1NCBL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL01
1FO0B 1VACA 3VJ6A 2MKWA 4OSUH 4CGTA 2ZNWA 5HGHB 1PX4A 1I1AC 4O2CA 1RY7B 4R7DB 4LGRB 3CH1A 3PWPB 2FATH 4FTVA 1HXMA 1U3HB 1GGUA 5HYFA 3L3KA 4AMKH 1SMAA 1XIWD 3MPCA 4AH2A 3QG7L 1U41A 1NBQA 2DIBA 2X1OA 3S34H 3QEQB 3GMRA 1OLLA 5F7UA 3SDCD 3HG1E 3M1BB 1SJHB 2SEBA 2VDPL 1Y6KR 1WGOA 3CC5A 4D0BB 4EDXB 4NPYB 1NCUA 2EXYD 4RFOH 3VXPA 2WSKA 2RIKA 5E6IA 3F5WB 3LN9A 1FN4B 5IEKA 2GEEA 2DB8A 2UYLA 2V9RA 3RHWK 4AEIL 1HDMA 2HT4C 2K7PA 5MEQB 3VE0A 2WBWB 3PWNA 4FQIH 3DUUA 1DQML 2IMMA 3IU3B 5JXAL 1ZXQA 3MV8E 1FJ1A 1PLGH 1BWWA 5DJZB 2BNQE 2WLZA 4X5WA 3BZ4A 3P30L 1NJ9B 2GJJA 4PJIB 5I8OL 5E00B 1CIUA 1OGAE 5EU5A 1IGJB 3RFZC 5GGUB 3ZT6A 3ZTNH 3RL1A 5TJWK 4X7FC 1RUQL 4KY1L 5IB5B 3FO9B 3G9VA 2BC4B 2L0DA 2BSSB 3EFDL 2G75A 1A14L 2BJML 2XN9D 2VNCA 2DKUA 3EDKA 2NXYD 1MCOH 4WV1B 1OWWA 3MRIB 5HYSA 2ZG1A 5E8OA 3D3VE 4FQQA 4GW1A 5DC4B 5CBEA 4S1DD 4MJIA 3MRMA 3D25B 3M07A 5FYJL 4YLQT 4D3CH 3GSNL 3QZWA 4QOKA 3PNWA 4RMRA 1FNLA 4DCQA 3RZCD 1NFKA 4M4RA 2X4RA 2C1PA 1RULH 1XGQA 1A7QH 4K9EL 5IVXA 5KS9E 4KJPD 5F9AC 1IE5A 3G6JA 3HZKA 4HIIA 4PP1C 4UTBL 1A7BA 1AGEB 1E6JL 2OCFD 3QUZB 2C5DC 4IJ3C 4KDTA 4JFZH 3T2PA 4F37K 4ETYA 1KYOJ 1MLBA 5KZCB 3STBA 3DX7B 4G6KL 4NHCL 5IQ7L 5ISZA 4HUNB 3TV3H 1P5UA 1FPTH 2VYRE 2X05A 4WU5A 5DQJB 5T1LB 1EAPA 4DOHB 5M94B 4RAHA 1MUJB 3W11C 3CUPB 3IDGB 1BLNB 2YUWA 4KGJA 3ILPB 1EUTA 1KSRA 3MRDB 5FA4B 3FMGL 5DVOA 5GZNC 5IB2A 1OP3H 4Z7OE 1CD9B 1RAMA 4QRPA 3KR3L 4HPYL 4DN3H 3G5YB 2ZKHH 4ORGA 2VJXA 4XCEB 1F6LL 2ZSWB 3MYZA 4Z7WA 3T77A 4K71C 3QRFM 5HDOA 3K2UH 4PP2B 5F7FA 4H5SA 1DANT 1LGVA 4NSKA 4C57C 2Z91A 5KN5A 2X4NB 2CGRH 2A6IB 2XG5A 2YD1A 4ONHB 3VI3F 2YKLL 1G6RH 1JPGA 2IGFH 3WUWB 4NUJA 4I2XE 4LVNC 1GAFH 5D93B 1PGRB 4OLVH 3DNKA 1S5HA 3VGGA 1WBYA 4PJXF 1S7SB 3PP3K 1CDUA 2F54D 5DK2B 5B38G 3EJYD 4GRWF 3BRFA 1T80A 1CZ8H 1LMKA 3WIHA 4I4WB 1RZKL 3IDUA 3ARFA 4UV4L 1BP3B 1LO3H 1HOCA 3AS0A 3VXNB 2BXYA 3NFPB 4U0QB 2PYFA 4MNQE 3VFVA 3P9WB 3IFPB 4OGXL 3BH9B 3DX8A 4EOWL 5KSBE 5IB1B 5JLZA 1TVDA 5C0AE 2BNUA 3DARA 3RBSA 3IDIB 1OB1B 2VXQH 1CXKA 2HFEB 4HUXB 4ONGH 4UMGA 1AHWB 4R4ND 5DUML 5E94B 4LEOB 5L8JB 1EO8H 4DGIL 1UM6H 4R97C 2ORBH 4F7CA 4IRSD 4LLMA 5E2VL 1BVLB 5IT2L 2AP2A 2YBRA 43CAA 4PJFE 2XI9A 3I3DA 5J0BA 1YEDB 4NJ9H 1K8DA 4KZDL 2UWEE 2VABA 2NY5C 4HUVB 1MNUL 1GPOH 4LU5H 4MGXA 3QNZA 4HLZG 1DVFA 3MRBB 5BMFH 3KPRB 1MFBL 2P47B 2VDKH 4HS3A 2IG2L 3U9UA 4HD9A 5GHWH 5HXMA 4KK6D 4LLDA 5TF0A 1QPXA 1YEEL 4PREA 4RIRB 1CE6B 1U8IB 3IDNA 1XGYH 4F57L 1OAQL 2V2WA 1FZOB 2WAHA 5T1KA 4Q2ZA 4PJBA 4ONFH 5I8CA 2J7LA 4PJ8D 3FQXA 1IM3B 3L3HA 5F6HI 4GQPH 4P23D 4U1SA 3KYAA 4G9FB 1CXFA 1VCAA 4W68A 5DMJB 3I2CL 5DHYA 3LS5H 4KXZI 2P8LB 3EDFA 3GKZA 1T5XA 5DD1H 2P5ED 4GG6A 4UUJB 5C07B 3VWKC 3QEUA 4CADA 4U6XB 2ZNXA 2DLGA 3MLYH 1K5NB 3WDJA 3BPNC 2X2YA 4UIKL 3OXSA 1A1NB 5FKPB 5BV7H 4NZUL 1AC0A 2XTJD 1FFPA 3NACH 2QKIB 1VADA 3T09A 2DKMA 3JV4A 3QI9C 2HFGL 4JY6B 1CR9H 1ZHNA 4R4FH 1TJGH 4TPRH 4NO0D 4CKVX 4AENB 2JB5L 2XNAA 1EK3A 3PQYA 4LDLB 4WJ5A 2QHRL 3CFCL 4R4BA 3UTQB 5HHVL 1WT5C 5CJQL 3TCLA 1MJUL 1S78D 1OW0A 3MNWA 4D2NA 2H32A 1IGML 5DK0B 2PXYB 2BFVH 1TDQA 3QPXL 4XP6H 1A5FH 3TJHD 4O58H 5TQ2H 3KPMB 5T5NF 2R56L 4WIQA 1LDPH 5C6WH 2VN7A 1JF5A 4RFNB 4H8WC 4WWKB 5D6DA 4NM4L 4FMFA 5IVZB 3CVHH 3DPBA 5GS0D 3OPZH 2XN9E 1FLRH 1J8HD 3T8XB 2C1OA 2O61A 4NRZB 5D8JH 5IVXF 1BBJB 1NLBH 3SGEH 2B2XL 4ODWA 1XR8B 5LXGH 3G6JF 2DLHA 5HHNA 4XWGH 2BNQA 4QXGL 5DC0A 5IBLD 4DUVA 1FFOB 2MMXA 1PEWA 1NBVL 3T0EB 3V4PL 4MLIA 1RJLA 1OGAA 3TO4B 1NCWH 1X5GA 2AW2A 3O2WH 2DF3A 3OXRB 5D1QB 3VD4A 4LCCA 2ZCLL 1CQKA 2X4TA 5FM4A 4OUUB 5LCVH 3QCTL 4M6MH 2ZSVB 4UOJA 1NCDL 4P3WA 12E8L 2XA8L 1EDQA 5C0BE 3D3VA 4LPYA 3FB8B 4HV8B 3RVXC 3BZDA 3BRDA 3LB6D 3HA0A 3WFEH 2FX8H 4XX1E 3PWLB 4YE4H 5I1DA 2F74A 3L95A 1MCCA 3FHAA 3KJ4B 5KS9A 3R06A 5JXEC 2FB4H 4OLXH 5E8DH 3RDTC 3SE8L 1JP5A 4WI5A 1E28B 3CDGA 5DEGA 3P0YL 1Q72L 3ARFC 4M7LH 1ED3A 1NEZA 5T33H 2GI7A 5FCUH 1WZ1H 2XKNA 4LPXA 5CHNB 4LKXA 2MHAB 3MGTB 5F7HA 3DMMD 3F12A 1J1OH 2BZDA 5JW3L 3LKPB 3UX9B 3TFKC 4DKEL 3G6AB 4KK8C 1QVOA 2Y07L 1BHGA 2ICWJ 2MNUA 3O8XB 3EJZC 3ZLQC 3VG9C 2VLMD 3UJIH 3WLBA 3BDYH 2F54E 3C8KA 4QCIB 8FABB 5I0DA 3L1OL 3QCVH 3U1SH 4Z7NE 4JO2L 4ZSOB 2BNRB 1EXUA 1VEOA 4MJ4A 1QQDB 1YN7B 3HCVA 5CUSL 3VMPA 4DZBB 3JXAA 2WP3T 4BH7B 1E4JA 4LGPB 2B0SH 3SHSA 2DQDL 4AIZA 4R0LA 1VB9A 1H3PH 4DGVH 5C1MB 1KXVC 3OKEB 3J8F7 3MUJA 4LHJB 4EUPB 1UCBH 3KPSB 3MV9D 3Q2CA 3KNBB 4I2XA 1FNGA 4NZTL 2YUXA 2EYRB 3RA7L 3C8HA 3UAJD 4YWGH 1DVFC 3CFBA 1I7RB 4XAWH 3EYOB 3UCRA 4MQ7A 3UMTA 3RUGE 1JV5B 3RTQB 3HFMH 4WTWA 4PLOB 1UKTA 4JZNB 3RY6C 5J1SC 4JLRA 1A6TB 1CVSC 1K6QL 4Y5XB 1B2WL 4MNQA 1MEXL 3L9RA 5J1TC 1FQ9C 4ZYKB 5KSBA 4ZFOB 5C0AA 4PJBF 4Y16A 5KSAA 5DDHB 5FV1L 5D2NB 2OI9B 4PBWD 3W2DH 2APBA 1QFUH 3REWA 3P4NA 5ICYA 2PYEB 5DWUL 3FZUC 5D2LA 4JZJB 4JZOB 4KV5E 4PY7A 4GKSB 3WCYA 2A6JA 1RZGA 1YPZA 4KDWA 4YHNB 4U3XA 4GG6F 2QSTA 4XNMB 5HI3D 4H20H 5DO2C 4HIXH 4PJFA 1AQKL 3S36H 1L0YA 3HB3C 4F3FB 4L9DA 3RPIB 1Q94B 1VFAA 