2ITEA

Crystal structure of the isda neat domain from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
publication title Haem recognition by a Staphylococcus aureus NEAT domain.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 24
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2iteA00
3SZKC 4FC3E 2H3KA 5D1XE 3SIKA 3QZNA 2Z6FA 3RTLA 2O6PA 3QUHA 4NLAA 2O1AA 3QZMA 2ITEA 3QZPA 5D1QE 3S48A 3QZLA 5D1ZI 3SZ6A 4WJG3 4MYPA 3VUAA 2Q7AA 2E7DA 4YMPA 3VTMA 2K78A 2MOQA 4H8QA 4H8PA 2ITFA 3RURA 3QZOA 3OVUB 3QUGA
chains in the Genus database with same CATH superfamily
4HOWA 4AEEA 4DZ8B 4QRPB 3A47A 3TFKD 2VN6A 3FQWA 5HYQA 3GHBH 4FLHA 1MQKH 2CO4A 4TF4A 3A67H 2DKUA 2XIIA 3LZPA 1TT6A 1QX1A 2QSVA 3BVDB 4DFIA 1BZOA 4PU2A 5ERWA 3ILQC 5I1GH 1HIMH 3MRDA 1I7UB 3BX7C 3QRGH 4RLDA 4ZFOB 2FD6H 1FI8C 2VUKA 4LQFH 4JPWL 2KPNA 4R5VA 1JZHA 4NN6C 3LZOA 4ILDA 4MJIB 1N19A 5LGKA 4NJ9L 5IGXH 3FQRB 1IAIL 3JZYA 4MTMA 5TE6H 2J2ZB 2D73A 3WFEH 3UAFA 3IJ9A 1WGVA 3RKDD 2P9RA 3FTYA 4UUJB 4MDJA 1CXIA 4NQXA 2JKNA 4I0PA 1XSIA 4R26L 1CO1A 2BXZA 1BQSA 3M7OA 4OSUH 2WBJA 3ETSA 4X8GA 1H3TA 2X4RA 2EDOA 1DVXA 4J3OH 3GSNH 2WNKA 3GJFK 5D1XC 3NAAL 2G30A 1VEMA 5F88A 4WO4A 3MVSA 4NQSA 2NRDA 2PXYC 3SYOA 5IFAH 4HQQL 1RQ5A 3MO1A 1HWHB 1KBWA 4PH8A 4FI7A 4ES9A 1JRHL 3FO0H 4J2QA 4QHMA 4WFHD 4RSVA 4AXWA 1OB1A 4FRWA 2Y72A 5DR5L 1V3KA 1BZQK 3BZEB 1E50A 7CGTA 2YPKB 3TA4D 4JS7A 4JM2F 2EXWD 4LEOA 1G0YR 4U6XA 5J1AB 3LN9A 3DGDA 3KNBA 3AQZA 4PD4J 5C6TL 3C9NA 1MFDL 2V8LA 1IGTA 1A7OH 4FEIA 4IGBA 1T5XA 3EJJX 3IFOB 1CICB 1WICA 2Z92B 3T1FA 4JDTH 4YHML 5IMMB 1XGYH 3BXNB 1RJLA 1RAMA 4Z7UA 4KROD 1FZKB 1RP8A 2P28B 3PREA 2YD9A 2ADGA 4UV4L 1J8RA 3ZK0A 1LO3L 1SLWA 5GIRA 2O5YH 4W68A 1RK0B 4DP5X 3GFUA 3FRUA 4ELMA 3MX0A 5KBKA 1WVZA 4OJCA 3VXUE 1LWHA 4JCLA 4Y2OB 4KY1L 3BIAX 5E9DB 1U8HA 4LLWA 3FULA 3CFQA 3MYJA 3SKUD 1F1AA 3DPDA 4MXWH 4CMHC 3WMQA 1LD9A 4TPRH 3T2OA 4XMTA 1AZBA 5FDWB 2IG2L 3UPCA 4PJ8C 4UNIA 3WKMH 4LCCA 2VMCA 4EO5A 5I2IA 2HN7B 6FABH 4HJ1A 5C7ZA 4NKMB 3TM6A 4WI8A 2E47A 4PY8J 2VXQL 2EZ0D 3GB7B 4X4YB 1LQSR 2IF7A 3FPXA 4J28A 4OW6A 5JPNC 4BV1A 4HZAA 4MZ2A 4Y7OC 3PWVA 4KKLC 2VN5A 5B4MD 2F7RA 3QZPA 1NUGA 4FJYA 5BZZA 3OAYK 4K8RD 2B08A 4UQ2A 1VFAB 2OI9B 1CQKA 4R4FH 5D96B 2G9KA 2F53A 1B90A 1QHQA 3FB6A 4MCNA 4JVPA 4GG6E 2AK4B 4G72B 5J13C 5AOIA 1FAIL 3U82B 2A4ZA 4MWFA 3FONA 2XZQL 1QLRA 2VDOH 3AM8C 4NQDB 2RR3A 3ULUC 2J6WA 3C60C 1MWAH 1HHHB 5EBLA 1BIIA 2AK1L 4XP4L 2BVQB 2VZSA 2F6AA 4NKIL 4LAJH 1EHKB 3NFPB 4CDHA 3RVVC 4Y4HC 1NUFA 3ZKQD 2F58H 2FEDD 3QNZA 2V9QA 4RNRA 2GJ6A 3OZKA 4U1KA 5CGYC 3W37A 3FN9A 2V2WA 3BN3B 3PL6A 2IALB 4FP8H 3QZWA 1V7NH 2JJUA 4FZEH 5FUOH 2B5IB 3VD1A 1DBBH 5KJ4A 2X4SB 3A0OA 3UTTD 2P24B 4XO4A 4N0CC 1QRNB 2XWBB 1VSCA 1A4KA 1JBJA 3IFLH 5CJXC 4P2OD 3ZTJH 3T77A 4WV1A 3ARWA 4N0UE 3PHOA 3N44F 4M8QA 5LNEA 4BIKA 3DC0A 1IQDB 1HH6B 1J87A 1CD1B 3WV0A 3UIZA 5D2NB 1HXMA 5CR8A 4BE6A 1TDQA 1KIUB 4QHNB 5CJ8A 3GRBA 1GY2A 4YE0A 5J9PA 3MUGA 2EXSA 4CL7A 5LXGL 2CNYA 1Y6KR 4YBLC 5I0VA 2PR9A 3BH8B 2NY2D 2YK1L 3GLAA 2YQ3A 5I1JL 4CN6A 5GS3A 3MRNB 2LU7A 2QLVB 4GAAA 3LH2H 3FQUB 5AVSB 4KXZH 3W0WE 2HMID 4OZFA 4PRBB 1U4FA 1XF2A 5EBMB 2DIEA 1ICTA 3EDDA 3H9HB 3KPSE 3ARUA 4YE4L 3UAJC 1C12B 4WHYH 4RSYA 1IL1B 1BFOA 4Z23A 4QTIH 1YYMH 1B9KA 1A6AA 2Y2TA 2YHGA 3BZDA 2IH3B 1AKJA 2F5BH 4P4KB 3VXRA 5DGQA 3NIDB 5DHEA 2Y6SC 5DEFB 5DO8A 1U8LB 1UT9A 2E3VA 3X13A 5I6XB 3GBDA 1LO2L 3UAAA 2J5LC 4JKMA 1MI5E 2FJGB 3MA9H 1RUAH 4G7VL 1TQCB 2VLKB 4WUUB 5GSRA 1F4HA 1G6RA 5EZJB 2NY5C 1CDCA 1F0LA 5T1DH 1U3HA 1XBDA 3DTXA 4GSXA 4QIRA 1MLCA 2D31B 5HYJA 3C09C 5LG6A 5IW1B 1NCAL 4L3ED 4UB0L 4OQTH 3MV8E 4YC2C 5M95B 5CEZL 4DQOH 5C08A 3X3FL 2HH0L 1F8TH 4YHPB 2YGOA 4Z0XA 1LDSA 3KJ4B 2UY7A 5KYXA 1R3IL 4GRWF 4HIXL 5CXPA 5GZOA 2HAZA 2YN3A 3OWRA 4L3FA 1XGQB 1J48A 1KIQA 4KJQD 3QHTC 1UUSA 2AANA 4DVBA 1Z0NA 3TS8A 4QT5A 5DFVD 4LKCA 2LABA 1I1CA 3ES6A 3E8UL 1GYWA 4G8EB 3QDME 1MNUL 4KK8D 5TQ0L 4LCYB 1GHFH 3BD4A 1QD0A 4OZIB 5JR1H 2OTWB 5DEJA 4BKLA 3W38A 1A65A 2HG5B 4JNXA 1YQVL 2OXGA 1T5WA 3QJFB 3C8KA 1EERB 3HG1D 2WZ6A 4ICWA 2NNXA 3ARED 5T5FA 1W91A 1TJXA 5DZVA 1IC1A 2BSEA 2C5DC 4HPOH 3CCHB 1ZT7A 3QEQA 2EYSB 3ULVD 5HHOD 2I9TA 1HL4A 2FT6A 3AUWB 1XIWC 4BCXA 1TZ8A 2R23B 1U8QB 2KDGA 1JXGA 1OQOA 3GMLA 4JO2L 3AGWA 4D8OA 2HFFA 4PLJC 4P2QE 3J27A 3X17A 2X6MA 4I3SH 1XX9C 3TWCH 3LZRA 1LLAA 4QNPF 4MNHA 3MRHB 1CFSB 1OTUC 1D6VH 1GGTA 3O3EA 5HDWA 1WC7A 3FK3A 3IDJA 1DQVA 1FN4A 3OG4B 3EFOA 1I9JL 4AL8L 4KQ3H 1G7PB 3MXWH 1UQSB 2A1WL 2KHAA 2G4GA 3RL2B 3DOHA 3QAZB 4TLSA 4TM9A 3KGUA 5LBSH 1YEFL 3FUNA 3P0YH 1MJJB 1BMGA 3L4XA 5IK3B 3CN2A 5MEPB 2A9CA 5JUEH 1VJSA 3NOIA 3GK8H 4ZAKD 3O45A 4JFOA 3QVAA 1RURL 5DHVA 5EWIH 2D3JA 3TESA 1KN2H 3SJVA 2R4RH 3KCWA 3L54A 1WD9A 1NM4A 4YHKL 1OAYL 1TKWA 1R47A 5E8NA 4HG4K 1FCGA 2CG9X 3C12A 5C0DB 1F11A 4PJIA 4G8GA 5GGTL 1XH3B 4YZWA 1T03H 2EC9T 3D48R 2WVTA 4O4YH 1V8HA 4GAGL 4JFTA 4R3SA 5KBDA 3FFDA 5HDOA 4HAGA 1ITBB 2CE6A 2H0FA 3OXSA 2NMSA 2VABA 2EDYA 4GUPB 3NSFA 1DFBH 1E9OB 3QXAA 3R8QA 4ANKA 1W72A 2OMBA 2YJLA 1YDPB 3ESMA 1TVBA 5DXWA 1GZPA 