNA 5JPNB 2QPFA 3UBXB 1ZTXE 1VGKA 1ZLWK 3S37H 3VE0B 1QEXA 1XGTA 4HWEL 1CR9L 4LGRB 4MXQD 4AV5A 1BQUA 4NI3A 5ANMA 1MVUA 5AVRB 2GEEA 1A64A 4UINL 5JHBA 1WZ1H 1EUUA 3C8KB 3V4VA 3W57A 1S7XA 5IROC 4AT6B 1F3JA 1XBRA 1PL3A 1ASPA 3ERXA 3CH8A 1MXDA 1TNMA 4ZXBD 1KZYA 3BWUF 4N2BA 1E5BA 3C75A 3DTDA 3JT0A 4Z7WB 1IBGL 1IZJA 2HRGA 5D55A 4HJ1A 1D5ZB 2WWNA 4ESKA 1IFRA 5I8EB 2MCMA 5IB4B 1JNJA 4FYTA 4X5QA 1KTRL 3TN0A 3MMEB 4R8WH 2W9DL 1SXSA 2K78A 1KIQA 1B4RA 3STZB 4K4KA 4U3SB 4KXCA 1BYOA 4KRPC 2P48B 4OF8A 3DOSB 4JFFE 2KC0A 4BZ1H 2NCMA 2J5LB 4JM4H 1R3JB 1DBAL 3CMGA 1JZ3A 9CGTA 2X6BA 1R19A 1P7KB 2KL6A 2UVFA 4HF5L 1TTBA 4ODBD 3VXSA 3WKYA 2UVEA 4D9LH 5CFAA 3T0WA 3SDXA 4GUPA 4L29A 4XOAA 4AL8H 3UJIH 1SDYA 3ARUA 1M42A 4ZS6C 4WCYH 1N64H 2ZJSL 1TYEB 3G08A 4J3BA 4ADJA 3NAAL 3D39A 3DTUB 1XH0A 3GIZL 1DVUA 3EYQC 5E8EB 2G2RA 4B9JA 2HVJA 4M1GL 5DSCA 2ZCHH 2V2TA 4BZYA 3VYOA 2BNRA 1XB8A 4FQLH 3QULB 3U79A 1BIIA 3KPQA 1NLDH 3K74B 1I1RA 5GGQH 2E27H 3DA0A 5HYIA 4AZ8A 3RJDA 2Y25A 5GZNC 5K9JL 3ZVVA 2G3XA 1OSPH 1A1OA 4PJDB 5ITBL 1QSEE 4PJEB 2ZP8A 5ANHA 2CLRB 3O4OB 2AXGB 3SPGA 1AD9A 1Q1PA 4OCWH 4PRPE 3A67L 5CUSH 3MROA 5AW7B 1BJ1H 5H37A 4IRJA 2DQIH 4MXWL 3QUXB 2BVTA 1BJ8A 5IJBC 5L9DL 4YZFE 1ZGLM 5E08H 3V4VL 3KWVA 4B9ZA 4ACTA 2H3XC 4K8RC 2A73B 3MNVB 3PP3H 2CJTA 4M29A 1I53A 2GUOB 5JO5B 3MRRB 4Y2DA 1JYXA 2CE6A 3V0JA 1EJOH 2PABA 5KSBF 2Y0SA 1REIA 1I1YA 1RZFH 3RX9A 1QQDA 1QFPA 4F9PC 3D9AL 1HT6A 3QR0A 3QIBC 4RDBA 3IFLH 2XWEA 3L16A 1V3JA 5GRZA 5I1LB 1CBJA 3L95A 4M9OA 5LXGL 4WWID 1WF5A 4BQ8A 1PFCA 1XDTT 4WHDA 3C12A 2W88A 2NXYC 3MC0A 2JK5B 1KEML 4OY9A 3QG7L 3EH1A 1IAIH 2FX7H 5DJ0B 3QUXD 3RFZC 5TDNB 1YY8B 4YHKL 2OL3B 2AMGA 3R06A 1YEFL 2F9BT 1V55B 4QRPB 5JLZB 3SDCC 5IQLA 1C08A 4OD1L 4AVHA 5FYJE 3ZL2A 1NGQH 3P9MA 5TQ2L 2FWUA 1HL4A 2IAMA 1CGYA 5DO2D 2CA4A 4GINA 5E95B 4UQBA 1U42A 3BP7B 4PJGF 4XB7A 3T9WA 5LXVA 4H88H 4D7BA 3WKML 1BOYA 1JXJA 1A47A 2FQGA 4MJHA 4WEUD 3UO1H 4ZDHA 2BVUA 4QY8B 1XGYH 5L2JA 2C5DC 4ZTPL 1D9KC 2WLNA 35C8L 3IFNH 5CAYB 4FTVA 2BCMA 1P2CB 1HCZA 2OMWA 4P5MA 3QEGH 4DP1X 3AY2A 2I9LA 3TFKC 4LLAA 1GCFA 5CXPA 4PD4J 2VO5A 4P3CH 4R4ND 1ZSDB 1ZE3C 3R1GH 4HPOH 4EZLA 4QRPD 4B0MB 1IAIM 1F11B 4MX7A 5EIIB 3V5KA 3NN8A 2FYVA 4DP7X 4AYFA 4U0QB 1A7OH 2GBAA 3ULSB 3EO0B 3KW7A 4UQ2A 4XCCH 4JJ5B 3NRPA 2PP8A 2WQUA 4TPRH 3R8BB 2V17H 2PN5A 4WO4B 3NIDB 4AJVA 1B0GA 3OKMB 4MJIE 1VSCA 2FO4B 3LY6A 3COOA 4K7PY 3VXRB 3WO4C 1XGPA 4L1LA 3LNFA 1M1XB 2BRRL 3CN4A 5DVPA 5C07E 1WSST 4CJ1A 1E5ZA 3S37X 3LPFA 3BT2H 4MD5B 2HT2C 1MWAB 2A4CA 4NRYA 3KYMB 4V1DB 4MWFB 4MA1B 3PHQB 1I9IH 3ZKMC 2B08A 1OP3K 2VKXA 2ADFL 3PAZA 5DZNA 2HJLB 4JANB 4JO4H 1JGVH 1RZGB 