1NCBL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL01
3BW9A 5E0QA 3FO9B 5GSVA 3KPRD 4QOKE 3SGKC 1SY6H 5A40E 1K8IA 3GKWL 4LVOB 4X6CF 1FFOA 1BD2A 4XCYB 3WBDA 2FX8L 2CKBL 1R6VA 4LBEB 1C5DA 5I9QC 4XMPL 4U31A 2XRAH 4X98A 5C0FA 3DV4B 4MA1B 3NAAH 1JWSA 3BUTA 3SGJC 1JGDB 3H42H 3Q1SH 4KTYA 2Q87A 5D2NA 4HWNA 4FRWA 3CXHJ 5EZIH 4AEFA 3HG1A 5I1JH 1J7VR 3NTCL 2HWZL 3QCTH 1EUTA 1BFVL 3ULVD 1A4JA 1A9BA 1NMCB 2PCPA 4PRHD 3RIFK 4AIZB 1XGRA 2BOBB 4Y7MA 3PHSA 1NUDA 1P7HL 4HS3B 3MJ9H 4LRIA 3CJJA 4RGND 1RUML 3QYCA 3MXVL 3QAZC 4LU5L 1Z0MA 2ATKA 5DMYA 4IRJD 1B4RA 3NIDF 3F7PC 3L5XH 5FKAB 1E28A 4GW4B 2W60B 4F58L 1YEGL 1X3DA 1JUFB 5F3BB 4P23B 1Z6JT 4U6XA 5FAAA 1T89A 4L3CB 1JHLL 3SDXE 1WUNT 3EOBA 1BZQK 4G43B 1BMGA 4Q2ZB 4UOW1 2DL2A 5CP7A 1KPVB 3DVFA 4HWZA 5CZVL 1CDJA 1P4IL 2GAZA 5FHAL 2AEPL 2F53E 3T0EB 5GISL 3MFGB 2XTJD 4ONHA 4ZS7L 3VXUE 1LP9F 4OAWB 4Z77B 4NOBA 3BQUC 4MJIE 3G6AB 1MJUL 2QL1A 5D93C 1D6EB 3VFMA 4RFOL 2BNRE 2FH6A 1FO0H 1HXMA 4WI4A 4MAUH 3GIZH 3EOTH 4GQ9H 4TNWK 3MNVB 3F5WB 2A6KA 2NQCA 3MUHL 5H37H 4PJEA 4NNYB 5TJWK 4X7TB 1CGSH 1DBML 2FX7L 1JZ8A 5I16A 3QUYD 4CMHC 3HLAB 4KUCD 4R97C 4MCYB 3WL9A 3VD9A 4KJQC 4LFHG 2HT2D 4XP5H 5GSRB 3QEUA 3DV6B 3PUCA 3IETB 3MROA 1OT2A 1XIWD 4WFFD 5GRYA 3IGAA 2OXGA 3SQOH 5HJ3B 1MCKA 4P5TB 1UM6L 2BY0A 1KNOB 3U0WH 3MNWB 3BH8A 3K8MA 4MCZA 4Z7QF 4KDTC 3U9PL 5C0GB 3TBYB 1YNTA 3QHZH 3VD7A 5T1KB 2A38A 3I6GB 1H3UA 3U1SL 5E8PB 2DLEA 3FOLA 4Y4KA 2WAHA 1IAOB 3KYOB 3PL6A 3Q6GL 3L6FA 3RVUC 5SWSA 1HSAB 1LHZA 2JK5A 2CDEA 2F9BT 1JNNL 1AI1L 2YD9A 5IR1A 1LEGB 1IM3B 4P2QB 5HYSB 1OM3H 3ULUF 2Y5EA 5ISZD 1JZ3A 1ES0B 5L9DL 3OBAA 1B88A 4FFVD 3KPPB 3PWUB 5TE4L 1S7WA 1S9VA 1OAZL 2DB8A 4IMKC 5E2WL 3BZEB 4HXBH 1NCDH 4QXTB 3FB6A 2BHYA 4I48A 3QO0A 5A3IC 1XF3A 2OS7A 4H5SA 4Q0XH 4AL8H 3IXAB 4WFED 3Q2CA 4CBPA 5DF0A 1CLZH 2C3WA 4NQXB 4D9QD 4LNRA 1K85A 4OF6A 3LB6C 3TYGH 2EDLA 4X9GA 3SDDA 3ZT7A 5FF6B 4HF5L 5C0BB 2FBJL 1JWMB 1DQJA 1QBLL 2EYRA 5F1OB 3EYFB 1KIQB 3KYMB 3N50A 3EGSB 3V6BR 5D5MB 2NY0C 4MD4A 5FUCC 2HVJA 5C0CB 4WFHE 3PDDA 5D72H 1RZKC 3HMWH 4NNXA 2G2RB 1F90H 4FQCH 2WUCH 4JFEB 5GS0H 3DYOA 3TO4C 4JY6B 4AK1A 1ZVSA 4P59H 1YUHA 4N68A 2YBRB 2YS4A 4PRIE 3BN3B 1A7NH 2WWMC 3KPNA 4G6JL 4P3DA 2VXSL 1D5MB 1H0DA 1NBVL 3D87B 5GS1B 3SDYH 3FFCA 2NY4D 1P2CA 1RUAL 4HGKC 2W07A 3TCLB 1Z5LB 2DMKA 1T20B 5IBLC 2HG5A 4E42A 5BCAA 5CSZA 4TSAL 5AD0B 4KKCC 4WO4C 4I18A 3LZFL 4KROB 2VLKA 1HQ4A 4XP1L 4PV8A 4CMMA 1QACA 1MCRA 3D3VB 4DW2L 5IVXF 1QFWL 2X4PA 4L8BB 3MRHB 1IGYA 4KQ3H 4OLXL 5CINL 5EN2B 1LK2B 4QHKJ 5IW6A 4Q9QH 1I1FA 5AUMB 3WN5B 2H8PA 2YRPA 1KJ3L 4LLDA 5CD3B 4F7TA 1K9TA 3ARBA 5D6DA 5D7JB 4ZUTB 3RVXC 3I3DA 2PUQT 5D6CA 1UQSB 1ZKAA 4UIKL 3HS0A 1LD9B 1EJ6A 2V6HA 1BOYA 2W9DL 3SEPA 2V2WB 1J8HD 1KB9J 4UTBH 3BEWB 4NFBA 4FQ2H 2CIKB 4YIQA 1HYSD 2Q7YA 3TVMB 3MV8D 4KUZL 1QVOB 3DVGB 4J1UB 3DBXB 1YEIL 1F58H 2C7UB 3ZKXB 1P1ZB 4RBPK 3T08A 5EUOF 2ZCHL 1MUJA 4ZO7A 4APQC 5TGBA 3ORJA 2XWJB 1ROWA 1C1EH 2YUXA 2FL5B 2F74B 4GAGL 4ZXBD 2HKHH 1KCLA 3NN8A 3OKMB 1BVLB 4XPGL 4JPWL 5D1QD 1BQUA 1UB5A 4BH7B 1BLNB 1PG7H 1J1XH 4L4TB 3CCHA 1DBKH 1L9NA 1CGYA 2AJYH 5FUZH 1NLBL 4LEOB 3QIWB 3R1GL 1I7RA 1H3XA 3S96B 4A6YL 5K9OB 3OGCB 4L8DB 1C5BL 4ZQKA 4GXVL 1IAIH 2MOVA 1ZWIA 5E70A 1PKOA 4CL7A 4M6NL 5E6ID 4KRPC 1LNUA 1B0WA 3T09A 1CIUA 4N8CH 5H2BA 3ZTJH 3D5OF 4WEMB 3V0WH 1M05B 2EYSA 2VLMD 4FN0A 4OCWL 2HJKB 4YXHL 4TULH 4JLRB 2IQAA 4OCXL 5DK2A 2CUMA 4PJIB 4Q6YA 1JGUH 5IG7B 3V0VB 1ZA6A 1NGYA 6FABL 5JORB 5KTEH 1IGML 3WS3A 5MENA 2VXTL 1U8JA 1GL4B 3O4LE 2AEQH 2FGWH 1AXTL 3OAZH 5C09B 3VXSB 3MRDB 3FN9A 1AQKH 4L8CA 5EH1A 4NQSB 1CFQA 3VWKC 3B4NA 3G9AB 2A6DA 4NQUA 1RURL 1D5ZB 4EBQL 4JJ5A 3ZHKA 1BIIA 1BOGA 1Z2KA 2VLJA 2ICWB 4Y19E 1C8PA 4HIJA 1FG2B 4ZFGH 2LU4A 2X4OA 1KYOK 5E2UL 4QWWC 3B6SB 2EE3A 3C5ZB 1FL5A 3CDGB 3KJ6L 2WMPA 1WIUA 3GSQB 2JCCB 3LKOB 1CE1L 1HEZA 4HH9A 4M03A 4JKMA 4XVTH 1UWEH 2Q8BH 3BX7C 2EDNA 3O2DA 3E8UL 4P9HC 5GGRB 2ICEB 1GGBL 3MOBL 1JPGB 3QQ4B 3FQTA 5I8OH 5C8JA 2L7UA 1A9EB 5HHPA 4NKOB 3OXRB 5FEBA 2X70B 1TENA 3AS1A 3TV3H 3VRLE 4Y1AE 3RGVB 5DDHB 5HGBB 1T89C 1JPST 4TTDD 4ELKB 4HUVA 1VACB 3WXVH 4O9HH 4XXDA 3AAZA 4OF3A 3ZKQD 1FJ1B 1QFUH 3UTSA 3QFDB 5DJDB 3TT1H 4HIXH 2Q76B 3VXMA 4M1DH 4ZPTA 2XWBB 1WZ1H 5I76A 4JFFD 3UYRH 1TJHL 3HC3L 1G0YR 2JB6B 1CZ8L 4K71B 3MRMB 3BPLB 4JB9L 1G6RB 2A6JB 3JTTA 3N1FC 3Q48A 1U93B 4KY1L 3GHEH 3IJSB 5KANI 2YPVH 1TQCB 3FB8A 4L4JA 4MNQD 4PJAA 3FQUA 3EYUH 4S0TD 1K8DA 3H9HA 1A21A 1YEDB 1AHWB 4MSWA 2EIZB 4XP6L 3PGCB 1QFWM 2FJHA 3SE9H 2YSSB 4TUJB 4RX4A 1NUFA 4MAYA 1WIOA 2BJMH 5DSCB 5DMKB 3EZJB 2PTVA 5AYUL 3D85A 1Q8MA 2N56A 3K81A 5FCUL 4PGJA 1U8LB 5B3JE 1P7KB 4JZNA 1GGCH 1NC4A 4JPIB 1QSZA 2HYMA 1BIHA 2ERJC 2VR5A 1QSVA 3KR3H 2ZSVA 4LVHB 3CX5J 1Q94A 3FTGB 5IVOA 5HVWA 1UCTA 4CU8A 1B0RB 2FLBT 1MOEA 4OZIB 3UTTA 2HP4A 3FHAA 4HSQA 3V79C 1A4KA 5KVEH 4ZSOB 2UVEA 3HZYB 5F1IA 1JYXA 1F4YL 1V7NL 5AEAA 2BVPB 4JGMA 2DYPA 4LDEB 3QNXB 5EO9A 5C9JB 3QJHA 4YE4L 4UAOB 1NMBH 3GB7B 4ONFL 3RVTD 1OQOA 2ADGB 5KVFH 3KGRA 3CFIC 5IBTL 1AKJB 3AB0B 1IKFL 