4DN3H 1IAKA 2VO8A 2YD1A 5IBTH 2VDNB 1IQWH 1X7QB 3QPQD 3UDWC 5D7IA 4LCWB 1JYNA 4AQ8A 1J1OH 1IBBA 1AR1C 3QDGD 4XNUL 1GCFA 4J3WA 3WN5A 2BERA 4B9GA 1EEUA 3DYMA 3HC3H 2DQCH 5D93C 1H3XA 1MHHA 2A9ML 4LEXL 1IC0A 2CUAA 1NBCA 2F7IA 5FYKH 5CLYA 2BSSB 4BDVB 2DV6A 4NS0A 2BNRE 3IDYC 1QFPA 1UADC 3QEHB 2WKOA 3NFSL 4R2GD 5IMKA 3AXLA 4PJEE 2VQUA 1U42A 1B3JA 1FPTH 3MGAA 3VGFA 5BV7L 1KCWA 3REWB 1F58H 2XX0A 3MOAL 4LVHC 4OJFL 1JGVH 1M05B 2BHYA 3MAWA 5LAXA 1MRDL 1UCTA 2H47C 2BNQE 3C8DA 4AKPA 4R5TA 4G5ZL 4APQB 2HJFB 4UQIM 3OZ9L 4LVEA 3QCUH 2BDNL 2M83A 1FH5H 4LASH 1RUML 1EA9C 1Z3RA 4M43H 5T1LD 3EYSL 4JPKH 3MOBH 5J11C 3SDCD 4L29A 5T3XE 4LP8A 1L0PA 4Y5YC 5JMOC 2IWEA 2X28A 4XPBL 1KFAL 2ADJB 2FIKB 1A6VL 3VXQB 3FUKA 3TEUA 3D2UA 5KTEL 3F7YA 4HAFA 3WCYA 4YHNB 1KY6A 1S9XB 4XNYL 5DZNA 1E8XA 3D3VD 4PB0L 4AIOA 1X9RA 2BFGA 4QXVA 5HVGB 5JIKA 4GW4B 3HEIB 2Z31A 4NDMB 2JJTA 1UXSB 3EOBA 4JPWH 5IQLA 4NP9A 4TXVB 3ZE0B 1VPOL 2V3DA 5IW6B 2FK9A 3IB4A 4ZODA 4NJ9H 2OXHB 5INCA 2VSDA 1CIDA 1IAIH 1I9IL 3HFFA 3BQUC 2G3MA 1X6LA 4HUVB 4FTVA 4IJ3B 3BP5B 4R26H 3IU3A 2W59A 3AY4C 4HALA 2JKTM 4WI9A 1D9KA 4NZ8A 5CFAA 4L48A 3PDDA 4HCRA 4UNVA 1GTFA 3G5ZA 3IM1A 2CGRL 3WEXB 3NAAH 4IS6B 2CZNA 4JM4L 1U95B 1T89A 1XCQA 1XV8A 3LZLA 4X4MA 4MCZB 4HQQH 3TCXA 5A6LA 3DV4A 4LVNC 1EZLA 2ZUXA 1P9MC 4Y19A 3BVNA 1JRHH 2YFNA 3ISRA 3UGEA 5DR5H 1BJMA 2GBVA 1TTFA 3VFUA 4AYFB 1ND0B 2WN3A 2DM7A 1URLA 2B3RA 2YGPA 2ZOUA 3QS2A 4Y16C 1G87A 3FW6A 3OX8B 4IW4C 2R1YA 3HB3D 2VZVA 1D5XB 2QZQA 5D4QA 1HCZA 5C6TH 1MFDH 4XXCC 2PETA 4NN5C 3P54A 4UAOC 1YNTA 3BP6A 3MV9B 3P0GB 4OZHB 4F8NA 2Z7ZA 4YHMH 2BS71 4OGAC 1ZKAA 5BRZD 3ZO0A 2NNCA 4FFWC 2CXKA 3ARBA 4JDVB 3M1BA 4LLAA 2G5BB 5JHLA 4Q58C 2W5PA 4N22A 3KPPA 4UV4H 3UXFA 3X11A 2GK2A 1LO3H 3QUZD 2RACA 3E6HB 2R27A 1UD8A 2XWEA 2O6EA 1NPJA 3HG3A 1U8PB 3AG1B 4UF7C 2APSA 4BA0A 4KY1H 1CG9B 3BVUA 5E8OB 5MHSE 1RLWA 5F3FA 3A4AA 4NLHA 4UIKL 3T65B 1YYLL 3QIBA 5A2CA 2BIOA 2IG2H 3L7FA 1N8ZB 4N2AA 3THML 3WJMA 3T4AA 4HWZB 4MDJB 1QPKA 3N06B 1SVCP 2HTLD 2JI3A 3TNMA 3O8XA 4N68A 3MGOA 3MNMA 4OIAA 3GRWL 2VXQH 4MLIA 4OFIA 2PYED 1I1YB 1O7VA 4Z76B 1J86A 3NA4A 1QQDA 2RA1A 3P4MA 3CPUA 1P4LB 4L1DA 4XMKL 5L0QC 1HH9B 1OF0A 2EO9A 2O30A 1JMZA 5DZJA 5IB2A 1GS7A 2GYSA 1WF5A 4IU3B 3MRKA 1FAIH 3QISA 3ZU8A 5CBAB 1IEBA 3P77B 3JV5A 2NUPB 2XZQH 3QZOA 3NJFA 3TA3A 3EOYG 1UH2A 2ZOWA 3QI9B 1X9LA 3H42L 4LARL 3KDMA 4YPGB 2AK1H 3IMUA 4XP4H 4NKIH 4JFED 4QO1A 3RIFF 3MKKA 3SKOB 1O6VA 1P0SE 3LQZB 1ERNA 3MLRL 4LVOC 3G7TA 5KW9L 1D5BB 4N9GB 1QG3A 3QYMA 2YRLA 4JANA 3SDAC 3ZW3A 3MJ9A 4W9JC 1SXAA 4MVBC 1IILE 4M3KB 1HXYA 1HEZA 4HEMA 4UZSA 4ELMB 3VD0A 4GQRA 4QF1A 1OSEA 3SKJL 4GOSA 1VACA 1ZA6B 4FLOA 4L4VA 4CGTA 1XH2A 3BUDA 4Z7WE 4M93C 5ACZB 4Y5XA 5I1EL 4M1CD 5BW7A 1LD9B 1P6WA 1JZ7A 4HWBA 3QDHA 5I76A 4TNVF 1URZA 1I31A 1DE4A 1SVBA 4ZUWA 5JO5A 5I2IB 1F3JB 2WCPA 3FHQA 1ROCA 3VFVA 1HHIB 1JF1B 5DJXA 2HX9A 4FF9A 3L3HA 4Y1SA 5K5YA 1E43A 3KS0J 4JFWA 1UATA 3BUYB 2D8KA 4J6RL 2J8UA 3MRQA 3NRFA 4X7SL 5LXGH 5I6KA 4OCLC 4X7CC 2YK1H 2VLMD 5JNYA 3FTVA 5I1JH 1UJ3A 1N5YL 4XXWC 5GZND 5DRWA 3P02A 5ICXA 2Q6WA 1DVFB 3S97C 3HJEA 1J0YA 1TZIB 2HVKB 4JMXA 1DSFL 1MHEA 1I7TB 3N2JA 4Z18A 5BUGA 4YE4H 2D03L 3H6JA 4XAKD 1FO0B 1FYHB 2BIQA 5DJ6A 4KGLA 3US1A 3BP7B 4IIQC 2OMUB 4NN7C 4KTYA 2A74C 3JWDC 4U0RC 2K9FB 3ZGHA 5B7MA 1UKQA 1LO2H 4C56E 3KYKL 3L16A 4F3FB 3TBTA 4IHOA 1S3RA 4G7VH 4HHAB 4ZUUB 2EH7H 3ROOA 1UTDA 2VR5A 1PPIA 5D7JC 2NTFB 2UYLB 2X88A 2VYRE 4WW2C 5D7EA 1ET5A 1A9EA 3NZ8B 4OUOA 4YDIL 1TXKA 3TWYA 3BLKA 3QZWB 2UWEE 1QRKA 4HD5A 1W0WB 3FNKA 1NCAH 1REIA 3E1F1 4O2EB 4UB0H 4KK9C 4JFHD 4QRRA 5CEZH 2UV3A 2VAAA 2J5WA 2VLRE 3X3FH 3ZDWA 2HH0H 3EJPA 2RAMA 5CCKL 1RZIA 2ZSVB 2YD3A 1MCWW 1A64A 2CCLA 3HAEG 1R3IH 2DQJL 2YGNA 4HIXH 5HJBA 4R97C 2WCSA 4E41E 3VGAC 2ZIDA 4WV1B 2RFXB 3QWRA 2X6CA 3QW9A 1TG8A 1XGRA 3MACL 1G7LA 1ZANL 2CJSA 2ENYA 2ENPA 2P80D 3H0TA 4UBDC 1XGPB 1TEGA 3E8UH 5DYFA 5I74C 1YUHA 4PJAF 3WO4C 5K9JL 3U0TA 1MNUH 5TK4A 5TQ0H 4OLVL 4PS3A 4QMEA 4ANVA 5CZXC 3ALWA 1KENL 4PLKC 4L18A 5IROA 3AGVA 2QQQA 5EIIG 1J8KA 1KG0A 1JVLA 1YQVH 2EDXA 4LK4A 5IEHA 2XUWA 2ED7A 3UTPD 4AJYV 4PJFE 1MZYA 2MTPA 3OV6A 3AS1A 2FATL 3QQDB 4MNQB 3ARYA 3GSQA 2GTWA 3HUJE 4M7ZB 4S1DD 1CBJA 4ZUVA 3SPGA 4XPHL 1NM9A 1G6VK 2ICEC 2NT0A 1BFOB 4A7GF 1KCBA 3SPIA 1FLRL 4KTEL 5DJZB 5I0XA 3IWVA 5E95B 3HNSL 2X9WA 4JO2H 4KZEL 2DF3A 3MA7A 2BSTA 3TN0A 1LM8V 3S37L 4OCSL 2NX5B 5FYJL 3VDCA 2R29A 3QUKB 1NCJA 5JW5B 2ZF9A 3EDJA 4ZDHB 3TBYB 2FDBP 3S3SA 5GSRB 3FZUD 4DO4A 3C08L 3IETB 3MLPA 1S7UA 1I9JH 2OCFD 1WIUA 4AL8H 2D7NA 2A1WH 5B8CC 5EC2A 3U0PA 1OVZA 1I7RA 2D7OA 2EDBA 2FYYA 2X9XA 4RIRA 4AUJA 1YEFH 5BO1L 1O9ZA 1K6QL 3CSYB 4G71B 1AO7E 5DD6B 3MRRA 43C9A 4EN3C 4WFGD 2XXGA 1CXFA 2MCAA 5I30L 5KYUA 1LE9B 3RX9A 4N24A 1A2YA 2LGNA 1RURH 4HJGB 4PGEA 4YVNA 5CJ5A 4HIIB 3OKNB 3SE3C 5AW5B 4N1CA 1IGML 3QJUB 3SDXF 4HEPG 3FOMA 4YHKH 1MCEA 1OAYH 1ZXQA 3DX7A 4JVWA 4V2BA 1AXIB 3R4RA 3FT3B 5GGTH 3DHPA 4MJ2A 3QUXA 2L7EA 1FC2D 4GAGH 4MDIA 1SOXA 1WYJA 2F08A 1DJWA 3CFKB 4A37A 5JOFB 1NCBL 2OSXA 4NUGL 3V7AG 1JGEB 2BCKA 5E1AB 1WAAF 