1NCBL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL01
1K9TA 4QXGH 5ITBL 4BZYA 1M7XA 1PZ5B 3E1F1 3BPCA 3RL1A 3ULUL 4EVNA 4KQ3L 1UWEH 2WIIA 3TN0B 5C6TH 4AG4L 1MAKA 1FGNL 3LEXB 2ICES 1VPOL 1DQLH 5FF6A 5IFJB 1IM9D 2HLAB 3JV5A 2JLLA 3GIZL 2DQIH 2DD8H 1IFHL 2IQ9L 4WW2A 4ZOEA 4LVNC 3SOBL 4Q9QH 1CZ8H 4Q0XH 3UPCA 1MFBH 3C6SB 3IDNA 3BP7B 5F7DA 2UWEA 2G60L 3DVGA 5KSBF 5DEFB 5ADOH 4ZFGH 1D7FA 1Z6JT 4LCCB 2C3WA 4N0CD 2LABA 4L3EE 1AXIB 4MJIA 1GC1L 3KLAA 5HHXH 1XGTA 1KIQA 3LQMA 2Q7YB 4OLZL 1SJHA 5SX5H 1J5OH 4PV8B 2NQCA 4LPTA 1U8QA 1FGVL 3D0VB 2FRGP 2D0HA 4JGMA 2B4CH 4JM4H 2ZCLH 3RWHB 1X7QB 4L1HA 5GGRY 3VWKC 5FYJD 3H9YA 4JM2C 5JNYB 2JKXA 4N9OB 4UT9L 3V8OA 3FMGH 4NQVB 3OZ9H 4NKDA 3AM8C 2V5TA 4PR5B 4U6XA 4WI3A 2P46B 4QRRA 1T5XA 4LPXA 5DRZA 3L9RA 2F9BT 3MA7B 1T80A 1ZGLA 3SHSA 5AUMB 4KPHH 3EKCA 3WHXB 3ESVF 2ORBL 3D18B 3RPKA 1JPGA 1U8PA 5FECB 4U3XA 3N1GC 4Q6IB 4PY8J 1F4XL 4PJ8A 5MEOB 1T7YA 5T3XL 1A7OH 2N7AA 2IALA 5EZLA 5HHNB 2J6EL 4FQXD 4DK6A 5CEXB 1QLFA 4G43A 4I3SL 5GSRA 4WW2F 4J12A 3RWIA 5B8CA 1MHHA 5MEQA 3EGSA 1AHWC 3BE1L 3MRIB 4U3HA 4M8VA 2LQRA 4F2MB 4BSWB 2V7NA 2UWEF 1NAMB 1FNLA 1T22A 3F7YA 1QFWL 2BERA 4U1SB 2BHYA 3LRGA 4FQHB 4KMQA 2OI9C 4YIQA 1CDHA 3VMOA 5DYOB 4DGVL 3IS1X 3LN5A 2R4RL 2LAAA 1YJDH 2OR8A 3BESR 3QH3B 2KZ1B 5CGYD 5EO0A 4LCIH 2X42A 35C8L 3DXAD 4JPWL 4NN5B 3RDTA 3LS4H 4GKOA 4HBQA 3DMMD 2QQLH 1FIGH 1HQRB 5TQ0H 3GSRA 2D7NA 3UZEA 1EHLL 4KJQC 4X98A 1NGWA 5K9KB 4MWFB 3FQTB 3DUSB 3Q6FA 5TH2B 1YMMD 4JN1L 1LEIA 1H0DA 4R90L 3WDHA 4NDMA 4G9FE 4X5XA 5E00B 1OTUD 5TF0A 4HV8B 3SKUD 4ODUA 4KKBD 5CJOH 1H3TA 3GSOA 3RRQA 4H0HB 1OARH 3AU1B 1KNOB 4P2QE 4FQQA 4HQQL 2DF3A 3ARGC 5CS7A 5HHPB 5J11B 1PQZA 1D9KA 2DMKA 3MROA 4P5MA 4FQCL 4Y4FC 5CP3A 2ZG1A 1YEKL 5BXFB 1CDBA 2YMXH 3DVFA 1NGPL 5CJBA 5DGQA 5E2TL 1A7BA 5E2VL 4BH7B 1WBYA 3Q5TA 3U0TA 2H26B 3OR6B 1FLRL 1YN6A 4PRHB 4WV1C 4A2MA 5D7IE 2HP4A 3A6BH 1J05B 2IEPA 1BECA 3S3SA 1NMAL 4TQEL 4EI5C 1MCOL 4NZTH 2F58H 5DQJB 4UV4L 4XMLH 5SWQA 5HHOE 1BF8A 4ZXBC 5H94B 3SKJL 1EJOH 4X6DA 4KI5C 1MFDL 3U4EA 2AEQH 2BC4A 1WIPA 5F7HA 3FO2B 3PWJB 4CVZA 3ARRA 3FOLB 1CGXA 4L8CB 3WYRA 2P4AB 1PY4A 3PQYB 3VXTB 3QEUA 1W0WA 2ICWA 3FJTA 2YKLL 4ONFL 4P4RA 2AJXL 3TZVC 1VKXA 4H8WH 4M7LT 2GJJA 1L7IL 3VXRD 2HG5B 4JRYD 1N3NA 2NXZD 2R8SH 5HGDB 5E56A 2CIIB 1FJ1A 3RPIA 3ULUF 4PRAB 2EDXA 1G7LB 2IAMD 2VNCA 3SKNB 1T1ZB 5DC9B 3V4UH 3QNZB 3QFJB 3QNXB 4QRUA 2J6EA 3EFDH 4PJCA 5HYEA 4V1DA 5ALBH 2V6HA 4PJEB 2XXMB 4KMTH 3UTTD 3QQ9C 4JG0L 3MRRA 3VFVB 1Y6MR 4H25B 1II4E 1X6LA 5EO9A 3OKEB 5F9OL 4YEFA 2X2YA 3NIGE 1S5HB 3QWOA 4MAYC 2HFFA 5EFIB 4CDHA 4RQQB 5IK3B 3BUYA 2JIXD 4B5EA 4QGYA 3KDMA 5EO1A 3STZA 1QKZH 1J8HE 2LU4A 2A9NH 1OGAA 2COQA 4OCSH 5TJWK 3VDAA 4ODVH 4TTDC 2Y4SA 4P4KD 5K9JL 2GK0B 1HIML 4F58L 2D7TH 4GKZB 1X6NA 4FFYL 4Y19E 3SY0B 2CKBH 1YDPB 4XBPB 5A2KH 2VJXA 1YMHB 2RIKA 3OKKB 4DEPB 5JO5B 3V52L 4I0PA 1EV2E 1MFCL 4X6DF 1FZOB 3ZKND 4IIQA 1OOAA 1MHPH 4LSPL 4RISL 4LKXB 3VA6A 3AREA 2PN5A 4ELMA 3LMJH 2FEEI 3D69B 1P7QB 5L0QB 1BAFH 3S3JA 3RY6C 3BKML 4ZAKB 1VGEH 4P46A 1UZ8A 2B2XH 4OJFH 4XMKL 4ZOAA 3T77B 3U9UB 3MCG1 3OPZL 3CFEA 4PP2B 3CFDB 2Y25A 3TFKC 4YC2B 3IKKA 5E6YA 1RURH 4PJCF 4KVCH 1ZVYA 4S1QH 5BJTB 1ZLSL 3H42L 4YFLF 4OQTH 5IROC 3VFRB 3GJEA 5D4QA 1AJ7L 3RX8A 4YWGL 3V2AR 4QXTB 3KPSB 4CNIB 4C58B 3GMMB 1XGYL 1M71A 3WUZA 1U3YA 2H32B 1KV3A 1TFHA 4ZUTB 1A3QA 4XCCH 4IS6B 3WKMH 1S9KC 2VLKA 2YZ1A 2R1XA 4O2FA 4YQXH 2FBOJ 3NGBB 3TA3C 5GGTH 1KEMH 3UJTL 1GVIA 3M8OH 3W0WA 1YYLL 3DHMA 4TUKL 3GSVB 1C8PA 4JO1H 2Z8VC 4CBPA 3SDXE 4ZS6C 5JQ6L 4HFWA 1AP2B 3HPJB 2VLJE 3R1GH 3UPAA 5MEND 4ELMF 4JVPA 1RZKH 4QXUL 3U7YH 4LVOC 4GSDL 5J1SC 3ZYJA 5CUSL 4NUGL 3NPZB 4U3CA 2GSGB 4L8DA 1JPTL 5DWUH 4IRJB 1CLYH 2HT2C 4OGXH 4WU7A 3EO0A 4HKZB 2C4FT 4XAKD 4RIRA 4TN9A 1KLGB 3PHOA 3QRFM 1NC4A 1F3RB 3BKCH 4JHAL 1OAQL 2B5IB 5JQHC 4I1NB 2UZYB 4LL9A 4OCWH 4W4NA 1FNSL 4P9HH 1IZKA 2IMMA 1G7QA 2FB4L 5DK0A 3TESA 1KYOK 3QUXA 4KFZC 3PUCA 1UM5H 1EJ6A 1CD0A 2YSSA 4CVWA 4IJ3B 5E6IC 5T1MB 3GSQB 5DHXB 4HK3N 5IV2A 2YS4A 4W81A 2NY1B 4AENB 1HHIA 5DTFA 3MXVL 1BJ1J 2ZP0T 5D1ZC 3ZT5A 1CDGA 1INDL 1RIVH 3HN3A 3U46B 5LXGL 3FN0H 5L2KD 3LKOA 1N6QL 2BSED 4AMKL 4XHJC 4JY6A 4JKMA 4WJ5B 3FFCA 5ENWB 5SWSB 3QCVL 3UBXB 3HZYB 5DT1H 3LD8C 5ACLA 1MCFA 3ECBA 5SWZB 5TF1H 4AIOA 2VQUA 4MNQE 3VXNB 5AZEL 3UEZA 1Q9KB 2B7DT 1JHTA 1RJCA 1KJ2L 5HI5D 5E5MB 3VWJC 3C08L 5ANMB 2APBA 4NSKA 1JGEB 4FTVD 1UB5B 3BEWB 3BGMA 1I7ZB 4HXAH 2QADD 4ONGH 3IFNH 5BVJA 5D93B 1Q0XH 1JZ5A 1XF3B 1EO8H 1WBXA 1JI1A 3IRPX 3ARFD 5IFHH 5I74C 1CTOA 5IEHB 2HLFC 1I1CA 5HGHA 1FG2A 4M62L 5KVGL 3BN9D 4RMRA 3A6OA 4CUCA 1BIIB 2A0LC 4XBGA 1AXTH 1TVHA 1YPZB 1JGUL 2NZ9D 3CLFH 3CFKA 2O5XH 4PJGE 3KYKH 3LRSB 1OHQA 4ODWB 4HGWB 5I1HL 5ECJE 1YEDA 1S9XB 3A6CL 3WL9A 1KN2H 1VDGA 4XPTH 1DLHA 2QHRL 3GI9H 1F8TL 4DVRH 3HS0B 2BMKB 1HILB 5E94B 3HE6B 2R1WA 3GNMH 4YK4C 2X4PB 4U1JB 4XVTH 4LASL 5KTEH 4HF5H 1YEFL 1UA6H 4UBDC 1CFVH 1JF1B 3GI8H 2XY2A 3QDJD 3DGGB 2Q76B 5CZVL 5GGQL 3RUGA 2P8PA 2C1OA 2AGJL 4CMMB 3V0VB 3P77A 4YAQA 3Q2CA 