4YHZL 1QSFA 3WKPA 5D1ZA 1NBZA 2NY3C 3JWOL 5KVDH 4M7JH 3BPLB 4G42B 4GBXA 2K0RA 2IG2L 3FZUC 4NZTL 4U1NB 4D8OA 2XY1A 2ZWLT 3PAUA 4X6FA 3JWNE 5E2TL 1OCRB 2Q20A 1U8KB 1A6UL 1F18A 3MQIA 4WO4D 3ZN6A 4IHOA 4WU7A 5CLWA 4ODSL 4S0HA 4WU5B 1K5WA 4QXUL 1DN0A 3T09A 4DFIA 3VXRD 1B0RB 3GBMH 3D34A 5T5NG 4AKOA 5KYYB 3NSDA 1G7MB 3EDEA 3VGBA 3VFNA 3SGKC 3F7PC 1UVQA 4MJ6A 5K69A 1BZ7A 3C5ZA 4Z3GA 1KCVL 5KVEL 5IB2B 1AZCA 2WBJB 3LHPH 4V1DD 1WZMA 2NSQA 5J4MA 4KBPA 4K7PH 3ARBB 4L4TE 3IDNA 1KN2H 3ARGA 5TE6L 5GS1B 1MH5B 3LRLA 1FIEA 4JM2C 4ERSL 1GS7A 1MIML 4ONGH 4OCYH 2R4RL 4AJ0A 1EJFA 2Y5QA 4MNQB 4KRLB 5IBTL 4AQ8A 3QIWC 1T5WA 4FNSA 4O51A 5B4MD 3JUZA 4PW3A 1IAMA 5E24E 2OXHA 3BPNC 5CLTA 3MLTB 3VFPB 1Z1WA 3SGDH 3Q6GH 5D7EA 5TK4A 4ZOEA 3V7MA 5GGTA 4PJIB 3W3BA 1WFUA 1D6VH 4Y1AE 3S36H 1S5IL 2RQEA 3P3RA 4OF7A 3TH4T 3TO2A 2X4PA 5MHSD 3CPUA 3TEYA 2XX0A 3O3EA 3WY3A 1SLUA 1J5OL 3AWFA 5E2WL 3IGFA 2WBJD 3ZTCC 4KOBA 2IMMA 1A7RL 4FAAB 1SUHA 1QR1A 3ARBD 3IT8D 4KI5E 3S96A 1DSFL 4QWWC 1I7TB 1T1XB 3OXSA 4AGNA 3Q06A 1I7ZA 1MFBH 4MNQD 2AJYH 2ZOKB 3NCXA 1OOWA 3IDXH 4FQJL 3C60C 4M6AA 5HDQL 2VLRA 2YC1B 5EEZA 1FNSH 1MCPL 2VC2B 5FCUH 1HS6A 2P80D 3ZKQD 1WAAA 5TE7L 3S35L 4AMXA 1FN4A 1H3GA 3B9VA 1E5AA 5ICZA 4YBQC 1I1CA 2E7BA 1EVTC 1JGIA 4G43B 4QUOA 5CEZE 3FH5A 1H15B 3I6SA 4R3SB 2OL3H 4MBOA 4LNVA 3OR6A 4WJKB 4DZ8A 1RJYA 2XJKA 4RAUA 5MENE 4PPTA 3C9NB 1CD1B 1UWGH 4MGXA 3QDJA 4ZQTA 3CZKA 4KXZI 4HWZB 4MZ3A 5FXCH 1OAQH 2XETA 3MNWA 3MUZ1 3RWIB 1NEZG 5GIRA 2OLDA 3OJMB 4LQFH 1E8WA 2W0PA 5DYOA 4I4WB 2X7LA 3OV6A 4ZAKC 2FLBT 3C08H 3KGUA 1H3XA 3D25B 1SM3H 3GMNB 5ADPL 2WAQA 3TA4D 5CWSB 4HWNA 2DJ4A 4BSJA 4KKZA 2HUHA 1MCNA 2WWOA 1NDMB 2JV6A 4L1HA 3TEUA 3KYKH 5K39A 2KI6A 4QHNB 3HC3L 4L9LA 3F05A 3HIZA 4XE5B 1LO4H 2CRYA 3JTTB 1UB5B 4DK5A 3PNWA 5KANI 3T0EE 5LUMA 3IJ8A 3DVGA 3KCPB 4Z7VE 1PZ5B 2H2SC 2RHEA 1H19A 5KBNC 5EO9B 3T6VA 1F8TL 1LEGA 3MUUA 4CAGA 3PF2A 2N0KA 4JR9L 3KL0A 4R0LA 4W70A 1UENA 2FHCA 2XC8A 4HH9A 1I3RB 2R0KH 1A3RH 4ZFFA 4XN2A 3Q2VA 1TJHL 1HK6A 5GGTL 1GTNA 3S9DB 4XNYH 3V2AR 1TJGL 3X13B 1NIDA 4FG6D 4M62H 2LE9A 2F74A 2DDQH 4JFFA 2X28A 2ICEB 4N2CA 2E9GA 2FX8H 2CDGB 2PCFA 5HVGB 4LRIA 5CIPA 2G9KA 3KNBA 1QEWA 1HXMB 2NZ9C 4UQ3A 1DQLL 5DEZA 5K33A 3TV8A 3WLWC 1F4YL 2E86A 1MRCL 2WO4A 2CLVA 4PGBB 2NY2B 3D4YA 4XN7A 1KG0A 4HETA 2HG5B 2WKOF 5GGSB 2WD0A 3L3OC 4G1EA 3LS4H 1J8RA 1MWAH 1NCWL 3MR9A 3THML 3I9IA 1IILE 3HAEB 2EUVA 2JCCE 3QDME 1ACZA 4L9DA 1Y1UA 1F00I 3DPBA 2YPKB 2Q87A 4LPXA 3ASOB 4HJJH 2XWTA 4B0MM 3M7FB 4YLBA 4R7DB 2I5YH 3UYPA 3VM5A 4EI6A 3CLFL 4ODUB 3M1CA 5F6HI 3RBGA 1MLCB 1FLRL 2YGOA 4P2OC 3QQDB 1YEHH 5DGRA 3VNYA 4BFJA 3N0PB 5CJ8A 4W6WB 