3LZNA

Crystal structure analysis of the apo p19 protein from campylobacter jejuni at 1.59 a at ph 9
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
b'GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lznA00
3PJNA 3LZPA 5I0XA 2O6EA 3LZOA 5I0WA 5I0VA 5I0YA 2O6DA 2O6FA 3LZRA 3LZLA 3LZNA 3NRPA 3LZQA 3NRQA 2O6CA 3PJLA
chains in the Genus database with same CATH superfamily
5D96B 4O02A 1R6VA 4OD1H 5BRZA 1NQBA 3KLQA 3U4EA 5DO2C 2GTZA 1NMAH 4CW1A 1ROWA 1Q9KA 1M05A 1NFAA 3P30H 1JWUA 4QEGA 4C56B 3TNMB 4QLRA 5A6IA 1DQLL 4UQCA 1PZ2A 3H7BB 2R0KH 5LHDA 3FUMA 4RA3A 4UILL 3SOTA 2G9HA 2HG0A 1ZVSB 1T7ZA 5ILTL 3TBVA 5TJWK 1YMMA 4K3EL 1PL3A 4K7PL 4KRNA 4ODHL 1RZ7L 4S1RL 4X0KB 5HI5D 4S2SB 5JPNC 2AQ2A 4HUXB 5HGAB 3NGBB 4HDIB 3B7YA 3LN4B 2W65B 3GMPA 5DMGD 1FORL 5BV7H 2AXHA 1UWXK 1DQMH 2PETA 1KTDA 4JQXC 4MAYC 5C0CE 3IDXH 1CGXA 2Y0SA 3CSYB 1CT8A 1NUNB 4J39A 1AQDA 4OF6A 2IQAB 2CLVA 5T5FL 4Q52A 3OKLB 4YUEH 4B9FA 3LIZH 3DUUB 4ZW8A 2J8UE 3X1BA 5AZEH 1MXDA 1VKXA 5LG1A 3PNWB 4GKSA 2UZXB 2FECI 3SDAD 4HFWB 1JK9B 3UBGA 4AIOA 1HEZB 3FH8A 3K5RA 2VZ1A 3VWJA 3UGEA 5AKVA 5D4JA 5IEKA 5IB1A 3GQFA 4LLVA 3CFNA 1RK1B 5GSRB 3UJJH 4G71B 5KVFL 2R51A 4LARL 1PBYA 5FK9B 3FOMA 4XGZB 4DERA 4YHML 3S8FB 4LEOB 3EH3B 3W0WA 3U46B 1MRFH 4X4YB 2F54B 3RX5A 4JB9H 3QJSB 5IUSA 2ZX6A 4U6TA 3HLAA 3G5ZA 3QFJA 1JGEA 4JKKA 5A2BA 2DYSB 3BESR 2FIKA 1IGIH 4NM4L 2V5RA 3OKKB 1NBCA 3RTQA 5ICYA 3QRLA 4YSCA 2NY3D 3PP4H 1L3WA 1G9EA 3DSFL 1J1PL 1J1XL 1G7IB 1R1CA 3RTLA 5B38A 1ORSA 2O5ZH 3QO1A 3UH8A 2EVJA 2H45A 3MNDA 2CKBB 4E5XB 4HQQL 4Z23A 2C9UA 5DRXA 4PGDA 2DL9A 4N5EC 2VN5A 3BEVA 5IBTH 1L9TA 4N3UA 1D5ZB 2WAHA 3HLKA 5D70L 2WNXA 4V11A 2VLRA 3AXLA 5T1MB 4MTMA 4DESA 2A9MH 3ATFA 1EUTA 3BUTA 3QQ9C 4QNPF 5A16B 4D9LL 3QFGA 3PAYA 1BPLB 1GZHA 2AJSL 4RAVB 1S3KL 1MJJA 3DX9B 2ZOWA 1KTKE 1F11A 4Q8BA 3A21A 2WKOF 5EBLB 5BS0D 3DETD 3MNWB 3LZLA 5GGQH 4C47A 5IQ9B 5T33L 1JCKA 3IDUA 1NMBL 3OLIA 3QWRA 4Y5YB 2DLGA 1DUZB 2Y2TA 4P2RB 3K72B 1PKQB 3TJEH 3NFSL 4GO8A 5CKAA 4DN3H 4QTHA 2DTMH 5ELIA 1DJHA 3BWSA 4OIIH 4PMFA 2COVD 5FO9B 3IDYC 2HFGH 2Z65C 1AHWB 3BW9A 1XZWA 2MCPH 1KFGA 5HHVL 3RNQB 2AJUH 3HZVA 2LLGA 3JQOB 4MXVF 5FYKH 1FNAA 3IS0X 2EACA 1CDCA 4KROB 3H3KA 4PD4J 4Q89A 3MJ7A 4WIQA 1O5PA 4JZOB 4FQ2H 2V5MA 2VDKH 3BUPA 4L4VD 4PJBB 2X70A 4BQ8A 4IU3A 4ZS6C 2MFNA 5IHUH 4J28A 3DX8A 3DJ9A 5DZLA 4U0RB 4IBWA 2HYMA 4AZUA 1BQHG 5F3BA 3MVSA 4N2GA 1NCBH 2JIXB 2F1EA 2X87A 3FO0L 1J0HA 4D9QD 4J12A 3HA0A 5DK2A 2A6JB 3R06A 2F7IA 3FHQA 1R17A 1TCRA 35C8H 1MREL 4HCRL 4IRJA 5F1NB 5J56B 4OJDH 3TEYA 2VW7A 1Q1JL 5E00B 4RDQG 4NRXB 2GG1A 4XBMA 1U8QA 7FABH 5E9DE 4X98B 1L5GA 5C2BL 4YDVA 2VT0A 2C1PB 5HDLA 2UY6A 3EJPA 4PJ7E 3OLEA 1JFQH 4P2OA 4R2GD 4WI5A 4K3DL 3FT3B 1IO4C 1SY6H 2XOTA 5LCVL 2D9CA 1MLBA 1RIHH 1T83C 4PWHA 5LN8A 1AFVH 4AK2A 4AW7A 1IC7L 1ET7A 4XN1A 4Q6YA 1VFBA 2EDLA 1GY1A 2UZIL 4GW4A 2ARWA 2F9BT 2C8NA 2FX7H 2Y6SD 1CICC 2FJGA 1AHKA 4J3OC 4BFEA 1FCCA 1VZIA 5D1ZA 3UEZA 5ACLA 1A3ZA 5DRNA 1V3JA 1HNGA 3P3SA 2ITEA 3Q3GA 1SDAB 1UUNA 3DMMC 1IBZA 1S78D 2NXZD 2Z8SA 1TTRA 4M7LH 4DQOH 5C0FB 4X5PA 4A37A 4MB5A 2VAAA 3P2TA 2KLTA 2XWCA 1TTGA 2Y23A 2DQGL 2C1OB 3F62A 2FR4B 2PWHA 4HK3N 4NCC1 5CS7A 4AYID 3W5NA 4K71C 5CU9A 4XCCH 1H8NA 2PCPA 1ILSA 3AGVA 4YDIL 4FNTA 2O6FA 2AJZB 3TN0A 4Z7UB 3SDDD 3ILEA 3MRNA 2WTPA 5DQJB 4M56A 3VFVA 3CUPA 1CL7H 2NOYA 2HLAA 3FRUA 5L9DL 1EZSA 2IH3B 2CO6A 4UZSA 5KAQG 3RGVA 3THML 1ET5A 2OMBA 1D7CA 3TBSB 1Z1WA 1TO5A 3QJUB 3M6DA 1YPZB 5CBEA 4MWFB 2NY2B 5DGQA 1BMWA 3LRHA 5TQ0L 4Z7VA 1J8HE 1J48A 2BNUA 3OMAB 3D3VA 4HKZA 4WGVB 3V4VA 1FCGA 3B9VA 3MLSL 3GIVA 3CXDH 4PRIB 5CLWA 5AW7B 3KPOB 1F00I 4I48B 3HAEG 1NDGA 1X5HA 3HC0B 4MAUH 4GXVL 3FCSB 5E8NB 1E8XA 4MJIE 1GXEA 1A7OL 4CN1A 5IJVA 1MFNA 2N1KA 1P5UB 3UZVB 4TS6A 4J3OH 1GAFL 2HLEB 5E2TL 1I7RA 4IBYA 1JJUA 1MFMA 3SGJC 4LSRH 4OQTL 4TL5A 4HIHA 3UTZA 1N8ZB 2I85A 4XNDA 4DP0X 3C8HA 4NI3A 1RAMA 3SBWA 1CD9B 4F20A 2YPLA 3VFGL 4K3JH 4L8CA 3OX8B 1KB9K 2C9AA 5C0CD 4UQ2B 3ECWA 5LGJA 4LSSL 4FFVD 1XCXA 4Y4HD 2EEDA 1BM7A 3VYOA 5IJKC 4PJHA 2APTA 2BWDA 2ADGA 3WN5A 1FNSL 1QSFB 4HKXA 1T0OA 5F7WC 5TDNA 2L7QA 3IRPX 2F7OA 2HJKA 3ZHLA 4YSSA 4YE4L 1NIDA 2XG5B 3LKRA 1OO2A 3QO0B 4FYRA 4K4KA 3QEGH 5FW6A 3WG7B 5HPMA 1A7NH 5E4OA 4ZTEA 4BFIB 5J89A 1DVFB 4XBGB 3FQUB 3O6KL 4XXDA 2XWJA 3FUJA 1AZNA 4M1CD 3O81A 5GHWL 4XN2A 2HTKD 3P77A 4L3EA 5EWIL 3ECVA 4IIQA 4S0HA 4O02L 1DQQB 1EJFA 1URZA 2F7QA 2ZKXA 4ORZC 4GAYA 5CHNB 3T3MB 2DRUA 1OTTC 1BZ9B 2CXGA 4KJQD 4IOIB 1IL1B 1Q9OA 1UFUA 3KXFA 4G6MH 3AREB 4U05A 3PJNA 1HWGB 1F6AA 3VB9A 2Y5TB 1IAOA 4XBPB 1U91A 4Y4FD 3RIFK 3UTQA 4K15A 5T1LB 3IGFA 2NZ1A 2YC1A 1U58B 4QTIH 4AK1A 1RY7B 3ZDXB 4YHKL 1QLEB 1KLGA 4AJVA 2W07B 2DQJL 4DO6A 3TA4D 1NJ9B 2XZAH 3G6JB 4ZPVB 2ZQKA 4ZO9A 2QADD 1F4WH 5B8CC 4KKCD 4F7MB 1MIMH 1EAQA 1NAMB 3ETBF 1MHEB 2ATKA 1MVUA 3MUZ1 5I74C 5T1KD 4LDLB 4KO9A 1QEXA 3W38A 1H0DA 1W72H 4OD2A 3EYVA 3VXPA 3F7LA 2PYEE 2YLHA 5BNXD 1ZXQA 5I0YA 1QKZH 4N3TA 5I1JL 2WMPA 4H25A 1BVKB 3L5JA 5FUCE 2PWEA 2CUIA 1GYCA 2BINA 4O4YH 2YBGA 5GISH 3DTDA 3ULAB 1N68A 4PJ8A 