1TENA

Structure of a fibronectin type iii domain from tenascin phased by mad analysis of the selenomethionyl protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
89
structure length
89
Chain Sequence
LDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion protein
molecule keywords TENASCIN
publication title Structure of a fibronectin type III domain from tenascin phased by MAD analysis of the selenomethionyl protein.
pubmed rcsb
source organism Homo sapiens
total genus 15
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1992-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tenA00
1G84A 3LKSA 1HXYB 1XGPA 4GLRI 5EIIB 3CC5A 3QEUA 35C8H 1ORQB 2XZAL 4M1DH 3MV7D 3V6ZB 3LSOB 2VDNH 3QHZH 1NANH 3HG1D 4LRIC 1EFXD 4XWOD 3S4SG 4FQ2H 1ZT7B 4I18B 4NFBA 3L6FB 4JY4A 4N5UA 3DMMC 2W9EL 1ZANH 3RDTB 4F7MA 1RUQH 1PEZA 3QQ3B 1T0MB 3R0NA 1XF3B 2A1WL 2UWEA 4LMQE 4HT1L 4HF5H 2F8XC 1MOEA 3SJVB 2NY4B 4OV5A 3STZA 2X44D 3WLBA 3QIWA 3QSKB 1GAFL 4MCZB 1AC0A 3ULVH 3KNBA 4LSRL 4Q9BA 2EDXA 4FN0A 1UACL 1QG3A 3NPSB 1A3LH 4X98A 5H35B 1XGPB 2C3WA 1LK3L 3GO1H 3QEUB 4X6DB 1CL7I 4ZAKD 1AXTH 2VN7A 2EE6A 1AD0A 1N64L 1U3HA 3O6LL 3UMTA 4DKFH 4X4YB 1AR2A 5CWSA 1TJHL 2AK4B 1N6VA 5CCKL 4JY4B 4MXWH 4G8GB 3NACL 4X8XA 5ECJE 4F7MB 2R9HD 5T5FL 3QNZA 3MLUL 2UWEB 1QBBA 1KENH 5AZEL 2V5YA 1MFCL 4OV5B 1MCEA 5C8JB 2ZCHL 3TT3H 4PRIB 1DSFH 3WJLA 5BMFL 3QIWB 3ZZ1A 1A47A 1FYTE 4XH2B 3KNBB 1I9JL 4ZYKA 2DN7A 1KPRA 2VLJD 1I7UB 4Z0XA 3VFMA 3OG4B 3NCBB 3PIQA 4JFFE 1WTLA 2DAVA 1AD0B 4Z6AT 1YYLL 3BD3A 1OW0A 3QDAA 3MV8B 1F45A 4U3XA 4P2CG 5C0GA 5ISZE 3QRGL 1L9MA 3BZDA 5DURD 1VB9A 1KN4H 3MYZA 3EYOA 3T8XA 3EDEA 1AJ7L 1DBML 5F96L 1QSFD 5CIPA 3QNZB 1OLLA 3KYOA 3GBNL 1J12A 5D93C 3VA6A 2Y6SD 2ZG2A 2QADD 2SEBA 4LSTH 5DUBB 1R3IH 4K8RD 2FH6A 3TFKC 3W5NA 3QJFA 1UJ3C 1KPRB 2Z91B 4NBYB 4U4BA 4LHUA 5FA4B 5IG7A 2P8PA 1QBAA 5D6DC 4Z0XB 1T0NA 4AG4H 3PIQB 2VXQL 1HHGA 5DMKA 4PTTA 4ONGL 1J1PH 3QCUL 3GJFK 4Z95H 1MEXH 3CXDH 5KOMC 4L4TD 1FVDB 4LNRA 1A7RL 3MGTB 5BXFA 3TBWB 3BRFA 5FUZL 5AUMA 2YRLA 4K8RL 5HHOD 5C0GB 3F62A 2H32B 3CMOH 2PN5A 1MHPL 3BP7B 4HPOH 3EYSH 3EYOB 3MRGB 4ORGA 3T8XB 4DZBB 4NQCD 1NC4A 1M71A 1JK8A 4FQCH 3OAZH 3KYOB 5E2JA 1X5FA 1FZJB 5DA4A 3L3IA 4PRNB 3WJJA 2GJ6E 2C7UB 2SEBB 2DI8A 5J89A 4BFIA 2Q7NA 3FQNB 4CUCA 3GKWL 4RGNE 2DKUA 5EU6A 1CICA 4LHUB 5L2KE 2AAVA 2P8PB 4C56E 3GIVA 1T0NB 4GS7B 5KTEH 2G2RA 4BFBD 1HHGB 4XPBH 2ZUXA 3BDXA 4PTTB 3RAJH 3W0WE 4F33A 5DMKB 4QF1A 2UVEA 4QRSA 1DL7L 2PYFA 5DQ9A 3CSGA 2W59A 1XR8A 3MRBB 4U1JA 5BXFB 4LCUB 5AUMB 3BH8A 5E0QA 3GM0A 4QYOA 4OZIE 4NO0A 4IOIA 5GZND 1WISA 2K9UA 2XXMB 4LSUL 2P5WD 2IFFH 4L1HA 1IGJA 3MR9A 4QHUA 4R97B 4JY5L 5C86A 2AK1H 1Y6NR 2X4QA 4P9HL 1B88A 4IOFD 3FRPG 1NKOA 3LKPA 5CHNA 3LEXA 5LQBL 4P46A 4Y5YC 4ONHA 1VGKA 5EU6B 5IESL 5AWNH 5BS0E 1FGNL 3GIVB 1OGAB 4LFHD 1WSST 5DD1H 4X5XA 5EU3A 5I1JL 4F33B 4LSSL 2JJVA 3Q48A 2PYFB 1UCBL 4KFZC 4P2YA 2MQCA 5DQ9B 3QUMB 3LV3A 3WKML 1U6AL 1XR8B 2IGFH 2J8UF 3ZT6A 5FYJE 4U1JB 5K9OB 5KS9E 3SDAC 2OK0H 5JXAH 1IC7H 1FH5H 4OCXH 1HHJA 3QUZD 1EERB 4ZTPL 5T5NF 3SGJC 5CEXB 5JOPD 1N59B 3FB8A 5FHBL 3MR9B 4QHUB 5FF6A 4QWWC 3MJGX 4PPTA 2C3GA 2KDGA 2NMSA 2X4QB 3P0YL 4Z7VE 4CVWA 3GM8A 1A1OA 3LEXB 2HFEB 3O9WC 5TQ0L 3V6OC 4ONHB 1VGKB 4XNYH 3IFPA 1GGIH 1NGQL 5D1QB 4KJQD 2QEJA 5HI3C 3G5VA 4ZFOA 5C0FB 2QQNL 2XTJC 4X5XB 2CGRH 2BVOB 1MFEH 1LO3H 5DD3H 2QQLH 2FX9H 5KVFH 3LV3B 4WI2A 3T3PE 1O0VA 1Z3GH 4XCEB 5CUSH 1I8LA 2COQA 1GIGH 2LTQC 4QT5A 2ED7A 5GZOD 1HHJB 4JREC 2ESVD 1JWUA 2XKNA 2IQAA 3BHBB 3EJZD 5FF6B 3VXSD 4NZUH 3AM8C 3S88L 1GOFA 2P45B 2BOCA 4TNVF 3QUXC 1FL6B 3KLHC 3QHTC 5HHVL 3T0BA 1GRWA 4CW1B 3JTTA 1JZ7A 1RUKL 3RGVB 4WFHE 5ANMA 1CGXA 1DBJH 4BZ2H 1BGXL 5IFJA 3LQZA 4ZFOB 3QIBD 3QO1A 1UG9A 4OUOA 3C5ZC 2AJVH 4JPVL 1UWEL 1U2HA 5C0CB 4ODVL 2UY6A 4N0YH 2CSPA 5IB5A 5DVLA 5D7LA 1VDGA 4HFWA 3RUGF 3ISWA 4P2QA 2MTPA 5FYJH 2XN9E 3HMWH 2I5YH 5DJ6B 4QRUA 4BZ1H 5EZJA 1D5IH 4R2GB 3P9MA 4QT5B 3MLSL 1OWRM 1KTDA 1BOGA 1RZ8B 3UTZB 4Y19D 4QCIB 4KKAD 5JLZA 1NSNH 4I5BA 5DMIH 2DQIL 5IOPB 1KJ2H 2JELL 5EPMA 4LMQI 3PGCA 1P7QD 3TN0A 1IGFL 5A2LH 4ZSOA 4P4KD 2EH8L 3ZDXE 2JJSA 3K80A 1MAJA 3ES6A 4M8QA 3H9HA 1PQZA 3LQZB 3T0ED 1N8ZB 3KPNB 5CD5C 3EYFB 4XMPL 1EXUA 4NM8L 4OTXL 5IB5B 2NY5L 1SM3H 2E6JA 1C12B 3H6JA 3Q2CA 4P2QB 2NW2B 5BQ7A 3U2SB 1MJUH 4M6MH 4H88H 3P9MB 3D25A 1KTDB 4WWID 5JW3L 2XIDA 2NQCA 2PO6C 3HRZB 4PIRF 1DE4A 3VXUE 3PGCB 5DZOA 5ILTH 2B1AH 3TN0B 1HDMB 4TSBH 2FGZA 2VE6A 3B9KC 2I9LA 4ZSOB 3QEHA 4X99A 4JFDE 3LKQA 5F6HI 1JBJA 1D5XB 2FZ3B 4R7NA 2MCPL 1OSZB 3ES6B 1A22B 5DR5H 2X70A 3H9HB 5A16A 2H1PL 2Y1VA 3RX7A 1TCRB 3MO1B 4N0FA 1EXUB 1OHQA 4K9EL 4OLVL 4NKMA 1G7LA 4MAYA 4O51A 4TUOA 3P30H 2B1HH 1I85A 3GK8L 5BQ7B 5C07A 4NN6B 2P48B 3OJDA 3BN3B 2R56H 4JRXA 1G7IA 3D25B 3QUYB 4M5ZL 5IBUB 3O6FC 4LCYA 3LQAC 4JFEE 3NCFB 5HSFA 1EAPA 1GH7A 1OTSD 4LDLB 4MDIB 4M6OL 2VE6B 3RVVD 3S96B 1T4KA 1A6UH 1AIFA 5KSAD 3V6FB 3X3FL 2ED9A 1A6AA 4L3ED 4X99B 4TSAH 5HYSG 5B38G 4G5ZL 1G9MH 3ZE2F 4X4ZA 3LKQB 5DO2D 3ARGA 1TETH 2X70B 3MXWH 1ZS8A 1SVZA 2VZ3A 5D2LF 1G7LB 3PGFH 4TUOB 1MY7A 4LLUA 3HB3C 4MWFB 3K46A 