2ITEA

Crystal structure of the isda neat domain from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Haem recognition by a Staphylococcus aureus NEAT domain.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 24
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2iteA00
3QUGA 3RURA 3VUAA 2Q7AA 2ITEA 3QZMA 4FC3E 2O1AA 3S48A 3VTMA 3OVUB 3QZLA 5D1QE 3SZKC 3QUHA 2K78A 2H3KA 4YMPA 5D1ZI 4NLAA 2Z6FA 3SIKA 4H8PA 4MYPA 3SZ6A 3QZOA 2O6PA 3RTLA 3QZNA 3QZPA 2MOQA 5D1XE 4H8QA 2E7DA 2ITFA 4WJG3
chains in the Genus database with same CATH superfamily
5BRQA 1LQBC 2VE6B 4HU2A 3C5ZA 2WQSA 2F5BL 3H6JA 3X3FH 3A6OA 1BM7A 4JZJA 4MQXC 3SBWC 4HV8B 3LS4L 4WO4A 2XN9E 1J9QA 5IUCA 3ENEA 1JG9A 4GKZB 3WFEH 2WD0A 5ESQB 4WNJA 1A6AB 4DOHE 5LGKA 3H2PA 1NBYB 3AMLA 3PGCA 3DYPA 4G80A 3FUDA 3GI8H 4HPHA 5JLZB 3WDJA 5K33A 3LQMA 4YAQA 1AD0A 5FO7A 2J3SA 4WNQB 2FECL 5F9DC 4KMQA 2YGPA 1QO3B 2BOBB 5GGQL 3MRFB 2TRYA 1XF5B 1U8NB 2PXYD 5HSFA 1A4JB 4BV1A 1JN6A 3KYOB 1ZLSL 2DMCA 2WINB 3IMVA 4OLXL 3UO1L 4TSAH 2BVUA 4O00A 4U7MA 1YY9C 4HUVA 2KQNA 3H7BA 1DVTA 1A6WL 3O3AA 3Q1SH 1F90L 3BDXA 1KJMB 2YSTA 4L05A 3VGEA 4BM7A 1QASA 2GB2A 5EUKB 2VMJA 5GRUH 1AQKL 1I9IL 4HMDA 1E9QB 2FNBA 1NDGA 4LCWA 1OARL 4RDQF 5F1SA 3NIFB 3LXBA 1TZGL 2VE6A 1K8IB 5CWSB 3RAJH 3WELA 1MHPH 1OGTB 4GMSH 1CFQB 1FJ1B 1OVZA 2O6DA 1MAJA 1T7WA 1H3UA 4HV8A 1I8LA 4AL8L 5DRWB 5BMFL 5CIPB 1KZYA 4XO9A 5DA0B 4GKZA 5D71L 4M6OL 1Y07A 3DA0A 3QH3B 4K9EL 1L7TL 2EDWA 5ESQA 4C83B 2NY2B 1A6AA 3NIFF 2YAEA 4XVSH 2PTTB 1NBYA 3IFPB 2YJLA 3SBRA 1OZTG 4N2GA 1TJGH 1T89C 5JLZA 5D7KE 4TYUA 3RZWA 5EZJB 1QR1B 4WNQA 4FG0A 1YECL 4FCHA 5E6ID 1QO3A 5FAAA 1B88A 1AMYA 3CFKB 4Z7QB 2BOBA 2WNWA 5DEZA 3SE9L 4Y5XC 3IM1A 1XF5A 3OPZL 3EFDH 1A4JA 3JWNG 5KYUB 5LQBL 3KYOA 2WINA 3D05A 4ELMB 3L81A 2R27A 4KI5C 2DQFB 2D3VA 1W80A 2H41A 3CBKB 4U6VH 5DLMH 4EMZA 2J8UE 1TQVA 3QJFB 1KJMA 4UMSA 3IK2A 3KEDA 4Z7QF 3RDTB 1WT5C 3WS3B 4WFHE 4WCYL 2Z1PA 1X9RA 3Q01A 5EUKA 4EAEA 3HCVB 1JL8A 1E9QA 4ELMF 4HG4J 4KRPD 1U8CB 4ES9A 2ITCB 3HI1B 1UC6A 1IZKA 1K8IA 4WFGD 5CWSA 2DV6A 1WAAA 1AAJA 1FSKC 1CFQA 1NUFA 4WWKB 1CDIA 1FJ1A 3FOMB 4MA8L 4UCFA 4PTTB 3P11H 2W0LA 3HE7B 3WEXB 1AOZA 4AOFA 2HT2C 5DRWA 2A6JB 2COVD 3MXWH 1ZXKA 2EDXA 1E5AA 5HHVH 5A6LA 1QLRB 4M9OA 3NT0A 1AS6A 1DN2A 1UWEL 3D30A 5KYNA 3QH3A 2VXTL 4C83A 5LVEA 1I8IB 3DSNB 4JHWL 2PTTA 3IFPA 1I7UB 4L23A 3UJIH 1YG9A 1ZVYA 3F8UB 4X6EB 3MACH 3QG6B 4MMZB 3GSVB 1B4JL 2OW6A 4ZAKB 2AAAA 1QR1A 2D2OA 3MV9E 1CD1B 4JCWA 3CFKA 2EDEA 1MN4A 2R15A 4F9LC 4YDMA 1N67A 5KYUA 2I9TB 4D3CL 3QR1A 1SY6A 3QJZA 4JVUA 4ELMA 3FUNA 2DQFA 1JV2B 4HAKA 5EC1B 4DP0X 1FH2A 1YDPB 4JGNA 2K8MA 3VXUE 3PV6A 4FQHB 5CLWA 4QD2E 3TVMA 3QJFA 4JBSA 4XR8C 3RDTA 1UJ3C 1A7OH 3PDGA 3WS3A 4QGTA 3AMKA 3HCVA 5CP3A 5C97A 3S3CB 2JELH 3WNNA 2ZSWB 3FO0H 2IV9A 2ITCA 2Y7NA 3HI1A 1LJMA 5AW6B 4R4FL 1PG7H 15C8L 3QJQB 4WWKA 5FV1L 2PR9A 3FOMA 3RWEB 4PTTA 3HE7A 1LQSR 1MREH 5IB5B 2Z8WC 3WEXA 1CCZA 2A6JA 1BDYA 1JJUA 1DJYA 1IEBB 4Y4KC 5J1SC 2AEQH 1BYPA 4F1SA 4LZKA 3OBAA 4HEMA 1I8IA 3DSNA 3HG1D 1XIWD 1YEHH 2FUQA 3C5JB 2BP3A 3WEMA 1RK1B 4MYPA 5D5ME 3H8NA 12E8L 4X6EA 5CU9A 3QG6A 4ZAKA 4MMZA 3GSVA 1CD1A 2R83A 1J1PH 5I0DA 2XX1A 2X4SA 4MA1B 3P0VH 2X4QB 2A9AA 2I9TA 4FMKA 2O5YH 1UYWL 4UQEA 4Y2DC 3O6FD 2M1KA 4L9DA 3L3DB 2CG9X 3LPPA 1TZ8A 3NCCB 1JV2A 5EC1A 5C0BE 1YDPA 5LBGA 2ADIB 1H0DB 4FQHA 3VD5A 1E67A 4HBQA 3B9KD 2GJ6E 3EOTH 4H8WC 3V10A 3ARSA 4IOIB 3W9EA 2ZYSA 2BS71 3DBSA 5IW3A 2MTAA 2QSCL 1I8KB 4QHUB 3ZRSA 4Y9BA 4AKPA 2ZSWA 2D0HA 1AE6L 4AGLA 3IFOB 3CXDH 2QQKH 3PUUA 4N0CD 5CN2A 3W38A 1F4XH 2BMKB 4GBXA 1IBYA 3RWEA 2BRRH 5IBUG 4GKSB 2X42A 5IB5A 2WZ0A 5BVPH 1IEBA 2EE0A 3GSQB 5J8OA 3NJVA 4KK5D 1BECA 1P6FA 3ARGD 5AVXB 3L5XH 5JIQA 4XI5D 4HU8A 3MV01 4GRLD 2DQCL 4FQXD 3C5JA 1MFUA 3EJUA 1RK1A 2XPGB 1IT9L 1B4RA 2EDMA 4F8PA 3LZQA 3MBWB 2E74C 1G9ML 4FXKB 1YJDL 5FUOH 4F8QA 1MDTA 2PWGA 4QRRB 1AO7E 2JSFA 1BM3L 2H0EA 2X2IA 3CLFL 4JRYB 4UQCA 3SDAC 5HI5C 3MLXL 1XXFC 2R1YB 5IIEA 3L3DA 1URLA 2ICEB 1NFKA 1AJ7L 1H0DA 1Q72H 2ADIA 2J7LA 2VR9A 4EI6A 2VMCA 4PJAE 4N8CL 2WP3O 4J3OH 1N8OE 4J4PA 5GZOC 4IOIA 1LMIA 4ACTA 2I60L 3QFGA 2BFVL 2YSSB 1I8KA 2Z4QB 4QHUA 5E95B 2YUWA 1BQHG 2R1XB 2GJPA 5GZND 1RXLA 1E2VA 2HTKD 3IFOA 3WHE1 5C1MB 4N3UA 3F6JA 1WFTA 1OTSD 2BMKA 3GRBA 2ICCA 4GKSA 3QUGA 1JXDA 2D7NA 3FU8A 6CGTA 3JZ7A 3EO1B 3D6GA 4NHUA 1V7NL 2DWXA 3GSQA 1R3LB 3UBGA 3UXFA 3QIUB 5E2VH 3T0AA 2Y1ZA 3AGWA 5C0DA 2MEJB 5FHAL 4H88H 4NFDA 4XPGL 1MWAH 2NZ9D 3TJEL 1T1WB 3Q8FA 4PWIA 3I02B 1AMXA 4RETB 3OZLA 1S9WB 1SLVA 2XPGA 3L7EB 4AYBA 3MBWA 4G8IA 4F3FA 1OAYL 3VI4B 2WYZA 1QBML 4QRRA 1SOQA 4FFZH 2CLVB 2JV6A 4JRYA 4PS4L 4TNWK 2R1YA 5FYKU 4P57B 3TT1H 1ITBB 3RFZB 4PWEA 2Z8SA 5GGVY 3KLQA 4G6JH 3KPRB 2ICEA 4PJ6A 1B90A 3LIZA 3LXUX 1QSEE 4K0OA 3QFJD 1YEGH 2OYPA 1CGYA 3MRGB 3R0MA 2YD6A 3MBEC 3VI4F 5L7XH 3UAEA 3GUFA 3FZUC 1SF5A 2Z4QA 3G5VB 3L5HA 4KVCH 2R1XA 3KBHE 4GRWE 2ISDA 2NY5L 2OYKA 2KERA 1LLAA 4LARH 1Q8MA 4P3WA 5JYLA 4NWUL 3ABZA 3NSJA 4PI2A 3QCTL 4LCCC 2R4SH 1D6VL 3MN8A 2D0GA 3UGUA 2MSPA 4N28A 2N1KA 2X6VA 3AS2A 1NGQH 