3U30B 4D7BA 1FFOA 1P6FA 3HR5A 5HGHA 4PJDF 1CTOA 1MSPA 3DX6A 3LKPA 3NJGA 1P2CB 2FEDC 3ARDA 5C0NC 1MEXL 1QI3A 2XN2A 2X5PA 5DF0A 3JV4A 2ATKA 4XNUH 2X2IA 3OJMB 1QO3B 3CN4A 4X6CF 5TFSL 4NUJA 5AAPA 1AP2A 5GGSB 3I6KB 2DM2A 4C4KO 3WIFB 4MD5A 4LEXH 2A9MH 1UWEL 4MNHB 3P4OA 5C0FB 3L13A 3O9WA 3OXRB 4TSBL 1QACA 3QPKA 3CVHA 3QJOA 4F93B 4LHUB 1AC6A 4FFZA 5EU5A 1CD8A 2HJLB 2YD5A 4YDVB 3OHXB 5F97E 3GBEA 3OKYA 4OGXL 4EEEA 3NFSH 4WFEE 3KLDA 4CILA 3KH3A 4PREA 4C54A 2J88L 5BV7H 2WYHA 1XDTT 4HPHA 1GAFL 2ZWYA 3EBAA 3EFDL 3MOAH 3GNML 4OJFH 3WXWL 2CIIB 1MRDH 2J55A 3D12B 1FBIL 1MDAA 4G5ZH 4ERSH 2A9AA 2C7FA 2NY2C 2CDGB 1E28A 3D51A 3OZ9H 2BDNH 2F74B 1XT5A 1RUMH 2WIMA 1ZJBA 3EYSH 4HOXA 3GYRA 4FYSA 1NDGA 4XOCA 3EFFA 2HMIC 3RZCA 1E9QA 3NCCB 2A4CA 2XPZA 4XPBH 1PKQB 1KFAH 1GMEA 4IKJA 4UNTA 1H6TA 1P53A 4GPVA 4Z7OB 1A6VH 5HDLA 4JO8A 4R3SB 5KTEH 2WQRA 5LNDA 3T0EB 1GS6X 5FYKU 4XNYH 1QSEA 4PB0H 3FCUB 4S1QL 4IJTA 1MIML 1L6XA 3PV7A 1AYRA 3SCMA 5I16B 3NTCL 5FKAB 1Q38A 1VPOH 2IGLA 3ZKXC 4Y4FD 2GW5A 1TVBB 5LO7A 4LMQE 4B9KC 5JIQA 3NP3A 1I9IH 1HQRB 1I82A 2NY4B 2WUBL 1BXUA 4LPVA 3QXWA 3SQOL 5SWZB 5IFHL 5DVNA 1M7IB 4XCEB 4MAZA 2WWMD 1AD0A 5CLXA 4GKZA 4KDTC 2VERN 2JKIS 4S2SA 1DUYA 4H5SA 2CGRH 2IQAB 1QEWB 1SYVA 4I48A 1K5NB 4FG0A 2XOTA 1S7RA 4JM4H 2MPVA 1OP4A 2QVMA 2AEQL 1ASOA 4ENZA 5FGBA 4WWKB 3EJYD 5E6IA 4KK6D 4LSTL 5F3HB 1HOCB 5E4OA 2EUVA 4HW6A 3G5XB 2IDSA 5MENB 4PLOB 5JORA 2AXGA 5H2BA 3HPJB 4Z7VB 5IIEA 4UYQA 5C0BD 4JRXD 5LAXB 5IZ7A 1MCDA 1T1XA 1KT2B 5K59F 1MW3A 2Y69B 1K2DA 4OKVB 4M61A 5C2UB 2W9LA 3WL9A 2WOYA 5FO9B 4PSPA 4NNYB 1AAJA 1OLZA 3CFUA 3CDYA 4ZMAT 4MMZB 3C6EA 2GSGB 5B39G 3OKKA 3D69A 1SN2A 4ODBD 4UQBA 3FQYA 3GTTA 1M1XB 1LE5B 3F7YB 2VDLB 5L6YL 5AKVA 3FSVA 1RJYA 1UXLA 5E2TL 5HGDA 1CXEA 1OOWA 4AMKL 2CM6A 2BWIA 3V79C 3RNQA 3EAKA 2IXQA 4UIKH 2APWA 2UUDH 3CHQA 4U2ZA 1YYLH 1UB6A 4NM8L 2ZX9A 3HG0A 4K5OA 4X83A 3THMH 2CRZA 4NO5B 2GEQA 3GSNB 1NIFA 2V8MA 4EMZA 1SXSA 3F85A 5KG9B 3GRWH 4P5TC 5E9NA 4CADB 4X6EB 3OKLB 2OL3A 1Z9MA 3OKDA 4JFVA 1JTPA 3T1WA 1A66A 4YHYB 4M03A 3GBNH 5FK9B 4ZMOA 3Q6FB 4XMKH 5ISZD 3H6AA 2IANB 4M7JL 3BP4B 4NOBA 2BVPA 3LKQB 3ABGA 1L5GB 3UO8B 1ADQA 1NBQA 2AVGA 4OQ1A 3VX0A 4GIAA 1PLGL 5GQBA 3K8MA 3SQRA 5AEAA 1EH9A 1Z9PA 4P04A 1GCYA 3MJ8B 3MV8D 5AUMB 5GS1B 5GRVK 2VWEE 4X98A 4OZGE 1TU2A 2FLBT 4OZFH 3UYRL 43CAB 1U2HA 5DUML 3IT8D 3U0WH 1NKRA 3H42H 3HE6D 3PU7A 3QULB 4LARH 1JZFA 3ZE2B 3VI3A 5FO8B 1DJHA 2G4EA 3LKSA 5AW3B 5K33A 1XGTA 5KW9H 3MLRH 2X1XR 3ILPB 3JTTA 4LSPL 2IPKA 4NERA 3M1BB 5DJ2A 1B0WA 2ZUYA 3K80A 3T8VA 2QR0B 4G9FB 1L0QA 2HLAA 1F3RB 4IOFC 3M88A 2WJ7A 3Q2LA 1PY0A 4GMTL 3FQXA 2BVEA 3ZKNC 1HQ4B 3SKJH 3WS3B 5BO0D 5IMLB 4Y9BA 3QUYA 4PJBB 4IBUA 1DZBA 3ROLA 3DVGA 3UJTL 5I8CA 5I1EH 3LNDA 5F7UA 3J7HA 4MXQD 3QIBB 3H2WA 4MYWB 2W1NA 5KOVC 4CA4A 5ANMA 3RWEB 5DC0A 4BH7A 2EKSA 1YMHA 4MAYB 4L4TB 3WDIA 4OT1L 1S7VA 1UKTA 2LT9A 3RWIB 3UADA 4J6RH 1PZ2A 4X7SH 2BP3A 4G7RB 4OD3L 1U0QA 1IKNC 3GSWB 4ZOAA 2JKSA 4ZUTB 4MJ5A 2X4OB 1N5YH 3G6DL 3HHMA 4JKPL 3TYGL 3WGVB 3ZJAA 1UZ8B 4UU9A 1EFXB 3RDTD 1DSFH 4WEEA 3S5LG 1A14L 2VDOB 1FFPB 3U7AA 3WJLC 1T2JA 1HI6A 3HMXL 5EPMA 4BFIB 5JW4Q 3DHJA 4QY8B 2D03H 5FA3B 1KCSL 4HS6B 2CBOA 1BDYA 2AEWA 4ZW7A 2HVJB 5E5LA 3WNOA 2F1BA 1ZV2A 2PYFA 4U6YA 1BJ1J 4KHTL 4ODVL 4Y4KD 5JIIA 1U6AL 1F4AA 2AJYH 2F1AA 1IGJB 3BVVA 3BSZL 1JVOA 3KYKH 3CPLA 4O2CB 2JCWA 2YA0A 4NNXB 2NY6B 3BD3A 1T0MB 3IE4A 4X8JB 4PVNA 1WWBX 4MA3A 1PS3A 1MXGA 4TVPD 4OIBA 4YDIH 1UXWB 3VGEA 1R3JA 2K45A 1QFHA 3LX9A 3VFRA 5B38G 5HHPA 2OTUA 2AV1A 2D3NA 1EAPB 2DQ6A 5PAZA 2D9QB 2BSRA 5DZAA 3UFIA 3SQBB 2BIPA 2ZOOA 5C0CA 5CCKH 3PGDB 4RMVA 3MOQA 5JOPE 3BAXA 1IM3A 3Q8EA 4IRZL 1JVKA 2DQJH 3CC1A 1DDHB 3TASA 4AUUA 1JXKA 4JRYB 4IRSB 4N1HB 4ZMQA 1TQBC 3MNWB 3MACH 4PV1C 4JB9L 1ZANH 1PG7W 2V9UA 4N86A 2X2HA 3P9MB 2VRKA 2O6PA 3OAZH 3S3CB 5K9JH 2P5WD 3VFWB 1H3WM 1U93A 4OLVH 4QRPE 1QI4A 4BBWA 3KPQA 1KENH 3VFNA 3AWFA 1O6SB 1LWRA 2NXZB 3RWJB 3A4FA 3G6JA 5AQ0A 3DURA 4YK4B 5F3BB 1AGBB 4UTBA 3WJJC 2Z65C 2PO6D 4FMKA 4XP5L 5AYQA 3VRJA 2FATH 2IH9A 2WUCL 3U2SB 3NYKA 4HS3A 4L9DA 1D5MA 2F54B 1NDMB 4UQ3B 1BAWA 1E7UA 4PRNB 4MJIE 4XPHH 5SV3A 3I2CL 4JZJA 1KIPA 1RLBA 4P3DA 1C5BL 1LGVA 4NB7A 1JHTB 1FLRH 4KTEH 5IJBC 4NPYB 4YLBA 3HNSH 4KZEH 2FHBA 4IBWA 3DVNB 4TLTA 3VWJC 3IDUA 3S37H 1ORSA 4OCSH 5FYJH 2JQAA 1HNFA 1LP9F 4GKNB 3HG5A 3EJSA 2XKNA 4BHUI 3CU7A 3V0JA 5F7EL 5KS9A 2Q86B 4TTDC 3B2XA 3C08H 3RGVA 4ISVB 2P45B 2IBZY 1ZVYA 2HP4A 1P7QB 4K8RL 2EE0A 2VWEC 4ODSL 4MS6A 2H6PB 1UD4A 5HJ3A 4AG4L 4QRRB 5BO1H 1K6QH 3QXDB 1QKZL 4DTGL 3TJHD 3GMRB 2ZP8A 5I73C 4OD2A 2G3ZA 5I30H 1DVSA 5FFLA 1S5IL 5K9OA 3SDDB 4EZKA 3PWJB 4NZUL 4PV8B 1QBML 2QPSA 4H20L 1IGMH 4PRID 1JXFA 1P4UA 1WFTA 4G9DA 4WO0A 1GYUA 2MFNA 5LQBL 3JTSB 1UOLA 4ZFQA 4Q9RL 5DJYB 2BVOA 4MKMA 3B2UD 1BZ8A 4NQCD 2KL6A 1NCBH 1IC7L 4A38A 4NUGH 1ZHNA 2LQRA 3MZTA 3TCTA 3VFGL 4PJXB 5FAAA 4PB9L 4U1JB 1TTAA 4FQXB 3NBNA 5C86A 1V27A 2HRHA 5DD1L 4C8XA 4KHXL 5E9DE 3V9FA 3N42F 2Q0ZX 5HYSG 4ENEC 2IMNA 1SM3L 4DEWA 2JIXA 3V9EA 1D3CA 3UPRB 4DP8X 1MEXH 1UWXK 3RIAK 3I74A 1I9EA 3F6JA 3BVTA 