4R3SA 4G6MH 3S35H 3R1GH 4MQXC 3RWDB 3ESVF 5L2JA 3GSNH 1X5XA 4WHYG 4M7LT 2IF7A 5EU5A 4Q7DA 1G1CA 1MHCA 2VLRE 1VFBA 2EYRA 1XF4A 2A83A 1KXTB 1OCWL 5I15H 4O9HH 1P7HL 3LZFH 2Z4QA 4NM4L 2RAMA 1IL1A 3B8SA 3V2AR 4DWHA 1FLRH 2CRYA 4LRNL 3ARGB 4AH2A 2QHLA 4MVBD 3TCXA 4X9BA 4ELMF 4QTHA 1CLYH 5I74B 4Q9RL 5CINL 1OAKH 3C5JA 4GQ9L 4HH8A 1T89C 4LLUB 2CDGA 3BI9X 2ED8A 1A0QH 3F7RA 1X6LA 2P8MA 3P3YA 5IBTL 2BNUA 4B7IA 1CGUA 4NQVB 4R3SB 3FOMA 1WT5C 3ZDZF 1UM5H 3WS3B 3SE8H 5L2JB 4PJIE 5I8CA 3QFDB 4OLUH 1JGVL 3SGKC 3AU1A 4LCWA 2OS7A 3IRZA 3MJ9H 2ZSWA 4YIQA 2NNAB 1AO7D 2EYRB 1B2WL 3Q1SH 2X4UA 3ZKMD 3MGAA 5DSCA 4TOYH 1ACYL 1L7TL 5T1KA 4OD1H 2BY2A 3Q6GL 3DYOA 4JKPH 1JJUA 3BZ4A 4GRWF 5CBEB 4HAGA 1Q94A 1A7NL 1OAQH 4Y4FA 3TESA 5JHDD 1OP9A 4QTHB 4IDJH 4JGUA 1J8HB 3C5JB 3MRFA 4XBEH 2AS5M 3RHWK 3Q6FB 2UZIH 4Z7QF 2CDGB 1FO0L 3UPAA 4J3XA 1CFTA 3NCEB 3WD5L 2AJUH 3RIFK 4ZNEE 2BNUB 4APQA 5DUPL 4AEHL 2GTZA 3FOMB 4H0IA 3RWJB 1FFPB 2CPCA 1U41A 4XAWH 4YX2L 1HYSD 3AU1B 1XIWC 3MODH 3QEQA 4YIQB 1N2RA 5EBMA 2Q76A 3MYJB 3CVIH 2YC1B 2FJHA 5DSCB 4QO1A 5C7XL 1UH4A 4FOMA 3SN6N 4MS8D 1M7XA 4ODHH 5CJ8A 5T1KB 4GAGH 1BJ1H 4RWYL 2OR7A 3NIFE 4PJAA 3ARDB 1JYVA 7FABH 5E8OB 1PG7H 1BVKA 1Q94B 3OGCA 1CGVA 3KPOB 1NAKH 3CZFA 5FO8A 2FJFA 3MV11 5HPOA 3RI5K 1U8QA 5IF0A 3D85D 3MRFB 1JHKL 2H45A 4XP1L 3C6LA 4M8VA 4J23A 1A7OL 4APQB 1XR9A 1NFDA 2GTZB 1ITBB 4YDVA 1JF1B 5ICZA 3QHFL 2R8SL 1N2RB 4BH8B 1RZJL 5EBMB 1X5AA 1NLBL 2C3XA 1IBGL 2FJHB 3OX8A 4HK0B 4WDIA 3IU3B 1YEHH 1N6UA 4PJAB 1S7TA 2VITA 4JCLA 4OCYL 3CSPA 1BECA 1GYAA 3PWVA 3U7WH 3GEWB 4EDXA 5GS0C 5IF0B 5GGVL 4M1GL 4OBSA 1K4CB 3QXUA 1CXIA 1R0AH 2V5RA 3F7YA 3C6LB 1WAAA 4YXKL 1XR9B 1NFDB 2ADJB 3SKMA 5AZ2L 4CAGA 3PDOB 1X3DA 3K1DA 4YDVB 4TN9A 3HC4H 4S1DD 4DAGH 3H0TB 1FAKT 2R69L 1R24A 4MXQD 1LO2H 2UWEE 3OX8B 1EGJA 2LVCA 2Y07L 4WDIB 4LIQL 5GIRA 1NCDH 1S7TB 1ZHKA 4OI8A 4W4NA 3RWFA 2ZCKL 5IJKC 3DMMD 4FQJH 3BKYH 2MQ0A 5EIQA 3V5DB 3DROA 3NA9L 1E4XH 5K59E 3HFMH 3PWVB 3HZVA 1RURH 3OB0K 4XB8A 4EDXB 2CKBH 2NXZD 3UJIH 4DJMA 4HGWA 1AFVH 4JZOA 4DUWA 1P1ZA 3F7YB 1RUMH 1KIQA 4Z7OE 1B6DA 4LVHC 4IRZH 4J4PC 4XMLL 3F5WA 5EA0H 4HFUH 3BT2L 1OAYH 3VGEA 1CTOA 3BN9C 1S9XA 4ALAH 2HT3C 3I6KA 3SDXA 4G9FD 4K94C 2R4SH 1FNLA 1WZMA 4W6WB 1NEZA 2QQKL 1BFTA 1R24B 3MGOB 1I7TA 4L8SA 4CRPA 1B0WA 1NGPH 2NY2C 4KI1A 2EC8A 3QXWA 1QRNA 1ZHKB 2NCMA 3RWFB 1GPOH 3GBML 4JB9L 5DYOA 4G6FB 4MCYB 3EKCA 1CK0L 3HZVB 1A3RH 2ZNWA 3B6SB 5EDXA 3V4VL 4UNVA 4NUGH 4X9IA 1YA5A 4HZLA 5IWLA 3MA7A 4YHIB 4HGWB 4ZUUA 4UIKH 5CILL 5B3JE 4JZOB 1P1ZB 1D5BA 3B43A 3F5WB 1KCVL 1ZGLB 4UIMA 3EZ8A 3QAZC 2IQ9L 4D9QE 1QHOA 3BP4A 1S9XB 3I6KB 3SDXB 4A2LA 2BHZA 4URTB 4GO6B 3T2NL 2XRAH 1LP9B 1FV1A 1I7TB 4L8SB 1F42A 3RL2B 4BSWA 1EHAA 4UILH 3P40A 1IGYB 4RMSA 1IKFL 3U9UA 1L6XA 4LPXA 1QRNB 4OFYD 1MRDH 3G08A 3CSYA 1EJOH 3SE9H 3WSQH 5DYOB 1U8JB 3W5MA 4MJ6A 2VMFA 2PCPB 2YWZA 4MA8L 2L4OA 1HINH 2PF6A 5TDPA 4ZUUB 4HAFA 2OL3A 4L8CA 1CDIA 1U58A 4I0PD 1ZTXL 2FX8H 1ZK9A 1D5BB 2JB5L 3C87A 3B83A 5CSZA 4WRLA 3ROLB 1INQB 4N0CD 1RZIA 2YUXA 4Z7WF 5HGBA 3I85A 4WW2F 5MP6L 3WFEH 3HLAB 4YZFF 2E7LC 5GGQL 3CNKA 4MLSA 4I9WE 1U8PB 3TWCL 4XPFL 1MCDA 3BW9A 1VACA 5AG9A 4YPJA 2XZZA 3JUZA 3OHXA 3MRPA 2BNQB 4JVUA 4BSWB 5IFAL 5GGRY 3G08B 4NZTL 3CSYB 4AT6B 1KN2H 4RNRA 1ETZB 1U95B 2YK1L 3C08L 5F93C 5IVXF 5J6HB 2GYSA 3OKMA 1N0XH 3L1OL 2EEAA 2X2YA 4XVJL 5EU6E 4L29A 3WHXA 1FLTX 3VMPA 1CLOL 3O2DA 2VC2H 4LAQH 4R0LA 4L8CB 1U58B 2GSGA 2GKIA 1Q1JH 1DQML 3UJTH 5ETUB 4TUKH 5E2TH 4I3GA 1RZIB 2VSCA 3NCCB 3PWJB 4XHJC 3ARZA 3D2UB 2AEQL 4YPGA 2C26A 3ARRA 5EOQL 3PWNA 2DMKA 5CIPH 5BZWB 3BW9B 2AXJA 5F6IB 4GBXA 4LLDA 1K2DB 3WFZA 4DGIH 4YWGH 5TE6H 2BJMH 1HHIA 3MNVB 3ORJA 5HYJE 5E08H 5F9OH 5T3XE 1YEEH 4RNRB 4WO4C 1AH1A 1IGMH 3HNSH 4ZS6D 1DUYA 3I2CL 3OKMB 3N85H 3EO9H 4ENEC 3ZE1E 5LVEA 4L29B 3WHXB 2WNGA 5D7IE 3AFLA 3WIHL 1CFNB 3KDMA 4R0LB 3PWLA 3OKNA 2HFGL 1PBYA 4FXKA 2NY3B 2EYSA 4L3CA 4I1NB 3Q5TA 3ZHDA 4HS8L 3RIAF 1H5BC 5E8PB 3UBXI 3ILQC 1YMMA 1UGNA 3G5XA 1SJXA 3PWNB 4XX1E 3D69A 1NDGA 4OZ4A 4NJ9H 1A7QH 3TPKA 5EU7E 4LLDB 4UTAL 1WFTA 1S78D 1S7XA 3RZWA 3EYVA 1KXVC 1NMBL 4LLWA 4XNZC 2HVKB 4P2OA 5IQ7L 3F7QA 3L3JA 1DUYB 3WIIL 4OD3L 3BKMH 4XC3L 4ODWA 1CT8A 1F3RB 1EFQA 4QWWD 3H9SA 5DZNA 1OB1A 2DYPB 3TJEL 3PWLB 2PTTA 3QQ9C 2FYYB 4UT7L 3BRDA 1AGEA 4FXKB 4KK8C 3WNMA 4KC3B 1YQVH 2EYSB 1P7KA 1JRHL 3G5XB 3QDJA 4LPVA 5F9AC 1G6RB 2FX7L 3D69B 1INEL 4P5TD 4B5EA 3VMOA 3WIFA 1VEOA 4XPHL 2IANA 4AM0A 5T3XH 1UJTA 4YDKL 1RI8A 1IFHL 3BZEA 2Y06L 5E03A 3HZMA 5BVPH 1MCJA 2OYPA 2BFVH 5D7JA 4BQCA 2F5AL 4ODWB 1FCGA 4X8JA 1CT8B 3THML 2GK0A 5ANME 5BV7H 1U8NB 4F3FB 3H9SB 4K3GA 3PL6B 2X1OA 4AEIH 2X6MA 3KLHD 4FFWC 1D9KA 4NQED 2OQJA 3OKDA 4YC2C 4OKDA 5D7LE 2L7UA 1W0VA 4P2QE 2GAZB 1KEML 5IIEB 5GISH 4YO0B 1P7KB 2DIBA 5F7HA 4KUCD 1YEKL 3T04D 4Y1AE 1S5IL 3PV6A 2BOBB 1D6VL 3V79C 5DVOA 5FEBA 1CBVH 5DMJB 2VERN 2XA8L 1HYRC 1UEMA 5I1EL 4AM0B 5JOFB 3L5IA 3C60A 3JSSA 1CDJA 1JPSH 3GSQA 4MA7H 3HI1B 4ZSOE 4JZNA 5D7JB 1Q72H 4KK5C 3HE6C 1RIUL 1P69B 4A6YA 4HKZA 1TVHA 2FD6H 3MLYL 2GK0B 2ICWB 4PJEF 4F7CA 4TSCL 4M43L 3MJ6A 1DLFL 2VXVH 5I19L 4HC1L 3IGAA 