1NCBL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
molecule tags Hydrolase(o-glycosyl)
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL01
2ZWLT 5D7JC 3O2DL 4MCYA 3GHEH 4D9RD 3MZGB 4U6HA 2JELL 3QSKB 5F3BB 1MY5A 3QAZC 43C9A 2Z91A 2JK5B 3U0PB 3BVNA 4FQ2L 3GRWL 2FX9H 5FHAL 1J0KA 1NCAL 3GMRA 4OIAA 3C9NB 4U1LB 4Y5XC 3V6FA 2A77L 2XQBL 3O2DH 4L4TA 1JTTA 5E8PB 1G0YR 3OGOE 3UMTA 4Z7NF 4UTBL 5CJ8A 2VDRL 4YK4B 3S34H 1IKNA 1IEBB 2E7HA 1ZTXH 3MOAL 4U7MA 5IV2B 3PGFL 3HZMB 1EERB 5HI3D 1ZA3A 1B2WL 2VDRH 1KENL 1VENA 2PF6A 2PO6D 4OZGB 3X13A 2Y1VA 3VI3E 1EEYB 3CAFA 4A6YB 1P6AB 1BAFH 3PGFH 1NCBL 3IDYB 1QSED 1KB9K 3VE0A 1VFUA 2OSLA 2MMXA 4Z7OE 3HC4L 2Y7QA 4P46B 1I9IH 1NFIB 2XWJB 1NMCC 1JZ7A 2DD8L 1IGTA 2DL9A 1JGUH 1G0DA 4G6AD 4ELMB 2EDOA 2F19H 5GPRA 5IMKB 4JPIB 3SGKC 1R3HB 1N7MH 1CFQA 2GUOA 3QIBB 4M1DL 4Q6IB 3D0LB 1W0WA 5DJ2B 4V2BA 4CMMA 4LCUB 5EC2B 1X5YA 5CP3H 4G3YH 5A40E 4F37F 2O5YH 4HFWA 2CUMA 3WLBB 3LAFA 4MAUL 4C56B 1OCWH 3CFJA 1PQZA 2R4SH 1CDHA 3OF6D 2ZSWA 3REWB 5DC4B 5L2KA 1W72B 4KDTC 4U1KA 2YD4A 4H0HB 2NY4D 1R5VB 3G6JB 5E8OA 4TVPD 4TOYH 3MV11 1S9YB 2XTJE 3LIZL 4ZDHB 5CJBA 3KWWB 1MCCA 3RIFF 3KNBB 4NQEB 4NSKA 3ULSB 4FQXC 4LCCB 2F5AL 4OUOA 1H3VA 3QRFM 3GMMB 5CEXB 2PR4H 4N0CD 3QJFB 5ETUA 1ZLUH 5D93B 3OSKA 5KSAB 1EHLL 4OUUA 2NY1B 2NXYC 2WUBL 4XNMA 3EOTH 4XC3H 1WT5C 5E8EB 2P8LA 3IDJB 2B39A 4TVPH 4Z77A 3KPLA 4X9HA 5F7NC 2AJSL 5FV2A 1U8OA 3MBEB 3VXQA 4PG2A 3JXAA 2VLJE 3BESR 5AZ2L 1T1WB 2R4RL 1DLHA 4WW2B 3U7YL 3IAGC 3FN9A 5J6GA 1QG3A 2BY0A 4KHTH 3V6OE 5F7KC 1A2YA 2ICES 5E2WH 2OL3H 4YPGB 4CAGA 1M7IA 2ITDA 5AD0A 1VADA 4OCNC 2YSSB 3HG1B 3I3DA 4Y16D 5LQBL 1FV1A 3NPSC 4FRWA 1YY8B 1JTPA 4EN3A 1TQBC 3GJFA 3L6FB 3F62A 3H9SE 4Z7UB 4XHJD 3BH8A 2QADD 2APWA 4NJAH 4Y4HC 1FYHB 4JM4H 3QUXD 3QG6A 4RMQA 4L8SB 1AHWC 3UTTD 3HLAB 1IZKA 2P5ED 2X4OB 1YQ2A 5EIIB 1T6WA 4KKAD 1DE4B 1LHZA 1RV6X 5TH2B 1AC6A 1BIIA 2VLKA 4XMPH 4JZJB 4OKVB 1INQA 5IB2A 4GAGL 1SJEB 5IEHB 2BHYA 3PHOB 5GRWA 2C3VB 4JRWA 3V9FA 2RIKA 2J1KA 1F6LL 3HZYB 3L6FA 3RAJH 5DD0L 5LGHL 2LVEA 2ZOLB 2LTQB 4P4KD 3PXJA 4LSDA 1HYRC 1FHGA 4PJ9B 3VFRA 3L5XL 4L9DA 4OCRL 4FABH 5C0IA 3TBYB 4H1LA 1UM4L 1QEWB 2AQ2A 5EU6E 3S6CA 3BGMA 2WBJB 3ZLQC 3KPQA 2XQYK 4FABL 2GT9B 1P5UA 5DRNA 2LU3A 5DD3L 5E70A 5F8RC 5AZEH 4JANA 5FO7B 2DDQH 2FX7H 4S1QL 2N7BA 1EXUA 3FB6B 1GGIH 4XNMB 3KXFD 4LLAA 2JJSA 4FFWC 1FRGL 3NMEA 2AV7B 1KPUB 1FNFA 4GW5B 2BMKA 1MFEH 3TO4B 5BVPH 4NKMB 4D9QD 2ZNXA 3UJJH 3U2SA 4JFPB 3KWWA 4GLRI 5BS0A 5ABDE 4NM4H 3MNZB 1R5VA 3QEHA 1VSCA 1SBSH 1G7QB 5EUOE 3CSYB 2HVJB 4WY7H 4K3GA 1IM3B 3CMOL 3OKNA 5IW1A 4N1HB 3KYMB 4HPOL 4OGXL 3LRSA 4G6KH 3RGVB 1NEZB 5I1DA 1X6NA 4XX1G 5AWNH 1KJVB 4OD3L 4KTDH 4I3GA 4RMVA 2Q7YA 3QCUH 5E5UB 4OGXH 3MR9A 4K9EC 1AD9B 4WFED 2G2RB 1J1PH 5T1DL 1D5BA 4QRUB 3SQBA 5I1HL 2FB4L 4JFHE 4F7CA 4AEEA 4L4VA 4K9EH 2K9UA 4NN6C 1L7IH 4F9LA 3BHBA 4ZUWB 4HIHB 1CGWA 1A4KA 3HNVL 5F9OH 4JN1H 1T0NA 5DRZB 4YXLL 2O93L 3BJLA 1KG0A 1YPZF 1FYTA 3VGAB 2PW1B 4K9EL 3LH2L 5IBLC 4AMKH 4ZNEA 3RWHA 1IAKB 3LDBB 2DKUA 3MV8E 1FO0A 4PJBF 3G5ZA 3K0WA 2Z4QB 1ADQL 3U48A 1UJ3A 2X41A 4LIQL 3VXPA 2KUTA 2P47B 3GSWA 2DQTL 3QZWA 3TN0A 5C2BH 3TT3H 2PXYB 4Q97A 1FO0H 1G1YA 1XR9A 2HLAB 5DMYA 1QR4A 4KH2A 2GKIA 5JZ7C 2QQLL 4U31A 2AJZA 1RZIA 3C5SB 3WNMA 5IBTL 1CDGA 4KMTH 4JDZB 3QHZL 1MCPL 4PJXF 2EH8L 1V3MA 4Z7VA 2I07A 2HLFC 4PD4J 1FC1A 3T0EE 3KAAA 3MRPB 4X7SL 3B9AA 1U3HC 3GMLB 3HRZA 1WZMA 3PQYE 4JDVB 4P5MB 5D1QC 4NWTL 2PO6A 2FX8H 3SE9L 4PRDB 1RIHH 4XBEH 2AJXH 4QYOB 1U8JA 3MV7E 4BSVB 3MTRA 4K2UL 1A6ZB 1U8NB 1A7NH 1X5KA 3B43A 4YDVA 3MRMB 4NQEE 1JGDA 3CLEL 1CFTA 1UFUA 2CO6B 2PYED 2Q7NA 2GW5A 4M1GH 5DJ0B 2YA1A 3FQUB 5AUMB 3UDWA 4XCNA 3FFCE 1N6QL 3IFOB 1F13A 2QSVA 1G7LB 1BWWA 4PG2C 5EO0B 4DZBA 4Q58C 1K4CA 2R9HD 1WQVT 3DRTA 1OAQL 5JW5A 4HFUL 4F9PA 1JTOA 1D6VH 1I1AC 1Y6KR 3P30H 1NGPH 1WAAE 5B3JF 3CVHA 2P42B 5L9DH 4NO5B 3O41A 3KPPA 3GUTB 3HZVB 5KVDL 1FNAA 3VWKC 1A9EA 4XC1H 4ETQA 1XF4A 3GK8H 4H8WC 4LASH 3D39E 1KB9J 1CDBA 3I6GB 1NDMA 4M8QA 2C1OA 3W81A 2Y6SD 4ODHH 5F7DB 1LILA 3RVXC 2XZAH 3V4UL 1JNJA 1LP9E 5DR5H 4XC1L 5D1QB 4YGVB 1VKXB 4ZFZA 4EBQH 3P77B 4HKJB 3WSQL 3FO1A 1NGXA 3O6FB 4HWBA 2XZAL 1ZHBA 3C6SB 4MAYC 4WHYG 4PJDA 2H3NA 2ICCA 1WGOA 4HC1L 1DQDL 4QT5A 1P1ZA 4PLKC 5KSAD 4MHHI 4GRMB 3OX8A 4NQDD 1QR1B 1RIVL 2RJMA 3CDFA 1OSZB 4HUUB 3N1MC 3VWJD 1K3IA 2OI9B 3RGVD 3BQUC 1V7NL 4UV7H 3DHMA 1Q1JH 5GSRB 1U91A 1R0AH 3AB0C 3LN9A 4NO3B 1JHLH 5EFIB 2H26A 1A4JA 4LSQH 3MRGA 4HKBB 3DYMA 1I9RH 3QXWA 4C56D 3KGRA 3MGTA 3VGFA 1I4FA 2X70B 3SKNA 5JOEA 4JCLA 1RULL 3UO1L 2ITCB 4LLVB 1RK1A 1VGKA 4Q2ZB 4HKXB 5FO8B 4R6UA 3EJZC 1IKNC 4NKDB 5FA3A 4GG6F 2H32H 1J05A 4ODUB 2D7TH 4L3AA 1X5AA 1IFHH 4LLDB 1EAJA 3RTQB 3EO0A 4O00A 5F8QC 2NPLX 2EDFA 5ICXB 4CUCA 3NGBB 4LGRB 1XZ0B 5FEBA 1RHFA 3H9YA 3MLSL 4U6XA 1QYGL 3WO4B 2YRLA 2VDLL 3QQ9D 1JFQH 3JV5A 4PGCA 3MODH 5EUOB 2HFGH 4U1GB 1EGJA 1WLHA 1YMMA 4O2CA 3SE4A 2YBRB 3MJ7A 2XTLA 5I15L 1UWXH 2AJ3A 3RPIA 3MCG1 2SEBB 5HHPB 1ZAGA 3T0VA 4NOBA 2WIIB 1ZLWH 3MRFB 2XRAH 2ARWA 4N90E 5SWSE 1U8IB 