5TFSH 5AL0A 3ARZA 2N01B 3TVMA 4JY4B 2JKXA 1MUJB 1UWEH 3SD2A 4YBQC 2B59B 3KH4A 2HT3D 4PJCB 4TSBH 3FQTB 2VC2B 1NGWA 5LGJB 2IOIA 2XFXA 1LJMA 2IBBA 3GZQA 3HNTH 4F7MA 2PABA 2ZCLL 1CK0L 3O6FD 4M1CC 4NIYE 4ZFFA 1UVQA 3CX5K 4OGXH 3TFBA 2ZP0T 5GISL 3BN9C 2ARJQ 2C9QA 3U4EA 2J88H 1GAFH 4P4RA 4IDJL 2AK4E 1BBDL 3EFDH 5ESQA 3VD2A 3GNMH 3WXWH 1FE8L 1XWVA 4F2FA 4BGDA 1RZJL 2EDRA 3BIBX 1GTNA 2DQGL 1FBIH 1WT5C 5EDXA 5ETUA 3PG2A 4NQDE 5HPMB 2AF2A 3LV3A 5SV4A 2XVBA 5GZNC 2JSFA 4BSJA 5HDRA 2W80C 2CO3A 3QH3B 4CU7A 5HJGA 4Z6AT 1R17A 1R3HB 1EEZB 2I7OA 1LK2B 3CE1A 3PWNB 4Z5RA 4GEJA 2VR8A 1JD7A 3UTSD 4AC2A 5L4FA 5D1XA 5GS2H 4CNIA 4M6AA 5B1KA 2MQGA 4ZMXA 1UA3A 1DN0A 3PAYA 2PXYA 2VLJA 2WLJA 4S1QH 2WXNA 3BFWA 1EDQA 1MIMH 3N43F 3BUQA 3QQ3A 1KXQE 3NTCH 4F7TB 3RVXC 2J44A 2Y23A 1QRNE 4CN4A 2WUBH 3SQOH 5IFHH 5IJDC 4PG9A 4G8AC 3UYPB 2ID5A 3KE0A 4UDUA 4E9YA 1NCDL 3H56A 5FYLD 4N6RA 1AOHA 1HNGA 3MBWA 4JM2C 5D2NE 4MX7B 3KL3A 2EILB 3PV6B 5BJTA 2BIIA 3P4OB 1KNOA 2JTYA 3ZR6A 5DVOA 4B9ZA 4D9RE 5DVKA 3TYFB 4LSTH 1TZHB 4LPCA 4FTDA 2XWTA 1D5RA 3MUHL 2NT1A 4LOFA 1IZKA 4NPJA 3S34L 1E4WL 1XF5B 3R4DA 2VJXA 2W60B 4NXKA 3V0HA 3KYNB 1WTLA 5E7BA 4AQ1A 12E8L 3TO4D 2D0FA 3ULVL 1OKEA 4OBRA 5EEUA 1ET8A 1IBGL 3S2CA 5IJKC 1KB5A 5DWUL 3EJTA 3PAUA 3APFA 3RUGA 3L3JB 3NIDE 1ML0A 3F00A 4FCHA 4L2LA 2RJMA 3K6SB 4PJ8A 2X09A 3VI4A 4PCKA 1YY9D 2ZOTA 1RP9A 4M9OA 5AB9A 1JV2B 3LNGA 4DO6A 1U8OB 4F8PA 5DA4A 1KPRB 3NN8A 2VLKE 1G9MC 4WUUE 2IWGA 4I89A 2PWEA 1P7KB 1BD2A 2FB4L 5D7LB 5JPNA 2VR6A 3ZQWA 1ZY9A 1UT1A 3CDGB 1JS4A 5L6YH 5B7EA 5CBEA 4HKJA 5E2TH 1KTDB 4AMKH 1PNDA 1NCNA 5DZLA 3LIZL 1YMMB 2DQEL 5DS2A 2R0LL 4K94L 5F0LB 1M3IA 4A7VA 1CICC 1M2VB 3P73A 1N6UA 1Q9KA 2GY5A 2FEEL 5CCGE 1I8IA 4GFTB 4U6HA 3ALXA 4QNPE 1NFDB 4XB8A 4GKZB 1OM9A 3AM8A 1SN0A 5ITBL 3TNNB 1W6WA 3O4LB 3C60A 2IGFL 2B0SL 3QPXL 4BZ2A 3MJ7A 1OF2B 2VNCA 2I32A 3NA9L 2FH6A 4DKEL 1S7RB 4IK7A 1SJXA 3FCSB 5F0MB 1OP3K 4UM8B 5IVXB 4K9EC 4Y4HA 4OZIE 1ZE3C 4X4XB 4YR6A 4E9RA 2HTKD 5CEYB 2R2BA 4M7JH 3NDYE 1UH4A 4PHZA 4AJVA 4MMXB 5IBUG 1R46A 1PLGH 2FUQA 1DLHA 3TURA 3HIZA 1HJCA 2N7BA 4AZ8A 1YPZA 5E7FA 5TQ2L 5IB4B 5MEQB 1FZJB 1WE5A 4NQEB 5I0WA 2G9HA 2KZWA 3UYRH 3DXAB 5CJXA 5DUMH 2WQUA 4WW1B 1BSIA 3VH8G 1N0LA 2VDPL 1HK6A 1E2WA 1NFIA 3STLB 2PTVA 5F7WC 1BXVA 4HA1A 1DQTA 5L2KD 2P5PA 5A2AA 4YSAA 2DJUA 2JE8A 4LSPH 3RTLA 2OI9C 4GSUA 2PWGA 5D96C 4DP0X 3L08A 1CZ8L 3WLWC 3VQ1C 3WNPA 4NHCL 1LO5A 4GMTH 3BRFA 1UASA 4G80B 3S4SA 2C1OB 1HAUA 1O7DE 3CQQA 4JL1A 5H37A 4MSWA 1SFDA 2G2RB 2IXQB 3UJTH 2GFBA 3LRSB 1OCRB 1YNKL 3J07A 3UAJA 1NLBL 4R4NC 5C0AD 1ZLWH 4OJAA 2X2JA 1VADA 1ZT4B 2E4FA 2MNWA 2WVVB 1FNLA 1AGFA 3FB5A 5ACLA 4OT1H 5CM1A 3TIDB 3P3TA 1WFMA 1LDPL 4TS6A 4POZD 4P48A 5KVEE 2CPCA 1ZLUH 3MJ6A 3QNXB 1RU9L 1TOXA 2B5IC 4OD3H 1YN6B 1E9PB 4ZW8A 1ZIBA 3QQ4A 4D3CL 5C3IA 2ITDA 1FZMA 3G6DH 4DN4L 5CLTA 5IT2L 5KYYA 4JKPH 1FL3A 3GSOA 4HLJA 3TYGH 1RZ7L 3WU1A 2KBGA 4FX5A 1JHLL 3KYMB 3LHPL 4OFQA 3VGBA 1F1DA 2HG0A 4OLYL 4PJHF 1MCJA 1A14H 3HMXH 5CD3A 1XCXA 2WINB 1KCSH 2FVNA 3D85B 4P2RD 1BQHG 2EACA 4P07A 2NY0B 2YMXL 5D2NC 2A6IB 3BKJL 4ODVH 4KHTH 4XN1A 1U6AH 1TQSA 3QUML 3MV7B 4RFOL 5IB5B 4N0FB 3BSZH 3CVBA 3GPSA 3MLWL 1TVDA 4LCWE 3D1MC 4PQXA 4JHWL 5B1BB 1EJ8A 1HYSD 2EKJA 4AKOA 3GSRB 1JPST 5JA9A 5F1IB 4DESA 1JWSA 1J1XH 4Y4FC 3G5YB 4ZXBA 1CVRA 3VXUA 5J1SC 4J27A 1OXYA 1INQA 4IRJB 5JIDA 2FBRA 4W9HC 4B9CA 3IXTB 1HDMA 1PX3A 3CLFL 3ZMRA 4AJ0A 5C6WH 2Z0UA 4GQZA 3I02B 1R9FA 4PRHD 3QUYB 4RBPK 3L9RA 3BPNB 4R7NB 4U4IA 3O2VL 4IRZH 3L3IB 1PG7L 2W0KA 4RZKA 4PVBA 5I6XC 2XBTA 2XI9A 2B3IA 4G5AA 3LCYA 4JN2A 4PJ5D 5GRXG 4QAMB 4OFYD 3O2WL 4JB9H 4YL9A 1YMHB 4PIBA 3ZDXF 4EJ1C 4GKLA 2EYRA 3DMMB 4ELDA 1K5WA 5HYSA 1CXLA 2KERA 1HX0A 1QUNA 3C6SB 3FB8B 4MJ5B 1PX4A 1QWHA 4X5XA 2CDFB 1JWUA 4LMQI 2FO8A 5DK0A 3KJ4C 4PRPB 3VXPB 3WDJA 4XP5H 5BS0E 2WUCH 4YDKL 2OW7A 1RPKA 1QLFB 3F64A 4UMSA 2NZ1A 3ZE0E 2P8PA 4GXVL 2FWUA 2X9ZA 1AHWB 1Q1JL 2PCPA 1JMXA 3AS3A 1RZ8B 2YPVA 1N6QH 3I2CH 2H3KA 5I6LA 3QK0A 1C5BH 4ZNCD 4JQIA 1X3DA 5C8JA 5MERA 3SOTA 2C1PA 5CN1A 5KUMA 4X0KB 3GIZL 1FL6B 3IKCA 4M8UA 1T7VA 2ERJC 5G55A 5SX4I 3P4NB 3GMPA 4J1UA 4U6VL 4HX1A 1RZGB 1MCPL 2DQHL 1SJEA 3IK2A 1Z9LA 2GC7C 3QO1B 4GRMA 3Q7JA 5F7EH 4PJGB 4AYGA 2GK0A 3NG5A 1PLBA 2EABA 3NIGB 1Q8MA 1OLLA 2A77L 5HI3D 2ATAA 3KPRB 1KBPA 4OI8A 2V2XA 4H26B 3V0EA 4K8RH 1KDIA 5E5MA 5E1GA 2WLHA 5HHPB 4ODSH 3MYZA 4P3WA 3F7VB 3ZR5A 4YSQA 3V5DA 2I60L 2BLFA 3MV01 3MRCB 4AG4H 4AT6B 1CTNA 2JLPA 1DQML 1QKZH 3HZ3A 5SWSB 4DTGH 2H2SD 4N0UA 5DLMH 3DX8B 4P23A 1EHXA 3AVEA 1S5IH 4N8VB 3HE7B 1SF3A 4AGNA 1BX2A 2Z0BA 4NT6A 4NZUH 5I75B 1FGNL 3Q8FA 1QBMH 3C8HA 5T8IA 4H20H 3CTTA 3BHBA 1IBZA 3MV9E 4OZHE 3UDWA 4JY6B 2EIZA 4MKTA 1EXUA 5BZDA 3SGDI 3WE6A 5LQBH 3QXVA 4Q9RH 1U93B 2J1KA 3D30A 4ZSOB 5FYJU 1M2OA 3SIKA 1O7DC 3HG2A 5ALCL 4RCAA 3PUCA 3W0WA 5A1AA 1IC7H 3B43A 4YS4A 5EUOB 3KPSA 3WTVA 1V3MA 4PB9H 5DMKB 1IBDA 3MGTB 4ZMPA 2C9RA 2WLKA 5JDSA 5DD1H 4KHXH 1S9WA 1A0QL 4P8QA 1XF4B 4WU7A 1SDYA 1G7QA 1SM3H 1I8MA 4JZJB 2OZ4A 3CH1B 3U4KA 4KRPB 1MI5A 2I27N 4H7VA 1D6EA 3V4PL 3GUTA 3C5ZB 