5I6XC 4Z0BH 5EU6E 1S3KH 4HGMA 4BH8B 1H3PH 2VH5L 4RZCA 4X6FB 1WEJL 4UINH 3ARFB 1G0DA 3VWJD 2HFGH 4PUBH 4U33A 3S34H 1U8MA 4M93C 5T1DL 2YA0A 5IHLB 3QFJD 1D3CA 4OIIH 1B6UA 3FB7A 4OQ1A 2DQGL 3O6KH 5HGAA 5K9KB 2X5PA 2E7LC 3IKCB 4PJXE 3RWFB 4F8TA 4UU9A 1RZ8B 1QLRA 2ORBL 3NCMA 4HH8A 4PB0L 4PJCA 4Q74A 2YOCA 2CRYA 2C9AA 4YXLH 2DM3A 2IADA 3S5LG 5HHMD 4N5ED 4NUJB 3U4BL 1JPFA 2E7CA 1VKXA 2VZ3A 1WC7B 4X4YB 4DEPB 1RZ7H 1OGAD 2IALA 4GLRH 5DWUL 5E8DL 5C07A 3VFNA 5HD8C 1Q72H 3PHQA 2OX5A 4FQIL 2C3VB 1F4XH 5EU4A 2A77L 4OTXH 2EC8A 2YZ1A 1CLYH 4JREC 5ESAA 3FT3A 1U92A 4FMKA 4WU7A 1FNAA 3RUGB 1PZ5A 2BNQA 3G5ZA 4OLZH 3V5KA 3C8KA 1AXSA 2Y6SC 4GAJH 1I7TB 3O3AA 4ZS6C 1NGPH 3DUSA 5B4MD 3QIBD 4KQ4H 4BKLA 5C3TA 2IAMA 1SEBB 5I9QB 3WNMA 4J23A 3HC4L 2W38A 4OGYH 5FO7B 5GRJL 3QDHA 4H1LG 3ZMRA 4N0YH 4I18C 2VLRD 2OK0H 1MJ8L 3W9DB 1BD2D 1MFAL 3NIDE 3SGEI 1HOCB 1G9EA 2VKWA 1A6UL 2GTZA 2J4WH 5TE6L 5IMMB 2W1NA 4P57A 3X17A 4LRNL 3VA2C 1QBAA 1M71B 1TVHA 1V7ML 4YHMH 5DTFB 3U7YH 3WJJC 3QDJA 5AZ2L 3DXAA 3HG1D 2JJSA 5D6DC 1CU4H 1M6OB 1KBGL 1MPAL 1OB1A 4NP4H 3QAZB 3WFEL 1HHHB 1JZ2A 2GSGA 4KJWC 2OR9L 5TE7L 1CL7I 4JRYE 3H2WA 4E41E 4D8PB 4KRLB 1AO7A 1LP9E 3B9KA 3O45A 1MSPA 2GK0A 5DR5H 4N0CD 2MHAB 1QHPA 5EDXA 1PFCA 3OXSA 4NQCB 2R9HC 5LCVH 1QTYT 3KWWA 1N2RB 4KMQA 4ALAH 3T0EE 1J10A 4QKXB 4G7YH 4ORGA 1AE6H 4XC1L 2P7TA 4LCWB 4EI6A 5IFAL 3OX8A 2BY1A 4BSVB 3F6LA 4HX1B 4UV4H 1L7TH 1QBML 1UA6L 3O0RL 5BVPH 1YPZF 5IESH 2R0KH 5J6HB 1JNJA 4Z0XB 3BQUB 3D9AH 5DXWA 3FT2A 5D93B 1CLOH 2H45A 2VJXA 5JNYB 5IFHL 4F80A 4PRPA 1JHKL 1R3LA 3BKCL 4TVPL 5IVZA 1C16B 3KPMB 5HVFB 1H5BA 2J5LB 3O3DB 5GS0D 5EZOH 5MP6H 15C8H 1TTGA 4ISVA 3GSRA 1FL6A 5H8DA 1LE9B 4GW5B 4CMHB 3QXUA 3H9SA 4R97B 4RGOL 3IDNA 1K4DB 1ZK9A 4Z7QE 5LQBL 1QP1A 1NC2B 3GRWL 4PGDB 1U3JA 1K6QL 1KN2L 4KAQH 5JA8B 3ZL4H 3A6CH 4G8IB 5SWQA 3OKNA 4JFDE 4YDJB 2Z93B 1FFQA 1S5IH 3TBWB 4O4YH 4EJ1C 5ITFA 1T6VN 1IGJA 3QEQB 1ZSDB 5HYJE 2EKJA 4M61B 2XYCA 2HJFA 3DX9A 1MWAA 3RX5A 5F6HJ 5F89B 1FBIL 5I1EL 3CMOH 2VE6A 2AQ1A 3ULUE 2BXYA 4LQ1A 4QRRB 1YMMB 3CFDB 5MEPA 2RB8A 4DN4H 3D0VB 5J1AB 5CEYA 3ULSB 2BVYA 1ONQB 1ZV5A 4JHBA 4NWTL 1MRDL 2DQIL 5E8NB 4WW2C 4HBQA 5I18H 3P9LB 5KJRL 2Q3AA 1FQ9C 3LEYL 3QPXL 1ORSB 4PLOB 3PWJB 4PRDB 4TUOB 5L2KA 3HUJF 5I8CA 4ODXB 3RU8H 4O2EA 1N64L 1RZFH 3O6LH 5C0RH 4Y4KD 1TQBC 3I02A 4AYFA 5J3HD 3QIUC 1NGWB 1YY9C 4XH2A 2R15A 3PL6D 4PRBA 5T3XE 5IWLA 1OY3B 5SWSD 3ZYJA 1S7RB 4RAVB 3KPQA 3HMXA 2HN7A 3CFKB 3IS0X 2E8ZA 5DQ9A 1QEWA 3VXPA 3FZUC 2NY3C 3ROOB 3PHOB 1BJ8A 4M48L 5IHZB 5E03A 1W8OA 4X7FC 1P84K 3L5WA 3WEXA 4YQXH 5EFIB 3NABH 5I1GH 1B3JA 2D7NA 2X6MA 5L7XL 1CICC 2IEPA 2CLRB 5DJ6B 2DLHA 1JVKA 4UB0H 4YEFA 3VCLB 1HH6A 4X6BA 5DGRA 1PBYA 4L4VA 2DLGA 5C0CE 3RFZC 5LAXA 3EAKA 3L9RA 4TRPH 4JANB 1CVSC 1KCRL 4JFEE 2BVQB 2NY0B 2P42B 2PYFB 2P5EB 1TJIL 4YUEL 1RV6X 3ZE0F 3SDDD 4O51B 4RAUB 5C0JB 4OGXL 1IC1A 4HGWA 3TO4B 5INCA 3WE6A 3O3BA 4L8SC 5L0QC 1KCVH 5E6ZA 2ITCB 4OI8A 4XBPB 4KTDL 5IVXE 1JWUA 1IARB 4I77H 1SJEB 3MUGB 4G9FA 4DGYH 3IDMA 1QSEA 3CU7A 1CGXA 4FXLA 3JV5A 1P6AB 2EC9U 3OAYH 3QXDB 1F4HA 1QR1A 4R0LA 2XACC 2EDBA 4YR6A 3S5LA 1G7PB 3GMMA 1OAUL 1OW0A 5GGUA 4NCDA 1SBSH 4YHOL 4WO4B 3RI5F 1YQVH 4X5WA 1A64A 4XNXH 5E9DA 1U8QA 1I1RA 1JMXA 1YNLH 5E2VH 1DLHA 3FFCD 2QADB 1WVZA 2YRLA 1FYHB 3X12B 5FECB 5F9OL 3MV01 2OZ4L 1I7UB 3HTLX 4RMUA 1NAKH 3FQNA 4HKXB 3KPSB 2VLKD 1I3UA 5C2BL 1MWAH 4KK9C 4PBVC 2AGJH 2D4FA 4WGWB 4ELMF 5EUOE 1Q0XL 4CW1B 2ID5A 1AGBA 4OLWH 4P2YA 3E6HB 1NBYA 1HCVA 4HWBA 4YHPB 1J0JA 3B43A 4K7PH 5DHYA 2I27N 3M8OH 2FCBA 2ZG1A 4GG6B 3GSUB 3ARBD 3WLBB 5DHVA 3VFRA 1E4XL 4M8VA 4BFBD 2A6IB 1MH5A 3UTPD 3JV4A 1FHGA 3KYNB 4KZDH 3IF1B 1GOHA 4APQB 2BSRA 2J6EL 4IRSA 3STZB 4BZ1L 2CRMA 5I1HL 1NCNA 4DTGL 3LMJL 1HDMA 4PJFA 3UJTH 1EEZA 1JV5A 1X5XA 2WINA 4WHTA 4X6DB 3KYKH 4LCCC 4LLWA 4D9RE 4MS8C 2VZTA 1JHTB 2PO6D 4NO5B 3EOAB 5DO2D 1BPVA 4IDLA 3HE6D 5EIVA 2QHRH 4NQDB 5TF1L 5K9QI 3HZMB 5BO1L 1CXHA 4YFEA 3OAUH 2EZ0D 3IYLW 3LKSB 4JFHD 2B1AL 4XC3L 5E7FA 4KRPB 4FQXC 3VFVB 5LXGH 1U8IB 4F57L 1I7ZB 2VIRA 1OTUC 2ZUUA 5IOPB 2PYEA 2VL5B 2YD1A 4PGZA 3H7BA 5D7IA 4U49A 2NXYD 4OCNC 3EW3B 1G9NL 1T0MA 4OJFL 3STLA 2ED9A 1KXTB 4PGEA 4NHCL 2YD3A 4CVUA 3QULB 1V3LA 1MRCH 1GCFA 5I8KL 1HSBA 1VFAB 5CZXC 1T83C 1ULVA 4DOHB 3K4ZA 3MV9D 1UFUA 5C09E 1G7JA 2O26U 5M95B 4Y5VA 2CKBA 1F00I 1UXWA 3G6JA 3HC0B 2QTEA 3BKJH 3OPZL 2G9HB 2UZYB 1KN4H 2P8LA 5T1MB 4QHKI 4HUMB 5GSVB 5JOEA 4JAMB 1S9YA 1U3HC 3EO9L 4NPYA 5DJ0B 1FZMA 4LFHD 5JW4M 5GRXG 3VWKB 4PYHA 4JM4L 3T8XB 1C5DB 5JPMA 5MEND 4ONGL 2XQYG 1VENA 5C0FB 5GZOC 3HPJA 4YWGH 3HCVB 2AJSL 4JQVA 4D0DB 1JWSB 2RGSA 5CCKH 4K3DL 1X5IA 2VLLB 3T0BA 4OLUH 5I66A 2NY1D 1P7QB 4F9LA 2W59A 1MNUH 5KVMC 3LV3A 5IF0B 1DSFH 3ARGA 5DMGC 2VLJD 2DQUH 4KDWA 1AFVL 4D3CH 3ZT6A 1QOKA 4NKIH 4XP9L 1PKQB 1MIMH 4HWBH 4JHZA 4FQHA 1RUPH 5CD5C 5A16A 1N0XH 2JJSC 4R7NA 4I9WE 2RFXA 4M1GH 4N8PA 3BEVA 5DHVH 3SOBH 1N59A 3VXNB 1X4ZA 3I50L 3W82A 4WCYL 2LAGB 2MNUA 3NFPB 1CS6A 5JHDB 1DQDL 5MI0C 3U4EB 2FYYB 3OR7B 1EO5A 3S36H 5FK9A 4BYHA 5I1IH 1IL1A 