1Z5LA 2AK1H 1BVZA 1URLA 1ZA6B 2NX5D 1NLDH 4FMKA 3C8KB 4D3CH 1DJSA 1IQWL 4HK0B 4YDKH 5C0AB 2EEAA 4TSAL 4F2MA 3DX7A 2Z0BA 4NQCA 3SDDC 5EZIH 1OP5H 3TYFB 3KPMB 3UAJD 3QXTA 4PJXE 1HK6A 5HGHA 3CVHB 4YFLF 5EU6D 1CF8H 3GKWH 4D0CA 2JLLA 1U58A 2NTSP 5ESVB 1OAXL 4MXWH 4LCIL 5INDA 4X8JA 2DQCL 2W9DH 5HY9A 1CGTA 4NFDA 1VDGA 5BV7B 1CYGA 1LK3H 3HE7A 1YEDB 2VITB 3QEGH 1WZ1L 1IEHA 1PFCA 1QFUL 1MJ8L 3QISA 3RVUD 4WO4A 1CXFA 4RZCA 3R06A 3DROA 2XZQH 3B9EA 4MMXC 2DI8A 3VG0L 4E41A 1CXLA 15C8L 3S35L 4R90L 1QFWI 1OP3H 4JN2A 4X8XA 4U1JB 3DVFA 5F70A 3JSSA 1NMAH 3NA4A 5E00B 4WEUD 15C8H 4X4ME 4R90H 5IROC 1ITCA 4HD9A 2IH3B 3UJIL 3WEXB 5HYQA 2R23A 4OF5A 1RZ7H 5DD6B 5IHBA 2X4PB 1XF3A 3B9VA 3TYGH 2V2WA 1MRCL 2CIKB 2FX9L 2N4IA 3T4AB 1YEHH 4PGEA 1BPVA 4DOHB 4Q7DA 1AGFB 1Q94A 4KK9C 4OZGE 5GSVB 3BRGC 1AKJD 4GQ9L 3K2MC 3TJEL 1MFDL 3QDMB 4KK6C 4M00A 5GRZA 3MLYL 4ZAKA 3IF1B 4AIXA 4G7VL 2X10A 4Z7VE 1FLTX 2X89D 5GRXG 3T0BA 2OR9H 3WN5C 2DICA 2VLMD 5F1KC 4CU8A 3QI9A 5C08D 5E99L 4KHXH 4Y19A 3VFTB 3QIUC 2IFFH 4YBQC 4LSSL 2BNQE 1X5LA 3OJ2C 1O5DT 1H0DA 3QI9D 1TFHA 3VFUA 1AHWA 1QSFA 5B8CB 2PNDA 1H8NA 3IS0X 4U3HA 1BM3H 5LG1A 3W0WA 1OLLA 4Y4HB 2YC1B 4HV8B 1JHTB 4WU5B 1GJIA 4L8DA 1NC2B 1KXTB 3D39B 1C12B 4M1DH 1FFPB 5CWSB 3PWNB 3LV3A 5KS9A 1BBJB 3QDGA 2CH8A 4G3YL 4HG4J 3BP6A 4LL9A 1OLZA 2A1WH 3MR9B 1RHHB 1FVEA 3QDGB 2UWEA 3BE1H 4F33A 5CWSA 3UPAA 1C12A 1OGAA 3RGVA 1J0JA 4ODWA 2UZIH 3JUYA 4IS6B 1BFOA 3GMOB 3X11A 2FJFB 4Z9KB 3ZSTA 1UCBL 4YXKH 3RDTB 4O5LH 4UV4L 3BDXA 3OJMB 4DTGH 3EJYC 4MVBD 3S36H 5MP6L 1C5BL 3SDXE 2FEDC 5EU4A 2CUHA 2CKBB 3ORJA 1JI2A 3ULVE 3RHWF 2F58H 2UUDK 4N8CL 4OLWH 3U2SB 2ZJSH 5TGBB 3JWDC 5HJ3A 3JWOL 2QQNL 2GJJA 1U8MA 5F6HI 3E3QE 1TJHL 4OLZL 5T3ZL 3R4DA 4WWID 5TDPB 1X5FA 1YC8A 4M6NH 1F3JA 3U7YH 1YNTB 4XH2A 4RAVB 2VXUH 2VLRA 1X4YA 3MO1A 5DRNB 4Z7NE 1TPXB 3MJ6A 1F6AA 4HQQL 3SE4C 1I85C 2NY6D 3UTSE 4AEIH 1T2XA 2Q86B 1XIWD 2WBJA 2VL5B 1BD2D 1N5AA 5I8EB 4HCRA 5EIQA 3RY5A 1HEZB 4U6VH 1DEEB 4DN4H 4HQQH 4NDMB 5DUPL 3FT4B 3OKLA 3B9KA 4OLUL 5FM5M 4AEIL 1KYOK 4PJ9A 2JCCA 2CMRH 1JPFA 1CGXA 3EW3B 3RWCA 3T2PA 1NAKH 4OIBA 3DIFA 5CBEB 1P2CB 5FGBC 5DK0B 2X4NA 2AQ3A 5L8LB 5C0FB 2AGJL 4O4YH 4I18A 1A6VH 1ZOXA 4LLQB 1T5WB 4NQUA 1F6FB 4LEXL 5D7JD 1YEDA 2VITA 4HG4K 3QG6B 1D5IL 2ZCHH 2NXYD 4RGNE 1GGTA 3DIFB 4KJQC 2I9TA 1FZJB 5ILTH 1BOGB 4N0CC 3SGDI 1RZGB 1RU9L 3O9WC 5TE7H 3LS5H 5F1NB 1HNGA 1QO3A 3VD3A 1NCCL 3NIFE 5GGRA 1JPFB 3BP4A 4FQXD 5EULV 4LNRB 1S7WA 1BFSA 3LDBC 4MAYB 1VADB 1W0YT 4PRHE 2AJYL 3H0TA 4NO0B 4YPGA 2XTJB 4HCRH 2QL1A 3X14B 1CLOH 5BZWB 4JCMA 4JY5H 3T2NH 5ADOL 2AJYH 4JFHD 3QUMA 5CLWA 4HJGA 3KPNA 2EDDA 4IMLA 1EEUA 1X5XA 4RAVA 3KYOB 4XH2B 3LS4L 3EYOA 3UTPD 4JFOA 2C1PB 1P7QD 3C2AH 5BVPL 4QTIL 3MJ7B 2YBRA 5FO9B 3QJFA 4JPWH 3P0VL 5J12B 3WNPA 5LBSL 2ZCLH 2L4OA 4G8IB 2MCPL 3VRJA 2BVQA 1TCRB 4JFFB 3KPSD 2BSED 3NIGE 3GSRA 1ZVSA 3U36B 1JRHI 3CZFA 4PJXA 4NM8L 1MY7A 5TF0A 4XPBH 3SGKA 5J56B 2CLRB 1E4XH 6CGTA 1EGJL 2A0LD 2HJFB 4U1HB 4CVZA 4AENB 4LSPL 3REWA 4LAJH 1XGPB 1CVRA 3TH3T 3WLBA 4PJIA 4BSWA 4RRPA 4GLRH 1PX3A 4ZUSA 2DYPA 1KYOJ 2PO6C 1I1AA 1J1PL 5T1DH 3MRJB 3V8OA 3L3KB 3RX7A 1IGMH 1XF1A 5D2LF 1GOHA 1EFXD 4KTYA 4PJGB 5EOCH 2EDKA 3BIKA 3PQYD 3QIBA 4HJ0D 4CU6A 3S5LA 3VXRB 1ZVHA 5ESAA 1RI8A 4WFHE 3EOAB 3HNVH 3OR7A 2YPVH 2Z92A 3GJFK 4A2MA 1MREL 3QIWC 3SKJH 5JIKA 2ENSA 5EOCL 3PWNA 4WO4D 2DQHH 3VXUB 1CVSC 4WUKL 4AMKL 3QUYA 1DL7H 2PW2A 1IC5L 2OR8A 2NR6D 2CLZA 2PTVA 5FYLE 1GL4B 2F5BH 2I27N 3H7BB 3JV0A 4HIEB 4HIXH 4HKZB 1UEMA 4JPVH 4LIQH 5DYOA 4FFZH 1UXWA 3F7YA 5DFWH 4U1IB 1OSZA 5I74B 2ZUYA 2F8XC 3EFFA 4PRNB 5IVXF 5DO2C 1Q0YH 1HILA 4NZUH 5HHOA 3ARGB 4Y19B 1DBML 3TA3B 4WNQB 3Q6FB 1U3HB 3FB7A 1FORH 5JPNA 3RWDB 3CCHB 2I5YH 5C0AD 3C5ZA 1SJHA 2H3NB 1OTTC 2XV6B 4L4TB 1LE9A 3O6FA 3FONA 1JGUL 1NCTA 3QDMA 4KZEL 4WWKB 4X7SH 3P77A 4HKJA 4Z76B 5CJXA 2JK5A 5DQJA 4Y5XA 4WV1B 1OAYL 4OFYA 2B0SL 4PJDF 1P4IL 4X6EB 3WD5L 3BPLB 4LPUA 1QSFE 4NNYA 1XF5B 4XVJH 4AEHH 4LLYB 3LVEA 1I7RB 5EO1A 3HZVA 3QNZB 2B4CH 1ZEAH 5I71B 4J4PD 2DLTA 4Y2DD 3VXRE 5E00A 4U6YB 2QQKH 4APQB 5DJDA 4Z7WA 5DI8A 5HBBA 3LQZB 2X9WA 4L29B 2KQMA 4ETYA 4DZBB 3T65A 1G7LA 3L3IB 2BVUA 4DCQA 5C9JB 1Y6MR 3ARUA 2C3XA 5E8NA 3FOMA 5MENA 2WP3T 1UWGH 4RMSA 2UWEE 4G6JL 4ONGH 1Z9SA 5ACZB 5BS0D 1NSNL 1DQQB 1EJ6A 5E8NB 3HNSL 1G9EA 4Z95L 2R1WB 1EO5A 3DO3A 2VZ1A 1JRHH 1U8NA 1FYTE 1BQHB 3B9KD 5DI8B 5HY9B 3ZKQD 5EU7C 5IVZB 5D5MF 1MFAL 3U30B 4Z0BH 5ESVA 3QA3A 4BQBA 5DVKA 2P5WE 1P4BH 4ZAKC 4DW2H 2IH1B 1NJ9A 1JPTH 4KC3B 3RZCD 1B4JH 2MJWA 3QCTH 1MFCH 2AEQL 2R4RH 4G42B 3MRBB 2GJ6B 3RI5K 5L0QB 4LPXA 3DX7B 4F2MB 3WSQH 4XZUB 3M45A 2V9TA 1OAZL 1BREA 4G8EA 1MFCL 3QCTL 4HLZH 1EEZB 1RQ5A 3D2UD 5TE4L 3K4ZA 5LQBH 3ALXA 1GAFL 2H1PL 1I3RA 2BSSB 3WN5A 3LSOA 3O9WB 1CWVA 3MRKB 3FONB 3DUHA 4NRYA 1IT9H 1F4WL 3OKMA 3O2WH 3FB5A 4RAHA 2BX5A 4C4KT 3WMSA 3VMNA 3K4AA 4RBPH 2CIIB 3T0WA 1H5BC 4PP1D 3G6AB 1ZSDB 5FHAH 1NGWB 3E3QC 4DGVH 5HPMA 5KSBA 3FB7B 2W0FA 4U1MB 1V7NH 3DBXB 1UJ3B 2EDEA 5FUOH 2G60H 3TA3D 4GKSB 2OZ4L 2BCKA 1G6RL 4JJ5B 3AM8A 1I9RL 1LK2B 