2FJHA 3AREB 2YHGA 4L18A 2DLHA 3NP4A 2NY2D 1QSEA 2XWCA 4KZ0A 4BK4A 5K5YA 4KZDH 4KNQA 2NNRA 5B1JC 1MPAH 4HYTB 4X4XB 1OGTA 2MCPL 2GJJA 1ZTXL 4PRPA 5AYTA 5B3NA 1JV2A 4KKCC 3ILPB 4NUMA 2WZPA 3QNXA 3MRFA 1FJ1B 2JB6B 3IF1A 1SGKA 3OLGA 5JW5A 2LAGB 3QUZA 5T1JA 5I16A 4P8QA 1OT1A 3JYBA 1CT8A 1CD9B 2DWXA 3L6FB 3X2QB 1H0DA 1IUZA 4KO6A 1WPCA 3PWLB 4AMWA 3RWJA 1ACYL 4HAGA 3ARED 1E4XL 4U6YB 1DYZA 4DHLA 1XXFC 3BDBA 2B39A 1IEBB 5B38G 2OA9A 4H0GA 2KZBA 1YCSA 1JFQL 1PZ2A 1TQTA 2NNAA 2ZOLB 4XVSH 43C9B 4AE0A 4EUPA 1D7BA 3NA9H 1DBMH 4KKBD 5F1IA 3GSNB 3FMGL 2QL1A 4X80L 4X6CF 4WIQA 4PYGA 2R2BA 2H6PB 3LIZH 4CVZB 1N18A 4JPIB 4WY7H 1TMQA 3TA3B 2F1BA 3F12B 3ARVA 2LLGA 4M8RA 3FO9B 5DHYA 2DQEL 2VXVH 2VC2H 4LEOB 4FMKA 2NY5C 3LNIA 2WZAA 4J4PD 4GKZA 2VLMD 4XO9A 5I1CL 4N9GA 2JJTA 3BX7C 2Z0BA 3EFOB 1KPUA 1I9RL 2WNKA 5C71A 1BQLH 1J0HA 1DE4B 2NT0A 5I17B 3D0LB 2W8CA 1ZOXA 5TD4A 3TT3L 1XMWA 4Z78A 2YRPA 3GM0A 3VXTA 3F7KA 3QZWA 1WISA 4XHJD 3LNHA 2A4EA 4RZKA 5AW1B 1LO2H 1WDAA 2HN7A 1P69B 3L1FA 1BD2B 2EDOA 1ACCA 5HPMA 2CGRH 4CMMA 3VFRB 1EAJA 3FCSA 3JVGC 3KWUA 2EO1A 3CQFA 2VMFA 1RSFA 1IQWL 3IPFA 4MD0A 2J6WA 4Z7QF 5AYUH 4FJYA 1DSWA 2OZ4A 1HTYA 3TA3D 3FCTB 5I8OH 4Z18A 1L4IA 1NDGA 5GGSY 5FECB 3V6OC 3HG1E 1VFOA 2DLIA 4RGMC 1XR9B 2N56A 2O1AA 1A7BA 3L5IA 1QWHA 1VESA 3VI4B 2X42A 1HE7A 2EIDA 4X4ZA 3OR7A 5KBDA 2D9CA 4OF3A 5KYXA 3S97C 3CSTA 1MCFA 4TLTA 1RHFA 2ZPKL 4NO3B 3REWA 4XCEB 5FUOL 1USZA 5D7IE 3ULUE 2HKAA 1RZ7L 2DBJA 3D69A 4YFEA 4MJIA 2B0SH 3L4YA 1TDQA 3BVDB 3GRGA 5CS7A 3JWDC 1KBKA 3K2MC 3PGCB 7PAZA 2ISDA 5SX5K 5C07A 3DX2A 4UQ9A 4H40A 1INEH 2AXHA 2EXSA 4AJWA 2A9NL 3HI1A 1P9MA 1XF5B 2QR0A 3H9HA 3IDMB 3QCUL 1JZEA 3SHSA 5F7KC 4I88A 4JN1L 2O6EA 1CU4L 3MJ8A 1BZQK 3EKCA 3H6AA 1A6WL 5LAXA 4Y16A 5JNYA 4I9WE 2WVTA 2MIZA 4MAUL 4KPHL 1G7IA 4CW1A 1IC4L 2B59A 5B1BB 4M43L 4MMYB 1AXTL 3HAEH 3QZMA 1AXSB 3GSOB 4IEFA 4Y9CA 4YDNA 3WSQH 5I6KA 5DVLA 4OLZL 1EJ8A 1G0XA 4KDVA 1MFMA 5FYJL 4B9IA 5AZ2L 4ZUWA 3IMTA 3U1QA 4AI7A 1AQHA 1U8LB 2WIIA 3O3UN 4LPVA 2Z93A 4H1LG 4MNHA 5DFTA 3RVWD 2XBZA 2E46A 3NTCL 3RU8H 4AX3A 3JV4A 2BIPA 1UM5L 2X2HA 4L4TA 2F5BL 3CFJB 3IJYA 5D72H 3PY9A 4K3EL 2FYYB 1JPEA 3Q5YA 1WFNA 2F2HA 1V8HA 4IBZA 4F1ZA 4WRLA 3LV3B 3F5WB 1ACXA 4XMXA 1MW1A 1ZLUH 2ZTBA 3MKGA 4IDJH 3REVB 5DJCB 3B2PA 4YFDB 4KGLA 3VAEA 1J5HA 2IALA 4TUOA 3ZPDA 2X2IA 4EN2A 1OB0A 4RISL 2OZ4L 4B5ZA 3L3GB 3OKNA 4HHAA 3CPLB 2X4OA 3GTTA 2V9TA 2XJLA 1H6EA 3F85A 4LHUA 1BEYL 3ZDWA 4CSTA 4Y1AA 3ARXA 1BZDA 1GAFL 1EAPB 4WHYH 2OZNA 3FUKA 1LP9F 3ARZA 1QX1A 4A2LA 3EBGA 3DSNA 5E4EB 3RWFB 3L3IA 2BIIA 4LAQL 4RGNB 1LO3L 1Q94A 4JFHD 3KLDA 2PF6A 1JL8A 4JPWL 4XXWA 5EU4B 1JYVA 