3EO1A 4KTDL 2ZICA 1R3LA 3AZUA 4PB9H 3QJHB 3QIUA 4MBOA 4WK0B 3UTPE 3CSYB 1HYSC 5D2LE 5AW4B 1T0NB 3V4UH 4HG4K 5E5MB 43C9A 5MEND 1T1WA 2Z31C 3I02A 1AGFB 2YKKA 3WTYA 2R0KH 1NGYB 1S9WA 3L7EA 4LOUD 3I3BA 4UNUA 4H8PA 4NZTH 5IHUH 5HGAB 2NR6D 1SYVA 1NQBA 3N3EA 3VI4A 1AS7A 3QP3A 2IDSA 2IWGA 2YGVA 2H6PB 4YIQB 1FL6A 2VQ4A 2CLVA 3Q2NA 1K6QH 1NCHA 3MOAH 4TLSA 3RFZA 4P57A 1Z9PA 2NXYD 3I3EA 5E1QA 1UEMA 5CLXA 5EU7E 5HVHC 2FWLB 3KPRA 2RA1A 4HWZB 3FO2B 4X6DE 4K7FB 3BUYB 4W6WB 1IGCL 3VG9C 3MRGA 4CDHA 3D06A 2OLDA 4S1RL 4Z9KB 3G5VA 4IBQA 3OQ3B 4GAAA 4U1LB 2AERT 1QWNA 4KNUA 1JS4A 1EDYA 4DP5X 1JZ8A 5AKVA 1DCLA 5TFSH 4HUCA 2C4FU 1BQRA 2HRLA 2WYTA 3B9VA 1RIUL 2B2XL 2ZX9A 4NQVB 4AH2B 1KWGA 1XGYL 3QJHA 3CSYA 2D2CC 1T0NA 5D1QC 4KO9A 5KAQG 2G9HB 3BSGA 4MXWL 1KCLA 1AGFA 3D4YA 1NGYA 3MCYA 4OKVB 5FM5M 4LU5L 1VEPA 2DLHA 2MQ3A 4TRPL 4WUUB 3RFRA 3S9DB 5JXAL 3O4LE 1IAIL 5HGAA 3LQZB 3GIZL 3L4VA 1BF8A 5D7IE 4A7SA 1HZLA 2P43B 3FO1B 2H6PA 3Q8EA 4YIQA 4LSPH 3P73B 4WI4A 3B5HA 5FYJU 2UVFA 4N4YB 2EIBA 3MLRH 4YLQT 2PCXA 2OMVB 2Y1VA 4AMKL 5KSUB 3QCUH 5IR1B 3AREC 1CQYA 1E65A 4OLZL 3V4PL 1XGRA 3FO2A 4K7FA 3BUYA 2KZBA 3TO2B 1WFNA 1E3FA 4QMEA 4KDWA 1JZJA 3V8CA 4AKQA 2EIMB 5EU4B 2N4IA 5I6XC 3KYMB 4U1LA 2PTVA 1DVUA 3HFML 4IOSD 3FNKA 1JAEA 3L4WA 2ZUXA 3AW5A 3U36B 3RTLA 3QZBA 4XN2A 1KJ2H 4ODUB 2XFXB 3H9HB 1DZBA 3HMXL 2QPEB 4B27A 4AK2A 4NQVA 3GJEB 1LO2L 1FLRL 3MNVB 4FZEL 4AH2A 4YSUA 1PJWA 1IQDB 3PFQA 5CM1A 4KOBA 2F9BT 3BAIA 2YXWA 4YSTA 2JTYA 4NBYB 1KT2B 2G9HA 3DHUA 1BMGA 3IF1B 4PI0A 1CU4L 2UY6B 4OKVA 1OPOA 2P8MA 4MKTA 1DBBH 5T3XD 4AGMA 2ZZUT 1XB6A 5FYJH 3BIBX 3LQZA 3LEYH 3WNLA 3FPXA 4PRPE 1J05B 3O8XB 2FX7H 3FO1A 4E9WA 5LNDA 1BWMA 2VM9A 4YHKL 4YSPA 4D9LH 5CJOH 4S11A 3QPXL 4F7PB 1XBDA 3P73A 3TASA 1U9KA 4ECNA 1HCVA 4KHTL 1B3JA 2OMVA 5KSUA 1RZJH 3CNKA 4U4BA 5IR1A 3A4EA 3BPLB 3I74A 3IDXH 4WHTB 3S2CA 4XNZB 3TO2A 2OZ4H 3LKRB 5MEQB 4FTVD 4DJMA 4Q52A 1PLGL 4XXDB 4Z7WB 3L45A 3VWJC 3D3VB 3HB3B 5EU4A 2Z7ZA 4G7VH 1T22B 1WYJA 2MKWA 2Z6FA 5TPWL 4YN3A 4ZW6A 3ZOAA 3U36A 2BNRE 3SPGA 1XCXA 5CUSL 4ODUA 2XFXA 3OAWA 3H9HA 2NSXA 4DKDC 3JZYA 1V05A 2A1WH 4KUZH 3GJEA 4UT6L 3MNVA 4Z7WF 1IQDA 1H9DA 3K6FA 4QHNB 1KT2A 5DMYA 4CGUB 4KNQA 3IF1A 3BFWA 3OAYH 4OD2B 5F3BB 3GNMH 5DA4A 4ZFFB 3Q06A 1DP0A 1PS3A 3BISA 1J05A 3O8XA 4DKTA 4F7PA 5HPOA 3QRLA 1MHHB 4OH2A 1HHIB 3FFCB 4L1SA 1KCRL 4RBPK 2FJSA 2ZCHH 3I75B 4HZLB 5CZVH 5D1ZC 3PAVA 1PLAA 5C08E 3SN6N 1A3RL 2G3MA 3LKRA 4J6RL 3BUDA 5MEQA 3QI9C 3DTXB 1G6VK 4L0PB 2BSEA 4XXDA 1KLFA 1QFWM 3B7UX 3FH7A 4Z7WA 5CLZA 4AYGA 4TTDD 1HINH 5BUAA 2B20A 1T22A 2D7OA 1HE7A 5CR1A 3GPSA 2CJSA 4RISL 3ZDXB 2EDBA 2R0WH 1I8MB 1P4BL 4MCNA 3ZRFC 2XWCA 4RAVB 1KN4L 1X5GA 3GXIA 3R06B 1A0QH 1B9ZA 1HL8A 2CHWA 4IMKA 1GTNA 1MF2H 2FJUB 1DFBL 3FT4B 1ZA6B 1F8TL 3VGHA 3ZR5A 3QPQC 4NB7A 4J3OF 2XIBA 4XCFH 2J4WH 5DZNA 5BV7B 5IESH 4GUQA 2FYYB 3ZDXF 4QHNA 3TGXA 4KRMB 4ZS7H 1EHLL 2F8OA 4R4BB 1PX4A 2QADB 4NRZB 4OD2A 2QKSA 2WQVA 2IDFA 5F3BA 3WFDL 4CU6A 4ZFFA 1QLEL 1CFBA 4FD0A 3BGFC 5H8DA 3CDGA 1INDH 4WI5A 2NY1C 3ECBB 5T3ZD 4K94L 5D7HA 1CFVH 3Q48A 1EQWA 3GKWH 1MHHA 5LCVH 1HHIA 2MCMA 3FFCA 2WLLB 4FZ8H 4YBHA 3BPCB 5A7EA 3I75A 1PY4A 4HZLA 5IFAL 3C6LB 4LSUL 2VERN 5CEXB 4QXVA 5EC2B 3DTXA 3O6ML 4P2OC 4L1BA 4ZTPL 1UA6L 1NCOA 1JGLH 4ONGL 1TETL 5JW3H 4TNFA 4UQDA 4GAFB 1I8MA 1TTUA 2DYRB 1D5IH 3JV0A 5I75B 1KY7A 1G1CA 4RAVA 4NKMB 3R06A 5F7KC 1UD6A 5C0RL 3RVUC 3ATAA 1ZA6A 4NNYB 3ARBD 2DBLH 4HFWB 4A2FA 2VWEE 4XC3L 2CLRB 5IFHL 2FYYA 3D25A 3NJMA 4FC3E 1OAUL 2KDGA 4R4BA 5DU7A 2OSWA 2C3WA 1Z7JA 4R97B 3ZU8A 1HYRC 2ORBH 3MXVL 5JOEA 1JGVL 3US9A 3H9YA 3O0RL 5FOJA 3SQOL 3MOQA 1HX0A 3GBNH 3NJIA 4TULH 4UT7H 1YUHB 3BKYL 1Z1WA 3O2VH 3B7YA 5KVDE 2OSYA 3TM6A 3KVDD 2B1AH 1F45A 3CSBA 3ZHLA 2WLLA 3KWVA 3BPCA 4FFZA 1YEFH 5KBDA 3C6LA 1YCSA 1RLBA 4P9HH 1CLZL 1GGCL 2BY3A 2FBOJ 5J0BA 5EC2A 5IBLC 3SEPA 3QWOB 3RY5A 2EUWA 2NNCA 3EUUA 1HEZA 1WIUA 1E9PB 2I27N 2NPLX 4QTIH 4YC2B 2CUMA 5DWUL 4LDEB 3KH4A 1BVLB 1YQ2A 2L0DA 3BWZA 4NKMA 1VSCA 5DSCB 1CURA 3GM8A 5DI8B 1AR1D 4NNYA 1EXHA 4HFWA 3LZLA 1BMWA 2JJVA 3J7HA 1IGIH 2CLRA 3AACA 1OK8A 1SDDB 1U8JB 5F3HB 1I9RL 2BSBA 4TPRL 2C4XA 4PJ9D 4PGCB 5IQLA 3V4VL 1JD9A 1JVOA 3FUMA 3R4DA 4ZO8A 5J7CC 1DVXA 3LDBC 4MRCA 3RZCD 1Q9LB 2APSA 5B38G 4NQQA 3GFUA 1YUHA 3OMNB 1MPAL 5M7QA 4MQ7B 5CGMA 1JDAA 1FAKT 1I1YB 3QXWA 3CLEL 5KZCB 1NC4D 4XVTH 1MG2C 4GXVH 4LIQE 3U25A 4XCYB 3EBGA 2YUXA 1XGUB 3E3QC 4M8UA 1HS6A 3SDDB 4HVBA 3QWOA 3SBPA 1ETJA 3RGVA 3C5ZD 1E9PA 1JZEA 4I7ZC 4WEEA 2J6EL 2V2XB 2HA1A 4LKCB 4WO4D 5JPMB 1LNUB 4OSUH 1R3KB 1BVLA 2UXGA 1BBDL 5DZ9A 2QZ5A 3QRGH 2HG0A 4F33B 3UAJA 2UVEA 4XMXA 1HFUA 1KJ2B 3AQXA 5DI8A 1WCQA 3HW7A 1G7PB 4KXZI 3QJRB 1KZQA 2A7BA 2LAGB 1AC0A 1U8JA 1SDDA 2JK5B 4K3HA 4U1KB 5F3HA 1JTPA 2EINB 4LRIA 4PGCA 3V95A 1T0PB 1SXZA 2PXYC 3ZT7A 3DDFA 5ALCL 4JGJA 1Q9LA 3IN2A 4JG0H 4KI5E 5CLTA 1JPEA 2YA0A 4EQ2A 3DETD 4W93A 4M56A 5B8CC 4H8HA 2RQ8A 4MQ7A 4ZRGA 3CFBB 3VXRA 2GHWB 3MZGB 2IH3B 1I1YA 3ISWA 2PYFB 1EO8H 4XCYA 3B2MA 2Z9TA 3GHEL 5EIQA 4UV4L 1XGUA 4LCWD 3DX1A 4KPHH 5AW8B 4YSDA 3QPKA 5E99H 3SDDA 