2DQJL 1KN4L 5JHDD 1ETZB 4NHUA 4PGBA 4R4BB 5CEYA 1P9MC 1Q9OA 3CVIL 1IKFH 2OP4L 1CFTB 1SYVB 1ZT4B 5KSAC 1F3JA 4TYUA 4RGOH 1OPGL 5I8OL 4X6BA 1BBDL 2FGWH 4I3RL 3TWCL 3TNMB 3T0EC 2H3NA 3Q3GB 1BGXL 1T1XB 1DCLA 5LWYH 4AZ8A 1RU9H 2AJYL 3NFNA 3MLXL 2V5YA 5J12B 4Z0BH 1DZBA 3S37H 3EDJA 1MI5E 5DD5L 4XHQA 3AAZB 4KXZI 5C09D 3MJ8A 5C0IB 1RIUH 3BX7C 3L1OL 3C9NB 1KT2A 5HHVL 3SDDC 4U6YB 5E1AB 3MRBB 1PZUB 4WEBL 5GS2H 2A77H 1XZ0B 4P2RB 5CEZD 1JZ2A 2Y5TB 2PW1B 5CBAB 4U1LB 5CD5C 1A6ZA 2Q86A 5TE4H 1KJMA 3RUGF 1KJ2A 1G6RH 4ZFZA 4QRQB 4WW1A 2NY2B 2OR9L 4DKFL 5I16A 4F57L 3OX8B 4HIHA 5CLTA 1UVQB 4PJ5B 3WFZA 3OL2A 4EIZC 5DJCB 3WJJC 1TJHL 4FMKA 1YEEH 1I3RA 2PW2B 1EAPB 1HXYA 3LOWA 2P5EA 4OCYH 4PJ9B 2IGFL 3CLEH 2IADB 2AABH 2XFXA 1U8NA 5HHME 4Z8FH 2VL5A 4PY7B 1VHPA 5F88A 1NEZG 1KTDA 4K8RC 1A3RH 4O58H 3EYFB 3VD7A 2GJ6B 4C4KT 4TSAH 2Z91B 1FDLH 4GRLB 4NOFA 4CADB 3GBMH 4Y1AE 5HI3C 4GAJL 3MRCB 1K8DB 2E8ZA 2MJWA 2XA8L 3MRGA 4YFEA 3DO7B 1S3KH 3E0GA 3TLRA 5D7JB 1OAXL 3B9KC 1U41A 3DIFB 3C5JB 1MWAB 3TPUA 5D1QC 2IBZY 2XG5A 1VESA 4U7MA 2OTPA 4BZ1H 2UZIH 3V4PH 4U1HA 1MF2H 2KKQA 3DYOA 3HC4L 3BZDA 2EIBA 4NUJA 4RWHA 3H0TA 1G9ML 3DRQB 3S96A 4M61B 4RWYL 3R8BB 2G75B 1MCWW 1DP0A 4G9DA 5GISH 3MBEB 5I8EA 4ENEC 4R7DB 5IBUB 4U1MA 4FQIL 3FT3A 5KN5A 2NY4C 3MOQA 1KEGL 3F7QA 1MPAH 1B3JA 4OD3L 4JFDE 1SM3L 3JV4A 1QBMH 2FLRT 3MOBH 4U6VH 3TO4B 4X4XA 5EZIH 2PXYA 2MCPH 2DM3A 3UZQA 2Q8AH 3S37X 5E9DE 3QCUL 4X0KA 3QO0B 1PVHA 3ZKXC 3RNKB 1J9CT 1MNUH 2RCSH 1KTRL 3RZCD 5I1KH 4ZMAT 4LEOB 1TPXB 1F6AB 4Q2ZB 2YEZA 3T0WA 5EU4B 3MUGA 3GM8A 5GGRA 5K9OA 2DKMA 3KS0J 1XR8B 3CFCH 3MMEB 4X80H 5FYJH 1S7QA 3HZMA 3LQZA 3VFSA 2XTJE 1A9EB 2OLDA 4EDXA 3TT3L 3EJYC 3FCTB 4M8QB 1A6AA 4P5TC 1VEOA 2AJVL 3DI3B 3MJ7A 4JO4L 4ZPTB 2EDYA 2F5BH 3QULA 4QOKB 5DZNA 5C7XL 3B4NA 4TSBH 2ZPKL 1NCUA 2A73B 1E28B 1FZJA 2NTFB 4HUVB 2K3TA 4XRCB 5DHVH 5EDXA 4N5ED 1SVZA 2QBWA 4Y5VA 2V17H 3KR3H 3QIUB 4GG8A 1FBIL 5L6YL 3QIWC 3VGHA 4EDWH 1XGRA 1A7QH 4GXVL 3X14B 3GMOA 1FVCB 4LLYA 4BQBA 5DR5H 2EEBA 4MQXD 2KL6A 4IRSA 4Y5YB 5D1XB 4Q9RL 2O5ZL 4U0RB 2NYYD 1B0RA 1A4JB 1JHKL 3MFFA 2I07B 1G9EA 2ZCKH 4ZUWB 1OSPL 5C9KA 4P9HC 4LLQB 3VJ6B 5IT2H 1J12A 1MCJA 2QKIA 3MRPB 3O9WC 5EU5B 3WUWG 2HJLA 3V7MA 3KPRB 3WSQH 3PHSA 2CJUL 4QHNB 1U95A 3NACL 1T83C 3W11D 5IBLD 1WFNA 4FXLA 4MGXA 3QUMB 1AR1C 3BZFB 3O3BB 2NXYC 4DKDC 4RRPG 1NEUA 5ID1A 5FYLD 4BQCA 5AAWA 2QQNH 1HOCB 3ZKMD 5ISZE 1I85C 5IQ9B 4OI9A 4UQ2A 1NUNB 4Z76B 4QHKJ 2AQ3A 1U92A 3BGFC 4JZNB 5E4EC 1N64H 4LFHG 3VFMB 5BMFL 3V5KA 3K4AA 4G42A 4Z78A 5BV7C 4PRHD 4R2GC 1IT9L 4UDUB 1FNFA 4HKJB 2NX5B 1UJ3B 5TDOB 5F97E 1NFDF 5IHZB 4NKMA 5HDBE 3ULSB 4AT6A 3CSGA 3KXFD 3TBVB 1PW3A 4YHZH 1U6AL 4QHMB 1RK0A 1C12A 5HPMA 5J1AB 5I8CB 5C0RH 4GG6B 5IVXA 4I2XA 5HYSB 3QIBC 3RP1A 2Q7NA 3L3OB 3D25A 1REIA 2R0LH 4HW6A 5E99L 5KVEH 4YHOH 2R1YA 5FUCC 4L4VE 1FFRA 1YEIH 1CD1B 4ZO6A 4YZFF 1HHJA 2X4SB 2DQTL 3CX5K 5K59E 3GB7B 5DMIL 4KK5C 3HE7B 3KPMA 1NMBH 1JTTA 5I1GL 4FQ2H 3DURA 4DAGH 3KJ4B 3MV7B 3UTSB 2EKJA 3IJHB 5DSCA 4HDIA 1YNLL 1ZHBB 4BELD 4JG1L 4QRPA 3EYOB 5HYJE 5DVLA 4OD2B 4KV5E 4WUUD 1U91A 3P4NA 5BRZD 2ZWLT 1PG7H 4PRIB 2VLRE 2Y36L 4XC1L 4MNGA 4MNHB 1BX2B 2IH1A 2CGRH 5FHBH 1KJVB 4D0BA 4YHPB 1A6UH 3H8NA 2QQKH 4F9PC 5IKCB 1J0IA 4ISVA 3QUYD 2OJZL 2ILLA 4MVBD 2GJZB 3LN4B 3LV3A 5LAXA 2G9HB 3S34H 4DGIL 4O00A 4F7EB 2C3GA 2VN4A 2R2BA 4MQ7B 5FM8A 1INQA 2AW2A 2IH3A 2CKNA 3SE4A 4S1RH 2DQCH 2UVFA 3EDKA 5DMJB 1I8IB 1OQXA 2R0KL 4LPVA 4OFDA 4HH9B 5HPOA 1OF2B 4G5ZL 1PYWA 2D2OA 4OKVB 1JMXA 3WO4C 5IVXF 3QXUA 2R39A 1GGBH 1OAKH 5IFAL 3BKYH 2ADGB 4PB0L 3PG2A 1MCBA 1QLEH 4ZSOA 1R0AL 3IDGB 1R3LB 4XXDA 3EYQC 3CDCA 4K9EH 1G7PA 1P7QD 3SO5A 3QXVA 1EUTA 3W9EB 1IL1A 1GIGH 4ZAKD 5T1LB 3Q48A 1U3HB 3EHBC 3SE3C 2X7LA 5CP7B 4XP5L 3IJSA 1OM3H 5C9JB 1GGTA 3IFOA 1GSMA 4ODSL 3HC3H 3RA7H 4F33A 3QPQC 3MRKB 5F70A 1HINL 1MFNA 5C0BA 5FYKD 4G6FB 5JOFB 5FCSH 1IEHA 1OAUL 3MNVB 3T0AA 3VXMD 4KROD 2ED7A 3VWKA 4JFEA 1AGEB 1DVFC 3BPNB 3FQUB 1P84J 4JM2A 1Z0NA 2QR0A 2DQGH 2WSKA 1D5XA 2XY1A 4WI8A 4OFYA 1N2RB 1QBAA 5E8NA 1W72H 4UT7H 1FH5L 3AM8A 4JDVB 4KY1H 2Y07H 3FQRA 3TT1L 1U8IB 3GGWA 3FONB 4BK4A 3CVHH 4X7FC 4QRRD 3QEQE 2X40A 3Q6GH 3VRIB 4HIXH 4G6ML 1S8DA 4G8GD 3OAUL 2VWEE 4OLWH 4XGZA 5HGGS 4O51B 3BT2L 4PJXA 4CVXA 3I3DA 3B6SB 3IVKA 3UTOA 4XC3L 2FX9H 4LNVA 3QZWG 5C8JB 3KYMA 4M6MH 4H1LH 2EE3A 3LQAH 4EXPX 1MREL 3GZKA 1PG7X 4MJ4A 3OKMB 4Z7VA 2ADJB 1AHWA 4FQ1L 1MLBA 3OSKA 1I3GL 5GGUB 1F4AA 5DXWA 1CG9B 1OY3B 4E5XA 1JTOA 4XNXL 2VYRE 3MV9B 3SGDI 5F7EL 3VCLB 4FMFA 5FK9A 1I1AB 3CCHB 1S7XA 5FO8B 3VFWB 1FO0H 1ZGLM 1MQKH 1K5NA 1NCDL 4Y16A 3SCMB 1LE9B 4R96A 1GAFH 5T5FH 4RX4A 4S2SA 1QRNA 3MRHB 4TVPD 4MA1C 4G8FB 3GJFK 5AAMA 5T3ZD 3RDTD 2ERJB 1QNZL 2FECI 3GKWH 3LH2L 3HB3D 4JM2F 4ZPVA 2NY1D 1EVTC 5MHSE 3QHZL 4PJAE 1PSKL 2VDKL 2X1PA 4KQ4L 3ARUA 1TETL 4BSVA 1AFVH 5SWSD 4N0CC 5I1LB 4YXKH 5I73B 4LLMA 3T8XB 1A6TA 4PIRF 1AQKL 3CC5B 1UWGH 2YD4A 3I02A 2KPNA 4JFZL 4CGTA 2HWZH 3ILPA 2FJHB 3RIFK 4LRIC 4NWUL 4TSCH 2DQHH 4N0UB 3VFOA 4PJXF 3ARGA 2PR4H 1RUQL 1GGCL 4GRWB 