1OVZA 4P9MH 5IROC 3IMTA 2B2XH 5CFHA 2VWEC 2CKNA 2HT3D 1V7ML 2XX1A 4JG1L 3PPEA 4M5ZL 4X6BB 4X6FA 2X2IA 4XOCA 1MF2H 4Z95H 2VDOB 3DRTA 2R7EA 5C70A 5FECB 2UWEF 1I1CA 2WYZA 3JWDL 3MRQB 1I31A 1P9MA 3CVIL 4ZFFB 1HJBC 2FT7A 2WWMC 3RWCB 4OZ4A 3BE1H 4QRQB 1HZLA 4ZNCD 3VFUA 1S7UA 2K0RA 1N5AB 5JXED 1DCEA 3NIGF 5FGCE 4PJIB 3TM6A 3HC3H 3KDMA 4ONFH 1U3NA 2OPCA 1A6ZA 3CFBB 3S37H 1LO3H 2YD8A 2Y1YA 4O58L 3TA3D 5CD3A 2DIBA 4PD4K 3VW3H 1F2QA 3NSXA 1LD9A 3H3PL 2OZ4H 4FFWD 4GQRA 1KPRA 4MJJA 3WTYA 2BVOB 3GJEB 4OGQC 4UQAA 2JLLA 4A2MA 1NLDH 3IDJA 4ZTOL 1NPUA 4ZFZA 2JJTC 4CVZB 2ZWNA 4JZJA 2ICWB 2F5AH 1MWAH 4U31A 3D5OF 1MFEH 3EFDH 3D39A 4TLSA 5KSAA 2CJUH 1HVXA 3KGTA 3WBDA 3QRBA 3WUWA 4F37F 3RUGE 4U1MB 5HYSB 3VFSB 5DZAA 3AB0B 4FERA 4JQIH 4QT5B 2E47A 4KBPA 1ZLSL 4LEXH 2QVMA 3Q48A 4HJUA 4OKVB 1AO7E 1MRCL 1JERA 2H3XC 3GIZL 2Y5EA 2XI9A 3SKNB 3MO1B 4KQ3H 1XCQA 4DN4L 1OF2B 4NKOB 3S4SA 5CJBA 4DGUA 1Z3RA 1MQKH 3FFCB 1S7WA 2G9KA 3WNLA 5JW4N 3BZEB 3KLAA 3NJGA 4RGNC 2Y06L 4KK9D 1MCHA 4AMXA 1GS7A 4NN5B 5G55A 4AENB 3BKML 1RJCA 3BT2L 1CD1B 3SB3A 3BFOA 2RA1A 2AJ3B 2DWSA 5E6SB 3UJTL 1HHKA 2CPCA 4KKBC 4WO4C 4B27A 2A74A 3K2MC 4MD5A 5DTFB 5L4JA 1RJZB 2OP4L 1CGUA 3OAZK 3VWKA 3L3DA 1CL7I 2FE0A 1AXTH 3NK4A 2DQUH 4JDVA 3A0OA 3HG1E 4PWEA 2IGFH 2EUVA 5CILH 4Z7IA 2EC9U 3MBXL 1H5BA 3CZNA 2XV3A 4GW1A 5GJTL 1BX2A 1KY6A 5D2LA 3IGAA 4XO3A 3U6RB 4M4RA 3EDFA 2DQEH 1FFNA 4I9WE 2C3GA 4ZPTB 4ZDHB 3EBGA 5I1DA 1IFRA 1BZEA 1EEUA 3B5GA 3H42L 5AB0A 5GRWA 2AAAA 1HCYA 3PAUA 4I18C 1KIQA 4PJFE 3KWTA 4BH7B 5I5RA 1Z9SB 1LNUB 2QGCA 4PWIA 4OH2A 5CMAA 1TKWB 2J1YA 3TXAA 4J3OF 4UNUA 3ABGA 3PV6A 4FABL 2V8MA 1T1YB 1JZ5A 5DHYA 3HCVB 4TULL 4IGBB 4PY8I 5DRWA 2IPKA 1F2XK 5AB2A 1HQRB 3M88A 1E5BA 1J8HD 3ESUF 3QXVA 5JW5B 4DW2L 2HVJB 3SDAA 3V0FA 5JA9A 2RMNA 2VN3A 1DE4A 1DQLH 4JPQA 2X4NA 1R3JB 5BOPA 2IALB 2D73A 3MJWA 3UPAA 3UX9B 4MJID 1JHTA 4UILH 4AYSA 3PWVB 2AV7A 1TMCB 3ZKMD 4K3EH 4ODHH 2K4AA 4C57C 4NRZA 3ZT6A 1KXQE 1ND0A 1FJ1B 1RZ7H 4S1RH 5JOFA 1RZFL 4IBLT 2X53A 2KQNA 5DDHB 3D9AL 4PSPA 2NY6C 3RWEA 3Q2CA 1J88A 3EO0A 4GUCA 3S5YA 1ZT1B 4FXGC 3IRZA 5CP3H 3FBQA 4W9ZA 2WWOA 3SE3A 1D5MB 1SF3A 2O4EA 1FORH 1Z0NA 1DBML 1B0RB 1HILA 2EXWD 5L88L 4XPGL 4P3DB 2GPZA 2UUDK 1JGLL 1B2YA 2AP2A 1IQDA 4YVNA 3SGKA 2OMYB 2BZ7A 2X6CA 1NPNA 2J3SA 4HK0B 5BJTB 1KJVB 2Z8RA 4I2XA 4KJPC 5EZIH 2PR4L 2ZPKL 2ZOKA 4LP5A 5T5FH 3ILQC 1EUUA 3QDJB 2XNAB 2SEBA 3CXHJ 4MMYA 5C0ND 2XV0A 2GK0A 5CIPB 2RJMA 4ELMF 5IF0B 1HHJB 3ZRCC 3WTUA 3B2DC 2DMHA 2NPLX 1U8MB 5IW6A 1A47A 3KEDA 1NC2D 3WMSA 4YL4A 3BZ5A 3FXIC 1TPXB 5E70A 4DKFL 3VRJA 3JZ7A 4B9ZA 3UMNA 2AXGB 5GRXG 1QHPA 3BVWA 5KVFH 4AEEA 4LARH 3R8QA 3AY4A 3NMEA 4D3CL 5HYIA 3TFKD 4NIYE 4YHMH 4Z0XB 1XGTA 1MCWW 4F9LA 3ML9A 3V4VL 3CFDB 3QUYA 3CX5K 3SY6A 5BS0A 1I9RL 4RMVA 1BDYA 1AHMA 3KH4A 1H19A 4JK0D 3B2XA 1E5CA 2V17L 4BWUA 3RA7L 2MCAA 1BOGB 4BFKA 3NP3A 4NM4H 2BY3A 1BYOA 2WLZA 1UKQA 3DSFH 3FTGA 1XR9A 5IG7B 3WMQA 1J1XH 1J1PH 4PRNA 1RP8A 1VEMA 4XODA 4DEPC 5HHPA 1UZ8A 2YIHA 4JDZB 3NG5A 3LJ3A 4JHWL 2P8PB 1Q9WB 2FO4A 1BD2E 1QQDA 3ZDZB 3AQXA 3JT0A 4MDJB 4HQQH 3IPBA 1YN6B 3MYZA 3VCLB 2B1AL 3V0EA 4JDEA 1M2OA 1U93B 2PTTA 4A55A 1ORQA 4U3SB 4KXDA 4WI9A 5D70H 4PCKA 5C0BB 4EIGB 3U6XS 5FYLE 4L0YA 4D9LH 2ZX7A 1K5NA 3NCYS 2JELL 3W9EA 1OM3L 3O45A 1UXWA 4AQ8C 2AJSH 2KERA 1T3FB 3IMBA 4FNQA 1S3KH 4BH8B 1ID5I 4NO0B 4RAUB 2X2JA 4W4NA 3OXSB 2BZCA 1REIA 4U4BA 3QQNA 4JFUA 3PP3K 5T33H 3TZVC 5INDB 2GJ6B 1NMBH 2GJZB 3F6LA 1JDDA 5TF1L 32C2B 1E2VA 1CS6A 3NFSH 4TRPL 4NI6A 1DVUA 3SJVB 2H1LM 1R5WB 4XNMA 1GOGA 1QFUL 2CBOA 2Z4QA 3LN5B 4I89A 3DRQA 2A9DA 3KLLA 1I8IA 1G0XA 5TQ2L 2YD1A 4ABQA 2D3NA 4GNKB 5HHVH 1SLXA 3N42B 3H3BC 3FFDB 3MBEB 2YAHA 4FFZA 1T20B 2VAJA 2VB5A 1F8TL 3GT6A 1NDTA 5IGXL 3S98A 1NCOA 3WDIA 2C26A 2Z93B 3S96B 4XHJD 1K72A 2IDQA 4EDWL 1ZHBA 5I0XA 4O2CA 3AITA 3VSQA 4FXLA 2AXFB 4LLQA 4P5MA 2VLKB 1JPFA 2P48B 1KCRL 2QFPA 1F4XL 1NAKL 3L5XL 3FO0H 2GBVA 1MFBL 2XN1A 3QXAA 3VSVA 2ZSVB 4P4KA 4ZFOA 1WLHA 5JNYA 2XG4B 2M2DA 1DQKA 4JPSA 1NANH 2V3FA 1AO7D 5EBWA 2MTAA 3KHOA 5CP7A 3HRZB 1CQYA 5KSVB 1YN7B 3SDDA 1KN2L 4ZUVB 4P5RA 4NQCE 4UQEA 4X8CA 5C2BH 4YBQD 4CGUB 4DUVA 1F42A 1MZYA 4XX1E 4R7NA 2JLPA 2GTWB 4LVOB 3UAJC 4HMCA 4PI0A 1K9TA 2YN5A 3I2CL 3N44F 2BSSA 3S35X 5LCVH 2V5SA 1CTOA 4UQ9A 3MREA 2YUWA 1SHXA 1IC7H 3B2VL 4H40A 5JO5A 2UZIH 2ADIB 1NOAA 3LRMA 2NY4C 3GUTA 1K85A 1G7LA 4UIMA 3HG1D 5I9QB 2YGNA 2GEEA 4LCIL 4OGAD 4NQXA 4PWKA 1T1WA 4KV5E 3K2UL 1GSMA 1A2YA 4NNYB 5F3FA 3JV4A 4ZUTB 1U8PB 5FPIA 5CINH 1JV2B 3HNSH 5I1KL 4BM7A 2P42B 1I85A 2DQGH 2AABH 5ID0A 2H1PL 5DZVA 4EN3D 1C12A 3V7MA 4HS6B 1KZQA 4L4TE 3PJLA 4NEHB 3S5LG 4LLUB 3T4AA 2E0PA 1D5XB 4YDIH 3KGUA 5KVDE 2UYLB 2RFXB 3CZEA 1BAFL 3B2UD 1S9XB 5EZLB 5C0CA 2GAZA 3MV8A 3U2SA 5C9KA 3D25B 2EKSA 2H32A 4Y4HA 1P4LA 3W39A 3BPOC 5L9DH 4FQCL 4OI8A 3L3IB 3I6LE 5AL8A 3THMH 1JXJA 1CPUA 3F2LA 2AITA 3DX6B 2NR6C 1QRNA 2VXSL 2QDWA 1KBVA 3IU3B 2HFFA 4APXB 4D0BB 2VJ0A 1NBYA 3EYFA 4JRXE 2J8UA 2RH0A 3OAUL 2GTQA 3EZ8A 3QCTH 3L4TA 5E1AA 3IJYA 1TYRA 1BIIA 3MLSH 3FU3A 4WEBL 4YSQA 4X5WB 2G3NA 1HTYA 