1QOKA 1OGSA 1QRNE 4OZHA 3FPXA 3QC6X 3I9PA 1MFAL 2GK0A 5LJYH 3K81A 5BQ7B 1ZIBA 3A5VA 3Q01A 2B16A 2X4TA 4FQQB 1JI2A 3NMEA 2X4SB 3GSNH 1ZLVK 3RUGF 1ROCA 3U1SH 4S1QH 5CMAA 3PABA 1FL5B 1RZ8A 1AO7A 3ESPA 1KPRA 2WWKT 2VE6A 4PRHE 4MKTA 3H4FA 2FHFA 4LSDA 1ZCRA 2J8UA 2MQ0A 1S8DA 1OWWA 1JGDA 3DURA 4Y5YC 2G3ZA 3V0IA 5MENA 1PLGL 1A6AA 1ASQA 5DJZA 4Q74A 3ESNA 2XPZA 4W9GC 4RGND 5I19H 4X4KA 2WXNA 4R96A 3BW9A 3QWRD 3L3JB 4WW2B 4R9HA 1HHJA 1MFEH 2QADB 4N86A 3TF7C 3C2SA 3SYAA 2HRPL 1PFOA 5H37G 4GG6F 2Z8SA 1IBFA 1MI5E 2HT3C 3E3QC 4TVPD 1X5GA 4HXAL 3VXMB 2VW7A 1IVTA 1NL0H 2FEEL 4G2AA 4JM0A 3EDDA 3KXFB 5GZOA 3SBPA 3CLEH 2HT4C 4OFDA 5JR1H 4WJ5B 3TV3L 2ZYRA 3FBQA 3QORC 2APTA 2X1OA 1AE6L 4PJCB 2ZNWA 3L5WB 4S1SL 1LK3H 2I7SA 1CFNA 1VB9A 2JI1A 3F58H 2QGEA 1KB5H 3P3TA 3QDGB 4MVBD 4Z7VA 2PMZA 3IJSB 2IFFH 5F8QC 4G3YL 2GG1A 3QUGA 1L0YA 1T04A 4YHML 3PV7A 3DBXB 5J6SA 2O5XL 3V9CA 5ESAA 4JCMA 2WN2A 4JHBA 5KJ7E 5DDHB 4NRZA 5IVXB 5ACZA 2QADD 1HDMA 3BEWB 1CGVA 3FFCE 2X2UA 4I3RL 4GH7B 4HLEA 5E99H 2BHZA 3S3DB 5HI3D 2GTQA 3WNKA 3VXMD 2K9UA 3KXFD 3I6KB 2FH6A 1SXNA 3MRPB 4PY8I 5CLZA 1E67A 4O9HL 2Z6FA 4HEPA 4J3WA 5C8JA 2FECL 5BOZG 2RA1A 5GJTH 3JV6B 1A6VH 2OSWA 4LOEA 1JF5A 4NWTL 5DFVD 3V7AG 3ZDXE 3OKDA 3GDCA 5AD0B 2VXTL 1S7TB 2W81C 3KMDA 4XNMB 5T8IA 1Z5LB 4OV5A 3QDGD 2JCCA 2AVGA 1UWEH 5J6HB 1MW3A 1YYLL 3QDMA 1WK0A 3PU7A 4QD2E 3V52L 5JW4M 1UXSB 3SKOA 3EJRA 5E1HB 4JLRA 2GB2A 2VR7A 2R83A 5CEZL 4RWYH 1AR1B 4M7ZB 4ES8A 1PLAA 1XGQB 3OPZH 3RIFF 2GSGA 4ZX6A 4KH2A 3VVWA 2OMTB 4DKTA 3CDZB 4AQEA 1OCZB 3KWWB 4YVNA 5IFJA 1U2CA 4AIXA 4XPHH 2ITEA 5JYLA 3UX9B 2VAAB 2AABH 1DQVA 2CRMA 3Q8BA 3N1PC 1ND0B 5BXFB 4GOSA 3K0YA 3MV01 5E2UH 4KTDL 4H25B 5J89A 1HZHL 5GS0D 1KUMA 3L7EB 3O9WA 4BYHA 4G80A 3UYRL 3BUPA 5K9OB 5JIKA 2XIBA 3VG0L 3MV9E 4FL4C 2W9EH 4DTGL 1CCZA 5T3ZD 4NEHB 1MCOH 1O6SB 1PDKB 1UXWA 4TSBL 3CSYB 4TVUA 2Y1ZA 3LQZB 1AR1D 1OSZA 1OAUH 4N2MA 1OANA 3ARSA 3LRSA 4G6AD 4DJMA 4HS6A 4X7SL 5CZVL 1U8PA 5KSAB 2J7LA 3TNMA 4XNDA 3TCXA 1XQ4A 2CLZA 2Z91B 4HU2A 1QA9A 4Q6IC 2CAKA 2WLLA 4P5SA 4RAVA 1J1OH 1RUKH 2AXFA 1ZAGA 4I77L 1TT6A 5H2BA 3BGFB 2P7TB 4Y9BA 4Z76B 2WYIA 3P77A 1OPGH 3HVDA 4B9KC 5I0ZA 4OSUH 3C5JA 4DKDC 2IBGA 4QJ5B 5FB8A 2D3LA 4NN5B 4KWUA 1AGCA 1LMIA 3ARYA 2NY1C 1S7QB 1UYWL 5FFGA 4DQOL 2IADA 2BZCA 2M2DA 4F7MB 4TVPH 4GQPH 4KKRA 1DZBA 4RETB 4OB5H 1KIRB 5BRZB 4Z7WE 5ENWA 3EOAA 1CE6B 1KDIA 1QUNB 4UDTA 1I1AB 3TBSB 5TF1H 1VFAB 3FW6A 5J3HC 1EO5A 4PMFA 4IU3B 2ZWNA 5KSAD 3L1GA 4OV6F 2Z1KA 3BE1L 1PG7W 5DJYA 1JZDC 4JFYB 5BRQA 3K80A 5L8KB 4L8DB 4UIMB 1AIFA 3LKRA 4NX0A 4KVPA 3SGJA 4JQXA 4LU5L 3MV8B 4OLUL 3FT3B 3UZEC 2Z31B 4BK5C 1Z9OA 4W9ZA 4WSKA 