3CK0L 4OFYA 3MBXL 1CFNB 1MIEL 1WAAF 3MRPB 4FS0A 1GYAA 1T0PB 2DI7A 2LFGA 3S35H 3I6KA 3UTSD 3VFMB 3B5GA 3BH9A 3RX7A 3VXMD 2R69L 1F45A 2IANE 5BZWB 2IPUG 3DURB 1UKQA 3BKML 5D4QA 3TH3T 3KPLA 4M62H 4PY7B 3TWCL 2VDOH 4JFXA 1KENH 3Q5YA 4LLQB 3VXRD 4LKXB 5J11C 1FVEB 3OKLA 5GRZA 2ICES 4GJTB 3CVHH 4MHHI 4JPKH 1TJGL 2Y9RT 3MRJB 5JIPA 4P2RB 4R90H 4NDMA 4NN7C 3UC0L 3K4DA 5FGSA 2IPKA 2HVKB 5GGVL 4LKCB 3GKWH 4XCEB 3MBEC 1BWMA 5HI5C 3P0YH 1BJ1H 2FX8H 2CKBH 4RX4D 3VFPA 1TZIA 3H3BC 2RAMA 2ERJB 4XMPH 4MAYD 2J8UA 3BH8B 1B9ZA 3V52L 4NCC1 1CR9L 1Q38A 1FYTA 2X4RB 2APXA 5ACMA 3HR6A 3EYSL 1A3RH 1NC4D 3QQ9D 4GRMB 2HWZH 1HKFA 1BFVH 3EJZC 1PYWA 5SWSB 2R1WB 4F33A 3BP5B 4R4ND 4V1DB 3KLSA 5IR1B 3UTTD 1WITA 4HK0B 4K8RL 5ERWB 4NHUA 4JZJA 4BQ8A 3RVVD 4JHAL 4MJ2A 3MXVH 4LU5H 3V4UL 2P8MB 4MXQC 1MHEA 2DYPD 5I6XB 3O2VL 5HHXH 1S7WB 1S9VB 4F58H 4PJ7F 1YEGH 1H15A 2H1PH 2V7HA 3FB6B 4LPUA 1N7MH 3A6BL 3WIHL 3QO0B 3SE4C 3FB5B 2E9JA 3NGBC 4M93B 3SKNB 1FDLH 4P3CH 5CZVH 4UUJA 2H2PC 1YEKL 4F37K 2EYTA 2LU3A 4LNRB 4NRXA 5FHAH 3QCUL 2GITA 4ODSL 5FA4A 5GISH 4OKVA 1TCRB 4ZS7H 4J7RA 3VXTB 4RFEA 2GCYA 1FH5L 1MJUH 4N8VA 3VGDA 2UZIL 4RFOH 5ESQB 2J88H 1ZEAL 4I5BA 5B8CB 1IVLA 2XN9A 5D1XA 1VPOL 4NNXB 2X1OA 4PD4J 5EOCL 3C60A 2AI0L 1DVFA 4UDUB 5T5NF 4JREB 4TQEL 1AIFA 4F15C 1YUHB 1DBMH 1WF5A 5JDSB 3K2MC 1DFBL 1MEXL 1IBGL 4FZ8L 3ZDXF 3QEGL 3MODL 4U1GC 5CZXD 4NJ9L 3CUPA 2GY5A 3MRQA 2QKIB 3JSSA 3QQ3B 3RTQC 1TXKA 4S11A 1P2CB 3ZHLA 4UMGA 4PG9A 2HG5B 4TPRL 1DQTA 3CSPA 1NAMH 2BNQD 4I18B 1I1YA 1N6QH 5JW3L 1UM6H 1MCBA 4EQ2A 5C0DB 3ZYIA 4CMMB 4GT7A 1AY1L 3DX8A 3MRNA 5ENWA 4XP4L 2IAMD 2X4PB 1S7TB 3OB8A 4WEUD 3U9PH 2OQJA 5AZEH 3VXUA 1HZHL 4ZPVA 1PQZB 1UH2A 3U1SH 3C6LC 2FO4A 1I1FB 3L3IA 2MQCA 4R2GC 5FKPA 3WSQL 4G6ML 4U3CA 1JRHI 4LLDB 1G6RL 1KIPB 1M7IB 3EYOA 4MB3A 5GPRA 5ADPL 1KIUA 2E6PA 5INDA 3TA3A 1EEQA 2NNAB 4AM0B 1H8NA 1JNNH 1AI1H 1YPZE 3RZCC 4LSQL 2M2DA 3HS0B 2WWKO 4QNPF 5DD0L 3OKOA 3RIAF 1UH4A 4CJ0A 3QDJD 5L9DH 5F88B 4WV1A 1HCFX 1MY7A 3AROA 1XCQA 2Q7YB 5TE4H 1AD0A 2W9LA 4QRQA 2IMNA 5EC1A 4JO1L 4OM1H 1OAZH 1T6WA 2MCPL 2GQHA 1XF2B 4UTAL 4KK8D 1JIBA 2WUBH 4CNIA 3B9KD 2C1PA 3L95B 3GKZA 4O58H 3T2QA 1AGDB 1CE6B 2GT9B 4GFTB 4PJGF 4PJDA 5JR1L 4M5ZL 3WDIA 2GI7A 1I9EA 1FAIL 4A6YA 2ENYA 2E3VA 5DRNA 3NZHL 1UJTA 1CFSA 2VQTA 3GJFK 3G5YA 4HF5H 2FBJH 1CK0L 3CCHB 4LARL 5F7HA 1QBLH 1DANU 5MEQA 1C08B 1JF1A 4DKFL 4M7ZC 2FSEB 5JOFB 4ZUVA 4F2MB 4KHXL 1OP9A 4JEGB 4AY0A 4KWUA 1TVBA 2EDXA 3ILQC 1AD9B 4JQIL 3PQYB 5IV2B 4JGJA 3ET9F 3GJEA 4IOFC 1NQBA 4PRPD 1CGVA 4Z7VF 4M6OL 4MXVF 5FYKU 5FYLD 3V4VL 1MI5B 3GEWB 2PTTB 4XAKE 4FXKA 5DJ8A 3SHSA 2WIIA 3CZFA 1AR1C 2EYSB 4G6JH 5DVKA 2VXSH 4O2CA 1XFPA 1A6ZA 2DQEL 2AJUH 1RUAH 3HUJE 2XA3A 5FYKE 5D70L 2OL3B 3A67L 4TSAH 1ZA6B 1CBVL 3LZFH 4O02L 5HGDA 2DL9A 4XP1H 4J3OC 5BV7C 4W6YB 5HI5D 4DW2H 4WW2B 2PW1B 1QFWH 4HKZA 4CADA 1W0WA 5I17A 4GRWB 4U7MA 4XAWH 4AEEA 5DJAA 5JZ7C 3D18A 1BEYL 3VFUA 3AY4A 4NC1C 1HINL 1TQBB 3CX2A 3VRJB 3QIUB 4HIJB 2EDTA 4OIBA 5B38A 2AAVA 2RCSL 1DDHB 2W9DH 5L2KD 3H0TB 1FL5B 4N9GA 2YPLB 5I1AB 3Q0HA 3EDJA 4PRIA 3ARGC 4X5LA 3INUL 2NY3B 4POYA 2IWGA 3G5VB 5I2IA 3V7AE 1IAKA 3ZE0E 2YEZA 3AMLA 3IFOA 4KC3B 1YEIH 2G60H 4U1KB 1YC7A 1INQB 3FQTB 5KN5B 1CICB 3P9WB 1PZUB 4Z7UA 5HHPB 3RZWA 3ZKSD 2XWTA 5HTSA 1IGTA 4JFPB 1NUGA 4Y5YA 3U4AA 1RY7B 3T1FA 4CUCA 4J3UA 3EO1A 5DJ2B 3MRCA 4U1NA 4K3EL 3MZGB 4GW1A 4WWID 2WZPD 5GHWH 4PRNB 4MMXC 4QRPD 3LPWA 3AAZB 1NLBH 5DFVC 4OD3L 4MQ7A 3TJEL 1GJIA 4S1DD 2XY1A 3R1GH 4X8JA 3JBG7 3CLFL 3K8LA 1AXIB 3BGAA 1C5BH 4L8SB 5L0QB 4GXVH 5SV3A 4WEBL 1T5WA 4M6NH 3B2VL 4L5FL 1D5BA 2R2HA 4O2FA 4Q9CA 2GJ6D 4DKEL 1HXYA 1XF1A 1EEUA 1NCTA 1F42A 2FJFB 4PJ5B 3C09C 4QRUA 4ELME 1K8DB 5F6HI 1UKSA 1NL0L 4WRLA 2FJGB 4OCXH 4G9FD 1NFDF 1QSED 2ZUWA 1RK1A 4WFGD 5MERB 5K93A 2F54E 4GXUM 2NX5B 3UEZA 3OMZA 6FABH 3NCYS 3QEHB 2CSPA 3THML 4JO3H 1IGMH 3JZ7A 5EZJB 1XZ0A 3FRPA 2VXTH 1AXTH 1J0KA 1N4XH 2QEJA 1F6AB 3D85B 1ZHLB 2B7DT 3RWGB 3WO3B 2NZIA 2ZSWA 1UZ8A 2P4AB 1R3KB 3SKJL 4JZNB 1F97A 5IB2B 3ULVF 5L2JA 4OSUH 3NFSL 1Q94B 3GSXA 1MHPH 4OUOA 5E2UH 2ZUXA 1FZKB 2B4CC 2HT3D 1MCWM 2Q86B 2Z8VC 5BVJB 3KJ6H 4OZHF 3QRGL 1CDCA 1ORQB 5B39G 1CE1H 1ED3B 5HI4C 2X41A 5EO9B 1YEJL 3E8UH 4X6DE 3W0WB 5DD5H 1S7UA 1GGBH 3SDAA 4U1IA 2JJTA 2NZ9C 5EU5A 4HV8A 1HNGA 3IXTA 2AK1L 3G9VA 4LCCB 4L1DA 1EV2E 3L7FA 1IZKA 1QZ1A 4IRSD 2X4QA 3FO1B 2A2QT 1KJVA 4K9EH 5IKCA 3WIIL 4LPXA 1UCBL 3VXQA 5SWZA 1OD7A 3FMGL 3L3JA 3TBSA 4P2OA 5KSAA 3S4SG 4H0HB 5HHQA 3IDUA 4FQXB 5F9JA 4QRSA 4J6RL 3DETC 3TN0C 3TLRA 3F12A 4NKDA 2BNUB 1TJHH 3HC3H 4XWOC 1CZ8H 2VR4A 1Y18A 1DUZB 4JB9H 4WWKB 1FZOA 4YO0A 4Y5XC 4DOHE 1AP2B 5F71A 1NKOA 4KUCF 1RIUL 1JI1A 3QUXA 3QZWG 5BZDA 4PJHF 3BD3A 3WUWA 5FYKH 5C0AA 5IQ9A 2HMID 4L3EB 2BHUA 2G5RA 3FQWA 3BP7A 5CJQL 5H35B 4DFHA 5KVGH 3MLPA 1VKXB 2PYED 3H3KA 2A0LD 1IKNC 5C07B 2UY7A 1CFTA 4ZDHB 3VFNB 3PHQB 3TBTB 1DVFC 2PKDA 1OVZA 4XP6H 1P9MC 1KV3A 1D9KC 3M1BA 4XTRC 2P44B 5K33A 3TO2B 2C4FT 1PDKA 5KSBB 5CWSB 1U3HB 3UAJD 3MRFA 5KSVB 4Y1AA 3BHBB 4IOIB 1T21B 1CL7L 3PWPE 