4E9RA 4GXVH 4Q14A 2CCWA 4OIBA 4L48A 3V6OE 2BVPA 3DX7A 1A7OH 3MRKB 4QHMA 2VITA 4LE8A 2IOMA 2QSVA 4TVUA 3IXAB 4D9RE 3MRGB 1OE2A 2Z92A 3MSPA 1GAFH 3TYGL 5E2TH 3ZTNL 1WIOA 5KZCB 1WWWX 1LE5A 4OQTH 2ERJB 2P44B 3L3GA 5FYJL 3VGEA 5FA3B 3RAJL 3L6FB 4PJAB 2ARJB 5EUKA 4KKQA 4GP5B 3MRMB 1SRDA 1P84J 2W91A 3JZYA 2PXYD 4JFQB 1U8CB 5JDSB 5F7DA 1G9NL 2EDXA 3VFGH 1FNGA 3BVNA 5CZRA 1HS6A 3WJLA 4WAFA 3UYOD 4K9EL 2EE9A 5BV7B 4LSSH 3Q5TA 3SO3B 12E8L 2G3XA 3KM1A 4RVBA 1FNSH 3HZKB 5IREA 4FI6A 1IAIL 3D4CA 4JPWL 1D5BB 1G87A 4MQXC 3L1GA 3QEQE 4NHCL 3BWZA 5IMKB 3FUFA 1L3NA 1U3HB 1HN1A 5ANME 4OBSA 5KTEL 4N1EA 1JF1B 1BLNB 3FAWA 4R5VA 5KYXB 4OZFG 3JWDC 4PUBL 1NEZA 1WAPA 1NH6A 2AVGA 2EEAA 5EWIH 1ZSDA 2ZP0T 4JFDE 4OCLC 4O02H 4R84A 3ZUNC 1MIEL 3TH3T 4KZDH 3SD5A 2AZUA 3BMWA 4TUJA 3M7FB 1NFKA 3HR6A 1IB5A 3HJ0A 2AMUA 2FQEA 3BJLA 4YC2C 3V7AG 4YSAA 4X5XB 2DLIA 4YHKH 2KQMA 4GUPB 3ZQXA 5IY5B 2VDLL 1TQBC 2DQJH 4ZMOA 2A73A 3SE9L 1AGDA 3BPNC 5GRYA 2G3ZA 1WIPA 5DI8B 1MH5B 1JXFA 3UTSB 2LABA 5JPNB 4QJ4B 3ZDYB 3MYJA 1M1SA 2EDNA 3WDHA 2YARA 3LIUA 4APQD 1MCKA 1ZGLM 5I1JH 3RZCA 3C75A 3DECA 4MAYB 3EIFA 3VFWB 1E30A 3IJEB 2UXGA 1T89A 1J12A 1JPSL 1V7MH 1YPZE 3MQIA 5FYLD 1CE1L 4M5ZH 1A7QL 1XX9C 4O2FA 3GZKA 4GG8A 3QH3A 1MUJA 1LWJA 1SEBB 1SYVA 3W57A 3DC0A 3PHQB 3F7YB 3BZ4B 3JWDH 3PUCA 4PJCF 2OMWA 4WI2A 3CVIH 3FCTA 4QDGA 5G4OA 4LOUC 3EDDA 4EZMA 1GZHC 4M02A 5E9DA 4G6AC 1BMZA 4MRBA 1CD8A 4PJ7A 1OD9A 3DPBA 1V3MA 1WAAE 2JFCA 2X6UA 4K2UL 4NO3A 3I9IA 3M46A 3I75B 4NERA 4JFHE 2QZQA 4YAQA 4O58H 5EIQA 1NANI 3P3RA 3NJLA 5E51A 2WTRB 3PWUB 1S7QB 2A7BA 3PDDA 2W80C 3ZY7A 4D0CB 3CQQA 4JFPB 4LCWA 1LHZA 3UBXA 2UWEB 3P2DA 2ED9A 2YJLA 5E2UL 3MJ8B 5C08B 3VXUB 4ZTOH 3AC0A 1JPST 2CDGB 4OGYL 3IMWA 2VDKB 3QNYB 4B9CA 4OJFL 5F3HB 4YPJA 2NXYC 3NIGB 1A6VL 3L2MA 4KVPA 4ODUA 1MCLA 4IS6B 4U7KA 3H9HA 3QJVB 2WQXA 4LIQL 1ZLSH 4LLDB 1MRCH 2BSEA 3GIZH 3PJSA 2VQTA 4DN4H 4IW4C 2A9NL 4NPYA 1MJ8L 4LVEA 4NQCD 1QTSA 2XXFA 3O0LA 2NW3A 9PCYA 4IRJC 1IAKB 3FPXA 1T2QL 4JFOA 3BKMH 4GI8A 4HUUA 3BT2H 3ZDXE 3ZE2F 2FWLB 1J8HA 1CFTB 2Z31C 4P2OC 2EIKB 4PGBB 4RRPG 3GF8A 3UJTH 4UAOC 4AT6A 5SX5K 2XXMB 3VYNA 1MSPA 2OP4H 5CJQH 4AQOA 1BF2A 5HD8C 2JCCB 3VQLA 3WJMB 3LVTA 1BECA 4PV8A 3H2QA 1YEJL 4GFXA 2E7CA 3D0VB 2MCG1 6FABL 2YZ1A 2WLHA 3HR5B 3MBXH 1JRHL 1E43A 3IDYB 3ZHDA 5GJTH 3DHJA 1ZGLB 3VD4A 3VGDA 3F7KA 1CWVA 5D1ZC 1J0ZA 1ZCRA 3KPRE 5J13C 2D7NA 5IVXE 4AEIL 3FHAA 3IF1B 3QZBA 3TCLA 4L4TD 1XAUA 4GP4B 1X5IA 3H42H 1XEUA 2HN7A 2OSWA 1JZ2A 1BA9A 3W56A 4X4XB 4NO2A 4XH2B 4Y89A 5LO7A 3NCJL 1PLGL 3HBQA 4ELKB 3BFWA 1I1AD 1CGTA 1G94A 2P45B 2LU7A 2OR7A 1XF3B 3GSXA 4BFFA 3FSAA 1FNHA 3UO8B 3MRFA 3OLDA 3IBOA 5FKAB 3RX9A 3TN0C 1YEHL 3I6LD 1WT5A 4NCC2 5K1NA 3FUNA 5EFIA 3Q0HA 4KI5C 1AD9A 4YFDB 4ZFOL 4TULH 3PCYA 4AGNA 4JGNA 5IJDC 4PG2A 4JRXD 1HC1A 3NCMA 5ANHA 2KKQA 3JTTB 1EEQA 1GIGL 3RVUC 2H0FA 5FUOL 1M71A 2EDKA 4F2MB 1DLFL 2PKDA 5MENB 1NC2A 4UUJA 5F96L 5B3JF 2QLYA 4AQZA 1A66A 3K46A 5DUBA 4GSXA 1U8JB 2Z91B 4HUWA 3KNBB 1UM6L 1UG9A 1A8ZA 4BSWA 3DKHA 2ZXBA 3MGTB 4HJ1A 5DJXB 5FYKU 5H35A 5J12C 4D9RD 5MERA 1WTGT 3MGOA 3VGFA 2EECA 1P84K 3BVVA 1RZFH 4ZFGH 5CEYA 1CICB 4KROD 2J20A 1F86A 2V7HA 2YPVA 3FCGA 1BMGA 3NEOA 5KANG 4R4BB 4HKBB 5FWRA 4E41B 4HAKA 4KK8C 3C5JA 5E6ZA 3EXJA 1TITA 1G4RA 1WZ1L 2ENQA 4X8JB 2PYFB 1A1MA 1ZLVH 4MCMA 1L0QA 1DBMH 2XYCA 3INUL 4ORGB 3DMMB 1WFTA 3NAAL 4XPGH 5E8OA 1RXLA 5L88H 5IJBC 1JGLH 3LZFH 4TF4A 1AKJD 4FTVE 3WNIA 1FGNL 3SBWC 1S5HA 1HHIA 4Y5VA 3S8GB 2PR4H 1RFDL 2ZPKH 4QCIB 3EGSA 4R0LA 3QG6A 1ZPLA 2PYEA 5E5RB 3F00A 4K71B 5G5DB 1I3RA 1WFNA 2CGRL 1WZKA 3IMVA 4M4PA 4KDVA 3UG5A 3FFCE 2XQYA 4K0OA 3QEQD 4XC1L 1E9QB 2WKGA 2G4GA 3DROA 3S36X 2D7OA 4AQAB 4EI0A 1F0LA 5DHEA 1KLFB 4MASA 1QX1A 2H3NB 1QO3B 1R47A 4EF3A 3CHRA 3KWWB 4DKFH 4JFDD 4X7FC 4MXWH 5LAXB 4G83A 5ICXB 3OPZL 2C9XA 5AD0A 3FSVA 1B6DA 4D3CH 4IIQC 2YFOA 5KG9A 1FN4A 3CMOL 3V4VH 4O5LL 3QZWB 5K33A 1I9RH 2V9QA 4GJTB 3NBNA 2E59A 4Z77A 4JM2D 1P5VA 4GSQA 4KUCD 1NCUA 3W82A 1UM5L 2V17H 1AIZA 3DTUB 4ELMB 1I7TA 1TSHA 4IJ3C 2KUTA 3P4OA 4PB9L 4FJ6A 3TVMD 1WWBX 1UJ3A 3QCVH 4FFTA 5GGSA 4LESA 3FRPA 3WTTA 1A4JA 2XXGA 2ITCA 2CZNA 3CFCH 2EE2A 3T0DA 3MOQA 3L7EB 4ENED 2J12B 5I71C 5D1QA 1W72B 5I6PA 1N2RA 1J10A 1N64L 2NUTB 4EZLA 3HPJA 2B1AH 3JYCA 2VCOA 5DZPA 3UJIL 1IGYA 4FQHB 4IBSA 1J0IA 4OUUA 5C8JA 2NY2D 3LNEA 4PJ8C 2EDYA 3RUGA 4JRFA 4XPTL 2VZUA 1FH5L 1RJYB 3D4GA 3DJSA 1AO7A 4F24A 5DF0A 4Z76B 4WI3A 2NX5E 4X99B 3T0BA 3TYFB 4I9XA 3TIEB 4S0TD 5FFOA 4ZMWA 2WOYA 4OJAA 1UYWH 4MVBC 4NM8L 1EANA 5KYYB 3GS0A 5TF1H 1P9MC 4GRWF 2W0KA 4TRPH 4WI7A 1U8NB 2OJEB 3T77B 4JFHD 1QFUH 5IIEA 3V8CA 2VSKB 4Y5XA 1JNJA 4BFBD 3CFKA 1UENA 1IBYA 3C09C 1BW8A 2HKAA 3F7VB 4YXKL 3DGGA 5FO7A 5F44A 1ERNA 3QDMB 1F8TH 5IOPA 4PS4H 1P7QA 2LQRA 4L3CA 4QHNA 3BWAB 5B8CB 5IGXH 1RHFA 5GS2H 1Q0EA 3SDYL 5CEZL 3HG1A 4XMLH 5H37G 1PIGA 1K4DA 1W0VB 2GC4C 2EIZB 5I74B 1BBJB 3QDJE 4KUZH 4QXGL 2J1XA 2Y22A 3EFOA 4LGPB 3PWJB 1GGYA 3CDZB 1KCRH 5HGHB 1F4XH 1MWAB 1AQKL 1NAKH 3L5XH 4UQ3B 4MB1A 2BC4B 4B9KC 4IU2A 4JZJC 4XVTL 4EN3A 2WP3O 4IOSD 2DWEA 