1WLHA 2X4UA 1D7CA 4XH2B 3OKLB 4PLOB 5K1JA 3EGDB 3UBHA 2XDHA 1FC1A 3Q1SL 5BRZD 2EDXA 3HG1A 4KDTC 3BP4B 4YC2B 4KI1A 4ZOBA 1FDLH 5KVDE 4PBVC 3ESOA 2BSSB 3R7RA 4GY4A 5JIQA 1I1AD 3KDMA 1F58H 2EDNA 3RGHA 3CC5A 1X7SA 3DV6B 5D7JA 5BCAA 4KHTL 4NT6A 1L9OA 1X5JA 4LLQB 1AIZA 5F7MC 1D5IH 2WANA 3MRLB 4PLJC 3VXNB 3TH2T 2W0LA 3LRHA 3HS8A 2VDRB 1NCCL 1NCDL 4H5SA 1QKZH 3SO3C 1JPTH 3VGGA 2NCEA 3GZOA 4PR5A 3MV8D 5EFIB 1JZ4A 1LQBC 1X4ZA 3HPJA 5FR3A 2Z31D 4N0UB 1ETB1 4YIQA 3AS3A 2VMEA 3JTSB 2YRBA 2K45A 3K3QA 3GUFA 3E9UA 4J3OG 4GAGH 5DWUL 3SE6A 1PJ9A 3F6IA 5ALBH 4G6MH 1F6FB 2ESVB 1WC7B 4GFTB 1KBVA 4PJDE 3BPOC 3OKKA 1DN2A 4O2CA 4PJEE 4IIQA 5JHLA 4G7RB 4ZUUA 4OJAA 1A22B 1VEMA 1ES0A 3HE6C 4G5AA 4AUJA 1WD8A 2BZDA 5I8KL 2NTSP 5LVEA 1J0JA 3H55A 1FNGA 1QAWA 4N3TA 4PGZA 3ZGIA 4YAQA 1DJIA 2V8MA 1VACB 1FL6A 4LIQH 1MW2A 1IT9L 4GAYB 3CWGA 4JW3A 3QXUA 1Q9WA 5EWIH 1I8LC 2JELH 1NBQA 2I07B 2UUDK 4HUWA 5GS0H 3WL9A 5E7BA 3HC4L 2R27A 3HN3A 5D6DC 2AVFA 1A14H 3CZUB 2BSED 4KV5E 4ZOAA 3B2VL 3E8UL 2GJPA 3BIAX 1CFTB 4YE0A 4Y4KC 3IKKA 4KFMA 5T3ZH 5I66A 3V0VA 2Q2EB 3MREB 1L9MA 2C1PA 2H3NA 2UX7A 3FT2A 3L9EA 2ESVD 2B4CH 1PBYA 3AXHA 4WWOA 2Y06L 3SBQA 3TPKA 2FBRA 1QTYT 3NSCA 4HIIB 3FTVA 1RSYA 1AVAA 3NCFB 1GGCL 1RMFH 4XAWL 3V10A 3VGHA 4IIZA 4P4RA 1LEIB 1AC6A 4H4NA 3EJQA 1OVZA 3EFDH 2MCAA 1UUSA 2ZXEB 3LYRA 2NYZA 4HZLA 2ZKHL 5GGRY 1EBAA 2PPCA 4JY5L 1T0NB 1I8IB 3LH2L 1HHGA 3PIQA 4JE4B 4QRPE 5IUCA 3CDGB 3GJFK 1KIUB 1RZKH 4CU6A 5I1KH 4Z5RB 1AH1A 1JPFA 1Z5YD 3SD5A 4XNXL 1HJCA 3LKNB 2Y5EA 2C7FA 1XB6A 2L3BA 1AMXA 1PG7H 2GTWB 1AG6A 5I6XC 1R5VA 2DQDL 1QRNA 3F3HA 5DUBB 4O2FA 3L4UA 1SNRA 2VR8A 3NABH 5EORH 5AB1A 4AEFA 4B95C 3WUWB 5FLUA 5IK3B 2X4NB 3O6FC 2RCSH 3SEPA 3GB7B 3FRUA 2HX7A 4H8QA 5IROD 1HZKA 5DWPA 3QIUC 1NOLA 1ORQB 2ATAA 4A7TA 4PRHA 4U33A 2Y2YA 1B4TA 1RUML 1CB4A 2OMUB 4WSGA 5JHLL 3IRZA 4OCLC 4QRSB 4Y9EA 4GSDH 1FRGH 4KNSA 3QJFB 1RK0A 4UZUA 4GI6A 3DX9A 1X4YA 4RMVA 1BVLB 3FQWA 3MRHB 2GJZA 1Q1JH 3LAFA 1IJ9A 5IEHA 1W6LA 5K9QG 1URZA 2LVEA 5CR1A 2BVQB 4BZ1A 3NIDE 4RRPA 3DHPA 4FLHA 1S46A 2V5SA 2VL4A 3QQ9D 3QUYC 1EDHA 5FF6B 1RHHB 1U6AH 2YN3A 4JFWA 1MI5A 1UM6L 5T1MB 2A6KA 3MRKA 4CC1A 1EK3A 3UJTH 4FQCL 1UQSB 1ETA1 1TJIL 3PGFL 5BMFL 1ZGLA 1BZ9B 3BYTA 4X50A 4HJ0C 3S3BB 2O6DA 4V1DE 1U8QA 4XGZB 3ULVC 3TTYA 3MLXL 4OIIH 2M1KA 3H3BC 1JRHI 1NM4A 3CFEB 3LPPA 1XCQA 1CDHA 3MLVH 4I0CC 4LL9A 2FUTA 4WFFE 4Y5XA 3ZTEA 4J6RH 2CMRL 3GLEA 4JCLA 4UILL 3EYQD 2FATH 3FN3A 1HESA 3SDAA 3BPCA 2BNUB 4YHLL 5BW7A 2FJGA 3VDBA 1KNOA 3FFCA 1DVFA 1N4XL 2VDRH 1JHTB 3ZUNC 5BUAA 1OTTC 3TYGL 2GT9B 1A2YA 1GW0A 4TUUA 1FZOA 4LCCA 5MHSE 1U58B 1U8OA 3D50A 5GZND 4E36A 5DQJB 