3C6SB 1A6AB 2BOBA 2EECA 2HVJA 5C09B 5GS1B 1JWSA 4JHWL 5EBLA 3V8OA 5BS0B 2P5EE 4NN7B 4FQCH 1KPRA 2VZ3A 2NNAB 3VD3A 4ELME 4XT1C 4LQ1A 3QIWD 1A1OB 4ZAKD 2XIDA 2XWTB 4P5KB 4XI5C 2XTJE 1OAKL 5K9KA 2CIIA 2GSIA 5C9JA 4OB5L 3ARBD 4HX1A 4MAUH 1RFDL 2XWBB 3IKCA 5D6DC 3KPOB 2DBLH 3C5ZB 4LLUA 3DV4B 3BP5A 2IJ0C 4RRPA 1A3QA 5DLML 1R0AL 1XF3B 3I9GL 4LOUC 3C2AL 4M03A 4P0DA 1JGLL 4BUHA 3MR9A 5L7XL 2APWA 1I9RL 1Z9LA 2DLFH 5C08A 5GPRA 1IGFL 1JF6A 1RK0B 3B9EA 2R1XA 4LCCC 3QNXB 3LIZH 5DURD 4G6AD 4QEGA 4QXUH 1Q9WA 5FUCC 1XGTB 2JCCB 4Z78B 4TSBH 1A9BA 3QH3B 2NTSP 1ZE3C 1J8HE 2HLAA 3R8QA 4NDMB 3Q5TA 4NT6A 2IAND 1ZT1B 3FOMA 3FN0L 4M1GH 5I19L 1X5JA 1WITA 5D7SL 1KTLB 5D6CA 5JW5A 3QT2A 3B6SB 1FV1A 1IGTB 5FO9A 2N1KA 5LGKA 1BM3L 1NMAL 4KMLB 1JPFB 2Q3ZA 5GS2D 3D39D 1FC1A 5BXFA 1A9EB 5ERWB 3S97C 3MRHB 4KKLC 2YPKB 4MMZC 1AXTL 5DJ0A 4OCSL 3DTXB 4U6HA 4JPVH 4YBQC 3WO4B 3SKOB 4P3DB 3HMXA 5KS9F 1U0QA 3WBDA 4DFIA 4F2MA 5D7JB 1HHKB 4QRQB 1IKFL 1H0DA 4JPIB 1OAUH 4M5YH 3RZCA 3BKJH 5CSBA 1MLCA 1CGWA 1D5MB 3V5HA 5DJDA 1MAKA 3FONA 4OIBA 5DD5H 1CTNA 4LCYB 1EEYB 3ET9F 1SJEA 4HZLB 3OZ9H 5EBWA 2NY4C 3ZKXC 1F11A 1WIPA 5FKAB 3V7AG 1JYVA 2NXZC 1BBDH 1YECH 4W6XB 1R3JA 3CXDH 3O9WB 5F6IC 3DIFB 4L1DA 4K3DL 1RVFL 3IJSA 3FL7A 4D94A 1FYTB 3GMPB 3C09B 1FG2B 1QRND 4C83B 2DTML 4KI5E 4R0LC 3K4DA 2Q8BH 3KLHC 1ZHBB 1YEJL 3DYMA 4G80A 1L0QA 1BECA 1EPFA 5FGRA 4WWID 1KB5L 2HTKC 1LO5A 2NLJB 3GJEB 2E7LA 4DKAA 4NM8L 4KRPC 2Z92B 2VKWA 3QHFH 4IHOA 4D0CA 1T0MA 4N5UA 2VLME 3UTSB 3QPQC 1CN4A 1KCUL 4PJDB 2A38A 4OZFH 1BEYH 4O9HH 5CP3H 2ADFL 3BHBB 4FHBD 3HR5B 3RNQA 2OP4L 2P8MB 1M4KA 4RISL 3BKML 5I76B 1QSEE 2FR4A 4N1CA 1ZLVH 2FEEI 3RNKB 3THML 2A0LC 3MV9E 2O5ZH 2GITB 3KYOA 1TTGA 3NPSC 4ODVL 1OOAA 3I6KA 4U6YA 4YPGB 1Q9LA 4JY4A 5E2UH 1M71B 3LN4B 1JI1A 5JW4Q 1UM4L 4ACPA 2JELH 5KSBF 1BAFH 1YEKL 4KKCD 4U1LA 1NAMB 1LILA 4M9PA 1A47A 1CGSH 2CPCA 2P7TA 2VDOL 1R3LA 4E9LA 2Q8AL 3UBXA 2Z31B 3O81A 3QDAA 5D2LF 3AVEA 3BPOC 4JGJA 4V1DD 2AERT 1YPZF 1TVBA 5J06A 4M6OH 3FQNB 4YAQB 3F7QA 4M4PA 1R5VB 1H3VA 4XP4H 4PJFF 4LHUB 5DVKA 4GH7B 1RK1A 1ZWIA 4XVTH 3HC0A 3QIUD 3BWAB 2XZQL 1Z0NA 4ESKA 4XNYL 1FCCA 5TE6H 4BQ8A 4S1RL 3GHEH 2PETA 4IRSA 3SDXB 2DM3A 3U4BL 2QHLA 5C0IA 4RDQG 3WE6A 4E42A 4CVUA 3BJ91 3LHPH 5A2IH 2XRAL 2F19H 5DTFB 5EN2A 5F9WB 1TQBB 1UXSB 2MCPL 4N0RA 4UDTA 3ZDZE 3GMQB 4J3XA 2VZVA 1WCBB 3QWOA 3EOBB 5GZOC 1KIUA 3NVQA 1I3GL 1Q9OA 1PVHA 4B41A 2AEIT 2IAMA 3OAYH 4UTAH 3RX5A 2EXYC 1NGWA 2ZUYA 5JOFB 5AG9A 5HPOA 2QQNL 4YXHL 4P23A 4MB5A 5EZIL 2VQTA 1ZA6B 3MGOA 5FO7B 4YGVB 4YHKH 4JFFD 5EU6D 2DQUL 5BJTA 3GMOA 3G5XA 1D6EB 1ND0A 4HXAL 2QSQA 5IHBA 3GFUA 3CX5J 3X17A 4PRPB 2ATPB 4OF5A 1M6OB 5DR5H 1LEKB 1T2QH 1A7OL 2YWYA 2VLLB 3E3QC 3VXMD 5IM7A 1HSBA 4HT1H 4TSAL 2XXMB 1UWXH 3QA3A 3BGAA 1FO0L 5HI4D 3BXNB 1CF8H 3WIIH 2ADIA 1UZ8B 5I9QC 3H0TA 4NO0A 2YA1A 4JR9H 3W39A 4RFEA 4MA3B 1FAIL 1IKNA 3NCMA 5I1EL 3Q1SL 3OGCA 4ONOA 3M45A 3BVNB 1F58H 1F90L 1A02N 3AREC 2V7NA 1L7TH 3NPZB 4FQ2H 4OZFA 3VFOA 2LVEA 2A6DA 4OKVB 2J6EA 2IANE 3H9SA 4XP5H 4BFBD 3L7EB 3MV7D 5E8EA 5DJ2A 4HUMB 2MQ0A 5IHLB 5C70A 2ZUQC 4PRID 1DBJH 5HYEA 2EEAA 1L7IH 1Y18A 2E7MA 4XBPB 2W9EL 4YDVA 4OFVA 2BVOB 4FFVC 3D39E 1FNEA 3DX6A 2Z4QB 5K9QG 4NP4L 1CG9B 3EYUH 1CD1A 5AZ2H 4GW4B 2FEDD 2NZIA 5CBAA 4HS6B 3D18A 4KTDH 4XC3L 1J8HA 2AJ3A 3T0WA 3S88L 2ERJB 5KVMC 4J3SA 1MJJA 2X70A 1T1WB 4OD2B 3V6OE 3QP3A 1HYSC 3UJJL 3E1F1 4J4PC 5C6TL 1TZIB 1GGIL 2ZCHL 4OD3L 2LE9A 4O5LL 3PL6B 2EICA 4OF3A 2F53D 1I9IH 1HHHB 5ABDE 5F96H 2MKLC 4MA7L 2E7LC 1H3XA 3FO2A 5L2JB 1JRHH 2D7TH 1H3TA 1RHHA 3LSOB 2JJUA 4XXCA 2HWZL 5SX5H 1QKZH 1NDMA 5IV2A 3B3IB 4D8PB 4TSCH 5DMKA 1EFQA 4TTDD 5TDNB 4GRMA 3LQAL 4JM4L 5TDOA 4R8WH 4KI1A 5A2KH 1QRNE 2OJEB 3BISA 1E4XH 3LKNA 1L6ZA 1YN6B 4XBEH 1QBBA 1KFAH 1T04B 5C7XL 3EDEA 2FIKA 1N4XL 4NN6C 3QUXD 3IFOB 2ED8A 2D9QB 2BOCA 1C08B 4L3CA 5D72L 5DSCB 1ZV5A 4CVXB 5EBMB 2FH6A 1EO5A 1P84K 1JHKH 2JK5A 3QG6B 3V52L 4F8TA 5I16B 1PQZA 5E8NB 1II4E 5KVGH 3MJ9A 1HH9B 3LOWA 2HT2D 3H3BC 3SGJA 1KLGB 2XZAL 2BVEA 3O3EA 4UU9A 3QUKA 3QXDB 1KJMB 3HS0A 4I13B 3GB7B 2BMKB 4Z7NF 3DMMA 3KXFA 5ALCH 2GSGA 1Z9MA 1W72B 4OQTL 2H26A 1WIUA 3P9LA 2VLRB 1E0OB 3N1FC 1MH5B 2E27H 4L4VB 3IB4A 3V2AR 3L3DA 1AI1L 4R4NC 1WF5A 1NGXB 4M7KH 1DQLL 1FE8H 1F4AA 1N7ML 4KHXH 3MYJA 3TCXA 3MOAL 4BFEA 4EIZC 1ITBB 4B7LA 1RJYA 3KVQA 3QQNA 1VKXB 4IRSC 2DQCH 4ETQB 3FTGA 3OR6A 1TZGH 4RGOL 3ULUD 1YYMH 1F4WL 3I75A 4V1DE 3SKUD 3MV9A 4HEME 4IMLA 4OBSA 3VFUA 4L8SC 5GRUL 4UQ2B 5GS2H 3MRLB 3Q6FB 4BFIA 4JO4L 2X7LB 3R0MA 4X8JA 3VDBA 2DYPB 1MFNA 2ZOLA 5A16B 5ILTH 3EIFA 3H7BB 1K8IB 3U2SA 5J6HB 3G5VA 1A6VH 2QADB 1YEGH 3CSYA 3AS3A 4JB9H 2IAMC 2AQ3A 2QTEA 4TOYL 4HKJB 2NX5B 3C60C 3T0BA 1BMGA 2X09A 3ULVE 2CRIA 4JQIL 1FVCB 2B1HH 1IQWL 4LEXL 1S9XB 2D7MA 5E6ZA 3I02A 1SYVA 5F8QC 3RQ3A 3U36B 3RWIB 2P44B 3PIQA 3SCMB 2AXHA 1QTYT 2Y06L 3IETA 1F4HA 4XP1H 1ES0A 3LRSB 1G9NL 4S1SH 2GJZA 3Q6GL 1A6ZB 3FFCA 3EO1A 1P1ZA 2PTVA 15C8L 1YEIL 1KTKE 1NUDA 4LVHC 4YEEA 1YY9D 1VESA 3BP7B 5D5MA 1Z3GH 5GRYA 2AABL 4IIQC 3VI4E 1U42A 1BD2B 