3N1QC 3FSOA 1OM3H 2AJXL 3P30H 2HFEB 1XXDC 2V2XA 1PKQB 4DGWC 4LKCA 4EVNB 3OKLB 5JPMA 1LNUA 1R3KA 5IREA 3I50L 3ZYIA 2O93L 1I8UA 4F33A 2HRPL 2IPUG 2YD7A 4JG9A 1KDIA 3PP3H 1VFOA 1KJ2A 1NPUA 3G6DH 4I89A 4R3SB 1S3RA 1G7PA 5EEUA 3UADA 1TPXC 2YWZA 3RTQB 3MREB 4OB5L 1YEDB 1MHCB 1ILUA 5SWZB 7CGTA 4U1KA 4MB5A 5E6IC 3BGAA 2HTLC 4LEBA 1KMGA 3ZN6A 1N8ZB 1RPQA 4NBZB 3Q0HA 3HG3A 3S88H 1U8HB 4PCTA 1GHFL 2CAKA 1RUKL 1GYWA 3CFBA 4JRLA 3TBTB 2IH3A 4UT9A 5EZOL 4FKEA 1T5XB 2PYFA 2YD1A 3FB5B 2ZCKL 5J11B 4DSYA 4TOYL 1IGFH 1FI8C 2H1XA 4GFXA 1NICA 3QVAA 4TV3A 4TN9A 3CLWA 5KSVA 5EDXA 2JKNA 4KRPC 5C09A 2IH9A 1MNNA 4XNMB 4E9YA 1M71B 3S5YA 3BKCL 4FL4C 5G5DB 1R24B 4HWBL 2Y06H 2HFEA 4A2EA 4YVNA 1BSIA 3WFZA 4EVNA 2CBPA 3OKLA 7TAAA 1A3QA 4K23L 4TVSa 2XCMC 4GQ9L 4OCRL 4WTZG 4XMLH 1KIQB 1L9MA 3N42B 2AQ1A 3HMWH 5T1KB 5EDSA 4YQXH 2BSSB 1CXIA 5LHDA 4TNVK 2NY2D 4R3SA 4S0HA 2TRHA 3NACL 4MAYB 2GIMA 4OY9A 1JV5B 1UB5B 3RTQA 1NMBH 4AEHL 2KZWA 1YEDA 1MHCA 4R9HA 2BFGA 2IDCA 5CN1A 3QRFM 3CSFA 1IJ9A 3EO0B 2I5YH 2ROYA 5DYFA 5C8JB 1T3FA 3N42F 2ZUSA 3VGAC 4DQAA 1WZ1L 3C9NB 5INDB 1N8ZA 1U8HA 1F41A 4OU3A 4N90D 2VXQH 3KAAA 3X1BA 3Q2WA 5C0CE 3TBTA 5FO9B 1OY3B 4QNPF 1T5XA 1T20B 3FB5A 5IVNA 3DWTA 3RDTD 4JO8A 5F8RC 5IGXH 3WO3B 3NSFA 3FULA 2YMXL 1DQDL 1WAPA 3QEHB 2IANB 3EDKA 3JT0A 4XNMA 1M71A 4Q9CA 5ICZB 4GPVA 5G5DA 3T6WA 4WWKD 4N0UB 1Q0EA 1R24A 3MV7E 1MDAA 2Y1YA 1CICB 3JWOL 3LYRA 4MJIE 4OLVH 3HE7D 3VE0A 4DO5A 3ULAB 3W3BA 3O6KH 4HX1B 5A6IA 4N2IA 4BFRA 4JFDE 4DP2X 2ZP8A 2EVGA 3H9SE 1M9WA 1FORH 4H5SB 2CDFB 5T1KA 2VZUA 2BSSA 4OD3H 2CXKA 1XIWC 3NEXA 4MAYA 1CZ8L 1JV5A 3QARA 1UB5A 3ZZSA 1MAMH 3PHSA 4FQ2H 5JW4Q 4ZAKD 4Y5VC 4DIXA 2XXMB 3EO0A 4N2NA 3VXSE 4BRVA 3R1GL 5C8JA 5ESAA 1N12A 3SDXB 2Q20A 3C9NA 3CMOL 3LHPH 5INDA 5L9DL 2ADYA 1KLGB 1Y0LB 1R6VA 1LO4L 3O6FC 4R7DB 4B9GA 3GSNB 4PV8B 2E7LC 5BXFB 4X8CA 3MROB 4HEPG 5FO9A 1OGAE 4KNSA 1KUMA 1D5RA 2VDQL 2HKFH 1T20A 2K6ZA 3DNKA 3QAZC 4KC3B 5GRJL 5F1NB 3WE1A 3RIKA 3SDXF 3NCJH 1HVXA 4N8VG 3TLRA 4Z0XB 1RUAL 4UB0L 1E4WH 1MCKA 3BRGC 1MCQA 2IANA 4P49A 2K0RA 5D7JB 4N0CC 1E6OH 3MLYH 3V6ZB 3EH3B 4ZX6A 2P44B 4WUKH 3S6CA 5ICZA 4N0UA 4ENZA 1OF2B 2HRGA 3T5WA 2WP3T 1CICA 1J8HB 1ZV2A 2HVJB 1BFTA 2ADFL 2J43A 4HX1A 3RGHA 1FYTB 1YYMH 2Z7WA 2CDFA 5DZAA 5L2KB 1ORQB 1J1XH 1H3XA 4XI5C 5JO5B 4GRLC 4FQXC 1JGDB 1Q9WB 3HEIB 4KDTA 2DKUA 2IGFL 5SWSE 3DXAB 4L1HA 1ES0A 1RZIB 1W72H 1P5UC 4WI9A 1ZANL 3W56A 2ED7A 3H1ZA 3SDXA 3IDGA 4NCDA 1KLGA 3FL7A 4R7DA 1NCGA 3SKUD 1F1GA 3GSNA 1TQBC 1TFHA 3C5SA 4IGBB 4JRXE 4OZGE 4PV8A 3WFBL 5BXFA 1KJVB 3MROA 1O9ZA 4U3SB 3SPVB 1FPTL 3GJFH 3DTUB 5EA0H 1R3IL 3N43B 4J4PD 5F1NA 3LRSA 4OJAA 1MKFA 2MNUA 3U4BH 4Z0XA 1ZGLB 4NC1C 5GZNC 1JI1A 2MMXA 2HTKC 4M5TA 3HZ3A 4J12A 4J3VA 5D7JA 1OTSC 3KM1A 4Q9RL 3V6ZA 5DVPA 1X9QA 5E7BA 4ABWA 1OF2A 1EEZB 3C09C 2B3RA 3V0HA 1SN5A 4GMTL 4IKJA 1J8HA 5GS1B 2HVJA 2WCPA 3N43F 2E9BA 4G3YL 3K5SA 2MTPA 4LCIL 4X7SL 4ZPVB 4PBDA 5L2KA 1ORQA 2JF1A 4HP5A 5LBVA 1CF8H 4WI3A 5JO5A 3MV8E 1IUZA 4Y1AE 1JGDA 1LO3L 4TQHA 1Q9WA 3O3DB 1Q9KB 4P5TB 1P5VB 2D31B 4AC2A 3NEOA 3DXAA 4HCRH 2GPZA 1FFRA 1U8QB 3NJGA 1RZIA 1MCEA 1GAFH 2KC0A 2X2HA 3TX4A 4KDVA 3D34A 2X2UA 4CW1B 1T6WA 4QRRD 3C2SA 3BDYH 1NOLA 1T1XB 4JRYD 5HBBA 4IGBA 3F7PC 3FQNB 4OZFG 5GGTL 1KJVA 3VTAA 4JFEB 1RV6X 4U3SA 2NYYD 3SPVA 3TCLB 1G84A 3L9EA 4K8RD 1T7VA 2W9DL 5HYSB 1E6JL 5DQDH 4XMVA 2ATPA 3TBSB 3VFMB 1ZGLA 2P48B 3V52L 4PRIB 1ZTMA 4JFFE 1M4KA 3SKMB 2BC4B 3IU4L 2EE2A 2LU3A 3PJSB 1KENL 3EJJX 2CK0H 1EEZA 2XWRA 2CCVA 5GS1A 2VQTA 3TO4B 3RYMA 4BZYA 5D2NE 1YEEH 5AKSA 4L8DB 3D39A 3VU2A 1YAZA 1TVHB 2BIPA 4ZPVA 4UTAH 2ERJB 3QIUD 3V7MA 5J9PB 2DQGL 1IAIM 1M7UA 4HZAA 4M1CC 2PCPB 3ESUF 4P3DB 3LRMA 4R7XA 1B9KA 4PJFB 3RVVD 5JDSB 2FB4H 3O3DA 5F6IB 3UOAB 4P5TA 1P5VA 2D31A 4LOUC 2OMUB 2XHNA 4YDKL 4A66A 4Z7NB 5HHOB 2XTJB 1U8QA 5F7NC 3U9PL 1I4FB 2NR6C 2UZIH 4ORGB 3FYEB 4AG4L 3BUBA 5F7MC 3TH4T 3DYMA 1R0AH 5L88L 2QPDB 2NXYC 4PJFF 4QXUL 2YAQA 3FQNA 1JGIA 3RVWD 4B50A 3KPRD 3SE8H 4Z7NF 4JFEA 5JMOC 2NYKA 3TCLA 3R0NA 1OAXH 1KGWA 2X6AA 3F2LA 1KB3A 3DOHA 2V5RA 3GI9H 5HYSA 3WTSA 2DQUH 2J5LB 5E4OA 4LNRA 2EEBA 3TBSA 4FNQA 4CC4C 4PRIA 1FGVL 3H85A 5HP5A 3SKMA 4XMPL 2BC4A 5LBSH 4TTGA 3BKJH 3PJSA 4TVPH 5HDQL 5KBLA 2CRYA 4ZUVB 4TQEH 4DH2A 4PJDB 5IQNA 4MS6A 3TO4A 5CS7A 2GBVA 5I6OA 2D9QB 1D7CA 3CFDA 4L8DA 3R8QA 1TVHA 4F7TB 3ARFB 3JV6B 1GGIL 1NOAA 2F54E 5J9PA 1ZHBB 4QXGH 2PCPA 4P3DA 1EO7A 3X1FA 2F74B 3D2UB 2FJHB 4LSSH 1GC1L 5JDSA 2UX7A 1N4XL 4WI0A 1VCBC 3WTUA 4PJDF 2OMUA 1F58L 5HHOA 3WSQH 2FAUA 5IT2H 5EU6B 1JF6A 3A67L 1I4FA 1RUQH 2H6UA 4HOWA 4ORGA 2CRIA 3CZSA 4YWGH 3NCBB 4H0IA 3NIDE 3MRHB 2AJUL 3HHRB 4QOKE 3VMPA 2CSPA 2BOLA 3V0WH 3ETTA 4K3EL 4ZOEA 3LKNA 5J56B 5FA3B 5JW5B 1UT2A 1B0RA 4D0CB 2LTQC 4RGNC 4X9HA 4M9PA 5D93B 5EBGA 1Q1JL 3DROB 2X89A 1FZMB 2VLMD 5I8EB 2YRLA 1E4XI 1TFPA 5EPMA 2BVEA 4YDVB 3GMQB 1GMIA 4JN1L 4ZUVA 3EJTA 4PJDA 5FEBA 1FVCB 1DE4B 4G6KL 5AAWA 4XMTA 2L7QA 4FQIH 4I3RL 5E1HB 4F7TA 1ESOA 3ARFA 3HC0B 5B3JE 3JV6A 2C9VA 2I24N 5HGHB 4U0RC 3ZTCC 2EIKB 1ZHBA 4OAWB 1MCBA 3HAEB 3HKFA 3NRPA 4OFYA 2GK2A 