1WV7T 1S78D 3K8KA 5E7BA 1NBZB 4C58B 1OF2B 3MO1B 5FCUH 3B8SA 4EVNB 4YDLC 4JG0H 3LSOB 1X7QA 4G8EA 4GO6B 3L3HB 3EJJX 5LGKA 1V3KA 3IFPB 3FAXA 2HLFC 4YGVA 2A1WH 1QRNE 2BVUA 4LL9A 2OTUB 3VFTA 3MJ7A 3P4MA 4IS6B 1MCNA 1I3RA 1JN6B 4EI5C 2FD6L 3DXAB 3IVKA 1W72B 1CD1B 3W11D 3W39B 1ZLWK 1OB1B 1DQQB 2UWEB 5TQ2L 4PJBF 1CGUA 2E6JA 2R8SH 1WAAE 3ARGD 2F58L 4CVXA 4YE4H 1AO7B 4UDTA 4Y4HA 5EU3B 4ONFH 1M7DA 3QXTA 1FRGL 3MLYL 5F1SA 5IJKA 2DBLL 3CAFA 5EO0B 2K7PA 2VAAA 4PV9A 5IBTH 5CJOL 4PJ9D 5F7WC 3RWIB 5MI0B 2FR4A 3SJVB 4BSWA 2AKRB 5DVLA 4FTVB 3CFEA 4DCQA 3UROR 2VH5H 2HFFA 3IDIB 1XF5A 1WEJH 4PLKD 4LIQL 5HYSG 5C0IB 5JTWA 3DLQR 5DD6A 5T1DH 4IIQC 4PGBA 3T3MF 3MV7E 3T77B 4I4WA 4UILL 3RDTD 4JJHA 5EIIA 3W81A 2DLIA 3FT2B 3MREA 4QY8A 5GXBB 1R24B 3BD4A 5C3LD 4PP2B 2B1HL 2GTWA 3GRWA 4OFYD 2IG2L 4WI8A 3SBWA 3LQAC 5IVZB 2ORBH 1CXLA 3ZT5A 4PB0H 3PJSA 5CHNB 1JNLL 1SQ2N 4H8WH 5JXEA 4HS8L 1JPSL 3U4BH 1WBZA 4KI5D 1RK0A 5J11B 4M7KL 1CDHA 3ALPA 3H9SB 5E8DH 5D7LD 4GKZA 4QRTB 4KXZH 4DQOL 3OR6A 3BSZH 4FQIH 3K4AA 4HFUL 3ZE1F 4WI5A 5LGJB 4J8RB 4NN7B 1L0QA 2NY7L 5DT1L 1V5JA 5HY9A 1IE5A 3K46A 2H3NA 3MBEB 3T0VA 4G80A 1S5HA 2IMMA 3DX9B 2W65B 6CGTA 4WTZA 5EU6A 5C0EA 5SX4I 4MD0B 4HMCA 3ARZA 5GRJH 2AJ3B 5BS0B 1FG9C 4H26A 5IB4B 3IB4A 3TFKC 3MLRL 1MJ8H 2ED8A 2QQQA 3N1GC 3O9WC 1MFAH 3T4AB 1KJ2H 5ADOL 4PJ7E 4V1DE 3LD8C 4YNYB 1A6UH 1LGVA 2C26A 3KLAB 5TE6H 2OJEA 5D2LB 1WBXA 4OCRL 3IDYC 4PRAB 4WGVB 3F6IA 1NCBL 1I8MA 3IU3A 5JW5B 2EECA 4MXWL 5I8CB 5ITBL 5DURD 5AZ2H 2RBLA 2CLVB 5ILTL 2Q1EA 1MPAH 1KBGH 4KVCL 1OSZA 2J3SA 3PABA 2WQRA 4U1JB 3WFEH 4YAQA 2OR9H 5IM7A 5TE7H 3QHFL 2AXGB 4PRBB 1NMAL 1OLLA 3FO9A 3NIFF 3O8XA 1I9RH 3KPQB 5C86A 4XCYA 4OZFH 5IT2L 2HN7B 2O5ZL 1ERNA 5I1KL 4EN3A 4LBEA 1R3HB 1NUNB 3LH2H 3NGBB 5E95B 4ZOAA 3O11B 3DV4A 1MCHA 1U91A 3HFML 1J05B 5DFTA 4XC1H 1OAKH 1NDMB 3NPSC 1EFXB 2GFBA 1QBMH 1UA6H 3E6FB 3O0RH 1MHCB 3IKKA 3VGAC 4UBDD 4JRXD 4L4VB 3RBGA 4D0BB 2FWOA 1EERB 1YN6B 4KFZC 4AIZA 2BOBA 3RKPA 3S97C 5IFHH 1I1AA 5CFHA 1JHKH 3BKCH 4TVPH 3PWLB 3S4SA 4HS3A 4JFOA 1N6VA 1TPXC 2FH8A 3WE6B 4F15B 2ZOLB 4GH7B 5FKAA 4Q7DA 1U42A 2FGZA 3HI6H 3BUYA 3MV11 4P9HL 5JIHA 3K0WA 4P23A 4U1GB 5F3BA 2XN9D 5D1XD 1QSEB 1VSCA 4G43A 1LP9A 4Q2ZA 3C60D 3RTQB 1X6NA 4YR6B 1RQ5A 3S5LB 1ZHNB 1KPVA 5GGUB 3TEUA 2D0HA 2X40A 2OZ4A 3AM8C 1R5IB 1A1MB 1IC5L 4W6XB 2KDGA 4L29B 5E9DB 3B3IB 3T0EA 3IFNL 2CMRL 2XZQH 1RU9L 1FVCA 2PR4H 2V9RA 4Z77A 4MJ6B 1WFNA 4QNPE 4ZNEE 5EA0L 5ALCH 3G6AA 3CXDH 5FM5M 1BVKB 1E4KA 1S8DB 1D6EA 2X4NB 2YK1H 3MYJA 3NACL 1F3RB 4NWTH 3B5TA 4Z7WB 2DQIH 3FQNB 1GOFA 4P4KD 3C6LB 1Q9KB 3GBML 1CN4A 4R2GB 2C3GA 4OZGB 3UDWA 5KS9B 3LEYH 5M94B 4CVZA 3OG4B 4H1LB 4NNYA 4X7TA 1AGBB 3HLAA 3CFCL 3DARA 1CG9A 4MCYA 3RZCB 1NBYB 4QHUB 3O2WL 4XXCC 5GSRA 5DHYB 4P46D 2J6EA 1SJVA 3BGMB 1BAFL 5EOTB 4Q6IC 2APFA 3DV6A 1VFUA 3IETA 3TA3D 1WFOA 1CQKA 2AXFA 4Q9RL 5HJ3A 3HNTL 5T3ZL 3TC9A 4W4OC 5DEGA 4JFDA 4CU6A 5KG9B 4NQEB 3MNWA 3CIQA 4M48H 5GQBA 1CD0A 4KH2A 5HYJA 1HDMB 4Z7VE 2HH0L 1EEZB 1JV5B 3TBYA 1BFSA 2WINB 4WHYH 4Z6AT 5T1KA 3SPVB 3I6GA 5E8PA 1KOAA 4FFYL 1ADQL 2DKUA 3RPKA 3PQYE 1IAOA 2AABL 3KYOA 4M7ZB 3F7RA 3MLZH 4K94H 1HSAA 1KCRH 1P4BL 1G84A 2KL6A 1IM3A 4P2QA 5HYSA 3GJFA 3Q5TA 1TJIH 1ES0A 4YUEH 1FC2D 2OJZL 2LTQC 1OPGL 4OGXH 3KPPA 4I0KA 4Y4FC 2VIRB 5CJXA 1VGEH 1JGLH 1GGIL 4KTDH 1B90A 2Y07H 4XVUD 3BZEA 1FNHA 4H0GA 4QXTA 4S2SB 1YZZA 5GGSY 3I2CL 5T1LB 4JM2D 1J5OL 4DVRL 3ME0A 3QDME 2FIKB 1CD8A 1RVFL 3IXAA 1OAUH 3BP4A 2EDOA 4G8GD 4NQXA 4ERSL 2BVOB 1T1YA 5DD1L 5JMOC 4YHOH 2AK4B 5FGCB 1FIGL 1MRFL 2WBJC 5BV7B 3VRIB 1N3NA 1YEFL 5C0BA 5FF6A 1JWMA 2D7MA 3GI9L 5C6PB 4JKKA 4LCUB 1U3YA 5EG6C 2P8LB 3VDAA 3EYFA 1KIQA 3KYMA 3EGSA 5F9OH 5D5MA 2K3TA 1INDL 2OZ4H 1OTSD 1MCLA 2B0SL 5C0CA 2DM7A 2G2RA 4OCSL 4IBLT 2EXYC 4DWHA 1JTTA 4JFEA 4JY6A 5I30H 1T0NA 2YPLE 1EIBA 2YBRA 4RMRA 4JDVB 1FGNH 4O5LL 2DQJH 4YHNA 3OKEB 1MFBL 4R6UA 5DLML 1WT5A 1D5MA 5IVXA 43C9B 4E0RB 5L8JB 1Z5LA 1Q9LB 1E4XH 2R0WL 5DJXB 5EBLA 1T20A 2ATPB 4PLNC 1UWGL 4KZEL 3U7WH 5IP4A 5A16B 3MLUL 1A22B 2J6EH 5FDWB 3D3VA 2X9YA 4PRID 4TYUA 5C08B 5MHSE 2RFXB 3QDGB 5I1HH 4U6YB 4G9DA 4DTGH 3LMJH 5DJYB 5DA4A 4L8BA 4LDLB 1U95B 4KK5D 3MRHA 3TZVA 4LPYA 3BRDA 5EN2A 1QLFA 4LAQL 2HFEB 5AUMA 2HT4C 4HK3N 3WN5A 3CXHK 2PW2B 3JV6B 4XX1E 5CD3A 4HPOL 5D7JA 3KPRE 1LO2L 1L7IH 4ODTL 1NFDE 1UQSA 5TF1H 1ZLUH 3RJDA 5BO1H 1IEHA 1YN7B 1LD9A 1DTUA 2DICA 5EUOA 2V2WA 4JO4L 5F3HB 2B1AH 4XC3H 5IGXH 2CIKA 3VH8G 3TVMA 2P8PB 4GKNB 5EOQL 3I6KB 1QVOA 3DVGA 4J1UA 3DBXA 4NRZB 2HRPL 2C7UA 5K59F 1P1ZA 2MQ3A 3C09B 3GMLB 5EBWA 1J1OL 2NX5E 4OJFH 2UY6A 1VFBA 1MJJA 3KPLB 4NHCH 3O6FA 3EUUA 3UZEA 2FL5A 3ULVE 5I8KH 2F74A 1KLUB 4PRHE 2NW3B 5L88H 1YECL 1GRWA 3OKMA 1BVLA 4BH7A 2BXZA 1LILA 1FGVL 4L4TA 3HE7D 2AV1B 4RGNE 5DVNA 3OPZH 4LEOA 1G6VK 4X7SL 4OZHE 3MUY1 2BOCB 3BIBX 3S96A 5K9OA 5I1DB 3OGCA 4RDQF 3EO9H 4XNQB 4AG4L 4X4ME 3LS4L 3GBLA 4AH2B 4JM4H 2IQ9L 3V2AR 3W2DL 4ONGH 1H3WM 3HA0A 1NGQH 3ES6B 2AJSH 3RWEB 3ARQA 4YHYB 1INEL 4YHZL 2ZPKL 3ZKMC 4PG2A 1FYTB 5EWIH 1IAII 5KANG 1M05A 1ZLVH 