1IKNC 4L8BB 4JFFE 5EU6E 4R26L 3UTTB 3K74B 3L5JA 5DUPL 4G3YH 1INQB 1FFNB 3K2MC 2OTWB 1OVZA 5TGBB 2AEPL 1A7NL 1W8NA 3MOBH 4X80H 4LLYA 4KMTL 4XP9H 4ZAKA 4W6WB 3VXME 1IGCL 5C0FA 2B5IB 3ARQA 1A21A 4I3RH 4BQ9A 1HI6B 1J0ZA 1KLFA 1KJ2H 3SJVB 5KSUB 4YDKH 4NQSB 1NGQH 5EC1B 1WFOA 3SGDI 2NY0C 2EZ0D 3OHXB 4NCDA 1CTOA 1IAOB 3OB0H 5BQ7B 3CSPA 1NCNA 3EYFA 5GS0C 2D9CA 1RMFH 4DGYH 1CDGA 1CYGA 1GIGL 3MV7E 1C5DA 5TH2B 2JIXB 2H1PH 4N0YH 5IGXL 4OLZL 3BW9B 4PRIE 1HIML 3WFCH 1RI8A 3QDGD 4O51A 1S7QB 1BOYA 1LO0H 1OSPL 2OR8A 5IOPB 3JVGC 1P4IL 1U95A 4MD5A 1T66C 4K3EL 4ZS7H 2JLLA 5I6XC 1CGTA 5M95B 4OCRH 3SQOH 3B2VH 1MREL 4H0GA 2R1WB 1N2RA 3D2UA 5IG7A 3GRWA 5I73B 3VMNA 1MJ7H 4HJGA 3CDCA 1VGEL 4P99A 1Q0XL 1SVCP 3GNML 1NFIB 3NZ8A 4WTZA 3VXRD 2JJTC 1IEBB 4Y19D 4JM2B 4PLJD 5LQBH 5L2KD 2GTZA 3GZKA 3LKOB 4PLNC 4OCNC 4HQQH 5DVLA 4JHZA 4OD1L 2UZIH 3O3AA 4JGMA 4PGJA 4A6YH 4DQOH 2X1QA 3H3KA 5CILL 4PJXB 2F53E 5BVJA 1E4WH 4G43A 2W65B 2QL1A 4PRHB 4GRWB 3D39A 1T3FB 4AQ1B 3QJHB 3ULVH 4M6NH 1ADQL 3W0WB 4FFYL 4HFWB 5IK3B 3QULB 3UYRL 1MI5B 1ZTXH 4NWTL 3FRUA 3MACH 2L7JA 1BREA 3BN3B 3BIKB 5C0GB 5DJXA 1U91B 5C0CB 4QWWD 3JTTA 3SGJC 4N8VG 2DQGH 1F8TL 4JG0H 4ZXBD 1HNFA 2V7HB 3ES6A 1MSPA 3CMGA 4GKOA 2P24B 2YSSB 4JO1H 3DBXA 3HNTH 4NUGL 4J1UA 1I8MB 3IKKA 4LARH 5IBUB 2QQLH 4JO3H 3LKSB 3ZKNC 1CDYA 1SM3H 3BDBA 4GG8B 2ZUXA 3MRRB 4WI7A 1T7VA 2CDGB 2QR0A 5MI0C 5IHUH 3QDJB 1Q38A 2CUIA 4ODXA 4G8FA 1U8HA 4J3OC 5HGBB 4NKDB 3GIVB 4GJTB 4HIHA 4MCYB 1VACB 1QRNA 1S3KL 3MLXH 3AC0A 1V7MH 4B53A 5IWLA 3JWOC 2ARWA 3C08H 2BERA 4GAYB 3W9DB 2PW2A 4Q58C 4MXQC 5BOZG 2FX7L 2R2CA 2CKNA 4YHOL 4OAWA 5HHOE 5I1GH 1MFCH 2ZWLT 4YUEL 2C7UB 3UAJC 1X5ZA 3JTSA 4AH2B 3VFWA 3S9DB 3Q3GA 5GGRY 1F4XL 4X7DC 1XF2B 4ZPTA 3UYPA 5IESH 3LS4L 3UJTL 4JEGB 5FYLD 4AL8L 4ZPVA 2SEBB 4MQSB 4ZOEA 5FGCB 4BKLB 2GK0A 4QT5B 1ZGLM 5ANME 4BELD 1Q1JL 1I85C 1KBGL 1JN6B 3CX2A 1EZVY 5TFSL 3GBLA 1D9KA 3TT3L 4TVPL 3ULUE 5E6IB 5FDWA 2YD6A 4HKBB 2ESVD 3CXHK 3VH8G 5IEKB 2UYLB 4Q6YA 3F6LA 5H35B 1ZMYA 5HDLA 5EPMA 3U83A 4NQDB 3TJEL 3L3OB 4PB9L 4PR5A 4M62H 4IRJC 1FJ1B 4GBXD 5BO1L 2NYYC 5JUEH 4U7SA 1FH5L 4F15B 3HAEG 3BZ4B 5HTSA 1FDLH 5EU5B 4TUKH 1A4JB 3VRIA 5E4IA 4WFGD 2NY2D 1RPQA 1G7MA 1XAUA 4DZ8A 5CSGA 4CVZA 1T21A 2P48B 3PHOB 5J12B 4V1DA 3RL1B 3VXTA 4WUUB 4YBLC 4RAVA 3C6LB 3FT2A 1JNLL 4U2YA 2BVQA 3NCCB 5BW7C 3LQMA 3DVGA 1A7PH 5D5MF 5CD3A 2C26A 4UILL 4LPWA 1GHFH 1X4YA 2P5WB 5HYSB 3HI6H 5E8OB 1EHLL 2AEQH 3QIUA 2UZXB 1YUHA 3MLSL 1ZHLA 4FQQB 5F9JA 5CBEB 4WENB 5J6GB 4MJIB 3A67L 5FOBA 3ZDZF 5MEND 3PNWB 4I0PB 2H2SC 1KN2L 3MCLH 4KVCH 1RURL 3S35X 1OCWL 2C1PB 4ODUB 1DE4A 1IEHA 3IAQA 4GQ9L 4GSDH 5IVXB 5ESQA 1JI2A 2WWKO 1G7IB 3G6JB 3HZKB 2FBJH 4HIIB 4ZFOL 2G5RA 2OK0L 3ARYA 5MERA 5CJ8A 3S4SG 5IKCB 1I1YA 3U82B 2FX9L 1T1ZB 3NTCH 5ISZB 1WBZA 4S10A 1SQ2N 4UB0L 2PTUA 4WU5B 1EAPB 4YPJA 2XQBL 4LVEA 2LTQB 3UTZB 4NKOA 1FG9C 4X6BB 4ZOBA 3MLUL 2Q6WB 4OZIE 4KHTL 4EXKA 4G6AC 1DBKL 5IB2B 3QQ9D 4XPAH 3FB5B 1IQDA 4QRPB 1GH7A 4MHHG 3BKYL 3D48R 1V3KA 1WQVT 4Y4HD 1T0PB 4ORGB 5IFJB 4ZFZA 3T77B 4LAQH 2IBZY 4R3SB 4H5SB 2NZ9C 1GGTA 4Y7MA 3VXMA 5KN5B 2CK0H 3G6DH 2R0KH 5L9DH 2X41A 3L7FA 1DCLA 3BGFC 1JPGB 1RZ8A 1AO7B 3Q5OA 3H42H 3ULUH 4HMEA 1KCVH 3P77A 4YXLH 4XXDA 3Q48A 2VN4A 1KLUB 1WBYB 5DD3L 4Y4FC 2WQ8A 4XMKH 3M8OH 4OM1L 4NNPH 3NZHH 4WU7A 3VXRE 4FABL 4X6DA 4HAGA 4DVBA 4Y19E 4U1HA 1MFEL 5L2KE 4XNZC 4KKAD 3BE1L 1HOCB 3E6FB 2IPUG 1EGJH 1AY1L 2AV7B 2EE6A 5F44A 3TNNA 3VFVB 2MOVA 3DX8B 5JLZB 3DWTA 4LSSL 1YYLL 2BNUB 4HK3N 3X11A 1DL7L 1UQSA 1X5IA 2ILLA 5SWZD 1OARH 1S7XA 2AXFA 4OIIH 2F8VA 1X44A 1FNHA 1HSAA 1OQXA 3B2UC 2AGJH 4HWBA 3FQUA 3OAUH 4U6VL 1IL1B 1EBAA 4U1MA 2VXUH 5DHXB 5T3XD 1TPXC 1JZ7A 4CJ0A 1MIMH 2ATKB 2F5BH 43CAB 2Q20A 2WBJA 4MS8C 2I07A 3V5KA 2DRUA 3FRPG 1K8DB 2F53A 2DQEH 5IVNA 3GSQA 1NL0H 4U1GB 3FHQA 4X6CE 2HKHL 4TQEH 1UWEL 1ZVHA 3QFJD 3WO3B 4FP8H 2XZCH 2DQIH 3K1KC 4GKZA 4P46C 3U9UB 3VGDA 4OJFL 2VXVH 4LLDB 4HIJB 2DIAA 3IDNB 4PUBH 4ZUSA 4V2CB 4HDIA 4L3EB 4Q2ZB 5T1KB 4H88H 1D9KC 1JF1A 1MRDL 2OZ4H 5F7EH 5I8CB 3FQXB 3WDIA 3BKCL 3L3HB 2DD8H 3ZYOA 3H9HA 4U1SB 3KLAB 3OX8B 2Y1VA 1CICB 3SDDC 4NCC1 3QUXA 2OR9L 1NCTA 1JYWA 3FOLA 4NRXA 1TMCB 1YMHB 4GG6B 4CMHB 1PG7X 3CIQA 3QEUB 4HUKB 3MODH 3VWJA 4G8GD 2YD9A 5CLTA 5DD6A 2AJXL 5FYLE 2KH2B 4OCYL 7FABH 1VDGA 4O2FA 2PW1A 1FZMA 3OXSB 3VGAC 1O0VA 1LO4H 1R3KB 5KVDL 2ESVE 3JV4B 1GL4B 1ACYL 1NLDH 4DEPB 5HBBA 43C9A 5ALBH 4N0CD 4EN3D 5C3LD 3UBXI 5I30L 4YDLC 3TCLB 4HMDA 4YO0A 1KPVA 1IFHH 2R1YA 1J88A 3MNWB 4L29A 3QIUC 4RSVA 5JR1L 3MCKA 4YBHA 4HC1L 3HG1B 1TCRA 3PV6A 4M8QA 1Y6NR 3GKWL 4CU7A 3FQWB 2R0ZL 2W9DH 4YNYB 1G6RB 2EE2A 4TYUA 1N26A 3D69A 4WFGE 5ANMA 1PYWB 5DFWH 3IT8D 2MPAH 5ICXA 3KJ6H 4O02H 1IGYB 1TNNA 4LPTA 1GYAA 2H9GA 3BOVA 3VFGL 5BOPA 1JTOA 2GY5A 4LLVA 5EZLA 4X7SH 2R2HA 1CL7L 2NR6C 4XCCL 3MV8B 4OQ1A 5D1XD 4ODWB 5I1AA 2VR4A 4WFFD 4BZ1L 1W0WA 2BNQB 1NAML 3CLEL 1CGVA 2Z8SA 2O93L 3DUSA 1RJLB 1OGAB 1T1YA 5D9SA 4PGEA 2X4PB 4FQHA 4K7FA 5I71C 5KANI 2KQNA 1WVZA 5BRZD 5D7KD 4LIQL 3WXVL 4YFDB 1S7WB 2PNDA 1IC4L 