3DUSB 3EBHA 4JO3L 4KXAA 1T66C 2V7HB 2XTJD 4F2EA 5EF1A 3C6LB 5E6SB 3KBEA 4KMLB 1C7TA 4Y5YA 3VFPA 3ABZA 1HU8A 1O7SA 2D7PA 3G5WA 4IBSA 4OBSA 4Y2DD 4HCFA 3MV8A 1MCWM 5LCVA 2ZCLH 1CK0H 4TUJB 3K2IA 4UOW0 1IEHA 4YOKA 1CE1L 2ZOLA 2E9BA 3MLTA 3WHXA 5D6CA 3SY0B 5GISH 4HKXA 4B5EA 4BYHA 2WXPA 3UH8A 4IDJH 1BBDH 3JVFC 2CA4A 4WTQA 1HC1A 1FE8H 2XWXA 4IMLA 5L2JA 3ESOA 1RZJH 2DQGH 5H94B 1SUJA 3ML9A 4G42B 4WZ9A 1KF9B 3BQUA 3QDMA 1LEIB 5D5MB 2Y5TB 5AAMA 2Y06L 3LNHA 3QIWB 3AY4A 1BYOA 2ARJB 3MNZB 4FXLA 5HHNB 4YO0B 1E8ZA 1NCCH 5CEXB 3ZHDA 2P8LB 4ZT1A 1NFAA 1U58B 2X70A 5SX5H 5JXEC 3TONA 1O6TA 1QSZA 5EIVA 2ICWJ 3UTZB 5JPMC 4P3CL 4APXA 1OOAA 3ARXA 3NPSB 5CS7A 4NC0B 3SHSA 1BWMA 5C09D 1IE5A 4BCZA 2PPEA 2VL4A 2CCWA 5BVPL 1KXVC 2Z9TA 3T04D 3BFQG 1ZGLA 1P9MA 4APQC 2ZOKB 3S3BB 1MW2A 1CFTB 3TEZA 5BPPA 2NY3C 4P2QA 2FWOA 3B5GA 4Y16A 4FFYA 1GR7A 1NCDH 2GHZA 2FH8A 1OPGL 1JZ3A 3CFJA 3RI5F 2VZ3A 5ALBL 3L6FA 5F71A 1JPGA 2VM4A 2FQFA 4YHLL 4QRBA 5D1QB 5TDOB 3UMNA 4E2OA 4OV5A 2FJFB 3A6CL 3VRLE 5KUKA 5AVQB 4XZUB 1WAPA 1J1PL 5BV7B 1YEIH 4PIRF 5GSVA 4CVXB 2H26A 3FT0A 3CZFB 3S34H 1GZQB 2H0EA 1E4WH 3Q6GL 3X1EA 5F9JB 4IJ3C 1HILB 3RTQD 1G9ML 4MJ6A 4F2MB 1ZVSA 4MQ7B 12E8H 5FECB 1CGWA 5D7KE 3ULVH 2AQSA 1B9ZA 1GL4B 2WC7A 2YPLD 1IBGH 2CXGA 2AQ1A 2HKHL 4HH9B 4PLNC 2CLVA 3VFSA 3HZYA 4Z7IA 5DWUH 4H2AA 4J4PD 5FO7A 1FIEA 2P1YA 5LG1A 3CN1A 5T1JA 4HKBA 1IJNA 3QNYB 2Y1VA 4EOWL 3BLPX 4DERA 4U1IA 3CMGA 3KD4A 3UTQB 4KY2A 1NIBA 4FMFA 3MRIB 4G8IB 2GIMA 2HYMA 5LDUA 4GUQA 3CVIL 1JCVA 2YC1A 2FB4H 2G3NA 2YMTA 4MD0B 5EU6B 3VWKA 3VXSD 1ETZA 1RMFL 4BFRA 2AITA 2N56A 2X41A 5CSZA 3W11C 3HAEH 1N3NB 3M17A 3KM1A 1E4KC 2EDNA 4NC1E 3LIZH 3OJ2C 3QQ3B 4QTHB 2JELL 1NTDA 5E6UB 3CXHJ 3Q44A 2DQEH 3BO8B 1J5IA 2R0LH 4K94H 4L4JA 2DLTA 4AVIA 1CE6A 3H9SD 3PQYE 2OJEA 2KLSA 5EZOL 5C9JB 3MI6A 1Q1PA 2WQSA 3L4CA 2ZXAA 2WP3T 3B7YA 3EZ8A 5ITBH 2HVBA 2IGFH 2B0SH 1CFNA 3QPXH 3EDEA 2ZNWA 2XY2A 5A2LH 1GJUA 1BVKB 1GGYA 1YY8B 3NA9H 1WGOA 5BMFL 2NTSP 2BNRA 4DKEH 4NRYB 4XN2A 4AMWA 3B4NA 4ABVA 2V2TA 4OR1A 3P3SA 5JHDB 2XXFA 3QIUD 4H1LG 4PJEA 4L0YA 1HE8A 5F9OL 5IY5B 5H35B 3KYOB 2DN7A 4F7PB 2X7LB 4LCUB 4PS8A 4Z7UF 3TBVA 4MNQE 4QI3A 1KJMB 2BNQA 4A7QA 3HLKA 4UIMB 3UYOD 5TQ2H 2QSTA 4LBEB 1PEZA 3OPZL 4DSYA 4PP2B 5EO9A 2OMYB 1OAUL 4TVSa 7TAAA 5DRZB 3EKCA 1T4KA 1JNHA 2VDPH 3BDYL 4JFXA 4PM1A 3BCDA 2W9DL 4PJ8B 4JPVL 1BHGA 32C2B 2MTAA 4KZ0A 3HZVB 2NX5E 4ZQKB 3WTXA 2CALA 3OQ3B 5EA0L 3DSNA 2E7CA 1GA2A 1CZ8H 1Z7JA 1OO2A 1XD1A 3U9UB 3RY4A 4NHCH 1U8NA 4TQEL 5CU5A 3EO1A 5EEXA 4GINA 3CV5A 4N0RA 3D39D 4ODUB 1ILUA 1Z5LB 5CBEB 3MBEB 4DAGL 1E27B 3BDXA 1XZ0B 2ZUSA 5KSUB 3ZT7A 4UTAL 3QXTA 1JZDC 2R9HD 3QI9C 5HHMD 1W8OA 1P1ZB 3VA2C 3MQIA 4NZRL 3Q5OA 1YNKH 3TGXA 1XTMA 3EYQC 3IDIA 2VOTA 5IW3A 1NLBH 4QKXB 5J13B 4TL4A 2P43B 3JQOB 2BHFA 5EO0B 2NUTB 4X5WA 4URTB 1TQUA 1RHHA 3KJ6L 2SEBA 3WUWA 1MH5B 2XXCB 2A74A 2YBGA 1LDPH 3C60B 3GC3A 3TZVD 2XETA 2V4LA 4MB3A 3S0PA 2H5UA 1RU9H 2BVUA 1IX2A 3K6DA 1SRDA 3EYUL 5C0JB 4BHUA 4D3CH 3DOSA 3PJSB 5D7JA 4Y4HB 3ZDZF 4DN4H 5IT2H 1UB5B 4YR6B 2HUHA 4BKSC 1RZ7H 5F9DC 3KWWA 1JHLH 3UBFA 5FF6A 3LHPH 5GPRA 4CVZA 5ESVB 2Z4TA 3OGCA 2DM3A 1SYSB 4OLYH 3UBXI 3VXMB 1HSAA 4KGJA 3ECBB 4PP1D 3AJ7A 5J6GA 4BELD 1E5AA 3SBRA 2YMXH 3BKJH 3OAUL 3QUMH 3NJMA 3T8XB 4AE1A 4RFOH 4XBGB 2DYPA 2PCXA 2ZQKA 3B9KA 5D1ZI 2LU3A 3BH9B 3CZJA 5IREA 2FR4B 3MLWH 3QA3A 3QORB 4CSZA 1F6LL 4XCYA 5KVGL 4JHWH 1ULVA 2VSKB 3QFJB 3PWUB 4XI5D 1QR1A 3UEZA 4JZOA 3WELA 4AIZB 1MJ8H 1DVFC 1OK8A 1JXDA 4N3TA 1KCVL 3GINA 4FNUA 4Y9FA 1HZHL 3CLEL 3X2QB 3I3DA 4F7KA 3CLFH 5IBLC 5HVWA 2OYLA 4GRLB 4NCC2 2O61A 4GKSB 1ID2A 5FA4B 1J18A 3ZDYB 1FYTD 4DJMA 3O2VH 1PG7H 3EYFB 2BSDA 4EI6A 1DQJA 1J8HB 4LSQL 5KOMC 1TFHA 3WEBA 1MCKA 1VEPA 5GS0D 4Y0GA 4ANWA 1MAML 4RZCB 1LVEA 1HCVA 3ME0A 4HZLA 3ARGB 5J3HD 3MN8A 4Q14A 2AMGA 3O2WH 1CURA 3D4ZA 3FU9A 3NDZE 4M5YL 4KKZA 1MFNA 1PZSA 3FSAA 4UM9A 1JIBA 2W92A 2R83A 3UCQA 4N1EA 5K1VA 1PKQE 1HSBB 1R5IA 1KLFA 3VDBA 4Z7OE 1FZOB 5D1ZD 1NCIA 2FO1A 3AY2A 3T0EE 5L4IA 4CW1A 4HLZG 2E46A 3JV6A 3TX4A 2R69A 1KTLB 1HL9A 3K6IA 4ZFZB 1OHZA 4YDKH 3C09B 2G2NA 4XP6L 4GXVH 1Q1JH 1UD2A 1WK0A 4YC2B 2XC8A 3G9AB 1T22B 3PHSA 2Y7SA 4IMKA 4R4BA 1UENA 4EN3A 5GRZA 5SWZE 1ZXKA 5D9SA 2H32A 1H6FA 4KRMB 3Q2WA 5CLZA 3TEXA 5CWSA 1AXSA 3FC8A 4U6VH 4GP8B 3SE3A 4M29A 4B5ZA 1PD0A 2ZYSA 1MCPH 2TRHA 2DQHH 3ARFB 1K4CB 4L5FE 3ZKMD 5F89B 3F12A 4AYSA 4NFBA 2PUQT 4UOW1 2H7WA 3LAFA 2A77H 5FKPA 1ZWIB 1PZCA 4B9JA 2K4WA 3N1GC 1BLIA 4LL1A 4M7ZC 3UG5A 1SOSA 4WI2A 2BP5M 1BEYL 4XTRD 3GMQB 4OGYL 3VMNA 4IQHA 2I60H 5IHUL 3BIKA 2HPOA 1DQMH 3D08A 1E8WA 5MENE 2CRMA 3MRPA 4KNQA 1WUZA 3NEOA 3VE0A 3C87A 1PCXA 4UMGA 3MCKA 2RGSA 2WSPA 4Z7VE 3N91A 2LFGA 5HI5C 1ED3B 5I1IL 1UOVA 2RQ8A 3IJ8A 4H0LC 1JPFA 3L5WA 1FGNH 3GM8A 3LKNA 5EZLA 1F6AA 1L9SA 3BKCL 5FOJA 3VD5A 1XIWB 3REVB 1U91A 4Q74A 1OCOB 4X5LA 5DJ8B 3PWPE 4WU5B 3FSOA 1GVIA 1QFWM 2AJUL 3FF8A 5ALCH 4WKZA 4NENA 4Z3FA 1J9SA 2GJZA 3O6LL 5DI8B 1KEGL 5FXCH 4X5XB 1KWKA 3MJGX 1OALA 4W6XB 1F97A 4D9RD 2YXVA 2PKDA 3BJ91 1HFUA 1J5DA 4O51B 1JZ2A 1A0QH 1ZS8A 4NO2B 1JPSL 2BRRL 