1NFDE 3MRCA 4XMKL 1NMBH 3EO0B 1B0GA 3FZUC 2WIMA 4UZGA 4LRIC 3VH8B 3V6OC 5DJAA 5SWQA 1CFVL 3WXWL 2E9BA 1S5IL 3MV8A 1EAPB 2JIXD 3A6CL 1CK0H 3OBAA 3FFCA 1MF2L 4XMKH 5DJCA 1OTTD 4PJCF 5B22A 1CFBA 2EKSB 2X5PA 4GXUN 4FQJH 4PP1C 3LMJL 5TQ2H 5GS0L 1UB5A 3VXOA 1H8SA 1YNLL 3U0TA 4XTRC 4MD5A 2F19L 2EDQA 5H37G 1UZ6E 5DO2D 5SV4A 4X5WB 3UPCA 3C8HA 5D7LB 4UU9A 3UBXB 4EKXA 5J4MA 1IM3A 2FEEI 1BEYL 3SPVB 1PG7L 3D48R 4OD2A 4EN3C 2Z8SA 3UYRH 5C0DB 5I1CL 2YN5A 4QRQA 1V3KA 3LHPL 4YHOL 3RZCC 4F8QA 3E2HC 3GMQB 2IAMC 4MCZB 4ZAKD 5C0AE 3BT2L 1BGXL 1CLZH 4GW5A 2ZNWA 3K8KA 4AIZB 3D87B 1K3ZA 2V2TB 2AP2A 3PHSA 1LVEA 4X98B 4ZD3L 1DFBL 1FNLA 3MV7A 1KTRL 5C0DA 3ZE0F 3QUZA 4CN4A 1NBYB 2R2HB 5CIPB 5E95B 2ESVE 1CS6A 3EYOB 1IQWH 1CLZL 4CDHA 3L7FA 3AC0A 3GB7B 3BISA 4ZD3H 5HYSB 3BKYH 3WFCH 1F2QA 1Q9WB 1Y0LB 4QRSA 5GRJL 1TVBA 3VW3H 5IG7B 1FL6B 3WFCL 1GZPA 1CGVA 1ZT4B 2Q1EA 3BAEH 4XNQB 3T4YB 4WI4A 2YOCA 5I1JH 4LNRA 3DVNA 4M02A 3ILQC 5GGRB 1I9EA 1EAPA 2E7BA 4IRSB 3ZKNC 4OFDA 5E6YA 1MJ8H 5IVNA 2E6PA 4YHNB 2NY5H 2AERT 3D0VB 1U2CA 1DLFL 2JCCF 5IB2B 1ADQH 2BVYA 4HF5H 2R39A 3K46A 1HQRB 5AUMA 4LLQA 4X7TA 5HYFA 2VWEE 4L8SA 1T03H 4JZOA 4OLVL 3QDAA 4JQXA 1AXSA 4U7KA 2NQCA 3BH8B 3CFBB 2K3TA 4BSVA 5FECB 1U8JB 4KMTL 1S7TA 1RZ7L 4PJDE 1YYML 4B0MM 4WDIB 4A6YH 3TYGL 2BXYA 4XRCA 4OCYL 4LKCA 5IHUH 1M7IB 2ITDB 3RZWA 2R1YA 3WUWA 4P5MA 1EH9A 1KIQB 4OZIF 3LSOB 4GQ9H 3MRPA 4LAQH 3PABB 4LCCC 1FZKB 3QP3A 5IHUL 5I66A 4N9OB 3VXQB 3TNNB 2ILLA 2Z93A 3IRPX 4P23C 4GG8B 3GSQA 1U8PB 3MRBA 1U92A 2IWGA 3FN0L 1I7TA 3BRDA 3ILPA 1OM3H 5KSAA 4GAYA 4HMDA 4ZUTB 1A7OH 3RJDA 1RK0A 1MEXL 1I8IA 1TQCB 1VGEH 2IPTH 4S1QH 3ECBB 4M1GL 3WS3B 4N5UA 1GGIL 3BKJH 5D6CA 1OM3L 1N6QH 3KVQA 4ZDHA 1A7OL 1J5OH 3O45B 1T0PB 1WBXA 1BFTA 4MHHG 3ZT5A 5I2IA 1WJ3A 4M48H 5E8OB 4GKZB 4OZIA 3FKUS 1EMTH 3PGDA 4QWWD 1HHGB 1MLBA 8FABA 2P24B 1T22B 3HA0A 4C56A 1KB5L 5ELIA 3BHBB 3G9VA 4WI9A 5FGCE 4MNHB 4LU5H 4U6YA 4J3TA 4LASL 4WFFE 3X12B 3IXTB 5JW4M 3L95A 3SJVA 5E9DD 4N0UB 4PJIF 3T1WA 1R3LB 3T2OA 1R3LA 4OCSH 3TCLB 1RZFL 1E0OB 3SJVB 2A6KB 4EBQL 3DPBA 4U1NB 1RUAH 2H2PD 3HTLX 4O5LL 3GIZH 4HZLB 4M7KL 5E5RB 1DN2A 1MOEA 4P46A 4RGOL 3V4PL 2ERJB 3K1KC 3WBDA 5GS0D 4JY4A 1QA9A 5MEQA 3MLVH 1T0MB 1KF9B 2F58L 4YDIL 4DKFH 3B4NA 3W39A 5IMOB 4M6MH 4P4RA 3AFLA 4ZOCA 1UYWH 4OZGA 4JEGB 1V7ML 5EH1A 5IW3A 4U2YA 3FT3B 1C7SA 3HG1E 4HDIB 5JPNB 3BWUC 5BRZD 4OLZH 5J1SC 4WNQA 4M6NL 3LQAH 5DEGA 5ESQB 1UYWL 2W59A 5HHME 1RK0B 5DK3A 1KTLB 4J3WA 4PV8A 3VXSE 5C71A 3R0NA 4JB9L 1MAMH 1JHLL 3F7YB 3S96B 1I8LC 4RGNB 3TO2A 1TETH 3Q5OA 1JK8B 4XNYL 3TT3L 3ARBB 2YUXA 3F7QA 1CU4H 4QF1B 1MAML 4JRXB 2EIZA 4L8SC 4TPRH 3VXUA 3WS6C 5I76B 1FZKA 4QOKE 4M93C 3BGMB 5HI5D 4OZ4A 1NC4D 2Z92B 2X4PA 4K7FA 3WFHA 5KSVB 2R1YB 5DA0B 3ARZA 1R24B 5BRZB 4L4JA 3W9EA 5C1MB 4QRPD 4LKCB 3O8XB 2CLVB 4Q9QH 3PP4H 4XPTH 2IPKB 4X4MA 2CRZA 3I3EA 5DZLA 2XFXB 1FN4A 1T1XA 3B8YA 4FQ1H 1A6AB 3C6LA 1MCSA 1U2HA 4PJ9C 3FFDB 5CJOL 1PKQA 4XPTL 1HIMH 4CVZB 1BIIB 2VLKB 5DHYA 2HJFA 4F58L 3OJVC 4EXKA 3LS5L 3QUYD 4K23L 1YNKH 1LEGB 1WC7A 1OD9A 4U33A 5ICZB 5C9KA 3AUVA 4HCRL 2AABH 2E8ZA 3T8XA 1FAIL 1EEQA 3ULUF 4D0CB 3KYKH 2XRAL 4HUKB 1F4AA 3SDYL 1A6WH 4HX1A 1IC4H 1HQ4A 1SM3L 2O5XH 3O3DB 1A2YB 4KMQA 1FL5B 2B4CC 3OKDB 1D6VL 4NQCB 4RIRA 5J6GB 1D9KA 1NGPL 3LS4H 5C0AA 1A3QA 3EDKA 1QLFA 3WUZA 1ZA6A 3VXNA 1SM3H 1T2QL 2O5XL 3VXNB 2BFVH 5D8JL 5J11C 2MQ3A 4ZOAA 3SDXF 2QSCH 3BPNC 4E42A 5LBSH 4ODHL 3OL2A 1FL5A 3MSPA 5C08B 4F7MA 1BQUA 2X09A 5IKCA 2VJXA 3RPIB 1R3KA 2BFVL 4WV1C 1A6PA 2VIRA 3MBEC 4WWKD 3RVTD 1KBGL 4BQ6A 2WP3O 2OCFD 1RZKL 2VDKL 4M8VA 3E8UH 4G9FA 3M8OL 3ULSA 5H8DA 1OSPL 5KAQF 4W4OA 2ZCKH 3MCKA 2JCCE 2NY0D 2DQGL 3TC9A 4KI1A 4OM0L 4R8WH 1X5IA 3C09C 1DQDH 3IDYC 4FFVC 1OL0A 2PN5A 3ZL4H 3DARA 4P23B 1GYAA 3FB8A 2EC9T 1R6VA 1AGBA 3W11C 4QTHA 1DVFD 5L6YH 1PKQB 5B4MC 4HGWA 3NH7L 4UINH 3WXVL 1Q0XL 3FFDA 5BO1L 4Y16B 3ZKND 3UJTH 3SDXA 4UV7L 5DZOA 2Y23A 4H8WL 1JZ5A 1MREH 3SKJL 5EC2A 3NH7H 1ZGLM 4NUJA 3UZVB 4Q2ZA 2J4WH 3UJTL 3VA2C 2Y25A 1YDPB 2EKSA 2Q20A 3O6LL 4JO2L 4JPIA 1GZQB 2R0ZH 1DANT 1K85A 4GUPA 3TJEH 1N5AB 5I8EA 2VL5A 3SGEH 4X7EC 5L2JB 4HIXL 1DQLH 3VXRD 2KZ1B 3LPFA 4PRHA 4NJ9H 4BZYA 3EYSH 2QTEA 4GRWH 1NFIA 4NQTA 4QF1A 3CFEA 2WLZA 1NLBH 2A9ML 2VOTA 4M4PA 1DBMH 4GMSH 5L8KB 5E56A 5CSBA 2WLYA 3CFCL 4HS3A 4ODXA 5CGYD 3QEQA 2YD3A 3HUJE 4HWBL 5E2JA 3HG1D 3RA7H 4ZFOB 4PJAA 3SGDH 5EN2A 4ZOBA 3CXHJ 1J0IA 3S9DB 5HVHC 3LEVL 4EOWL 2NY4B 5DEZA 5DZNA 1ZSDA 1UB6A 1ZGLP 1ZK9A 3RA7L 3M17A 1U95B 1A1MA 1QLRA 3MJ9A 1YEFL 2WQ8A 4XNZC 3FB5B 5HGGS 3IJSA 2HFGL 3HRPA 3MYZA 2BHZA 5GGVY 4NRYB 5C0CA 4RCAA 1QRNA 1L4IA 5D2NE 1G7JB 4BKLA 4J6RH 3NPZB 4IS6A 1EEZA 3C5ZC 3IFLL 2YPKB 4QHUA 1INDL 3SOBL 3CSPA 2F15A 2C1OB 5DD5L 3IJYA 4JLRB 3TBWA 3L3OA 1XF4B 4NC0B 4Y1AE 4AM0A 2QSTA 3BPOC 3VRLF 1INDH 3BZDA 1N4XL 4GW1A 5IVOA 3VXMD 3W9DA 1RAMA 2YXFA 4YXKL 5J13B 3CDGB 4NFCA 1UWGL 5JW5B 1H15A 3D39A 1EUUA 4LDOB 4NN5B 1G9MH 1NCWL 4KVNH 1N2RB 2I25N 2V5SA 5FM5O 5KZCB 2HRPL 5D7LD 3TWCH 5K93A 4JZJC 3ZTNH 4R4FH 2DQCH 3VFUB 1FFOA 4LHUD 1W2KT 2DQIL 