3RL2B 2QQKL 3ARSA 3GSUA 3DO7B 2IBGA 3TA3B 1NSNH 5HYJD 3D3VB 4PJ7E 3MBXL 4FQLL 4HUUA 1R5WA 5EOCL 4GRLD 4M43L 4LMQI 3OR7A 2NW2B 1KTDA 4AEHH 4UQ3B 4YQXL 3V0WL 5I1DB 3BQUD 3T3PE 1EERB 4PGDA 2W59A 4CMMB 3ARDB 3L95B 2RBLA 4HK3J 3SE9L 3E6HA 3U7AA 5JNYA 5KS9B 2DJUA 2OQJB 5INDA 5IMKA 1JHLH 4Z0XA 3O4LD 1KELL 3R06B 1MVUA 1DSFL 2J8UE 1TZHA 5GRXG 5JQ6H 2VR5A 4MDIB 4XHJC 3U9PH 5ACZA 1P4LA 1PEZA 3BAEL 5DEGB 1P5VA 1QFWL 3PWUA 4Z5RB 3T1WA 2DQFB 1NBYA 4QTHA 5FYLH 2OZ4A 5EC2A 2R2EA 1NEZB 3TN0B 5CJOH 3FQTA 4LCWD 5TE7L 4LKXB 2HJKA 4G6JL 4X6DF 4FS0A 1WEJH 1DLHA 4Q0XH 1BQHA 5FV2A 4N5ED 5LWYH 1G0YR 3OGOE 5H8DA 5IBTL 4NQED 2FEDC 1BF8A 4LCIL 1BVZA 2GIYA 2IQAA 2YS4A 1KNOA 4YIQA 3U7WL 3WFDL 1J1XH 3WLBB 3C8KB 1D5BA 4NFBA 1DBML 2IQ9H 4NC1E 1EXUB 3TIEB 5BV7B 4P5TD 5B39A 3QDGA 5FXCH 1DFBL 2IALB 4AIZB 2WBJC 1JNNL 2FGZA 4S0TD 5LBSH 2VQUA 1F3JB 5EOTA 1HYRC 3MBED 1J1PL 4I2XB 3NCJH 1C7SA 2R0WH 5CMAB 1UB6B 3GSXB 3AROA 5HHXH 5SWZE 4HWZA 1A7RL 2HTLD 1ZT7A 4TRPL 3VFNB 2C4XA 5MP6L 4PGBA 1YNLL 4HGWA 3EYSH 1IT9H 4MQ7B 4Y5VB 4FG6C 4P2QA 4TTDC 3VG0L 2BDNL 4P4KD 3K1DA 5T3XE 4KJWC 4JY5H 4Y19A 2PR4L 5GSRA 3NFNB 5L2KA 1VFOA 3X3FL 2A6KA 4JLRB 3OL2A 5JIPA 3HI5L 2EDLA 1AKJB 4I18C 4KQ4H 1PDKA 1DJSA 5H2BA 5J1AA 4MNQB 5D70L 3CVHB 3L9RB 3T0AA 1IGIL 1C5BH 3IU4L 2R4SL 4Z7VE 5KSBB 5C0AB 4UT6H 4Y16B 3T1FA 5KSAB 3AS1A 3QFJE 5EORH 1NDGB 3QR2A 3P4NB 2VH5L 2ICWA 5DRWA 3VWJC 1MFAL 4MVBC 1U93A 1MCNA 3GI8H 2CR6A 3LVEA 2ZPKH 1HCVA 5I18L 1FYHB 4PLKD 3KWWA 4PY7B 1LE9A 2HFFA 2I60L 1RZGB 2YA0A 4J12A 4IBLT 3V6ZA 3BIBX 1FBIH 1MHPL 3OKDB 4ZXBA 2DLTA 5CWSA 4HJJH 1A64A 4PJFB 5GQBA 2N7AA 2Z8RA 1FL5A 1JTPA 3GEWB 1VFAB 1RU9H 2UWEB 2HVJB 3T2NL 1JWSB 5JOEA 3AU1A 3LEXA 4KMQA 1FFQA 2AJSL 5F1OB 5GJSH 4NYLA 4Q9QH 4G8GE 5FUOL 2X5PA 2GCYA 1A22B 1UWGH 2YOCA 1HEZA 3PG2A 3EO9H 5I1CL 3D5OF 3GMNB 5F7YC 1R3HB 5EA0L 5E2WH 3T4YB 3O2DL 1U8PB 4LCUA 4PRDA 4F58L 1NCCL 1A3RH 2GSIB 3D9AL 2FZ3A 1EMTL 2IBBA 5FHAL 1T5WB 1XT5A 4PGCB 5DT1L 5GSVA 5EOQL 2FECI 2X9YA 2O5YL 2AJVH 2EH7L 2JF1A 3HR6A 3FCTB 1XIWB 4LLUB 3RU8L 1N0XL 3SDCB 1RIUH 3QXWA 5M7QA 3TVMA 3CLFL 1B0GB 5DMGD 2GJ6E 4YDIH 2B4CL 5CJBA 3C5JA 5D7LA 4HUWB 5FYKU 2ESVA 2YWZA 3F65A 2ZZUT 1W72L 2GYSA 4OKDA 2DWDB 3I6GA 1Q9WB 3B9KD 4J7RA 4LBEA 3EO0A 1A9BB 4P9HH 5F72S 1KYOK 2BHUA 3MLTA 2NY6D 4M6AA 4KZDH 1N8ZA 3P2TA 1UH2A 4GBXA 4NT6B 1MFDH 5C0JA 5GXBB 1F13A 2HA1A 3W9EA 4WFFE 3V8CA 2IH3A 3NFSL 2YK1H 1R3IH 5IF0A 1ZSDA 3RVWD 2VO5A 5D6CB 4UT9L 5JW5B 4GUPB 1CFTA 4L9LA 5T3XH 3V6FA 1FV1B 1RZ7L 3CPLA 1CLYH 1WC7A 4Y4KD 3TM6A 4X98B 1OAQH 3QRGL 3OJDA 5D7KE 4PV9A 3WFBH 4P59H 3UP1A 5DJ0B 1JMZA 5L0QB 4U6HB 4MA1C 2XN9B 3S37X 5F88B 3WUWG 2NXYB 5EU7C 4I5BB 3K8MA 1NH6A 1U36A 5HYJE 2I9TA 1HILA 3DO3A 2VWEE 2NCMA 1BFVH 4NO5A 5GGSA 1JWUB 4M5ZL 4APQA 2VTFA 2ZUQB 3DJ9A 1RUML 2F5AL 3QNYB 4JHAH 2RHEA 1H0DB 1V7NL 1XGUB 3CDFA 5MENA 4EVNA 2Y36L 3RZCB 2A1WH 3GI9H 4PJCE 4UAOB 5ITBL 3RWHA 3V5HB 5DJDB 3FONB 3QHZH 4J23A 4MD0A 1YJDL 4BUGA 1P7QA 1ZGLA 3JV0A 4UT7L 4NGHL 4K23H 4GO6B 3IFNL 1I3RA 3IDMB 4K55A 4U49A 5EIQA 4LP4A 1R3JB 3VRLE 4PRBA 5EU3A 1QEWA 1OTSC 5C0BB 1K9TA 1GC1L 5KTEH 4LCWE 2FL5A 1I3VA 4G80B 4HW6A 5EIIA 2UUDH 4DKFL 3HC4H 3CZFA 2JTDA 2X4QA 4KUZH 1XCQA 1WFNA 4PTUA 5GGVH 5I1HL 4NQEE 4KJQD 2VITB 4IHOB 4D0CB 4RDQF 1FIGL 3NN8A 2J8UA 4G7YL 4JDZB 1MPAH 1P4BL 1CLZL 1F4YL 1MQKL 5IR1B 2D0GA 3DYPA 3BZFA 1DQDL 4JFPB 3RNQB 5FECA 1C12A 1UH4A 3GBNH 4MB4A 4UINL 2H2PD 2FR4B 1JIBA 5TE4L 4YGAB 4Z7UA 4PPTA 5SX4I 4Q6IC 3DRQB 2XTLA 2L4OA 2W07A 3HC3L 3ZHDA 2Q76A 3TBTB 4NN6B 4XWOD 2HN7A 4HWEH 4Y1AD 4Y2OA 1GGYA 2A9ML 2GTWA 1Q9LB 4JY4B 2A74A 1KXTB 4UOW1 5E5UB 2E9WA 3JV6A 1EFXD 4KUCD 2F54B 3BRGC 4G5ZL 1FZJA 1T2XA 2D03H 4U1LB 1FHGA 2NMSA 4U2ZA 4LF3A 2P7TB 1T4KB 3IJYA 3QEGL 4KPHL 1INDL 3BD5A 4P2OD 3O6LH 2YN3A 1S7RA 2Y72A 4YHIA 1G1YA 3K4AA 2R8SL 2EIBA 2MFNA 5SWZA 3BI9X 1AGFA 1ZK9A 4OF6A 1BGXH 1P84J 5EO9A 4C4KT 3JWDL 5LKNA 4X7CC 3HC0B 1BQSA 4YX2L 1AGDB 4ZFFA 3RUGB 4YHLL 4LSVL 3LEYL 3QYCA 3A6BH 2V5YA 2YZ1A 5KVEL 1KF9B 5C0IB 4DAGL 5GGVY 3TBWA 5GISH 4M93C 2HT4D 4X5LA 3WEXA 5EN2B 5IQ9B 2ZUUA 4ZD3L 3QFJA 3QWOB 2CMRL 3ZYZA 2Z93A 4P2YA 3KHOA 3KPLA 3TVMC 1Q9OB 2VLJD 4GAGH 3SQBA 3GMMB 2YD4A 1A6WH 1NGWB 3WD5L 1TJIH 5IIEA 2UY7A 5ESVA 4PJ8B 2AI0L 4BSJA 3NCFB 4TUOA 2KKQA 4P23B 1D5XB 5CUSH 1EEZA 1PSKL 3DYOA 3INUH 1L4IA 3GMOB 4YHYC 3X12A 1WAAA 2Z8WC 2P5EB 3OKLB 2G2RB 4GBXC 1AFVL 4U1NB 3WS3A 3ZDYF 3MLWL 1QLFA 1G9ML 3RJQB 2Y6SD 4ELMB 1WV7T 3MNZA 3TYGL 5IM7B 1HSBB 5E4EC 4EXPX 3ETBF 4L9LC 4FZEH 4RMVA 4YHZH 2XTJB 4U05A 4OCLC 1CLCA 1U8JA 4KXZH 4JN2A 2ADIB 3H0TB 2V5MA 3KYNA 4NO0B 4Z0BH 1J12A 3DHMA 4PP1D 4PRAA 3TF7C 3OGCB 4XRCB 5JIKA 4CN4A 2VDML 2WWMC 2YRLA 4EN3A 1RJCA 4OZFB 3VFOB 4QHNA 4K9EC 2A6DB 1R24A 4JRXD 2V17L 4NN5B 3K8LA 4F33B 3U0TB 1SBSH 5JO5A 4JFEE 1U8NA 3BPLB 3ZDXE 4APQC 1RUKH 3D0VA 4KROC 4AG4H 4XPGH 5FHBH 1PW3A 3W11D 3OSKA 3N0PB 3DSFH 4I1NB 4XPBL 4NNYA 3H2WA 2CJUH 1SY6L 3VFSB 4IS6A 5EZJA 1ZLWK 3R0NA 4LLWB 1I7ZB 1KIPA 2BVYA 5GZND 2PO6A 1KC5H 4X99A 5K33A 4OZ4A 4TULH 3W5MA 1J8HB 4E0RB 5D1XA 1MJJB 