3LZNA

Crystal structure analysis of the apo p19 protein from campylobacter jejuni at 1.59 a at ph 9
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lznA00
2O6EA 5I0WA 3LZPA 3NRPA 5I0XA 5I0VA 3PJNA 3NRQA 3PJLA 3LZOA 2O6CA 3LZRA 3LZLA 5I0YA 3LZQA 2O6DA 2O6FA 3LZNA
chains in the Genus database with same CATH superfamily
5DSCB 3NCXA 4TUOB 4A7GF 4P5TB 5JHDE 3JVFC 2WINB 4OCYL 3O3BA 4S1DC 2VH5L 3P2BA 4HZ1A 1VACA 4TRPL 1Q1JL 6PCYA 1OSPL 2EO1A 2VTFA 4S0HA 9PCYA 3NK4A 4DO5A 2BNQB 3CFEB 3IJYB 5D71L 1A9BB 5E2TH 4NKDB 3TYFA 1BP3B 3MJ7B 1PZCA 3RZCD 3ARYA 1GGCH 4GAYA 3FCUB 3O2WL 1BVLA 3LSOB 4OZGF 5AVZB 3FC8A 3VRJB 1MCQA 2XWJB 4NUGL 2AEPH 5ACLA 3QQ3A 3BVXA 3Q7JA 3O4LD 5C0AD 3RPKA 2F19H 3V4VL 4X6EA 3ZBMA 3CZKA 4MJHA 4HSAC 5KVGH 3AQYA 2GTZB 2ZSVB 4DEPC 2DH3A 1NANH 1YC7A 4M8RA 3U7YL 4O5LL 3CC5A 3IGAA 4FI7A 1PSKL 2V37A 4U6YB 4XI5C 3GK8H 4IGBA 3ATFA 3RWEA 5L2KE 3HZMB 3CXFA 4DEPB 4OIAA 4YE0A 4AG4L 4ZS6D 5DK2A 3OKLA 1AG6A 5DWUH 4KI5D 2AQSA 3L4WA 5CMAA 4KKLC 1T03H 4HK0B 4X7EC 1S5HB 3NIFF 4XTRD 2VAAA 5FGCE 3IDIB 2AV7A 4G1MB 4F33A 2QDWA 3CBKB 4ZPVB 5A16A 4ZXBA 3W38A 1HXKA 4ETYA 2F5AL 2H6UA 2AP2A 4J3OC 1FZMB 3IU4L 4I4WB 1IKFH 1TZ8A 3HHMA 3VWKB 2L04A 4XNBA 2AF2A 4NCC1 1R3HA 4E41D 3D39D 5LN8A 2GHWB 5T5FL 2EABA 2XNAB 3FAWA 4J3UA 1ZLWK 5B38A 2EADA 4KXZI 2R2HB 3TA4D 3MUUA 1SOXA 4LARH 2L3BA 3IU3B 3PLYA 4ZS7H 1MH5B 2VLLB 3VXQA 2NZ1A 1JNLL 5I73C 4Z7UE 3OAYK 2IWKA 4BKSC 1CFVH 3Q48A 2RH0A 3W0WE 1LQSR 4I77L 5DJAA 4NQSA 3QB7C 2BO0A 3WUZA 2BHUA 1I9IL 5DYOB 5EF1A 2BSSB 4KY2A 2R59A 3AS3A 1BM3H 3KLLA 2H0JA 3BJLA 5CN1A 3TEWA 3TO2B 4HEMA 3QORC 2V9RA 2IH1B 2DQDL 5JIQA 2BLFA 1OE3A 1TZHA 4DQAA 3ARRA 1GTNA 4P99A 1YY8A 5DK3A 3UABA 2CR3A 3TBWA 1FP5A 3F62A 3K80A 5ETUB 1AOZA 2UXVA 4RISH 3VI4F 2ZWZA 3ZL4H 3QORB 3U4BL 1FVEA 4XVSH 5E03A 5BMFH 1IKNA 1IE4A 4XBPB 5J6GB 1OM3L 5DQJA 3VXUB 4O02H 4KMQA 2E9JA 4AK1A 3JTBA 2VDOB 4PJ5A 5HI3D 2XN9D 4FXLA 4K94H 3BSZA 2BVOA 3B2UC 2X1PA 2EZ0C 1CN4A 5D7IB 1ZVNA 3GMLA 5LGJA 