2ENJA 4DFHA 4F9PA 2CO7B 1OP5K 4L8CB 4C56A 2HLEB 4ABWA 2QKIB 3IJSB 3ZHNA 4E9LA 1FG2A 3P11L 2ZXCA 5J4MA 3V4PH 5HGAB 4HOMA 4JO3H 1ES0A 4KRLB 5IOPA 4JGNA 4P4KD 3FCTA 4OM1L 2EDFA 2AZAA 8FABB 3GBLA 1MCBA 1PDKB 2UWEA 3K5SA 1NCTA 2XTLA 4R96B 3U30C 1JFQL 2GTZA 1XF3A 3KXFD 4GG8B 4N8PA 1OWWA 2BSCA 2VLRA 4C57C 2IANE 1RV6X 3EO0B 1CE1H 1KLUA 1NDTA 1QW9A 4ZG1A 5IG7B 1QW8A 4P57B 4PJIF 4WWNA 4PGDB 1KB9K 1FDLL 4WI0B 4NUQA 4E41A 5I23A 4XN9A 1ZLVH 2CIKB 4N0UB 3K2MC 3L95B 2NLJA 4EPSA 1Q9OA 3E6FB 3LNFA 4N0YL 2EDTA 3JTBA 1XCWA 2ZTBA 4NT6B 3T3MF 1XR9A 4DF9A 1WD8A 2Y06H 3HS9A 3UBHA 3ZE2E 4KDTA 5FCSH 3BHBB 5I1AA 4NO3B 5IB1B 3HLAA 3FFCE 5DJ0A 5G4MA 5HDBF 3OHXC 3PDGA 3Q9QA 5I17A 4B95C 4PJFA 1BZ7B 3G5VA 3MUZ1 4IK6A 4BSVB 5D93B 4TVPL 3K4ZA 5D7IF 3DJ9A 4G9FE 1OANA 3VCLA 2OTPA 2IPUK 3HUJA 4D9QE 4F8TA 5BVPH 3KPSB 2AXFB 1C8QA 1T1WA 3P30L 2BP8B 5J89A 4LOUD 1SMAA 2F8VA 4KV5F 3EDFA 1FC1A 1FAKT 2BPBA 2VKXA 4L9LA 1AACA 1E3XA 4PJBE 4XMZA 5J06A 4TUOB 1S9WB 2PLTA 4X5QA 3QDJE 4XNAA 3L5HA 3CAFA 1BVNP 3KW8A 1DQKA 1UCBL 2XN9D 4H1LA 1A8ZA 2IBZX 3FU7B 3KPTA 2ZYIA 4GBXD 4XVTL 3IEAA 2WKOF 1NOAA 3LXCA 4RDQG 3D34A 3HZKB 1D6EB 1OPGH 3FO1A 3DBXB 1FUNA 5ALBH 2PCFA 2H9GA 3T0EC 2EIKB 4YHLH 1J5OL 4MXVF 2Z4QA 4ZO6A 1Z9NA 2WOBA 5J11B 3ZYZA 1T1ZA 4Z77A 2WMPA 3A6CH 1ZSHA 1IM9B 1JZJA 2M26A 3RVWC 3P4LA 1N5AA 4PGBB 2FSEA 5E8PB 3MRJA 1ONQA 1BBJB 1MOEA 1NEZG 2OSYA 3H7BA 1J1PH 1LO0L 3FRPG 4W9DC 3UX9B 1BVLB 1SJHA 4HOZA 2H8PA 2J71A 4K3JL 1NJ9B 1AO7A 5FB8B 4M8RA 2NY4C 3LEVL 2B15A 3K0YA 4M62L 3Q6GH 2WBWB 3GEWB 1G9MH 5DO2C 5AVVB 4BWUA 3I6GA 4JJOA 4ZK8A 2J3SA 4BK4A 5DSCA 5TF0A 2HKHH 3GM0A 5F0PB 5AZUA 1AI1L 2YD6A 4QRQA 5F1NB 4HJSA 1S7SA 3NJHA 5AOLA 3GJFH 4ZRGA 1SOQA 4EOWH 4DP6X 1UYWL 2P5ED 4XNMB 2ZG3A 5C0IB 2Y2WA 4GIOA 4P5TA 2X70B 1ZOXA 1RZPA 1WBXB 2IJ0C 3CVIH 3NIFB 2QEJA 4APXB 2MKWA 4ORZC 4Q97A 4PJ9D 5IKCA 3R18A 3Q43A 1OHQA 4DEPB 4HMDA 1RMFH 5MI0B 2JCCB 3EH1A 1NEPA 3UJIL 4LVNB 2H0PA 2IEPA 4XPGL 2Q9OA 1VFBB 2C4FT 2JELH 4OVUA 4MAUL 1PKOA 2ESVE 2X4QA 3NABL 1JGLL 2R2CA 5EZOH 1I1AB 3SE6A 4MMZC 4OZ4B 3L5XL 3OR6A 4FG4A 2EDLA 1U8MA 4XPTL 4JRYE 4QHLB 4V1DD 5FM4A 4A2LA 1UACL 1JN6B 4L8BB 2J6EA 4Z3IA 2YRZA 5HI3C 4YUEL 3WHE1 2BOBB 4M7LT 2YMOA 3VQMA 4EI5D 4PCTA 1QHOA 1EV2E 4YGVA 3QC6X 4NN5B 1ITCA 3ULSB 5BMFH 4XPFL 1JPGB 3S3JA 2XVKA 4MA1B 2XVLA 5I1LA 4OV5B 2AQNA 1PYWA 4YHOL 2AKRA 3KLKA 3QUGA 4D0CB 2ZUUA 1YNTF 3A21A 1RUPL 4KMQA 5F9OH 1UA7A 3DI3B 4J8RB 4OAWB 1G7JB 4X42A 2VKWA 1ZRUA 3ZUNC 5KSAB 2DW5A 4PTTA 1AGEA 2F54E 2WY3B 4F7CA 3OD3A 2GSIA 4X0NA 5F7KC 3NFNA 4FNLL 2E74C 4HSCX 2KT6A 1FV1A 1KXTB 3OPZH 4NX0A 1JJUA 2QGDA 5F7LB 1OAUH 3L2NA 4A55A 2R8SL 1JI1A 3LPWA 3BDYH 1XGZA 4LLYA 3ATDA 1KJ2A 2W9DH 2E0PA 4JPVH 2PF6A 1BZEA 1GJWA 2GHWB 2X3AA 1JZEA 2HT4D 2VW4A 4LLMB 4GEIA 1KJVB 3F5WA 3OAYH 5EA0H 4WVRA 1HT6A 4M6OL 3DDGA 4WFFE 3Q5TA 5JIPA 2BWQA 4TQEH 1WZKA 5B1JC 5KSVB 2ZKHL 3QFDB 1YN7A 3SBPA 2OJ1A 5GS1C 3V4UL 2GJRA 4DAGH 3B2PA 4UNUA 2IAMB 4UTAH 3TPUB 1XGUB 1DVQA 2X4PA 1DJGA 2XTJC 1L9TA 1MFAL 4NZRH 4DPAX 3WJLA 4GJTB 3KPMB 4N90E 5E8DL 2E6JA 4ICXA 4P46B 1JZ4A 3D7PA 3CZNA 3S36L 3KJ6H 2YJQA 5IJVA 1QSFB 1WRFA 5T1KD 4E5XA 1Y18B 1W16A 4UOZA 2CU9A 2AQRA 4L8SA 1BJ1H 5JLZB 1KPUA 2O1AA 4FQQA 3VSQA 3VO0A 3UBXG 1GOFA 1L6PA 4UCFA 1BZ9B 3EYUH 4PYHA 3ILDA 3V7MA 2QELA 2VUYA 4YPJA 5IQ9A 3SOBL 2YEQA 5CIPA 2EUWA 5FWRA 3MRFB 3SEPA 1USZA 1KGXA 2WYTA 2FBJL 5KANI 3DV6B 2FZ3A 2K0RA 2VIRA 3V0GA 4PJXE 2QTVA 3SDAB 1UZ6E 2D4FA 4K3EL 4GRWH 1RZQA 3D6GA 1CFQB 5DHXB 4MAYC 3HBQA 4HAKA 1KPVB 4HUWB 4XMPL 3OAUH 5D71L 2GTQA 2YA1A 4LRIC 2WLMA 1YEKL 3DIFA 4FKKA 5EU4A 4M93B 4W93A 4LDCA 3D0AA 1XCTA 1Y0LA 2ZX5A 5F7DB 5KVGH 3II3A 4ZPTB 2CRYA 5FYLL 5ESAA 5EOTA 4Y1AB 5JW3L 1U8JB 2CQVA 4XVUC 3DX1A 2A6KB 2OMWA 3MV9D 4OCXL 4NKOB 4PV9B 1MHCB 2VITB 3L5IA 4L8DB 2G3XA 4PJCE 1OWRM 1KCVH 1NZRA 1Q72L 1HZHH 3CLEH 3FT4A 4XNBA 4BQ6A 3HN3A 2V5RA 2BC4B 2XLLA 3NRQA 3BWAB 2J8UF 4LLUB 3EBIA 5BQDA 4XWOD 2VUOA 3MREB 3R0NA 4A2EA 5L8LB 1AIFA 1A1MA 4LSQH 1N0XL 3TJEL 3P9LB 3O6KL 5ICYA 1MAMH 2WANA 4X5WB 2X4TB 4IIQB 2IOOA 2MHAB 3WUWB 1JUFB 1Q94A 8CGTA 2EDKA 3QJHA 4PWGA 4AITA 4MCYB 3VWJA 4I0PD 4QLRA 3ESVF 4Z7QF 2IFFL 1SXCA 1H15B 4XXDA 2WBJD 5I19L 4S11A 4JFQB 3LDBB 3RL1B 4N3UA 4O02A 5D7JB 2NY1D 4WW2B 1PZ5A 2FJHA 3IJHA 5HD8C 2BOCB 2WCGA 4I2XB 4WGWB 4FADA 2O6CA 4WO4D 2R1WB 3UZVA 3OGCB 3ZQ9A 4IRSC 3TLRA 1CT8B 4XP6H 4F58L 1HJBC 4OZGA 4AJWA 2J21A 4C83B 4NP4L 5C97A 3QGVA 2VR4A 3KPNA 5FOBB 5E5UB 4Y5VA 2H6OA 4A6YL 4HT1L 2PNDA 5CR1A 4H25A 5DRNA 4YXLL 1BQ5A 3T4YA 2WB7A 3Q8CA 3KGSA 3EG9B 3VGAB 2JXMB 4YDNA 5I8OL 3EZJB 2NXZC 4RAUA 5I1CL 1A1OA 2A0LC 3MRBB 3AXHA 5FYKE 1BOGB 4YK4C 4IGBD 4JZOB 2ZG2A 2JFCA 1B0GB 1S7XB 2JI2A 2OPCA 2G5RA 3ZTNL 4KKQA 1C16B 5IOKA 2VL5B 1BEYH 5KYNA 4AYEC 1KIRB 4OGYH 5IHUH 3EGXA 2LE9A 5IP4A 1WZLA 1PF3A 3GIVA 2NYYC 3JV0A 3KGTA 1QMUA 3CHXA 4HIEB 4HVBA 3DYOA 4HC1L 2WSDA 5CGBA 1TLKA 3I6LD 5I0ZA 3BAYA 2R15A 3GSXA 3O2DL 3RNKA 3V0DA 5I1IH 1NC2A 2ICEB 2BWDA 4X6BA 5TJWK 3WYRA 1FHNA 2DMBA 3BKCH 4LDEB 3PABB 4KROB 5FGCB 4ZD3L 4F5CA 1ZT1B 1RY7B 1U8KA 1WWCA 3UZQB 4O58L 3CFDB 