3H6JA 3HMWH 2X70B 1J87A 4WI2A 4EJ1C 2WW8A 2K7QA 5KJRH 1FORH 1HHIA 1T6VN 3ARGD 2VDQH 1J10A 1MAJA 4AK1A 4XPHH 3EW3B 4K8RL 3BT2L 2EDDA 3PE9A 2G60L 5BRZA 4HBCL 3QQ9C 1K4DB 4EUPG 1NDMB 3L5IA 1JK8A 32C2A 1IAKA 5HYJA 1ITCA 5INCA 3QUMH 4QHMA 5TDOB 4WUKH 4GRLA 2J8UF 3FQRA 1OAYH 3O11B 3LKNB 5EFIB 4OZGA 5E08L 2FO4A 4M61B 4LSTH 5E5MA 1RZKC 3QB7C 2FIKB 1IEAB 2YD2A 5T1LD 4L3CB 4Z7UF 1EIBA 1F02I 3O4LA 2JK5B 3VDCA 3LRHA 4AM0A 2R29L 3O0RL 1I1CA 3HAEA 3IJHA 1X5XA 1CU4L 1MHEB 4RGNE 4EKXA 3O3BB 4LSPL 1A6UH 4LCWA 1S7UA 3DMMB 4FTVD 4J6RH 4JN1H 1GGCH 5GJTL 5F9DC 5BVPH 4WW1A 3PABA 3CFIC 4Y1AE 2H26B 3SKJL 2CLVB 1J86A 1AE6H 3OAZK 5J8OA 5HVGB 4NQEA 3LEVL 2HMID 5KW9H 3JUYA 3UTPE 3WNMA 3BESR 3L3DB 1CFVH 1EEQA 2X6MA 4JFOB 4MCZB 3MJ8A 2Q7YB 4LSRH 4OSUL 1WZMA 2EEBA 4Z76A 2EYTA 3AGVA 5BZWA 3UYOD 3OR6B 1QSEB 1Q8MA 2FATL 1Z5LA 5C0NC 1S9WA 4CL7A 1SJXA 3U30C 3MV9B 5ELIA 2MTPA 4IMLB 4DKDC 4AMKL 4FXKB 2A77H 3MRCB 5J11B 2AAVA 3GSVB 3S34L 3VWKD 2ZCKH 4R7NA 3FAWA 2ZOLB 3K8KA 3TWCH 3RX8A 3ALPA 2VISA 2FO1A 1U2HA 2VLKD 3CSYB 3F7RA 1DUZA 4MXWH 1OTTC 5K9OB 3MRFA 1TQCB 4RFOL 1YDPA 5F97E 3KYKH 3QI9D 1R5IA 5DZOA 1WJ3A 4IDJH 5B3NA 1WUNT 3ZTJH 4X0KA 1MWAH 4HCRH 5A2JH 1KIQA 4ODTH 5KSVB 1AIFB 3IF1B 4MD4A 3GGWA 4ELKA 4TVSa 4FQIL 1NMCC 1I4FA 1SYVB 4MZ3A 1PLGL 3PIQB 1XF5A 1UJ3A 2R23A 3RWJB 5I74B 5LGJA 1S5IH 3MUGB 2GJZB 2VLJE 4NQTA 5SWSA 3EO1B 1GZPA 1I7UA 3VXOA 1WAAF 4L4JA 2EDXA 4P9MH 4QOKD 1RQ5A 1REIA 1G7LB 4LRIA 1SYSA 3ZTNL 1WWWX 4ZOAA 4LP5A 1OF2A 4YR6A 1ZLUK 5AYUH 4D9RD 3KLDA 1JHTB 4D0DA 4ZUUA 5AG8A 1MCOL 1ERNA 4QXWA 2OM5A 2KL6A 3QUMA 1I1FA 1MCEA 5CZVH 3TPUA 3WNKA 1OT1A 3QIWB 4LLYB 4ZAKB 4WFED 4C56D 4D3CL 1RZJH 3QXTA 4EIGB 5I1LA 4F7MA 5DVMA 4WEBH 3EGSA 3GMLA 4P48A 3ARBB 3MFFB 1RULL 3UZEA 1A7QL 2CLRA 3QEHB 3VFMA 4JFZL 2PO6C 1DN2A 1KJVA 4UIMA 1OL0A 4JRXE 2XWJA 4YHPB 3S96A 5D1XC 1C5DB 3RP1A 3ZL4H 2AV1B 3TV3L 1JZ6A 2OSLA 1FPTL 3LV3A 1QLEH 4Y5YA 1BFOB 3NIGE 3PP3H 3W5NA 4MD5B 1ODAA 4G6MH 4NNXA 2D0HA 4MQTB 3X14A 1AXSA 2H3NA 4XVUC 5ICZA 4S1RH 1A3LH 4X6FB 5DURB 3UO1H 5JXED 2LQRA 3B9KA 3RDTD 4DN3L 3VI3E 3QDHA 2NY3C 4LL9A 4XVJH 2ZKHL 4DK6A 2IANB 3NZ8B 1A8JH 3ARFD 4LVOC 1D5ZA 3K2UL 2J2ZA 5J3HC 2H6PB 5DJCA 2CGRL 4J2XA 2GTZB 5D71H 5B22A 3O3AB 2OTUA 5FCSH 1G6RL 2IGFL 4WCYH 3S3PA 2HRPH 5BVJB 1HXYB 4G43B 1GAFL 1A4KB 4Y4KA 3U4EB 5MEOA 3TFKD 4OLVL 3D39B 3WN5B 1P2CA 4OZGF 1I75A 5B4MC 3PP4H 3WLWC 3P0GB 3N1GC 2MQCA 4EBQH 3VXSD 1CZ8L 3FRUB 5AWNH 3U7YH 2B20A 3JTTB 5F3HB 5TQ0H 1LO3L 1CGUA 1JGDB 3HE7B 4WW2C 3V0AC 5MEPA 3OKMA 1J0JA 2IADA 1FRGH 2FLRT 3T65B 1ACZA 2AJUH 1OWRM 4J1UB 5A43C 3IRZA 4WVRA 1DVFD 1FVEA 1FVDB 4ONGL 3DV6A 4JPWH 1KB5A 4RCAA 2QR0B 1EO8L 5GGQH 3WDHA 1N6VA 3ECBB 1MCKA 3BH8A 4ODXB 1UM6L 2ORBL 4G8FB 4CBPA 2VDLH 1U8HB 4I0KA 2IPTH 4C58B 2W0FA 4HIHB 4LHUG 5D1ZA 1QRNB 2X4UB 3QHTC 3WS6A 3CFJA 1CS6A 2YPVH 5SWQB 2EC8A 4NJ9L 1M7IA 3HNSH 4FTVE 2C3VA 1GPOL 4LU5L 1ROWA 3KHQA 3JTSB 5BMFL 3VFWB 1EA9C 4XMPH 2VDKL 3FZUD 1C7TA 3BUYA 5F1NA 3O6FA 1XGYL 4GW5A 3GSOB 4ZPVB 3EJJX 4UNUA 2GK0B 4YC2B 4OZHA 4DN4H 4ONFL 1KJ2B 5DO2D 4GOSA 4O00A 5DZLA 3VGEA 2DOCA 5FDWB 3EDJA 3PQYD 2YA2A 2WIIA 1KEGH 5KVFH 3QDMA 4JE4B 1QSZA 3LS5L 4Y1AA 1H15B 3RZWA 4F9LA 3T0VA 5DD1L 3ZSTA 4PR5B 1UJ3C 3MLYL 2AQ1A 4PLKC 2CDFA 2VLKE 4XI5D 5BV7L 4M9OA 3VRJA 1S8DB 3WNNA 3NACL 5HHQA 3IGAA 3RVUC 4HGKC 4P2OA 4R4FL 1CR9L 1Z6JT 4TPRL 1TJGL 5T5FH 4CVZB 3LN5A 4V1DB 4RAVB 3FT2B 1T20A 5DRZB 3AXLA 2WMPA 4HK0B 3DVGB 3TO2B 3TBVB 3QO1A 3CX5K 4O2EA 2Q86A 4PJ9C 2AXGB 1YUHB 3GK8H 4LOUD 1ZHLB 4X9HA 5F9JB 3T0DA 3QUYC 4XP6L 2ADJB 5D72H 1N5AB 1A5FL 5F1KC 3CCHA 4O58L 4QOKE 5TQ2L 1F97A 1U8MB 4A6YB 2XPGA 3FJTA 3RVVC 1LDPL 4U0RB 3V5DA 1INEH 3S5LA 2H45A 3R1GH 1DE4B 3CVHL 5ESQB 4I77H 5J89A 3LY6A 4D9RE 3OPZL 1UZ6E 1FLRL 2V6HA 1UCTA 3EOAB 5D8JL 2X4OA 5LG1A 4WHYH 5LXGL 2EDTA 1I1YB 5K9QI 3NABH 4W81A 3PUCA 4XWGL 1XZ0B 4WFEE 5C0EB 1EAJA 5DMGC 1KCKA 2VLJA 4C56E 4MNGE 3JUZA 4XNQA 4ZTOH 1NCWL 1TVHA 1VGKA 4U1JB 2J4WH 3O2WL 3CFDB 4NKOB 5DRNB 3PHQA 1DBBL 1Q0YH 2AJYH 4PJAA 1FO0A 2DI8A 3MMEA 2NY5H 5E70A 5LCVL 3QIBC 3EOYG 5HGHA 4JFFB 5EU6B 2X1PA 3B9KC 3IFLH 1WFTA 4FQXC 4M6ML 3U0PB 2ED9A 3RWGB 4YBQD 3HZVB 4U31A 4U3HA 1EHAA 4Z7WE 4ZFZB 2I9LA 4HULB 3O41B 1YEFH 3RVWC 3VXMB 3RHWF 1XF4B 3WFEL 2FX8L 1JYXA 3GJFH 4YE4L 1A1MB 1CI5A 1F45A 3E2HB 1RZ8B 3M1BA 4Y4KC 5E1AB 4J3UA 3OB8A 3SY0A 4D0BA 2FB4L 4OLXL 5E8DL 2NXZD 4OI9A 2VL5B 2X1WL 3OQ3B 4DVRH 3WHXA 3MV7B 4M7LL 4OUOA 4PJGE 3U4AA 1PAMA 2R9HD 3I50H 3VW3H 3FFDB 4PRIB 3KLHD 5T33L 5FCUL 1WZ1L 1AGCA 5LJYH 4XCFH 2RR3A 1J1OL 3RJDA 2VDNH 3TNNB 3DROB 1NJ9A 5EO0A 4PJIA 1NCAH 4KRPD 5IFHH 4GKNA 4HJ0C 5E00A 3X11B 4OFPA 5DQDH 4GLRI 1UQSB 1IGJA 5CZXC 1NFDE 2AXFB 3UJIL 3BDYL 3QPQD 2FJFA 3QCVL 3U1SL 1HSAB 3VXSE 1P9MA 3FQUB 4JFQA 4U7KA 3NOIA 3FO9A 5F7DA 2WUCH 2BC4A 2B0SL 4UNTA 3AB0B 5D1ZC 2DI7A 1H3PL 4DGVL 5CGTA 4WV1A 3WS6C 3ARGA 2PKDA 3V5KB 2A0LD 1UCBL 4HH9B 4WFHD 1OAZH 2VC2H 2F53B 4DK3A 2DL2A 1D5IH 5C92A 3GSQB 1A7NH 1A2YB 3D25A 4H8WH 3V7MA 4PS4H 1ZA3B 4YWGL 2YRPA 4HBQA 3D0LB 2VQ1B 4OT1H 3TZVC 4XAWL 3SDAC 