3RVXD 1NCWH 1WBXB 4KVNL 5I2IB 4HHAA 2FYYA 4RQQA 3T65B 1XR8B 4CRPA 1KACB 1EHLH 5F6IC 2UV3A 1JPTL 1IQDA 3HUJB 2DBLH 4QYOA 2W9LA 2XZQL 1I8IB 4F15B 1EPFA 1F45A 3ARSA 2AJSH 4GAYB 2GTZA 1I7TB 1U92B 5ANMA 5BV7H 4KGLA 5EU3A 4KDVA 5DURB 2ZP0T 5KTEL 1PY4A 4LKXA 3VGAC 1ACYL 3GMLA 3BIBX 5IMLA 5GSVA 1GOFA 4DN4L 4G6FD 2NX5E 3VCLB 4QHUB 4X6EA 3CUPB 3IETB 4RAUB 2BERA 3D9AH 1KN4L 1FE8L 2CIKA 5I1GH 2V2WB 4YBLB 3EYVB 5FB8A 3T09A 3WEXA 2OJZH 3BKCL 4R96A 3IJSB 4OQTA 1FE8H 1SJHB 2AGJH 4MA1C 3FHQA 4L4TD 1U3YA 1XF2B 1A64A 4U1JA 5HD8D 5BJTB 1KLFA 5FGSA 1Y18B 4QRTB 4D9QE 2X1QA 3GRWA 5DT1H 1U3HD 2VKWA 3BW9A 1A7RL 1IAKA 4FMFA 1CFVH 4J3XA 1N26A 4KHXL 1FYTB 1S5IH 1FPTL 2V17L 4BZ1L 1MF2H 4N8VG 5DRZA 1KENH 1T0NB 3D0VA 3MROA 3VRIB 4ZSOE 3L3DB 2PETA 4DK6A 5F7LB 2Y5TB 1PKQE 4YO0A 1IVLA 1DBAL 4F3FB 4KUZL 2DLHA 5TQ2L 1DANU 3GIVB 3LN4A 5GS0H 5E2TL 3SBWC 1YNLH 3DI2B 4KJPD 2ZUSA 4Q6IC 4OGAD 3EOAA 1CDUA 3AS1A 4PG9A 4RNRA 5HHOE 2AV1B 4CJ1A 1CLYL 1DSFL 1YMME 3KLHD 2NW2A 4KUZH 1FVDA 3B2UD 1HHJB 5D1XB 4L9LC 1BOYA 1UADC 3IDMA 4P2RD 4HK0A 3GGWA 5I1DB 4UIMB 1P84K 3SO3B 1Y0LA 3S88H 1SY6A 1HSAA 4YHLL 1SVZA 4ZUSB 1FIEA 3UYRL 1JN6B 2F53B 1YEIH 1XGPA 2PCPA 2FGZA 4HUXB 2HVJA 3LHPH 3CSYA 1C1EH 5HHPA 5CGMA 4UOW1 3SKOB 1F4XL 1CN4A 1DEDA 4X7DC 1FQ9C 2CLRA 3BT2H 2V2TA 2VC2H 4UIKH 1CD9B 3B2UC 5LWYH 4WTZA 5F7UA 5FYJL 3MV9B 1VFBA 5GISL 1ACZA 5JQ6H 4UV4H 2GJ6D 2PXYC 4XNXL 4G9FB 4WUUB 3S36L 2EH7H 1J0HA 1VFBB 3I6LE 5GS3A 5C0JA 3HAEG 1JMZA 4K71C 4I48B 5GZOD 4IHOB 5FYJH 5FO9A 5I1EH 4KRLB 4JFFD 3BJ91 4DUVA 1CQYA 5J7CC 3DSNA 3C5ZD 2NR6C 3VW3L 1K6QL 1U93B 1UM5H 1IGML 1VPOH 2PR4L 3DVGB 4GKOA 2AKRB 4GRWE 3UBXA 4UU9B 4JQXC 3KPNB 4ZPVB 1HSAB 4I2XB 3F7VB 3EIFA 3QDMD 4K3HA 4KQ4L 5CP3A 4TTDC 4Y0GA 2IQAB 3UDWC 4OLEA 1LO0L 4J7RA 1F58L 5HD8C 4P2RA 4WUKH 1YEJH 5DRWA 5D1ZB 4ZXBB 3B83A 4HUWB 2X2YA 1HSBB 3MGTB 2F5BL 4U6VL 3KG5A 1T20A 5C2UB 3GM8A 4JPVL 4FFZL 4W6WB 1UZ6F 1BOGA 4M61A 5E2WL 2WQRA 1Q72H 3QRGH 1F3DJ 4DAGH 4AT6B 1NCUA 1QFWH 1B0GB 3SEPA 4PRIA 1NAMA 3P0GB 1K9TA 1DE4A 3VXSD 2ENYA 3NFSH 5EUKA 2DLFL 3QUXA 4LLWB 2I5YL 3ULVD 5JHDE 4MS8D 5IW6A 2C26A 4A6YL 5C0FA 3MUHL 4IJ3C 5DVLA 3KJ4B 3BDYL 3TT1H 2VLME 4O4YL 1Y18A 3DXAD 3NAAL 1MHEB 5B21A 1LGVA 1SEBA 2DLEA 2NMSA 4P9HL 1XF2A 4EUPB 4QT5B 3BXNB 3GJFB 4M1CD 5L8JB 2OJEB 2ZZUT 4M62L 2MCG1 2CIIA 2VXTH 1UWEL 5DEFA 5EOCJ 4P4KC 4Y2DC 3FTGB 1C16B 3WO4C 5FKPB 3VGBA 4P9HH 3MLPA 5IESL 5EBGA 3FO1B 2Y07L 4PJCE 1T89A 1UWEH 4GOSA 5D1QA 5IMMB 2DMKA 2X1PA 4D9RE 4P9HC 5DFVC 1F6AB 4GXUM 2WBJC 3I3BA 4IRJC 1LO3L 1CLOL 1I85A 4Y1AD 4I2XE 3O3BA 5ALBH 1JJUA 1JK8A 2P8LB 1EIBA 1F4HA 2Q76A 5CEZL 2XA8H 3TNMB 2WNGA 4R0LB 2Z35A 4NO5A 5HTSA 2IH1A 3PJSB 2IG2H 2JJSC 3VXUD 2D0GA 1KTLA 1WFOA 3QUZC 3ZE1F 4N5EC 5J3HC 5C09B 1P7QB 4G6JH 4Y4KC 2NYYC 4MQ7B 5D71L 3WO3B 1Q9KA 2CKBA 1FRGH 3IU3A 1JYVA 1OGAE 3OV6A 3ZYZA 3OKEB 5EU4B 4S0SD 3G6JA 1JRHL 3AREB 4XCNB 3VJ6A 5FYKE 4GBXA 2ADFH 1MFAH 4EIZC 4LCWE 4Z0BL 1T0MA 4F7PA 4APQD 1QA9B 5MEQB 4DCQB 1J0ZA 4KPHL 4D0DB 3Q6GL 4PV9B 2ID5A 3HCVB 5EPMB 3K80A 4U7SA 1I3UA 5DJDB 1H15B 5F96H 4APQA 3S35X 2VDPL 5EC1B 2QKIA 2CGRH 1YJDC 2DIAA 2BOCA 3Q6GH 3P11L 2PO6B 1RUAL 4I0KA 3DURB 5E2UL 1HHKA 3H9ZA 4ELKA 4G6KL 2NW3A 4OF3A 1C5DB 1YJDH 1XIWC 2F8VA 4QRPE 3L3OB 2E7CA 2UY7A 4UQ2B 3X12A 4HULB 4XAKD 4EEEA 1RUQL 4XCFL 4BSJA 5K9QI 3RL1A 4HV8A 1UENA 3O4LB 5ANME 1JF6A 1IC1A 4YEFA 5M7QA 4M6AA 2VB5A 5IUSA 4K94H 1HHGA 1MLBB 3WCYA 4XCFH 1Z2KA 4PRPD 5E1AB 3IS1X 7FABL 2EE6A 5F9OL 2V5MA 4HAFA 3BO8A 4POUB 1MFNA 2NLJA 5BZDA 3QZWB 4U0RC 3TN0B 5I1IL 3GSWB 3LKNA 4F80A 3VXPB 4LNVA 3K4DA 4W4OC 4ZFOA 5FHBL 2MOVA 1Q1JL 3Q0HA 3NBNA 4IDJL 1T1ZA 3ISWA 4ZO6A 1QPPA 3ALPA 3CPLA 2VXQL 5C09D 1FORL 5B4MD 2R2BB 1A3RL 1PYWA 3A6CH 4LPTA 2FL5B 1IM9A 5C2BL 3GSQB 1FO0L 1WIPA 3D25A 4AG4L 1FG2A 3CXDH 2QQLH 5D6DA 3QUYB 4NOFA 1D7FA 1S7UB 4N90D 2AJUH 4MA7L 1QSFD 3NVQA 3PABA 4KZEH 3WUWG 3UC0L 4GUPB 1RMFH 4K7PH 4YDLB 3RKDD 3KPOB 5JW4Q 1YYLH 2W92A 2VQ1B 4XPHL 4Y16C 4PJGA 4HIIB 1OTUC 2R1XA 1KJVA 2H6PA 4QRRE 2VQTA 4F58H 1V8HA 3WFBH 5HYEA 1PD6A 2GCYB 4PJIB 1N59B 4WRLA 2AXFB 4X0KB 1AGBB 5CZXD 1G7QA 2XPGB 1S7RA 2FEEL 4CDGC 5JOPE 1LDPL 2DQJL 43CAB 3QEHB 4XCCH 5D2NC 5L88L 1I8MA 1ORSB 5SWZB 2HT2C 2RBLA 3GSOB 4NKQB 1HZHL 4XWGL 5C09A 4XCCL 3V95A 3L1OL 4JVPA 3QXAB 4UBDC 4LP4A 1HOCB 5GGRY 3ABZA 1HDMA 3MRHB 4I3RL 1QNZL 2VDOH 4JRXE 5T1KB 4F7MB 2QSCL 1JE6A 2HTKC 5IG7A 1GPOL 4M93B 2GSGB 3MOBH 4P57A 3PL6A 4I3RH 4PBXA 1A22B 4NIKB 4NN6B 1KBGH 2B7DT 5E03A 5C70A 4KDTA 4RIRB 3ARYA 4NBZB 1NEZG 5C0IB 3CVHL 4WFHD 3V4UH 3PP3K 4BH8A 5J8OA 5JW4R 3BN9C 4MAYA 3ZT7A 1KJ3L 4UOW0 4DZ8A 2ZOLA 3LKPA 5ID1B 3GSXB 5CINH 3T8XB 3QDGD 2W0KA 3BH9A 5M95B 1C5CH 1ORQB 3MYJB 3ULVL 1KJ3H 1YZZA 3NIGF 1EO8L 4AIOA 4NHUB 4JZJA 4OKVA 3S35H 1FG9C 4MDIA 1BIHA 3NPSB 1FFRA 5EIIA 3H3BC 3OAUL 3ULVH 1YYMH 2W38A 5IB5B 3SDCB 1EO8H 3VMPA 1ED3A 5E7BA 4O2EA 2XKSA 5CBEA 4PJCB 2VYRE 2XY1A 3SGEI 2DB8A 1G6RH 1T20B 4XP9L 2IPKA 1TZGH 2BJMH 1KCKA 4POZC 3HG1A 3PIQB 2GK0A 1RJZA 4H0GA 4X6FA 2AK4E 1VGKB 3FT4A 4PP2B 2CDFB 4K7FB 3WFHB 1NLBL 2VZOA 