1K4CB 5J1AB 3S37L 4NUGH 4YPGA 3L3KB 1UGNA 3QIBB 4QGYA 2H0PA 4RZCA 4F3FA 1I4FA 1EXUA 3GSVA 1QFHA 2C3VB 3LD8B 1NGXB 3BUBA 4J3OC 5AVWB 1WZ1L 1EO7A 4G1MA 2K3HA 2QQQA 1YECH 3AITA 4MNQE 5D1XC 4OKVA 3ZE1F 4LP4A 4QRQA 3RFZB 1FFTB 3DX7A 2W60A 4DCQB 3DUUB 3QZWG 3S5LG 5C3IA 2FR4A 2J44A 2P1YA 4AQ1B 3BEVA 4PWJA 3II3A 4H26A 5B1KA 4K8RD 3SDCB 3ZYJA 4PJIE 1R17A 3UEZA 3U4KA 3PL6A 1HSAB 1TCRA 2Q7YB 3TIEA 3S8WA 1KFGA 2G60H 3VU2A 4RMSA 3BOVA 4OUUA 5BZDA 1K8IB 4ZUSA 5CSZB 4UNIA 4R8WL 5BZWB 1ERNA 2G75B 5C97A 4L0ZA 5AOIA 4KO7A 1Q4NX 2BVOA 4IRSC 3QIBD 1HEHC 1OB1A 5GSRB 2N3JA 3K72A 2F15A 3SPJA 1QFWM 4BZ1L 1D9KB 1PAMA 4JM4L 1P84J 4IKJA 1FAIH 3TTSA 4BFIB 4Y88A 3P1VA 1G4MA 1EERB 4FXKC 4HSQA 4YHNA 4Y9FA 4WDIA 3FTWA 1ZT4A 3A22A 1BFOB 3FYEB 4GKOA 4UQCA 3SDCD 1TZ8A 3CFBB 3BVUA 1A4JA 3VTTA 1DQMH 4ZXBA 5FO8A 3CX2A 4U6HA 3UJIL 3MFGB 3HBGA 2EYTB 1BYPA 3AADB 4PUBH 4WCYL 1ZDSA 1N64L 2VZTA 3P2DA 4JJOA 4HVBA 5FHAH 5ABAA 3ZMRA 2A6JA 1RY7B 1BHGA 3KJ6L 2ZCHL 1AOHA 1NCTA 5CP3H 4FQLL 2VDNH 1R24B 1RZJH 1NLDL 1RUQH 3CZEA 5JPNA 3UBXA 2ZXBA 2YPVH 3K2UH 5GGQL 2E27L 5DHDA 2ICES 3QE5A 3QJQB 3AB0C 3CHQA 1D9KD 5CZRA 3U46B 3HMXA 3VE0A 1CMOA 3BI9X 1ED3B 3MJ7B 5TTRA 2VXUH 1XGRB 1OSPL 4PM1A 4DGYH 3WNLA 3AFLA 5KTEH 1WS7A 4JVUA 4W9JC 4B96A 3TFKD 2JQAA 1DQDL 1G94A 3C8KA 5C1MB 3NPSC 4AT6A 1YEJH 5JA8B 3NZHH 1A5FH 1Q9KB 1II4E 4A7GA 2YGPA 3CDCA 4Z7WA 1VIWA 4GI9A 4ZYKB 3FU6A 1LE5B 5C9KA 3RX7A 2DOCA 2EEBA 4J3SA 2DQIL 2O93L 1D5ZA 3ZSTA 1XCWA 1B2YA 3HCVB 4PTTB 5E08L 4PS4H 5EZIH 2NY3B 5I8EA 3AG4B 4O5LH 2GIYA 1HEZB 4XB8A 5IB4A 4N85A 5KVGH 2XWZA 1SQ2N 2A38A 4XP1H 3MMEA 3N5AA 2BNQB 1EJOL 2Y1VA 3STZA 3OXRB 4U3SA 1WV7T 3FAWA 4TLUA 4L1SA 1RZFL 4W9IC 4W4NA 2E9BA 1FNLA 3DOSA 1KJMB 3MACH 4AQAB 5IJVA 1R3JA 3IFLL 4Y19B 3U30C 5KBMA 1P7KA 4K3GA 2HT2D 4JZOB 3NP3A 4LHUG 5FIEA 1RPKA 4C4KT 5AVZB 3VFSB 3WUZA 1JK9B 1IAIL 2FX7L 3NFSH 4JM2B 1BP3B 1E4WH 2ORBH 3FN9A 4B97A 1S9XB 2AXJA 3KYNB 1JMZA 2NY3D 1YJDC 2XWXA 3FZUD 4JDVB 2CQVA 3B9DA 3DRQB 1F0LA 2X9WA 1QW9A 4XO3A 2FK9A 1NGQL 2BNQD 3OKEB 3I84A 4FC3E 5E8EA 2P8LB 2WJ5A 1FFRA 3QULA 4LLVB 4F8TA 5FLVA 1MIEH 3PQYB 1ZVSA 4WK2B 4BFGA 2FCBA 3QR2A 5AOJA 2E9WA 4K8RH 2YN5A 1T6WA 3UO1L 3CE1A 4Y19D 4DGIH 5I1DB 1ZS2A 2AXWA 1XGYL 4GAFB 4PJDA 2MPVA 2XKSA 3IFNL 1C5CH 4PJEA 4K94C 2C1OB 2CLRA 2ZKYA 1M2OA 2AXGA 3QEGL 1IGJB 3E2HC 4JM2D 1PEZA 4P3CL 4M5YH 4EIGB 4P2RE 3HMXL 4FEIA 3ZL1A 4MS8D 3R1GL 4HPOL 3QIWD 3C60B 4I3GA 2HPTA 3W9EB 4QI3A 3IS1X 5AUMB 3QUXA 3NSYA 1JZHA 1YUHB 2GFBA 5DRZB 5ERWB 2WB7A 2J25A 2A73A 1A7OL 3BSHA 2AQNA 3MNVA 4HOWA 4BWWA 1EEZB 4C8XA 2GUOA 5JO5A 5DMKB 2P42B 4XCCL 3LNGA 3MRRA 3PQYD 2VLME 2EDLA 3U0TB 4GB9A 1NWOA 