3GK8L 2BY3A 5HY9A 2D7QA 4Y4FA 2DQDL 4UINL 2KH2B 2ZZUT 4GKSA 2BHUA 4PRDB 2DTML 2XTLA 4Z7VF 3LKSA 4K3EH 2O26U 4XNUL 4WV1A 4Q6YA 1SMOA 5C1MB 4JFFA 1KGCD 3VFTB 1QFOA 2PNDA 4EI5A 1NMCB 4PJHE 5EU7C 3VI3F 4XX1E 5BZDA 2EDDA 3FN9A 4ZXBA 5KG9A 3FB8A 3BH8A 4QXGL 3L3HB 5ETUA 3P0VH 2RJMA 1MCRA 1UWEL 4IRZH 4YHIB 5C6TL 1U8HB 4FQXC 2GIYA 1JZ6A 3IAPA 3TZVA 1QSEA 5DRXB 3VXOB 5DDHB 4AH2B 3BRGC 5DJYB 2DQIL 2DD8L 2QSQA 2GY5A 3RKDD 1MRDH 3GJFH 3GUTB 4M5ZL 1AQDB 1I1RA 5F1IB 5F6HI 1ZLVK 4Q0XL 5IB2B 1MFBL 3S98A 4MB3A 3CMOH 4HHAA 5I1EL 1N26A 1T1WA 4WFFD 2ZSWA 2IQAA 5ADOL 4ZFGL 1TVDA 5GIRB 3ES6B 1SY6H 3FT2A 5HTSA 5E5RB 5CGYC 5HHXL 1NGXB 1UM6H 1SQ2N 2E8YA 1FYTA 3PQYE 3DMMC 3NMEA 3TYFA 1J5OL 2P8MA 2V7HB 3NIDE 2Y9RT 1J1OH 3RWGA 1K4CA 3O2WL 2B4CL 4MA8L 1MEXL 4JM4L 3CUPA 2EDLA 5A2LH 3FQNA 3WNKA 1XIWB 5CJXC 1BZ9B 1AI1H 3FRPG 4EIGB 2PYEB 3DBXB 5I2IA 4OZHA 1S7WB 1MLCA 4Z7WE 5BO1H 4XMPH 4P59H 3I75B 3FMGL 3ZDYF 4D0DA 2AJZA 1OGAD 1IGCL 3OZ9L 3O4OB 4QHKI 1OTUC 3SGKC 1KJ3H 2W0FB 1GOFA 1MIML 1UB6B 3QFJE 4KKBC 1ZHKB 4MD4A 8CGTA 1R3KA 4KI5F 4PJEE 1KIRA 5IW1A 2VSDA 3LKNB 1RK1A 3VI4F 3H9HB 1FZMA 5IM7B 1X4ZA 3JTTA 4I0PD 4TPRH 1I4FA 2Y23A 1CWVA 4U1KA 1JNJA 4YFDB 3C5ZB 1A7OL 5B39B 1DDHA 2BNQA 5EIIA 5GHWH 3RY6A 3X11A 3E3QC 3V5DB 5EBLA 7FABH 4NZJA 1NFKA 2C7UA 1QFWM 4RAVA 5MEPA 4ODTH 5ADPH 2HFEA 2EIDA 4TNWK 1ZLVH 4BH8A 4GMTH 1KB9K 4PJ5D 4KHTH 2WBWB 2AK4B 2VTFA 2AJ3A 4UZGA 2ZSVB 3VMPA 2HN7A 4HFUH 4Z7NE 5IROA 5EBGA 4PJ9D 3CDGA 2QQLL 1FIGL 5TQ0L 4P3DB 4OLXH 5TDNB 5I8KL 2WBJD 5TE7H 5JTWA 1F58H 5J56B 2VZ1A 4JDZA 1WIUA 1EHXA 2NXZC 3MRFA 4LSVH 2L0DA 5L88H 1C16B 3P73A 3F7VA 3N50A 1KBGH 3MNZB 1I8MA 5I1DA 5H37H 2IAMC 5C0GB 4UQ3A 2GITB 3TA3A 4HSQA 4PJIA 1Q9WA 3EUUA 1PBYA 4OM0L 4NQDB 1MJUH 5CMAA 2HJKA 3HNVH 1NL0H 4MX7A 1QSFB 4LVHB 5I15H 1OARL 1FG9C 4KK8C 1GL4B 43CAB 1TCRB 3H7BA 4BUHA 4YXLH 2AEPH 3W0WD 3IXTB 2ESVA 4KKCD 4F7PA 3VD4A 5D2LA 3KPSE 1IAIM 2IPKB 2YMXL 4WHTB 5HDQH 2A6IB 4P4KC 3GFUA 2VXSH 3HR5A 4UU9A 1EVUA 3QDMB 1P69B 4AIZA 3MBED 3A6BL 4JHWH 1XGPB 2AXGA 3ARWA 1H3GA 1FNHA 1M05A 4HK0A 4NZTL 5MERA 2F58L 3FZUD 4XMLL 4HS8L 3ZKNC 4NRYA 4D9LH 3OXRA 1FVEB 1BWMA 4PGDA 1HSBA 3C6LC 3G6JB 1U8MB 5SV4A 3RWJB 5I0ZA 3TO4D 1DN0B 5E6IA 3REWA 1N59B 5C0CD 5CJQH 5INDB 5C0EA 5F96H 1BPVA 4IDJH 5D1ZA 2NW3B 2DLEA 3EDEA 3TPKA 4Z77B 3MACH 3IF1B 3U1SH 4HXBH 3PWLA 5EZJB 1IJ9A 2Y7QA 2YC1A 4KTEH 1F6LL 2WMPA 1JNHA 3KPTA 4H20H 2SEBA 3FFCD 3BKJH 4PJIF 1GZQB 3PNWB 5A40E 3VWJA 3HMWH 3ARVA 1XF1A 3BI9X 3V4UL 2GAZA 3MLZL 4F80A 4JKPH 2DLFH 5DK3A 2CLZB 1NGZB 3HKFA 4KMTL 1FC1A 1Z3GH 4GW5A 1RZ8A 3GRWH 4P9MH 4M7ZC 5D2LF 2ICWJ 3NVQA 3QEHA 4LSUH 2YOCA 1ND0A 3DHJA 3JV6A 5D96B 5FO7B 3RX5A 5D1XD 1QKZL 3DV4A 2BFVH 2ZUUA 2A6DB 1EAJA 2A9NL 3EOTL 3JWOC 4KK9D 4OCSL 4DKEH 4ODVL 4RGNB 5LBSH 1ORSB 2NR6D 4PG9B 4YBHA 2W59A 3QXTA 2FIKB 2D7TL 3HUJB 2J5LB 2CKBL 2EYTA 2OQJA 1DFBH 2BVOB 4BYHA 4UOJA 1P7KB 1NAMH 3KPRD 4MXWH 5ESAA 1NFIB 3CK0H 3RWDB 2CSPA 3NCCB 3B43A 4F3FA 1G7IB 1MHPL 5CJ5A 4U33A 5E5UB 4F7MA 3N85H 4YNYA 3DSFH 5FA3A 1U3JA 5I30H 4M03A 2D03L 4UNVA 3HZKB 4TVSa 5IIEB 5DLMH 3BPCB 3LMJL 2ITCB 4JZJC 3RL1B 4GW4A 1BAFL 3O2DH 2APVA 2DWDB 3UPRA 4M5YL 5E2UH 1T0MA 4U6TA 5JORB 1YPZE 1UACL 2HMID 1UYWH 2B2XL 1PKQA 4OJFL 1FE8H 4F9LC 3PGDA 1KTKE 1ZK9A 2RFXB 4WW2B 3MXWL 4HG4J 5I66A 1YNKH 1NEZA 1SEBA 5ESQA 3OB8A 3INUH 2CMRL 3IDNB 1P9MA 2WP3O 2B1AH 1CICB 1K8IB 3PWUB 5KSAA 1Q72H 1RURL 3RU8H 4KVCL 4UAOB 4P2YA 4S1QL 3L3IB 4Y4HB 4B50A 2VZSA 2GUOB 4PRPD 5J6GA 2IWGA 2R2EA 4NNXB 4PJDA 3IU3A 5GRUH 2RGSA 4X6EA 3NFSH 1NLDH 4JFQA 1U8QB 2FEEL 5DF0A 4L8SB 3L7EA 3C09B 3HC0B 1GXEA 4JO3H 5CD3A 1E6JH 2BY0A 2JE8A 5M94B 3CMGA 4H1LG 2O5YL 1C5DA 1YZZA 4LK4A 4WFGD 3P4OB 4XCCL 3MGTA 4YQXL 1AXSA 3MV7D 1QSZA 3MRDA 2ITDB 3UTSD 3MV8A 3QXDB 5GGTL 1B0WA 4U6XB 3U83A 2QADC 1T5XB 3M8OL 4I9WD 15C8H 4JO1L 3EOYG 2D31A 3ARFC 3R1GL 3VG0H 1U8PB 2G5BB 3PV6A 3U7YL 4EUPB 1MVUB 2R2HB 3BN9C 2FO4A 3ARBA 5EBMB 4QO1A 5DWUL 5A1AA 2NZ9C 3GMPA 4JFHE 4OGXL 4PGZA 3G04A 3CZFA 1EIBA 1MCNA 4QWWD 4O2CA 5I9QB 5TFSH 5MEQB 3VGAB 2ZUWA 3EGSB 5T5NG 5EU7E 1BVZA 3IAQA 2V7NB 3KPLA 4K07A 5IHUH 1YECH 3OHXA 4P9HL 3VFPA 3WJJA 5C08A 4HWBH 4RDQG 3SJVD 2ZOLB 2XZAH 3H9SD 1UM5L 1DBKH 1OGTB 3MNWB 5A16B 2VISA 4GUPB 1V3MA 4J8RA 1LO5B 4YIQB 4Z7UA 3I6KA 5DK2B 4P2RE 4PJDF 2R29H 3O11A 4QHUA 3LN5B 4WHYH 2N56A 2BOCB 4XP6H 5IESH 3D39B 4LBEB 2H9GB 5EWIH 3W9DB 3KPOA 3OV6A 1CXLA 1S7TA 2CKBA 2DLHA 3LPWA 3FN0L 1PLGL 2ADIB 4NQCB 2C1PB 3LS5H 1OSZB 2DI8A 3MREA 1CYGA 4ZFOB 5HHQB 4PJFE 4K2UH 1NGWB 3PWPB 3K81A 4NBXB 1U3HD 5TF1L 3QJHA 5DUMH 3PDDA 1MHCA 1FORH 3Q6FB 4EI6A 1XH3B 3B9KA 1Z9LA 4ZUSA 3VXSE 5D1QA 3SGJC 2J4WH 4N5UA 5I1JH 2EIZA 2O61A 4TUJA 4EN3D 2DKUA 4HXAL 3WUWA 4ONGL 1G7HA 1WAAA 3QA3A 3IFNL 1Q0XL 4HMEA 2BNRA 1EO8L 4D8PA 3OR7B 4FQQB 1ZHLA 3S8WA 2XNAA 2GJ6E 3L95A 4RRPA 2P5WA 4L4TA 4QTIH 3CLFL 3U0TB 1BFSA 2O5XL 2EE2A 3KYKL 5EBWB 2HVJA 1E4KA 5FKPB 2BY2A 4HLZH 4ZFFA 4L8BB 1A1NA 3WNPA 1KN2L 2DICA 1EEYA 2J1KA 5EOTB 4XPTL 5SWQB 2APXA 2VXTH 4M7JH 2CDFA 4F37K 3O4LB 4Z7UF 4DVRL 3MGOB 2XACC 