2OQJB 2VLKB 3OKDB 3IJYA 5ALBH 3U4EA 3KS0H 3DURA 3ARBC 2BMKA 1EIBA 1QLFA 1BD2D 5EORL 3HS0B 4OF3A 3MA9H 4YXLH 1HK6A 2EH7H 5DHVH 1MIEL 3TJHC 2XZCL 3UBXB 1IC4L 3DI3B 4NO2A 3C60B 3TA3D 3GSQB 4Y5VC 2V2TA 3BYTA 2A6IA 3HPJA 4O4YL 4LLAA 4HV8B 5CEZD 3MJ7B 5L0QC 2Y72A 2PO6D 3L3KA 4WJ5A 3RY5A 4A6YB 3V0AC 5LGJB 2KL6A 4F7CB 2OI9C 3W82A 3RNKB 3IT8D 4KY1L 3CFEB 5DA0B 4N0UA 5TH2A 1AGCB 2EO9A 3IJYB 5LKNA 3DURB 5C07E 5DGRA 2GCYA 3DO7B 1UA6H 2BMKB 2XOTA 3U30C 4JRXE 4HLJA 4Y5XB 5CEZL 4LVEA 1GXEA 1Z9SA 1FG2A 1HXMA 4ODSH 1WZ1L 5B8CB 2A6DA 3DX9B 2H2PC 1R3JA 4RZCB 4QHKJ 2P5ED 4LARH 5MEPA 3QCTL 4N8PA 2BCKB 2A6IB 1OD9A 5HGDB 2Q20A 5FYKD 4WJ5B 3L3KB 1C5CH 3O6FD 3QG7H 3QQNA 3TGXA 2AXGA 4HCRA 4P2RB 5TE4L 5GXBB 3P4OA 3LHPH 1HSAA 2K7QA 3ILPA 3CK0H 5JOEA 4O00A 4QRPD 3P77A 2AV1B 3IRPX 3AAZA 4CU6A 1LO4H 1BM3L 4NSKA 1IGTA 4O2EA 3D5OF 2VDKH 3SDCD 4POZD 3T3MF 1IQWL 2L0DA 3ECBA 5FCUH 4QRRB 3N1MC 1FG2B 5TF0A 1HXMB 3TT1L 1J1OH 1R3JB 1OPGL 5MEPB 4JFXB 3CFDA 3MV7A 3AS1A 2R0LH 4PJHB 3HG1A 3O45A 3TYFA 1EFXA 1E4WL 4O2CA 1CGWA 2AXGB 4J3OC 3OKEA 4OLYL 3CGTA 3DWTA 3HCVA 5SX5K 4RMWA 4LLYB 1KYOK 3T2QA 4KHTH 2HTKD 4KKBC 4P3CH 3ARPA 3ILPB 1TMCB 5SWSE 1V7NH 5C09B 2K7PA 5IHUL 1NUGA 2J5LB 5KVGH 3V4UL 1GGCH 3S34L 4Z8FL 5I1KH 3QDMB 4NSKB 3O8XD 1FBIL 1FNEB 4HK3J 3LKRA 3U9PL 1CXEA 1NGZA 3DETC 4HDIB 3QBTB 2P44B 4WY7H 2LQRA 2QSVA 4LEXH 2O5XH 2W9DH 3V52L 4C83A 5FV1L 4LCWE 1KB9J 4UV7L 3GHEL 4KK6C 3NIDF 4M00A 3EO1A 4H26A 1C1EL 4KQ4H 3WUWA 1E4KA 3B9VA 4ZAKA 1DQQB 3MV7B 5GGTL 3NCJH 3T4AA 3QULA 1X5JA 3UO1H 1KACB 3O45B 3TYFB 5E9DD 4LQFL 2XT1B 3BSZH 1X4YA 3I6GA 4MQSB 3I6LE 5DT1L 1F4AA 4WEBL 2NY7H 1H3PH 4DN3H 3RVTD 2MFNA 4R26H 2ORBL 1IQDA 3RUGA 4P23C 4XC1L 1FSKB 4Z76B 1Q9OA 1U91A 3T0AA 5I1HL 3FQRB 5HDBE 2P42B 3AREC 3LKRB 2WUBH 4CVXA 1XGYL 3MCLH 5FGBA 4QXUH 1HHHB 3MLTB 1CFVH 5KZCB 5K93A 5EC1A 4HBCL 3QEQE 4BELD 2VLJA 3EO1B 5J1TC 3WUWB 4UOW1 4CU8A 2FB4L 1M6OA 4ZAKB 1FFRA 3T4AB 4YHPA 1N5YL 5IMMB 3QULB 3CFJB 1JGDA 2AABL 4Y16D 2VDQL 1MQKH 2XQBH 4G8FB 2MWCA 4K71B 4KUCF 2VXSL 2ITCA 1QFUL 1QSFA 5M7QA 5E4IA 4PB0L 3GMLB 1J0JA 1Q9OB 4K7FB 1U91B 4G6KH 1VPOH 5FUOH 1FL5A 1FIGH 1L7IH 1NFDE 1ZHLA 3ZL4L 4XZUA 4PJFF 5K9QG 2ARJQ 5FFLA 4X9GA 4F57L 4PRDA 5EC1B 4IIQC 5I75C 1YMHA 5AAMA 1NGWA 3DXAD 1W2KT 2VLJB 2HLFC 2JKXA 3ULUD 4WIQA 1W8OA 3PGDB 2BRQA 1M6OB 4IOSD 4YHPB 2ZUQB 1RUPL 1R5IB 1OT1A 1MIML 1T21B 4U2ZA 1JGDB 5JPMA 2D03L 5J13C 4L4TA 3HC3H 4HIJA 4BYHA 5I18H 3BZFA 3IVKB 5HHOA 5E1AB 3V8OA 4QLRA 3T4YA 3FMGL 2ITCB 4NQCA 1QSFB 4WCYH 5ID0A 2IBZX 5TF1H 5FA3A 1TJIH 4L8BA 3ULVC 3EZJB 3OPZL 4NCC1 1WAAE 5BCAA 2E5EA 5F3HB 3VXPA 5EOCJ 3QIUD 1ZHLB 3BPNC 4WHDA 4WUUB 1T6WA 3VW3H 2X09A 2YOCA 3IS0X 2EZ0C 4Z7NE 4PRDB 4Y4HB 3VWKC 1XF1A 1NGWB 2PW1A 5HHMD 3LCYA 3BPLB 4DCQB 3ARXA 4NRZA 4HJ0C 2BY1A 2X4SA 1WLHA 2B5IC 3WFHA 3C5SA 4NQXB 1G6VK 2W65A 5F3BA 2QSQA 1E6OL 4L1DA 3SBWC 3L5XL 5JPMB 4PGJA 4XGZA 2DLHA 4L4TB 2AJSL 4P5KA 4NKDA 4K2UL 1KV3A 2YRPA 5HHOB 3TM6A 5L88L 3VXTA 4NC1E 3T4YB 5D2LA 1JFQH 5HI4D 5GS0L 4KI5C 4B41A 2QTEA 5JQ6H 5ERWA 1YN6B 1KCUL 4NCC2 1CN4A 1DEEA 5ID0B 2P5WA 1FP5A 2J4WL 5FA3B 1P53A 4L8BB 1YNKL 4ODUB 2CLRA 5HYIA 5SV3A 4OLZL 3NH7L 2HH0H 3L3GB 3WNLA 2NR6D 3KPLA 4NNYA 5I2IA 3U82B 1OAUL 1OTUC 3IYLW 1A7PL 4EOWL 3VI4F 4LSQH 3ZKND 2OBGA 1NCWH 1ZHBA 3BEWA 3OTTA 4J4PD 3LOWA 1XF5B 1RHHA 3BFOA 4OGYL 4HXBL 3WFHB 2J88L 2W65B 4FTVA 5F3BB 4P49A 2JB6B 5EUOF 1UKSA 1JPFB 2HT3D 2VDML 4M4PA 1JHTA 3MMEA 2FJGA 4P5KB 5GRXG 3W11C 1F4YL 4ELMA 4JANA 4I3SH 4N8CH 1A6WH 5D2LB 5SX5H 1P9MC 3QUZA 4JRYB 1JMZA 4HIIB 4E9LA 3BE1L 4XPGH 1SQ2N 1RMFH 1F11A 3NMEA 1XGTA 2O5YH 4KTDL 1PG7W 4U6VH 3ARFC 3SEPA 3UTTB 4EN3B 3KPLB 4Q74A 4YFLF 5I2IB 3TH4T 5C2BL 5F7YC 2VRAA 4K94L 4O58L 4M5YL 3SGDH 1QO3A 1EGJH 5I30H 2PYEB 2ZJSL 4DEPC 5E2WL 3O0RH 1FVCA 4FTVB 1H3GA 2JCCF 1TTFA 4XCNB 2YS4A 2WIIB 1JHTB 2DI9A 2BNRB 3TZVD 5I1DA 2D0HA 4R4BB 4ZTOL 2ESVA 3S37X 1ZGLM 1PZ5A 4DW2H 4GW5A 1EO8L 4YHYB 4YHNA 3VXSA 1S7UB 1F90L 4FQQA 1T1WB 3ZSSA 1NMAH 3X17A 4ONFH 1XGTB 4EBQH 1MHEA 4YHOH 4LEOB 4F8TA 5JR1L 1MREH 3BPOB 3KPRB 4L4VD 1RIVH 5ACZA 2KZ1B 4IRSC 5D1XC 2YD2A 3WS6C 3QIBA 4OZGF 2E7BA 3OZ9H 1QO3B 2ZUTA 1K3ZA 2ARJB 5GJTH 2Y7QB 5EO0A 3CH8A 1FVCB 2VWEE 4NHUA 1T7VA 3WXWL 3U46A 3BIKB 1XGRB 3D3VD 1MWAL 2Z31D 1I75A 1P2CA 3KPPB 1FNAA 1TPXB 1YN7A 4RMVA 4GRMA 5D2NA 4K3EL 1E6JL 4GMSL 3ETBF 4PJBF 4Y19A 3MRKA 4GW5B 3Q3GA 4YHNB 1QNZL 4FQQB 1P7QA 3R8QA 3MLXL 1NJ9B 5CJOL 5LBSH 1MHEB 5I1LA 4P4KA 5I1IH 5GS2D 1ZLWK 2PR4H 4OCRH 3O4LD 1FQ9C 4E0RA 3NZHH 3FO0L 4EI6A 5ACZB 1MF2H 4JDVB 2YPLD 3U36B 1JPST 3K3QA 4G43A 2F54D 3OXSB 4M93C 4XCYB 2F53D 5H8DA 1Z9MA 1KELH 2ZUVA 5EO0B 3QEGL 4LVOC 4M7KH 3RWEA 2MNUA 3OKKB 3U46B 2KUTA 5E4EB 4PS4L 1P2CB 1DFBL 3V5HB 3FQTB 4GRMB 4ZOEA 4DK6A 4PGBA 2F8OA 4Z9KB 3HA0A 4ZS7H 2HP4A 3MRKB 5GGRA 2OL3H 4IMKC 1BFSA 1OAZH 2UZYB 2YR3A 4PJXF 5A3IC 4RGNC 3B2VH 3ULUF 5I1LB 2R29L 3LIZL 1CD0A 4E0RB 4JDTL 5GJSL 1OTTC 1YMME 4F58L 1MCPL 4NWTH 5DD0H 1F02I 1R5WA 1U8LA 4GRLC 4PR5A 5E2UL 1TFHA 2E7CA 2QKIA 3VXMD 2HTLD 4PRAB 3A67H 4KVNL 1DBBL 4L8DA 1IGIH 1XF2A 4KDTC 3RWEB 2BY0A 1CIUA 4K3JL 4RGOH 4ZPTA 3RVXD 1LDPL 1ONQA 1S9VA 