4YGVA 3PIQA 1ZHKA 3LZPA 3QUXD 5JHAA 1A4KB 5KSAC 2VUYA 2E74C 1AI1L 5JTWA 4LT7A 4PJFA 3VDCA 1BFOA 5JHDE 1RZKL 4XNUH 3VXNA 5DC9B 5TE7H 5T5NF 1YZZA 3HI6H 1KF9B 2OYPA 4Q4IA 1H8OA 3E6HB 4PWJA 1O7SA 3VXQB 1YCSA 4ZXBD 4AGLA 2YGQA 1IZKA 3L3OB 3WL9A 3I2CH 5GGUA 1W15A 4BDVB 4ODXA 5T3ZE 4M1GH 3B2VH 4WFEE 4OZHF 5AKTA 2CRYA 1WPCA 4WI0B 3MNVB 4XCFH 4DF9A 4G1MB 3H9ZA 4PEEA 4B9JA 1EJOL 5F1SA 5AYTA 4ANKA 1QUNA 1KBGL 1SUJA 5HTSA 5LBSA 3CDCA 2A74C 5AVXB 3WKQA 1HI6B 4LCIH 2NZIA 4P4RA 3VWKC 3K2UH 1HL9A 1TTBA 4XRCB 1KXQA 3HG2A 4XP9H 4XX5A 3V9FA 4P2QE 1G9NC 1IBHA 3KPRD 4QAWA 1H5BC 3ZDZE 5I1KH 2BSDA 2BK8A 4K9EC 4KH9A 2H1PH 2ZD0A 4AE0A 3VFOB 3N44B 4ZQKA 5ERWA 2BS71 3SYCA 5F93C 5DRZA 4FRWA 1BBDL 4H26A 1SXCA 4ZTPL 1TOXA 1X7SA 1H15A 3DO7B 1BAFH 1ACXA 4KHTL 1JZFA 3C5SA 1I1FA 4KJYA 5DMGC 2J6WA 2V8LA 3ESPA 1W6LA 3RB7A 4DPRA 1CLOL 4FQCH 2QL1A 3E80A 5K93A 4L1HA 1A6PA 1CVSC 1QI3A 5ENWB 5CEXA 1WE5A 5I8EB 4XXCA 2VXSH 2NW2B 1FAIL 4B5ZA 2GJ6E 2DI9A 5D1ZI 3OAUH 3NPZB 6TAAA 3I6GA 5IKCB 1FBIL 4EUPA 2VDPL 4JG9A 4E42A 4WF7A 2OCFD 1ZLUK 2VISA 4JM4L 2YA0A 4RGNB 3IGLA 1HAWA 2GHZA 1II4E 4WEBH 3SEPA 1JSYA 3T6ZA 5FFLA 3SDAC 4K5LA 1ITCA 1C5BL 1RK0B 4OU3A 4N2BA 1IEBA 4JFYA 5GGVY 2AJXL 3TYGH 4WO4B 2C4FU 2EJ1A 3GSVA 2AV1B 3HS0A 1XIWA 3D69B 5FYJH 1AMYA 1M7XA 2FJSA 4FC3E 3RAJH 4PY7A 4KI5F 1DN0A 2CHXA 1CLYL 2XFXB 5FIEA 4ES9A 4E5XG 1G9NH 1T0NB 2YXFA 2D3JA 2CDEA 3DURA 2QVKA 4K9EH 5BUPA 3CSFA 1T21B 1ZT7B 4Z0BL 3SE3C 1XBRA 2R39A 12E8H 4F7EA 5HYQA 5HDQL 2R1YB 2NY3C 4NNXA 3DTXB 4F3FA 3SGKC 1CK0L 1CF8H 2OR9L 4APQA 1IAIH 4JPWH 2X4UA 2XN9B 3FFCD 1BD2A 1CMOA 2ZXEB 4NHCH 1GC1L 5D8JL 3ILPA 3BDBA 1MPAL 1YRKA 3HNTH 3ZQ9A 1LJMA 5KTEH 5JQIB 4GXUM 2A38A 4B60A 5J6HA 4PUBH 2NY0D 3M1BB 1AC0A 2HT4C 2NNXA 1CO1A 3MRHB 3SKOB 2CR6A 2AEWA 1CF1A 3D4YA 3CAFA 5HYJB 1S9WB 4MKMA 4ZUUB 1DJYA 5D7IF 3WO4C 4PVBA 3UACA 4O00A 5DS2A 4W81A 3D12B 3AY4C 4P48A 1M3JA 2YUZA 2LVCA 2VDLH 2X4QB 5E7FA 1XGPA 4Q74A 1NGYB 4F9LC 3SE9H 1Z5LA 3QUYC 4J3TA 3DETC 1ZA3B 3QQ4A 4PJ9A 1NIFA 1HH6B 3IXTB 4LPVA 4EI6B 3S2CA 2NY6B 3EH5B 3MJGX 4YHPA 3Q43A 2B3RA 4OZIF 4FXGB 1PSKL 2YPVL 3QXWA 1IFGA 4WI4A 4HVBA 1J8RA 2LU3A 1SN2A 3LS5L 3AWEA 4HWBA 5KEZA 2WBWB 1IGJB 4YXHL 2G2RA 3H53A 3R1GL 3MUUA 5LJYH 3PWNB 4R96B 2IH1B 5DS8B 1JPSH 2XJLA 2QELA 3G6AA 3NIDE 4IGBD 1WA0X 5GJSL 4Y16A 2HWZH 4HWZA 1EV2E 1A7QH 3FO1B 2ICWJ 3OKNA 1JZ3A 3V0WH 2X10A 2L7EA 3PWLA 3MLRL 1CLZL 1KGWA 3HZMA 3FN3A 4G8AC 1AOHA 3ULUE 3QA3A 4UNTA 3KZ8A 4CU7A 1XH1A 4CSPA 2NX5D 4GAGL 2NY7L 5HPOA 2YRZA 5LXVA 4NQCA 1VFAB 4N9GB 1CVRA 1GZPB 1A8JH 4LNRA 5EOCJ 1AGFB 2HVKB 1I9IL 4UT9A 1ZVYA 2X0UA 4AYBA 2B59B 3ZPDA 4X9IA 3BUQA 3PHOB 4PJAE 4HC1A 1D6VL 1G1YA 2CO7A 4R2GC 3RWIA 1QEWA 5F7NC 4JLRA 1OPGL 1RURH 2EDHA 4X7TA 5E7BA 1PMYA 2E46A 1CBVL 4PR5A 2FWSA 4IBVA 1AGBB 4X6DF 5E2UH 2Y6SC 2K9UA 3ARDD 4XP1L 1A25A 3QDJD 2JTDA 3RJOA 1T7XA 4OGYH 5BXFA 2Y7QB 4DEPB 5LNEA 1O7VA 1EO7A 1IGFL 4PJDE 4OJFH 3LD8C 2XKUA 4CGTA 2Q6WB 4KKRA 1X3DA 3L3JB 4R5TA 2WJ5A 1S78C 4L4TA 4U1LB 2CGZA 3KM2A 5HGBB 1QLRA 1KPUA 5FHAL 4LIQH 5EULV 1PIFA 2DI8A 1GRWA 4JFXA 3OMNB 3QR0A 4C83A 2A9NH 2MPVA 1MJ8H 4ANVA 5KVGE 3KVDD 2F2HA 5L8KB 4JZNA 4ZMQA 1HSAA 1TYEB 1GW6A 3SDDC 3S88H 4I77L 2CAKA 3S3BB 1T2QH 4QRRB 4AE1A 4FKKA 1MFCL 4FYQA 4B3VA 5T3ZD 1CTNA 2BIQA 1M6OB 2IPTL 2ZKHL 4WFED 3TZVB 4RQQA 4PBWD 3QPQD 5DA0B 5C7XL 4MX7A 4TNFA 1EHAA 4EZKA 2CIKB 2IMNA 1J0YA 1YEJH 3GSNA 4JY6B 3V6OA 4Y0GA 3ZTJG 4PMEA 1JRHH 3ZDYE 3FB7B 1PZUB 2MJWA 3NACL 4JG0L 1HHGB 3KLKA 4P2QD 4NP9A 2C7UB 1AD0A 1DEEA 2Q1EA 3JUYA 1OEZW 3IE9A 4FFZH 4JGUA 4AEIH 1R3IL 3N40P 3QXTA 4WLCA 5F89A 2XWDA 3EADA 1P4IL 1LK3L 1NDMB 4QHUA 3ZE2B 5C0BD 5DD6B 1TQSA 3S34L 3BH9B 3NCJH 1PLGH 3VXRE 4ATWA 1BZQK 1V55B 3GM0A 3CH1B 4UM9B 2VABB 4PPTA 1AKJA 1MVFA 1JNNL 3T4AC 4G82A 5I1GL 2D03L 1TZOA 2WXLA 4RBPH 3U0TA 4D94A 3RNKB 4FMKA 3GI8L 1HWWA 5CSZA 4NO0D 5AOMA 4DO5A 3BP7B 3B3BA 2HKFL 5EO1B 3HW7A 4FFVC 3FB6A 4YZWA 4Y4HC 5MP6H 4HWEL 2GFBB 1BLIA 3QEQA 2GJ6D 3DLQR 3EXLA 4CVXA 4R8WL 3FCUB 2XWRA 3IMUA 1MWOA 5ANMA 5DEGB 5FUOH 3SJVD 1RZIA 2Z64C 3P2BA 1DLFH 2FGWL 4OLVH 3BEWA 4NHUA 4NBZB 2E6JA 2OSLB 3HUJE 3Q2NA 5D2LF 2JKIS 4JFDA 5KJRL 1NCJA 1CGWA 1UM6H 4PRPB 4M1CC 1U42A 1RLWA 3CHOA 3QQDB 3MBED 3PABA 2HTKC 1IAII 3RWFA 4I0PD 4ZUWA 1RL1A 2R15A 3FJTA 3QJFA 4LF3B 2DH2A 2ATPA 1PCSA 2HX9A 2NY4B 4KJQC 1BQKA 5DFAA 5HVHB 1KXVA 1ETB1 4NFBA 2DY2A 3ARFD 4JM2A 5EIIA 3AUWB 3NSJA 4U6YA 4K07A 3P9LB 1UVQA 2OTUB 4QWWD 4JS7A 4ZNEE 5LNDA 3C6SB 4OTXL 3TVMA 3CHQA 4HKJB 5IVZB 1BQUA 1FGNH 1RCYA 1FL3A 4NSKA 2FYVA 3AG4B 2P26A 4AZ8B 1KTRL 2QADC 1V10A 3Q1EA 2NYZA 4POZD 2UZYB 1RFDH 5HYEA 4KKCC 4YQXL 1U8HB 1UKSA 4S11A 3WJLC 3T8VA 4QRTB 4LLMB 3CZUB 3IMRA 4TNEA 5EO0B 2CGRH 1FNEA 3GMMA 1AZZC 3CDGB 4W68A 5KWYC 3EJCA 5D7KE 3BPOB 1DCLA 2NMSA 2H32H 4U6VL 5LDSA 2XVBA 4QTFA 2R29L 2W0FB 3IDMB 3OPZH 4PGEA 4WTZG 1QOKA 4J3BA 2HT3C 4LPWA 4IBUA 4O02B 4YBLC 3ATAA 5BRZB 4MS8C 3U4EB 5L7XL 2JCCE 2GTZB 3CMOH 4CW1B 1KCSL 1I4FA 2F5BL 1CGSL 1Q9KB 1M05B 3UYRH 4EJ1C 1JWUB 2GIYA 1WAAA 1UM5H 2R1XA 3H9YA 2BCKA 2IDSA 2YOCA 3ALWA 2HP4A 3QEHB 1ID2A 