1CQYA 2HJKA 3W0WE 1A6AB 4JLRA 2XTJE 2X1XR 3BWAB 1UEYA 8FABB 3VU2A 2ARJQ 5DZLA 5IG7A 1FNGB 5BXFB 2B5IC 2QSCL 3JV0A 1AFVH 3H8NA 3N06B 3V0VA 4F33B 2FZ3B 3TJHC 4NN5C 4XP9H 4RFNC 5JORA 1RIHL 1C5CL 3CMGA 3QG6A 5J8OA 3ESVF 1OAQL 1X5JA 5L6YL 4C4KO 5C09A 4FHBD 3VXSA 4G7VL 5T33L 2AXHA 4C56B 1GIGL 3O8XC 1SJXA 3CC5B 4Y2DC 3P30L 4WI3A 1JMZA 2OL3L 3I50H 4XNYH 5F21B 2DIBA 4NQSA 4PJHE 3SDAD 4QF1B 5EBMB 4RWYL 4ZYKB 5C9KA 2XV6B 4EN3C 1DQDH 1IGFL 4QOKB 1D5ZA 2VXUL 1EJOL 3QWRD 2ICWA 4WFFE 4X9HA 5CEZL 2WANA 5I73C 3SKMB 5TDNB 3TN0B 3CK0H 4KTEL 1ND0B 4NYLA 2PXYC 3BDYL 3MBXH 3B6SA 3I6LD 1MIEH 2EE9A 5FA4B 2FEDD 1HE7A 3C5ZA 3FCTB 4FFWD 4JDTL 4L3EE 3F7QA 5SWZD 4Y5XB 3GSQA 3LKOA 2GCYB 3P3YA 1A7QL 1WFTA 2VXQL 3KPTA 4P2OD 5KSAD 2B20A 1BJ1J 3V6OE 2CDFA 2MPAH 1E4WL 4JFYB 1PVHA 1OTTC 5GGRA 1ZHBA 2ICEA 1JPGA 2R69H 3QQ4A 3ARTA 1I1AC 4KKAC 5IMKB 1A9EA 1LO5B 4PJEF 1JZ6A 3TWCH 1ETZB 4NKOA 2CJUL 3OXRA 1DVFB 5CS7A 3QUXD 5KSUB 1D9KB 5C0AD 2XY2A 4I2XE 1JRHL 3RGVA 5HGBA 1TJGH 2IFGA 5ISZE 3QCVH 1PJ9A 4NZTL 1VACA 1S9KC 1TZGL 4Z8FH 2HFTA 3WS6C 1FJ1A 1II4E 1YEEL 3QFDA 4PG9B 5DJDA 5GGVH 3SDXB 5FM4A 4YDLB 2Q76A 1TTFA 2XWBA 4J3VA 4EUPG 2JB6A 3CH8A 2O5YH 3TH2T 3MRMA 4U1MA 4M7JL 1G6RA 2A6JA 4Y1AD 1U93A 3MJGX 3IJSA 3MRNB 4BQCA 1FVDB 4WFEE 2F53B 5DUBB 3BDXA 3SGDI 1IZJA 3V52H 4S1SH 4D9QE 2OQJB 1CR9H 3VXUB 5IHUL 5E99L 3EYSH 1KCSL 4MJIB 3BIKB 4JDZB 1FZJB 1YEDA 4EI5B 2JIXB 1AHWA 4J12A 4QHLB 3RY6A 2PN5A 3EYOB 4R8WL 5ECJE 2BNRB 5INDB 3V5HA 4RISL 2F5AL 4YHKL 1N5YL 2IANA 2Z8RA 5JO5B 3L3DB 3NH7L 1FLTX 3ZHDA 3N1QC 3T3ME 2YSSA 4TUJA 3SJVE 4K8RH 2A74A 5ESVA 1XCQB 5DSCA 3V4UH 4NO3B 5DMKA 1JPTL 4JHWL 4WHDA 1U8LA 4GRLC 1P7KA 4NO0A 1ZOXA 2C1PB 4WDIB 4LHUG 4Y4HD 4JPIA 3WIHH 5CIPB 3R8QA 1R3IL 1UYWH 2HTKD 3MGAA 1WWCA 4IIQB 4C59B 4CN1A 4GG8B 4A6YB 1T03H 3ZE1E 1B0RA 3FQXB 4OZIA 3QUZC 3QCUH 4TNVF 3ULUC 3G5YB 4ODSH 5E8OB 3DRTA 4ZSOA 4TVPD 2YZ8A 3HNSL 1KB9K 4KK6C 1JF1B 8CGTA 2MCG1 2ILLA 5LWYL 2BVPA 1FH5H 3ZZ1A 3QNXA 2ZKHL 1HHIB 1XH3B 1ZEAH 3QWQB 4ACPA 1G9NC 2EH8L 4XMLH 3GB7A 1VPOH 5DRWB 4I1NB 2IBGA 2ADGA 5EOCH 2ADIB 1I85C 4POZD 3V7AG 1AKJA 4TQEH 3I85A 5LGHL 4BK5A 4X9BA 5TFSL 3BPCB 3LKNA 1RHHA 5JXED 1MEXH 1IBGH 4FZ8H 3MODH 4BH8A 5SX5K 1YQ2A 4HS6B 3ARFA 1J8HE 5BS0E 1I8LA 1A6ZB 4YHLL 3MA7B 3WNLA 3MV8E 4M3KB 3OB0K 4TPRH 1J0IA 1A0QL 3EJYC 2ESVE 5CKGA 2NY5H 2VXVL 3BZFB 2V7NB 1S9WB 5D2LE 4LASL 4AJ0A 3O9WB 3NIFE 1AY1H 5GZND 4XP4H 3LD8B 3MACL 1LDPL 3REVB 1S9XB 5GJSL 1W0WB 3IDYB 1HZHH 1HH9A 2L0DA 1WC7A 4X4YA 2VR9A 1TTUA 4FXGA 3TIEB 3OJDB 5C6WH 2C3VA 4PS4L 4X80L 1G6RH 3S37L 4GMSL 4M5YL 1UWXK 3ZKNC 1G9MH 3HRZB 1E27B 1J18A 4F9PC 3SGKA 3DSFH 4LSQH 2DD8L 3U82B 4G6FD 3BAEL 1I7TA 4Z5RB 5DD0H 4N9GB 2JJWA 4GLRI 2K1MA 3DX6B 4YBQD 1I8KB 4U6HB 1PLGL 1UZ6F 1SEBA 2NTSP 4JO1H 5I2IB 5FO7A 1ZANL 4JQXA 2C3HA 4UTAH 5FM8A 2VLME 3NPSB 5C92A 3RIAK 3SGJA 3W9DA 4PFEA 2X9WA 2XWTB 1HOCA 5JR1H 4BUHA 4M5ZH 5ICZB 3D2UA 3MRIB 3VGAB 2I24N 5ID0B 1ZLWH 3GM8A 1QYGL 3NZHH 1S7VA 5IMMA 3TZVC 4GW1B 3KYAA 1Q1JH 1M71A 5DTFA 4YXKH 1B0GB 1CK0H 4LARH 2D7PA 4XB8A 1A6TB 3MOAL 4MQ7B 1M6OA 3QPQC 4KHXH 4XNUL 1TPXB 4N0UE 2A83B 1ITCA 5J06A 1X9QA 4D8PA 4JQIH 1MFCH 3KDMB 3E0GA 4OCYL 4ENEC 5JW4N 2VQUA 3V9FA 2MHAA 4X9FA 1YPZA 4P99A 4NQCA 1W72L 3V4VH 3LPFA 1N2RA 4LQFL 3TBVA 4RIRA 4OBSA 1EBAA 4BSVA 4HX1A 1BP3B 2IFFL 2DWDB 4P23D 5GRUL 5DK3A 4K23L 3O6FC 2BZDA 5IQ7L 3GK8L 4LEXH 4PP1D 3QI9C 5E08L 3A67H 3BQUA 5F8QC 1VADB 4K3HA 5KS9E 4O02H 1CBVH 2GW5A 2VZUA 4OF8A 5JNYA 1XZ0B 5FB8B 3T0ED 2XKNA 1C16A 3KPMA 2Y06L 3O3DA 1EGJL 4FZEH 1RMFL 12E8L 4FQJH 3CVIL 2ZSWB 1ZLSL 1LE9A 4GW5A 1X4YA 2X4UB 4XNMB 1SBBA 1BEYH 1NC2A 2NLJB 3VFGH 4ZUSA 1NJ9A 5L2JB 3MOQA 1KIRB 1EBPA 1MCEA 2I5YL 4NKQB 1P6FA 3LHPL 5HGHB 3UJJL 4Q6IB 2BCKB 1SYSA 4YDJA 1T1WB 3TBWA 2RCSH 4JFFE 5IMLB 3QUKB 2BY3A 3QEQA 2MFNA 4A2MA 1ZSDA 2XKSA 3MJ6A 3B2UD 2IF7A 3OKKB 2LE9A 4KU1A 4BQBA 1F3DH 3INUH 5CEXA 3E3QC 4QRRA 1YMMA 3DI3B 3R4DA 4MNQE 4XCNB 3CFDA 1S7SB 1S7UB 3L3GA 3D0VA 5J1AA 2HA1A 3GI8L 4KDTA 3ULSA 5EU5B 1ONQA 4N90D 1IC4L 4P5TD 5E8NA 3UTOA 4LNVA 4JR9L 1NSNL 1IMHC 3P9LA 2R1YB 5DI8B 3CX5K 4N0FB 3HAEG 5AAWA 2ZNXA 4K3EH 4HDIB 3PWJA 1V3MA 3O4LB 1U41A 4PRDA 4PGCA 4TUOA 4RQQB 5JPNA 4ODXA 5T1KD 4ZD3H 3PGDB 3TJEH 4HK3J 2L4OA 2LTQB 1NGWA 3CLFH 4Y4FB 2MWCA 3P11L 3AS3A 3JUZA 4WEBH 4YPJA 1OARL 3F12B 1S7RA 4RAVA 4NKDB 4UT7L 4BZ2H 4IMKA 4IRZL 4P2QD 4Y19B 1FZOB 3CFKA 1KCKA 3IDGB 1FC1A 2E9BA 3EIFA 1NBQA 4PJAF 2X42A 2G75B 1KB5A 3ROOA 1MCDA 2EC9T 3PHOA 1FN4B 2GSIA 4MA8L 5IHZA 2LQRA 3FQWB 3BP7B 2NYYC 2VMFA 4KKLC 5EFIA 2CLRA 1NL0H 4XPFH 5DJ6A 3CU1A 3HMXL 3VCLA 2CUHA 2WBJB 3VFWB 3WFDH 4F3FB 2DTSA 4JANA 2CK0L 4JVUA 3THMH 4NGHL 2PYFA 4NC1E 2P5EA 4G5ZL 4MA3B 4Y89A 1OSPL 1NCUA 3OSKA 4O51A 5C0BD 4RAUA 5C0JA 5K9QG 3TO4A 4LVNB 4G8EB 4XBPA 1FPTL 3SKJH 3BZ4B 4WY7H 1DBAL 4ZAKC 4QGYA 5ANMB 1SJEA 5C0CD 5C7XL 3MUGA 4MQXD 3NFSH 3QFJE 3MLVL 1WWWX 3QXDA 4JFED 4XPBL 4L9LC 1G7PA 3P4MB 4NZRL 4WO4A 1T2JA 1T1ZB 3UCRA 2YC1A 3QRGH 3RY6C 1GHFL 5C0NC 3RWJA 3PV6B 2RQ8A 1YEJH 1BBDH 5FHBH 1PGRB 2P46B 1I9JL 3X12A 