3GNML 1MRFH 5F1NA 3QBTB 4MDIB 4CVZB 4X7SH 5D7LE 5I1CH 3TO2B 4HF5L 3MLWL 5KTEL 4OB5H 1UA6L 1CFVL 4LU5H 5CBEA 1X5FA 3GI8L 5HGAB 4NQXA 2QQQA 2ICWB 5GGTA 1EZVY 3T3PF 4P4RB 1VKXB 5JPNA 5B3NA 5GRWA 3OXSB 4HKBB 4P5TA 4Y4KB 4PJ7E 1EERB 3WJLC 2H32H 2YPLA 1BQLH 1QQDA 4KTYA 1U9KA 3HAEB 3G5YB 4E41B 4FZ8H 5I6XB 1IKFL 4NPYA 3F12A 4K7PY 4WI6A 1I1AD 2V9RA 4RGOL 3QIWA 2FWOB 1FNGB 1WAAF 4UMGA 4YH6A 4QYOB 4N8VG 2F54E 4R3SB 1QR1A 4V1DB 4P23D 3FO9A 4O4YL 1QFHA 3UTQA 1A1MA 3MRRB 1MFEH 4LDEB 4U1IA 4FZEH 5EO9B 2CDEA 2VABB 4XBEH 5SV3A 1RU9L 3QWOB 2IANA 5F9WC 4QOKE 3O9WA 5EO1B 3STZB 2P49B 3W39B 4UIKH 4Z0BL 2VERN 4LCCC 5E8OA 4LSTH 3S37L 3G5VB 4Z9KB 3O3DB 1R3HA 1AD0B 1K2DA 4I4WA 1JPST 5EULV 1M6OA 1ZS8B 3MRNA 1YEGH 1NDGA 5D2NE 1N6VA 1KC5H 5GRZA 5DURB 1N0XH 4EEEA 2NY3B 1TZIB 1RIUL 4JJ5A 4QNPE 2F8XC 4LARH 4RNRA 1FN4B 4IIQB 1CE6B 3SQOL 4TVPH 1I85A 4PGEA 4BKLA 2A77L 4K3DH 1CFBA 5DJXA 2VDMH 1TDQA 1JVKA 4GS7B 4NZUH 3BAEH 2ZKHH 3LZFH 5TE4L 4LSQH 1JRHH 3HFML 1G6RL 3HG1D 4U49A 2C9AA 4NQSB 5C0AA 4BA8A 1YN7B 2M2DA 5DEZA 2DMBA 1Z5LB 2JB6B 5H37G 4ONHB 1JGLH 5D71L 1SYSB 1T21A 2VXQL 2EC8A 1YEEL 3QIBA 4Q6IC 3M17B 4OCYL 2ATPA 3RZCC 3CLEL 2AABL 3NPSB 1IC4H 4GRMA 4Z8FL 2QTEA 3LKPA 2XRAL 2YPKA 4X7TB 3U9PH 3JUZA 4N68A 3BXNB 4O58L 3BFOA 3FQWA 3FTGB 3GJEB 5DJ2A 4ZODA 2NX5E 1DQJB 3HTLX 2NY6B 4TSAL 5MP6H 1FDLL 2OL3B 3GBML 2VXVH 2VR4A 4YHKH 3CSBA 4G9FA 4D9RE 1S3KL 3T1FB 4N5EC 4GG6E 5JXED 2VLKB 2R1XB 3GIVB 4WIQA 4OCNC 3M07A 4S1DD 3B5HA 3ARZA 4NN5C 4JHZA 2R0WH 3TIDA 3TBYA 4BZ1L 2UZIL 1FFOA 3V4PL 4MQXC 3DROA 1MF2L 4JCLA 4YE4H 5T1KA 2NYYC 4OAWA 1D5ZA 4NKOB 4XNZB 1CXHA 1DJSA 3D3VE 3IYLW 1XIWD 2X4OA 4PJBB 3X12A 1I7UA 2PYED 1U58A 4P2OA 2F8VA 3L3DA 3QZWA 4X6CA 3T2PA 4L8DB 3DUUA 3W11C 5IBLC 4E42B 5KS9A 4NQEB 4QKXB 1QBML 3PHOB 4HUMB 3MLUH 1NC4B 3UC0H 5HYQA 3MOBL 3PXHA 5DJ6A 1HKLL 2FZ3A 4OZFG 3LDBB 3SKMA 2VC2H 5EZIL 2D0FA 2MCPL 3AS3A 5J11C 5E24E 1E4WH 3JWDC 5LKNA 4U31A 3CXHJ 3ZKMC 1RPQA 5DK0B 2WZPD 3QUXB 1MHEA 3CD4A 3C5ZD 2RCSL 2VUYA 2BJML 4OGYH 2X4TA 4UI2A 1DE4B 2YD6A 2QSVA 1SBBA 5DRWA 4XPFH 3CFCL 3BJ91 4X80L 5FYJL 1D5IH 4OZIE 3ZT6A 1IC5L 3ZE0E 3SE3A 2EDQA 1NANH 5FUZL 4JAMA 2HKHL 1WGOA 1RZIA 3LKOB 3B2UD 4WDIB 4R4ND 2F5BL 5FM5O 1KG0A 4TSBL 1ADQH 3QDGB 4LRNH 2Q1EA 2NY7H 1IARB 2R4SH 4HZLA 3GMLA 2NMSA 3MRMB 2IPUK 1A1OB 2AK4D 2V17L 3KR3L 2DLGA 1U8OB 5BS0E 5JHLH 3CPLA 3BGMB 1G6RA 5DR5L 1ZT1A 4BM7A 3AB0B 5BVJB 4LKCA 4NO0A 2ZCKL 3T4AA 1ZVSA 3QWRD 4X6CF 4WUKH 5CKGA 2AXJA 5IT2L 5HGHB 1FG2B 1FAIH 2E7MA 3V6OE 3S9DB 4ZNEA 5KS9F 3WSQL 4MS8D 1TZGH 3GMQB 4Z18A 1TVHB 4QT5A 2WINB 3CFKB 3MYZA 3RL2A 3QT2A 3MLSH 1DUZA 4Y8AA 1CQYA 1YY8A 1VEMA 1AO7A 4X9BA 3WL9B 1QVOA 2Q87A 1RZJH 3WEXB 2XN9A 2QQNL 3QUYC 4MVBC 4B53A 5GS0H 4A6YL 4NO2A 4HJ0D 6CGTA 2PO6B 3V7AE 1YC8A 1IAKA 1V7ML 4L9LA 4LAQH 3MV01 4HIJA 1HXMA 3RKPA 4JQVC 1NCWH 1YQVH 4YHLH 4L29B 1JYWA 1CXEA 3RUGB 3O41B 1IGYA 4CN1A 5DUPH 1AR2A 4YHZL 1U93A 4L3EB 4ACPA 2PUQT 4PGBB 3LKRA 4UDTB 2ARWA 5CEYB 1Q1JH 4YHYB 4I0CC 3GMRB 1IM9A 5DJDB 4DGYH 1MWAH 4Y16D 1F3JB 3C2SA 2R0LL 5JW5A 5KVEL 4KUCD 4YHNA 1QRND 3QNYA 4YHOL 5ACZA 3P0YH 1YEIL 1RUKH 2F74B 2YD9A 3P0GB 3PJSB 4PRBA 4ZAKC 4PFEA 5CSZB 1HYRC 3TGXA 2H3NB 3RAJH 1RSFA 2A83B 1NMBL 3HI1A 3MV9E 4FQ2L 4YXHL 4OF6A 5JHDE 3BH9A 5DMKB 1HI6A 4ESKA 1CGSH 3FRPA 2QJDA 4YBLB 1H8SA 4N0RA 4JFPA 5EPMA 3P9MA 3RJQB 4JFXA 4WVRA 1HEZA 4KROC 2AJUH 2Z4QA 1ZANH 2VLJA 3MJ8B 5FHBL 3PWVA 1FV1A 3RTQB 5HVHB 1AGFB 1HH6A 1A6UL 2QQKL 4JZOB 1CL7H 4JKKA 3S34L 4GOSA 4WHYG 3QEGL 1K4DA 1NC2B 3BQUA 5D72L 4KTDH 2YBRB 4RGND 2W9DH 5AWNH 5DHVA 4NIKB 4X8JB 5FOBB 2YN3A 3SGEH 1KJMB 4P2CG 1CK0H 5MI0C 3ORJA 2DQCL 5IMLA 5FKAB 2V2WB 1DN2A 3KJ6H 4ZS7H 1BD2D 4HIHB 1KLFA 4GRWE 3E2HC 3ELAT 1OAKL 1JWUA 4FQXA 2E9WA 3BKYL 4HS3A 4PJ8C 4XPHH 1QLEL 3KG5A 3ZSTA 2P5EB 1EEZB 1WFUA 5FO9A 5DVOA 2XFXB 1H9VA 4XCEA 3VXUD 3QI9B 4LLWB 1FFNA 1OCWH 1OB1B 2CLVB 1GIGL 3DO3A 5DJ8A 5GRVL 2J8OA 4IMLB 4J3OC 2GFBA 1JNNH 2B5IC 1JV5B 4OCRH 1V05A 3C8KB 2GYSA 5GS1B 3P9LB 2DYPB 1KIPB 1L6ZA 2YA2A 3DXAA 3I3BA 3MRGB 1WZMA 3HC3L 5DRNA 3U48A 3RA7L 3DMMA 4A6YA 5IR1B 1P6AB 3ZYIA 3RDTC 2XWBA 3VFNB 1FVDA 4HLZG 3HB3C 4XNYH 2AXHA 2Q3ZA 2NY1C 3OAYK 3QUMH 4ZUVA 2F19H 3D48R 3OJDB 5CJXA 5FV2A 4JE4B 2W0KA 1YMMA 1TITA 4ALAH 3MSPA 5C2BH 4NUJB 3OKDA 4OIBA 2OMBA 4OCLC 3S96B 4XCYA 4IHOB 4UT7L 5EUOE 4IMKA 4KY1L 4C83A 1OLLA 3HCVB 2YRLA 3SPVA 1DQML 4PJGA 3BRFA 4U1MB 4MCYA 2CRZA 3FT3B 2P24B 3K1KC 4HIXL 5HHOB 2HFGH 3QG6A 4M6OL 5FB8B 1LILA 3QQNA 4NO5A 5DA0B 4YX2H 1KPRA 2APFA 2FX9L 2BSTA 4X4XB 4S11A 2C3XA 2PXYB 4M6ML 1F00I 2AERT 2F53B 2C4XA 3K2MC 1EMTH 1BFVH 2XKNB 3VH8A 3MLVL 2MCG1 3X17A 2BNQD 3WIFB 1HSAA 4X6FA 3OTTA 1C7SA 3P4MB 5D6DA 1GC1C 2YEZB 3D2UB 5JDSB 2XKSA 1HHGB 5LGHH 3MUGB 5F3BA 5K9OB 1W8OA 2DL2A 5INCA 4NT6A 1W0VB 1U42A 2FO1A 4PYHA 3LQZB 5J13C 1N6UA 4EDXB 5C0JB 4KJPD 2GHWB 4Z0XA 1KXTB 3TBTA 1K6QH 1FO0L 1MQKL 3JXAA 3V5HA 1NFDB 1GAFL 4M43H 3VRLF 2ZUQB 4YGVA 1N7MH 2GSIA 3TH3T 2FR4B 5F89B 1GGIH 4Y5VB 4GG8B 1IGJA 3RKDC 3GKWL 4JRYA 4K7PL 1RZ7H 3BZEA 4J3WA 1KCRL 3OAYH 1L0QA 