4PJ8B 2F74A 3D2UA 2FJHA 3F04A 4KZEH 3D18B 2G75B 2FQFA 3SZ6A 3TWYA 4WW2C 3HJ0A 1N6UA 1WIPA 1AI1H 4G8AC 1KEGL 4KQ4L 3MRHA 3K2KA 5I8OL 5GGRY 1AS8A 4JZNB 3ESVF 2X70B 2QVMA 3AM8A 4GI6A 2NZIA 3CJJA 4KY1H 5FA3A 5JW5A 5LGJB 2MWCA 3K6OA 3KPSB 4D0CA 2R29H 4FQLL 1KBKA 1N59B 2HN7A 3WXVL 3DROA 4DEUA 1TEYA 1FZMA 2EH8L 2JIXB 3FK3A 2Q8AL 5GGQH 5I8EA 2WNXA 4IM8A 2X4OB 3IB4A 1MCWM 1YEIL 4I2XB 4YDVA 3UIZA 3IRZA 2L7UA 4PRDB 4M29A 4WU5B 1FVCA 1DE4A 2X38A 4CSTA 3D07A 3B3IA 4QAMB 5KYXB 4Q56A 4WQOA 1PGRB 4L3EB 3VRLF 3MCLH 3HC0A 1G9NC 1S7SB 4F5CE 2VZVA 5HGHA 1TEFA 3PGFL 2BNQB 5DURB 4MRBA 3FRPB 3HTLX 4OAWA 5DHDA 3HAEA 4PJ8A 4Z3HA 4OM0H 4XN5A 2ITDB 2V3EA 3D18A 2G75A 2RGSA 4WDIB 4GSRA 5IQ9B 2H9GB 1N2RB 2EJ1A 3BT2H 3SO3B 2IQ9H 4PLNC 3LEXB 5FYLD 5I71B 2JJTC 4JFSA 3O8XD 5J6GB 1PFCA 1W72B 4JZNA 1H5BB 2X70A 2IG2H 1KB5H 4MD5B 2OR9H 1ZSHA 5LGJA 3KPSA 1R5IB 3QZWG 1BEYH 1CC3A 1W9XA 1N59A 4I1NB 4M62L 2BSED 3GJFB 1X5AA 2DKMA 2JIXA 1PNDA 2JNZA 4TTDC 5E8DH 2H3XC 2CR0A 2VXUH 2X4OA 4X8JB 4U6TA 1C5CL 2YUZA 1WWCA 1PY9A 3DIFB 2P5EE 4I2XA 1N7ML 4PRDA 4PD4J 1EEQA 4OFQA 1NGZB 4WU5A 1CD0A 1WWAX 1F11A 3ZYOA 2VRQA 4QXTB 5KYXA 3MI6A 5EO1B 4ZG1A 3IGAB 1ZCRA 5KVDL 2XKSA 4QTHB 1S7SA 5CJXC 2IJ0C 3FRPA 2JKXA 1MRDH 2ZYIA 1P4IL 3CFJB 4L5FH 3U1SL 2ITDA 5TF1H 4YMPA 5LDUA 1NIEA 3ZZLA 2A74C 5IQ9A 4OF7A 3RHWF 4C56E 4Z7OB 7PCYA 2H9GA 5DJ2B 1N2RA 5FFOA 1L3WA 2A4ZA 3R4RA 4LHUG 4MA8H 1MW1A 2EP6A 3LEXA 5AVUB 3QXTA 2C7UB 3EJCA 5J6GA 1F1DA 3OX8B 3TFKD 2FEJA 3PDOB 1W72A 2WOBA 1MCIA 3CC5B 4B9JA 1H5BA 3ARDB 3FFCD 1QRKA 4MD5A 2H32H 2XUWA 5C07E 4OJFL 5DD0L 4WEBH 3SOBH 4DTGL 4Z7OF 1R5IA 4G8GE 5AW2B 4YZFE 1FCGA 4YE4L 4N8PA 1P84J 4PJ5E 3BVTA 3PLYA 4W4OC 3ILEA 3GJFA 5HDBE 3SYOA 3UPCA 1FRGL 3A6CL 4HPYL 4J3OD 1HKLL 4X8JA 2MOGA 4LXFA 3DIFA 3ZTNH 3QQNA 2A9BA 3EIFA 3DECA 5EF1A 4P2RE 1QI3A 4BKSC 1NGZA 3HVDA 2PR4L 2DQEH 2GY7B 1A3ZA 4QXTA 5T33H 5EO1A 5DHVH 5I30H 3FCTB 3IGAA 5F7EL 5JOFB 5F1IB 5HD8D 4QTHA 1J0YA 3OB0K 3CFJA 1MCPL 4XVJH 3GTVA 4XZUB 1SVCP 3B43A 2QADD 4P9MH 2F7IA 2IAMB 5DJ2A 3LZFL 4I0KA 3EYSL 3L8QA 4NJAL 1XD0A 4HCRA 5ICUA 3ULUH 2UYLB 2C7UA 4C55A 1EXUB 5DTFB 2QELA 3OX8A 4TS6A 3MOBH 3PDOA 4HT1L 5TE7H 3WJJC 3NIGB 3IDNB 3ARDA 4NN6C 5AKTA 2BSDA 4BZ1L 3BIAX 4ZZFA 1CGVA 2CUIA 1G4MA 5F0PB 3C6LD 1NCAL 3V5DB 1USZA 3QUYB 1ACXA 5IWLA 1TU2B 2Z8RA 5AW1B 3CFMA 4JO4L 4YHPA 3RBSA 3GK8L 1ADQA 1SFHA 2MHAB 4WWOA 5EOTB 3NIGF 4O9HH 2DH3A 2QJDA 4Z8FH 2ZUUA 4XVUD 3D8MA 2BZ7A 3JUZA 4N2CA 4DVBB 1EUTA 3TONA 5H35B 5AVQB 4BSWB 3EJSA 4I9WE 3TURA 1GY2A 1AR1C 4K7PL 5JOFA 3FCTA 4S1SL 2CNZA 2OFQA 1L0XA 3ARPA 5F1IA 4PGEB 1J1OL 4M8VA 4WKXA 2QMJA 1NIBA 3L4ZA 4M6AA 3KPLB 4UTAA 3LZNA 3GBDA 3NK3A 4HZ1A 4XZUA 3G6JE 2TSBA 5CBAB 3LEVH 2NT0A 1QPKA 2XBZA 3RZCC 2IAMA 3P4OB 4RFOH 1ZEAL 4FP8H 1RPKA 1CD9B 4G5ZH 3U6RB 3QEQE 1T2XA 3OLIA 3AY2A 3IDUA 5DTFA 4L48A 5D8JL 5E9NA 3OHXB 3U0PB 4AUYA 4DPCX 3IDNA 2Q1EA 1QBLL 1RFDL 2XBTA 1MQKH 2VIRB 3UJTL 5IP4A 5TDPB 4BHUI 1R17A 1X5LA 3V5DA 5HVFB 1UTDA 2VZOA 2YZ1A 5I1JL 3QUYA 3AU1B 4ODSH 4OIIH 1TU2A 3NA9L 5BQDA 4G9DB 1CL7L 4XPFL 3HE6B 4S10A 3C5ZC 2MHAA 1A7QH 2DQTH 1HESA 4NRXB 3ETBF 1NOFA 4WJ5B 5EOTA 5FDWB 4JZJC 3HC3H 1QHQA 4TM9A 4WO4C 1SNRA 4EBQL 2XIIA 4DVBA 2KUTA 1XZ0B 5K1NA 5AYUL 2UWEE 5H35A 3TPKA 2EO7A 2YHGA 4A6YL 4BSWA 3Q05A 3UAJD 43CAB 1AJ7H 3LNEA 3D0VB 4ZFOL 1KGYE 4K7PX 4PGEA 3RDJA 1UH4A 1S7UB 3SYQA 1DLHB 4Q0XH 3KPLA 3ZL1A 4IK6A 1QA9B 2DY2A 2EIJB 1COBA 4IDJH 1FFQA 3ZL4L 5DK0B 5DRXB 3AQZA 4HQQL 2EKSB 3KYNB 4XCEB 3P4OA 2HXAA 4QPEA 5ACMA 1B6DA 2Q2LA 5DEJA 3U6RA 3T3PE 4HETA 3DETC 3WKML 4AVJA 1S9VB 4OZIB 3U0PA 3VFOB 4ZX4A 1L6PA 2LLNA 5HVWA 5AVWB 5KZCD 5HHXL 3CN0A 3H3PH 5DRZB 1TKWB 5EO9B 3DUUB 2YA2A 5AZUA 5TDPA 1KXQE 4MA7L 2OJ1A 1EERB 4KXBA 4NKIL 1XR8B 4YEFA 4LRNL 3SDDD 1KCUL 1KEMH 3KLKA 1N6QH 2WJ5A 2XRAH 4G9DA 1TENA 4XPBH 3HE6A 2V7HB 4OZIF 4NRXA 1IFRA 4AVHA 2LT9A 5FDWA 3WFCH 1QBMH 4U1GB 3U7AA 5KUKA 1I8LC 4TUOB 3BAYA 2IPUK 1XZ0A 1LK2A 4UIMB 1VEOA 2JLPA 3OZ9L 4YO0B 4JS7A 4DN4H 3EJPA 4KMTL 3S37X 1JRHI 1SF3A 1WUNT 1V55B 2R2BB 43CAA 4JPIB 5IMLB 2ED8A 2BX5A 2K7QA 4H8WL 3G08B 1HK6A 1S7UA 3UABA 1DLHA 1PZBA 3ZDZB 1TXKA 1KFGA 4Z7VE 1DVYA 5SX4H 1QA9A 1XAUA 4I77L 3L1OH 5DK0A 5DRXA 1F3RB 1UD3A 2FLMA 3M17B 2EKSA 3KYNA 4XCEA 5JR1L 2ZUVA 2JKWA 4LEXH 5C9KA 4OF5A 1XCQB 4ZUWB 1UM4H 2R0LL 1S9VA 2PW1B 4M1GH 3ZDZF 4OZIA 3VFOA 2DQDL 1NCCH 1QX1A 5FYJD 4M8RA 1MVFA 2XETA 3QFDB 1MWOA 1Z9LA 3F7VA 5DRZA 3N1FC 4H8QA 4G72B 1TKWA 5EO9A 3DUUA 4WY7L 4NXKA 2PW2B 4XNQB 1HTYA 4X98B 2DLIA 3REWB 1GZQB 5C09D 1XR8A 2AQNA 2AXWA 1KV3A 2X4RB 2V7HA 1S7RB 4R84A 2R29A 2DQJH 4J3XA 2H6OA 4WHYH 2Y6SD 3BAJA 1IC7L 4NO2B 1ASOA 4TUOA 3N44B 4ODTH 4UIMA 1XO8A 3TJHD 3EYVB 1DBKL 4V2CB 4WFED 4NBXB 4NOBA 4X9FA 4JHZA 1EZLA 4RQQB 4R5VA 4YO0A 4NWTL 2JB5L 5E8OB 5GHWL 3UTTB 2JJSA 3WCYA 2R2BA 4AUUA 5IMLA 1NL0L 4JPIA 2NY2C 2VN3A 3FUFA 3DK0A 1P84K 4HBCL 4N20A 3G08A 4NCC1 3RTQD 3KGSA 1IC5L 1CBVL 3N44F 2KDYA 3UBXB 5JTWA 2NW2B 3M17A 4K2UH 2XZQL 1CLOL 2IAAC 4WGVB 3DUHA 4WIQA 4ZTEA 1CXLA 1XCQA 4JREB 2YQ3A 4WSKA 4ZUWA 2PW1A 1NDTA 1XH3A 3BW9B 4ONFL 4P59L 3RI5K 