5FECA 1M7DB 1XMWA 1AGFA 1OGAE 2R1XA 2F54A 2B2XH 4HKXA 2C5DC 3HI1B 3KPSA 3KXFB 1AGCB 4KROD 4X4XA 5K59E 3D3VD 2VZSA 3NCCB 3CFEB 3WIIH 4XBGB 1LO4L 5ID1A 2V2TB 3E6HA 4YHPA 3FMGH 1RFDL 2YMXL 4AEIL 4I4WB 4GG6A 3K2UL 3JWDC 3WLBA 5D7JD 3D0LB 5HI3C 5D8JL 2VLRE 3MXWH 1W2KT 2A6IA 3MUJA 4PJCF 2GUOB 4M9PA 1BD2E 3IF1A 1ACYL 3TGXA 4HBCL 1RIUH 3PJSB 3STZA 1FAKT 4WUUB 3UPCA 4NM8L 1SVCP 4DGVL 3TVMD 5CJQH 1RK0B 1T1XB 1I3GL 4X6DA 3OR6B 5D2NE 1CF8L 2P5WB 3QP3A 2B8OT 3HG1E 3WXWL 1B2WL 4ZO8A 1JHTA 4NO5A 3AC0A 3DOSA 3HPLA 4M1CC 3EOAA 3PGFL 5TF0A 4NQDA 1T2QL 3HZMA 4HEME 1I8LC 4M00A 5B22A 3LKSA 3S37X 5FYJU 2QSTA 4LOUC 5EU6B 4L4TD 1BHGA 4U6VH 3VFVA 1GZPB 1U8IA 1G1YA 1DN2A 2NR6D 3QIWD 4ORZC 5IOPA 3KAAA 5KAQF 4HJGB 5EUKB 1JCKA 2CH8A 1DN0B 4NQTA 3BRGC 1RZKH 1CXIA 3IRZA 1FNLA 4XVJL 1SY6L 3QULA 2OJEB 4PJXB 3BI9X 3RJQB 3BRFA 2B5IB 1VFAA 3CGTA 2X4TB 4CN4A 4X6CB 4NN5B 4YLQT 4RFNB 4K8RD 2OYPA 5CSBA 3B9EA 1I1CA 4V2CB 3OHXB 3IJHA 3EFDL 3C6SB 4G6AC 4R4FL 5JW4Q 2Y36H 3NAAL 3OG6B 4MHHG 4YPGB 1KXQE 5MEOA 2G9HA 5T1MA 4QT5B 2F58H 1ZHKB 4OGAD 3H42L 3Q1SL 3O8XB 1QNZH 1MCSA 4JAMA 1RZJC 4Y2DB 3QH3B 2OTWB 1FRGH 3MLYH 5DJ0A 2DBLH 5B39B 3VWKA 3RNQA 5CJBA 5CJOH 2VDQL 4EN3B 3T8XA 5BV7L 2E6QA 5CGYD 5C09D 5F6IC 1EMTL 3VXSD 4GOSA 4JQXC 3HCVA 1U91B 4PJEE 4D0DA 5I73B 2XICA 1I3VA 4LIQH 2PXYB 2GFBB 2VLLA 4P4RB 5ACZB 1P7QA 4LLYB 5CGTA 3ARVA 4UILH 3L5XL 5IF0A 2VL4A 1R5VB 1QO3B 3ARDC 2FWOB 3FO2B 5E56A 5D71H 3FT4B 3GMPB 5DRXB 2B1HH 4OB5L 1I1AB 1PKQA 2IG2H 3C5ZD 3S4SB 5DQJA 4JFOB 1JNLH 3RPIB 4KJPD 1JPSH 5LG1A 4GMTL 1K2DB 3VXNA 3I3BA 3JVGA 4WI9A 3BUYB 5FO8A 4HFUH 3NFPA 4JRYB 4E41B 3QZWB 5JHDA 3U4EA 1LP9B 2FYYA 3OR7A 5I0DA 3GSNH 2NY7H 4HLZH 3JUYA 5DT1H 4XHQA 3F58H 4LSTL 5HHOB 1CFNA 1UEMA 3EOTL 3RGVD 4BM7A 5HPOA 4MNGB 4JFZL 4PB9L 3MRPA 1FVCB 2DQTL 4NKMB 3FRUB 3WHE0 4XP5L 3MYJB 3MLRH 3N9GL 3M17B 2Q8AL 1AJ7L 4S1QL 1L9MA 4U6TA 5BZWA 1BFTA 3DURA 5A2KH 3DO7A 2Z92B 3FAWA 3MRGB 4YK4C 2GJZA 2J5LC 4PY7A 4CVZB 4M3JA 3MZTA 3RWHB 4LLQA 1GGTA 4LKXA 1FVEA 1NCBH 3OJ2C 5KZCB 1CG9B 5ITBH 1A14H 2P47B 5ILTH 3MRJA 4K9EC 4P2RA 3P9MB 3MTRA 4ODWB 3QHFH 4KJYB 2D7QA 3RVWC 2HVKA 1NMAH 1R0AL 4K3JL 4OF5A 4LKCA 2GJJA 2AXFB 1IQWL 4XCEA 1HILA 3U83A 4GRLB 1AH1A 3GDBA 4HIHA 1NGZA 5I1KH 2JLLA 5DEGB 4JFDB 2VN4A 1ADQA 3G6DH 1T7YA 2VYRE 2DLFH 3H3PL 5HYJB 4OM0L 3D39B 3HFMH 1OM3L 2YUZA 1N26A 1KG0B 3QUZB 5ICYB 2X4RA 3UZVB 1A1OB 3PDOB 3WLWC 4GRMA 4KMTL 3SCMA 1KT2B 3MCKB 1AQDB 3TH4T 3I84A 1D5XB 3FFCE 3B9DA 4HXBL 1UACL 4NZJA 2R1WA 3BP5A 4V1DA 4ZFOB 5J7CC 3QSKB 3GJFB 5ELIA 4HK0A 2B4CL 3BP6B 5ERWA 3BN9C 4G3YL 4XWGL 3DMMA 3HI5L 2EKSB 4MJ5A 2P8MA 4XHJC 2ZUYA 3HB3C 2EDQA 3LOWA 3MLSL 4P9HH 5J13C 4QXUL 5F7EH 4S0SD 3O3EB 3O4OC 3FB5A 4QTHB 3TNNA 3SKNA 1IQDB 1AKJD 3LKPB 1J0ZA 1DE4B 2R0ZH 3BP4B 1GZQA 1T1YB 3BYTA 4P2CG 1IC5H 4HFWA 4XX1G 2E7LA 2LV4A 4Y88A 4NSKB 1RU9H 3ARFD 1H9VA 1N3NB 1TCRA 3MRRB 5FV1L 4P59L 2WV3A 4DN3H 2JB5H 3VXTA 5FYJH 5EA0H 2YN5A 3OZ9L 5ESQA 4ZTPL 3NACH 1UZ6E 4EIGB 3UTQB 5B8CA 4LLAA 4KKBD 3GBMH 4UDUA 1EFQA 5DJZB 1PSKL 1T0NB 3G5XA 5JDSA 2ZNWA 3CFCH 4J4PC 4YHNB 1FLRL 3CSYB 3O2WH 5E1AB 5EU7C 4DFIA 2XFXB 2QQKL 1ZVHA 2Z31C 5CBEB 2QKIA 5IVXB 3QQ3A 4KQ3L 2CLZB 4TN9A 3BE1H 3KLHD 2JTDA 2FECL 3MUZ1 5EORL 5EBLB 2HKFL 4DVBA 4Q9RH 3HNTH 4MDJB 5T3ZH 1YY8B 2COQA 2WP3O 2WBKA 1BBJB 5C0DA 4FFZH 4YC2C 1OD9A 4PJFF 5JQ6H 1EXUA 2QADC 4G9DB 1A7RL 1S7TA 2L7JA 2HH0H 3CSGA 3TZVB 3MV9E 4BA8A 2F19H 1QLFB 1KFAL 1PQZA 3WJJA 4OF0A 4FFYH 3S3SA 3F7YB 4QHNB 1ADQH 1L4IA 3CVHB 1DANT 1KIPA 1M7IA 2AABH 4KHTL 3GUTB 3DGCR 3D2UD 2NNAA 4AM0A 1P4BH 4PTTB 3VG0L 2KQNA 3RL1B 1A5FL 3TT3L 1TVDA 2OI9C 5EUOB 2FATL 2OJZH 3ARRA 5F88A 3ARWA 1OPGH 5MENE 1T5XB 2HKHL 5D7IF 3U30C 1GGIH 2EIEA 4JCMA 1XF2A 1DBKL 1VDGA 2AJYL 1MJ7L 4JKPH 3L95A 5EBWB 3RWDB 3I2CH 1TCMA 1AGDA 1VFBB 1CE6A 1MJJB 2GT9A 4MGXA 1J5OH 5D1ZA 4DVRH 3O6FB 4NQCD 4K2UL 1IAIL 2VLJE 3QI9B 1PW3A 4ERSH 2LU7A 5DD1H 3G6JF 5GGSB 3X3GL 1T7VA 4CDGC 1IM9A 4LCWD 3IDXL 1FIGH 4UNUA 3RKDC 3GI9H 1KEML 2CGRL 2R2EB 4LPVA 3D69B 1C08A 4N8CL 4AIXA 2FSEA 5JOFA 4GBXC 4F2MA 4OFVA 3V0WL 1NCAL 5C71A 3SY0B 2CUIA 3BQUD 3KNBB 4JZOB 1INDH 1AD9A 2B0SH 2EIDA 3PQYA 5IV2A 4HQQH 1BM3L 5C6TL 3L3KB 1JGUL 2GEEA 2F8VA 1CLCA 3LQAL 5DD3L 1RJZA 4LPCA 1MI5A 1FSKC 3G04B 2PTTA 3ZSSA 4O5LH 3OB0H 2X1WL 4OI9A 1DCLA 5J12C 4HKJB 1MFBH 3EDEA 2AEQL 5DLMH 4PJ8C 1G7MB 4KJQD 1NC2D 2LVCA 5I19L 4Y2OA 5HVHC 3BJ91 2R0WH 3CSBA 2BERA 1OP5H 2OL3A 4U4BA 3LEXB 4FP8H 3VXME 1UWGH 2DQHH 1XF4B 4KZEH 3QG6B 1UB6B 3QEQD 3MLUH 2VRAA 4WW2A 1YNKH 2PW1A 4ZFGL 4YEEA 1UWXH 1Y6KR 3VXRE 4QRRD 1YMMD 2QQLH 3LIZL 1OL0A 4PJAE 4LAQH 1UGNA 1MCFA 4U0RC 1R5WA 1NEZG 2IPTH 2Q8BL 2NPLX 4NO2B 4HPOH 3VRJA 1QFWI 3QIUA 1LO2H 4ODTH 5I8OL 2DRUA 4OZ4B 3FN3A 5CUSL 4NYLB 3RVUD 1A6PA 3EHBC 3MPCA 1DDHA 1WCQA 4JO4H 3H0TA 5BJTB 2YPLA 5I1AA 4KI5F 3GBNL 3TIDB 1NAMB 5D96C 5J89A 2P48B 1DQLL 5EOQH 2CDFB 3VD3A 3DVNA 2VTFA 3G5VA 1A3LH 4NC2B 1ZHBB 3HZVB 1IEAA 2HRPH 4U1KA 3SDCC 1U8KB 1INQA 1CI5A 5KN5A 1CICA 1J1OH 4QYOB 1QFUL 1RUKL 3PDGA 2R4SL 1LO3L 2Q20A 1U8HB 4W81A 