4YR6A 3UYRH 4IRSB 1LK2B 5GRXG 1C7TA 4NQCD 2IAMA 3B83A 1B0RB 1AFVL 3MFFB 4YXKL 4M00A 1URLA 1XGQA 4WCYH 3K74B 4PJGF 3PWPD 1S5IL 3UZVB 5T33H 4Y19B 1LP9A 1UWGL 3C8DA 4PD4K 3UTTA 1GYAA 2HWZL 4OLUL 2WUBL 3VGEA 2XKUA 4TSCL 1A14H 2DQHL 1QTYT 1U95B 1ULVA 2PR4L 3MR9A 5CHNB 3UBXG 4G8IB 2JIXA 3VXQB 1L7TH 2XQYG 3QUKB 5DD3H 2MKWA 5DFTA 2IBBA 3PGCA 4MHHI 3TBSB 1OAZH 2ESVD 5FDWA 3MV11 4P4KA 3GSWA 5K33A 5TGBB 4K3EL 2JF1A 4XWGH 3KNBA 1RJLA 3GKZA 2ICEB 3RFZC 4AQ1B 3OWEA 4NQDE 1UXSA 5KOMC 5I1AB 4J3XA 4Z78B 3EOAA 5DQ9A 5K9QG 3NN8B 4I0PC 2E5EA 1IBGH 3P0VL 4U2YA 2HVKA 4IRZL 4CU8A 3RWCA 1RUMH 3O4LD 1GZPA 3R06B 4EOWL 1RK0B 1C12B 5HPMB 3OAZK 5H2BB 3DRTB 4I2XB 2C3VA 2GT9A 3MFGB 3QDME 3D25B 4NM4H 5KJRH 4YJZL 1MRDL 1EHNA 2R1YB 3JWNC 3GMNB 3WLBA 5IB3B 1G7MA 3ULVE 1GCFA 1NCAH 2H8PA 4GMSH 1HHJB 5A2JH 3KWWA 4IOIB 4J2XA 1YNTB 1EGJL 5IJVB 2FX7H 4NN7B 4Y4KD 1LP9F 3EFFA 4RA0C 5CILH 3EO9H 4H1LA 5LCVH 4E41D 1UM6L 4PJ9C 3QUZB 3LEVH 1JWMA 1ZWIA 1G7JA 4HDIB 2AV1B 2CLRB 1R24A 4H88H 2WBJC 2ZUVA 3G9AB 4XPAH 2OTUB 4XXCA 3SDXB 1KPUB 5BZWA 3BSZH 3P4NB 1LE5B 3G6AA 1WJ3A 3RIAK 3V8CA 2L7JA 4C56E 4XNMA 1LEKB 3ISWA 1JYVA 5ITFA 4MNGB 3QFDB 2EKSA 2XA3A 1KLUA 5C07B 1AKJB 2CDGB 4RAUA 4XMPL 5DVMA 4P59L 3CXDH 1TNNA 1FO0A 3HNSH 1EX0A 1BOGA 4E0RB 1KJ3L 1BQUA 5GRJL 2AQ1A 2A6KA 1RQ5A 3O3AB 5KSBE 4KDWA 4NFDA 4W4OC 4YDVA 5ALCL 4HUWA 2R2BB 3WFEH 1MUJA 2EDBA 5IQ7L 2IH3B 1GOGA 2NLJA 4KAQL 2AXFB 1N8ZB 4EQ2A 4KKCC 5MENA 1IGIH 4TPRL 2LE9A 1HHKA 1HE7A 3HNTH 5L2JB 5HJ3A 1CLCA 4JZJA 4YDLB 2HAZA 4QRTA 2P43B 4R0LB 5DFVD 5GHWL 3TJEL 1X9QA 1LNUA 3MBEC 3GM0A 3ROLB 3WFHB 3OAZH 1BZ7B 3TVMB 4NKQB 4F8TA 4F9LA 3FZUC 3MUZ1 4LVNB 1HDMB 4KJYA 3TBWB 4ODTL 5ADPL 1EK3A 1D6EB 1I9EA 1YEJH 2R23A 4GMTL 4MNQB 2VDLH 2Z31A 4WI5A 2EYRB 4KHTL 3TO4C 1G0XA 1B0GA 1IEAA 2X7LB 1SEQL 1C08A 4MD0A 3WN5A 4HFUL 1ED3B 1OL0A 5LGKA 2QLVB 4CU7A 1IEBA 4OLXL 5L2KA 5C0BB 5TE7L 1XF2A 1F58L 3KLSA 2GEEA 4GRWH 4HS6A 1ZKAA 5GZOD 4JB9H 4LSVL 1JYNA 5CEZL 4XCFH 4FOMA 2FEDD 1IGTA 4JQIL 4JFEB 3VWKB 1KBGL 9CGTA 4JM2B 4TULH 1IQDB 3MRLA 1J18A 2QR0B 1Q9LA 1HN1A 2NY6D 2UWEE 4KZDH 3VXPA 5E8NB 2CK0H 2HT4D 2Z93B 4FTVA 3MJ9H 4HIIA 3PP4H 2LV4A 4WU5B 1MJUL 1MCPH 2VAAB 3MYJA 3HNVL 4JPIB 1NL0L 4MJIE 5FYKE 5I15L 1UM4H 2OBGA 4P57A 3IGAA 4YXLL 5I18H 5DJAB 5IMOA 3ARFA 4HH8A 1MQ8A 1T5WA 4Y5YC 5D1XC 4OV5B 4KK9C 1TTUA 5HDQL 4GAYB 3I6LE 1EGJA 2NR6C 1ZOXA 3PABA 2VXSL 5D6CA 1H3VA 3ARBD 3DX8B 5IMKA 1RJYA 2GCYB 2IPUG 3JV0A 4JHWL 4OUUA 4MXVF 2GTWA 5SX4H 1MLBB 3ZE2F 1V3JA 4QRRE 1C5CH 1XGUB 2UY7A 3NTCH 4JLRA 5F6IB 4D9LL 1JZ4A 3UTPE 4NQED 1EFXD 3KLDA 3WIIH 4E5XB 2XYCA 4WHDA 1KFAH 5FXCH 5LGJA 3CX2A 3MQIA 5ELIA 1X5LA 3DYPA 5IBUG 1B6UA 1S7XB 3K4DA 3A67L 4WFEE 1ACYH 1RUPH 3FOMB 3QG7H 5EB9A 5EIQA 1JF5A 3QDJA 3BP6B 5DUBB 3MACL 1A47A 2HMIC 5DZLA 3ET9F 5EORL 3U1SL 3A0OA 3VD9A 2DLIA 2CR3A 3KPNB 4ZPVB 4N8VA 2HFTA 4KTEL 5IGXH 3EYVA 1TZHA 2D3VA 2MFNA 4H20L 1Z0MA 2BSRB 3TNNB 1NGYB 4LLDB 3D85B 5LQBH 1T3FB 3SGJA 1KCUH 1MI5B 3T09A 3PHQB 1U8KB 3O0RH 2GQHA 2FATH 4JKPL 3I02B 3ROOB 1Z3GL 2YRZA 4N90E 3GRWL 4P9ML 4PRNA 4F15B 2QL1A 3VFOB 3ARGB 4CN6A 2HJFB 5IHBA 4MDJB 4LSUL 5KOVC 3PL6A 1A6VL 5JLZA 2BFVL 4JN2A 2Q6WA 4Y4FB 1WWBX 1IM3A 1UKQA 2UYLA 5LBSL 4GKSB 3KJ4C 4Q97A 4OI7A 4MJ2A 2ZNXA 3F5WA 5C09A 1DFBL 4V2CB 4TUOA 3ULUE 3JZ7A 1NAML 2YXFA 4JKWA 3CK0L 1R5WB 4QF1A 1QG3A 4YDJB 1GPOH 3K8LA 4ZXBB 4ETQB 4IM8A 1WTGT 3IDMB 3N85L 3DSFL 3CFBA 5BVPH 5I30L 5DLML 3MODH 3L3KB 3JTSB 3O2DL 1AGBA 5I71B 2FCBA 4O2EB 3L3GB 4QWWC 2PO6D 4LF3B 3TZVB 1IAOA 1UYWL 2VDNH 2YD7A 1FE8L 32C2B 3WJLA 1YNKL 3PDGA 4UUJA 3INUL 2B1AL 1T1WB 2ZSWB 2IQAB 1T20A 5JMOC 3RU8L 1U8LB 3TN0A 2PTVA 4X6DE 1CXFA 3FT2B 1ITCA 4L3ED 3LEXA 3CU1A 1JN6A 1MFAL 1F11A 5EOCH 1GGYA 5IFJA 2HLAA 5GRUL 3NFSL 3G5XB 2P47B 1NLDL 2P8MB 3EYUH 1BVLB 1RHHB 3RWGB 4MAYB 1K4CB 4IDLA 2EIEA 4JO3L 3C6SA 1E6JL 3BP7A 4HPYH 3WXWH 1DUYA 1U3HC 2B39A 1FFPB 5DEFA 2DQFB 5L9DH 4LCCA 4RGMC 1SBSL 4J6RL 2E7BA 4HUXA 4L1DA 1TTFA 2Q7YA 4JFDB 4EN3C 1HQ4B 3QQ3B 5T3XE 2DQUL 4PV8A 3SDAB 1A0QL 1KB5B 3W5NA 2K7PA 1JZ3A 4V1DE 3SDYH 3D0VA 3HPLB 2FDBP 2I9TB 1X7QA 3VG0L 3S5LG 3WE6B 5JNYA 1B90A 3RTQD 4OZFA 4UNUA 3IS0X 5IB5B 4WNQB 1DDHB 1IKNC 4PR5A 1OGAE 4QY8B 4ERSH 4MD5B 4WWKB 3MA7A 3X3GH 4C59B 5TFSL 5EBLB 1MCWM 4AQOA 5B3JF 1G84A 2XTJB 3WHXA 1MCDA 3O6FB 5B21A 1YECL 3D18A 2BK8A 3NCYP 3GRWA 4RAVB 4HWBL 4POYA 5FECA 2E6PA 3UTZB 2XZAL 2HFEB 1VCAA 4Q6IA 2BHZA 4BH8B 4X5WB 4PLJD 5IB4A 3D0LA 3W81A 3RZCA 4GW1B 2JJWA 1FRGL 3E6HB 2R29L 2YUWA 5CEXA 4XP6L 4Z7QF 5IESL 2HN7B 5EWIL 3NFPB 4B41A 1SJVA 4F2MA 1P6FA 5HBBA 2R9HD 1EFQA 3U6RA 1FZKB 1NAMA 1VFAA 2XZZA 3QI9D 2YWYA 3L5WB 5TDPB 3B3IA 3GSXA 4K2UL 5FGCE 4U1SA 3WS3B 4NGHH 1CD9B 4KDVA 4TNWF 1FL5B 4FQHA 1KENH 5EC2B 1FORL 2DAVA 1I1AC 3B9EA 3C5SA 4FABH 2V5RA 5DYOA 2XWJB 4YEEA 2DBJA 3QH3A 3TA3B 2J4WL 4G9FD 3WNMA 4FXKB 4PJIB 1CE1H 4NP4H 3O2DA 2W60B 3S35H 4P23C 3U30C 1OQOA 2MWCA 5GZND 2ERJC 1UKSA 1W0YT 1ZHNB 4P2QD 2V5SA 5T1KD 3L3JB 4F7PB 5ISZB 4MWFA 2VQ1B 3THMH 3DUSA 5TH2A 1ZEAH 2OTWB 4PBXA 1A7NH 4I18B 5EU6B 4TNVK 3O45B 