4U05A 4KI5E 4OZ4B 3FFCB 1EZVY 5HI4C 3SN6N 2A9MH 4AL8L 4LCWB 3QDME 3O3EB 3UO1H 2VLKD 5GSRA 4OGZA 4S11A 3D25B 4LVOC 1VA9A 4NPYB 4ZYKA 2O26U 3TO2B 4LARH 4PTTB 1S9VB 4LVNC 1FNHA 5D2LE 3RJQB 3WFEL 4FQPA 3JTSB 1MQ8A 5IQ7L 2J12B 3RZCA 1HHHB 4NSKB 4NQEA 5KSBB 1E4KA 1KCUL 2FWOA 1QYGH 4FG6C 4ESKA 1EK3A 3HE6A 3VDAA 3O4LE 5EBLB 3WFEH 1H3PH 4GRLA 1JBJA 3VGHA 4NC1C 3MOQA 3IFLH 3SKOA 1ZANL 4U1KB 4LU5L 1BQLL 4DVRH 1TCMA 3P3YA 5I8KH 4BM7A 3RDTA 9CGTA 2HFEB 4JY4B 4D8PB 1I3RB 2BSSA 4Z78A 1QBMH 4H25A 4NZRL 4XXDA 4HK3N 2BNRA 2H8PA 5IWLA 3HI5L 3ZDXF 4U0RB 3TN0C 35C8H 5I17B 1V3LA 1QSEA 2A6KA 4LCUA 1BD2E 2WINB 5MEOA 3TIEA 1T66D 3VGEA 2BNUB 3QPQC 1HHKB 4GG6E 3SDDB 3TV3L 4PG9B 3K7UA 3O6MH 4YDKL 3C87A 4ELMA 1WBZA 2R0LL 5GS2H 3MLVL 1IGTB 4F3FA 4MNHA 1UVQB 3PWPE 2YPLA 4LFHD 1T5XB 3MJ9L 4P23D 4OZHE 3HCVA 5EPMA 2YC1A 2UUDH 3O6ML 5DMGD 1M7DA 5GGVH 3TV3H 3ZSSA 5EO0A 3GI8L 1AE6H 2P24A 3VWJC 4CJ0A 1DQQA 4OD1H 4YFDB 5JXAH 3GI9H 4OZIB 3AS2A 1XEDA 5FV1L 4XVSL 3LQAL 1Q9OB 2CKBL 2YWZA 4MA8H 2EZ0D 2FZ3B 3OKEA 4YNYB 4HUMB 2BVPA 4PJ8A 4OD1L 1TXKA 5BJTA 2PTTB 3ZT6A 4R7NA 5KTEH 1FGVL 4CL7A 4MA8L 2XZCL 4JE4B 1UM6L 2WWMC 1JUFA 4G8GD 3IF1A 5HHOD 3WKML 1MNUL 5C3LD 4ODTH 2VSDA 3GMRB 4U1LA 1D5ZB 1DBJL 1X3DA 4Z8FH 1CICD 4UT6H 3U0PA 43C9B 3MACL 2P8PB 1Q94B 5GJTL 3U79A 1JZ4A 2VXVL 5C0CE 4Y5XB 3QB7C 1AC0A 1T7ZA 3TA3C 4Y5VA 4WWKA 5E08L 3EOBB 4FQ1L 3MRLB 4FFYL 2HKHH 5EU7E 4NUGL 3ARDC 2OJEA 4KJYB 5GQBA 3CCHA 5DT1L 1JL8A 3Q6FA 1S5HB 1XH3B 2LE9A 1IQDB 2Y9RT 2YZ8A 4X6BB 3X3FH 1AO7A 2HKHL 1R3JA 2YHGA 3AY4A 2PXYD 2BVPB 2Z4QA 4E41B 3OZ9H 2AEPH 1O7VA 3PWPB 5C0RH 4Z7QF 3G5ZB 2FZ3A 2EIDA 2IPTL 1NGZB 3P73B 3ZYOA 1ZMYA 2K1MA 1T89C 4PJ8D 4U1IA 4YIQA 4XBPB 3WFZA 1HQRA 3RWFB 4HKZA 4YHYB 4IRSC 1FAIH 4XPFL 2ATKA 1NCCH 4Y88A 5JO5B 1UWXK 3QDJA 1FC2D 5F1IB 4CW1B 8FABB 4ZUWA 1T5XA 2J88L 4U3XA 1EMTL 4IRSA 3QCVL 2XTJC 4QHMB 2OTWB 5K9QG 3T2NL 5EBWB 2FR4B 5EZJA 4BUHA 4LCWD 4OZGF 2JB5L 2G2RA 2BNUA 3KJ4C 3GBNH 3ZKSD 3WDHA 1Y6NR 3WS6A 4URTB 1XGYL 1AXTL 4D0BA 5D7KD 4I0PB 5MI0C 2ADGB 1F4XH 4L1DA 2EDJA 2BNRB 2AKRA 2XACC 3LRHA 4Z78B 1UCTA 1G7JA 2GY5A 3DV4B 1U3ZA 3IDXL 5FGCB 3T0EB 5C0CB 3O11B 4S2SA 1A0QL 3M8OH 3LKOA 2P5EE 4OCLC 4XNXH 2RB8A 5GHWL 2UZIL 5HVHB 4IHOA 4NM8H 5E9DA 1B88A 2X40A 1UB6B 4QXTB 2AAVA 5A43C 3Q3GB 4ONHA 4DKFL 3GMQA 1DN0A 1MI5B 5F1SA 1C5BH 5KOMC 4LSPH 4PJHE 4X6CB 5EA0H 1U8LA 5IBLD 1H3XA 2EYSB 1AP2A 3DOSA 5GJSL 2Z31C 4H8WH 3TJHD 1UEYA 3IGAA 2DWEA 5FOJA 2F53A 1G7PA 4MJ2A 4P99A 5HPOA 5T3ZH 5FA3B 4QOKD 1KJ2H 2ZKHL 4YQXH 4S1RL 5I6XB 3I50L 5IBUB 5BZWA 2FJGA 4XB8A 5IJVA 4MD4A 4ZSOA 1P5VA 2CDFA 1HN1A 4QHKJ 1YN7A 3JZ7A 4LLVA 4I8DA 4KQ3H 2VXSL 1YMHB 3D39D 1DL7L 3H42H 2ZKHH 1A6TA 1ZLUK 3MRRB 3G6JF 3CSBA 1JGLH 2IBZX 1U8HB 3ZE0E 4HJJH 4J3VA 4POYA 2DLFH 1XGUB 2VXSH 2Y5TA 1U91B 4KWUA 3JV4B 2R9HC 5E94A 4M7LH 1ZGLA 3QIUB 5I8CB 2BCKB 1JWSA 5IB4B 2G75B 3IFNH 3NN8A 1QQDB 5IHZB 4WHTB 2NY6B 5ENWB 2IFGA 5BRZE 1A6VL 1YEKL 2W9EH 2BNQA 1HI6B 2DLIA 2Y07H 2FNBA 3GMPB 1FV1B 2VIRB 3ZYIA 3NOIA 2AEWA 3U7AA 3DNKA 2RAMA 3WIIH 1P69B 1N6UA 2CR6A 1OHQA 5EOTB 1FAKT 3THMH 3KYKL 5ISZD 3GHBL 4OZIE 1CT8A 4CADA 1TTGA 5CEZH 1T1WA 4JR9H 4YX2H 4RAUA 3MJGX 3WIIL 3CFDB 4P57B 3O4OC 3QDGE 4WFFD 5F7DA 4JGMA 2HLFD 4X4XA 5HXMA 4JQVC 3WJLC 1RUML 2C3GA 3BGAA 3BKMH 3QWOB 1YNTA 3BEWA 3R1GH 4Y7MA 4JR9L 3DUUA 5T1KA 3ARQA 1A6UL 2VNCA 4ZS6C 6FABH 4RMUA 2IQ9H 5LCVH 1C08B 4MJ5B 5HDLA 5I30L 5TGBA 1D9KD 4HZAA 3P0VH 1I8MB 4NBXB 3IFOA 2DQUL 3BX7C 2A6DB 2ED9A 1OSPH 2WUCL 5DHVA 1ZS8A 3KDMB 4A2LA 3CFJB 3RU8H 1N59A 2HTKD 4DW2L 3W5MA 3JV6B 3HZKA 4PJ5E 1FN4B 2FLBT 1ACYH 1DDHB 2GSIA 4OAWB 2UWEB 4YHZL 3RU8L 4EDXA 1RUQH 3D0LA 2VQ1A 2HG5A 3V5KA 1NKRA 1IAIL 5MEPB 5TE4H 2AEIT 4ENED 4XP1L 5D96C 3FQNA 5KW9H 1NCAH 3TBTB 4WHYH 4QCIA 2ZUWA 1D5MB 3W0WB 4Q9RH 4F7EB 2ICWB 2QADB 3CX2A 3ARFA 3CPLB 3QIWD 2VAAB 3TBVA 4Y8DC 1AGCB 5DWUL 4ZOEA 4Q9RL 1Q9LA 4HEPG 3QPXH 3WKNA 4JKPH 4GMSL 3QI9B 4FXKA 3ARGA 4NO0D 3CFCH 5EN2B 2XN9D 1NMBL 2RCSL 2D03H 4TNVK 3RX8A 2RR3A 3U6RB 4HIEA 3H7BA 1KG0B 3ARRA 1XGRB 3ESVF 3KLDA 3BPLC 4MXVF 4LHJB 5KN5A 3KPTA 3MRQA 4JHWH 3DX6A 4QO1A 4N0YL 1L9MA 2GQHA 2O5ZH 3IKKA 1PGRB 4HMEA 4U1NA 3T4AA 1BVLB 3OJDA 2Q8AH 2X1WL 2FGWH 4J6RL 1KPRA 2NW3B 4Y19D 2YN3A 3C60A 2ZPKL 4N0YH 2ADJA 3GSNA 2HJLA 1LP9A 4KY1H 3KHQA 1KN2H 3S98A 2EC9U 3IXTA 1OQXA 3MRJA 3OMZA 1CDIA 1NEUA 3RVWC 3LRSB 5C0CD 1NBZA 4Y16A 5IW1B 3NIDF 5FUCE 4PV9A 2BSTB 4D0DA 1KN2L 1ZS8B 3AVEA 4WGVB 4BK4A 1PZ5A 3BGFB 3DROB 2FHCA 5C92A 4WO4B 2EKJA 1LNUA 3REVA 1KCSH 1NUDA 4H88L 1P4LB 2HJKB 2W91A 2YKLL 3IU3B 3E6HB 5IGXL 3MCKB 4JFPA 4BZ2L 5D6CB 3MRIA 2WUBH 4JFFA 4NKMA 1TZIA 5INDB 3TVMC 1C08A 4MJ5A 3TBSB 2BMKB 4ONFH 2BZDA 3UEZA 4YHPA 2I9LB 3LKRB 4FZ8H 4PREA 1NCDL 4EI5C 3BKYL 2P43B 1W8OA 5E9DE 5I19L 2NZIA 4R0LA 1LMKA 2C1PA 1EXUB 1C7TA 5GRJH 2BC4A 4L8BB 2GHWB 3BEWB 2APBA 3KYOA 1J8HB 4HWUA 1LO0H 1P4BL 2Z93B 1F97A 4DQOH 3G6JE 4KHTL 25C8L 1DTUA 2GT9A 5IMMA 3MLWL 3PWPD 5JLZA 3RDTD 4LLMB 5IFAL 2HMIC 3WUWB 3O3DA 3OXRB 3QRGL 1Q72L 3WJJA 1OTUD 5DK2B 1C16A 4HX1B 3MUJA 3MLWH 4D2NA 2NYYD 5DEFB 