2A9CA 4Z7QE 2Q7AA 4WFFE 2G9HB 4AV4A 3TBVB 5EOQH 1YMMB 1UOVA 1BAGA 1DSFL 3TA3C 3MJ9A 1P0SE 4W9GC 2F74A 1MLCA 3WKML 5HYSG 1HXYA 1N64H 2VXQA 4QXVA 5JOEA 5AVTB 1S7VA 1CI3M 2A6KA 5J4MA 3GMPB 2K6ZA 3GSWA 3R19A 2TRYA 3JV5A 3RZCC 1WTLA 2WW8A 1OSPL 2JJUA 1KTDB 2F1AA 4KU1A 5HGDA 4F9PA 3CBKB 2WXJA 3SPGA 2ZWKA 4P46D 3EH2A 1AQDB 3JWOC 4PVMA 1T89C 4IOSA 2CLVB 4N8UA 5CUSL 1R19A 2YD3A 4XPTH 3QUXA 5PCYA 3VVVA 1FH5H 2NZ9D 3LOWA 2Z3FA 4YN3A 1YECL 4QOKB 4DEWA 1U2HA 4ZX6A 4PLNC 1BFVL 3FSWA 1NLBH 4DK6A 4JQVA 3GI9L 4PJ5A 4FKEA 4GKSB 5DMIH 4NM8H 5HI5C 5FYLL 4EZJA 2XPZA 2QHLA 3PWPE 3VWJB 4DFIA 5B39A 2RCSL 3AU0A 4N2AA 4OZGE 4ZXBA 5E99L 1S4IA 1VIWA 4ZMVA 2NNAA 5IB1B 5IEKB 5KZCD 4DZ8A 4LLVB 2KT6A 3PDGA 4G6JL 4KY1L 4LLYA 4YC2B 1CE6A 3V52L 1IGTA 1AGEB 3DUSA 4KK9C 3FOMB 2DN7A 4YXKH 4CC4A 1TQBB 2DJUA 2LW3A 5DUML 4ZS7H 5EZOL 2LVEA 4TNVK 3W0WB 1K2DB 3EJRA 4HIQA 1UASA 3BP6A 3BPNB 2XVKA 1UB5A 5CEZH 2Y1VA 4BA0A 4ZT1A 3QIWA 3G5ZB 3QFJB 1JGEB 4XMVA 4JRLA 4BXVA 1TJGH 4NUGL 2YAPA 2FIKB 4QXGH 3R8BB 4NOFA 3RTQB 5A40E 3APCA 4H44C 5ICYB 2OCCB 2H1XA 4JVUA 2D4FA 4RAHA 1K3IA 5IVXA 1AQKH 3H6AA 4PJGA 3UBFA 1U3HD 4XVTH 1ORSB 2CBPA 3GSQA 5FX3A 1TVDA 3QO1B 2FLMA 3FS9A 1AI1H 1M42A 3LRLA 2ZG1A 2WLJA 1LE9A 2MOQA 1JYVA 1JRHI 1U8KA 5DRXB 4PGDB 5IB4A 3NFPA 3T65B 2H6PA 5B1BB 2EVIA 3BEVB 1FLTX 4KX8A 1P69B 3UDWA 2BFGA 2B9BA 2DJSA 2VLRB 3AXLB 4P9HL 5EOTA 3NESA 4WHYG 5HDBE 4EQ2A 4ONOA 2VLJA 4L9LA 1QSEB 1J05A 2IG2L 3I6KA 3N1FC 3IVKA 1MJJB 5FGRA 2VRKA 2PPFA 3O3EA 1F11B 5HVFB 1EJOH 3RE0A 1W16A 3S2AA 1TTCA 1KBGH 3EJZD 3FOLA 4BKTC 5F1IA 3MROA 2V9RA 3HKFA 5ESQA 5E5UB 5DURB 4J6RL 4M7ZB 5DR5H 5JMOC 4QTHB 4XO4A 2LR4A 1WBZA 3ZZ1A 4HC1L 2ZXAA 1EO8L 4AOFA 2COQA 3C6EA 5IBUB 1NL0L 5BVJA 3BW9B 2A6IA 1RLBA 3ZKMC 1IKFL 3HZVB 5JPMA 3HZ3A 1SGKA 3J07A 4XO8A 3S48A 2BXYA 5CJOH 3BMVA 4XMXA 4ZTPH 1R5VA 4M8VA 5I6KA 3BPCA 5J7CC 3L1EA 4FTVA 5KS9A 3MJ7B 3UTOA 4KHTH 1UCBL 3AQDA 1JOIA 2AJVH 1GC1C 4IU3B 2EXWC 2P80A 2J7LA 2AVFA 2NXYB 2XTSA 3FF7A 3IDGA 4MFHA 5D6CA 1CLOH 5DWPA 4JNXA 4PHXA 3DX8B 3GHBL 4BK4A 3CSPA 2BNRE 3EO1A 5F3BB 2JF1A 1FAIH 4KI1A 5DK2B 3TCXA 4WWID 5KVDL 3NEEA 3G9VA 3R06B 1DDHA 4X7DC 4Y9CA 1FBIH 2BWQA 2VDPH 1TCRB 4IRJB 3TIDA 4JM4H 5DVOA 2XU9A 2C34A 3WAKA 1SFDA 1DR9A 1U8QB 4KZ0A 1MHHA 1L5GB 4YDVB 2XACC 1CUOA 2UY6B 4LK4A 1C5BH 3LEXA 3PGFL 4P2OB 4KKLD 4HP5A 4UAOB 2AJXH 2BIMA 3NJHA 1EZUA 1DTUA 2DI7A 4HJSA 4UAHA 1MLBB 2CUMA 4H13C 5F9AC 2X4TA 1FP5A 2OQJA 1X5LA 3TFKC 3VXUD 5CKGA 2QR0A 3VJ6A 1VFBB 1M1XA 5B3SB 4GW4B 1CLYH 1DVXA 1IV8A 5IWLC 2FJGB 43CAA 2YXMA 2C7FA 5C7ZA 3VYPA 4P04A 4YNYA 5AVUB 2XWEA 1T66D 1JWSA 1RZPA 5D1ZB 4MA7L 4B7IA 3WU1A 3MRDA 1FNFA 5DRNB 4Z0BH 3KYMA 5J13B 3ZE1E 2FCBA 3QIBA 5E8DH 4LVHC 2I7SA 4A7UA 2Y2WA 4N5ED 1SOXA 3VE0A 3FPYA 4L3AA 1LEKA 1DFBL 5HDQH 4AXWA 5C3LD 4YSEA 3CSGA 1CK0H 2VAAB 2OR9H 3T8XA 2DD8H 1LEIA 1ITBB 3HN5A 1FZOA 1TO4A 1GC1H 4R0LC 1JMZA 4R26L 5DFWH 1MPAH 4RGMC 2PCPB 2PPDA 5D7KD 3DNKA 1B88A 3TN0B 1RQ5A 5FUCC 3MRNB 3CUPB 4OIFA 3ESNA 3I02A 2HLAB 2DLEA 4M5YL 3FRUB 4JAMA 2XA8H 5F7LB 2CO6B 5FCUL 4YHZL 4YSDA 4HEPG 5EHFA 3RGVB 2DLTA 5AW4B 2E7DA 5E4EC 5E0FA 5CBEB 2VE6A 1G5GA 2NX5A 4X7SL 1E5AA 5IVOA 5ICZA 3ETBJ 4Z7VB 4Q2ZA 3T3PB 2BNUB 3V4VB 2NUPA 3D3VB 3DHUA 4HKZB 3CVHB 3C5ZA 1J18A 3DJTA 3GIVB 1QA9A 4BV1A 5J12B 1Z9MA 3UIZA 3WNPA 1NDGB 3UADA 5IT2L 1JNHA 3C8DA 4WFFD 3APMA 4BQ6A 5IJVB 1VDGA 3IGKA 1MW3A 3KPLA 3LPOA 5CLYA 1PSKH 5GXBB 1HT6A 1I7RB 2YPVH 2XN2A 3BUYA 1UJ3C 3LS5H 1NPJA 2W60A 5DQ9A 4HIHB 4Y2OA 3OLGA 3UTZB 1UH3A 2BHUA 4GQ9L 5BVPH 2X28A 4YXHH 3ARDA 5CCGE 5D7IB 1T2JA 3CJJA 2GY7B 4Q6KA 5KSBE 4UTBA 2CLRA 1NBZA 2A9BA 4L8CB 4GT0A 5GJSH 5LGJB 3E6FA 3L4VA 4GBXD 4FQLL 5D55A 3MLRH 4PJHB 2GSMB 1CLZH 2ADGB 3NQIA 4NKDA 3U82B 2EH8L 4J5VA 4HKXB 4LHQB 1AKPA 3HMXA 5AVRB 2ID5A 5TDNB 2HJKB 3PGCB 5JHDA 2O6EA 3N1GC 4AX3A 3LKRB 4GAGH 2NY7H 2HVBA 4AIZA 1NCIA 2UX6A 3ECBA 5GS0L 1ZLEA 5IB5B 3PWPD 4XXDB 2XWJB 4XVJL 1J11A 4QRPE 1OGSA 1I9IH 2DKMA 2OMZA 3P77B 4U6HA 5E56A 4L3EB 4QRUA 4IIQB 3ILDA 4J3OD 1L9PA 4X9FA 4DFHA 4YBQC 5ID1A 1QATA 3M8OL 4GAYB 1ZK9A 5CCHE 5I8KL 4XVUC 1D6VH 1Q9OB 3KXFB 4KNUA 3ISWA 1KXTA 1G1OA 3GHPA 1KCWA 1F6AB 1IAOB 1OPGH 1U91B 2VMEA 3E3QE 4G7VL 4Y5XC 3UTQB 3TEWA 4RMTA 2YC1B 4PWGA 1A14H 4WNJA 4IJ3B 3RIAF 1R46A 1CBVH 1KLGB 3L08A 2HRHA 3X3GL 1OCOB 4OLWL 4WHCA 4XP1H 4ZO7A 5DA4A 2QQLL 4UIKL 1QASA 5I71B 4WW2A 4DGWC 4P2QA 1BWMA 1IGFH 2XN9E 2ATKB 1MVUB 4FQQA 1V5JA 4H8HA 1DJIA 1IGCL 3DWTA 4OGAC 3UG3A 1DVZA 1CFVL 3MJ9L 2AI0L 4FI7A 1H0DB 5TF0A 4OD2B 1JGDB 3EYVB 4CVWA 3VXPB 3WNOA 2VXQL 3FO9B 4U1KA 3L5HA 5E6YA 3VXSE 4PJ7F 3HI5L 3QJZA 4EN3C 2WMPB 4EOWL 4H25B 4YHNA 2VJ8A 1IKOP 1WC7A 2FNBA 1PF3A 2H3KA 4X4ME 4PJ8B 3K5SA 4BUQA 5K9QI 2WWKO 5K1JA 1MVYA 3QEUB 1DVTA 1IAIM 3B2UC 4I77H 4I3GA 2IBBA 1X5GA 4NXKA 4X6FB 5EF1A 5HY9A 5KYWA 3DRTB 5ESVA 2R7EB 1HWHB 5L4IA 4ATTA 3UBXI 3V10A 2IPTH 2ZKHH 5CN3A 5AOJA 1CLCA 4LFHG 5DC0A 4KAQL 5C7XH 3U0PA 4IKNA 1BCIA 1TQVA 1DQJA 2ENSA 3MGAA 4R4NC 3ZRFC 4AYEC 3AVEA 4FDWA 1MW1A 4OZ4B 5C0AE 4E36A 2P3YA 3RWJB 3AWFA 3V4PA 2P52A 1S7UB 4YHOL 5F9OL 3B4NA 