4P2OD 4JPVL 2DDQH 4UU9B 1ZT7A 2VLKE 4AIZB 3AU1A 4O5LH 3S88H 2AXGB 1KNOA 2BRRH 4IOSD 4HK0B 5HHOD 5HHPA 1A2YB 3W0WE 3V6ZB 2VXTL 4GQPH 4M7JL 3OXRB 4W6XB 3STLB 4LMQI 1HSBB 1MRFL 4PJBE 5E6IB 5I1CL 4X7SL 2H26A 4OB5L 4KHXH 4OLVH 1F2QA 4R8WL 4G7YH 1MH5B 3OR6A 3VMNA 4PRHA 1J05A 2YUZA 4KUZH 1N5AA 3VFUB 3U36B 5DQJA 3KXFA 3D2UD 2CXGA 3ZE1F 5E08H 4LCYA 4ODXA 3PWLB 4H5SA 5H94A 25C8H 1BQLL 4OD1H 4R26H 3CJJA 2N1KA 2FNBA 1G9MC 2UV3A 3FO2A 3PWJA 3FOLA 3DX7B 5BOZG 4FQPA 3PQYA 4GT7A 3VXTA 3UJIH 3FAXA 2VLRB 3SN6N 2RHEA 1D5BA 4M1GH 5DS8B 3REVB 3T1WA 4UB0H 2HG5A 1MFEL 4GW5B 4FZEL 3QB7C 4XBEL 5HGDA 5KSVB 5K93A 1DEEA 3NCYS 4EUPH 2H45A 2VDRH 5I74B 2CIIA 4HWBA 4QCIB 1AE6H 1WCBB 1J8HD 2YZ8A 1G7LA 4Z95H 3QDGE 2X4QB 4KGJA 1X5GA 2DKSA 3SKNA 1T1ZA 2VZ3A 4QTHB 4LSTL 2WWMD 5JXEC 4WUUA 1NGQH 3QNXA 5BRZA 4S1DC 1BJMA 4WFHE 4HKXA 1ZA3A 5FCUL 5B38B 2OQJB 4FN0A 1YEGL 3VFVA 1KC5L 4AEFA 5ESAB 2JJVA 1N0XL 3K1DA 3H3KA 3OKEA 1S5HA 5EFIA 5IP4A 1INEH 2N7BA 4RQQA 4LARL 1P1ZB 2FYYB 3TYGH 5D8JH 3QUYA 2LFGA 4TVPL 1XIWC 4K3DL 1L9NA 4YNYB 4WGVB 3S35X 4YK4B 5T3ZL 2VDML 1D6VH 2GK0A 3BAEL 2ZKHL 2YRPA 3FRUB 3LZFL 4LSQL 1WZ1H 2W9EL 5GSVB 4OQ1A 3M1BB 3SY0A 4JQVA 3UPRB 1YDPA 4XBPA 1CFQB 1YMHA 3OKKA 3WDJA 5JO5A 2LU3A 1BOYA 2ZOKB 1PKQB 1FZOA 5IVNA 2X9WA 1JGLL 4QRSB 1UWXK 4DW2L 1YEHH 4LKXA 5ESQB 5GGSB 3C5ZC 2AJSL 1R3JB 5KSAB 3ULUH 1P7QA 4KQ3H 5GJSH 1IC4L 2VQTA 1FFQA 3KLHD 4BSJA 2EDJA 3U9PL 1BVKA 5J6GB 5F3HA 4ZAKA 3IB4A 4MQTB 2R2EB 3IU3B 2WW8A 5ERWB 3GIZH 3RGVB 3T0EB 3CNKA 3B2UC 3U9UA 4R4NC 1BZQK 4PP2A 3RUGE 3CFDA 3ZL4H 5CD3B 3D9AL 2VXVL 5CP3H 1NBYA 2ZCHH 4YHKL 2G60H 4DN4H 3K4ZA 3MGTB 1AXSB 5CFHA 3QEQB 5D7KD 2M8XA 3VXMA 2R0WL 3QUZD 3VFRA 2EYSA 4Z5RA 3FHAA 4YE4L 5IBTH 3C2AH 5DQDH 4FG6D 3OJ2C 4QXTA 4CNIA 2F8OA 3SDDB 2VLJD 3TH4T 2E6QA 3V4VH 3K0WA 4LEXH 4B0MM 2H32A 4G7VH 3PV6B 4ZUTA 3U7AA 2IFFL 2CH8A 1AKJD 4IS6A 4P5KB 5J0BA 3GDBA 3NABH 5FHAH 2XXCB 1S7RB 4MS8C 4JFOB 3ZDXF 3BQUD 2OMNA 2J8HA 3GMPB 4G8GA 1T7XA 4O2CB 3DGCR 4LVHC 2OM5A 1AP2A 1WWWX 3HPJA 2ORBH 3HAEH 1E4WL 1PAMA 5C08B 2DWEA 4UTBL 3SDCD 4HJ0C 1MCSA 4MZ2A 5T3XH 2UY6A 2VISB 3D6GA 3GEWB 5DHYA 2GSGA 5GXBB 1HNGA 4IRJA 2J6EH 1G1YA 3O11B 2PKDA 4HKZA 4HX1B 1KLGA 2YWZA 4LIQH 4I3SH 5B4MD 4PJAB 3BE1H 3TVMD 1FNEB 3FB6A 5B39G 3CSPA 3F65A 1NQBA 2CIKA 3ARDB 4LRNL 3GBNH 2X1OA 1WITA 1CDUA 2NY7L 3GBLA 4D9QE 5F21B 4MNQD 2R4SL 3BP5B 3I6GB 4Y16C 1BLNA 1MHCB 1BBJA 4LCWB 4FFVD 4ZUSB 2R4RH 2AI0H 2P5EE 3G5ZB 5D1QB 4AENA 1IC1A 5JHLL 1TXKA 4G3YH 4JPWH 4TUJB 1FHGA 1DANT 2B0SH 3U0WH 3WUWB 5J89A 4YUEH 3NCJL 3QA3B 4X7CC 5F7WC 1EHLH 2BNRB 2E27H 5SWSA 3RVUD 3UBXA 1M7DB 1ZHLB 3AS2A 2I60H 3HZYA 3I85A 5CIPB 43C9B 5SWZA 4WUKL 2XNAB 4NM8L 3VXNA 1F45A 1FAIL 1G9NC 4JN1H 3L95B 3QISA 4PJHB 2P5WB 5ANMA 1VEPA 4KVNH 1UB5A 3BEWA 1DLFH 4OBRA 2I27N 4AM0B 2LTQB 3MLSL 2HVJB 3AROA 4MCZB 2KZWA 5C70A 1DBMH 4NC2B 1EEYB 4JO2L 1RZJL 5D96C 2Y6SD 2ZNWA 1SVCP 2P7TB 3BDXA 1YEKH 3NIFF 4RGNC 2BVPB 1UEYA 1IAIH 1BIIA 4JRXB 3CDYA 3ZSSA 2OZ4L 4X4MA 2B1HH 1AGCA 3OKYA 2X1WL 1GGUA 5CBEB 2NCMA 3LRSA 1NCWL 4ODWA 4HGWA 4YHLL 1S9XA 1EXUB 1RHFA 1D5MA 2OL3H 4P5TB 4Y5XB 1BEYH 2EDHA 4W6YB 3CSYA 4MA3B 5E2WH 2BMKA 5I76B 1HILA 1QQDB 2EC9T 2XIDA 5F7YC 3HE6A 1MFDH 1Q1JL 3QJFA 4U1JA 4DGYL 1MWAL 2F53E 2BVYA 3F12B 1MOEA 4FNLH 3QIWB 3WFBL 4OIIH 4HULB 1JF1A 3DGGA 2Q76A 3P0YL 1RUKL 1UFUA 4ONFH 2AJXH 4NO3A 5F7UA 1QR1B 2VXUH 1WLHA 3FO9B 1QO3B 4CMMA 4CRPA 3V0VA 4Z7WB 4YPJA 4U1IB 1ETZA 4R4BA 2GTZB 3D5OF 2IANB 1CGSL 2AKRB 2XPGA 3MLTA 3BW9B 1CFTA 1SYVA 2X1QA 3O9WB 1D3CA 4RMTA 1NFDE 2I24N 4ZO8A 5HDOA 3D85D 1LO4H 4RZCB 1C1EH 2YXMA 3I9GH 4I4WB 2AJUL 3MA9L 1M6OB 3Q3GA 1NDGB 4JG0H 2NXYB 1TJIL 5F9OH 3BO8A 5GPRA 4RNRB 3GSUB 1IGFL 3WNNA 1CL7L 4NFCA 4PGEB 2NW2B 3BGFB 5DJXB 5E4EB 2W9DL 5AWNL 4F58H 5BV7B 3W2DH 2CRIA 2PYFA 4ZS7L 3KJ6L 3L6FA 2AK1H 3MRBA 4O02H 1XZ0A 4XPHL 4P2RA 3LKQA 2Y5TA 2PW1A 4NZRH 4U1LA 3G08B 4CMHB 1UQSB 5HHMD 4OI8A 3LKPB 1OCWL 3IKCB 1Y6NR 4QRQA 3OX8A 1JNNL 5IWLC 4HD9A 1UVQA 4OCRL 1R6VA 1XF5A 4PJ5A 4GBXB 3FO0L 1I1YA 4KJWD 4WI7A 5DJCA 4PTTB 4FQLL 2DM7A 4UIMB 3PIQA 3BOVA 4Y1AD 3BVNA 4C54A 1EAPA 3X13B 4G6JH 4PJ9A 4HCRL 1JK8B 1MRCH 4PREB 2IADA 3DX6A 2WBJA 5IVXE 4I2XE 4WRLA 1ZLSH 1I3VA 1KTLA 1MCQA 3Q5YA 4XNYL 1DQDH 3QUML 2OZ4A 5E2JA 1AIFB 3DLQR 4M93B 4FP8L 5DD0H 1FFOB 3DROB 3EYFA 3RVXD 5C2BL 3J7HA 4XP9H 2DB8A 1RZGB 2X4UB 2Z91A 4OAWB 3VE0B 1D5ZB 1XGYH 4CADA 3WIHL 3MRCA 1K8DA 4M6NL 3IDIA 3DO7A 3X12B 1I7UB 4W4OA 3K7UA 3DIFA 3L3DB 1MWAA 5E70A 3N1QC 3SKOA 3UJTH 1VFMA 4JFDD 3IU4H 4QRPE 1XR9B 3SDAD 1YYLH 4LLUB 4AEHH 4RMQA 2DIJA 5DJ6B 2FZ3B 4YX2L 4MNGE 4M61A 2X9XA 4B7IA 2G75A 5E9DD 5C07E 3OMZA 3U0PA 1CD8A 5LVEA 3MBEA 1EMTL 1BFVL 4GSDH 2FSEB 5JXAL 1MHEB 4R7DA 3S6CA 2CRMA 4NNYA 1DBBH 4DQOH 1JPTH 3LB6C 4BZ2H 3P3YA 3X3FL 5LGHL 3RNQB 1IQWL 4WWKD 1IGMH 1BFOB 2XTJD 1OAQH 1VADB 3O6FD 4JAMB 3TO4A 1FL3A 5C0CA 1K6QL 3P40A 2B4CC 1KG0B 1DBAH 2Z31D 3RNKA 4M43L 1LDPH 3AXLA 3GHEL 3I2CL 3VA2C 5FV1L 4LEOA 4CW1A 1GGIL 4ZSOE 3MO1B 2ARJQ 1V7NL 2PF6A 4JPKH 1XR8A 3H9ZA 4Q74A 3MMEA 1RAMA 5TE6H 