3D2UB 4TPRL 3DV4B 2V17L 1BQSA 2DL2A 1THAA 5I18H 3S5ZA 5E6ZA 4X7EC 4PSPA 3VSUA 4N8UA 2P5PA 4QWWD 5DT1H 1OPOA 5I1LA 1FAKT 1U91B 4HIHB 2GHWB 4F9LA 4ZAKB 3F62A 1OO2A 1U2YA 2JK5A 3GHBH 1F1GA 3C60D 2WLJA 3BT2L 5DJ0A 5TDNA 1LK2B 1YY8A 4X2UA 1Y1DA 2D7MA 2OL3A 1I9IL 4YHYC 3TT1H 4YBQD 4JO4L 4QRPA 5JLZA 2AHIA 1YNLH 1JGVL 2J5WA 1T83C 3S3PA 3V8OA 1XSIA 2MQCA 5KVDL 2BY3A 3ECBB 4M7JL 2E56A 3D2UD 1ZE3H 2Y5TB 1DVXA 3KPTA 1GGYA 2HG0A 3Q6FB 4GW4B 3BP7A 4FFTA 3H2QA 4OH2A 3VRLE 5AVYB 3GBML 4PLNC 1QG3A 5AG9A 3TX4A 4QY8A 1T1WB 1L0PA 2P5EB 2XFXB 4I87A 3UDWA 5BVPH 4DVBB 3MI6A 4EZJA 3ML9A 4ZAKD 1BD2E 4HJGB 2JE8A 1X9UA 1MFCH 1P2CA 1AGBB 4Z0XB 5C09B 4KO5A 3LHPL 4K7PL 2BP5M 5AEAA 1T03H 1KN2L 4HA1A 3JV0A 1ZSDA 2DWSA 1G43A 1WBZB 1F11A 5EIIA 4OCYL 5EB9A 2JTYA 2IEPA 5CGYD 1KCRH 1RIVH 5HBBA 3L3OB 2I9TB 2HSIA 3BVWA 3VI4E 3BQUC 1EO8L 3ULSA 2X6CA 2H2SD 3EO0A 3Q6GL 1FFNB 5B1CA 4JJ5A 2QJDA 1CI3M 3KPRB 1PTZA 2H9GB 3DYOA 4DP5X 1D6VL 4PJ7B 5DS8B 2DMKA 3KYAA 4ZS7H 3S36L 1LQSR 4WO4A 4UMSA 4QHPA 1NFIB 3OKMA 4YR6B 3KLLA 3SYPA 2FO4A 4GMSH 3VXRA 5LBSA 5C09D 2FL5B 4BSVB 1NPJA 4P2OB 2HKFH 3NJGA 4OZGF 1M1XA 4XC1L 3V0DA 4ZO9A 4KK8C 1UD4A 3WLWD 2V6HA 3NQKA 4MD5A 1MZYA 4BCZA 1MWAA 4JUTA 4V1DA 3KYMA 1MFBL 5HXMA 4MWFA 1UKQA 4XVJH 3PHQA 2AJYL 2D31B 2C8NA 4AYBA 3IDXL 3EH2A 2HJLA 4JANA 1FNSL 1BF5A 1AKPA 5FCUL 1RZGA 1RU9H 1TJXA 1UA6H 2Q3AA 4AYMC 1WD9A 3PDGA 2CNZA 4Z7UB 3TL5A 3NEXA 2FVNA 4P5TC 1FFOB 3ISRA 3KPRD 5H35B 4G42A 1ZA3B 4U1NA 1G0DA 5B7EA 1UOKA 2OL3L 4P9HC 3DO4A 4UTBH 1PW3A 1T2QH 1U8KA 1O7VA 1J5CA 4FNQA 3UBGA 4WU5A 1B0RA 2CGZA 1UWGL 4LSPH 2GITB 5KYYA 4P2OD 5F0LB 1G7MA 3K6FA 3HMWH 1FO0B 2F7IA 1RUPH 2CNYA 4UUJB 1OAQL 1NICA 4Q9RL 3DIDA 4J27A 2J3SA 5E5MB 3QHFH 1OW0C 5IB2A 4P5KB 1EJ6A 2WBJA 4X9YA 4LQFL 4JFHE 3ARBA 1KIPB 2WBKA 2NY6B 3C08L 5GS1A 2YK1H 5DHEA 1MH5A 5GQBA 1SM3L 1WVZA 3D30A 3C6EA 3QEUB 4KKCD 4X5XB 4MNQA 2EICA 4NZFA 2RMNA 4HIEB 2XTLA 1W6WA 1ZSHA 1OZTG 4NKMB 4K9EH 2P80A 3KYKL 4V11A 5EBWB 3MLTA 3VFPA 4KJPC 3E1F1 3S2AA 3NCCB 4K71C 1LO4L 3U9WA 4PJIA 1VKXB 1YY9C 2AJVH 2J1YA 2YRLA 4ONFH 3RWDB 5KSUB 1PX4A 5KVMC 3F7RA 1E3XA 3LTVA 1JJUA 1PYWB 1QHQA 3IBEA 3VX0A 3ZDZB 4GMTH 1IZKA 3GBNH 2R0KL 3C6SB 1A3RL 1FVCB 2ZUSA 4MXVF 4WJG3 3ZYOA 4WK0B 4M4PA 5C2BH 4XP6H 4HOXA 4XNYL 3U0PB 2NY6D 4M62L 1I7TA 4F7CB 2DDQL 1T1XA 3LIZA 3CXHK 2FX8L 3CHOA 3D2TA 3L5HA 3WIHH 4DKEL 2ZOKA 2PYFB 3G6AB 1TEGA 4TVPE 3BAEH 5LBSL 4OUOA 1W91A 5I1GH 2YC1A 3GS0A 1HU8A 2YD3A 3LS5L 5CR8A 1AFVH 5KSBB 1NEZB 2YEQA 2YLKA 2E0PA 3ZT5A 2AP2A 3DOHA 1T0PB 3T3MF 1HIMH 3LS4L 4G43A 1K2DB 1GZHA 1MWAL 1H15A 2ZXDA 4RGMB 4R3SA 4YEEA 3C6LB 2G5UA 2CR3A 4TNVF 1GC1C 4Z7NB 3OF6D 