5CD3B 1YNTA 2Z35A 3ALXA 3RDTD 2NTFA 5TDOA 5L7XH 2DQDH 3EJJX 3JWDH 32C2B 2ICEA 3AS0A 1C7TA 2YKLL 5J3HC 1HE7A 1CLCA 3TIDA 1FPTH 4NYLB 3SJVD 2NY4D 2F58L 2EDEA 5KSAA 2DQUL 4L3EA 1U42A 4XNXL 4LHUG 4RBPH 4M6NH 3RZCC 2R0WH 4YHLL 2APWA 5IV2A 3VDCA 4Z5RB 3QDJE 1R5WB 4P57B 4PR5B 2IJ0C 4KROC 3DVGA 1Q0XL 2QKIB 5EWIH 2IANE 5CJXC 3M45A 3HRPA 1JIBA 1PLGH 4GW4A 4DN4L 2WBJB 3NCMA 4FHBD 2AK4D 4KRPC 4ZPTB 1A6ZA 1S9VB 4JRWA 5DQJA 1NCBL 2Z35B 4G8GD 2Q6WA 3VCLA 2IH3B 2FWOA 1DCLA 3MCKA 2NTFB 4H20L 2HJKB 2ICEB 4AEEA 1T3FA 4PLKC 1E28A 5EO1A 3TIDB 2VDOL 4I0KA 1BREA 4PRID 4P59H 1MJ7L 5DS8A 4YDLC 1FGVH 2AGJL 5TE7L 5IV2B 1QQDA 4DQOL 4NBXB 3DVGB 4G3YH 4FFWD 3KYNA 3UROR 1DVFC 4WGVB 4GW4B 4B53A 3SDDC 4TPRH 2EDOA 5L9DH 2CRIA 1KC5L 3MV8D 4UT9L 1ES0A 1YJDH 1GZQB 4UAOC 5F7FA 2Q6WB 4HWNA 3MCKB 3TVMC 5D5MA 3GDBA 4S0SD 4X7DC 5F9DC 5GSVA 3ZSTA 1IEHA 3CAFA 3VXRB 1RZFH 5DFVC 1T3FB 1AO7A 4LKXB 1RZ7L 1E28B 4N5ED 1RK0A 4XVTH 4Z7WA 4QOKE 1LNUB 4WUKL 2DLTA 2X4NB 4WW2A 4NQTA 4ZUTB 2XZQH 5AYUH 5DS8B 3LEYL 4IJ3B 2M8XA 1F58L 1IAKA 4KZDL 2BVEA 2CIIB 1MFAH 4TNVK 5JHDA 3KYNB 2ZSVA 3VG9C 5DD5L 4UQ3A 3TO4C 4NKIH 1A5FL 4ZXBB 5B22A 1ZLSL 1U0QA 4MJ4A 1MUJA 2P49B 3DHMA 4Q9CA 4LCIL 1ES0B 4XX1G 2IPTH 4HMDA 5GS3A 1C7SA 1IAII 5D5MB 12E8L 5DRWA 1MFDL 3O2WH 1MPAH 3SE4C 4KTYA 3WNNA 4H5SA 4NQUA 4ODXB 2I07A 4DOHB 4KGJA 3SOBH 1FO0B 4CMHB 2IAMB 3OR7A 1G9MC 4DTGH 3C09C 4N0UE 5IBLD 5LAXA 5IMLA 3VFRA 1DDHA 4EIZC 4ETYA 3UJJH 3FB7B 2YSSB 3MLWL 1NH6A 4I2XE 2R23A 1AI1H 4JM4L 4RQQB 5EBWA 2F5BH 4HUNB 2X89A 4HJGA 1IGCL 2VL5B 1IVLA 5JHDB 1KJMB 2DMCA 3BUYB 1HOCA 4UQ3B 3D85A 4K23L 2IPUG 4JPKH 1DEDA 1RZKL 3AB0B 4LSVH 5I8OL 4ZMAT 4A6YH 1GGBL 2J12B 1DN2A 3FB6A 5F6HJ 2QHRL 4NP4L 5E5MA 2EIBA 3NIGF 4H5SB 1YPZF 2I07B 4L9DA 2HJLA 3MBXH 5F1IA 4YHML 3OR7B 1UYWH 5CS7A 4FFZL 1WC7B 2J8UE 1UH2A 4EI5D 5C0NC 3CZJA 5IMLB 3OF6A 3EYUL 3VFRB 1IKNC 5F88B 4S1SL 3GSUA 3W39A 2JJTC 4JM2B 3NAAH 5EZLA 1MI5A 5L6YL 1QFWH 2XACC 2DBLH 3CUPA 4MHHI 1BEYL 1CL7L 4AK1A 1OGAD 4Z18A 4LHQB 1NCCH 4OB5H 1HOCB 4KAQH 5DJYA 3D85B 1ULVA 1YECH 3FQWB 5J1AA 2YXMA 1ZEAL 1SBSL 5IM7A 5A2KH 3MV7E 4DK3A 3WN5A 4KKLC 1QD0A 5IJVB 3HG1E 3KAAA 2FECI 3K2UL 3RGHA 2V7NB 4Q6IA 2J6EA 4X7CC 3FB6B 3TO2A 3MJ8A 2DDQL 4ZPVA 1PAMA 1GL4B 1HKFA 3HUJF 1QACA 1T1ZA 3D18A 2HJLB 3E6HA 3FFCE 5JDSA 1H8SA 5F1IB 4KJPD 1II4E 3RBGA 3FZUC 3QO0A 5CZKA 4HIXL 3GSUB 5F9JA 1OGTB 5EZLB 1MI5B 3GUTA 3DMMA 5BRZB 5EB9A 3IDGA 1FL3A 4D0CA 3CUPB 4DKEL 3HMXL 4D9LL 5D1QD 1YZZA 3BD5A 1LHZA 2RIKA 5KSVA 3RPIA 3U4AA 5A43C 5DJYB 2DTMH 2OSLB 2I60H 1QLEH 1G9NL 1VEPA 5J1AB 4Y88A 3ALWA 1SJHA 1CDUA 1YUHB 3U7YH 3WN5B 3DTXB 2R4RH 3K8KA 4Q6IB 4U1HB 4HCRH 3OGOE 3TO2B 4JJ5A 5FKAA 3LN5A 4GUPA 4G9FA 5TFSL 1T1ZB 2O5ZH 2DS4A 2AJXH 3D18B 4XWGL 3E6HB 4KRLB 5A2JH 3IDXH 3RUGE 4FG6D 3GB7A 5CJBA 4G6AD 2B0SL 3RTQC 4ACPA 4AJ0A 4BFEA 2XWBA 4NKQB 4X6DF 5F9JB 2D7TH 3DMMB 3RGVD 3AXLA 4MZ3A 3TBYA 2A1WH 4P23D 1RHFA 2PNDA 3RPIB 4PGEB 2HRPL 4HT1H 5C0CD 2VLJE 4NUJB 2NX5B 2VXTL 1QSZA 3DIFA 4LOUC 1F4XL 4KHXL 1MCRA 1GAFH 4KTEL 4OF6A 1QTYT 3GZKA 1JTTA 1UACH 4EUPB 4X5WA 2YMXL 4AMKH 4PJEA 3HE7C 2B7DT 3KLAA 4ZUSA 1CFSA 2P4AB 2XG4A 4KDWA 1LK3H 5FKAB 3LN5B 4GUPB 4G9FB 4IM8A 2YBRA 1T83A 3BGAA 1RD6A 3GB7B 4CBPA 4OFYA 3RHWF 4Y2OA 3RIFF 3AXLB 3E6FB 5T5FH 2YD7A 3TBYB 4F7EA 3MLUH 1JNLL 1N7MH 5D70L 5CBAA 5KSBF 2W60B 3STLA 2I24N 1BVZA 3BH9A 1MFCH 3H7LA 3DIFB 5GGSY 3K8MA 3RKDC 4XI5D 4I0PA 5D72L 1I9JH 1AE6L 3K81A 5FB8B 1TQCC 3BQUC 4FQLH 4X5WB 1TZGL 4PJEB 3DRTA 3KLAB 1T2JA 1I1AC 1CYGA 5HHOE 3SKUD 5ICXA 2HLFD 3EJYC 4Y7MA 4H25A 4KH2A 3QNXB 4X6FA 4OCLC 1JRHI 4NQCE 2YBRB 5ACLA 3TPUA 2EIDA 5MEOA 1UWXK 1AGDA 2RB8A 1EBAA 2BRRL 4JG1H 3UAJC 3F12A 1ZVYA 4K7PH 3TBSB 5F96H 1ROWA 4GXUM 4DVBA 4F7EB 4R4NC 3VDAA 1M05B 3STLB 4M1DL 2NY0C 1J18A 2DIJA 3MBEC 5D93B 3D6GA 3QHZL 2EDYA 1KT2A 3BH9B 2JTDA 4FQ2L 4UBDC 4OUUA 5JTWA 1IC5H 1S9YA 3ZE2E 1LQSR 3L5HA 1ZSDB 3C2AL 1ZANL 1UJ3B 3I3BA 3PWPD 1D5ZA 4OFVA 3U79A 3QUYD 5DI8B 3IAPA 3RKPA 1ZVHA 1UM4H 2XA3A 2VXQH 4MLIA 3WIHA 5D2LE 1I1YB 3M8OL 4O02L 4P99A 3L7FA 4PD4K 4GSDH 2YA2A 2P5WE 3QXTA 3ULVL 5MEOB 1ED3A 1AGDB 2IBGA 5FUZH 4K8RH 2ENSA 3DUSA 1RU9L 5ACMA 1IAOB 3GMQB 1CDCA 3F12B 4LP4A 3QH3B 1P84J 1CE1H 4WU5A 3GO1L 3TNNB 4DVBB 1QR1A 1AGBB 5DC9B 1AXTL 1Y18A 3G04A 1B0RA 4DKFL 3KJ4C 2OMBA 3VFUA 1XGQA 1BQHA 4ZO8A 1S9YB 3GKWH 1TTUA 4MXWL 1DN0A 3O4OC 1D5ZB 3ROOA 1OTUD 3EOBA 3EAKA 1I7RB 4ELME 3U1SL 1RJLA 3X11A 1QLRA 1KENL 1DL7H 4WW1A 3TT3L 5JOPE 3FTGA 1FDLL 1LE5A 4LNVA 5ADPH 4LLQB 4MMZC 4Z78B 1ED3B 3W11D 3DUSB 3ZDZE 3VFWB 4WTWA 1FAIL 2CIKA 4LSUH 5J57B 4D2NA 1Y18B 3G04B 1U3HC 4HPYH 2Z93A 4NO5B 1DQJA 4P9HH 3VJ6A 4P0DA 4MJIB 4GAFB 4HWUA 2V5SA 4QXTA 4B7LA 4P9MH 4PP1D 2Z8RA 5ITBH 3JV6B 2W38A 1DN0B 3DX7A 1AHWC 4GRWE 3UYOD 3O9WA 4Y5YB 1KN4L 3UCRA 5IESH 3ROOB 3IAGC 1FGNH 1K5NA 2CK2A 3EOBB 1MCFA 3EDFA 3MRRA 3WXVH 1RJLB 3X11B 1QLRB 4C4KO 4P5TA 1RZGA 4LSTL 5H2BA 4D0BA 4Z7QE 3WJLC 2ESVE 1DJSA 1LE5B 3KJ6H 3VXSE 1I8IA 1U6AH 3CFCH 3BISA 4XP9H 5F8RC 1ZHNA 5J9PA 3SDAB 2HT4C 2YA1A 2PW2A 1JNHA 1PFCA 5I6XC 1EZVX 1BQLH 2CIKB 3V0WH 5J11C 1J1PL 3HZKB 1UM6L 3S5LA 1J8HD 3PJSB 2Z93B 1MEXL 