3IFLH 2PCPB 1C5BH 2IMNA 3IT8D 4Y0GA 1INDH 3UYRL 1DVFB 3FCTA 2WANA 4M8QA 3IXAB 4ZPTA 4Y4KC 4OFPA 3PWNA 3S3PA 1E28A 1X5KA 2G2RB 4WCYL 3L7FB 2NTFA 4HUVA 2EXYD 3EOBB 3KYNB 5T33L 3KHQA 4XRCA 5AZEH 1JGDA 5F8RC 3QIUA 1LD9B 3RWEB 4MSWB 4APQD 3TH2T 3FL7A 1A14L 5DO2D 3IFPA 5E8EA 5C0BE 3BGAA 1L7TL 4XCNB 3KYOB 5DD3L 4Y5YA 5D1XA 3RL2B 1I8KA 2VKWA 1DUZB 4POUB 1A4JA 1OAZL 1CT8B 5E7BA 2VLME 1AO7B 4JFEE 1KOAA 1WK0A 1JPFA 1QVOB 4LLQA 3H3PH 4XWGL 4EXKA 4M62H 3GO1L 5EU5A 2HKFL 1QLRA 3KPRA 4HCRA 5CJ8A 3N9GH 4N0FB 4LHUD 4QHNA 1YJDC 1T04B 3BWAB 5IVOA 3KPPB 2FJFB 4TOYH 3OKOA 4PG2A 3SE9H 3QUMA 2E3VA 1IBGL 3A6CH 2D0GA 2QHRH 3VG9B 1F8TH 2MQ0A 1HOCA 5DFVC 1U93B 1S9VA 5IQ9A 3LKRB 2P1YA 3WIHA 2W0LA 4Z76A 4JZNA 5C3TA 4K71B 4MA1B 4R97B 1IM9B 1UZ6F 1PD6A 3UX9B 4GS7C 4LASH 3BP4A 4NHCH 4NM4L 5KJRL 4Z7VE 5JW5B 5ACZB 2JB5H 4NRZB 4UDUA 4HKJA 2NX5A 3MJGX 4L4VD 5DD6B 3R0MA 4PRBB 4LCUA 1HWHB 1T7VA 5TDOA 1CGWA 5IHZA 3ULSA 3TBVA 2FX7L 1VACB 5CILL 4QHMA 2DQJH 4I48B 2QSCH 3VGBA 3BH9B 4PRPA 3AC0A 5J1AA 5I8CA 5LCVL 5ILTH 2KUTA 3FFDB 2OP4H 3L3OA 5C0FB 5L8KB 2KQNA 4XNQB 5HYJD 3ZMRA 4H88L 5I8OH 1QRNE 1PX3A 3BSZL 4JFXB 3R8QA 5AD0B 5GZOC 2BSSB 1CD1A 2EEDA 2VLRD 1XAUA 3MC0A 2X4SA 2I25N 3S4SB 3HAEG 3GB7A 2FEDC 2FD6H 3HE7A 2LVEA 1FV1B 1O5DT 4NJAL 2JTDA 2NY6C 3CXDL 3PL6D 3MV7A 5HGBB 4A2LA 4HWZB 3UTSA 2HT4C 3S5LA 2F5AH 1K3IA 3E6FA 3RWFB 2D7PA 1K4DB 1ZHBA 3EYOA 3ARPA 4OD2A 3WFEL 3DWTA 5DD5H 1S7VA 3SO3C 4AEEA 4PRIA 4MNHA 4H8WC 2AVGA 1TQBC 2BX5A 5I0DA 1BX2A 1KJVA 3HNTL 3O3EA 3FB5B 4YHPA 3U4BH 1P4BH 5HHVH 5IKCA 4XNZC 4JY4B 1JWUB 5E03A 3ARBC 2GJZA 4G6KH 3LN4A 3D1MC 2OK0H 1EO7A 1QUNA 4KKLD 1PDKA 1ODAA 3ZDYE 4JFFE 2MTPA 4ZD3H 1CF8H 4PJFB 5KZCB 3SJVA 3ABZA 5DJ8B 3H9SA 2VZTA 2OR9H 4DKFH 1YEJL 1OF2A 2E7LC 4F57H 4G8EB 4OKVA 2VDLL 3LDBC 1A7PH 3FHQA 2MQ3A 4KI5E 1T0NA 3HMXH 3VXSB 1B4JH 3VI4E 1H5BC 1U3ZA 1WC7A 3IDGA 3TN0D 3BPOB 1F97A 1R3LA 4XAWH 5H35B 3DMMB 3LHPL 4A6YB 3V6FB 1S9YB 3LEYH 1WVZA 1FVDB 1QSEE 4X8XA 4JB9L 4ZUVB 4XCFL 4NWTH 1U3HA 2EZ0D 3RGVD 4N1HB 1YMMB 4TULL 2EE9A 3OKDB 1X44A 5C9JA 4KZDL 3V6OA 2CK0L 1S7SB 3MJ9L 3PP4L 4EN3A 3BYYA 1MCPL 1JMZA 4FHBD 1ZTXH 5GGVH 3SPVB 5JOFA 1OAXH 1UM4L 3DSNA 3MNVA 1A9BA 1PX4A 1FYTE 3QEQD 5I18L 1P7HL 1P2CA 4Y2DB 5IEKB 3BIKB 1AGEA 3FQUA 3AB0C 2D7OA 2CO6B 4K3GA 1N2RA 4X7EC 2BSTB 5D7LB 1IKNA 2L4OA 4JDVA 1MJJB 5E8PA 3HRZB 3IDUA 1U8IA 1CXIA 4XTRD 4RFNB 4JVWA 3FONA 1RULH 1CTNA 1JHLH 4FQIH 1C5CL 1KEGH 3S36L 4PJ7B 1AH1A 4OD3H 2NPLX 1E4KC 4RFOL 4N8PA 4NT6B 4O51A 3PGFL 5IVZB 3BISA 2X4RB 3CIQA 5C8JA 1DQQB 4Z0XB 1S7UB 1ES0A 2RBLA 3QCUH 1RUPL 3OKMA 2C4FU 2F54B 2PO6C 5I1IL 1G0YR 5GGUA 3VXRB 2JCCA 3FO1A 3C60B 3P30H 1CG9A 4MAUH 5MHSD 2X09A 2DQEL 5IGXL 1ONQB 4J3TA 4WO4B 3MV9A 2IJ0C 4BK5A 4YHMH 1Q0YH 3VCLA 1I1AA 3CCHA 3MBXH 1I7TB 5FUOH 3VFWA 5E0QA 3CU7A 1A7RL 5D5MA 4AL8H 5LQBL 2WLYA 1LE9A 3ARDD 1KCUL 1RZKC 5F7KC 1RFDH 1XGQB 2HT3D 3O0RL 5IG7B 3MRHA 3QWQB 4P23A 4G8FA 1T4KA 4GLRH 5D2NB 1I9JH 1U0QA 1V5JA 1JWSA 1S9WA 1FBIH 5L6YH 1ROWA 2Z92B 4BQ6A 2YR3A 5F6HJ 3MR9B 5TQ2H 2VE6B 1UXWB 1PFCA 1OVZA 4K3JH 4D3CH 3PGCB 1JHKH 4LPUA 1EBAA 1L6XA 1Q94B 1LVEA 2FL5A 5FM4A 3KNBB 1A64A 4HIEB 1SJEB 5JZ7D 2FJHA 4PJIE 5L8LB 1QZ1A 4OFIA 4N0UA 2APTA 1I1FA 2X89D 1GPOL 3AY4C 5DC0A 3EOAB 3C6LB 3H2WA 3RTQC 2J88H 3MODL 4WEUD 4N0YH 5D2LE 2HVKB 3L5XL 5KANG 5EG6C 1BJ8A 3HG1A 3GHBL 5EU6E 2JCCF 3MJ9A 4RA3A 5CZKA 3VFTA 1F3DJ 2GT9B 3MLYH 3UYOD 1ZAGA 2Q8BL 4JFYA 4GFTB 5HDLA 1OTTD 4ORGB 1WISA 3IETB 4M7KH 2K7QA 1G7MB 3L3HA 1QP1A 4WTZG 3IRZA 2H8PB 2HRPH 5D5MF 4PLJC 3U82B 1U8HA 1LHZA 2V9TA 5D9SB 1OD7A 3NZ8B 5EOCL 3VFGH 1ZV5A 3VXOA 5DDHA 2VDPH 3PQYD 5DJYA 2R9HC 1QEWB 3GUTA 3EYUL 1CFNB 3QI9C 4M7ZB 5F1IA 3WD5H 5IB2A 3G6AB 3WXWL 3D3VB 4XNMB 4QHLA 1MJ7L 5GS1C 2YA1A 4YPGB 3ES6A 5L9DL 5I1GH 5JXEA 2AV7A 5C3LD 4P0DA 4U6HB 1OD9A 1NGXA 4EBQH 1BOGB 3QFJD 1YNLH 2A74B 2GY7B 2V7HA 4M3JA 4QXWA 4JG1H 8FABA 5GZNC 2EO1A 3SDYL 2APWA 2XZQH 4FRWA 1YUHA 4D2NA 4R9HA 1I9IH 3RIAF 2EDKA 4XC1H 2WV3A 1XIWA 3EZJB 1BZ9A 1U36A 5IOPA 1H3XA 2PYEA 1GH7A 3DBXA 1HHKB 1S7WA 2NXYD 2GKIA 4LSRL 4CAGA 3U7WH 1NCBL 2VOTA 4LNRA 3UP1A 3VD3A 2IBGA 4P2OC 2OJZH 4ERSL 3AS0A 3AS1A 2Z8RA 3MPCA 4OZIB 1UB6A 3T04D 1KB9J 2EE6A 4FXGB 3LKNA 1NLBH 1CFSB 3MRQA 1J1PH 4UT6H 1QA9A 3H9HA 5IM7A 1JZ8A 1G9NL 2P8LB 3C5ZA 3QP3A 5B39A 4YGAB 2WLZA 1IEAB 5E6ZA 5BS0B 3V5DA 1FCCA 2CUHA 2VH5H 4ZDHB 1XF2B 2MMXA 1XFPA 4HS6B 2D9QB 4S1SH 1Z9SA 1PKQE 4I3GA 2X9YA 2AP2A 1KCVL 2BOBA 2BDNH 1IGTB 1KENL 4GBXD 4WEMB 4FABL 5HSFA 4M6AA 2AK4A 1BMGA 2H2SD 2ZSVA 4Q9CA 3VXPB 1CE1L 1FL6B 4HIIB 5ESVB 4PV9B 2QADB 1P4LA 2ID5A 5ICYA 3EO1A 3DETD 5HI4D 2F15A 1XCQA 2ZJSH 4P57B 2WP3T 3BJLA 3T0EE 3QWRA 3ARFB 5EN2B 1VA9A 4GQ9H 4I13B 2R0ZH 3KPSD 3MNZA 3THML 3WO3B 1NCTA 5C0GA 1ZEAL 2GITA 1BQHB 1A7NL 1HK6A 2WWMC 1F90L 5GS3A 5KAQF 3V79C 3S7GA 2DDQL 3TT1H 3MV8E 1QSFA 2YHGA 4O5LL 3FT4B 4RFEB 1K85A 1TCRA 4X4YA 2BRRL 5J6HA 4OT1L 3IXTA 5FOJA 5JPMA 1AGDB 5FGBC 3OAUH 1ZSDB 2PTTA 3MRJA 2IPKA 5LGJB 1F42A 4WHTA 1JCKA 1YY9D 4OCXH 5FIEA 1B88A 4OLVL 4KHXL 4G7YL 1MREH 4OTXH 3TIEA 