1J5HA 3NYKA 3QFDA 4FHBD 4PBVC 5EORL 2H7WA 1KGCD 2PW2A 5I1GH 4XNQA 1AKJB 1RUML 3GMNB 4X98A 4YHLH 4KTGA 2H32B 3B8SA 1GZQA 3REWA 3F12B 1KTKE 4XP1L 1OO2A 2R23B 2X4RA 1V3KA 3MLZH 5E7FA 4TQIA 1MFNA 1S7RA 4WWKC 3RY6A 4WW1B 4OCWH 3HE7C 4JO1L 1MJUL 5FUZH 2ZJSL 3EYVA 5E8OA 5I6PA 4RQQA 2DQ6A 2ICWB 4NIYE 3UTTA 5JPNA 3B5TA 5T1KD 5BUPA 2NX5B 1B2WH 4X4MA 5MP6L 3GRWL 4P2YA 1WEJL 3UTSE 4JB9H 1KJ3H 2Q3AA 3QXVA 4MAYD 3WY4A 4BK4A 2Q8BH 2A6KB 1A7RL 5DHVB 4MMZC 2R56H 5H37G 2PPAA 3UBXA 2WBWB 3LZOA 2NW2A 2YPVH 3PWJB 5JHDB 4LSRL 4LMQI 1WAEA 4XP5L 2V17L 2ZF8A 4K3JL 4HS8L 1OWWA 1BCIA 1G9HA 3BW9A 1UGNA 2UXTA 2AP2A 4PWHA 3NH7L 5HGDB 2VCOA 1UM6L 2VUKA 3TC9A 1Z66A 3GZQA 4NRYB 4N2MA 3FJTA 1AKJA 3GMNA 5E2WH 3F5WB 3F12A 4MVBD 2IAND 5E23A 5B1JA 2F5AH 2R23A 1DUZB 2G60H 3II3A 4N9OB 1IARB 4NQDB 1KC5L 1IEAB 2DBJA 4L8SC 4X5RA 5KOVC 3S98A 1MOEA 3ULUF 4NQEB 2B14A 1CICD 1SM3L 4JFOB 1W0VB 1GYAA 1Q0XH 4KFMA 2ICWA 2NQ3A 4ZMXA 2ZCLL 1BFOB 1FF5A 2NX5A 2R59A 2W81C 3AT0A 1IBGL 5CJQL 4LPXA 1NGPL 4OBRA 3CZNA 1RSFA 2A6KA 1S7XB 3N55A 3OB8A 3FQ1A 2ALWA 4WKZB 3F7QA 4XT1C 5SWQB 4MA1C 3PWJA 4KNTA 3WY2A 3QDMB 4DGIH 4KAQL 5TQ2L 5JHDA 2RAMA 4MZRA 4KTYA 3ARTA 1EBAA 4B3VA 2Z34A 1EDQA 3JWDL 3QS2A 4X7CC 1OANA 5KVEH 2XWZA 1IGYB 2DEXX 2CUHA 4Y2OB 1LMKA 35C8H 1GPOH 3FCGA 4KMLB 4QY8B 2OMNA 5HGDA 4XE5B 3BWUC 4NM8H 2EDOA 2V3DA 2VAAB 4DGYL 4W9IC 2JWYA 1AGEB 2F08A 3IN0A 3F5WA 5F21B 4CMMB 4ODVL 2VXSL 3CTTA 2EUVA 2L04A 1WS8A 5E5UB 5D7JD 1DUZA 2XC8A 3IVKA 1SXCA 4NQDA 1IEAA 1SLXA 3WGUB 1J8HD 3MRQB 1ASQA 2KLTA 5BRZB 3TEXA 4MS8D 1XEDA 1QRNE 4JFOA 1W0VA 1KELH 4FQ1H 3AAZB 5L2KD 4MAZA 1ZXQA 1BFOA 2H45A 2VLRE 8FABB 2IPKB 5E5LA 1GGBH 2WQUA 4YVUA 3I9GL 2V2WB 2BWDA 2X12A 4M43H 2JQAA 1DANT 2JVUA 3DXAD 1S7XA 2Z64C 3NJLA 4FXKC 5F44A 4WKZA 3BQUB 4MX7B 5SWQA 1WS7A 3OHMB 3QDMA 4MNQB 2A9ML 5I1IL 4V1DE 4ZUSB 4GI8A 1NCJA 5DUPL 1JE6A 4IGBD 4P2QA 1CDCA 5CMAA 2ICEC 1IGYA 4Y2OA 2NYYC 3SCMB 4QY8A 1MHEB 1TTFA 5D96C 4OVUA 1A1OB 1NKOA 2VAAA 5HYJE 3OM3B 3CK0L 4PLOB 1AGEA 4CMMA 1C5DA 1DHKA 3SKOB 3CVHL 4PGJA 3WFDH 4IIQB 1WD8A 2Y36L 5DRNB 2E7HA 4IKIA 1I31A 1NM9A 1JPSH 1TCMA 4DETA 3SGDH 2WXMA 2Y72A 3MRQA 5J6HB 1HT6A 5BRZA 1OEZW 1LK3L 3WIHH 3D39D 1ZTXH 4UZSA 3RG1C 3QIUC 3U1QA 1NINA 3AAZA 4F2FA 1LEIB 2CPCA 2YEZB 5FOBB 8FABA 2IPKA 2VR8A 3WUWG 3RVVC 1OCZB 4LCVA 3SKJL 4UOW0 3L3GB 1T6VN 4UINL 2V2WA 3VRIB 1LP9E 1RU9L 3E1F1 1ILSA 3PY9A 4P5TD 1ZLWH 2AC0A 3O6LL 3E6FA 2WZ6A 5TDOB 2CK2A 3S36L 3AWEA 3OC5A 4ONGH 1A4KB 2OTUB 4WNSA 2IO5A 3BQUA 3HJEA 4MX7A 3ZTJG 4MD0B 3D7PA 4MNQA 4OJCA 3N04A 4FNRA 2CGYA 4PV1C 4ZUSA 1U8MB 2HLFC 3RFZC 1K9TA 1OLLA 1ZRUA 1E4JA 3T3MB 1F3DJ 1UA3A 1G9EA 1OQOA 4QRPE 4BFJA 3NCYP 4JFED 4RGNE 5I16B 1X5MA 1MHEA 3GGWB 4NQCB 5F3FA 5IMOB 1DSFL 1BQLL 5DO8A 4U1HA 3RGBA 1UASA 4PEEA 1A1OA 5DC0A 1F4WL 3S35L 2O5XL 5DJZB 1SEQH 3IDYB 4LF3B 3PAYA 3L3JB 4PRID 3SKOA 5C7ZA 4IIQA 2E9IA 1CS6A 1QKZL 4G8EB 4P5RA 2BPBA 4RMUA 5DRNA 3T3MF 1BIIB 3SQOH 3OAYK 4ZXBB 3QHFH 4P04A 3NPZB 1M7IB 1JTTA 3OLEA 2G4GA 4YSOA 4ZW7A 1FNSL 3TO4D 3ZT6A 5J6HA 3H9ZA 3CCHB 1XVSA 4NZRL 2YEZA 4QRFA 5FOBA 5CP7B 1LEIA 2EECA 5JYMA 3H3KA 3P9MB 4H13C 2VDMH 3L3GA 3VRIA 1ICTA 4JKPH 4M3HA 4LP5A 5F72S 5EWIH 5HHOD 2EVJA 5TDOA 2XTJD 2Y5QA 4KXCA 2HVKB 4B5ZA 1A4KA 2OTUA 1J0KA 4DERA 3OKMB 3S36X 5HJDA 4S1QH 4B60A 2ZUWA 4MD0A 4YHZL 2R8SL 1RLWA 1FIGH 1L6ZA 2ZX7A 1XGPB 5EN3A 1EH9A 2DYSB 3HUJE 1U8MA 2CGZA 2D73A 4PVBA 4OLWH 2B4CC 1FAIH 2AAVA 1M57B 4H0LC 2X6CA 2QLVB 4NQCA 3GGWA 5IMOA 1ET8A 3T0EB 1F2XK 5CGTA 3QJUB 2X89D 3HS8A 1KCVL 5DJZA 4LF3A 3WNMA 4XAKE 3NN8A 1V7ML 2VL4A 4G8EA 2W91A 3KPTA 4LVHC 1HDMB 4PY7B 3WAJA 1BIIA 3INOA 1BAFL 2YC1A 2EO1A 1U3ZA 1NMAH 4L4TA 4ZXBA 4BH7B 1M7IA 2XYBA 4P2CG 1UD5A 1JNLL 4BKTC 3ARFD 3CCHA 4F2EA 3X17A 2K3TA 1HAWA 4HXBL 4U6XB 3P9MA 4OFYD 3RPIB 3NJKA 3D2UD 2OPCA 5FK9B 5A2IH 2QGCA 4QHMB 1ACCA 3GUTA 2CM6A 5EZIH 3FQWB 2HVKA 2V9TA 1RMFH 1DBMH 2EEDA 3OKMA 4K3GA 3VXNA 1MFEL 5FKPB 4FABL 4NP9A 4OCSL 2ZKHL 4JQIL 3ECQA 5AW0B 1XGPA 2WXRA 1BD2B 2VC2L 4NZUH 3W81A 3T77B 3M45A 3N91A 1E5ZA 3MRPB 3OMAB 1UKQA 4OCYH 4LASL 5CGYD 3DX7A 3IFNH 4GQPH 4QR7A 2WAHA 3T0EA 3JWNE 3KBFA 2XA8L 3FFDB 1UQSB 2FGWH 5B39B 3BD3A 4RZKA 3I9PA 5CEZH 4F9PA 1PQZB 4I18A 1OLZA 4XE0A 4JM4L 4ELDA 3NGBB 3P4LA 4PY7A 1PKOA 3FUJA 2FO4B 2BY1A 2BLFA 4HGKC 3H6AA 1TNMA 4CILA 2OS7A 3CVIH 2A9NH 4BH7A 2PP8A 2VDKL 4PWFA 5TGBA 4DN3L 4GW5B 1GSKA 2ESVB 4ZOBA 2D8KA 4U6XA 5DZJA 1F4YL 5HDLA 1U8KB 4PJ8D 1NAKL 3RPIA 5AAMA 1IGTB 3NABL 5FK9A 4PJIB 5IBTL 1ET7A 1Z9MA 4QHMA 5C71A 1TJHL 1BIHA 2CJUL 1L4IA 2P45B 1YNLL 4XNBA 3FQWA 3ZDYE 3OJDB 1ODUA 2P49B 3U9UB 1ZE3C 5FKPA 3S7GA 3O8XC 5I9QB 2JKLA 3GMPB 2NNXA 2HJLB 2QMKA 1BD2A 2YPVA 1T4KB 5DD1H 3QQXA 2G0KA 4PJIF 3MRPA 4D7PA 1KB9J 4JVWA 4X6BB 3MUZ1 3V2AR 1T1YB 1DQJB 3HMXA 3F58L 3BPLC 3KPSD 3WKPA 4XNZC 3MJGX 5BNXD 3JT2A 3FO9B 4ZODA 1MFCH 3N85L 5EG6C 5AVZB 2BIHA 3FFDA 3HB3C 2Z1KA 1ASPA 1UQSA 5B39A 2JIXD 2DRUA 1AXTH 2WSKA 1PQZA 1G6RH 2IDUA 3ETSA 3QULB 5I24A 3IXTB 3COOA 2FO4A 2AJYL 2L4OA 4IMKC 2AV7B 5IEHA 5CCKL 1I9EA 3R19A 4GW5A 4FI6A 4GIOA 5EOCL 4JCLA 2ESVA 4TOYH 1QFUL 