2OL3H 2EDOA 4GKZB 3HFML 4KRLB 4PJHE 4Y2DC 3F62A 2WINA 4JG1H 3O6FC 5IJVB 4JVPA 1KJ3H 3LAFA 1EEUA 4PJBE 2OS7A 4ZUSB 1QBMH 5J13B 4JANB 2DBJA 2H2PC 1JF1B 3BYTA 3DX7A 2CK2A 1CXLA 3R4DA 4JJ5B 1FYTD 4EI5C 5IHZA 4RZCA 3QUXB 4OZHF 4XWOC 2DMCA 4MA8H 2YEZB 4W4NA 5T1LA 3F58H 3W2DL 4F9LC 2NTFB 2C3HA 4JRYD 3FOLB 4NRXB 3CUPA 3IDGA 4I3SH 1GZQB 6FABH 1BLNA 3GIZL 4OQTA 2IPUK 4R2GC 1JGVH 5DD6B 3LDBB 3DVIA 3MRDA 2NPLX 5DZNA 5FA4A 3X3GH 1MRCH 3MRPA 2PW1B 3NH7H 4H20L 3CK0H 4HIXL 3S36L 5FO8B 4KUCF 4FA8A 3NCEB 4P2OC 3HPJA 3PQYE 1I7TB 2ZSWA 3LZFH 4MJ5A 1OAXH 4NC2B 3G08B 4PP2A 2CIKB 2X4NA 1OHQA 1KTRL 5HHOB 5D7IE 4IOFC 5CGYC 4FQCL 1E6OH 1DLFH 2DJSA 5GZOD 2R1YB 1EVTC 3FT3B 1C5CH 3EYVA 2HVKB 1TCRB 4X4YB 3WIHH 3FO0H 4M8QB 3GJFA 3STZA 3B8SA 1S7SA 3TBSB 1NKRA 5DK2A 5ANMB 1TTUA 3D69B 4LFHD 4MAUL 5C08D 3HNVH 4RWYH 5ICXB 4P57A 2H9GB 5TF1H 5KG9B 3VXNA 4N90D 2DBLL 3NFPA 3WXWH 4LSDA 2WM0A 3IAPA 1NMBH 2COQA 5EZLB 3VWKA 2DQHH 3BH9A 4F7EB 2R2HB 4WHTB 1CFQA 1U92B 5I1AB 3PXJA 1W0WB 3P73A 2VLKA 1T03H 3L3IB 2DLFL 5D9SB 4PGEB 1T1YB 4LEOA 4FQHB 3QI9A 5EH1A 5ACLA 2E8YA 4OLUH 4QXUL 1UM5H 5FUCE 3ARED 4TSBL 1WT5A 2HKFH 2I5YH 1YEDA 4OGYL 2YXFA 1U3HC 1G0DA 4HUVA 4M1GL 3PGFH 4PJAF 5DFTA 4LGSB 1S9YB 3B83A 3BWUC 2Y6SC 3OG6B 1BFSA 2XFXB 2VAAB 2V9QA 4X7TB 3KPRA 3OR7B 4HKXA 1X4XA 4MX7A 4KK5D 4FFVD 1U8IA 1WBXA 3CFEA 2DIJA 1FZOA 3E6HB 5JNYB 2XICA 5INDB 4Q97A 5IMKB 3L5HA 4H26B 4Z0XB 1J9CT 4WEMB 2OL3A 2IBZX 4JPVL 4Q9BA 1IM3A 1TZHB 3LH2H 4G9FA 3L5WB 1HKLH 3PWUB 5T1MB 3NMEA 4LSUH 1HYSD 1FCGA 2CR3A 1NBYB 4J4PD 2D7OA 4QTHB 1HHGB 4WI4A 5CKAA 4C56A 1UACH 2R2EB 4MNGA 5I66B 1CVRA 4UUJA 1OAUL 5GGTH 4M5YL 3FQTB 3O6MH 4U6XA 5IP4A 4XMLH 2HJKB 4PRPD 3BKJL 2VDRH 1K5NA 1DEDA 4LRNH 1DLHB 5DD5L 1BQHB 5FB8B 3ALWA 3QJFB 4RAUA 4YH6A 5FKPA 3OZ9L 3NIGF 2XOTA 4OZIB 2QKIA 5DMIH 1QPPA 4QTIH 3MNVA 1J05A 1BBDL 1Y0LB 4JY6A 1N64H 4B50A 1YECL 3CXDL 4AENA 4UNVA 4PJIF 1P9MC 3EZ8A 1BIIA 1SEQH 3UTQA 5C71A 2H32H 25C8H 3SGDH 1CIDA 2Q8BL 2VSCA 5B39B 5IBUG 2GHWB 4D9QD 4JRWA 4WV1C 5DS8B 3ARGC 4LPCA 5DF0A 4ODSH 3LQAC 5EOTB 1F5WA 1UB5B 4LHQB 1HN1A 3P4OB 3QHFL 4X4ME 3KPMA 2IPKA 5JXEA 3RDTA 2I25N 4H1LH 1QR1A 4HGWB 1BEYL 4O9HL 4WWKA 3QAZB 4CDHA 4PD4J 1V3LA 4HS8H 3VXRB 4XH2A 2CKBL 4PJGA 3QUZC 3OKKB 4Y19B 1PZ5B 1FZKB 5L2KB 2A6KB 4WTXA 4NRZA 4MZ2A 2O5ZL 1LHZA 5H2BB 2ZP0T 3VD7A 4POZC 3F7VB 4D9LH 2FSEA 3OKOA 5H37G 1H8OA 5E2UL 3VFRB 1W0VA 3PL6D 2WP3O 4Q9RH 1NFDA 2ITDA 2H8PB 1CFSB 1P7HL 2ICWB 5D2LE 5DRWB 5KOVC 2EC9U 2JELL 1BAFL 1U93B 3O4OB 3VXSA 1MIEH 2NW3B 5DJ8B 1YPZE 4XNXH 3KWWB 4OUUA 3MUHL 1DQJA 1CGSL 2HFFB 4HF5H 4KHTH 2K1MA 4JKKA 2ZSVA 3V6ZB 4FFWC 4ZXBB 5CWSB 5T3ZD 1FGVH 2LFGA 3G9AB 1FL5B 4XC1H 3N06B 4M6OL 4RGMB 4HV8A 4NFDA 4XP4L 4X6CB 4KKBC 4JRYE 3AU1B 3LEXB 3PWLA 4I0CC 1U2CA 2HMIC 3LKQA 4XVTL 4NYLB 1ONQB 2V5TA 4RMQA 1EJOH 5D93C 2GCYB 4JVUA 4PJHA 1U6AH 5TE6L 3GHEL 2IAMD 3KDMB 2XZZA 3RY6A 4NQCD 3O3UN 5CEXB 1LWRA 1QSFD 3C60D 2R39A 4LCUB 4PRDB 1E28A 4ZNCD 5HYSG 4HMCA 5T5NG 3DI3B 3LHPL 2FZ3B 4W4OA 1AR1D 1VA9A 2F19L 3I6LD 5E2JA 4PYGA 1L0XA 3ZSSA 3DX9A 4NO2A 1ZLSH 5L88H 1Z9SA 2GT9A 5C8JA 4N0UE 3MA9H 4YK4C 2MCG1 2VLRD 1WZKA 5GGTA 2BXZA 4UTAL 3C5JB 1AHWC 1CLOH 4QCIA 1G9NC 3H3PH 3VGFA 5C08E 4X5XA 4G6FD 4ZSOA 5ID0B 4HPOH 2ESVB 1YN7A 4DZBA 4YHKL 4M02A 4N90E 1CXEA 3I6GB 4LBEB 5D7IA 3BP4A 3OKEA 5JIIA 4EUPA 3MLTB 3H9SD 1N8ZB 3WFZA 5B8CA 5FM5M 5DR5L 1N5YH 1T2QL 3E3QE 5DGRA 2EYRA 2IH3B 4MNHB 2ID5A 4HT1L 4M48H 1AD0B 4MHHI 1I7RA 3EYOA 1CF8L 3V6FB 3WIIL 1XR9A 2NY2B 1LQSR 4XGZA 2QADD 4BH8B 4JR9L 2NY0D 1DBAH 2FJHA 4JZNA 2X42A 3D87B 1F58L 2YD5A 3OJDB 3DVNB 4PV9B 4H1LA 1A6TA 1L7TL 4FQ2L 5JHLH 1ZEAH 4Y5XA 4HFUH 4UV7H 4XP5L 2AK4D 5EUKB 4Y88A 4M1CC 5DDHA 4LLQB 1CE1H 1DBJL 4NO5B 2M1KA 1LP9E 1UZ6F 1YNKL 1M05A 1L7IL 1AJ7L 1T66D 3N9GH 1CK0H 4PJ5D 1GRWA 1KCSL 4GKSA 4YHNA 2CO7B 3UTOA 3ARPA 3EYUL 5AZ2L 1KUMA 3MRKA 4XNMA 2A73B 4FQ1H 1I9EA 5ID1A 4G9DB 4KVNH 4F3FA 2Y5EA 2DS4A 5CCKH 2CD0A 1U58B 5GS1A 1F6FB 1QEWB 1JFQH 4PJ7B 2V2XA 3L6FB 3N1MC 2NNAA 5HSFA 2PXYC 1I9IL 4Z7WF 3CZFB 5F96L 4CU6A 1A1OA 1XH3B 2X4QB 1XCQB 2JJWA 4HC1H 1PKQE 4P49A 2BCKB 4PTUB 2XWTA 4P5KA 1JRHL 2D7TL 2DTSA 4OLWH 3EHBC 3SO5A 2C4FU 1XGPA 4WGVB 2VXTH 5JZ7C 4RFNC 3RI5F 3NN8B 2J8UB 1CGXA 1UYWH 2XACC 2XWBA 3BX7C 4TSCL 4WWKC 4QHKJ 3KPPA 1IJ9A 4Y4HB 4Z8FH 2DQTH 4R8WL 2WQRA 4E5XB 4QRRD 3REVB 3C5ZA 4D9QE 5EUOE 1JJUA 1Z2KA 3IDYB 1E4XL 3VFGH 1AP2A 1C16A 2EEDA 4XBEL 1F2QA 1KFAL 1U8LB 3QXUA 4ZODA 1S7TB 2JIXD 3KXFD 4ORZC 1WISA 4NBXB 5I1IH 4PJGF 3MXWH 1U8KA 2HN7B 2Y5TB 5IW1B 4OFIA 3T0EC 2GTWB 1JHKL 3ZKND 2A74B 5I1JH 3SGKC 2AJZB 3GJFK 1DQQA 3TBYB 1RK0A 5DJYB 5KVGL 4CNIA 1FZJB 4IMKC 5C2BH 1XGTA 1NFDF 3RAJH 4Z78A 1IARB 3FB6A 5CFHA 1K3ZA 4EDWH 1A0QH 5EDXA 3VMOA 3WNOA 1ZT1A 3JSSA 4MXQD 3PGDB 2ENYA 1KTLA 4JM2D 5FGSA 4TNWF 2E27L 2F58H 4X4MA 5SWZB 1XGRB 3MX0A 1AGFB 4LQFH 2ZG3A 2A9NH 5EO9B 4M7KL 4QHLB 1FE8L 4KHXL 4N8CH 3KJ4C 1G7JB 3HMXH 1OQOA 3SE9H 2MJWA 1KCRH 1WIOA 3V79C 2XT1B 5HVHB 3AAZB 1MI5D 5T3ZE 1TZGL 3ILQC 1YYML 3SDYH 3MLRH 4PJHF 4JFHD 4W4OC 5JIHA 1B6DA 