3IFLH 4HIXL 4JFPA 4P5KA 5A3ID 3C08L 4M1DL 4J3SA 4O00A 2ARJB 5DJ2A 4ODHH 4TOYL 3JVGC 1KLGB 3T3PF 1ZGLA 5AG9A 3GHEL 3QXAB 4PRNA 2YPVL 3LB6D 1U8NB 5DMIL 3EO0B 2JF1A 5ANME 1RZGA 3DJ9A 2XG4A 4EKXA 4L8SA 4KGLA 2VDML 4AG4H 4UV7H 2Z35B 2NY0D 2J8UF 3P0VL 2IQ9H 4ZAKB 4U1MB 3W2DH 2VDLL 1REIA 5HHNB 4PD4K 2P5ED 2DMBA 1FORL 2QBWA 3NCJL 3SE9L 3TO4D 1INEH 2FLRT 4L9LB 4YHZH 2ZPKH 2FJFA 1ZT4B 4PJ5A 3U2SB 1ZA3B 2BJML 3GSWB 3P0GB 2WWMD 2FJGA 1KCUL 2NY6C 3R06B 4UT6L 4JVWA 3U9UB 2A73B 5MERA 1U6AL 3V5HB 2QSCH 2IANB 4ZOEA 2NX5A 3KXFE 1A2YB 4YDVB 3QEHA 3RBSA 3QG7L 3AREC 5IBLD 1RIHH 3KR3L 1C5CH 2A74B 4KKCD 4K94C 5EZJA 4WO4D 5ESVB 1OAQH 3X3FH 1FNSL 2CO7B 5I75C 3EFFB 4G7VH 3ZTNL 2X89A 4XCCL 1KACB 4DK3A 4PJCE 4EDWH 5C70A 2I07A 1F6AA 1C12B 1ZHLA 5DC0A 2QADD 3LRGA 2ZUTA 3RWGA 2OL3H 3NZ8A 4NO0B 1R3KA 2DQDL 2WWKT 5IB2A 1IGFH 1J1PH 2VXUH 3KPSD 2FO1A 1QA9B 1KPRB 4HJ0C 5CEZH 4YDIL 2H2SC 3WFHB 3BDYH 1FZKA 2JE8A 2UV3A 3RVXD 4GRWH 2Q86A 4KRMB 2VSDA 4WUUE 3DRTB 5BVJA 2D9QB 4JDTH 1JZ4A 2V5RA 5GRVK 3Q6FB 4M4PA 1ORQA 4F8QA 3SCMC 1ED3A 1IGCH 1A7QH 3OTTA 1E4WH 4AT6A 1IAIM 3W0WA 2P5WE 3S34L 4MX7B 5HPMB 3D25B 4OIIL 3VH8B 3TYFB 3DMMC 2QSVA 4LCCA 2Y72A 3K3QA 4APQD 3LKNB 2WNGA 1RHHB 3FO1A 3MLWL 4LGPB 3O2DH 1A6VL 2VQ1A 3TPKA 1KTLB 1U9KA 4HIIB 3ZE2F 5L8KB 1N5AB 4GS7C 2OXHA 5HXMA 3V6FB 1TNMA 4IHOA 3QDJE 1TZGH 4Z9KB 3QUYA 1Q0YL 1YEEH 1GSMA 4FQXA 4OV5B 2YD5A 2NW2B 3P4OB 2BNUA 4OTXL 4NQDD 1CLYL 4L3AA 4M7JH 1DUZA 3UBXG 4WWKA 1GAFL 4LSRL 5FGRA 1AP2A 4LK4A 2VAJA 4X6CE 4NQVB 3RHWF 4KRPD 4L3EA 4GAJL 4LLMB 5H35A 2LVEA 3L3OA 5IHUH 5DS8B 1NGPL 1HH9B 1T83A 5B8CC 5E99H 1EPFA 3QO1B 2D03H 2E9IA 4FXGB 2DJ4A 4ZDHA 5A2FA 2ZOKB 3TBTA 2VOTA 4N0YL 5TPWH 1YMHA 1N5YH 4LSSL 1DBJH 3NH7H 1FE8H 4HCRL 4HKBB 3TO2A 3VFSB 2R29L 5KSBA 2KH2B 5CWSA 1U3HA 2ICWJ 5KSVA 3BHBA 4IOIA 4PRPE 1T21A 5TDPB 1TIUA 2J4WL 3IRPX 2EXWC 4I2XA 5FYLE 1JPTH 1NBZA 5ISZA 1OF2A 3MO1A 4YHML 5EOCJ 4EVNA 5F6IB 1UJ3C 3LSOA 5BRZB 4X6EB 2DI8A 3L3HA 4PJDF 4XGZB 4XT1C 1CU4L 3IFPA 1H8OA 3VWKD 1X5HA 2XQYK 4YFDB 2OTUA 3D2UB 1S7VB 1PG7X 3ARDB 3UZQA 3N1PC 4IS6A 2X44D 2UYLB 2VSCA 4QWWD 4Y16C 2YXFA 3VMPA 1JN6A 3HNSH 1UC6A 1N0LA 4XZUA 1P7QD 1W72A 1CD1A 3W39A 3O6MH 4G7YL 2UWEA 1DQQA 3LCYA 1AE6L 3IAPA 3FN0L 2ZKHH 1HHKB 4TNVK 1L7TL 3WHE1 2BVTA 4JM2F 5F7DB 4I3RH 5EU3A 5J57B 5IESL 1RIVH 2BSSB 3S6CA 5EO0A 3STBA 1YPZB 1SEQL 3RWIA 4MB5A 5LGHH 5HHOE 3SJVA 1CLOL 2AKRA 3TBVB 4MNGE 2E5EA 4FTVA 4RIRB 3BDBA 5IJVB 1MVUB 4FMFA 3IDIA 5L2KE 5C0IA 2OSLB 5AG8A 5EZOL 4N9OB 5D1ZC 3PIQA 1EGJA 5JHDD 2H41A 3T77A 1VGKB 4WUKL 5FYJD 5IB5B 3SQBA 5JUEH 4ODUA 2VXVH 3OAZK 1R24A 4PP2A 4LASH 5FV2A 5BOPA 1SMAA 3ZL4L 1JTOA 2XKNB 3A6CL 3MACH 4YK4B 1LDPH 1JNHB 1KJMB 1F3JB 5CHNA 1RULL 1UM5H 5FA3B 5A2LH 5GJSH 4ZOBA 1NLDL 2FHBA 3AGVA 4YX2L 4EUPB 2DF3A 4Y8AA 1YA5A 1NCWH 3MCLH 2IPUK 1EH9A 4K7FB 4QRTA 4ZUSB 4Z78A 2ZUSA 1NJ9B 4PS4H 4QRPE 4X80H 5LGJA 3IDJA 4M5YH 3U46B 1U36A 4J8RA 4JO2L 4OFIA 5IIEB 1SYSB 2NXZC 1XCTB 2CIIB 5J1TC 2E9WA 2DD8H 4FG6C 1CFBA 5T3ZD 3MBEA 1GPOL 3D39E 4KXZI 3V0AC 2W65A 4P2RD 1PLGH 5IEHA 4JFQB 5CEXB 4MD0A 4D0CB 1IT9H 2GJ6E 5CP3A 1PAMA 1ZANH 4Z7UF 2AJ3A 3L3GB 5BS0A 5IB4A 5KW9L 4RMSA 3HUJB 5FUOL 3MGTA 4FQ1H 3U79A 3V4PL 3T4AA 1U58B 2ESVA 4YNYA 4WFGE 1KC5L 3KLAA 1QYGH 5D2LA 1IJ9A 3GO1H 4PRAA 1CWVA 4IDJL 1BQHG 4PGCB 4LHUB 1HWGB 5JPNB 5JW5A 4BK4A 1T66C 5DA0B 4ZXBA 2CLVA 1J9CT 3DPBA 2WW8A 3MOAH 2HTLC 5D1QA 4I0PC 5I1GL 3NABL 4U1JA 2AXGA 3ZYZA 2HJLB 3X13B 3GNMH 4UB0L 4OCYH 4V1DD 4QHMB 5J13B 4UT9H 1MCWW 4KRNA 2P1YA 4TRPL 3O4OB 5H37G 1R3HA 3SE4A 2IH1B 4UZGA 1KB5B 3DMMD 4LQFH 3O11A 2GSIB 1OAXL 4HWEL 4XBEL 3DX7A 4UOJA 1J05A 5E6IA 1J87A 1NDMA 1NDGA 1EFXA 2IFFH 1ZT1B 3E6FA 5CJ8A 4K23H 5IQ7H 2DAVA 4XPAH 3GK8H 5E00B 1MHCA 1KCVL 4LCYB 1PEWA 3CDCA 1YJDH 3L7EB 3HHRB 4D0BA 2HLAB 4I77L 1OAYH 3ALXA 1JFQL 1F3DJ 1YN6A 3BKYL 4CDHA 4X99B 3PWLA 4QGTA 2D7TH 2Y06H 1EGJH 5DUMH 2ADJB 5E4EC 12E8H 1WSST 2ZOLA 3CVIH 1ZLSH 5TDOB 4XNXL 4PJFE 3WYRA 4RDQG 4BFIB 4RNRB 4N0UA 1YNLL 2GYSA 5E2VL 2Z31B 5HD8D 3MRBA 1J12A 5FYLH 1UT9A 3UJJH 5F9WC 3RTQA 4ZFFB 4JY5L 3NVQA 3NCYP 1ZHNA 2MSPA 1R5IA 1A1MA 3T2OA 4L29A 4HZAA 2YC1B 2Y6SD 3B3IA 1MY5A 4ZS6D 4MYWB 4KGJA 4YC2B 1K5NB 1GGUA 3RWJB 4OLWL 4ELMB 1E6OH 4MJ6A 4X7EC 1BVKA 2V5YA 4AEHL 1S8DA 2X4NA 1EX0A 2F15A 3X14B 1IC4H 1AGFB 3ULVC 5D7IE 4KI1A 2R1XB 2F54B 4Z7WA 3C6LA 1E6JL 1Q9KA 4JR9H 1NSNH 4X4XB 4OZGA 5KS9A 2WLYA 2JKXA 2NY2B 4H1LA 4RGNC 3GMOB 4URTB 5ID1B 1HI6B 1YDPA 4KZDL 2G5BB 1IFHL 3NCBB 2A9ML 4IRJC 3JXAA 3RZCA 4QHUA 2YR3A 1MVFA 5E5MA 1T22B 5DQDL 2OI9B 3G6JE 2LABA 3BGMA 4NWUL 5EOTA 3UJTL 5HGGS 3P11H 1HHGA 3U30B 4KJWD 4UT7H 4HUWB 4IRZH 1T2XA 4JRWA 5KG9A 5F7FA 1QSFB 4NQEA 4XRCB 3DIFB 4MA8H 2R9HD 2XTJC 5K9JL 1KJ2B 1Z3GL 3OAUL 5CBAB 2WBWB 5IUSA 4D9LL 5B21A 3SPVA 1EEYB 3HMXH 3WNKA 1CVRA 1X5ZA 4OCLC 3N0PB 3WIFB 5C1MB 3J7HA 5IW3A 3MFFB 3B8YA 5C2UB 2V17H 1AC6A 3AU1B 4GBXB 4HMEA 3HPLB 5IB1A 5I74C 1DLFL 2CK0H 3QWOB 4NGHH 1G9MC 2YKLH 3ULUL 3QUYC 4IMLB 1OSPH 2FX9L 1MRCL 1PY4A 1SY6A 1TMCB 2QHLA 2QQNH 2X4SB 4C57C 2HT2C 1X4XA 4OZFB 