1FVCB 3X14A 1ZDQA 1A4AA 3UJJL 2YQGA 3C5SA 2E7HA 1I3GL 1OP9A 1WCBB 2AJUH 4XMVA 1GW0A 3BYYA 5E1IA 4ZUSA 4GAYA 3GXDA 3O6LH 1SDDB 5D7LE 1KEGH 1NOLA 1XEUA 2I9LA 3FTGA 2CPUA 3OAWA 2ZXWB 4HCGA 3OB8A 1NAML 3CIQA 3SDDC 5J8OA 2PCYA 1NBZB 4X6FA 1TMCB 4WJKB 5B8CB 1YMME 1S7QA 2FRGP 3KLSA 1EX0A 6PCYA 1JPSH 2BRRH 4J3VA 3CHPA 1DQQA 2I07B 2F53D 1A1NB 1FVEB 2VMDA 4OM0L 3PGCB 2DQFA 1M6UA 3P11H 5EBWA 1WT5A 5GGRY 2Z35A 1NFDE 3RWGA 5D9SB 5DUBA 3MNVB 1QBLL 3O4LE 4OM1H 1TTBA 2YD0A 3OKOA 3DPBA 2YEVB 3D06A 1VGKA 2X4UB 2WLIB 4FQXC 1JFQH 1PY4A 5IVXE 2YAFA 5HGBA 2F9BT 2CGYA 1BQRA 4A2FA 2GJ6D 2C7UA 3MRMB 3U1SL 3PL6D 4JZNB 1T1YB 3NMEA 4OIFA 4FFTA 4Z7WB 1FDLH 1KGCE 3ECWA 4GP4B 3SODB 1G1YA 2P52A 1HHGA 5J1TC 3VJ6A 1SGKA 4NQEE 2JB6B 4G6FB 4JE0A 3EUUA 4IOIA 4JPIA 2AGJL 4N0YH 4OB5L 5IMOB 4G8FA 3DXAE 4MMYA 4XX1G 1R0AL 3L5WB 5EZLB 4X2UA 3LKNB 4F37K 4GLRH 4QRPA 1WBYB 2EDHA 1UFGA 3ET9F 4K9JA 4W81A 4BFGA 2YRBA 2BHUA 4WJG3 2VSMB 4TVPH 2XPGB 3UTTB 4WKZB 1I7UA 1PY9A 2VERA 4B41A 4UZGA 5G2NA 1UD6A 1X5IA 1EDYA 3P30H 4MJIA 3EHBD 4P2OB 4NAJA 4RGNC 1SY6L 2Y7NA 3E1ZA 3OC5A 4W9LC 3FQRA 3HS0C 3TBWB 4YEEA 2J2ZA 4XI5C 3IE9A 1ZS8B 2V5TA 4WCYL 4UUJA 1JYXA 4ZS7L 4WDIB 3MTXA 1RL1A 1UCBH 2XZCL 1M6OA 4YAQB 4XVTH 2AI0L 5IJKA 4G11A 5AW4B 2E9JA 2XY1A 2RD0A 1SVZA 3IVKB 2XZAL 1KV3A 2NY2B 2MQ3A 3DGCR 4K5LA 1AGDA 3VXRD 1J5OH 4XBPB 4WY7L 3PGFL 1SFHA 3ECVA 3HJ0A 4MD4B 1DLFL 4KI5E 1OGTB 2LVEA 4MB4A 1R5VB 1LO0H 2EVJA 4Q2ZB 3BZEA 4K3JH 1EGJL 3LEVH 2XWJB 5J3HC 2YXWA 4M62H 4DOHB 5E5RB 1U3HD 4Z7NB 5HYJD 4E41B 5J1AA 4OF8A 5CGMA 2AQ2A 3G04B 5C08D 1AI1H 3IFOA 1CL7I 4FNTA 1CICA 3CFBB 2J57A 2Z92A 2I26N 1PD1A 2ZE0A 3MV7E 4F37F 5IMMA 2V3EA 5DC2A 3BXNA 4JFPB 3CSPA 3N6YA 3W39B 5GZOD 4RMBA 1PMYA 2DLFL 8PAZA 1FZKA 1UYWH 3APNA 5ACMA 4IKLA 4WWPA 2JMRA 1E42A 4L3EB 4N2CA 1RK0A 4PJFB 1II4E 2BY1A 5I5IA 4RMTA 1USQA 5E1QA 4Y2OA 5E9DA 3UJIH 4X7DC 1S46A 1E5UI 3ALPA 4XPGH 3EF7A 1SUHA 1H6EA 2NCMA 3AG2B 2X2UA 1PLAA 3LZQA 4MAUH 4CMMB 4KDWA 4K5NA 3NABH 1JGLH 5FDWA 2ZUTA 3LMJL 4B9IA 2DWXA 5EBGA 3L5XH 4XPTH 2HN7A 1ZGLM 2NNRA 4BRJA 1AZRA 4M7KH 4D0DB 2BSED 4NKMA 1UACH 2EVHA 3O81A 4IBTA 3QEQD 4YUEH 1PLCA 4BH8B 4X4YA 3GB7A 3DX3A 3PAZA 5DJDB 4X6DB 1KJ3L 2XG5B 4XPFH 1LILA 3ILEA 1RKRA 4MB5A 1AG6A 1CWVA 2SODB 4F9LA 3HG1B 4QRSB 3R19A 3PAVA 4YHOH 4XN8A 1VFAA 3AREB 3V6ZB 4LGPB 1DUZB 4JDEB 1NQBA 1RUPH 2H3NB 1ADWA 2AK4A 5DWPA 4PRPE 4RETB 1WHPA 1J9TA 3LVEA 5HHOB 2E8YA 2X38A 4YX2L 2D7TL 4I1RA 1KYDA 2VISB 3RZWA 3BCFA 1BYNA 4NQDA 4FNLH 2EXTA 4JM0A 1U3NA 1KZYA 1HHHA 4G6AC 4HJ0C 2VT0A 5I66B 2R8SH 2BVQA 2ZX6A 4HBCL 3NFPA 5IQOA 5DLLA 3VG0L 2P8MB 4XCCL 1DDTA 2IALA 5EUKB 1OZTG 2J1XA 4UT7L 3SJVD 1OAZL 4M6OH 4MMXC 3HAEB 4N5EC 4FA6A 4PJGE 5EFIB 4XO5A 4N2EA 3NIGE 1JZGA 3QRFM 1KXQA 5CEZE 1TEYA 3G3LA 3KPRE 2ZKHH 4G8GD 2X4SA 3S35L 1CU4L 2P24A 2OMNA 2E5EA 4LIQL 3V4UH 2G0LA 5EULV 3CFCL 4AGPA 1QRNA 2XWBA 4ZAKB 1KGUA 1RZKC 5GRVL 4TQHA 2C9UA 1YSOA 4ODXA 3ETTA 2AS5M 5SWSE 3POHA 1MFAH 3NCJL 2PPCA 3ZZSA 5E8DH 4L37B 1IQDA 1HH6A 1DJYA 1V55B 2WGNB 5EIIB 5EF3A 3S36H 1CD1A 5CF3A 4ZZKA 5D2NA 7FABL 4GP5B 3HOGA 4AV4A 1KIUA 4QHNA 3S3PA 2ORBL 4G6JL 4YGVB 3BH8A 5GGUB 4W1TA 4JL2A 4ZSOE 4I85A 3MRNA 1OT4A 2A7BA 1SF5A 1VCAA 2PPDA 3FQUA 3ECQA 1NBYB 2AEPL 3SOBH 4A2MA 3IF1B 3VI3F 2FBJH 4PRBA 2ZONA 4CKQA 5EBMA 5EUOE 3H9HA 3BKML 2PW1B 1C12A 4K3EH 4I9XA 1IL1A 1RK1B 4IOSA 3BISA 4W6YB 2VDPB 2GSIB 2IH3A 4XMPH 5DEFA 1DEDA 1U8LA 5D71H 1MWAL 1YEKH 5B22A 2OSLA 2FJGA 5IQMA 2RH0A 4JE4B 2GITB 5FYLH 4OLEA 3CWGA 2VLKA 5JW3H 4WUUA 5DHYB 5EZJA 3QNFA 4OCXH 1I8KB 3QQ9C 2XIBA 4ZX4A 2D31A 3NCMA 4HUKB 4TLUA 1Q72H 4R2GB 1UKSA 5IW1A 4ZOEA 3PUUA 1U2CA 4RAHA 5JXAL 4FC3E 4QOKB 5F9AC 1YEWA 4L0PB 5AB0A 3CFIC 4LLVB 4GBXC 4HPYL 4YHPA 2VXTL 4UT9A 4OI7A 2DWYA 1SMDA 3D2UD 4M7LL 4E42B 4LO9A 1HHJB 4S1RL 2V7NB 4IU2B 3CUPB 2WIIB 2X4PB 1XGQA 3PFQA 3Q01A 3RY5A 1GJIA 2Z31D 5T1LB 1N0XH 3N9GL 3TJEH 3SDCB 3O6KH 3IAQA 4F8LA 3UOAB 4U1HB 3QEUB 3D50A 4N6QA 5FHAL 4G8EA 4JRFA 2PWFA 5D5ME 5IJVB 1UHVA 4FTVD 1JTTA 3F01A 2P3YA 4IRJC 1EZVY 4JLRB 4XAWL 4X9FA 5E4IA 1MW0A 4OZIA 4LXFA 2IFFH 4Y2LA 1URIA 2AJZB 1D9KD 3V4VL 2OTWA 1AJ7L 3D3VB 5F1KC 1AGCB 1EANA 5I19H 2HG5A 3QJFA 1L7IL 3NRPA 4BWTA 3RFZC 4YHIB 5ENWB 3BPNC 2V5MA 3T0DA 1OTSD 2A38A 4KMTL 2HFEB 2YWYA 2FQEA 1EJOL 4PGCB 3CCHA 5IWLC 3PPSA 2IAND 2XJLA 1ZPLA 2EYSA 1NGXB 4HU2A 1GY1A 3QUMB 3KWVA 4U1SB 1JK8B 5CJBA 4NP4H 2X12A 4A6YH 1MJ7L 1U8QA 2R23A 2R39A 4HT1H 4ETYA 1OY3B 2B4CL 5F44A 2DB8A 2CLRB 4K0OA 3QJTB 4YXLH 3DMMC 5FM8A 5TE4L 1JPEA 4EKJA 1NUNB 4PJ9C 3MU3A 1NWOA 1T7WA 3L9BA 1JOIA 1TQBB 5B21A 3TBSB 5I8OH 3MRHA 1G9NL 1DN2A 1CFSA 3KYAA 4ODTL 5I1CH 2MRYA 5JQ6L 2V9TA 4PBDA 4JGUA 4H8UA 5D1QE 3MR9B 1G7PA 3ZTNH 3SZ6A 1UQSA 4U1NB 1J0IA 2NNAB 3RL2A 4Y9GA 5D2LB 3ARBD 2OR9L 1MJJA 2CO6B 5IK3A 4BZ1A 5MEPA 3WMPA 1X5KA 3HB3B 1FIGL 4HUXB 4HC1H 4YZFF 4F33B 4F2ME 3BZFB 1KXHA 1XH1A 4RX4A 3G6JF 4LOVA 4UQDA 1RSYA 2XV2A 3IDNB 3QZWG 4L1SA 3GSVB 3O2DH 2WNGA 5BRZB 2W38A 4NLAA 4U0QB 1VFOA 5DJCB 5C0DA 4ZD3H 3QIBD 3DGGB 3GZOA 2O5ZL 4JKNA 4O58H 4FQJH 5K39B 3QJHB 1QABA 1B0RB 3QUZB 3ZIMA 1QPXA 3UJJH 