1B0RA 5C6PB 1VPOH 4MAYD 3TBWB 3IS1X 4NQXA 3UXFA 3WEXB 1VERA 4Z7VB 2IEPA 4JPIA 2Y25A 2GAZA 3QFJB 4IRJD 1MRFH 5ILTL 5E2TL 3RWEA 2NYYD 1DN0B 1A6VL 1H5BB 2Z93B 1YEGL 1EEYA 1H8SA 2YPLD 3FFCD 4JDVA 4XHQA 3O8XC 3KPLB 5HD8C 4JB9L 5FKAA 5I75B 1YEHH 4NQCE 1QSFE 5GRJH 4KQ3H 1B6UA 5IIEB 1CXHA 4LPUA 5ESVB 1J8KA 4Z7QF 4BSVB 2B1HL 1EEZB 1FYTA 3I6LE 1FG2A 2K3TA 2F8OA 1ZHBA 3QXAB 4LMQE 1TENA 4JQVC 4OV5A 2WUBH 4JRYA 5CS7A 2FH8A 2Y9RT 4POUB 4XP1L 4GT7A 5T1DH 5B8CC 4M7ZB 1TETH 35C8H 2VLRE 4G8GB 4S1SL 3WS3B 1SJVA 3ARZA 4R90H 2C3XA 5D7IF 4K2UH 4OLYH 3UTSA 2I26N 1KN4H 1AD9B 2AK1L 1Z3GL 4PJDA 2H2SD 5DD0H 1YNLH 1U8JB 4HC1A 3RTQC 4TTGA 2E6JA 4JN2B 5FYKD 2BX5A 4JFDD 5JORB 1XEDA 3KYNB 4P4RB 2FD6H 3R8BB 3T04D 3AMLA 1MCBA 4P2RD 2J5LB 2GKIA 3MCG1 5E9DD 4OFYD 4Y5XC 4G3YL 4EN3B 4UI2A 3RNKA 3H9SE 4QHNB 2IF7A 4N0UA 5I1KH 1E4KA 4X80L 3MOBL 4XP9L 5JO5B 5IMLA 5IFAH 4YPGA 5D2NC 2RCSH 2OI9C 2W0LA 1U8NB 3RI5K 4I3RL 3LN4A 2GJ6B 2VE6A 1KJ2L 4YDKL 1NGQL 4JZJC 1NAMA 3TPKA 4TN9A 1MF2H 1BJ8A 1VFMA 2G5BB 3D2UD 1NEZG 1RMFL 4DGYL 1JTTA 5H94B 5E99H 1KG0B 4OZ4B 4JVWA 5CEZD 1I9JH 2AK4E 3C6LD 2H1PL 4N0YL 5GS1C 3BDXA 1I8IA 1WWAX 1RIHH 1CDHA 5IVOA 5EULV 3RWDA 3WFCL 4S11A 2NZ9D 4LHUA 1LO0L 4NN7C 4ODHH 3HPLB 1HQ4B 1ZOXA 3BWAA 4PJ5E 4GS7B 4ZS7L 1VSCA 4OCRL 5T3ZH 5I1CH 2YZ8A 3B2VL 2QQQA 5EZOH 4Y4FD 3AREA 4LPVA 4ZUWB 4ZNEA 1MJ7L 4XNUH 3BIAX 2AVGA 2P45B 3EKCA 4TNWK 3FB7A 3OKNA 5HYJB 3BN9C 4PV8A 1LK3H 5DTFA 3C5ZC 4QHMB 5LQBL 3LMJH 1YNTB 1GGBH 1LP9A 4GRLB 3FQRB 3GMQA 2UZIL 4TUJB 3AS2A 4W6YB 1WCBA 3ZYJA 1JE6A 4A6YL 4DQOL 3EOBA 4N9GA 1UH3A 1E4WL 5E5MB 1CWVA 3BQUB 2AKRB 4PJCB 1GVIA 4MJ6A 4CW1A 4M6NL 3ULVL 3MLVH 3ARUA 4CRPA 4KRNA 1RUPH 4UBDD 1T7XA 3B2UD 1ZTXL 3HI1B 1MAMH 3HLAB 1OTUC 1XCTB 1P7KB 5FO7A 1YA5A 1MY7A 4QRRE 1DEEA 2DQGL 5FAAA 3TC9A 2R9HC 3RWFB 4JG0L 4XB8A 4J4PA 4MS8D 2VIRA 2G9HA 4LCWB 5A1AA 3KXFE 4PRPA 2ATPA 4JO1L 1S7UB 4JQXC 1M6OA 3HNTL 3KS0J 3KGRA 2VLLA 4WW1B 1NC2D 1PKQA 2HG5A 4LARL 3O45B 1EV2E 1NAKH 4MMXC 2QQLL 4JO3L 1LO2L 4ZDHA 4NQEB 2O26U 1SM3L 1RZ7H 3RVTC 1UZ8A 4P46D 5IHUL 4MA3A 2J6EH 5EO1A 3MJ8B 1MCPH 1JZ2A 2O5XH 2FJGB 3ROLB 3MLXL 1KPUA 1EO7A 4P5TB 4U7MA 5EUOA 1D9KD 3WO4C 1V7ML 5TDPA 2EYTB 4OKVA 3C08L 5IROC 3AY4A 3NIFE 5ECJE 3ARTA 4OCWH 5E0QA 2P8PB 1B4RA 1YQVH 3MBEB 3MRNA 5D7JC 3SDDD 1MFCL 4JFXA 3PWVA 3MC0A 3O2VH 4K3GA 3WJLA 4OFDA 2VZOA 4S1QH 5GS0H 4R7NB 3T0XA 2VZ1A 2EDNA 5IESL 3VFTA 1G7PA 2DAVA 2Z4QA 2B7DT 4MWFA 1JGUH 1MCWW 4P4KB 1DQTA 3MRFB 1YDPB 4UT7H 5DUBA 3O9WC 4RRPG 4OIAA 4JFHE 3DI2B 4QRSB 1QBLH 1T1WA 4OD2A 4FQJH 3C09C 1KIQB 1T1XA 1VHPA 4MD4B 1TZIA 3GGWB 1BJ1J 4ELKB 3UC0H 2PCPB 3V9FA 4FOMA 3PL6A 1QG3A 4M62L 1C8PA 5F1IB 3PWJB 1HHHA 3BPCA 5JUEL 1K2DB 2YPLE 3FFCE 2IFFH 4B7IA 5LGJB 1ETZA 4XPFH 1FDLL 1GZPB 4LDEB 3VXOB 4TUKL 5D5ME 4YHMH 3NIDF 4K3JH 3B3IA 4D8PA 1B4JH 1DTUA 1SYSB 2DL9A 3VD5A 5TDNA 3BEVB 3B5TA 5JHDD 1MQKH 2LAAA 4L8SA 2OJEA 2R2BA 3S6CA 3STLB 1A7PL 4PJDF 2WNGA 1YN6A 1GHFL 5FM5O 3HI6L 2NR6D 1VEPA 2AEQL 3QUMB 3IFOA 1I1FB 1E4KC 4TNVF 1LD9B 3TPUB 3WSQH 1BVKA 3MJ9H 3QG6A 3U79A 1UEYA 3QWQB 1BZ9A 4NQCA 5I16A 4F7MB 1QSFA 3C60A 3MCLL 5E8NA 4KVCL 5C9KA 5FYKE 3VXUD 4JFDE 3TP4A 3GBMH 3SN6N 1D7FA 3DGGA 3Q5YA 3SKMA 4GSDL 1I8KB 5D96C 2FBJL 4P2RE 3QXDA 1KJMA 1YMMD 3VFMB 1U3JA 5E9DE 2Z31C 1QNZH 2BMKA 5I0ZA 1KJVB 5IMMA 3EFFB 4GMSH 3MV11 1W72A 3S96B 2VLRA 3NTCL 2R8SH 2ENSA 4S0SD 3L5XH 5A3IC 4Y5YB 3SO3B 4YXKH 2HP4A 4LNVA 2FYYB 3S35H 1NC4D 5AD0B 1IAIM 1K4CA 4IIQA 3HG1D 4NNXB 3L3JB 3JWOH 2ICEA 4WDIA 3ZZ1A 2H3NB 1VKXA 5ICZB 5EWIH 1K85A 1TCMA 4XPAL 3B9KB 2HH0H 1CXIA 4FN0A 2DM2A 4XHJD 1GXEA 2C4FT 1KENH 2FIRT 4XX1G 4NO3A 5CEZE 2NY6B 3NGBC 1T89A 2IH1B 3ZMRA 4GMTH 4LAQL 2DWEA 1G7QA 1D5ZB 1QO3B 1TQBC 3MRLA 5F9WC 4JFEB 4UZGA 2CK0L 5A16A 3G6DL 2R0KL 5L9DL 3H7BA 5CGMA 2M26A 4KK5C 5FF6A 4BZ2H 1FSKB 3H42L 3ULUL 2J88H 5A2FA 3LD8B 2VB5A 2DQJH 1KCVL 1LP9F 2AXJA 4YXLL 1WICA 5L6YH 3CSGA 4HXBH 4XMKL 5FUZH 4GXVH 5CJ5A 3M8OL 1MCIA 4NNPL 2AK4A 2J1KA 3PXHA 1S9XA 5IB3B 2D7PA 4KZEH 4DTGH 3RWCB 3U36A 2WBJD 5CZKA 2V5RA 3JVGA 1EGJL 1BFTA 5F9OH 3LRSA 5MEPB 1MWAB 1W0YT 4PGZA 4PJ5A 1A6ZA 4HHAB 3C9NB 2EYSA 2B1AH 1OARL 4OIIL 3BP7A 3B5HA 1UEMA 3OAUL 3MROA 4FG6D 4L8BA 2JJTA 2VXUL 4FXGA 4KJWD 1OM3H 3BH8B 2BRRH 1MIML 1BQLH 2F5BL 2PUQT 2CRZA 4LSQH 4I48A 4K7PH 4DJMA 4WI8A 3AY4C 2V17H 1CDIA 2DQEL 5TGBA 3AMKA 1NL0L 3RIAF 3ULSB 1BIHA 5FYKH 2GFBA 4GAJH 5EUOF 4M00A 4L5FH 4TQEL 1HI6A 3WJLC 1GOFA 5ETUA 2OXGA 5ADPH 4MSWB 2Y4SA 3GUTB 3SJVA 4FP8L 2XZCL 3VWJD 1RZIA 2DQIL 4MVBD 4NQSA 4LNRB 5EC1A 4KK9C 5HI5C 3BUYB 2VXVL 5F1NB 3OHXA 1LE5A 5ESAA 1IAOA 1QYGH 4PUBL 5EU4B 4QRRA 4X6EA 1RD6A 5CSZB 4JFYB 4H88L 2JJSC 4RGNB 2OZ4L 2QSCH 4TNVK 5F7EL 5I8KH 2B39A 4OFKA 4X4XB 1U8QB 2ERJC 1BQUA 1G7HA 2JIXA 3RKDC 4MQXD 1AQDA 1XFPA 1S7QA 5IOPA 4Y1AB 3K46A 3PL6C 4HLZH 4YJZL 3GRWH 3MODL 3N85H 3MLPA 1J18A 1EFXB 1HZHH 5I15H 3ZE0E 2EIZA 5SX4H 1FGNH 3BT2H 5F7LB 7FABL 3WKNA 5CEZH 2CDFB 2CLZB 4X9GA 3I3EA 4NKQB 2R1WA 5GRVL 3VRJB 3LPFA 5HY9A 1LO4L 3VXQA 1I1AB 4ENEC 3IGAB 2QBWA 1NFIA 1RHFA 4L4TD 4P2CG 2UV3A 