1DQJB 3CXDL 5DXWA 1OW0C 5B21A 5GS1A 2Q87A 4NQEA 3DX7B 3RL1A 4HPOL 3O9WB 3EYSL 5HYEA 1K5NB 1F6FB 1U9KA 4JKKA 2MSPA 4MNHA 3MRRB 1SEBA 1S7SA 4FQCL 5D2NE 4JQXA 4Y19E 4O2FB 2FHCA 5D7SL 5H2BB 4D0BB 4HC1A 1W0WA 1I8IB 1ODAA 2ZG1A 2AQ2A 4S2SA 1A9BA 1PSKH 1ZHNB 5FM4A 2X05A 4PJFA 2NZ9D 3ARDD 2PW2B 1XH3A 1JNHB 4KUZH 2LTQB 4IHOB 5DLML 4HIHA 4JREB 4U1MA 1UENA 3RAJL 5IEKB 1ZMYA 1NBVH 3UXFA 4GG6A 4YFDB 3T0EE 3S88H 4JO4H 3MOAH 3QUXB 1WFOA 5FDWA 4CKVX 4GRWH 5AAWA 4PJ8C 3RY4A 3NABH 5ENWB 3CFKB 4CVUA 3QA3B 2YPVL 4YHKL 4F9PA 1SY6H 4MNHB 1NEZG 1SEBB 5CJQL 1BD2A 4JPVH 1UWEH 3C5ZB 5EC2B 4RFOL 2AK1L 4TUJB 4HUVB 2DIAA 1ZKAA 3JTSA 1HQRA 1W0WB 4RDQF 3GGWA 3RY6A 5KJRL 1A9BB 3TA3A 4PJFB 1CICC 1XH3B 4XCFH 5AWNL 3RX8A 4WVRA 3EO0B 4G8IB 4U1MB 5D96B 2HKHL 2PO6A 1MRCL 1NBQA 4PRPE 2DQIH 5GRJH 3JBG7 2Q8BH 3NTCL 3J8F7 1G0YR 5A3ID 4GG6B 5BO1H 3O6MH 1IGFH 5IB4A 2IGFL 2DI7A 1DR9A 5F7EH 4C56D 3L7EA 1U93A 5EG6C 2WSKA 1SMAA 2EH8H 1X4ZA 4JO2L 5JXAL 2OK0L 1H3UA 5HD8C 1FH5L 4OCXL 4RMTA 5J56B 1I3GH 2ICWJ 1FVEA 2X4OA 4E41B 1OTTD 4H1LH 5CZXD 5CP7A 5KVDH 2R15A 4GRLD 1BD2B 1KCSL 1NUFA 4DVRH 2LE9A 4XMPH 4OTXH 3JTSB 2NY5H 1HQRB 4QY8B 1MLBA 3P11H 3GGWB 1PYWB 4P46C 2P5EA 2NPLX 4PV8B 2EDNA 3CSBA 4EKXA 4XNYL 1NBYA 1GGIL 4L3EE 5BV7C 3UEZA 5JW3H 2PO6B 4FFVC 1KPUB 3O6FA 3MSPA 1LO3L 3UX9B 3TBVA 4U1IB 5DD3L 2XKUA 2ZOKA 4M3KB 2O93L 1T20B 1JVKA 1WWBX 2A9MH 5KVFL 1AY1H 1ERNA 1Z3GL 2JK5A 3B9KB 2UUDK 2EKSA 1U93B 5EUOA 3OXRA 5BVJB 4QRPA 4YXHH 5EBGA 5JXED 3RZCD 1S5HA 4MHHG 2X4OB 3CX2A 3HNTL 5EU7C 4GG8A 2IALB 1Q9LA 1FNFA 3SDCA 2H1PH 1V3JA 2HG5B 5FYJD 4W6YB 2UVFA 1AR1D 4OLVH 1FN4A 3HPLA 3QWRD 3PHSA 3RIAK 2P5EB 3IXAA 5AEAA 4UDUB 3CJJA 3EGSA 1DBJL 1DBAH 1SEQL 5DMGC 4G6FD 1A6TA 2AJVL 3KYKH 1TVDA 3HI5H 3O6FB 4KJYA 4N0YL 5I0DA 2H2SD 1JWMA 4KMQA 3LPFA 5FYJL 3PP3K 1IM9D 2DWEB 3HMWL 4M6OH 4U6XA 4F37K 2FRGP 2I5YL 2JK5B 1I8LC 2JCCA 2WANA 4BZ1L 2EKSB 4EDWH 5EUOB 5IP4A 4R2GC 3ARVA 4QRPB 3ZKXC 1EEYA 5IMOB 1XFPA 1FE8H 5EFIA 4GG8B 5DMIL 1YY9C 1KJ2L 5KAQG 5DHYB 2GTWB 2NZIA 4EXPX 1EO5A 4G42B 5ICYA 1JN6A 4MAUL 1N6QL 3HPLB 5DJ8A 1AO7E 1ZA3A 4DOHE 4E5XA 1V3MA 4AL8L 3LN4A 4PG9B 5HVWA 4Z7WE 5HTSA 2DM3A 1MRFL 3T77A 1WT5A 3EGSB 5FYKU 2A73B 5E9DA 4YZFE 3H7BA 3S3SA 3RVUC 4HMCA 4OZGA 5JIKA 1JWMB 1SM3L 5SWQA 1EK3A 4H0GA 5JHDE 4WFHD 3U4BH 2BDNH 4WFEE 1NFKA 3X14A 3BWUC 5M95B 4H88L 2EEDA 5IVXE 2WLZA 5EFIB 2ID5A 1Q8MA 4PBWD 2H3NA 4PJBA 1GGUA 3GMPA 5J06A 4I77L 4WI3A 3G6DH 2ADGA 4Q9RH 5CINH 1J87A 5FO7A 3TO4D 4TSBL 3WKNA 1J0IA 1JN6B 4WWKC 5I1GH 3QPQC 2LAGB 5DJ8B 1ZA3B 2BNQD 1XMWA 5TPWH 2JJSC 1OY3B 4IS6A 2F9BT 3MRLA 3U0WH 3T77B 1U8OB 1GSMA 4I13B 5DR5L 3TBTA 2WINA 3H7BB 3WDHA 2IADA 4Y16A 4OZGB 3RNQB 2X9WA 2B1HL 4LU5H 1ACYH 1L7TH 2DQEL 4PJGB 2A6JB 2IBBA 3EHBD 4Y2DC 1JI1A 3Q6GH 4WNQA 3A0OA 2R56L 3N50A 3BDYH 2R1XA 3W81A 2FH8A 2LABA 5FOJA 3ZHKA 3WNOA 3D2UD 1TZHA 2H3NB 2Z8WC 4PJBB 5FK9B 3GMPB 8FABB 2ADGB 1MFBH 5FO7B 3M1BA 1EHLL 4PJXA 1A6UL 4M9OA 3DXAA 4V1DD 2YEZB 3WD5H 4UU9A 4TSAL 3S4SB 5C08B 5F7NC 1G9ML 4IS6B 3VE0A 5DUPH 4AEHH 1AD9A 1QR4A 3GSRB 3B3IA 5I9QC 1TETL 4YX2H 1YYML 2WINB 4OGAD 2V2WA 4KV5F 5HPMA 5CGYC 2IADB 1M7DA 1T0PB 4MAYC 2FGWH 3GBLA 3PGFL 4RFEB 4ODBD 3NBNA 4PJCB 4PLJD 4RWYH 3FN3A 5C0ND 2DM7A 3QYCA 4LPUA 4MXVF 4UNUA 5MERA 4G6ML 2NY3D 4MD0B 3S35L 3GSNL 1CE6A 1HKLH 2VTFA 5SX4I 3QIUA 1QVOA 4RIRA 3WL9A 4PJAF 1Q9WA 4GQPH 3M1BB 1JV5A 4ISVA 1EEUA 5I15L 4O9HL 3LZFL 5KOVC 4XP1H 4TRPL 3RWIA 1A7OH 2BVUA 1U92A 3IFOB 3B3IB 3ARGC 1UWGL 4GKZA 2RFXB 3WBDA 3GSWA 4JR9H 3QHFH 2V2WB 1CLYL 2R8SH 1M7DB 1OAKL 5CGMA 5IT2H 1NLBH 5GSRA 1IBGH 5MI0C 3O11B 4WEUD 1GHFH 5IQ9A 2DYPD 3QQ4A 3H3BC 2AP2A 1JYNA 5MERB 1JGEA 3SKNA 2UUDH 3L5WA 3VFOA 3SE8L 3NA4A 1S7WA 4H8WH 3QIUB 1QVOB 3ARSA 4QGTA 4RIRB 4ZDHA 3WL9B 1Q9WB 4PV9A 1JPTH 3Q1SL 3FCTA 1FYHB 4R7DB 4UDTA 4YBQD 4TTDD 5GGVH 5C3TA 1LE9A 1HILA 4TOYL 1JV5B 2YN3A 4ISVB 4LDEB 3FFDA 1PJ9A 3D39D 1WV7T 4OD1L 4G9FE 3RWIB 2Y5EA 1G0DA 4J4PA 5I66A 3LMJL 1JYWA 1KFAH 4OZFA 1OAQL 5E94B 4X83A 4IDJL 2VIRB 5F1NA 1NMCB 2UZIL 2HVJA 3DYMA 3ZYIA 3H9YA 3PL6D 5IQ9B 2XY1A 2Y07H 3G6JA 3PP3H 5LJYH 3RTQD 2DJ4A 4JEGB 3CFBA 3SKNB 4AIZA 5JHLL 1JMXA 3VFOB 5JNYA 3MV9D 1G0XA 2ZCKH 3VRJA 1S7WB 5E8EA 4NFDA 1QSEB 3NA9H 2Q8AH 3MODL 1KJVA 1IAIM 2J6EH 1FNSH 4PJEE 3P9WB 4PV9B 3SO5A 3P4NA 3GMMB 4UDTB 4XPAL 1I3RA 2OM5A 3FFDB 5FYLD 1L0XA 2FHBA 1U8KA 2YPKB 1KTRL 4MSWA 4XMLH 4QHLA 5I66B 7FABL 1PG7L 1ZWIA 3A6CH 4Y4FC 3X13B 2OR8A 2MPAL 4LBEB 1R3LA 5F1NB 3TZVA 1WZLA 4FFYL 4APQC 4NKOA 3SDXF 3G6JB 5DEGB 2NY2B 2Z92B 5F7DA 3CFBB 1LP9F 1CG9B 2VLKD 2NTSP 3VRJB 2FR4B 3LKNA 4JB9H 1MWAA 3BKJL 3HC0A 1KJVB 1MCSA 4L4VA 1Q0YL 4S1RL 5D1ZD 5F71A 4Q9QL 3VDBA 2H6PB 4OGXL 5HHQB 1YEHL 1BZ7A 3INUH 3FT2B 3OKOB 1LEGB 4PTUB 4MSWB 4QHLB 3C60D 3K2MC 1KCVH 2ZPKH 2IQ9H 3QFJE 3QAZB 5FAAA 1LEIA 3RVWD 1I1AD 3D3VA 2E7LA 3QXVA 2Z31A 1R3LB 5D9SB 3IJHB 2WM0A 4C59B 7CGTA 3CDFA 4NN5C 4JN1H 3MRHA 2ILLA 5CMAB 3O41A 4MNQD 4Q2ZA 5B39A 2V5TA 1DBKH 3KYMB 3S37H 4HS6B 2D9QB 4M02A 3PABB 3HC4L 1MWAB 2Y5TA 5GRWA 3PV7A 4ZFFA 2EE3A 3IB4A 4R4ND 3O4LA 1T66C 4L4VB 4L5FH 5E8DH 4MA8H 1YPZA 4R4FH 2HT2C 3MBED 4YQXL 1LO2L 4OFKA 3LD8C 