4TL4A 2XTSA 3QSKB 3WU1A 5DURD 2VZ3A 3ASOB 1XAKA 3NFSL 4LPYA 4NJ9H 1U8KA 2ZXCA 4L29B 4JHAH 1IGTA 4PJIA 1KNOB 4JFTA 2DQHL 3KPOB 1FO0H 1UJTA 4NZFA 4F57H 2K7PA 3OJDA 4ABUA 3MRKB 3U9UA 4U4IA 3TFKC 2C9RA 2V6HA 4A63A 3GMPA 1D7FA 1KIRB 3DC0A 1WSST 1X5FA 3Q9QA 1T4KA 4RA3A 3GBMH 3LXCA 2F19H 1BPLB 2BY2A 4X6BA 1T1YA 1DQJA 1XSOA 1VIWA 4KZDL 2D03L 4UT6A 3FH5A 2N3JA 4XP4H 3FO9A 4W6YB 5I66B 3LN9A 4JANB 4PP1D 2DI9A 2WGXA 4NLAA 4ZW5A 2J1YA 2I26N 4QWWD 3CDZB 1IM9B 1WD9A 3D69A 4J3OC 4N24A 5E70A 1CGSH 3VMOA 2OJEB 3QULA 3V9FA 3IXTA 5D1XE 1SXNA 1VFMA 4YFLI 5AVSB 5FV2A 5JHLL 2BW5A 1CIDA 2FWUA 4FYSA 4ZPTB 2AV7A 3BP7B 3ALXA 4MB3A 2UV3A 4KZ0A 2GC7C 1YMME 3L7FB 1IMHC 5HD8C 3VO0A 1PZ3A 2EC8A 1WZMA 5I23A 3G9VA 2YRPA 1YC8A 2WLJA 4PUBH 5BV7C 1DVFB 1K3IA 5KJRL 3THMH 3TH2T 1NUDA 4L29A 3SJVB 2XXGA 3ARRA 3PS6A 1KNOA 3O9WB 2QADC 1PX8A 1JHLH 3VYNA 4AYMC 3P40A 3KPOA 3A5VA 1UWGH 4ODHH 2PF6A 1HNGA 2WB1A 3MRKA 4GQQA 4BZ2H 4X9IA 3AY4A 1ETB1 3BKML 2EXWD 2Q7YB 1KIRA 3TYGH 3ARDD 3EF7A 2ENQA 5BS0B 4WFFE 2JE8A 4LSTL 2QT6A 4XODA 3IPBA 1R1CA 3JUYA 2ZG1A 3GS7A 4DO4A 5I66A 3NZSA 2E47A 1YNKL 4JANA 1MXDA 2X4TB 3T8VA 4UYQA 3CDZA 1IM9A 4YSCA 3ZL2A 1A1MB 4XVUC 5DJYB 2OJEA 3X1NA 2XV0A 3DO7B 4DP6X 3H0TB 1V3JA 1I1FB 2XVGA 2X3BA 1XGTB 1ZS8B 2Z65C 4ZPTA 2APFA 1OAQL 3L7FA 4TUKL 1KBPA 4LSQH 5GGSY 6PCYA 1H3WM 2UXFA 2H0JA 3EW3B 3FQ4A 4PQXA 3VXME 2XN9B 1DVFA 4NNPH 4U1NB 4UI2A 5J89A 3GXTA 4AVIA 1VFBB 3SJVA 2AQTA 3O9WA 4DOHB 1EAJA 2XVBA 5HVGB 1QBBA 3UROR 25C8H 1CTNA 2IAMD 2VDMB 1CI3M 2WSPA 1BQ5A 2YS4A 1INEH 3QDHA 4JY4B 5AVRB 3HIZA 1FG9C 3CFEB 4RH4A 3RA7L 2P24B 1RJYB 3FTWA 2Q7YA 3D5OF 3QCVL 5AENA 2DEYX 4XWGL 3WJMB 4Z76B 1TOXA 5E4AA 2X0WA 4WHYG 4FNLL 4O02L 5BS0A 3FHQA 4HAFA 1D2OA 2VXVH 3O3EB 5AAPA 4HS6B 2J6WA 3HNVL 5EF3A 3QUYD 2VDOH 1WA2X 3BSZH 4GXUN 4LLWB 2DN7A 2X4TA 3GS0A 3C2AL 1KXVA 3LH8A 5JOPD 2XV3A 1A1MA 1JPTL 1OT2A 3E7JA 2ZPKH 2QEJA 3N41B 2FWOB 4H0HB 3KWXA 4YC2C 3V4VB 3R18A 3DO7A 3ZYJA 1IBFA 3H0TA 4LNVA 1E9OB 1I1FA 1WBYB 2WNKA 1S3KL 1XGTA 3UAJC 1ZS8A 3MHZA 4TVPD 5I1EL 1S5IH 2DWDB 1A7NL 3B37A 4UV7H 4AIEA 1JZ3A 5ECGA 4V2BA 5EOQL 5C6TH 2FBJL 4E9LA 1P7HL 3CQFA 2J25A 4UANA 2XN9A 2W94A 3WNPA 3N41F 1VENA 1VFBA 1H6UA 2NW3B 3ZZ1A 5T5FH 2YLHA 1ACYL 4NAJA 2AEPL 1LM8V 1BVKB 4JY4A 1OAKH 1EXGA 5AOJA 1WPCA 4LPTA 4HAGA 3CFEA 2P24A 2WM0A 1RJYA 4J8RB 3EH2A 3DLQR 4DVRH 1XF4B 3WJMA 2AJZA 4Z76A 1A8JH 1RUPH 1KFAH 1A4CA 3IKKA 3WJLA 5EIIB 4PJ7E 3O3EA 1PLCA 4I3SH 5B1BB 3MQIA 4HS6A 2APTA 3NIFE 3SDDC 4FFYH 4TMPA 5KVMC 4LLWA 2VDLH 2X3AA 2J8UB 2XZZA 4UQBA 3HE6D 3CIQA 5LAXB 4XHJD 1J0ZA 1OP3K 3QZWA 3FQRB 4G8FB 4F8NA 2QL1A 3PWPB 2FWOA 1W8EA 4WHCA 5C0JB 5JPMC 3V4VA 1SFDA 1E9OA 1KB9K 1P2CB 1WBYA 2DWEB 1MFDL 4MNHB 2DWDA 2CMRL 3FSVA 3SGKA 4DK3A 1L9TA 3C8KA 2P52A 2J8UF 3CMGA 1W8OA 3RB7A 3SD2A 3CBRA 2FHBA 1NCBH 3T4AB 1WLHA 5AL8A 1E6JH 2C9AA 3C6EA 4Z7QE 2FR4B 1F02I 1KN2H 1XL6A 2Z91B 4AXWB 4L3AA 2MPAH 2NW3A 2QFPA 1QD0A 2WO4A 3X2QB 1H8LA 4ELME 4RGMB 4MWFB 1BVKA 1UD8A 3QWRA 1FIEA 2D0FA 1UB6B 5KYWB 2YFOA 3NEEA 2OK0L 3ZZQA 4TSBH 3HNTL 4ODWB 3BLBA 2EDKA 2NUTB 3QZOA 4XNUL 4ZUUB 3MLUL 4J8RA 2PPDA 3DVNB 1DQLH 4ZW8A 1XF4A 2DQGH 3S3BB 5MHSE 2RCSH 4HKJB 4QT5B 4R8WL 3GXPA 5EIIA 3VXQB 5LAPA 2A73B 1DLFL 3UYRH 1YQVH 1IVLA 1RZJC 4DEPB 4FAAB 4U3CA 3VXUB 5E9DB 2J8UA 1M3JA 4Z7IA 3D1MC 4V11A 4HUUB 2N56A 5LAXA 1B2YA 2K78A 2Y6SC 3QB7C 1GGYA 4Y7OC 3FQRA 4JPKH 4G8FA 2DLFH 1HWGB 3UEQA 1IGJB 5C0JA 1UZ6E 3TJHC 4HYTB 5ITBL 2B08A 5JUEL 3G9AB 1P2CA 3QUMH 1GS8A 2DWEA 4MNHA 4PTUB 4XBEL 5ADPL 1EJ6A 1USQA 4U1IB 4EIGB 4MQSB 3RTQC 1HIMH 3B1TA 2JKSA 3T4AA 4BK5A 1IE5A 1DQML 2Z91A 4B95C 4AXWA 1F6AA 4HJJH 4AQ8A 2AQSA 5INCB 5I18L 5KVGE 1OCWL 1RURL 2VLJE 2B59B 3RWJB 5J13B 4MWFA 4ZMNA 5D5MB 3SB3A 1UB6A 4DUVA 2RH0A 4ODWA 1FO0B 1I1AB 1MZYA 3MV9A 1OTUD 4ZUUA 4HULB 2R2HB 1ZOXA 1LDPH 3DVNA 5J11C 4QT5A 2CZNA 4NPYB 1MRCL 3T1FB 3VXQA 2X09A 1A6VL 1VGKB 3GDCA 2KPNA 5C0BB 5D5MF 3U7WH 5LB1A 4K71B 3Q6GL 2EDRA 5E6RB 3VXUA 2CHNA 5E9DA 2FX9L 2G4EA 3C12A 2GJ6B 4E9RA 4HUUA 5GJTL 1MEXH 4U1MB 2DTML 1EHNA 2FEEI 3FQYA 1MCCA 1IGJA 3I6KB 1JCVA 4HCGA 4PRBB 5D6DA 4YR6B 1GXEA 1ZLVK 5H4YA 2YKLH 3UTTD 3GWJA 4OT1L 4PTUA 3DGDA 4C4UA 3TPUA 3TS8A 2C5DC 4MAYC 4U1IA 1A3LH 3B2VL 3T6ZA 2WLHA 1RIVL 1XV8A 2FSDA 3DX4A 3KYAA 1NH6A 5HYIA 2OP4L 3TU6A 5C2UB 4PG2A 1BBJB 4DQOH 4HLJA 1S46A 1JVKA 1MRFL 3DJTA 5KS9E 1IBZA 5INCA 4GAYB 2B59A 3OKOB 3RWJA 1N0LB 4N2DA 1JCKA 3OKKB 3ZGIA 3NCXA 5D5MA 1IQWL 3HNSH 3M7FB 2O6EA 1XB3A 4YXKL 1FO0A 1I1AA 5DT1L 4HWBA 3F64A 2I7SA 2R2HA 5TE6L 2ZP0T 1PCSA 4NPYA 3T1FA 2VGLM 1YEWA 4HJTA 1VGKA 5C0BA 1AKJD 1MJ8L 5D9SB 1AQ8A 4WSGA 4WWNA 1M53A 4ZNEA 2GJ6A 3UIYA 4PJAB 5ADOL 2GI0A 5I73B 4U1MA 1CICC 5HI4D 4NPJA 2DD8H 4GT0A 2Q9OA 1OWRM 5IQ7L 3I6KA 4YR6A 1DCEA 4YXLL 3VGFA 2AQQA 2NX5D 2J20A 1GW6A 4H7VA 5BQ7B 3TN0B 4KDTC 4PJAF 1Q0YH 1CVSC 1FH5H 5HDWA 3K4AA 4LP4A 3J07A 2VDQB 1BBJA 1MVUB 4M3JA 2Q8AH 3HPLB 1EAPB 4D9RD 2LAAA 4M6NH 3KG5A 1QYGL 4GAYA 5JHDD 1E30A 3OKOA 1N0LA 1P53A 1UM5H 3QIWB 1LDSA 3OKKA 3PWVA 3E8UL 4NI6A 4MB1A 4E2OA 4BZ2A 5ANME 1RK0B 2AJSL 1X9UA 3ULUD 4FQQB 2NCEA 