1ZS8A 1IEBA 2XYCA 1EUUA 4JM2A 5ALBL 3LKOA 4HAFA 3AXLB 4YDJA 5HPMB 1AKJD 1PG7H 2ZJSH 4QYOA 1JZ8A 3QO1B 1IFHL 4NZRH 4M1DH 5AZEH 2EH8H 4O2EB 1BZQK 4PRHA 2EKSB 1ZHKA 1T3FA 3QJHA 3W0WA 2W9DL 4K7PY 1I3UA 1QUNA 1I85A 2XPGB 5DJ6A 3QULA 3T08A 2Z8VC 1MI5A 4OZFG 2MPAL 2P4AB 3KJ6L 3BIKA 4O02L 3ESUF 2CSPA 5JHDE 4HWNA 3V5DB 3S5LB 5C0CA 2B4CC 5HHPA 1AR1C 4MAYA 3B9DA 1E27B 4G7VH 4LSPH 4JJHA 4X7SL 4F7PB 2YC1B 4JHBA 4IRJA 2X4OB 1LEGA 2QSVA 4X8XA 5E03A 4XCNB 1GSMA 1I8MA 2YPLA 4EZMA 1M7XA 1N6QH 2VLJB 4WEUD 4GG8A 1S7VB 4WRLA 4XNQB 1TVHB 3MRRA 1VGKB 2CDGA 3DHJA 3VXUE 3QDJA 2VZTA 4HH8A 4ZQKB 3PHQB 3WKMH 4JDTH 5IEHA 1YMME 3MMEB 5BW7A 2KBGA 1IBGH 5B38A 2W1NA 3GHBH 4GAYA 5HGAA 2LABA 1T89C 3W9DA 1NSNL 4GXUN 4I8DA 1UXWA 3BSZH 3TIDB 4BZYA 2C7UA 4LASH 2I9LB 2CO6B 4NCC2 2JJVA 1RIVH 1CD8A 3P11H 4AEHL 1XF2A 1I8LA 3T4AB 3QQ3B 4K94L 2QADC 4JFDA 4AIXA 4P3CL 4BKLA 4FZ8H 4QT5A 5E8PB 3ZYIA 3SY0B 1JHLL 2YRZA 4P2RA 1JN6A 5JQ6L 5E9DA 4IJ3B 5IJKA 4OFYA 1MHCA 3RIAK 3U9PL 1SY6A 4HKBA 1WK0A 4X6DE 5I2IA 1YJDC 2P42B 4JRXB 1RUAH 5H35A 1F3DJ 1OTSD 3WHXB 1UA6H 1WWBX 4NQDA 4QRTB 3MLZH 4IRZH 3L3OA 4QY8B 5FYLL 4B0MM 4KAQH 2HAZA 5CJOL 3SCMC 3KAAA 1AGCB 1FP5A 1VFBA 3DETC 1BZ7B 4OF8A 1WEJL 4Q0XL 5DXWA 5CJXA 3EYQC 2R69H 5LWYL 5EO0B 3HHRB 2BSRB 1GC1C 4L8DB 4KWUA 4GKNB 5ADOH 1A4JA 3HUJE 1J1XL 1HE7A 4QXTA 3WYRA 3MA7A 2RAMA 2FJFB 4ZTPH 3VCLA 3PHOA 2IQ9L 4LAJH 4P2QD 1J0HA 4WUUA 3C6LA 5FA3A 4JFQB 4C55A 2D31B 4K71B 1KV3A 5F7DB 2M8XA 5LBSL 2P5WA 3HRZA 3ARGB 3CGTA 3DXAD 4BSWA 5CP7A 1J5OH 3NCJL 2R0WL 4LVNB 3TGXA 3GO1H 5J6GA 2B5IC 5HHXL 1T83C 3HE6D 1MCQA 5JA8B 4DW2H 2X44D 3MTRA 4ZMAT 3CVIH 4I0PA 4Y4FA 2YMXH 4G8EA 3P9MA 3EYSL 1IT9L 2M2DA 4OF0A 1JNHA 5FK9B 1IM9D 4ODUA 4PB0H 2WINB 1G7IA 5DJAA 4JY5L 5F7WC 2GK2A 5J9PB 1T2JA 1HWGB 3ARXA 4OM0H 1ORSA 2EIEA 1SEBB 4KQ4L 5IKCA 3SKNB 2OLDA 4PG9A 2VL4A 2W0KA 1T1ZA 5C0BD 3V0VA 1H9VA 1C5BL 3S3JA 5IHZB 4RZCB 4UT6L 2BK8A 1CFNB 5EORL 5C0DA 3UTZA 1PBYA 3GI8L 4QRUB 3K81A 2ZPKL 4X6BA 4OTXH 2ZOKA 2Q6WA 3OMZA 4Y89A 4X8JB 4R97B 5I73C 5B3JE 1FBIL 3VJ6B 3MRPB 1OGTA 3FB5A 5ACMA 3JWDC 4HJJL 5DMYA 2Z35A 1NGPH 5TPWH 4O2CB 1RZFH 5F3BA 3HPJB 3CH1B 5IW6A 1RU9L 4FTVB 3QCUH 1HXMB 4MJ5B 5DI8A 1AGBA 5IFJA 3NA9H 1HH6A 4R3SA 4JM2C 1NC2A 3L3KB 5GJSL 3BZEA 4Q9QL 3O6KH 3NIFF 3V4UH 1AO7A 3GMRB 1QA9A 3PDGA 4P46A 1UWGL 4JM2F 3EO9L 3EYVB 3TVMD 3ZT7A 3D85D 5KBNC 1KLUA 3CC5B 5E2WL 3C2SA 3GJFB 5D7LD 3STZB 2ITCA 4XPTH 3VXPB 1A3RL 1X6NA 3TNMA 4ALAH 4AY0A 1YY8A 1JUFA 4L4TE 5F7KC 1NCBH 4MAYC 3SDDA 1HDMB 4P57B 3W82A 3V7AE 1B3JA 2AJVL 3E6FA 3N1QC 3VE0B 3PWNB 3DUUB 2AV7A 2XY2A 1LNUA 5LAXA 3VWKB 1RIUL 1CFQB 2RJMA 4YK4B 4YFLF 4HWBH 3BPNB 4X5WB 4WY7H 4FFZH 3E8UH 4YDIL 3P73B 2VLKB 3K7UA 2EE9A 1X5FA 3HZYA 3CMOH 1IL1A 1G9MC 3QI9B 4UDUA 2NY1D 3GDBA 5FYJD 1OD9A 2ATKA 4KJYA 4QGYA 2WWMD 4P9HL 5J56B 2G75B 4I3GA 1N6UA 1IRAY 2R0LH 1MFDL 4PY8I 6CGTA 1GCFA 3V4VH 3OF6A 4GW1B 2YK1L 1AC6A 2R4RH 1N59A 1R3IL 4APQD 3MRMB 1IAIH 5JPMA 4KROD 4N9OB 1TJHH 4KRMB 5HGDA 5T3XL 1I8LC 4HKXB 3QZWB 4QOKB 4DCQB 1OLZA 3NCYS 1CLYL 4MX7B 1IZKA 2X4RB 5DA0B 4HIJA 1XGQB 4WTZG 5JHDA 3QFDA 4X83A 1WBXB 3CFEB 1SHMA 1WWCA 5C0RH 3WFBL 4P59L 1P7QD 4L3EA 5E6IC 2OL3B 5IJKC 4MJ2A 4FNLH 5EU7E 1XF1A 3JV5A 4M7JH 5FM8A 2N7BA 1MLBB 3KLAA 3OX8A 2OBGA 1CICA 3TT1H 4Z77A 3TYFA 1BFVL 1ZKAA 1JMXA 3ZKMC 5K59F 4JHAL 4BFGA 1YMHA 4C56B 4MNGB 2A1WL 3GI9L 5SV4A 5K9JH 3VXUA 5CJXC 2YXMA 3WNLA 4F15C 3QHZL 1UVQA 4RAUB 4U1KA 2YD8A 2RB8A 1YMMA 2NQCA 1CL7I 1R3KA 4ERSL 3S37H 4K23L 3MNVB 1J05B 4X7EC 4K8RC 2VZUA 3NAAH 3MRQA 5J12C 1BIIB 3C6LC 4Z7WB 1U3YA 3QDGE 3IDJA 4XBGA 1X5HA 4NSKB 2Z91B 5KTEL 4AEEA 5E5RB 2EE3A 3HC4L 1NC4A 4NUJB 4KUZL 3HG1A 3SOBH 3IDXH 3FQWA 5GGVL 5GRZA 1S5HB 3PJSA 4YNYA 1G6RA 2IPKB 4I0PC 4ZFGL 1PYWA 2VRAA 3RDTB 4RQQA 4NKMA 4IOIA 1MPAL 5DK3A 1QR1B 1IGYA 4P2QE 2E9JA 1FNFA 3F8UB 2AS5M 3ARFB 2F9BT 4XH2B 4JGUA 2XY1A 4PJGB 3GBNL 4KDTC 2PYFB 3DXAE 3MV8A 1JPSH 1R6VA 5JW4R 1CBVH 3AFLA 4HWEL 2NY7H 4Z6AT 2FSEB 5F7NC 3VGBA 3OKOB 1W0VB 2X4PA 3DLQR 4JPKH 1NFDB 3VG9B 2PN5A 1UKSA 3HUJA 1D6VH 2LTQC 1QFWI 2FGWH 2ITDB 4UBDC 4JAMA 3VXSB 1O5DT 1DBBH 2D03L 3B5GA 3DRTA 1DQJB 4F7CB 4LLMB 1S7WA 3RL2A 2YBRB 3DO7A 3L3GA 3O6LL 5C0ND 3MZTA 1P53A 4MXVE 3TA3A 1T7WA 2VABB 3F6IA 1QP1A 3WHE1 4RMSA 4PG2A 5HHMD 2XA3A 3QNZB 2NW2A 4UQ3A 4WO4D 1BGXL 1DVFB 3C87A 1DZBA 2L7UA 3LKQB 5IMOA 1EH9A 1OPGH 4OCXH 4HS3B 4CMMA 3BUTA 3ARDA 1FIEA 4PREB 4PJHB 3EOTH 2OQJA 2CDEA 4YZFE 1OTTD 4KGLA 1EJ6A 1T6WA 2V2WB 3A6BL 3K0WA 3U0WH 4MDIA 4ODBD 4PJBB 2OJZH 2E7HA 4I18A 5GIRA 4JKPH 4U1IA 5GISL 4Z5RA 4K3HA 2DQFA 1FFRA 3TN0A 4KI5D 5DHYB 1OD7A 3DX9B 1T5XB 4NO2B 3FO1A 4L8CA 4CADB 2GT9B 3BMWA 5C2UB 5C8JB 1UJTA 1IC5H 1HINH 3OJMB 3MV01 3MXVH 4UOW0 3ROOA 3WFHA 4ZUVA 4DWHA 3CU1A 4GAGL 1CQYA 5D7LE 4XTRC 1A6WL 1FFPB 1TJIL 1X5KA 1VADB 4X5XB 3ZE0F 1ZHNB 1MOEA 2XNAB 3TIEA 3PQYB 4WJ5B 3ZDYE 2R15A 4R4BB 3INUL 5ENWA 1ORQA 2IALA 4HG4K 1QSED 2OXHA 4JCLA 5D7IB 3ZT5A 1F3JA 3BP4B 4NJAH 2H32B 4IOSD 1C1EH 5B8CB 3QISA 4U1GC 1ZLWH 5CMAA 1UB6A 3GSXA 5LGHH 4XVSH 3FT4A 5HDQH 4FZEL 4YHZL