3T6WA 4OF8A 3GKWL 3C09B 4BFOA 5EUOE 3KDMB 1JI1A 3LQMA 1A6ZB 3NACH 4JG0H 4KFZC 5ADPL 3O9WA 1JZGA 4OLYL 5CD3B 4IBZA 4KX9A 2AK4A 1R3IH 2P5WA 2WZ0A 5D5ME 1SN0A 3ARFA 1NCDL 4ODSL 3U6XA 1KPRB 1P4IH 4CJ1A 1LK3H 3O2WL 4YFEA 3L16A 4C59B 3S34H 1XVSA 4P06A 4WDIA 1A9BA 4PY8J 1ZT4A 3E0GA 4HOXA 3IDJB 1JNNH 3I84A 2D03H 4GO6B 2WZPD 3OV6A 4ZFZB 4JZJB 3GI8H 1PTZA 2BHZA 4OV6F 4TSAL 4J2XA 2VR3A 2BNRD 2HKFH 5KSAB 3LMJL 1HKLL 2XBDA 3G5VA 3KG5A 2ZG2A 1QMUA 3GDCA 4HWEH 5AVWB 1B2WL 3WUWB 1ESOA 4R8WH 3G6DL 2FT6A 1QW9A 1H3TA 2WCPA 5A2CA 3VFVB 4XXCC 3IFOA 2XC8A 2FGWH 3GMRA 4OCSL 3WFDL 4I87A 2X42A 2ARJQ 1XCQB 2G30A 3S4SB 3MLXL 5EZJA 5KJRH 1XHHA 3MRJA 1S7WB 1DJGA 4LCCA 2B14A 1AXIB 5FKPA 3KLAB 4AM0A 4L1LA 1IT9L 3FTSA 3UZEA 1E9OA 3FTUA 1AYRA 2BS8A 4OCXL 4MS6A 5EORL 1SJMA 1HL8A 1TZAA 1GVIA 3N91A 5I2IA 4Z3IA 2I7OA 1PDKA 4QIRA 4RISL 1HHKB 3QCUH 3RG1C 2A74B 4MD5B 4U1NA 3VWKB 5LBSH 1XIWC 2DWYA 1FE8L 3B56A 3L3DB 3O2VL 5D7SL 4JDVB 3SKMA 2CUAA 3MX0B 1IE4A 5L4FA 2WQAA 3GEFA 3OG6B 5LXGL 1H5BB 3F12A 4GW1B 1PAZA 5JYLA 1BX2B 2P5EE 2XHNA 4H8QA 2FEJA 3LQAL 5D2LB 5F7EL 2G2PA 3IGAB 2WZ6A 3OHMB 4YQXH 5C0DA 1TZHA 5EEYA 2WIMA 1FFNB 1T5XA 4JCMA 3GTVA 2R2HA 3IJSA 4KZCA 4AUYA 4ZG1A 3RHWF 1XCTA 1XB8A 2PP9A 1U3YA 2Z0BA 1E7VA 4APQC 1M2VA 3I9AA 4I13B 1KIQB 3WLBA 5I19L 3ARBD 2J1ZA 3WE1A 2O5XL 2P7TB 3OGOE 2W38A 3O3DB 4U6VH 5FM4A 3CN0A 2VQ1A 2YAQA 5CMAB 2WWMD 1AQMA 4P46A 5EU6E 1KDJA 3PV6B 2HG5A 1KV7A 2V9UA 3ARXA 8FABA 5IW3A 5DHYB 3TTYA 2EIMB 1R34A 5L7XH 5DRWB 4NJ9L 4MZ2A 4EUPH 5A2KH 1KCSH 4HLZH 4KRPD 2F5BH 1CGSH 1BEXA 3SDAB 3WNMA 1DE4B 1XDTT 2VDLB 4JMNA 2X4NB 4GSDL 4OW6A 3PDOA 1XB3A 3MU3A 2YGOA 1JHTB 1B0IA 2N4IA 2AV7B 1JXGA 3LH8A 3TBWA 4PJ9C 4JFEA 4H8VA 4NRZB 5JOFB 3U0WL 1DSFH 5LQBL 4DKAA 1S2EA 2YWYA 4BFRA 4TMPA 4AKQA 3EO0B 3WKMH 4ADIA 1N0XL 1HYRC 1U3ZA 2DL2A 2YXVA 2V2WA 5ABAA 4YDJA 1HILB 4EDXA 1N59A 3FQYA 2UV3A 4HD9A 1OSPH 2NY3B 4PJDA 1UFGA 1IQDB 5JA8B 1UWXH 3NCYP 4I2XB 3TV3L 2ZOKB 2X4SA 4K8RD 2WXQA 1DQTA 2SEBB 3D48R 1YECH 4MMYB 4RGND 5C3TA 4P9HC 2GK0B 1BFVH 3MLTA 3F58L 1FIGL 3Q13A 3GI9H 3ZHNA 2H2SC 3HG4A 1Q72L 2PPAA 4G7SB 5FYLH 1UC6A 4WWKD 5IW6B 3LS4L 4WO4D 4QRPD 1F41A 5DD5L 4XTRD 5E99H 3MCKA 5FYJU 2G4EA 2ICCA 3VRJB 1SXSA 2F7PA 4MMXC 2BZDA 1KC5H 4G6JH 4KY1H 3WO4B 2IWFA 2AQ1A 3NK3A 3V52H 4LAJH 4EE2A 4F8TA 1CG9A 1I53A 4ODVL 4JCWA 4XPHL 5CNHA 1KY7A 1XGTB 1TLKA 5EZOH 5ACMA 1A5FL 3QUYB 5BS0B 1ZIAA 2A4ZA 4PBDA 4M6AA 2ZCHL 4PJEE 4Z7NE 3A6BL 3A23A 1QNIA 3L1OH 3ROLA 2YAOA 3NJVA 4NUGH 2R69A 5BQDA 3RUGF 2QTVA 1XH2A 3F04A 2ZXWB 2XN9D 4GMSL 1SBSL 3TASA 3FTGB 1XR9B 3V9EA 4PRNB 4HWBH 5HHPB 2HX7A 4NAMA 3VXSD 1UZ8B 5GZND 3VXRA 3B7SA 3ZYJA 3H9SA 2FO4B 1QQDB 3IDIA 1RV6X 4H8PA 4UTBL 4OF5A 3ESMA 2BS9A 4JDEB 2PTTB 3AU1A 1ORQB 1A9EA 1B4TA 2R0LL 1I1AC 4ZO8A 2N0KA 1T6BX 3MLVL 4P9HH 2M1KA 3VH8A 4FQ1L 3HMXL 1K5NB 5I5MA 3O45B 2BP0A 1UXWB 4CBPA 1WP6A 2IG2H 3P3YA 3U9UA 3KWUA 4J3OG 4TLTA 3SD2A 4X2UA 3HUJA 4MMZA 2YMOA 3ZYIA 2B20A 3V6FA 2ZWSA 2V7NA 4ODBD 2JKTM 2WUCL 5C0AD 4UT9H 1G7JB 1CTMA 4J6RH 5FR3A 1N5YH 3I85A 2JCWA 4CAGA 2Z4QB 4HC1H 1SEQL 4NRYA 4R4FL 3V6OC 4L5FL 1J5CA 3B37A 3DRQB 1EO8H 1NCWH 3D0AA 3KBHE 1S7SA 4TUKL 1I8IB 3DV4A 4HYTB 1OE1A 4PJFF 4HG4K 1NL0H 3KLHC 3U30C 5DD0L 1IKFH 1VGEL 4H1LA 1LQBC 1BJ8A 5CF3A 1HOCA 4RFNC 3VD0A 4JHVA 1W9XA 1C5DA 2WIIA 2NYYD 4UMGA 2AQ3A 4WHTA 3WY4A 4ZNEA 1WSST 3K8KA 1MCPH 5JR1H 3HBZA 1GGUA 1XCWA 1IJ9A 5E95B 1MW0A 2I25N 5GGRY 1UCBH 1ZHBB 3LD8B 4NJ9H 4O2CB 4ECNA 4BCZA 1OL0A 4LLQB 3GHBH 4P5MB 1JPFB 3CFIC 3DA0A 1RUKL 2H0PA 4YOKA 4HJEA 4HBCL 3QXAB 4ZFOB 4P4KB 1AR1D 4MNGA 1JAEA 1B4JL 1TNMA 4I1NB 4NENB 5KVDH 3LRKA 1MCRA 4WNQA 3BISA 3MACH 2K8QA 5EBWB 3ABZA 3OQ3B 3QZWG 5CP7B 5AVVB 1L7IL 3O11A 3SDDB 3V4LA 4UINH 4LSTH 4LRIA 3RBSA 3WXVH 4AUJA 4FLOA 2FZ3A 1J5IA 4R7NB 4L23A 3ZZSA 4JO2L 4BGLA 3QVAA 1JBJA 2BSSB 4DVRL 4IYKA 1HZHL 3UAFA 3CC5A 3GRWL 3MLZL 3MREB 4TVPE 3BSGA 3QFJE 4RZCA 5JO5B 1RZQA 1UKTA 1LWRA 1Q9LA 3GSNH 4E9SA 3QI9D 2MHAA 1OAXL 3L81A 3BAWA 2X9YA 3GPSA 3O3UN 3CPLA 3GO1H 1KXVC 3GUTB 1G7LB 4UIMB 4JM2C 1Y1UA 5I0VA 4Z18A 3MI6A 2OMNA 4WVRA 2QSQA 4NQXB 1T1WB 4GRLD 3PHAA 4IIZA 2Q76A 1A2YB 3OXRA 2K6YA 3JV4B 5JZ7D 1DFBH 3TVMC 3RU8L 3MRLA 4H7VA 2APFA 4Y19E 1XSKA 4QY8A 2YA2A 5ID0B 4WUUE 4BZ2A 2BP8A 1C12B 4ENEC 3Q5YA 2IC2A 4R26H 3T4AB 1QLFA 1E2WA 5E03A 3ARWA 4JPIA 3FB8B 4BQ9A 2VLRE 4N0UE 2OYMA 2OXGA 3MRIA 1JI2A 4JKNA 2E8YA 5C0CB 2GAZB 4GBXA 3U2SB 4RH4A 2EKSB 2H32B 5EU6D 4Y4HB 4BBWA 5IOKA 1GYVA 4M5YH 3W39B 5IEHB 1BAWA 3QIUD 3TZVD 4YHZH 5FCUH 5GS0C 4OGXL 2WLIA 3BIKA 3QZNA 1PZ5A 1VLXA 1QRNB 4L1DA 5C1MB 2HFFB 4X7SH 1NBYB 3EYFB 5BCAA 2J8UB 1ILUA 2VL4A 5DVPA 3GYRA 1U4EA 4XWOD 5E1AB 1CFMA 3IJYB 1CQKA 4L0PB 3L9RA 2FX9L 1BIIB 4OZGA 1DUYA 3EZJB 3S3CB 3HFML 4NQQA 3FUIA 5ABDE 2BVPB 3T2LA 3DX7B 3DK0A 4QHMB 2VITB 1MEXH 1Z3GL 2NY1D 2WYTA 5B4MC 1FGVL 2Z92B 3WNJA 3CN4A 2KS0A 2ZNWA 1LE5B 1D7DA 3N1PC 3L3GB 1F5WA 4HGWA 1CFBA 3ISRA 4AKOA 4U1HA 4GQ9H 5EUKB 2X88A 4NZDA 4KC3B 1T0MA 3S5ZA 4KY2A 4UV7L 4ZODA 2QADB 3QDAA 5F7DB 1FNGB 3BVNB 5CD5D 4AY0A 1YC8A 4PVLA 3HB3D 1SOSA 3LV3A 1O75A 1ROCA 