4XRCB 1GAFH 4L4TE 3LZFL 4JRYA 3BXNA 1S7TB 3GNML 1V05A 1RZGA 3PWJB 3CD4A 3SJVD 1WV7T 5FDYA 3NZHH 3ZDZF 5JMOC 3O2WL 4MA1B 2I9TB 2G5RA 1WFNA 3MLUL 1AXSB 4LSTH 4QRPA 1T03L 3L3HA 2PKDA 4QXGL 3DMMD 4XPGH 1KEMH 1MI5D 1I1YA 4K3DL 5INCB 5ENWA 1U6AH 3D18A 2DM7A 1MHCB 4PLOB 5KJRL 3DX8B 3HI6H 1JWSB 2WBJD 4ODBD 2HAZA 5A2KH 2D9CA 5D7IE 1S3KL 2VXTL 1ZHLA 2F8OA 5FUOL 5J06A 3H3PL 3W5NA 3C6LB 5B39A 3NABL 2V2XA 2E7LC 4LVHC 4YWGL 4M61B 2XNAB 1G7IA 4PJEE 4NKDA 1UM4H 2MQ0A 3MRRA 1FL3A 2YSSA 3LOWA 1XIWB 3ZDYE 4ERSL 3WXWH 1KUMA 1R24A 5BRZA 4P2RB 4O02H 2ZUUA 2W65A 3SCMB 3VH8G 4EZMA 1G6RA 1ADQA 2DDQL 4MVBC 4Y4KA 5DVMA 1QZ1A 1BVKB 2XA8L 1QRNE 5BCAA 4JRXA 1U8OB 2DKMA 5TE6H 3HFML 2DWEB 3DVGA 2XXCB 3ARBA 5A16A 1RURL 4K8RH 4WU7B 1IARB 5DF0A 1NBYA 2R2HA 1HYSD 3DVIA 5TDPA 5ADPL 1TQCC 1S7SA 4DUWA 4PV8B 2BHUA 1BEYH 5I9QC 2J5LB 3DV6B 4JREC 1F8TL 1BQSA 1DN0B 1MI5A 3B9DA 2ADFL 5HJ3B 1ZANH 1SBSL 3AY4C 1BQLH 1CXHA 3Q3GA 2A6JB 4JFDE 5KANG 5FXCH 1OB1A 3KS0J 1BD2B 1S9YA 3GBMH 5IMOA 3TLRA 4IIQC 2CD0A 4RFNB 12E8H 3CGTA 4CMHC 1NGXB 1MCBA 3BYYA 2ZSWB 5L2KB 1OT2A 3VWKB 1DFBH 2W0LA 1B6DA 5C6TH 5J0BA 4OCSL 1TJGH 2LV4A 3QO0B 4UIMA 4YBQD 1HKFA 3VG9B 4S1SL 1NDMB 3G9AB 5I1HH 3QIUD 1EFXB 5BW7A 4CMMB 4Y4KD 4ZPTA 4EI5D 2NNAB 3TCLA 1CFQB 2GUOB 4Q6IA 2NW2B 2HH0H 4W81A 3WNKA 4RNRB 3MRDB 5JUEL 2OTWA 2YD2A 3P4MB 1T4KA 5KS9B 1OF2A 5CZKA 3LV3B 1S78C 5JXAL 3PHQB 3LH2H 2HH0L 3BZ4A 1BJ1H 4P46C 2AJVH 2OSLB 4IRJD 1ZT7A 1LK2A 3MRCB 1T22A 1KLUA 1MHPL 1WVZA 1FLRH 1IGJA 5ITBH 5I0DA 1ZWIB 2DQTH 4DAGL 1V3JA 4GS7C 3X13B 5HGAB 5HHQB 5JIPA 2NY5L 1CFTB 1FGVH 1AGDA 1GGCH 4HF5L 3DBXA 3BDBA 1FLRL 4LMQI 4W68A 1A6ZA 2W0PA 4U1MA 3STLB 1S5HA 1XH3A 2C7UA 1FFNB 1A3RH 5BXFA 1NGWA 4KJYA 1KCLA 3RIFK 4JO4H 2XXMB 5JTWA 4XP4H 3ILQD 3FQWA 4X9FA 5E8PA 1LEKA 1QOKA 1FH5L 2Q3AA 4UT7L 4Y5VB 2XQYG 5L0QC 3TNNA 2E9WA 3IETA 3CK0H 1CI5A 4K3JL 3S36X 5I66B 3T0AA 3BQUD 4PGEB 5DMKA 2RGSA 4NUGH 4F37K 5GIRA 5DD6A 2ADIA 4S1DC 1JNLL 4RA0C 1KGCE 2J6EA 1IL1A 2N7AA 2GTZB 5KSAC 3IKCB 4PBVC 2EDLA 3QZWG 3N85H 3ZE2F 1KEGH 1QSEE 2VABA 4JN2B 3STLA 1BQHA 1EDQA 4GG6A 3ZHLA 1PKOA 2P5EB 4U0QB 1NDGB 4WI5A 1UKQA 3WL9A 5FIEA 4R7DB 1ZWIA 5BS0E 1HZHH 4N8VB 2JE8A 2YPLE 3FOMB 1J12A 4NCDA 1J8HD 5MENB 4GQPH 4C54A 1ZT7B 1N2RA 2Y6SC 3QNXA 3W82A 3LQZA 4L29A 3B2VL 1FJ1A 4P59H 1IC4L 4ODVL 4O2FA 4L4VB 4YHKH 3VGDA 4MDJB 3TO4C 4F7CB 2EE3A 2QQQA 5JW3L 3ZO0A 2XYCA 3QEQD 3CFIC 3W9DB 1D5BB 4GW1B 3T4YA 2EE9A 1PAMA 4Y4FC 4PJFF 3KPMA 3BI9X 2OQJB 3UTSA 4ZPTB 2CGRL 2WINA 5MEOB 4LLYA 4TSCL 1UT9A 5I17A 3P11H 5D7IB 3DYOA 1MIEH 1J11A 4HWEL 5DC9B 1Q9WA 4K07A 5I1AB 1RZFH 1BJ1J 5FK9B 2DQDH 2R8SH 4LPYA 1XGTB 4K3EH 2XT1B 3J7HA 4BKLB 4R2GD 4KUCD 5HGBA 3TESA 5SX5H 3X3GL 2A9NL 5T1LD 1LE9B 4KVCH 5CIPA 2CKNA 4WHCA 4DFIA 2D9QB 1AQKL 2DQDL 4JKMA 4XCEA 4RGOH 1QLRB 4P2RE 3V4PH 2DN7A 3KYNB 1GC1C 1BD2A 2YUVA 3IDIA 4MLSA 1HXMB 1N0XH 2JJVA 5I6XC 4XGZA 5JDSA 3MNVA 2EDHA 4MA3B 5HHOB 3RZCB 2N1KA 4OF0A 5FYLD 2A6IB 4F7TB 4PJFA 5IEKA 1KJ2L 3FB6A 5DYOB 4OZHA 5HHXL 1QBBA 5EZOH 3KPSA 1K2DA 4P2YA 3BFOA 4ZYKB 4EUPG 1O0VA 4AZ8A 3EGSA 5I8OL 5D7LA 4JFEA 1MCOL 5JHDA 1J10A 1CXIA 3VI4E 4X5WA 4TUOA 4I5BB 5IQ9A 4NYLB 3UTSD 4JRYD 2PYEB 4M03A 4XI5D 4OF7A 1CIUA 5I8OH 3TBYA 2HVKA 5CEZD 3BYTA 1R3IL 4IJ3B 3RP1A 1JI1A 2FJHB 1FGNH 4M7LL 1RMFL 4K7PL 5DJCB 1M6OB 1RZKC 2XTJD 1YYLL 2VTFA 3MV8B 5EORH 3MRGB 1A02N 2WSKA 2WANA 1R5IB 4PJCA 4XCYA 1WZKA 2P46B 4S10A 5DJAB 1MJJB 2NXZD 3V2AR 1FBIL 4Q9QL 3ARED 4LK4A 3B9KC 1FGNL 1VB9A 4HWBH 2APFA 5IB5A 3RY6A 2YR3A 4GJTB 1IJ9A 3VG9C 5TH2A 3WFBL 3SQOH 3VFOB 4U3CA 4HUUA 2DBJA 4P9ML 1CD8A 3VWKD 1HIML 4O9HH 3VD5A 2Y06H 3MYJA 5CKGA 5I15H 3VD4A 3ROLB 4RBPK 4XHQA 1P1ZB 4DVRL 4YJZL 1C8PA 4EN3B 3GHBH 1Z9LA 3EO1B 3R0MA 5DK2A 4BH8B 3CH1B 3OKMB 3O2VH 3UTQB 4D3CL 3Q48A 4N0RA 2MHAB 35C8L 3VFGH 3BKML 4JFDA 5T3ZE 1FYTD 1RZJH 3KR3H 4KV5F 4G9DB 3SDYH 3N1GC 4MNGE 3RNQB 1W0VA 1HH9B 3W11D 4XVUC 5F88A 3SJVE 3MV01 2VWEC 4AQOA 5KVMC 4MJ4A 1UJTA 1CF8L 2Z31D 4FFVD 2OP4H 4HS6A 3H2WA 1OARL 1RZJC 5LCVL 1OGAD 1G7MB 2VL4A 3TH2T 1ZLVK 3ARDB 3S3JA 1T2QH 3H0TB 1NJ9B 2EYRB 4Z18A 3RWGB 4ZTPL 3LKRA 1WFUA 2H9GA 4FQIH 4PY8J 4KKLD 1QO3B 3MV7D 5I18L 2YD5A 1OW0C 2P8MB 5FYJD 1M4KA 1PVHA 3HR5B 4E5XA 4XP5H 3B3IB 2DQFA 2DF3A 2L0DA 4QXUL 1JF1B 1T83C 2B8OT 5F44A 2YEZB 2EZ0C 4J1UB 3FQUA 4PB9H 4AH2A 3ZZ1A 1AO7D 1S7RB 2XPGA 1N8ZA 1NMAL 1X9QA 1NBVH 3L3IA 3MRMA 2BSTA 1RY7B 2ZSVA 4RISL 3NFPB 4LRIA 1LP9F 3ZL4L 2OYPA 5JZ7D 3ARBC 3PXHA 3VXSA 5D1ZD 4ODTL 4ZXBD 5FOBB 1AIFB 3RWCB 3OAUH 2H6PB 2VLJD 5D70H 3DX9B 4ZQKB 4XP1H 1TTUA 4PJBE 1MRCH 2B5IB 3MACH 4FQHB 2OK0L 1LP9B 1PW3A 2ADJB 2DWDB 4IOIA 3GHEL 1WTGT 4G6ML 5E4IA 1NPUA 3MFGB 1T66C 4OT1L 1TZGL 3VXUE 5DSCA 2HRLA 1MFDH 1AIFA 2BDNH 5E08H 1SJXA 2XQBH 3DX6B 2EIZB 3FN3A 1NAML 4G6MH 3NFPA 4TUKH 2R0ZL 5TPWH 1KCVL 4CKVX 3U9PH 4OT1H 4JDZA 3SKUD 1QACA 2A73B 4L4VE 4A6YA 2R2BA 1VERA 5I1LB 5GZNC 3C5SA 3M07A 4Y4HD 4TUKL 1FNGA 3CX5J 1B2WH 1I1RA 2PXYA 3B3IA 5MENE 4Q0XL 4LHUA 4U6TA 4YXHL 1Z9MA 3FT3A 4X5LA 3ARVA 2FBJL 3RWGA 2M2DA 2VLRD 4U4BA 5E1AA 3W39B 2DTML 4WJ5A 1UXWB 