2WKLA 4L4TD 1I3GH 1DQDL 1DQLL 3CHRA 3HVDA 2F5AL 3O8XD 4N87A 5KVFL 1JZ8A 5DC9B 4D7PA 4GUPA 4KKBD 2O93L 1E9OA 1BCIA 3T09A 3X12B 3RRQA 3K72B 5EU6E 2KC0A 1PZ5B 4XWGL 3DUUB 4XHJC 1FNAA 3O3DB 1O75A 2JNZA 4HIHB 4WLCA 1NAMH 3HE7C 3LQMA 1AVAA 5KS9F 5I75C 4ZFOL 1BLNB 1E5ZA 2PMZA 4GKOA 4OM0H 4LCWA 5DMIL 2B7DT 3DWTA 1UEMA 4B50A 1R5WA 4PMFA 4Y9EA 2DBJA 5DVMA 2PYEB 1P6AB 5CMAB 3VB8A 1OGAB 1QBLH 1ZPUA 1BAFL 1OAQL 3EYOB 3L81A 3SKMB 1FJ1B 4FKEA 1EXHA 1AQDB 2LTQB 3KPOB 3TA3D 3TO2B 1ZHBB 2ZG1A 2ICCA 3L5JA 2BSSA 3SO3B 4BDVA 2CR3A 3NZUA 1FLTX 4MQTB 4F20A 3QG6B 4P5MB 5E99H 1MPAL 2GCYB 3M7FB 1TVHA 5JXEA 1IGCL 1O9WA 2P49B 3QEHA 5JHDE 5I24A 1IIKA 4KX9A 3DDFA 1OSZB 4FLSA 4Z9KB 3U1SH 1ECZA 3REWA 2WP3O 3O3AB 4BEIA 1M05A 5B39B 1KXVA 3M6DA 5M94B 1TTRA 4IEFB 4AEHL 1O5PA 2WYIA 3AUVA 4APQA 4MQXC 3U4BL 5EEZA 3C5ZC 4L4VD 3V5KB 4RDBA 4JFEB 2AGJH 4OB5H 4AL8C 2BHZA 4YLCA 4I9WE 3C6LC 3IGUA 1UD3A 4X5RA 5DMJB 1R0AH 4HUNB 4KOCA 4P2YA 2ADJA 2FIKA 1TPXC 3VXQA 1WIOA 4YHNA 1F45A 1S9XA 4HSQA 4TOYL 5BS0A 5HYFA 4GW4A 4NDMA 1UXSA 3OC8A 1KYOK 4LLDB 4NKDB 4Q6IB 3RURA 2VGLM 5IW6A 2XPYA 2Q7YB 1SY6H 4JREC 2OXHA 1VRSA 4HGWB 3W9EB 1CXHA 3WFCL 4WCYH 4HUVA 4ZS7H 2EEDA 3BP5A 3V4PB 2DYRB 2X4NB 3QIWC 1SEBB 2XZCH 1ET7A 5GS0L 1AH1A 3ZE1F 4U05A 2BK8A 2IH8A 4EI0A 1A4BA 2AI0H 3QRBA 4JO5A 2EE6A 1BIHA 1BF2A 3ISYA 2AXHA 3Q9PA 5IQ7L 2XZAH 3NPSC 4IS6A 4PBXA 1U95A 1PIGA 5EB9A 2KZ1B 4MCZA 3FKUS 1BXAA 3PGFH 4WY7H 3LEYH 5IF0B 4FXTA 1I3UA 1DLFH 3GMMB 3IRCA 5BUAA 3KBHE 2WO4A 4ONHB 3ZKSD 1V10A 3BGMB 3SDYL 1EGJH 2CH8A 4EKXA 4AYFA 1ND0A 4NWUL 3I9AA 1IIIA 3T3PF 1E4KA 3OX8A 3FQNB 5DDHB 1D5XA 4U33A 2OQJB 4ZO7A 5EOCJ 4QRRD 3N40P 3MV9A 2ZYHA 3D4GA 4OZHA 5D1QC 3T2PA 1T20B 1MHPL 4C4UA 2DLFH 1UOWA 3LZNA 5ICZB 3B7TA 3COOA 3QWRD 4JDVA 3WLBB 2VZUA 3QFJE 2G5BA 4NBZB 1LYQA 4L05A 5BV7C 5BQ7B 1X5FA 1Y6MR 2QADC 4ADIA 4YHZH 1MFUA 2CKBL 3E6HA 3PYCA 4JM2B 4K3GA 4OKDA 3B7SA 1FQ9C 5CSBA 3SPVB 4N20A 1TQWA 1U8PA 4M3HA 4TN9A 2A2QT 1CG9A 5E8OA 1VHPA 1AE6L 2H2PD 5IROD 2PTUA 3T65A 1BXXA 25C8L 3N50A 3ZDYE 3AABA 5HTSA 3S2AA 4F92B 1BREA 1N8ZA 3LMJH 4P05A 5K9KB 1IO4C 4HWZA 4IGBC 4E9WA 1J8HE 4Z1PA 1GOHA 2G0KA 5EF2A 1M6OB 4KU1A 2NW2B 3RB7A 3CZUB 4A66A 1G1KA 3KHQA 3U36B 5DD5L 4CU8A 1BF5A 3SE9L 1KJ3H 4KNTA 1MRCL 1I1YA 5T1MA 1AGDB 4Z76A 2WWOA 1L9QA 3MKGA 2VH5L 1P4LA 2ZUWA 2FE0A 3IYLW 5DRXB 3TN0D 4HLZH 1KMGA 1HH9A 1JWMB 1Q9WB 3CJJA 3RUGF 1PZAA 3GMOB 4QXTB 3SN6N 2YSSB 4NAQA 3B2DC 3VI4F 4IU3A 5SX4H 4EAEA 4YX2H 4Z78B 2D7TH 4ZX3A 3DRTB 5CBAA 3P77A 5IHHA 2NUPA 4J3TA 4WI6A 1HZLA 4LEEA 3GJFB 4N5UA 1KFGA 4LCCC 3QI9A 1TTGA 4NBXB 2W91A 2B8OT 4WWID 2VQ1B 5ANHA 4YPGA 5KYWB 3VDAA 3SKOA 2J7LA 4HBCH 4OF0A 1RZKL 3LQZA 5B38B 1MNNA 1B0IA 1D5BA 3KVDD 4N9GA 3FTWA 4QHKJ 3VG0H 5K69A 1MAKA 4XCCH 4AW7A 4UT7H 5CP3A 3PLYA 3ASOB 1OAZH 3BPLB 2ZSWA 5LWYL 1IGYB 2NCEA 4U1LB 5H4YA 3S35H 3ULUF 3OHMB 1ZA6A 1CU4H 4PUBL 1ZK5A 2OAAA 3QUXD 4LIQH 4N2HA 3CFCH 1QTPA 1R3KB 3ELAT 1AMYA 5ACZA 4QWWD 1B2WL 1QR4A 2FUTA 1WIPA 4HLEA 3KLHC 3NCJH 4G1MB 5E94B 4DEUA 1YEEL 3AT9A 5TK2A 4CU6A 1AD9B 3LOWA 4EE2A 1A7NL 1F3JA 1HXKA 2E4TA 1HHIA 1JF1A 4RA3A 3DROA 7FABH 1ZLDA 1PZ3A 1OV8A 1P84K 3BUYA 2ORBH 2GVYA 3ARDD 3NJJA 2CHXA 4ONGL 1MG3C 1TENA 1YPZF 4G6JH 4ODWB 3WTUA 3EGDB 3ENEA 5F6HJ 5T3ZD 1A47A 1EAQA 2O26U 2VDRL 3MBEC 2CR0A 3B34A 3BPCB 2BMKB 4JFFB 3ZXAC 2EVFA 1DVFA 2AEPH 4AGMA 4LPXA 1TZIA 2HVKA 3V6OA 2WO2B 2IPUG 3O9WD 1I7TA 1JXJA 4B7IA 3BKMH 3B56A 3N44B 4JPKL 3RVTD 3H85A 3W57A 1M7DB 4K7PX 1FO0A 1L9OA 2YAMA 1MQ8A 3LPPA 3BP7A 4U3SB 2OMUA 1COBA 2C34A 1OT1A 4LZKA 1BG1A 3LPFA 1BA9A 4EVNB 1Q9LB 3VW3L 1TCMA 3TU6A 4HDIA 5FYJE 4F3FA 4FQ1L 4HHAA 4ZUUA 2EADA 4GW5B 1G7HB 2NTFA 3RWDB 2R2EB 2UYLA 1I4FA 3NZ8A 1D5IL 1MFEL 1RJZA 4OVVA 2IH1B 1XMWA 5A3IC 1JE6A 1W0WA 3RZCD 1RUQL 1SJVA 4FN0A 4O2EA 5JXAH 2WHVA 4HH8A 4R7DB 4WSKA 5I5JA 4ATWA 3EOAB 4HPYH 2VXTH 1FNGB 2ZSVA 4AEIL 3NCBB 3PQYA 3QHFL 4M7LH 3LZFL 3S96B 4A39A 4F24A 3CU1A 5A2BA 4S1RH 1B4JL 1QSED 1Z5YD 4ODXB 4KK5D 1E5CA 2RFXA 3QORC 4E0RB 4JDZB 4KXBA 4V2CB 3SCMD 4BK8A 3N9GH 5BOJA 5CLWA 5LN8A 1TJGL 5IUSA 2K4AA 1CD9B 3IMWA 1N6VA 1XGPA 1EZSA 5FHAH 1ZHKB 3NACL 2QPEB 4XAWH 2W65B 3WEOA 3B9VA 3WEMA 5HGGS 1OD7A 3V4VH 1AJ7H 1U3HC 1KBVA 4RMRA 4GRLC 3S88L 4HHGA 2A9NL 1L7IH 3DIDA 5CILL 2ADIB 4GRWB 3PS6A 4PRDB 3QQDA 4OF5A 2IWKA 4LB8A 4KMTH 4MNQA 4Y4FB 3SD5A 2UZXB 3E9TA 3SKNB 3BJLA 1EJOH 1GS8A 4CJ0A 3H3KA 4FG6D 2EXYD 3NSCA 5E6ID 1EHNA 4HIJB 5DMGD 1DHKA 3ARGC 3ZO9A 5DJZA 1MJ7H 4KKPA 2B4CH 2FTAA 4M3JA 4N2NA 3AWEA 3PRZA 5TE4H 1FNFA 4QRFA 2FGWL 2OSLB 2HFGL 4HJJL 1SXBA 4CN1A 2NX5A 3QUKA 2VDNL 1G9NH 4ODTH 5JQ6H 2EH7L 2YS4A 5JW5A 4ZDHA 4OTXL 3ABLB 3TBYA 3ZL2A 5TD4A 4LPYA 4EN2A 3IETA 5GJTL 3WTWA 1SOKA 4BFFA 2DMKA 1KULA 1RSFA 4WHTB 5FV1L 2OR9H 4FFVC 3CSYA 5C0BB 1SLVA 2ZPKL 4JRXB 5DD6A 3VFOB 1J88A 4Y19E 1FIGH 2J72A 4LCVA 2EEAA 4RMSA 1S78D 5CU9A 1LE9A 3RVUC 1ZV9A 2MKLC 4HJGA 4B0MM 4GG6F 4NQVB 3RYMA 4HIIA 3OKNA 3ARFC 4KX7A 1QBBA 3IJYB 2DLHA 3FFOA 1DR9A 5CNHA 3NJXA 1NMBL 4R0LB 1UA6L 1G7IB 2O5ZH 2N7AA 4MS8D 3FT3A 2CO1A 3MJWA 4MA8L 4Q56A 5CN2A 4F57L 4MBRA 4DK6A 4AENA 1DQ