1D2PA 1OHQA 2VXTL 3D2UD 3KPNA 2AEIT 4FQLH 4QJ5B 4U3CA 4N2KA 2EH8H 3ALXA 2Y7LA 4FCAA 4F9PC 5C09E 4KDWA 2ITDA 4BWWA 4CMMA 5SWQA 4LCUA 4HOMA 1RIUL 3P54A 3QUXC 4BJLA 4PRPD 1X5ZA 3N40F 5IQNA 5GS0H 4QR7A 1SJVA 4XVJH 1WZLA 1YJDL 2G75A 1NEZB 4YBLB 4OM0H 4JQVC 1WS8A 3VI4E 1UM4L 1ZSDB 3CH8A 2J55A 3M8OH 3H56A 3ULUL 3KPSE 4HPOH 5I8KH 2P9RA 3OKDA 5F97E 4ZXBC 4TUJB 4G8GA 4WWOA 2FD6L 5DWUL 4ZX3A 3WFHA 5D93C 1FA4A 4HT1L 1C08A 3MLYL 5K9OA 3H1ZA 4G7VH 3QUZA 4PGJA 4UANA 2UXFA 2EXYD 3DVFA 4N6RA 4CC4C 5ECGA 1XSJA 3X3GH 4OLWH 5LUMA 1UGNA 2A73B 4FXTA 1QR1A 3RPIA 1AGDB 2QQLH 3UTTE 4UIKH 2R27A 2R2BA 1ZGLP 4KKAC 2H26A 1Z7JA 4N9OB 4UZUA 1PLBA 2CBQA 3IJ7A 2AI0H 3MJ9H 1DO5A 1R3HA 2XIDA 1IBBA 3MYJB 5E0QA 2VXQH 3V5HA 3HI5H 3GXFA 4NZ8A 2WXPA 3RZCB 2NR6D 4EOWH 3LQZA 3GBEA 1A7PH 1ZV5A 1H9VA 2YD4A 3QUKA 5BRZD 2BIOA 1UA7A 1RJLA 3EBAA 3ARTA 2BNRA 4UNVA 4PJXE 4RGOL 4N2HA 4A7GF 4HIIA 5EZPA 4O2FB 4Z7VE 3U83A 2WO3B 3FHEA 3GHEH 4GG8B 1P1ZA 3QH3B 1MUJB 2K7PA 3UDWC 3ZMEA 1SYVB 1UH2A 2E6PA 3OGCA 1GGCH 2VUKA 2C9VA 2WXKA 5EF2A 2OMWB 4O51A 4KAQH 1UXMA 5KVGL 4NZRL 1M56B 3FCTB 4L9LC 4KV5F 2LLNA 1KZYA 4UOW0 5J9PA 1TTFA 3BH8A 5ITBL 5E9DB 2VR9A 4YGAB 4I1PA 3NP4A 4DHLA 4NLHA 3TH4T 4PJ7B 1INQA 4FA6A 5F9OH 3DPBB 1NGXA 1OV8A 1VZHA 2OJ1A 3GKWH 5DVNA 3UTPE 4NO3B 1UQSA 3U1SL 2BSBA 3Q8EA 4OLYH 2BERA 2K3HA 1CDYA 2B1HL 3ABKB 1OE3A 3ISYA 1GCFA 3CPUA 2YPLE 4ODSH 1SPDA 3O2WH 5LGHL 1DHKA 1VA9A 4DVBA 1LO5A 4NAJA 4LCWB 2WLNA 2OMTA 3UBXB 2R69L 3WN6A 4MQXD 5JPMC 1Q0YL 4PJHE 4GIAA 5EU5A 3CC1A 4DPBX 2F8XC 2V33A 3RI5F 3KW8A 1A6TA 5INCA 4HETA 4RZKA 1UXLA 1ZDQA 4TSAH 5FW7A 1HE7A 1OALA 3BDYL 4DQAA 1HKLH 2A1WH 3SDXE 5IMMA 1B2WH 4AEFA 1LGVA 4ODUB 2OMVA 4P57B 2ILLA 3G6DH 2ODHA 3DUUA 3H9HB 3P02A 4FMVA 3SQOL 2GCYA 3P9MA 3VWJD 3JUZA 3BN9D 4PRAA 2KI6A 3N41F 3PJSB 3WFDH 4OCSH 3U2IA 1KJ2A 4L3EE 4AJWA 2VDPB 4WV1A 3MLXH 3ML8A 4NPYB 2QLVB 2XPGA 1JK9A 5DC4B 2NW3B 1KCVL 3X1NA 2DEXX 1O6SA 4MA1B 1IT9H 3MHZA 5ECJE 3W0WD 3EW3B 2NY0C 4FP8H 4JFOB 1VEOA 4OCXH 2IMMA 2Y3AA 4HUUB 4JO1L 1MCBA 5IQOA 4XGZA 4WTWA 1J8HB 1EFQA 3QFJD 4JVPA 4AT6B 3OC8A 4RISH 4UTAA 2DM4A 3AS2A 3EOTL 4D8PB 3RTQD 1FE8H 3AY2A 4PV8B 3O2VH 3M1OA 3BN3B 4L29A 5D7SH 2R4SH 5D7EA 1HK6A 2CM5A 1YNTA 2R0ZL 3H8NA 2K45A 4MJIB 4NQVA 3OAZH 4ONHA 1T4WA 4M3JA 5LXGH 2X4PA 1ADQA 2XTLA 1I1YA 2CIIA 1OK8A 1RSYA 2P5PA 1EZLA 3ASWA 3MUJA 3NYKA 4ANXA 3Q9PA 4OY9A 3QIBC 4WUUD 3WJJA 3TCLB 1F13A 1WCBA 5AAPA 3K3QA 2MNUA 2ZP8A 4LAQL 5LKNA 2HN7B 1QSZA 3GMOA 4L1BA 7PAZA 1HEJC 5KSBA 4NO2B 2VLRD 1PLAA 5I19H 4JJHA 2O5XH 4HIPA 4XOBA 1SYSA 3PLYA 4LOUD 3GSXB 2CK2A 3ZTEA 4Z8FL 2IBGA 2X09A 3TPUA 3DGDA 3MRFB 4G6AD 1KGJA 5EFIB 4J3UA 3VA2C 2ENJA 1AD9B 4N28A 2ZG3A 1O5DT 4JM2F 1PFOA 2DTSA 4KUCF 2L4OA 4JFWA 1HQ4B 2XPYA 3QWRD 1ZHLA 3QZOA 1NBVL 1QI5A 1CU4L 1M71B 5IB3A 4WK2B 4WWKA 1NC2B 4UUJB 4QRPA 2ZCZA 5DUBB 1XL4A 4HUWB 3QS3A 3GRBA 1H3GA 4Z7UF 4BSWB 4FCHA 4DGVH 5H35B 4ELDA 5MERB 3MGOB 3BAIA 4AG4L 3U0WH 5LQBH 3ZK0A 5CEYB 2V7HB 3O2DA 3RB5A 4RMUA 1YPZF 3C5JB 1N0XH 4UOW1 1A1MB 1T5WA 1WF5A 3PE9A 2WXFA 2XWBA 2XZQL 3DHMA 2CNZA 3ASOB 4LVHB 5D71L 4LSPL 3D39E 5E8OB 5HI4C 1FVEA 3O3AA 3ARDC 1NWOA 1S5HB 2VXUH 1HHIB 2DZEA 4PG9A 4DJMA 4Y5VB 4F57L 5DEJA 3RDJA 2UUDH 3S97C 3TV3H 1KYOK 5L2JA 1T03L 4R0LB 2QQNL 3QG6B 4AC4A 2PYEB 4IRJD 3MRRA 4BZ2L 1I3RB 1DLHA 3VXSA 1RMFL 4PGCA 2ZTBA 2Y7MA 3MOBL 3F58H 1FIGH 4X4MA 3DROB 5C0GA 1Q72H 4P2OD 1TPXC 3MUGA 4W6XB 2HA1A 4OV5A 4PIBA 2EILB 3LS4H 3ZQWA 1H3UA 4LHUD 5DD5H 3WHXA 3BAEL 4HPYL 2YEZA 5E4EB 2VERN 3KL0A 1SXBA 3BLKA 4G6KL 3FT3A 2C3VA 3KPSD 1WVZA 2WM0A 2VR4A 4RFOL 2QGDA 1BYPA 5AD0B 1XWVA 5JIDA 2ZX5A 3Q8CA 1YAIA 4ODVH 4XPHH 1N6QH 5KG9B 3IAPA 1FN4B 3ZRSA 2P8LA 2FBOJ 3IPFA 3APFA 1RHHA 5IV2A 2O6PA 3EAKA 1JTTA 1S7XA 3PS6A 4QYOA 3SPIA 2AJYH 2Y3NA 3LH2L 3QPQC 1BIHA 1YYML 1X4YA 3O3BA 1TR7A 5C0AA 1OTUD 1P5VB 1URIA 3A6BH 3KYKL 4YHIA 4NUMA 2YWZA 1MCWM 4M6MH 4NQDA 5BRQA 5FA4A 5FGCB 5EUOA 3UTTD 3K4DA 1I7TB 1TEFA 3AXHA 4ADGA 3P4OB 1BZ7A 4LXFA 1UJ3B 4WGWB 5GGSB 5JQ6H 3QK0A 1SBSH 2IDTA 4GMSH 1EO5A 3FRPB 3OTTA 1A4JB 5D5MA 3U1QA 2ITCB 3T6XA 4U7MA 5BQ7A 1MCJA 4MXQD 2XTJE 5F9WC 4WW2C 3MR9A 3N1QC 5D1QB 3AQYA 3DK2A 3DOHA 2I24N 3JTSA 2PCXA 4QLWA 2FR4A 1N2RB 1SDDA 1OSZA 4XOEA 3X1EA 4YLQT 4NN7C 5FV2A 4U1JA 5H2BA 1CDJA 3GC3A 4ZD3H 4P2YA 4MDRA 4UTBH 2AQPA 3HPJB 1OAYL 3O4OC 3SODB 3ZDXF 3RGVD 1IGYB 3D87B 3WEAA 2R0LH 5K9KA 2YKLL 1IKNA 1OARL 4HS3A 2GABA 4HLJA 4QF1A 4N2OA 2E9WA 4OUUB 5C8JB 3MLVH 3CQFA 2YMTA 1E27A 4FQ1H 3HMXH 4FQXD 5AAMC 3ME0A 4XP5H 3RUGB 2YEVB 2Z7ZA 5EU7C 1ZHNA 3NJIA 2VR6A 3I9GH 4MWFA 1WBXA 1AO7B 1CDUA 4J3WA 1CXFA 3APDA 2DQDL 4HS8H 4Q0XL 3UO1L 2WUCH 2O5YL 3LPGA 2CXKA 4N20A 2EDEA 5IVXF 3UTPD 3B2MA 2GYSA 5D1XE 4GY4A 4KTEH 3VRLE 3EO9L 5IIEB 1SEQH 2BVQA 2WQ8A 4R4FH 4L5FH 4Y5XB 1VFOA 4PCTA 2NNFA 2DM7A 3L5IA 1DANT 1F1GA 4I0PC 1MKFA 3DGGB 5FO7B 1VGEH 3FU5A 4AIEA 5DJ6A 1IAMA 1D7FA 2YPLD 3O9WC 4JRYE 3V79C 5IOPB 3QI9A 5CZKA 1P7QB 1MCIA 4L3CB 4QHNB 5I26A 3PY9A 4OD3L 3HG1B 1XTLA 2FEEL 3ARFC 3RQ3A 4HMEA 1K4DB 3NSFA 1QVOA 4QWWC 2P5EA 4GRLA 3K8MA 4DCQA 8CGTA 1IC5L 4YDZA 1VB9A 