1FSKB 1FPTH 1CD9B 1DBAH 5J12B 1JYNA 4ZFOL 3P4NB 4S2SA 5C7XH 1XIWC 1W0YT 3E3QE 4J3WA 4WWKC 3WJLC 3PQYD 3NFNB 5ALBH 1KN4L 3BPNC 4PJ8B 1QKZH 3C2AL 3MRLA 2C4FU 3MLVH 3X11B 5T1LA 3LN5A 3SO5A 4XPBH 2FIKA 5HVHB 3H6JA 3KLDA 1MI5D 4CRPA 2BVOA 4TSBL 3V6OC 2AK4A 1CT8A 3T0DA 5J6GB 2XIDA 3FHQA 3VRIA 3IJHB 5T3XL 4LCUA 3T0AA 5MEOB 1FCGA 1I9JH 4KI5E 1I8IA 5DEZA 3FOMA 4IM8A 5D7LE 5HHVH 3RNQB 2CR3A 3PWNB 1P4LB 1NFIB 4U0RB 5J56B 3VDCA 2DQUL 3LY6A 1A02N 5CEZD 2BSED 3PWPB 2W0KA 1R3JB 4FFVC 4JDVA 1RUPL 3U0TA 1N0XL 1WTLA 3OKEA 2R4RL 1RFDH 1NANI 2APWA 2Z91A 3T3PE 4AEIH 3T2PA 2Y5TB 3HAEB 3OWEA 2D9CA 5D96B 43C9A 4E0RA 1T7ZA 3K2UH 2MMXA 4H1LH 1Q9LA 3ZDZF 5DJXA 2ATPA 3QIUD 1QRNB 1U8OB 1YY9D 5D8JH 3QFJA 1EZVX 1Y6NR 3DROB 4NCC2 4OLYL 5SX4H 3SDCB 3RAJL 1RI8A 2MQ0A 1F11B 3BT2L 3EDKA 2EEDA 1ACYH 4HBCH 5HYEA 5DQJB 2YPLD 3UYPA 1TETH 5C08A 5FDWA 2C1OB 3ZTJG 4NM8H 1FL3B 3QDGA 4DGVH 2J8UE 4U6YA 5IFJB 3FZUD 5DJYA 4F7PB 2NY3D 1U95A 2WIMA 1I3GH 1MLCB 4X7CC 3RA7H 2HFEA 5FO8B 1WWAX 4X8XA 1CF8H 1CICD 2Y4SA 2PW2A 3JV6A 3IS1X 4U1HB 2OCFD 1LWRA 3H9YA 2KUTA 4E5XA 1KGCE 3J8F7 1YN7A 4M62L 1ITBB 4RBPH 4AENB 1U8PB 5F3HA 1KENL 4JCLA 1GC1H 4X4ZA 2UUDK 2P8PA 3CVHL 3EKCA 4GKNA 3GZKA 3QIBA 4NRZA 2NY4C 1JL8A 3MV7B 3F7VB 4LP4A 1XAUA 1JF5A 3GMLA 1CXFA 2APBA 4NUGH 5DYOB 3DO7B 3MR9A 4XVSH 4XVJH 2GJZB 2NY6B 4JRXE 2VLRA 3GIVB 2VABB 4LSVH 5I1CL 1KLUA 5KVDL 5CZKA 2NW3A 3P0YL 2XZAH 1JGVL 1G7QB 5I15H 3AREB 4PJ5D 4Q9BA 4U0QB 3EFDH 4KKNA 4R4FH 5B3NA 2AV1A 32C2B 4K07A 2CO6B 2VITA 5I75B 4QXGH 3LQMA 4Z18A 2BOCA 1JGEA 3D1MC 2AQ2A 5I1DA 1A3RL 2NX5D 4MZ2A 5EPMA 1HILB 3C5JB 4XNQA 5ETUB 4HIHB 43CAA 1NGZB 1QPPA 4AH2A 1Q9OB 4RA0C 1BREA 2XN9E 4H25B 2VDQH 4WJ5B 5BV7H 4B5EA 1LEKB 4RCAA 5GGTL 1S7XB 5DK0B 3VJ6B 1EMTH 2X89D 1HK6A 3ES6A 3RWEA 4KK9D 4AQOA 3D85D 4XI5C 1HYSC 1A1NB 1GXEA 1F8TL 4NFDA 4P0DA 1A6AA 3C9NB 2FRGP 3ZE2E 3NTCH 4WTXA 5HHXL 3BWAA 3SCMB 8FABA 4D94A 4F37F 2ZZUT 5I1LA 1FNGA 5BXFA 2H1PL 3P2TA 4PJ7B 1N7ML 1MFNA 2FZ3A 1WCBA 4OB5H 4LHQB 2Q7NA 1NCCL 4ZXBC 1FDLL 4P3CL 1RUMH 5D1QC 2D4DA 3DMMB 5D7KE 1QRKA 4MJ5B 1EO7A 5F1KC 4OLEA 4C56A 4GMTH 3CC5A 4AIOA 3W0WD 5HSFA 3OAYK 4GS7B 4OUUB 4QF1A 5EBMA 4L1HA 4ZYKA 1JHLH 4QXWA 4QOKA 5F96L 2ZG2A 4WIQA 4WI7A 3TNNB 2AW2A 5LBSL 2H32B 2J88L 1D6VL 1CDIA 3REWB 5E6IC 1GZQB 4I13B 4W70A 3SKMA 5TDNA 1P4IH 4MS8D 3TN0A 5I0ZA 1ND0A 4LSTH 1EHLL 2AEPH 4HFWB 4GKSA 5BW7A 4JFZH 3FCTA 4PB9H 4FQQB 4MDIB 2DQTH 4Y5XA 1KEGL 5JOPD 2FHCA 3AFLA 4FQXD 4JFYA 4PTUB 3N9GH 3ECBB 1OTUD 2Q8AH 1AJ7H 4S1QH 4FA8A 5IMKA 1IKNA 1LO5A 4ZG1A 1J86A 2YWZA 4WWKD 2AJZB 4JKLA 1ETZA 3MLTA 2D3VA 3JWOC 3TNMA 4PJDE 1NAML 1F6LL 5KSUA 1N6QL 1W8NA 1P9MA 2EO1A 3QT2A 2FX7H 1D9KA 2E7MA 3G5XB 4L3ED 4K7PX 2DQFB 5I71C 5C07D 3U48A 5BRZE 2BSTB 2VISA 5AZEL 3VMOA 1R0AH 4K3JH 2AEIT 3SDXA 1M1SA 4W6WB 4DVBB 1IQWH 1UJ3B 3ALWA 35C8L 3DVIA 5FDYA 4BSJA 1U3HD 4RAHA 1F6FB 2X09A 5IB3A 2DQCL 1EXUB 3H3PH 1FVDA 2F53A 4ODVL 1I4FA 1VB9A 4OM0H 4TUKL 5DUBA 4G8GE 4U3HA 5GZOD 4UIMB 3BO8B 3NA9L 4MJIA 1T4KB 4Y16B 3BIKA 4JDZA 1FZJA 5J9PB 4EI5A 2PF6A 2JIXA 4ZODA 1VEPA 4QHLA 4KMTH 4OM1L 2YD4A 2BNRA 3Q6GH 2WK2A 1UACH 2WUBL 5JO5A 3L3DA 2DLTA 1ZS8B 2WQ8A 5DMGD 4IOSD 4O58L 5E2JA 2IBZX 5IROA 4J2XA 2B4CH 1BF8A 1OCWL 4G3YH 4XWGH 1DUYB 3OKDB 3HI5H 4PJGB 5CD5D 3BISA 3DXAD 5E8EB 1OP3K 2EDRA 4TTDC 2WSKA 4NO3A 3GMNB 3MLSH 5GJTL 3E1F1 5E2WH 2R0LL 2O61B 1A7BA 4QXUH 4FQLL 1AO7D 4WDIA 2SEBB 5FO9A 1QFPA 3MGOB 1MREL 5CIPA 3NOIA 4BFEA 5D1ZB 3B9AA 4IIQA 3QR2A 4GG8A 4G42B 3SJVD 3W5NA 3FQXA 4FTVD 4RWHA 2RJMA 1IM9B 5E8OA 3W9EB 3TPUB 4Z7VB 3OKYA 1DP0A 5D5MF 3H9ZA 4QO1A 2ITDA 1E4JA 3OZ9H 4ZTPH 1HHIA 1XH3A 3AXLB 3UMTA 3JWDL 3WUZA 1HN1A 2AJUL 4LF3A 4Z7UE 7CGTA 4M7LT 5DRWA 2ADIA 3CPLA 3KHOA 4M43L 1RJZB 1PSKH 1P53A 3BPCA 3HZKB 5D7SL 2ICWI 2NXZB 1FLRH 1SJHB 5EULV 2BMKB 2DWEB 1DBBL 1IEBA 1VA9A 4HS6A 3H9SD 2QQKH 1NBVH 4C83B 3MA7A 1M4KA 1NFKA 1AGEB 3FQRB 5EORH 3FFDB 4XAWL 2HKFH 1HHJB 3MSPA 2DN7A 2H6PB 3T65B 3F8UB 2KBGA 2VDNL 3BZFA 3QDMB 2V7NA 1S9WA 2QJDA 1EA9C 3MBED 3O9WA 1J0HA 3I3EA 4POUB 3GSOB 1DQML 1A7RH 1Y0LB 2R2BB 4WW1B 3REVA 1GVIA 3U6RA 3EYVA 1S9XA 4OLXH 5CINH 4Q97A 5BS0D 1KFAH 3UPAA 1T04A 4XI5D 1ZMYA 3S36X 2MKWA 1EAJA 2I9LB 3TIEA 3OJDA 1R5WB 1KJ3H 2ZCKL 4KHTH 4C4KT 4LPTA 2ESVD 2G60L 3QNZA 4I0PB 2Q6WB 3RVTC 3WNNA 3HRZA 1BJMA 2QLVB 1E27A 3EJZD 3QQNA 3VG0H 1UKTA 4UIKH 1A5FH 3TT3H 4Z5RA 2FATH 2PO6A 5GS2H 3S35X 4N5UA 3DX6A 1MCOL 3HE6A 1I8KA 4U6HA 4KUZH 4LDOB 5IBUG 3VWJC 2QSQA 4NN6C 4WHCA 3DVNB 3CFJB 5GHWL 1IEAB 3P77B 4MXQD 1O5DT 5EIQA 2X7LA 1MJ7H 2ZCHH 1RZJL 5IW1B 1UM4L 4HUUB 1FFPB 3QHTC 4P5KB 2E8YA 4K2UH 5ICZA 3MRIA 4QEGA 5ID0A 1A7PL 1J8KA 4GAGH 2W0FB 3V95A 1G0XA 3X3GH 3L5HA 4XPGH 4JPWH 4NBYB 2H2PD 3IDXH 3LDBC 1ZGLB 3I9GL 1EFXD 1B0GA 1KEMH 2CGRH 4N5EC 4QCIA 5CIPH 4OD2B 1A6TA 3MV9A 1XEDA 4XPTL 3S88L 5F7YC 5TH2A 2OR8A 3DRQA 1GGYA 3ZLQC 4L4VD 1J0YA 1NCAH 1RZGB 4XPHL 2EEAA 5E4EB 2A83A 4A6YH 5EU7E 2OLDA 3UTZB 4R96B 3KDMA 4ETYA 1BM3H 5C6TH 4PBWD 1MCCA 5DJCB 3DUUA 3KPRB 3AMKA 4ETQB 1NFDB 3LQAH 5DD3H 5J4MA 1QFHA 1FFNB 5CLTA 3QA3B