2PW1A 2QSQA 3PUCA 5KSUB 1LD9A 4HW6A 3NGBC 2FECI 2Q8AL 1A4KB 3F58L 2EIBA 4OV5A 4QCIB 3ULUC 1DSFH 4LSVL 3ZKMD 2I60L 1N7ML 1KC5L 2HKFL 2OMBA 3GBNL 4G9DA 5DS8B 5GGTA 5HHVH 1JCKA 3P4LA 4O58L 1AXTH 3VXMA 5IM7A 1L9NA 3UTQA 5H94B 2X44D 2R2CA 4NBYB 2CK2A 1KC5H 2HKFH 3QFJE 5F9JB 3VGGA 4ZUUA 1L7TL 2HWZL 1IKFL 1MSPA 4UI2A 4U2ZA 1SQ2N 3UP1A 2CXGA 4NQVB 5T1LB 5DTFA 4GW4A 3ARTA 4HGKC 4BSWB 4KJQD 1EVTC 1EVUA 1F11A 1EFQA 3H7LA 1WBYB 1F3RB 5B8CA 3RVVC 3VJ6B 5D7SH 1JPSH 2L7JA 2F5AH 4HIJB 5D72L 4JFYA 3MQIA 2H2PC 1IAMA 4UQ3B 4J3OC 3GSRB 1KIUA 1M71A 4MQ7A 4HWZA 3RY6C 1CL7H 1TJHH 1TCRA 1CDCA 4KDWA 3HHRB 4G8IA 4IBLT 3SY0A 4KKBD 4P3WA 2WBKA 5AG9A 3ILPB 5TDNB 2NY2D 5AZ2H 2ZG2A 3TNMA 1KELL 2N56A 1OP5K 1RD6A 3ZHKA 1T7YA 2EYTB 3L5HA 4RFOL 3SDAC 2CDGB 2OL3L 3IJHB 4WEBH 3RRQA 1FIGL 1CT8B 5D9SA 3X17A 4ZS7L 1QEWA 4F57H 5DUBB 2ZUQB 4I0CC 5AYUL 2R23B 5HI3C 3SKMB 5IEKB 4NJAL 1FIGH 4FG6D 4GRWB 1OTSC 3MNWA 4ZS7H 4D9LL 4XPGL 2FIKB 4R3SA 3HZYA 4ZFOL 3QIWA 2OJZL 3BKCH 1SEBB 4O51B 3PHOA 4PRAB 2JF1A 1E27B 3WV0A 5C0NC 1I3VA 4WUUD 1E28A 1IILE 4EXPX 3QUXB 32C2B 5I73C 3QEQE 4WHTA 3R06B 4YDLC 4EVNB 5I0ZA 1RU9H 3FQRA 3D3VE 1ZGLB 4LFHG 4H26B 3HE7B 2NY7H 3O8XC 1P7KB 3JV4A 1L0YA 4LEOB 3K81A 5HI4D 2FD6H 3LPWA 4G7YL 5IESH 4HBCH 1MLCA 2ESVA 4WEMB 2RFXB 4QHLB 1YY8A 3JVGC 3L7EB 2E8YA 5DJ6A 3QJHB 2UZXB 2A74B 3K8LA 5ISZA 1UG9A 4XNUL 3UTSB 2YPLD 4WENB 1QSZA 5GS2D 2G9HA 3BWAA 4NDMA 1HKLL 1WSST 5T3XH 4TULH 5TE6L 3JWOC 3GO1H 3NIDE 1KIRB 4I4WB 3QCVH 1BBDH 3R1GL 3C8KA 1CLYH 3FT2A 4OIIL 3GM0A 4O2FB 2FIRT 1OY3B 2B2XH 3IGAB 4K94C 4ZNCD 2VDQH 3QQNA 1AKJB 3TH4T 5E8EA 4OTXL 2Q3ZA 4NQXA 3QUZB 4YHLH 5JR1L 4OUUB 4UMGA 4X98A 5DQDL 1U8LB 4PLJC 3BIAX 2B2XL 3FRPG 4MNGA 4I77H 2AQ1A 4WUUA 1A0QH 1RUPH 3CU1A 3BPNB 2WUCH 1EGJH 3T1FA 3DGCR 3NCYP 2X4QB 5CEYA 4WTXA 4WY7L 2VC2L 4UIKL 3BN9D 4I77L 5J89A 4LPCA 1F5WA 4K55A 4JRYE 5HYJB 4K71B 1IL1B 1EBPA 3KPRB 3WYRA 1CE1L 1YECH 1W72A 2EO1A 2Z31A 5GZND 4S1SH 4HUXA 1F3DH 2EDTA 5MHSD 3RTQA 1BFOB 3GMOA 4ODWB 1WEJL 5H2BA 3SCMD 4I9WE 1CE1H 1I9JH 1OGAB 4UAOC 1MCKA 5E24E 2R0KL 4OLXL 2YPVL 5FO8A 3BZEB 1MCFA 4PY8I 5KW9L 1KT2A 4XP6L 1WTLA 2NY2C 2YUZA 1UB5B 4HMCA 4HKXA 2NY3B 3HUJF 1RHHA 1WEJH 5DJXB 2R0KH 1I4FB 4DKDC 3N9GH 1G6VK 1E6JL 1MRFH 4BA8A 3T04D 2DI7A 5ITBL 1A4JB 1NC2A 1H5BB 2XWJA 4OZFA 1JHTA 4WU5A 1YN6A 1FCCA 3MLZL 1RUKH 4CW1A 3VH8A 3O2DA 4R9HA 4EN3D 5JO5A 5E7FA 1E6JH 1IAIM 1FZOB 1MVFA 5A2LH 4JKPL 3CXHK 2QEJA 1RUKL 3UBXI 1A7BA 1QFWL 4KROD 3ZDYF 5BQ7A 5FHBH 1X5GA 5JA8B 1INEL 3VFTA 1YN6B 1AR2A 1SHMA 4Q74A 3IFNL 4EDWH 5IBTH 2R56L 1BMGA 1S7XA 1IEBA 2IADA 2H41A 1FH5H 4MQTB 5HPMB 2X4UB 5ACLA 3WHXB 4CVUA 2IANA 2AI0H 3TT1L 2X1OA 4N5ED 2EH8H 1YEKH 2W9EL 2AJUL 4ZAKB 4FS0A 1BJMA 5A3IC 1JYNA 1XMWA 1EO7A 3L5JA 3H3KA 1MHHB 2X7LB 2QLVB 4HUVB 4XVJL 3CC5A 4AEHL 4ZFZB 3SDDD 2Z91B 1P9MA 3PDDA 5IB1B 1CBVH 4NWTH 2UVEA 1ZVYA 4NKOA 4NNXB 4JFZL 3O81A 4Z0XB 3I6GA 2V7NB 4M8QB 1T2JA 3Q1SH 3JTTB 4J4PA 4ETQB 4AY0A 5EU3B 3WFDH 3D69B 3KYAA 1CD1A 3DYPA 1OCWL 1BX2A 1RUMH 4XVTH 4P5KB 5FM8A 2VZTA 3RGHA 3IFPA 3WFDL 2A83B 1K4CB 3MGAA 3LIZH 3QFJA 4XVTL 3NIFF 1Q9OA 3VXTB 4MS8C 3V7AG 2E3VA 3D3VD 4ODVH 3L9RA 5I30H 2XWBB 5CKAA 3C6LC 4EI6A 5A16B 5JW3H 3V0VB 5IT2L 5L9DL 3A6BL 4X8JB 5C0BE 4X6DA 4RDQF 4M4RA 3V5DB 2HA1A 2UYLA 4N0UE 3LEXA 4NQDB 3PNWB 3SDDA 5HGHB 3MOBL 3A6BH 4PJHA 3B6SB 3DXAB 5F96L 5EO1B 3TYFA 4E0RB 5SWZE 2R8SL 3FRPA 3HRZB 3L7EA 3LQMA 3ARBD 3X3GH 2BSRB 2LU7A 3NZ8A 1UC6A 2I07B 3P40A 2Q6WB 1J87A 2BRRL 3ME0A 5ACMA 5JDJA 1AQDA 4J23A 4P49A 4APQC 2HP4A 1N0XL 2BNQD 5CFHA 3NZHL 1RZIB 5ITFB 4IRJA 4GRLB 3NCCB 4PTUA 5EBLA 3ARPA 3D1MC 3Q5TA 4K94L 3EOYG 1CICB 2H2SD 3L3JB 4KKLC 5KJRH 3QIWB 3HI6L 4GBXD 7FABH 5HHXH 4PLKD 4IIQB 1S3KH 1G9MC 1W8NA 1MCWW 4OLYH 4FTVE 4R4BA 1KPVA 2GFBB 3DUSA 4IRZH 4U6XB 3MX0A 4PJHF 3HMXA 3O4LD 5JA9A 2Q8BH 4PJ7E 3F6IA 1S9VA 3FZUD 3HS0B 1HCFX 3HPLB 4NPYA 5B39G 2V9RA 4UT9L 3EBAA 4XVUD 5DFVD 3V52L 3MA7B 1TITA 2PW2B 3L5XH 4OCRH 1CGYA 4PPTA 5HVWA 2AK4B 5HHNB 3SO5A 4O02L 5L2JA 3S8WA 1IGYB 4P3CL 1BZ9A 5KZCD 1BHGA 4AG4H 4P5TA 4NN7B 2ITCA 1RJZB 4Y4FD 1N3NA 5GGSY 4M1CC 3QH3B 1G9NC 3L3KA 5A1AA 1RURH 1FSKB 3KPRE 1ZLVH 1QD0A 3MRNB 3C2SA 1PG7H 1KULA 1NEZA 5CCKL 2DYPB 1F42A 4GKNB 4HLJA 5FKAB 1ED3B 3G08A 4RGMB 5DVOA 5B3JE 2CK0L 1N64L 3FB8B 4X7FC 1KFAH 5D96B 3P9LB 1LQSR 1PX4A 5D7JB 1QR1A 1JV5A 3HKFA 3BPOB 3O4OB 1OQOA 5JIHA 3QHTC 5J57B 2X4RA 3NCJL 4NQVA 1TQBB 2XOTA 1KPUA 1HWHB 4YFEA 3C6SA 1ZHBB 1OAUH 3NCYS 2AK1L 2P5WA 1X44A 1I8KB 4ONFL 4E42B 3BQUA 1F2XK 3VXMB 4PYHA 4JANB 5FO7A 5GRVK 3GSVB 5DS8A 1K4DB 4P5TD 1WFTA 3MRQB 4YZFE 4NN7C 3KPSE 1D9KB 4UILH 5JW4N 1ZKAA 4YFLI 1LD9B 3I02B 5CLTA 5KSUA 3U30C 4H1LB 25C8H 5D7LE 4NO0A 1HDMB 5F6HJ 5GZOC 5GGVL 3PV7A 1LK3L 1TDQA 3QHFH 3NACH 1KB5A 3VFMB 5FUCC 5GS1A 4QXUH 4Z6AT 5IFAH 4MXQC 5CILL 5FCSH 1AJ7H 2ZG1A 2KH2B 1WF5A 3BP7B 2CKBH 4G43B 4YEEA 3HC0A 1ORSA 3VG0H 1AGCA 1ULVA 4JY6B 1QUNA 5C8JB 5I1LA 4PRHD 1JNNH 4BQ9A 2FO1A 1YMMD 3G04B 2A73A 1OGTA 4LSTL 4UUJA 4AEFA 4DGYL 5F3HB 4YDVB 3MCLH 4HGMA 2X4NB 5DK0A 4G8GB 1U6AL 3G5YA 4DK3A 