5IB1A 4XP4L 4KUZL 4L9LC 1H8OA 1XGPA 3O81A 4IRJD 3OG4B 3CFJA 2FBJL 2DOCA 5E08L 1FVEA 1G6VK 2Z35B 5JHDB 4N8VB 1BF2A 1EEUA 25C8L 4MJ5A 1TZHB 3G6JA 4OD1L 1U8MA 4R26L 3RWJA 5C08E 3T65A 1DN0A 4LP5A 1N59A 1QFUL 4M7LH 5INDA 3KLHC 1MCEA 3UJIL 1Y18B 2NW3A 4Z7UE 1KB5H 1M1SA 4Z77A 1FNAA 2DJSA 4M1GL 4O9HH 4OSUL 4UB0L 5I17B 5EZJA 1HKFA 1WV7T 4CJ1A 1V3KA 2CD0A 2VDRL 1HNFA 1TMCB 5J57B 1PSKH 1AE6L 2ARJB 1DVFD 2XWTB 4Z95L 4XVSH 4NN7C 4WY7H 2Q6WB 2X4NB 3PNWA 1IC7L 1IM3B 5SWZD 1NGQL 5EC1A 2HYMA 3MJ6A 1T66D 3TCLB 4LCWE 4XVUD 4OF0A 2CLZA 5SX5K 1NGZA 2MPAL 3QUZC 3HI6H 1L0XA 4JFZH 4JREC 2FHFA 3M45A 4FG6C 4NWUH 2OXGA 4QF1B 1KUMA 2BVQA 1MIEH 5IF0A 1WAAE 1CI5A 3QO1B 4F7TB 3TYGL 2I9LB 5DJZB 5D8JL 2FH8A 3FB7B 2BNRE 3GSNL 2J8UA 2A6DA 1Z9MA 5EZOH 1RMFH 3K3QA 2DQDH 3RY5A 1D6VL 2YD3A 2FIKA 3DTXB 1WZ1L 3BQUC 3HUJA 2JJSA 1DR9A 3CAFA 2R2CA 2P5WE 2BVOA 2ENYA 4L4TE 3NZHH 4PGCB 1NFIA 1XT5A 1BD2A 4ZFOL 3UJJH 3G6JF 1G7IA 1X5XA 5IMMA 4Q58C 1RV6X 1YEHL 2OJEA 3CH1A 3F58H 3VGDA 5C2UB 4UUJB 4KUCF 3SDCC 4OZGA 1OWRM 5IJKC 3HZKA 5IIEA 4PBWD 2ITCA 4YDLC 5C0DA 1T20B 3P11H 5GJSL 5BQ7B 3VXUA 1DQLL 4R0LC 5I75C 3HE6D 5C71A 4H26B 2DWDA 4NRXA 1OAYH 1JN6B 3NCFB 5B4MC 4JRXE 1F11B 5JORA 3TVMC 4Q9QL 1NBQA 1CZ8L 2RFXA 3FQXA 1FPTH 4M5ZH 1WF5A 1PG7W 4JR9H 5EIVA 3ZL4L 5EUOB 5F9WB 2LVCA 4R4FH 1CQKA 1DUYB 2ZCHL 1CICA 5JUEH 1K8IA 3PWUA 5I1EH 1XMWA 1ZA6B 2YPLE 4X99A 2ED8A 4DN4L 3T0DA 3L3IA 4FFVC 4Y4HA 5HXMA 4HUXB 2GUOA 5A43C 3VGFA 3BZ4B 4NNXA 1WIOA 2BNUB 2JJTC 1F4WH 5IBTL 2VMFA 3C2AL 4K7FB 5DQDL 3R4DA 3G9VA 4L8SA 2ZCLL 2J8UF 3HC0A 3RVUC 3O8XB 3V4VL 3CFIC 3O2WH 4MA8H 1MEXH 2BP3A 4LEXL 4G7VL 5E8DH 1CDIA 2LAGB 2VR9A 1F13A 3P4OA 3HUJF 4P49A 2IANE 3DX9B 4OZFB 3NABL 1RI8A 5FHAL 4IMKC 1CDCA 1WUNT 3BPLB 2ITDA 3QXDA 1IGCH 4JFHD 4I5BA 1UH4A 3EIFA 4KPHL 4HMDA 1MIMH 1KELH 2X70B 3T2NH 4OZGF 3F7RA 2XICA 4MMXC 1YA5A 2X44D 1GHFH 2G5BA 2JELH 4EUPA 2Y6SC 1MVUA 2R2HA 5EBMA 2DLTA 4XZUB 5ID0B 2PTUA 1R3IH 3D0LB 4R7NB 3RZCB 5IB4B 3O3UN 4P2RD 1E0OB 4PB9H 4U1GB 4WI4A 4LIQL 5D6DC 1OP9A 4ZNCD 5IWLA 4DZBB 4D0CB 5DJ0A 3TC9A 3U6RB 2NY2D 1VFAB 5F6IC 5C0AE 5KZCD 3B3IB 2DIAA 2ZOLA 3GSXB 3GBNL 3MLRH 4S0TD 1OGTA 3MNWA 5A16A 4GUPA 3GSNA 1YJDL 1LO5A 1XF4B 4LCIL 5DK2A 1XCTA 3C5SB 3VXSD 3LS4L 2AI0L 5GS0D 2BOCA 3D39A 4LBEA 2H9GA 3W9DA 4G3YL 5DC4B 2B0SL 3U0WL 5AYQA 5FUCE 4YUEL 2ADIA 2VZUA 4NQCA 2C1PA 4OZHF 3IDJB 5I8KH 1TQCC 1OSZA 5CZXD 4ZQKB 5HHQA 4ZFOA 2E27L 4KI1A 1X5ZA 4DVBB 2I60L 1R5VB 3PWPA 1T89A 4ZUUA 5GGVY 2GJ6D 3STBA 2VDQH 2H6PB 4NCDA 3WFCH 4GRLD 1XH3A 1J7VR 3QRGH 4YDIH 4KVNL 5D7JD 1M4KA 3O6KH 1DLFL 4OM0H 5CJOL 4BFIB 4N9GB 1ZT7B 5I19H 1JNLH 1ZE3C 3JUYA 4K9EC 2EH8H 4FFWD 5EH1A 4F15C 1T2QH 3OR7A 1RVFH 1DBML 4DUXA 4HBCH 4Y2DD 4HPOH 5EUKA 3BMWA 4DTGH 3LIZH 1FSKB 1IAIL 4W68A 4OIAA 5D7LD 4TNVF 1KACB 3N06B 2DIBA 2B1HL 4X6CE 1PY9A 5EBWA 1N5AB 5FKPA 2IBZX 4L8BA 4LLAA 5KS9E 4HUUB 2OL3L 5GQBA 1EJOL 3KXFB 4HS8H 5EOTA 1BEYL 2OSLB 1DBJH 3VH8G 4LCYB 4HJGB 4ODXB 2AEQL 3O4LA 4H5SB 5E2WL 3MGOA 4MDIA 3TO2A 4UTAH 4FNLL 4H8WL 4OIIL 5DFWH 5I71C 1YQ2A 5HGAA 1E27B 2F54D 2IG2H 4C56B 3OF6D 1FIEA 2VXUL 4U1NA 1D5BB 3OXSA 2R8SL 4HKBA 2QEJA 5E1HB 2VIRB 1Y0LB 4KJWC 4Y4KA 4CJ0A 3C60D 4G80B 4N1EA 4LAJH 1DEEB 2DI7A 5FYJU 4WO4D 3HAEA 1MAMH 1H3UA 3G5YA 4XH2B 4E41A 1MSPA 4QOKD 1A5FH 3DYMA 1KPVB 5KSBB 2FWOA 2J12B 3EFDL 1FNGA 5ALBL 1LO4L 1NDMB 4WUUB 3RVWD 3LQAC 1NUGA 3MLZH 4QYOA 5BRZB 1C1EL 5DA4A 3MCKB 4R3SA 3QIUD 1JUFB 3I9GL 4HKXB 2VITB 4LHJB 1ZA3B 4XXCC 4MJ6B 3QXAA 3CDFA 3RVXC 4M48H 4KK8D 2VABA 1MY7A 2YK1H 3QUYB 4AEIH 3W39A 3EOTH 3IJYA 3BHBB 3TM6A 3G5VA 3O3DA 4LLVA 1AD0A 4K8RH 4ZNEE 3W2DL 2ZG3A 1ZS8A 4NQTA 3OKLB 1E6OH 3SDAC 2XT1B 1TZIA 2Z0BA 1FN4A 2AK1L 2UVEA 1CE6A 1IAMA 4O02L 4RCAA 1AC0A 1AO7E 3C6LD 4FQJH 4EVNB 2WIIB 2D03H 1LO2H 1BQSA 3BD4A 4NZRL 1J8KA 1NAKH 2XN9E 1T1YA 4GJTB 1VGEL 5FF6B 5DVKA 4M5YH 1NSNH 1BVKB 4WWKC 4NQSA 5F3HB 2ATKA 4OCMC 2XTJC 1UACH 1YN7A 3O6FC 1Z5LA 2NX5D 5CIPH 2JB6A 4JCMA 4ONHA 3MXWH 5F7DB 2UWEB 1SYSA 4LDLB 3DVGB 3RY4A 3KVQA 3CZJA 2Z31C 2ZUTA 3UAJD 2CMRH 3M17A 4G6JL 4GO6B 1NBYB 4XVJH 4D9RD 1MRCL 3RJDA 4MJIB 3WN5C 3KLAB 4OQTL 1XGTB 1KIQB 2AQ2A 4X7TA 5JW4N 3KYAA 1DQDL 1SJHB 3VXMB 1QPPA 2RB8A 5DD0L 3BXNA 4KROB 2P45B 4YO0A 2EYSB 3FTGA 4Z5RB 1DQJA 2MKLC 4XP9L 2OL3A 3HE7D 3D3VD 4HWNA 3WKML 2EXYC 2O5YH 4OF8A 3T1FA 5HI5C 2VO5A 3RI5K 1W2KT 1A21A 2VZVA 1KEML 3PP3K 4KRPB 4NKIH 4NKDB 3GIVA 4APQC 4QRRB 5DRZB 5DO2C 3L9RB 5D7KE 1ZGLB 1L9MA 5MI0B 1UENA 3IU4L 4G8GB 4NYLA 3IAGC 2GI7A 4AEHL 4PRID 1JPGB 4KH2A 3E2HB 3IDYB 1RZKL 4NKOA 5FYJE 4PJ8B 4PJBA 2DWEB 3ZDZF 2IALB 5EZLB 3N1FC 1CLYL 1MAJA 1DBBL 5DHYB 4I18C 4DQOL 1QLFB 1UCBH 4G43B 4BZ2L 5GSRB 4E42A 3RWIB 4F8QA 5B8CB 1MHHB 3BKCL 4NQEA 1EFXA 1IGML 4OCWL 2E7LA 4ZOCA 3F62A 1R5IA 1T22B 3F7YB 3FB6B 1QSVA 2CIKB 3OGCA 1DBAL 5EA0H 1H5BA 5GRYA 4U0QB 1E4XI 1LDPL 3MGAA 5J1TC 3RHWK 2ZUSA 1LO0H 1BLNB 5EO0B 3QQ4A 1BBJB 1DE4A 2BCKA 4ZOBA 3OKNA 3RDTB 4JPKL 3L5JA 5BS0D 1RIVL 5TE6L 3U2SA 3IFLL 1C5BL 1DEDA 3GSRB 2E9JA 1PLGH 5T1LD 2I5YH 4WDIA 4X98B 5DT1L 3QDGA 4Z6AT 1LEIB