4HJJL 4Y9GA 3C9NA 1JVOA 1CD1A 1DDHB 1ROWA 2I5YL 3RIAF 1QLRB 3N41B 5FM4A 3WE6B 4L1DA 2Q8BH 5DMIH 3PREA 3RWIA 2WK2A 2COVD 3PP3K 1YEHL 5K1NA 3WJMA 5EOCH 3UABA 4I4WA 4Q4IA 5BNXD 3D25A 3W56A 3X14B 3GMNA 1NPUA 5TGBB 1IGYB 3VXME 5CWSA 5SX4H 3QYNA 4KZDL 2K6ZA 3KXFE 2PO6B 4N28A 4G8GB 1RJZB 2DH3A 4IK6A 4U1SB 4ODVH 1ZVHA 3UG4A 1NDMA 3GO1H 1XIWC 1JTTA 4PJCE 5K59E 4QHNA 4XMTA 1HH9B 3JTTA 1UB5A 5JIPA 2DD8H 2XQYG 3OB0K 4UM8B 3KCPA 3QDGE 1PZ5A 3ET9F 5EO9A 4FFVC 4JG1H 2V7HB 1M7XA 4HJIA 1RFDH 5IW1B 1EVUA 1I3RA 4NSKB 3PP4H 5IVXE 1NGZB 2JH2A 2RFXB 1NKRA 2YGVA 2SODB 3X13A 4CMHC 1GSMA 1T66C 5F0PB 5EHFA 3IGUA 4AIOA 4XTRD 2ICEA 2OSLB 3OAUH 2CDGA 2OTWB 3ETTA 4XVSL 5DJ8B 2PO6D 1HXMA 4G8GD 1EFXB 2JJSA 3CHXA 4GQ9H 5FGBA 3NA9L 1DBML 4YLCA 3VH8G 3ASWA 3EYVB 5KYWB 4DT2A 4PGBA 5EH1A 4FQXC 2EDEA 3L7FA 1H5BB 1SPDA 2QGCA 2CBPA 4LIQE 5FDWB 4NS0A 2HG5A 5GGSA 3MRJB 3RJQB 1T1ZB 4I8DA 4XMWA 3LIZL 4N1HB 1NUNB 2IOMA 4WY7L 3HAEA 5C92A 2OAAA 4TOYH 1WEJH 4HU8A 5AAMA 3LN5B 4BKSC 5I5MA 2HFFB 4NP4L 1P4LB 2VXVL 2YPKA 2VC2L 1HXYB 2PR4H 1GY1A 2WTPA 2MTPA 2YSSB 1TTFA 4HKXB 3L4ZA 5T3ZE 4PS8A 4PCSA 4PGDB 1R1CA 5CP7B 1B88A 4YWGH 1BQLL 5DVMA 4ODUA 4DETA 2AMUA 3WTVA 1E5CA 2N1TE 2WC7A 2ALAA 3IXAB 1MLCA 4XMZA 2B2XH 2EJ1A 2HFTA 1H8SA 3MDJA 3ALXA 4QXVA 3QQDA 4KQ3H 3GK8H 1EZLA 1IBDA 3AREA 1EFXD 1ODAA 2Z4QB 1LO2L 3N55A 4ANKA 2JFCA 1UHVA 2CGRL 2DYRB 3DECA 1D2PA 3FTUA 2XPGB 4X4XA 3SDDC 1RVFL 4X8CA 4WFGD 5AYUL 2EDMA 3EF7A 4N4YB 2J8OA 2L0DA 3NFPB 3PFQA 5I8OL 3ILPA 5B38B 5IJCC 1FJ1A 2JB6A 4A67A 4EBQH 5L88H 3MLYH 2IH9A 4OGQC 3QA3B 4RRPG 1CFBA 1WE5A 2LT9A 3OHXC 4M03A 1MEXH 4OR1A 1CLOH 3RDTC 3VFMB 2APFA 4WHTB 3GZQA 1G4RA 5JPMB 4Y4HC 4XT1C 1YVLA 4J4PA 1GPOH 1NFKA 3L6FA 1B4JH 3B5TA 2ZX7A 4Y5YB 4TMPA 5AAWC 1EQWA 4F1SA 3PWLA 3VG9B 2B3IA 2CO7B 3ZHNA 2NY5H 2YZ8A 1X3DA 2R0LH 4U6YA 5AZEH 4N1CA 4DGUA 1IEBA 1DCEA 2B0SL 1XCTB 4LDLB 43C9A 2NZIA 2ZOLA 4DAGH 2I60H 1QSVA 3KBPA 1BM7A 4X9IA 3GSNA 5EU3B 4QRTB 4YSPA 4I5BB 3WDHA 2CSPA 5CSGA 4HCGA 1INEL 3ZTNH 3RGBA 1SYVB 1E42A 2H6PA 2HFEB 4CVZA 4F15B 4JPIA 5EA0H 3W38A 3FFDB 4JFDB 3TA3A 6FABH 4PJ9C 2KHAA 1FGVH 3F12A 1I82A 4PWFA 4ZMAT 5J57B 3FO9A 4DSYA 2DQUH 2HRLA 2NOYA 3QORB 5FOJA 2XT1B 5BRZE 4LEOA 3KJ4C 1MRFH 1OCWH 1GR7A 1PS3A 3T0XA 3WFCH 1IJNA 3EFOA 2DMCA 4PVMA 2A9MH 1DE4A 2XBDA 4X7DC 5DK3A 4LSSH 3CFUA 5EBMB 2QQNH 3D0LA 5I17A 5JOFB 4W4OA 3NBNA 1Z9MA 3R0NA 3WSQL 4FE9A 5JUEH 1ONQB 1JTOA 2AV1B 4P59H 3UL4A 2ZKMX 3ZE2F 4Z95H 4IOIB 5JHDB 5F7AA 5E2VH 3MV8E 3ZT7A 5DR5L 1AZRA 1M7IB 5AB2A 4LEBA 1DVQA 3VFRA 4N90D 2HT3D 3WEAA 4DP8X 3RU8L 1G6RB 4TXVB 2CUHA 1UZGA 4DGVH 4JFDD 4X6DB 5D72L 3FCTA 2HT4D 3HJ0A 3VXPB 3F7LA 1NC2B