4BFBD 3GBLA 4BFNA 1CMOA 3P1VA 3FTYA 1J9TA 1I85C 4K73A 2MCPL 1LHZA 4XPTL 5D9SA 5ESVB 2A9CA 2EDDA 4ZFZB 3VUAA 5D7JC 4PS8A 3SHSA 3VACA 2VDOB 4PJAA 4PLKD 1DBAL 3S5LB 5C2BL 4NQDD 3N9GH 1J8RA 4NHCL 1B3IA 2PWEA 3B34A 1H8SA 4MS8C 2H3NB 6PAZA 1DANU 5FGBC 5H2BB 3D52A 5I0ZA 1PL3A 5KW9H 3HRZB 2WXOA 4C57C 4CJ0A 2N0KA 3K46A 4LCYA 3ZRCC 4I3GA 3Q2LA 5BQ7A 3QHZH 4J3BA 3TN0A 4I1PA 1S6NA 5F7FA 5LLIC 2KZKA 3LXAA 2WUBH 1MVUA 3TBVB 5IG7B 3HPLA 1EAPA 2E27L 3MA9H 4PW3A 2QSTA 5I6LA 4P3CL 1C5CH 3QDMD 1H3TA 4HC1L 3O0LA 4E42B 3QIWA 3CZLA 4YX2L 3JBG7 3D9AL 1ULVA 2NUPB 4ETYA 4AEIH 2R69L 4IGBC 1YPZE 2GIYA 1YRKA 5T3XH 1SJMA 4P2QD 1HCFX 3ZE0B 3K6NA 1RK0A 4GS7B 1IFHH 3KM2A 4FQQA 1KDJA 4BA0A 2XQYG 2MH4A 3WDHA 3VQ2C 4WTQA 5K1JA 4XMZA 3E9UA 3BO8A 5IVZB 1R75A 3PF2A 5ESVA 4ZFZA 4BFIB 3N06B 2FYVA 3BHBB 1YYLH 3G5XB 3U2IA 5CILL 2JI1A 4X6DB 3ZE0F 4GUCA 3BSZA 3CDCA 4JN2B 4GXUM 4KK8D 3FXIC 5B1KA 4XBPB 3B9KB 4XPAL 2APXA 5BRZD 3T8XB 5EF2A 5H2BA 3GEWB 4MLIA 3M1OA 4OI8A 4LLMB 2FH6A 5BW7A 3HRZA 5F96L 4BD4A 4NNXB 5CINL 4OJFH 2AJVH 4WGKA 2XVKA 2F53E 4X6DF 1LILA 2VDNL 4IKKA 4P5TC 2E9GA 4DNLA 1AFVL 3U4EB 2C3GA 3C5XA 2X9WA 2Z93B 3A6BL 1UGKA 4NKDB 4Q4EA 3CDYA 4QHPA 3TBVA 3VH8G 5ACZB 5IG7A 3BQUD 4J3SA 2NTFB 2VRKA 4P5SA 2G30A 1M9SA 3ARGB 4MNQD 1ZT7A 1NKGA 4E42A 1VADB 2NUPA 4KITB 2B1HH 2R9HD 2ENSA 3O4LB 5I28A 3IBOA 5D7IB 3TYFA 5D7LE 3BVDB 4LIQH 4WV1B 2ZP9A 1J11A 3C75A 1O6SB 2A77L 2N7AA 5IVZA 4IKLA 4YBLB 3M8OH 5I0VA 1BG1A 4BFIA 3BHBA 3G5XA 1KXTB 3D12B 4X6DA 2EH7H 4CU7A 4N0FB 1L0PA 4JN2A 5D7IF 5K93A 3Q8BA 3TO4C 4Q58C 1H3PL 4HT1H 1YN6B 5BO1H 2ERJC 5EMYA 5FWQA 1CK0L 5B4MD 1L5GB 3VD0A 3T2NL 4NNXA 1HEHC 1HEJC 2AMGA 5CXPA 4HH9B 3GO1H 1OSPL 5F6IC 1WTGT 3MCG1 2GITB 4WUUE 3U4EA 4AM0Q 4U7SA 2XTJC 4OCXH 3TA3B 2Z93A 4NKDA 5ACZA 1E2WA 3QUKB 4MDIB 4HKBB 4I1RA 5I1KL 2NTFA 2IOOA 4JDEA 3NVQA 2ENYA 3K91A 1T03L 1WG3A 3FT2B 5GRWA 4E5XB 1VADA 5A1AA 1ROWA 3VFGH 4IRZH 4HUWA 3G5WA 4KWUA 4X7FC 4L8CB 4X50A 3O4LA 2LE9A 4S1SH 4X8XA 5DS1A 4MZIA 2IFFL 5D7IA 4PRPB 1J1OH 5T3ZH 4NQCD 1QFWI 5D7SH 5ICXB 4WV1A 2DJ4A 2J5LC 3ZKMD 1GYVA 4ZTOL 3BYTA 4W9CC 4WLCA 4KHXH 5K9JL 1KXTA 1CR9L 5DHMC 4N0FA 3MKKA 3RWIB 2C3HA 5TJWK 4XN4A 1GJIA 3JV4B 1OM9A 3QZMA 3P54A 4ZXBD 4D7BA 4L4TD 5AAWC 3BE1L 4G7RB 3O11B 4QI3A 1EGJL 1YN6A 2BP8B 3ARFC 1I7ZB 3ILPB 1L5GA 3GIVB 4RFEB 3MU3A 1DQKA 5EZLB 4HS3B 3JQOB 4HH9A 1L9SA 4P4KB 1JNNL 4KKCD 4RWYL 2GITA 5ABZA 2J56A 3LS5L 1C5BH 3TA3A 2QBWA 3MLSH 2XTLA 3QUKA 4MDIA 5I1HH 4HKBA 4GAGH 1CYXA 4XMWA 2J1WA 3FT2A 3FN9A 4RMTA 3S37H 4E5XA 3M1CA 2NY0C 2XSKA 4HUNB 3K2UH 4JO5A 3NZ8B 5MENB 5CGYC 4L8CA 5FHBH 3TOPA 4KVNH 4AQEB 4B96A 5I15L 1DQIA 1N26A 2AXJA 4JNXA 3BAEH 4PRPA 1AQDB 5DVKA 5A2FA 3V6OA 4Z7WE 5D93C 4L4VE 5ICXA 3D3VE 4EOWL 4XOEA 3T0ED 3EOAB 4HWEH 5L4JA 4HIPA 4KKNA 3OJVC 3G7TA 3GYRA 5L8JB 2VZTA 4HHAB 5C08B 2ZX6A 3RWIA 1QSVA 2APVA 4P05A 1GIGL 1OP4A 4XP6L 1YMHB 3JV4A 4F8TA 5JHAA 3SO5A 5CD3B 4RGOL 5DYOB 2BP8A 4DPAX 4ZFGH 5IM7B 5SX5H 1I7ZA 3OXRB 3NSDA 3GIVA 4QRQB 2FT7A 4RFEA 1PSKL 3QK0A 4Z5RB 2CCWA 5EZLA 4PJ8C 4ZDHA 1ZT4B 5I8KH 4HS3A 2KKQA 1G5GA 1RZFL 3EYFB 1A14L 4P4KA 1JF1B 2JKTM 4G6FB 4RFNB 2X1WL 3MGAA 3AUVA 3TA4D 4LOEA 1JXFA 2JJUA 5CF3A 4NN5B 3IT8D 4YDJB 3MNZB 1NPNA 1TZAA 2YK1L 3O41B 3OZ9H 1BG9A 3FFCE 4PJXE 1BD2D 4KMTH 3NZ8A 3BN9D 2IALB 4DGVH 2X28A 3HLKA 4H20L 4AQEA 1KG0A 2Y2YA 4XBMA 1AQDA 1QI4A 4O58H 3FTXA 1I82A 3QYMA 1KTLB 4OUUB 1XTMA 3BT0A 2VDRH 2GBUA 3EOAA 4PY8I 4K3DH 4I77H 4LSVH 4UNIA 3E80A 3PJNA 4HHAA 5C08A 3QO1A 2VKWA 2FECI 1EAQA 5FS5A 1P9MC 2WIIA 3CX5K 4OLUH 1SEBB 1YMHA 3OR6B 2VN7A 3NJJA 5CD3A 1A22B 3MGTB 4XMKL 3GHBH 4Y2NA 5DYOA 3V0DA 1E5BA 4JPWL 2ZXEB 5IM7A 2CR3A 3OXRA 5DMKB 2ESVD 4QRQA 4JPVH 4Z5RA 1DJSA 1ZT4A 3O2WL 4H8UA 3EYFA 3RIAF 1JF1A 5E1AA 5IJDC 4H1LH 4BWWA 2QHRL 4BDVA 1E4XL 1VJSA 5TQ0L 3SDCB 3H55A 4HXAH 3SGEI 3SO3C 1WA0X 1S2EA 3ZGHA 2SEBB 3BZEB 4EKXA 5I71C 4MAUH 4YDJA 3MNZA 5IHZB 2F58L 2HT4D 4JO2H 1H5BC 1NBZB 2C4FT 2JB5H 3STZB 5CJ5A 1MAKA 2IALA 2VJ0A 3BEVB 3WNJA 2WWNA 4L3CB 3MGOB 2O5ZH 3TWCL 3IJ7A 2CE6A 1KTLA 4OUUA 4PP1C 1LE5B 4ZBJA 2D4FA 4PN6A 4QWWC 4HDIB 2X05A 4OI7A 3WN5B 4WEMB 4B0MB 5L8LB 2NLJB 1X9LA 4DKEH 1DO5A 4J3WA 3OR6A 4PFEA 5EEXA 3MGTA 3NQKA 4I87A 3W9DA 1QNZL 2J73A 1T2QL 2VH5L 4ANUA 3MCKB 3MSPA 4JPSA 4OI9A 4POZD 4QAWA 5DUML 2KLSA 3OMIB 1Z3RA 4E68A 5E2TL 1PZDA 2HKHL 4N0YH 3UBXI 1EFQA 2DMHA 3SDCA 5D70H 1SOXA 1SXAA 4JFXB 3UC0H 2SEBA 3BZEA 3FUIA 5ENWB 5FYKE 3ZUCA 3MLWH 4HSQA 1NAML 2EXWC 4NUGL 3RRQA 4N9GA 2KHAA 4OTXH 3SBQA 1TMCB 3STZA 2EICA 1NBZA 4CMHB 2V5TA 1A1NB 3ARDC 4PR5A 1S9YB 5GISL 4L3CA 4NKOB 3MGOA 1I8AA 2QHLA 1CGUA 5AZEH 2K4AA 1SDAB 3K74B 3ARXA 2YAOA 1LE5A 1MJ7H 4POUB 1OSYA 2J8OA 4DUXA 1NBQA 2FATH 4HDIA 1IM9D 1HHJB 3RU8L 5H94B 4ZFQA 2WBXA 1KCSL 2EXSA 4M61B 3WN5A 4Q4IA 3P3SA 5E0FA 2NLJA 5AWNL 4LOVA 5C3TA 1TZOA 4XNYH 5E8NB 5FXCH 4OF0A 2DB8A 2QDWA 4CVUA 2YARA 3ZTDC 1TJIL 3FF8A 1X5IA 3EADA 3DSFL 4UZUA 1KGIA 3E2HB 1EHAA 3QUHA 1DVFD 3MCKA 1RIHH 3JSSA 3SJVD 4FULA 3O9WD 1IB5A 3BMWA 5GGVH 3C8DA 2IAMC 1GVIA 1CD8A 3QZPA 4FNSA 4ESKA 4PG9B 4JFXA 2W0KA 3AS0A 5ENWA 4E0RB 4N0RA 