1A6AA 3I6LD 3QWQB 4Z7UA 5BVJB 3DO7A 2V5YA 3WIFB 2XFXA 4UT7H 3BGFC 4H5SA 4X80H 5DSCB 4DGYH 4HIIA 3MCLL 4NQSB 1EX0A 4MXQD 5GGSB 3W2DL 5GJTH 4L9LA 2HG5B 3V5KB 1BZ7A 1TZHB 5GRVL 3HNTL 2WW8A 1FVCB 3TO4D 1KCVH 1AY1H 5F7FA 1E4XI 4ZQKA 3DX9A 1DLHB 4WW2A 5FOBA 1F02I 4LVOB 1WAAF 3JV6A 4P2QE 5FGBA 1FG2B 2MKLC 3TFKC 1I7ZB 1MEXH 2F74A 3IDJA 1DBBL 1N8ZB 1DUZB 3S96A 1RJCA 4AH2B 4YXHH 4X99A 4Y2DB 5IR1A 3FJTA 4F8TA 4LSSH 3F7PC 1U8MB 3NCBB 3HC0B 4DWHA 3I85A 4LARL 1F4YH 5MHSE 2MFNA 5AG8A 3C08H 2DTMH 5F89A 4CVXA 5BMFL 5F93C 2P8MA 3RQ3A 1BM3L 4KGJA 2WM0A 1KB5B 3N06B 1T3FB 3CDCA 3P9WB 1L6ZA 2ZUTA 5GS1C 3KJ6L 5FUZH 2D7MA 3MUY1 4O58H 2A0LC 3DXAE 1QHOA 1FNEB 1TMCB 3OB8A 4JJHA 3CFDA 5ID0B 3U1SH 3IVKA 2WMPA 5LGKA 12E8L 5JHLH 1NGYB 4X9IA 5JIIA 4Y1AB 2OTUB 3QWRA 2HWZH 1IKFH 1H3WM 1W0WB 3I9GH 5EOTA 5C07E 2NX5A 5EU5B 4ELKB 1QSVA 4JG0H 4HXAH 3T3PF 4U1SB 4QRRD 2BOCB 4KRMB 2A9NH 1CL7I 5ALCH 5J9PA 4YDIH 4B7IA 5IFJA 2BNQB 1JPSL 3VWJB 4YC2C 1S9WB 2H45A 1EJOL 1PDKA 2R0LH 2EEBA 4OFPA 3DJ9A 5EWIH 3VA6A 3MNZA 3HAEH 3QIUA 5I8CA 1H0DB 2Y5EA 1D6EA 1RJLB 1EJOH 1B6UA 5EA0L 5E94B 1AE6L 1Q9KB 3RKPA 3V79C 3GMNA 1IMHC 3C8DA 3DSFL 1CFSB 4XBGB 5IIEB 1KELH 1TETL 4AYFA 2P7TB 4G5ZL 3WJJC 1NL0L 2NY5C 2VXUL 1N3NB 1TJIL 4OGYL 4TPRL 1DQJB 4NRZA 4P2OD 3SE8H 1U8PA 1MVUA 1S7QB 2PYEA 4IMKA 1KJMA 1LEIB 1DZBA 4F57L 4XP4L 3QULB 1X7QA 4OM1H 4GAFB 5DURD 4NCC1 4OF8A 1MNUH 1Z3GL 1X5JA 4KQ3L 3KPQB 4Z8FL 3PWLB 5HDQL 3EGSB 1CDYA 2WZPD 4PJ7A 1KLGA 3H9HA 3QI9C 3KPSB 4PJEB 4WFEE 2EE2A 1BJ8A 5CJQH 5F7MC 3CIQA 5HYQB 1Z3GH 4NC1E 3HMWL 4ISVA 3FTGA 3ES6B 4JQIL 1JPST 2CRYA 2A6IA 4IIQA 1UZ8B 1HE7A 4QY8B 1T1YB 1ETZA 3HMWH 4ODSL 1LO2H 1XCQA 2EDWA 2J7LA 2VN4A 4JQIH 4XGZB 5JDSB 4NKIL 5E9DB 3RWEB 4IRJB 2R2EB 1Z0NA 5ITFA 5KSBE 2ZUXA 1VESA 1J8HE 3F5WA 4KK9D 1NC2D 4NKIH 1AH1A 1EHNA 2AEPL 1CTNA 1REIA 4N9GA 5C0RL 4DEPB 2LAGB 4AT6A 3VFPA 2Q6WA 3N50A 2ADGA 5K9KA 3O3AB 3F8UB 3T2QA 1JWUB 4P3DB 4C56E 4EJ1C 2DLGA 5B38A 1NFDA 3HAEA 2RHEA 3GO1L 3VFGL 1G84A 3BN3B 1PEZA 5EZLA 3OPZL 4JM2A 4M7JL 4RMRA 1KNOA 5DMIL 5DUML 4YX2L 5D1ZA 4ZXBA 1BF2A 5I9QB 4JREB 1NLDL 3IXAA 3AAZA 3NTCL 4JM2B 4X6DF 5EZLB 5KG9B 3EJYD 1YPZA 4OZFG 4MDJA 5DGQA 5DUMH 5HVGB 5CJXC 5L2KE 4KK5C 5JOFA 3HPJA 5JR1H 5FA4B 1Z5LB 3VFPB 1U8IA 4QTIH 4XAWH 5DRXB 3UTTB 1DVFC 4M7LT 4JPWL 4N9GB 1A47A 4QLRA 2J6EH 1MIEL 1MCRA 2VDKH 3TPKA 1MWAB 1RUPL 4YK4C 1U8QB 2DM4A 3RWEA 3PWPA 5A3ID 3QEGL 2P4AB 5CEXA 4I48A 4AIZA 4XPBL 4L1HA 3IDXH 1G0XA 2J6EL 1GXEA 4OB5L 4MCZA 2VABB 3WDJA 4YE4L 5GHWH 2NY2B 4BYHA 4N1CA 5F6IB 1BZQK 1P53A 4P5KA 3TZVB 4QEGA 2KBGA 3RWIA 4FOMA 3SGJA 4JKKA 2HMID 4OD2B 1LO4H 4BFIB 4OLXH 4YR6A 3D5OF 3SPVA 2VLJA 3QXVA 2GTWB 5C0EA 3PWLA 5J6HA 2XG5A 3LPGA 1JN6A 3EHBD 5F71A 1J05B 4ODUA 1HINH 2EDNA 2P8PA 3O6LH 2G5BB 4JO2H 3QULA 4M3KB 5EZOL 3UPRA 5TF1H 4MD5B 1S8DA 2VZSA 2VH5H 1P9MC 4NQED 2DQHL 4PIRF 4QOKA 3OKYA 3O0RH 1HINL 5BOZG 3TF7C 1XFPA 5TJWK 1QTYT 3I50H 3H9SA 3OKOA 4FQ2H 2IANB 2BXZA 1T21B 2M8XA 3FMGH 4JHBA 5CGTA 1RJYA 5FAAA 1U0QA 4PRPB 5K59E 3IAPA 1OTSD 2PTTA 3T3MF 1U8KA 4EQ2A 1ZE3C 4KK6D 3EDDA 3H9SD 4PJ8B 3L3DA 5F7HA 3U4BL 2YMXL 3G6DH 3MPCA 3QUYC 4S0TD 4Q6YA 5CIPH 5HVFB 1RJLA 1WCBB 3S34L 2OR9L 1H9VA 1WWCA 1XGQB 3UTTE 5EORL 5AYQA 3LEVH 1B0RA 4MNQE 2I26N 1IGJB 5IK3B 1QFHA 3U4BH 1WCBA 3MLTB 1ZA3B 2RCSH 2D03L 2R15A 4GRMA 3N1FC 3QNYB 1YEFH 4C59B 1A7QL 2LFGA 2ZOKB 1UVQA 2W0FB 1U9KA 3GSUA 4PRPA 2I24N 3V6ZA 3G6AA 4PUBH 1WBZB 2P1YA 2VKXA 4Z5RB 5DJXA 4WHDA 3BPCA 4JHWL 3MRKA 4QRRB 5HI5C 1F90L 5KVGL 4GXVH 5HHVL 5C0BB 5I75B 3PL6C 3Q1SL 1ND0B 4NT6B 1I3GL 2WWKO 5F3BA 4RDQG 2YD7A 2A1WL 4JHZA 3WNOA 3QQ4A 3VCLA 3D3VA 3CC5B 3I6KA 3VWKA 4XZUA 1L7TH 1OAKL 1NANI 3QQ3A 4KXZH 1GGUA 2QQKL 3GUTA 2X9YA 5EOQL 4KI5D 3BOVA 2R4SL 3BP5B 1A1NB 1CCZA 1OB1B 5J1AB 2FWOB 2OXHA 2FECL 3ZTNL 1TNMA 1SYSB 2KDGA 1EHXA 1NSNH 4OQTH 1KCSL 2VO5A 4Z95H 2FYYB 4HHAB 4RQQB 4Y4FA 6FABL 4MNGB 3ULUH 3ULUE 4TSBL 1K8IB 5I18H 1U8QA 5K9OA 4ELMF 3ARGD 5JNYA 4XP5L 4WU7A 4ZUVA 3RUGE 1ZT1A 5C9JA 1NMCB 5T5NF 1TVHB 5DGRA 2FDBP 1D5XA 4FZ8L 4TSBH 1NCDH 4OCXL 2OTPA 4PB9L 4LCYB 1B4JL 4Z7WB 5JXEC 3EOTL 4XC3L 3O3EA 2AEQH 3I84A 1RFDL 2X89A 1CXKA 4TVPL 1YUHA 4EUPH 1G6RB 4DQOL 3S37X 3SCMA 4TNVF 1RSFA 3ET9F 3EYFA 1QBLH 5KBNC 5IB3A 5GGSA 1I7RA 5KVFH 2GK0B 4X6FB 1FL3B 4DFHA 5EBMB 5I1GL 2IAMB 5SWSD 3MBXH 4NNYB 2VISB 3VFSB 5L2KD 1G7IB 2CO7B 1QBLL 4UNUA 5AYUH 2BY1A 2YPKA 1SMOA 4Z7VB 4LEOA 4P2CG 1ZHLB 5CUSH 3SO3C 4JFEE 3GDBA 3OR6B 1GH7A 2DM2A 4Y5YA 4WW2F 1MHCA 2PYEE 3D2UB 4UOJA 4BFGA 5BOPA 5IBUG 1A1MB 2HLAA 4RFEB 1ERNA 4OSUL 5MEND 4QXGH 1E27A 4EIGB 3BP7A 4G43A 5BW7C 2Q8BL 1U3HA 1JWMA 4QNPE 3PWJA 4HWNA 5CP7A 2YD1A 5FYLL 3ROOB 3UTZB 3LKPB 5DWUH 4UT9H 5TFSH 4HS3B 4ODXB 1FO0B 2D31A 3AXLB 3RWHB 1J0YA 2OMNA 1GGYA 3QPXL 3S3SA 4YWGH 2FD6L 4AK1A 1L6XA 2YRZA 4W4NA 5E2TH 5JPMA 3WHE1 4F9PC 4HEME 3RIAF 3F12A 4LVHB 3VFNA 3RGVC 3PG2A 3ZTJH 4ERSH 3CX5K 5D2NA 3AS0A 5HYSG 4TULL 1X7QB 2JJTC 1J1OH 5IJKC 1J8HA 1OWRM 3DRQA 3OR7B 4JO1L 1DR9A 2BC4B 2J3SA 5ADOH 3F6LA 5ESAB 4XTRD 1KTDB 1T04A 5TDNA 1HOCA 1JMXA 2O5ZL 4LQFH 3LD8C