3AS3A 1V27A 3MLWL 4HCRA 4HBCH 4W9LC 1U4FA 4IU2B 3IDNA 4EN3B 3IAGC 3QUML 2DWEB 4YGVB 1B4JH 3PIQB 1Y07A 1EHNA 4YIQA 4PJFB 1BFOB 1NUFA 1A4BA 4L3ED 3VXNB 2HT2D 1L7IH 4Y2NA 3BGAA 2IV9A 4LLWA 1DVFA 1IUZA 1SQ2N 3FQ2A 3NFNA 1A6WL 5EU6A 4LVOC 3WS6C 1FYTE 3KXFD 3QIUA 1FNLA 3L4CA 5FF6B 5TD4A 5L8JB 3GZPA 3MRCA 4JO2H 2MRYA 3WL9B 3T1FA 1KWKA 4LCCC 4FQPA 1IL1A 1A64A 4DVRH 4I3SL 5GGUB 1HZHH 1X6LA 2FQDA 5AEAA 2X6VA 2R8SL 4ODXB 4S1SL 3HMWL 3MLZH 4RWHA 5GS2D 5F0LB 2YUXA 3U7WH 2EIJB 3TF7C 3QUGA 1OAXH 3FAXA 1QUNB 1QTPA 3V4PH 4AQEA 5MEQA 3D7PA 5TK4A 2APSA 1KMGA 2E4FA 2VLME 4P4RB 2QPFA 5GQBA 3WKPA 2AC0A 3K6NA 4PM1A 3RU8H 1OAKL 5A6MA 4UT7L 4JUTA 2XVGA 1GH7A 4A67A 3BSZA 4HIXL 1TFHA 2QSTA 4ZQKB 5ERWB 3TO4D 2FX8L 1BXAA 5DRZB 1BVKA 4H26B 2G2NA 4OUOA 3H85A 1UADC 3WIAA 2RALA 4TPRL 3BGMB 1H15B 3KVPA 5LWYL 4J2QA 2R83A 3C5SB 3RWDA 1I1FB 1SVZA 3D2UA 3Q2VA 4KJYB 4PW3A 3V5DA 5F6HI 4HFUL 3EYOA 4MVBD 4X83A 5KBMA 4M43L 3F64A 4OGXH 5AUMA 5CEXB 1CXHA 3NPSC 4QRSA 4Y8DC 4P46C 3VG0H 4G6FD 5FECA 1ECYA 3GPEA 3I6GB 3ULUC 5CU5A 4EUPB 6PCYA 3VO0A 4E42B 2FX9H 2VSMB 2VISB 2EDWA 4LCYA 1HXMA 3EBHA 4LEEA 3BVUA 3HFMH 2WXGA 3Q6GL 4WTZA 5JUEL 4H0IA 2WK2A 3Q7JA 1RZJL 3TV8A 1Z3GH 4NS0A 1IEBB 4JFYB 1FGVH 1ET8A 1ASQA 4PTTA 1F4HA 2C4FT 1CFQA 3GSVB 3HS0B 5CO1A 4UTAL 1XIWB 5B38G 3QT2A 4FA8A 3V0VA 5BOJA 1CDHA 4PJEA 5BZDA 1S5IH 2Q87A 1OIOA 2MCMA 1X9LA 4PY7B 4JGJA 1DN0B 1IX2A 1HHHA 5F72S 2YSTA 4UV7H 1FPTL 3D39D 3P73A 4MNHA 2CDEB 1ADQL 3DURB 2JJWA 1LO0L 2EH7L 3PXHA 3QSKB 4L05A 2OMUA 3PUUA 4PYGA 4P8QA 4NZJA 4B6ZA 3V6BR 1WFMA 2VXTH 1EVTC 4ZMYA 4F7EB 3OM3B 3IKCA 1TQCC 5HYQB 1UWYA 4NNXB 2OYLA 3K8LA 4K3GA 1H3VA 4F3FB 4RNRA 2OAAA 3D8MA 4APQB 1WO2A 1UT2A 1BD2B 4WKXA 3VFSA 1RIUH 4O2EA 1HYSC 3STLA 3ILPB 3DVIA 3OJVC 2AQRA 1KG0A 4Z6AT 5J6HB 4E9XA 1B9KA 2QBWA 3S35L 5T1JA 1FHNA 3BZEA 1UM4H 4K8RL 3CLFH 3VD5A 4GRMA 4EIZC 3T1WA 2KHAA 3ULUH 3QW9A 4M6OL 1SHSA 4KFMA 1V3KA 5T5NG 4AENA 2BP3A 5FYJD 3FYEB 5DWUH 5KVEL 2FD6H 3CQPA 3VWKD 1KYDA 1BSIA 4HT1H 3MLYH 2OSXA 1X6NA 2X3AA 4XN5A 5IBUG 4ZYKA 4LLAA 2C9PA 1G9ML 4P5TA 5I1IL 2VM4A 2WZ5A 4HJ0D 1F3RB 1KIRA 4ODTL 5I6MA 5A6LA 2AXWA 5I0DA 2EE3A 5DQDL 1RI8A 1XGPB 4HJGB 1NGQL 1Z5LB 4K94C 3WIIL 3QQ4B 3CHXA 3EJZC 4PJ9B 4HA1A 1A21A 1KSRA 4E2OA 1MCSA 5E1IA 4YHPB 2YAFA 3O2DL 2XTJD 3B83A 3CHPA 4WJ5A 3TU6A 2YD5A 4ZK8A 4E9QA 3WSQH 3M7OA 5TFSL 4PLJC 3MV8E 4OCNC 5AW6B 1IBFA 1WK0A 2G2RB 4AGPA 5DEZA 1UD2A 4YEEA 1Z9LA 4WU7A 3G6AB 1QRNE 4CBZA 2X6MA 4Y16B 1H8SA 2D7MA 1WUNT 4HWZB 4RGOH 2GT9A 1UD3A 3OKNB 2VL5A 3SE4A 2H9GA 2ZAGA 3PWLB 4O9HL 2W1NA 1JPTL 2VDNL 5JHMA 3DX4A 3HZMB 3FQXA 3G04A 4PRBA 3QA3B 4PRHE 3LAFA 2A6DA 5KVGH 4NZRH 1JTPA 1PNCA 3BIBX 2HVJA 4TUOA 1UCTA 5ITBH 3SE6A 1ZS8A 4P3WA 2CBTA 4M6NL 4NQCB 3RVWD 1LO4L 5BRPA 2FYYA 4MMXB 4WW2F 1ZDSA 5CSBA 4LNRB 3ZDZF 2FAUA 2ZXDA 1L7TL 5AOLA 4MMZC 5D1XD 5GRVK 5GS3A 5MHSE 1NM4A 2LTQC 2SODB 3U1SH 2AANA 5MEOB 3PL6A 4M48L 2NT0A 1N26A 4S0SD 4KKLC 2CO7B 3RWIB 3KBPA 4UV4L 2B1HH 1QEWB 4K94H 4V1DA 4AQ1A 3VM7A 1ZLVK 3IU4H 3LRSA 4JRYD 4JLRB 1C1EH 3U48A 3B9KD 2GJRA 4WUKL 4X7TB 1OM9A 5LGHH 2RTTA 3SKJH 4PR5B 2ALWA 2R69H 1Q0YH 1S8DA 4A63A 1JZEA 1SUHA 5AQ0A 5BXFB 5H94A 1T66C 2PUQT 3MNMA 3NEXA 4JW3A 4BRJA 5AAWA 3T2OA 4JFTA 1UH4A 4Y19A 4H0LC 1TDQA 2FJHA 4WUUA 5J06A 2HT4D 4L4TB 1WJ3A 1QLRB 2RIKA 1KPUB 4N0UA 3N42F 4JFXB 3OKOA 2CQVA 1FZKA 1I1AB 4C83B 1DO6A 1VFUA 1FYTD 4JZNB 3DI2B 1HSAB 1KCVH 5I6OA 2LE9A 2WP3T 3MKGA 2KZWA 4PB0L 2PO6D 4YBHA 3GMQA 4JHBA 4Y1AA 3RWHA 4LRIC 3QUYD 4XP6L 4CSSA 4JRXB 4JO1H 5I18L 5GIRA 3TL5A 1PQZA 2YAEA 1AZCA 4NQEE 5D7LE 4RQQB 3OZ9L 5DJAA 4RIRA 5CEZE 3EOTH 5F7MC 5FAAA 4BSJA 1QNZL 4MX7B 1RUML 3VGAC 5E8EA 5A2FA 2F18A 3GSNB 1Y0LA 5SX5H 2R0ZH 1HE8A 2VLMD 3N41B 2PR9A 4M9OA 3U30B 3NJJA 3C6LD 5HHXL 1TJIL 4RFNB 3TWCL 2ADJA 1AD0B 2XV2A 4H1LH 1G5AA 1DEEB 4OVUA 4JBSA 3RGHA 2J72A 3UPRA 4I1RA 1VPOL 1XD0A 5E9AA 5F89B 3U36A 4YL9A 1TIUA 4LAQH 4ILDA 5DMYA 4QHUB 3BT0A 3LKPA 3C8KA 1DZ0A 5IFAL 1AKJB 3ULVE 4Z8FH 1AZVA 3U0TB 2UXVA 3L9YA 3WHE1 3ZT5A 5ACZA 1XD1A 5CSZB 3S8WA 5IUCA 3KPQA 2AQNA 4GBXC 4D8OA 5C09A 3FB6B 4AJYV 2X89A 3QEQB 4CVXB 3JVGA 1NBVH 4BCXA 5JORA 1CU4H 4W9FC 5ANMB 4H5SA 1RZIB 1JD9A 3HPLA 1C8PA 3BEWB 4NHUB 4LHUA 3VI4A 2DWXA 3BLBA 4JFDB 5HJ3A 1NCAL 3KPSA 2X40A 2BHYA 4L8SA 4YDLC 2CHWA 3PABB 3RWFB 4ZUWB 3D50A 5TH2A 3QJFB 4L37A 4AG4H 1B3JA 4UNIA 4LCWE 2ATPB 3BYTA 4F7PA 4KVCL 3WY1A 3NIDF 4FQJL 4ZMZA 2N7BA 4KO7A 4XMKL 3HTLX 4ZO6A 4JM2B 5EIIB 5B3NA 2VDQL 3ALPA 4FD0A 1S46A 4U6YB 1EHKB 2XZQH 1UVQB 3UTTA 1GGTA 4HCGA 3U9PL 5L6YL 2DQHH 1IVTA 1NUGA 4S10A 3TVMB 3Q06A 2WKOA 2PW1A 4PREA 1WIUA 4J8RA 1FL3B 3KAAA 4NSKB 3Q2WA 4P4KD 4F57H 2VLKA 2FLBT 2BNQE 5TE6L 1T03H 2Q86A 2QQNH 2APBA 3K0YA 4BZ2H 3BSZL 2EVFA 2YFNA 2OM5A 1FNEB 1PGRB 3MOBH 3A6CH 1SHWA 2MQGA 3VU1A 5AVSB 2VYRE 3KBEA 3VMPA 1YYCA 4HXAL 4PJAF 4PCSA 2WBJD 4F7KA 3ARQA 4L1SA 3VAEA 4PJXA 4HPYH 1MFAL 2IVFC 1YAZA 2XICA 4I0CC 2H41A 4G6KH 4PGEB 2JVUA 4FQXA 3E7JA 4K3HA 1L9RA 1NIBA 3RX7A 4RFOH 4KTDL 2ADYA 3MMEA 2P1YA 3GJFA 2AEOA 4V33A 2YA1A 4GYBA 2YS4A 5LN4A 5FC9A 3ARYA 2NLJA 5FB8A 1I4FB