3WUWG 1CXLA 4FXGA 2YPLA 2NXYD 1BZ7B 4L3AA 1C5BH 4N8VA 4WI7A 2JB5H 2F54A 3PXHA 3MUGA 5HY9A 2H41A 3DV4A 3O3BA 2F53A 4FQJL 3DGCR 1E4XL 1RURL 3T3ME 5GGQH 2OCFD 3RRQA 2CKBL 2WBKA 2D7PA 3OKYA 4CJ0A 1VFOA 5JZ7C 5GGUA 1AFVL 3BVNB 4P2RD 1RUML 3MRHB 4OAWA 5IFAH 5GRUL 3MOQA 4Q2ZB 3KWWA 4IRZL 4LHJB 2GITA 3P4MA 4NZTH 4HFUL 3SY0A 2CKNA 2R2HB 2YK1H 1OAYL 2EXWC 1SMOA 4NRXA 2C3VB 1OVZA 1K8DB 3L1OH 4XVJH 2WQRA 2YZ1A 4I8DA 3HUJA 4X5LA 5DJAA 1CVRA 4QRRD 4KZEL 2KBGA 4PG2C 4FXGB 2YPLB 1NGPL 1S7VA 1YEFH 5F21B 4ODTL 1W72B 1HXYA 1MLCA 2F54B 1BX2B 3VXMA 3MUGB 1GOGA 5HY9B 4Z0BH 2V9QA 5IVNA 3O3BB 2F53B 3C2SA 1F4HA 1TTGA 3IFLH 3V6ZA 4ZFGH 1YEDA 4LPCA 4NC1C 2BVYA 1A3RL 2IH1B 4NUGL 3H42L 3OKLA 3L6FA 1UEYA 1JPGB 3RDTA 3NIDE 3EOTH 4OAWB 3QQ3A 2UZXB 3KWWB 4JQIL 5C09D 2GITB 2EECA 2NLJA 5DFTA 4J6RH 4WO4B 2HMID 3N1GC 3QDMD 2B4CH 1WIUA 3I2CH 4XP5L 4MCZA 1TIUA 3FN0H 5DJAB 4L8SC 1VERA 3PQYB 3WIHH 2EKJA 1FFQA 4UILL 5BJTB 4RAUA 5H35A 1MRDL 1MLCB 4NO3A 3VXMB 3SE9L 4LGSB 4X6DA 4PBVC 3DSNA 5J8OA 1YEDB 3T65A 1F6LL 4HS8H 4KPHH 4X4YA 1H5BB 1JNJA 4TNWK 1UKTA 2AK4A 5FECB 1AXSB 2I26N 3OKLB 1HINL 3GHBH 4KK9D 1A14H 4QXGL 4G8GA 4ZFZA 4CDGC 1X6NA 2FX8L 5C70A 3FONA 5TQ2H 1JI2A 2NLJB 4F80A 3Q0HA 4XNZB 2DMBA 2OX5A 5GHWH 3WFEL 5C8JA 1MVUA 4OD3H 4NQEE 4PRIA 5FHAL 4NFCA 4WFFD 3RFZC 4XH2A 2HJFB 1T04A 3MUZ1 3D9AL 3T1FB 1PD6A 5KZCD 1KCRL 4XTRC 3TJEH 4RAUB 4UT7H 1I7UA 3T2OA 5DRNA 4NO3B 3LN9A 5EH1A 3BIAX 5LG1A 1HZHH 3T65B 1QRKA 4PJFE 3PDDA 3MV8A 2UV3A 2P8LA 5KSBA 2CMRH 1INEH 4ZFZB 3QZWA 4EEEA 4XPHH 5JO5B 3UJTL 3IJSB 1UZ6F 5E2TL 3FONB 2WP3T 4LASH 3UTSD 2F5AH 1MVUB 4XVUD 5DUBA 3MZGB 4FRWA 4YDIL 1F13A 4MD4B 4KVCL 5DDHA 1T04B 2BHUA 4LFHG 4DGIL 2Z91A 4YWGL 4NIKB 1BD2E 8CGTA 1KG0A 5FA4A 2VWEC 1P4IH 2WQ8A 4UUJA 1C5DB 4X6CF 5F9OL 5DRNB 1YEEL 4PJ8D 4YC2B 4OCMC 4IMLA 4I9WD 1IGML 4GKNA 2GK2A 3G9AB 3FRUA 3MTRA 3ARBA 3EO9L 1FVDA 4HUXA 3MGTA 3JWDC 3TBWA 3LB6D 1CGYA 3AMLA 5L8KB 2P8LB 3OMZA 4YAQB 5ESAB 3V0VB 5KSBB 2H32A 3QZWB 3BP7A 2XA8H 3MRGA 4DZBA 4OIBA 5I1EH 1KULA 2VLME 5DK3A 1G9EA 2VLLA 1KSRA 2APBA 3K1KC 1FZJA 4XT1C 1IT9H 4PRNA 2C7UA 3NGBC 4JQVC 4U1GC 1KPVB 2C4FT 3HE6B 3FQNA 3O3DA 3MLYH 1G7QB 4WUUD 4AIXA 5DDHB 5F7WC 1A7QL 1GC1H 4GBXC 4U1NB 4M43H 3OB8A 5HJ3B 2EDHA 4OT1L 1KG0B 4Y4HD 1VA9A 3TCLB 4UUJB 4H0HB 1B4JL 4HC1H 1TZIB 5IGXH 4IMLB 4GKNB 1K4DB 4J1UB 1P4BL 3BKML 5E5RB 2P5EE 3FRUB 1L0YA 3ARBB 4MJ5B 4G7VL 3BWAB 4JKLA 3MRBA 4HUXB 4JO1L 4ORZC 4LCUA 4EQ2A 3JUYA 1A2YB 4QKXB 5FYKE 2CR3A 1GJIA 3VI4E 2EDBA 1MIEH 1QZ1A 2VLLB 3QDGB 1YQVL 2IG2L 3NPZB 1I4FB 3IAQA 3VFVB 5EUOE 5IK3A 4EI5A 4QRPE 5IB1B 3EDJA 4HUWB 5DK0B 2XQYG 3ZDYF 5L0QB 1CGSH 3O3DB 3LEVL 1R6VA 4OCNC 2OI9B 1I9EA 2ZUSA 4X4MA 1K3IA 3GSVB 2X7LB 3KPSD 1OGAA 5T3XL 2FIRT 4P2OC 5BVPL 4OF5A 2GFBB 2GUOB 1P6FA 1YJDC 4OM0H 4XB7A 4H1LG 3QUMA 5C0JB 5BV7L 1F8TL 5K9OA 1MCBA 3ARYA 3HMXA 1F6AB 4Y8AA 1EH9A 2CJUH 4JRYD 3FL7A 3FQXB 2B39A 1R3KB 5CEXA 2AV7B 1N59A 2HAZA 2ZNXA 5GISL 2JCCE 4PRHB 5IK3B 4EI5B 1X5KA 4AENA 3BOVA 3UTTD 2NY1C 4EN3D 1F3DH 1RFDH 3MQIA 4PJHF 2HFEA 4DFHA 2ZP0T 5D1QA 3KPQB 4PJ7F 3BMWA 3GI8H 3MXVL 5C0FA 5HDOA 5T1DL 2EC9T 4Q97A 4MA7L 2BVOA 4HULB 3BJ91 2PYED 1OARL 4FTVD 1BAFL 2FD6L 3B2UC 1NANI 1VFAA 4FQ1L 1KF9B 4XCEA 5FYKH 1T2QH 2BNRD 5E9DE 1AQKL 2CXGA 3LKOA 1OAXH 3TT1H 2DJUA 3CPLB 4OZGE 1D9KC 4JO3H 5ALBL 1OPGH 3F58L 1SJEB 3BHBA 1PGRB 1FL6A 1EHXA 4AENB 4OLYH 3RVUD 4MA1C 3MA9L 3KPRD 4YXLL 4CW1A 2CR6A 1NBZB 4PJBE 3LAFA 2EH7L 3RGVA 5FGCB 5JQHC 1JWSA 2ATKA 1REIA 3X12A 5IHUH 4P23A 4Y1AD 3V4UH 5C0CA 1T5XB 3S34H 1NC2D 1VGEH 4UB0H 1GCFA 5I1CL 3UC0L 4XMKH 1VFAB 2AJYH 5DJ6A 3VD7A 3V52H 1QBML 5FM8A 3GHEH 2DWDB 3LKOB 4WWKD 1RZ8A 3QPQD 3RA7H 3UTZA 4QCIA 4M62H 2MJWA 1MJJB 2AERT 5IOPA 2WZPD 3VGHA 2BERA 3JVGC 2WIMA 4LQFH 1CWVA 3TP4A 5CSBA 3NOIA 1JGUH 3OAYK 5DT1H 3WEXA 4WEBH 5JMRA 2V17L 3IDYC 4ODSL 3BPCA 1JWSB 4LKCB 3HR5A 1QKZH 4U0QB 2ATKB 4Y2DD 4NNPL 4XVSH 4LARL 1N8ZA 3X12B 4P23B 4PJXE 3KPNA 5KN5A 3DXAE 3RWHA 3EYFA 5D8JL 3ULUE 1KEGL 3I3EA 3AREB 3CVHL 1C12A 1C5CL 3D0VB 5FKPB 4Z77B 2NW2A 3U2SA 3LHPL 3S36L 1E0OB 4HBCH 3DPBA 3DHJA 1HNFA 2VZOA 3CK0L 5C6PB 3EDKA 3HRZA 4UV4L 1LO4L 1CZ8L 5HVGB 1QOKA 3L9RA 2VDKL 3CU7A 1HDMA 4YUEL 3OL2A 2VDQH 5I0ZA 3WEXB 1H15B 5T1MA 5C0BD 2VSDA 1D5XA 2FZ3A 4I48B 3S35X 5HXMA 3BPCB 3H8NA 1J1OL 1OSZA 2ADIA 1L6ZA 1IARB 1S7RA 3HR5B 3S6CA 3BKCH 3RU8H 3UYRL 1TCRA 5KN5B 3DUHA 4PB0H 3MO1A 3RWHB 5HHME 3NCYP 3PE9A 5KVMC 4K3HA 4BKLB 1UKQA 3ZL4H 3GJFH 4P3CL 3PWPA 1V7NL 4NQDB 3Q5OA 4IIQB 3QUYA 3VFPB 1KJ3H 1GGCL 4M4RA 1T22B 4D9RE 1D5MB 5I1KL 5I1AA 2RJMA 3SE3A 3L9RB 3MACH 4MDIA 1MAMH 2D03H 2D7MA 3S96A 5J13B 3V6FA 4WY7L 4RMUA 4HBQA 1I8MB 1PZUB 2WWMC 5T1MB 2ADIB 1S7RB 3FMGH 4KQ4L 2YN5A 2A77H 2R2BB 5D71L 4GXVH 3FAXA 4DGYH 1ZT4A 5FO9B 5F7UA 3UO1L 3ULUH 4XWOC 5ELIA 3OPZH 2JE8A 1B0GA 3BSZL 4MWFA 2WBJD 3SKOA 3BPNB 3KXFD 5JPNB 1MSPA 4X7EC 2APVA 2NY7L 3PWPB 1INDH 3RWDA 3WV0A 2DLIA 4R26L 1NEUA 4XNQA 3U6RA 4IRJD 2B5IB 4QGYA 5I1AB 2GT9B 1KB9K 2CD0A 1CQYA 5TDNA 4S0TD 3MCLL 4G7YH 5SWSD 1J0HA 4QXUL 4FA8A 5BW7A 2EDTA 4K2UH 5JORA 5L88H 4RA0C 5J6GA 5LXGH 1E4KC 4ZAKC 5HGHB 1ZT4B 3STBA 1A9EA 3V6BR 