3WUZA 3F83A 2UZYB 2P1YA 3ZHDA 4Z3TA 3QNXA 2W07A 1MNUL 3HI5H 1P1ZB 2WBJB 2G5UA 4M7ZB 1SY6H 1S9YA 5BS0D 1DVQA 1NJ9B 4ZMYA 4NKOA 2EIEA 4HK3J 3QJSB 3QUYC 4Z78B 3DV4B 4UILH 4A2DA 2C9UA 4OJYA 3U0WH 3APDA 1P7KB 1RH8A 5MERA 5DR5L 1NCDL 1WK0A 2NY7H 2ZONA 4PIRF 4LGSB 1HHJA 1RJZA 3ZSTA 5H94A 2XWJB 5AG9A 4M61A 2K6YA 4GW4B 4O4YL 4HKXB 3VG0H 1NEZB 1IM3B 3WIIL 5D7EA 3BH4A 2ZUQB 5C0ND 5E8NA 1GY1A 4XH2B 1BVNT 2QQQA 4BUHA 4NN7B 2YD0A 5EN2B 2PN5A 5KWYC 3LB6D 1VB9A 2BJML 2I32A 3MLVH 3RBGA 5T1DH 2HWZH 2OXGB 2XN9D 4IHOB 5BZWB 3VXPB 2LGNA 5AKRA 1VGEH 2CBMA 4XAWH 2CNYA 4L1LA 4N5ED 4R2GB 3CHQA 1FBIH 2XPYA 1EMTL 1RZ7L 3EF4A 4PG9A 2OTPA 5GS0H 4E0RA 4FLRA 5FYJE 2UZYA 3OHXC 1IEHA 3AXLB 3I2CL 4YHOL 1P1ZA 2WBJA 1VFUA 2X6MA 2V4LA 1EZSA 1NJ9A 4BH8B 4IRZA 2FEDD 1UCBL 4NP4H 4UQ9A 4Z78A 4X7DC 1JXJA 2UXVA 4JR9H 1E5CA 2H3KA 5DS2A 1C1EL 1P7KA 2XZAH 3HE6C 4XHJC 2VN5A 3ZBMA 1PKQE 4TNGA 2XWJA 2CKBL 1N0XL 5LN8A 5KVGL 3CN2A 4HKXA 1L9OA 1NEZA 4MCZB 1IM3A 1EVTC 5J1TC 3L4YA 4A7TA 4LDCA 1A6UH 1FNHA 2O6FA 4PJBE 1MFAL 2N01B 1NSNL 1S8DB 2X4PB 4HIXH 1XSJA 3MO1A 2K1MA 4XH2A 3ARZA 3KLSA 4JFQB 3AVEA 4NUPA 1Y1DA 4PLJD 5TD4A 1G1OA 5SWZE 5JIPA 2ZWZA 3OAUL 2OXGA 4IHOA 1MCDA 3L1GA 3VXPA 3HZKB 5F71A 1IGML 2A6IB 3IU3B 4PP2B 5I19L 3N1GC 3X3GL 3CVHH 1L7IH 2ADGB 3MRNB 3QQDB 3SY0B 2EC9T 2QVFB 2WZ5A 1A5FL 1AP2B 3GEFA 1KULA 1MIEH 1GOGA 5JA9A 3QWRD 5E08H 4DWHA 5D7KD 3LN5B 4YHMH 5BJTA 4JO3L 1BMZA 1QUPA 1CUOA 3WMSA 4GAJH 3BVNB 2R0ZH 1N5YL 2KS0A 3DOIA 4PJ9B 1H9VA 3C08H 1D5ZA 4BH8A 2WYHA 3SKJH 1DL7H 4UINH 4O5LL 3DHJA 2Y07L 1FNFA 3BXNB 4YHNB 1DJIA 2MRYA 2W9EL 5C0CB 4WI8A 3UPRB 2QSQA 2H0PA 4NXSA 5LDSA 4M7KL 2VDRB 1U21A 4U1GC 4MCZA 3OKNB 3FHAA 2WQAA 1S5HB 2N59A 5CEZD 1S8DA 2X4PA 4M5ZH 4P06A 1JP5A 4PSPA 3PGDB 3BJ91 1KCKA 2CALA 3DJ9A 4PW9A 1QNIA 4MJIB 3ZIMA 1X4YA 1LO0H 3OGCB 4QNPE 3H9SB 1G0XA 2WTOA 3ABMB 3HZKA 1EEYB 2A6IA 3T8MA 5IMKB 3QQDA 2FSEB 2ADGA 1HHGB 3MRNA 3SY0A 4W9LC 3H7LA 1AP2A 4KKBD 3U7YL 2ZOLB 4NGHH 4F2MB 2W38A 4NSKB 5SX4I 1BOGB 1JPGB 1TQCB 3KR3L 4H1LB 4D8OA 3LN5A 3QW9A 1G7MB 4P0DA 1OTUC 4FJZA 2EDQA 3FH8A 4C58B 4YAQB 4ZW3A 2IGTA 3BVNA 4HOMA 3CHXA 3LKQB 3QQ3B 4Y2DA 3PQYE 3NZHL 4ZOCA 4YPGB 4N1HB 1O7DE 3VTMA 2R4RL 2IANE 3MJ7B 4YHNA 3VXUD 3QJXA 3LIZH 5C0CA 1OGAB 5E9DD 3RIFK 6FABL 4EE2A 4K8RH 1SHWA 1MFMA 3MJ9H 1CLYH 3G5YB 5E94B 1Y1UA 2DIAA 3WE6B 3OKNA 2GYSA 5KTEL 3P2DA 4HUXB 5EOCJ 5LXGL 1MLCB 1PAZA 1S5HA 3V5KB 5CFAA 2XG4B 3L1EA 5JPNC 3MPCA 4JM2B 1FWXA 2OYLA 4YNYB 4ZMAT 3FU3A 3PGDA 1J5OL 1N19A 2GTZB 3ZJAA 3HG2A 1EDHA 3MV7A 3NDZE 4MJIA 4X83A 2Y23A 3BRDA 2IPTH 4NO5B 3OGCA 1JRHH 1WHOA 3H9SA 5GS2D 3PG2A 1ID2A 3WD5H 1EEYA 1NIDA 2KT6A 3FT9A 5IMKA 1FFNB 2FSEA 1HHGA 1V3MA 4JM2F 2WSDA 1SBSL 4PREB 2QQNH 2DM7A 2RQEA 2H8PB 2ZOLA 2QSVA 4F2MA 1Y6KR 1VZIA 4NSKA 1BOGA 1JPGA 4NOFA 4H1LA 3LQAH 4JREC 4NQXB 5SWSB 5HHQA 1G7MA 4M02A 1S7QB 1I1AD 4PCKA 3X3FL 3GMOB 5L6YH 4X80L 2EDFA 3LKQA 3QQ3A 4MCYB 4YSSA 4HJIA 4NC0B 4YPGA 4L0ZA 3WFEL 1OOWA 1OW0C 1WTLA 2VQUA 4OZGB 5CSGA 1CF1A 5C0BD 4ZNCD 1DJZA 3MJ7A 5JORB 3S4SG 5B1JC 1OGAA 3GI8L 1U3HB 2GJ6D 4AIZB 4LO9A 2EQDA 5HI4C 3G5YA 5E94A 5DFAA 1FYTE 3WE6A 2EDLA 2HB0A 5EU5B 3HC4L 3S34H 4HUXA 3ELAT 1MLCA 3F05A 1IAII 3V5KA 5DFWH 1AHKA 2XG4A 1UCTA 4OZGF 2FHFA 4DKFH 3LH2H 4FEMA 3CBJB 4JM2A 4YNYA 2VR3A 2GTZA 2W9LA 4TSAL 2OCCB 2HT3D 4K7PY 1WH0A 3O2DH 4HHWA 2XIDA 4NO5A 4OM1H 1F00I 3LRGA 3DPDA 4YFEA 5DD5H 1FA4A 1GR7A 5I74B 1FFNA 5GRUL 4ZD3L 2Z31B 2K9FB 5FUCC 2J71A 4QGYA 3NP4A 4PREA 2H8PA 4JUTA 4OV6F 2BY0A 4NQXA 5SWSA 3RAJL 1MHPL 1WAAF 4GMSL 1S7QA 4NO3B 1KBGH 4YDNA 4A7UA 1QR4A 3GMOA 4W1TA 3ULUC 3KLHD 5E9AA 4ERSH 4MCYA 5PCYA 3K0WA 1Z9SB 4HSAC 4F7MB 1UG9A 4OZGA 5IBTH 1F18A 1AC6A 2QQLH 2B4CH 4XVSL 5ECJE 3GHPA 5JORA 2O6CA 1TJGL 4QRTB 3BZ4B 2GG1A 1U3HA 4PLKC 3P2BA 4AIZA 4TLKA 1NPJA 1KYDA 3PV6B 3W0WE 3TVMB 5DO2D 1EJFA 4OLYH 5EU5A 2WGNB 4JFFB 3EFDL 3UBFA 4QKTA 3WHXB 1J5IA 4YZWA 1OE3A 1V54B 2WQ8A 2DMKA 3F58H 1JZHA 2GT9B 3ZE1B 1MH5B 5GJSH 1CFTB 4S2SB 4U6VL 3TN0D 5D2NB 4UZGA 5DLML 2DIJA 3B2DC 1KYOK 2X4NB 3IYLW 5I1DA 4X6CE 5C0AE 3U9WA 3MV8A 2Z31A 3OL2A 3O81A 5KSBE 2DTSA 3SD5A 3QIWD 2AJYH 1Y6NR 3N40F 1NTDA 3ZE1F 4L37B 2YQGA 5HTSA 2IMNA 2PLTA 4NO3A 4NYLB 4UWQB 2XQYK 1N68A 1QACA 3P11L 1JFQH 1KBVA 4W70A 1QFUH 3MXWL 1CDJA 2ID5A 3VW3L 5HHVL 1Z9SA 2X4SB 4JHVA 4F7MA 2G3NA 5L4MA 1SXBA 3AREB 3U2JA 3UJIL 2O1AA 1C7TA 4BSJA 4QRTA 3BZ4A 4IJTA 2VDPH 3QORC 3MACL 4KK8C 2NXZB 2WZPA 2YPKB 4L4JA 4DP4X 3DIVA 5EH1A 5FPIA 1SJXA 1THAA 4JFFA 3W9EB 5I1AA 5IW1B 1Q4NX 3WHXA 2BP0B 1URIA 4PJFE 3Q5YA 2GT9A 4FYTA 4YDIH 1MH5A 1CFTA 4S2SA 4G11A 4KXAA 5D2NA 4Z7NE 2DS4A 2XTJE 4GBXB 1E8XA 4AC4A 4ZD3H 2X4NA 1A7OL 2F54B 3H42H 3UTPD 2PYEB 4F37F 3BQUC 5JW4R 4YFDB 3ZHNA 3GSWB 3P4NB 4JKNA 3OVUB 1DVZA 2JELL 2C7FA 4KK6D 3FO0L 3X1EA 2J57A 2NY6B 3CVHB 4EUPG 3CZEA 3ZR6A 3CFQA 4L37A 1PG7L 2R9HC 3FQ2A 4NYLA 2WMPB 3P0YH 4CAGA 1G7JB 5AYQA 3SCMC 1EK3A 1ZE3H 2VNCA 5FYLH 5JXEA 5ELIA 2Z0UA 3CPUA 3NIDB 2Y1AA 2EKJA 2P80A 1GJUA 2OL3L 2RBLA 2AEQL 2B1OA 1UH3A 3FS9A 4WAFA 2YPLB 4FG6D 4YXHH 3IS1X 3AREA 4ALAH 3FN0H 3KPQB 4EDWH 1HZHH 1VFAB<