4HK3N 1WEJL 4OCSL 5INDB 1B0GB 3NH7H 3SDYL 3SKOB 1MQKL 4YGVB 3P0VH 4NQVA 1N0LA 2R9HC 3WS3A 2G9HA 1A7PH 1KIUA 3QFDA 4EOWH 1PG7X 4KKCC 2VDRH 3P9LB 4XNQB 3ZKQD 3VXRD 2NNAA 4G6KL 3U6RB 1VPOL 4OGYH 1QHPA 5FUOL 2J88H 3WFBL 1NCUA 1L7IL 1WBZB 5TDNB 4KMTH 5CKGA 3GJEB 1TQBC 1F4YH 5JORB 3B9DA 1C16B 2ZKHH 4XXCA 5CBEA 1AQDA 5J6GB 1NLDH 2DLFH 3PP4H 4L4VE 2ZUQC 4HUUB 3BE1H 4K7PY 1PDKA 4W81A 1J8HA 1A9EB 2G75A 4ZXBD 2X1XR 1JNNH 3W9DA 3Q6FA 3L95A 2J1KA 4KTDH 3HC3L 4OZFH 5ADOL 1EBPA 4W4OC 2D31A 1CS6A 2MCG1 3EOYG 3VFGL 3RWJA 3D3VE 4JFPB 1FFPA 1PKQA 2G9HB 4O58H 4WCYL 1TJIL 2QADC 4UMGA 2DQGH 2ZJSH 3BAEH 1I3UA 5E2WH 3MYJA 4DEPB 2DM2A 2IAMD 2YC1A 4K8RC 4KRNA 4M6AA 4PP2A 3WHE0 1MH5A 2DKSA 3VW3L 1CDGA 2VKWA 3DYPA 3T0DA 3ARDA 5K9JL 5E8OA 2HLAA 1AQDB 4U3CA 3BPLC 5DD6B 3O4LE 3NIGE 4ZTOH 3KPOA 1RJYA 1YPZE 43C9A 1U8HB 2D4FA 1FYTB 2ARWA 2QQQA 3MLVL 2YPLE 5F44A 1F90H 2G75B 3W9DB 5HHXH 2A6KB 3L95B 2OLDA 3QXDB 1QPXA 5C0IA 3JV4A 2F53E 3A6BH 2D31B 4JKWA 1M7IA 1T66D 1K9TA 4JFFB 4X6BB 1JFQL 5D1XB 1PKQB 1XCTB 1JF1A 3CH1B 4Y4KD 3D1MC 3QUKA 4BH8A 4PY8I 5C0AD 3R0MA 4PP2B 1EVTC 2HH0L 2BY3A 1MH5B 4HK0A 4YLQT 3WXWH 1MWAH 3IU3A 5D7KD 1NKRA 2EEBA 5T1LB 4WTZA 4JM2D 5JZ7D 2KH2B 2HLAB 1E6JH 4LSQL 2X89D 2X41A 3MRDA 1NCWL 1RJYB 3HUJE 2E8YA 4ZD3L 43C9B 2VQUA 4MX7A 1QNZH 1HEZA 1K4CA 4HWEH 3MLXH 4ERSH 1BFVL 1NDMB 2D0GA 3JV4B 5C0IB 4C56A 1BHGA 2VZTA 4AQ1B 5I71C 1M7IB 1OP5K 5J12B 3KLSA 2ADJA 2AQ1A 1T7YA 4I3SL 1A6WL 1P5UA 3PDOA 3BIBX 4M1CD 4GRLA 3P73B 3WFDL 3H0TA 3QUKB 4L9LC 5F7MC 5IFHH 4XPGL 1F4WH 1RMFL 2A38A 1BBDH 3CU1A 3KGRA 4M93B 4RGMC 2O5YL 4IOFC 5DVKA 1S9WB 4U6VL 3OF6D 2OZ4A 1DFBH 1PW3A 3SJVE 2X1QA 1KB5H 1MI5D 5GS2H 4OKVA 5BRZD 3V5DA 2YZ8A 2GJ6B 3FT4B 2YUVA 4K3DH 2Q7YB 2XICA 3MRDB 1BJ8A 3VWJD 2VABA 4MX7B 2BSSB 3O0RL 4RGNB 1HEZB 3AGVA 1TNNA 1S8DA 1BQUA 2R1WB 4C56B 4X6DE 4ZOCA 4BZYA 5JXEA 3RZCA 3QUZC 3W0WB 2AK4E 4DW2L 4GRLB 2AI0H 4G8GE 1JTPA 1Z5LB 1B3JA 2JF1A 1MELA 5CJXA 5KS9A 3MUY1 4MB3A 1DBBH 4ONFL 3MGOA 4OFDA 4YHOL 2OJEA 3QWRA 4OZIB 3BPOC 1MREL 4NNXA 1RIVL 4PRIE 4OKVB 4KJQC 2I25N 3OWEA 5J1SC 2LU4A 4JFHD 3WHE1 1K8IB 4MCYA 3CMGA 2VABB 3B6SA 4WFGD 1HI6B 1DZBA 1ZLUK 2NX5D 4YHIA 2VYRE 1IM9A 2F58H 1S8DB 2DQUH 4XNMA 3U7AA 1IAIL 1H9VA 4U6HA 5GZOC 2OTUA 1RULH 3RZCB 4QXWA 4YHLH 1GOHA 1ZGLA 1VADA 3MV8E 2QLVB 3EJZC 4KROB 2RHEA 2G5BA 4RISH 5KS9B 3MROA 4G9DB 2GJZA 2K1MA 1LP9A 5LBSL 2OJEB 4R90L 3RL2A 5I1IL 5DF0A 4NNXB 1IGYA 4KRPB 1OM3H 5E95B 1MF2L 4BA8A 3OAUH 4M7ZC 4WTXA 3QNYA 2DQJL 4YR6A 1KJ2B 3QIBC 1PKOA 1N3NA 1U8JA 1FJ1B 3CDYA 1J5OL 3BO8B 4C57C 1KELL 2PCPA 1BQHG 2OR9H 4PJ5D 2PKDA 4M7KL 3L3DA 1IM9B 2JIXB 4XNMB 1JYXA 4CN4A 3HN3A 5D2NC 1MJ7H 3KR3L 4TYUA 4U6HB 3LS5L 4YDLB 5DFWH 4GKSA 5EZIL 2OTUB 3ROLA 1INQA 4FABL 5DHXB 3F7PC 5TE7H 4KKAC 1VADB 4JE4B 4ZS7L 1BJMA 4HSQA 2NY5C 2OL3L 3HLAA 1OAZL 3HI6H 1BFOA 2V2XB 5ESVA 1QA9A 2G5BB 1U8PA 3SCMC 3MROB 2IPKA 2GJZB 3TO4A 3B2VL 1DVFB 2MOVA 3OJ2C 4BSVB 4P4KC 2BNQA 3SDDB 4UT9H 1KC5H 5JUEH 4U2YA 4LSPL 4AT6A 4UAOB 3QNYB 1ETZA 1U95A 3N0PB 4NWTL 4YR6B 5DD0L 1YQ2A 3FB5B 3T0EC 3TVMB 5J6HA 1MCLA 1KCKA 1N3NB 2OP4H 3JWOC 4OZHF 4XPTH 3SE4A 1FIEA 3TV3H 1AKJB 5K9QI 1IGIL 5D5MF 1UADC 3SGEH 1UQSB 5MEQA 3L3DB 2Q3AA 2FECL 3VFSA 4GOSA 2CLZB 3TFKD 3MLZH 5ETUA 1U2CA 4GKSB 5L7XL 3O6KL 4KZDH 3BP5A 3PWJA 5IROA 2N4IA 3D2UA 4Z7UF 5EOCH 1BFOB 2W07A 2XN9B 4NJAH 5ESVB 4OF0A 1QA9B 2VN4A 5DD5H 3IS1X 2FL5B 3U48A 3VFTA 3VG9B 1FPTL 2AJ3A 2IPKB 5BZWA 1ZLSH 2ICCA 3TO4B 1CVSC 1K2DA 3PXJA 4V1DA 4F8QA 5HDQH 5BOPA 4XBGA 1N26A 3MNVA 4IEFB 4M6NL 3NZ8A 5D6CA 2PTVA 2VDPL 1T6VN 12E8H 1MFDH 4YFEA 2H8PA 4I4WB 1CU4L 1PY9A 3M07A 3S5LG 4M7JH 2X9YA 4X4ME 3DGGB 5EWIL 1SVCP 1PLGL 1OGAE 1FORL 5MEQB 3C09B 4XRCB 2Z8SA 1CFNA 5CP3A 2DQHH 1ITCA 3VFSB 3DLQR 4LLMA 1EA9C 1N4XH 4JM4H 1OP5H 4GLRH 3BP5B 5E2VH 5E8PA 1ZA6A 2FO4B 2H32H 4PGDA 4JM2F 3FO2A 1OTSC 5EZOL 1F5WA 3VFTB 3EYQC 4NC2B 2AJ3B 3MCG1 3RVVC 5JW5A 5KSAC 4K23H 4V1DB 4P59L 2FSEA 4XBGB 3GSNB 3AY4A 3R4DA 1RZKH 3AMKA 5D6CB 3NZ8B 5I8OH 1X5LA 4GT7A 5DO2C 3T1WA 2VUOA 5KBNC 3VXUB 2HVKA 5F72S 2H8PB 5H37H 4YNYB 2QHRH 5FOBA 1L0QA 4ZO9A 3REVA 3BGFC 1DTUA 4JFDB 3DBXB 4ELKA 3NFPA 3UTPD 2BSED 4TPRL 4JFZH 2DYPA 5L9DL 2A9NL 4MJID 2FYYA 4LLMB 2BSTB 1YJDL 2XWTA 2NY1D 2VH5L 3HZYA 5L6YH 1HSBA 5E99H 1QEWA 3L3HB 1BEYH 1ZA6B 1RZFL 4PJDF 2YA0A 4X6EB 4PGDB 3FO2B 5K33A 3CLEL 3MOBL 3BRGC 1G6RA 2G60H 4FQXC 4XVTL 3GRWL 4ONOA 5JW5B 3D39A 4HZAA 1TDQA 2FSEB 3MX0A 5IW6B 2XZQL 5EUKA 5AYUL 5KVEL 1XGUB 1D6EB 3SDAD 4JFEB 3K2UH 3GMOA 1A6PA 4F37F 4MVBC 1MCNA 1MFAL 3OJMB 2DDQH 2VR5A 5FOBB 1E4XI 2BVQA 4NKIL 3REVB 1XEDA 1U8NA 3OB0H 4ELKB 4F3FA 3NFPB 1ZLUH 3PL6A 5C0CE 4HIXH 5I8KH 3RTQA 2XWTB 5E70A 4JHAH 3QUMH 4RFNC 4G80A 4FQIH 3HZYB 3MV9A 43CAA 3O2WL 2GAZA 3O9WD 1HSBB 1MPAL 5IIEA 1QEWB 1UC6A 4DKEH 4YO0A 5HI3D 2E27L 3BEVA 4HX1A 5DWUL 2XTJD 4CMHC 3SOBL 3VD3A 3ZKMC 2BOBA 4DTGL 4GAYB 2C1OB 1I1FA 5CFHA 4NDMB 1G9NH 3D39B 2CUMA 4WW2C 3E2HC 1JZ6A 3UJJL 4QNPF 5EUKB 2EDJA 1U3JA 2VLRB 4KGLA 1Y0LB 5JOFA 1AI1L 4BQBA 1V7MH 3GMOB 3HI1A 3IDIA 4V2CB 3GI9L 4XAKD 3C8KB 2BVPB 1EEZA 3IDUA 2R2EA 4TVSa 2BVQB 2CLVB 4X6CA 5DJ2A 1HIMH 2ICWA 5TFSH 1D3CA 4CU7A 2P7TB 4HD9A 4HKBB 1WTGT 2XI9A 3G5YB 3VG0L 3QDHA 3BX7C 3QUXD 4LSVL 3RTQB 2Z9TA 2Q3ZA 4G80B 2VLKA 3MV9B 43CAB 1HYSC 5FUCE 3BEVB 3IXTB 3UDWC 1A02N 4HX1B 5HVHC 5IMKB 5DJDB 3C5ZD 3MBXL 3HS0A 5D1ZA 3H3PH 4LF3B 1UYWL 2LVEA 4CDHA 3FQUB 3BMVA 4DUXA 2VXTH 1I1FB 4MS8C 3S36X 2VO5A 4OM1L 3UBXA 1ORSB 4OQTL 3ZTNH 4P48A 4HH9A 3HE7B 1WFNA 3IDIB 3OAZK 4XNUL 1I1AA 4HV8A 1FHGA 3MFGB 3MJ7A 1EEZB 1I7ZB 2R2EB 4X6CB 4KAQL 5DJ2B 1RQ5A 5LGJA 1YECL 1YY8A 4BH7A 4UT6L 3RNKA 1YEJL 3CFEA 4MNQA 4H8WC 2RGSA 4NGHL 1A1MA 2YRZA 1AGCA 4PJ9C 1V5JA 2VJXA 5GGSB 4OJFL 4E41D 2ADFH 2RBLA 1F97A 3DO7A 4LVNB 1JNLH 3PWPE 4PLNC 4Y5XA 5AD0A 5D1ZB 2IBZY 5CD5D 3MBEA 1A6VL 5DJXB 4JZJC 1I9RH 5GGVY 3E3QE 5B8CA 3DX9A 4ZQKB 5D72H 4W68A 4RZCA 1CFQA 4HH9B 1TQCB 2BCKA 2FEEI 3C6SA 4YBLB 5HGDA 1I1AB 3ARUA 1RVFH 1T5WA 5KW9H 1EHNA 1GZPB 5E6YA 1QLEL 4P2RA 1YY8B 2B20A 4BH7B 2ENYA 5LGHL 4MNQB 3WN5C 3B9KD 2Z0BA 2EDLA 1F00I 1A1MB 1WBXB 2R4RL 4O5LL 4Q6IC 1R3HB 2AV1A 4ETQA 4HCRL 1BIHA 5TGBB 1MCOH 5DJ0B 4HQQH 2CKBB 3RPKA 2O5ZL 2AJXL 5AD0B 2GHWB 5ITFA 4MXQC 2NY0B 3MBEB 3IDXL 4QRRA 2DL9A 3DVNB 3JZ7A 4JFYA 2NXYB 4Q0XL 2DB8A 2D7TL 3C2AH 2IEPA 4JFXA 1CFQB 4XCCH 4PJHA 3C6SB 3LH2H 3FFCD 2HKFL 1UB5B 3AUVA 4PJ7A 1T5WB 2NXZC 3O2VH 3TNMA 3OG6B 3M8OH 4O02H 4LLYA 1CF8H 1MCCA 5MHSD 5C09A 3FO9B 3WCYA 4JFQA 1EEQA 4AMKL 1RU9H 4HLZH 1RY7B 4ETQB 3DSFH 1OSPH 3QDMA 3LKSB 1FNEA 4RMQA 4K55A 4CVZA 3CC5B 2O61A 3ABZA 4HDIA 4X4XA 2W0FA 5ITFB 4AZ8A 4OLXL 2AXHA 3KJ4B 3U0PA 1NGYA 5SWZD 2EDFA 3LQAL 4JFYB 2DQTH 3HB3D 3FAWA 4F9LA 1AHWA 2CQVA 2YHGA 1VHPA 3O4OB 2W1NA 2R0KH 1DQQA 4QHMA 4MQXD 4HS3A 1N7ML 3U1SH 4KKCD 4PJ7B 3E8UH 2FBJH 3TNMB 4OF7A 1SJVA 3STZB 1J88A 3WLBB 2MKLC 3N1FC 1FDLH 4DZ8A 2DOCA 4GH7B 3N06B 4R8WL 1J8HE 4JFQB 4FQLL 1MVFA 4Z76A 4X98B 2QSTA 4RAVA 3FQRA 3UZQA 4CVZB 1FAIH 4JPWL 2O61B 4X4XB 2W0FB 1PKQE 1JE6A 1HHHA 1T83C 2FO1A 3MLTA 1YEGL 1U3HB 4NWUH 3U0PB 1NGYB 3TYGH 5CWSB 1UH3A 1OP3K 4JG1L 1AHWB 1RIHH 2X5PA 4QHMB 5IMMA 4K7PL 1JHLL 3WE6A 4HS3B 3MLRH 4LCCC 3CFJA 1EUTA 1Y6KR 3CXHJ 4G8FA 4C54A 4I0PC 1IC5L 4WI5A 4DZ8B 1EAJA 3ET9F 3FN9A 4ZYKB 4N0CC 5DQDH 4N1EA 5E7FA 3MRIA 3ARWA 1YC7A 3GMLA 2GY7B 4K7FA 3UTSA 4OSUH 4KRMB 4RAVB 5I6XB 4KV5E 3T08A 3VFMB 1UM4L 4NN7C 1S9KC 5T3ZE 5J11B 1UM6H 4GSDL 4PYGA 4N90D 2LU3A 3QR2A 3QPXH 4ZOAA 1QPPA 4MXVE 5DMYA 4OZFG 5C08D 1MNUH 3PGDA 4PJ8A 3NFSL 3RQ3A 3H2WA 4BUHA 1R5IA 2WW8A 3WE6B 1CE1L 1T21A 3OQ3B 4TQEH 5CIPB 4PJAE 4N9OB 4NOBA 1XIWD 2WWKO 2YXFA 3IVKA 3T0VA 5D7SH 5E1AA 3B5TA 2FATH 1CXHA 3QJFB 2B4CC 3MRIB 5E6ZA 1NAML 5IG7B 3UTSB 1I9IH 3WFCL 5DLMH 5F3HA 4WUUA 3TLRA 2AVGA 1P84K 4Y4HA 5ADPL 4LNRB 1OD7A 4DCQA 3SPVA 4QHNA 1J10A 4PJ8B 4GG6F 3J7HA 4ZS6C 3GNML 4ORGB 2YPVH 4NQXA 4YHKH 1NC4B 1M71B 1JZ8A 1YEIH 1JK8B 5DRXA 2OTWA 5CJQH 5HVFB 3L3IB 4RFOH 4HPYL 5HYJA 1UB6A 1T03H 1PX4A 2H9GA 2IFGA 4BFIB 4NHCL 4P9ML 3TH3T 5ITBL 1YN6A 2Y25A 5KJRH 4FP8H 2E9IA 2IWGA 1CICB 1YC8A 1W0YT 4ODUA 1BLNA 5D7IA 2C4XA 3WXVL 5IHLB 2G2RB 2HKHH 5T3ZH 1MRCH 3L3GA 3NTCH 4QF1B 4QRSB 4FQPA 1CD1A 5A40E 5GS0D 1J11A 1S78C 3I50H 3KJ6L 3KPSA 3W2DL 3CFCL 4XP9L 5HI5C 5EN2A 3BH8B 4JO2H 3SPVB 4QHNB 4QYOB 2DQCH 3LS4H 4U31A 1XF5A 4BK4A 4NO0B 4IOIB 3S8WA 3DARA 1CDBA 1BQLL 2JB6A 3V0WL 1JPFA 1IGJB 2OTWB 5DRXB 1KCSH 3JXAA 1K85A 5HYJB 2DL2A 1UB6B 1WGOA 5B39G 2H9GB 3EFDH 5C6TH 4JRYA 2DTSA 3LKPB 5CHNB 1KGCD 2HWZH 4P46B 4HIIA 3VXOA 1H3TA 4EVNA 4MNGA 2WUCH 1OWWA 4LSDA 5BV7B 1BLNB 1VESA 5D7IB 1QSED 1CLZH 5EU3B 5GRYA 1I1RA 1KLFA 4P5TC 1CR9H 3UTTA 4EN3A 3SKJH 1CD1B 1KBGL 4N8VG 4MB5A 4TNWF 3KPSB 3SDXE 4GMTL 1G7HA 1PSKL 5EN2B 2OXGA 1LP9E 4FZEL 4KUZL 3AS2A 2PYEA 4WV1C 1NUDA 2OZ4H 3HNTH 1QRNE 3FB8B 4XCNA 1JGLL 3BN9D 2WIIA 5DHVA 1NBVL 2HFFA 2BNRA 4JO4L 3MOAL 1ADQL 4EZMA 5GS1C 2R2CA 1A1OB 4POUB 4R4BA 2W92A 3NABL 5CAYB 2NY2D 3VXOB 4EVNB 4MNGB 1NCAL 1S7UA 3IFPB 1SEQH 1T1WA 1SY6L 3G5VB 1GC1C 1B90A 1HCVA 4WI9A 3V5KA 4OFIA 4GFTB 4LEOA 5IVOA 4JQXC 5FIEA 4C58B 3KPRA 5C71A 3LPWA 3QCVH 4BK5A 4FMKA 2FBOJ 1B6UA 1G7HB 4HXAH 1MJ8H 3JV5A 3ZKXB 4XCFL 1OP3H 4Y1AA 2ARJA 2BNQE 4XP4H 1NC2A 2Y7QA 5D96C 5GRJL 1JWUB 2XKNB 2IQAB 2Q8BL 3BIKA 1XGRA 5DHVB 2HFFB 3KPPA 5ID1A 5BO1L 3SCMD 3LRGA 2BOCB 3O6ML 4MAUH 1N6QH 4WWKA 4LP5A 4AIOA 5F7EL 4AL8H 4OLEA 3JTTB 4HEME 1I3GL 2DD8H 5E1HB 5JIHA 2E9BA 3CVHA 3T2PA 5ANMB 1MRFH 1MCIA 4F9PC 5JIIA 5KVDL 5IFJB 2CDFA 3QO1B 1NJ9A 3V5KB 3P2TA 4XP6H 1QFOA 4DVRL 5EU4A 3ZYZA 2OXHA 2QSCL 3LRHA 4ZO6A 5D7LB 4JDVA 3BGMA 4HFWB 3P11L 3RY6C 4Y2DA 3U36A 4QRUB 3TA3C 5EZJB 1WCBA 1TJGL 3OXSA 4V1DE 4Y1AB 4XCYA 1BOGB 4PJGF 4PB9H 4X7FC 1NC2B 4I3RH 5JLZB 4I5BB 3IF1A 3OKKA 1NCNA 4I77H 5EPMB 4OD2A 1MCWW 5ID1B 2A9ML 3JWOL 3V5HA 3FQTA 1AY1L 4WWKB 2ERJB 5CZVH 4YXHL 4PRPD 3CVHB 6FABH 2F74A 3C9NA 4JAMA 4M8QB 1PQZB 2CDFB 5EU4B 1LDSA 3BGMB 5C0BA 2DQEH 4Y2DB 2VXUL 1EMTL 3SO3C 2GEEA 1WCBB 4XXDA 1IEAA 1DBAL 4PRAA 3QI9C 5GRZA 4PJCF 1I8KA 1X5IA 4XHJD 3KYKL 3HI5L 3IF1B 3DNKA 3QZWG 1DE4B 1YNLL 4OD2B 5CD3A 1IZKA 3EYQD 1EHLH 2I9LB 3QEHB 4UINL 4EDWL 32C2A 2CO7B 1CIDA 2B2XH 5I9QB 1H8NA 4R7NB 2F74B 1W72L 3C9NB 1FE8L 4JAMB 4YJZL 4WO4D 4DGVH 4A2MA 5A16B 3SDCC 4NYLA 1YYMH 4YBHA 4POZC 4BQ8A 3IU4L 2Y