1XR8A 1I9RH 1ZSDA 4LASL 1E6JL 3CIAA 1KELH 5B39G 1CGYA 2Q7YB 4KVCL 1MRFH 1TO5A 4CVXA 4AZUA 1FGNL 5KTEH 2QQQA 2K1MA 1J1OH 1D5MA 3NFNB 4ONHA 5C3TA 1MI5B 2F74A 2CLVA 4XB3A 4Y4KD 1CICD 1QD0A 2GG1A 1QI5A 5IMKA 1OY3B 1RZIB 4NNPL 3NN8B 1YLBB 2X4OA 4U7MA 2ICWA 1MWAA 3F7PC 3K0WA 3LPOA 3KH3A 4NZUH 5DGQA 1E28B 3HAEA 5DQDH 3ULVF 3TCTA 2XWEA 1UJTA 1P4IH 3QZOA 1LEGB 4AYBA 5GGVL 4YDVA 1VADA 3TLRA 4KZDL 2JI3A 3KWVA 3FQWA 3UX9B 3PFQA 3SCMC 4OFDA 4JO4H 1IGIL 1R3JB 3H42L 4JFOA 4PIBA 3KLAB 1Q1PA 3APDA 4LSUL 2FX9H 1UZ6F 3JBG7 2HYMA 3FBQA 4R90L 2HFFB 4U0RC 4APQD 3SCMB 1F3DJ 4J1UA 4IOSA 4XHJC 2PCYA 1LO4H 3C2AH 5GS2D 3MRQA 2YAMA 5KYYA 4X98A 3FMGL 4U0RB 2JKNA 1AXTL 3FN0H 4OZHF 3F58H 4K2UL 4AQ1A 2QVFB 1P84K 3L1OL 2JELL 3MMEA 1FNSH 4J6RH 1KLGA 1LO0H 2NNRA 5AB0A 5L2JA 1ZHLA 5FO8B 3FQTA 3OMNB 3OR7B 3CZNA 6CGTA 2UY6B 3MC0A 1IGFL 1PY4A 1S9WB 3QHFL 3WDHA 1IC5H 2YPLD 2GPZA 1Z6JT 1CXEA 4IRSC 2FJSA 4LSPL 1PIGA 1F1GA 5BRZA 3MR9B 2PWDA 3CSBA 4NDMB 4FTVD 2ZJSH 4JDVB 3VGGA 4HPHA 1XGUA 1UD8A 2Y7MA 2QKIA 3KR3L 3QJRB 4OF6A 4TTGA 3TBVB 3LN5A 4U4BA 2KYIA 5F6HI 1NAMA 3H3BC 2G30A 1IV8A 1O5DT 2P5EA 4MFHA 3H0TA 5IVZA 2E4TA 3RG1C 2OTPA 4WVRA 1PZUB 2DTSA 4FZ8H 1KPUA 4WJ5B 3QPXH 3WTXA 1VFBA 5J6SA 2OZNA 4IEFA 5C0AE 2FD6L 3RX9A 3O4LE 3TPUA 3POHA 4AV0A 1YJDC 1PCXA 2KLRA 4XMZA 4KNQA 1MCSA 1IIKA 3V7MA 4PJAB 3VXPB 5JLZB 1CK0L 1SZNA 2C3VA 1N67A 1IQWH 5DUJA 4HOWA 1C12A 5LCVL 2Z92A 2WB7A 4PJ8D 3HN5A 4X99A 4AYSA 1NDMA 2EEAA 3VGHA 2DQCH 1OK0A 4U6TA 4X8XA 2JNZA 5M7QA 5HBBA 1A7OL 3DXAB 3GMRA 5EU5B 4P4KA 4B9ZA 3WUWG 5HHPB 3MCLL 2OW6A 4GQ9L 2AEIT 3QIBC 4F7PA 2MTAA 2BRRL 3FO1B 4UUJA 4XN5A 1I53A 2YXWA 3I9AA 2JJWA 4WW2B 3CHXA 3OGCA 4E41E 3D39E 3WLWD 3QIBB 4QRPE 3TEYA 4IBZA 4QHMA 3KYOB 2F5BL 5GZND 3CZGA 3DOSB 5DDHB 4FQLH 5BJTA 3SDXA 3VWJD 2PABA 3TF7C 2Y36L 4JFZH 3STBA 4DWHA 3DGGB 2H2SD 4NUJA 3MV9D 1W15A 1IQDB 2TRYA 3CBRA 1U6AH 2IFGA 2O5YH 3D18A 1G0DA 1ML0A 1CR9L 2EYSB 2Z8RA 3GJEA 3MLXL 4I2XB 1U95B 2CJUL 4KJWD 4YGVB 4NGHH 1EO7A 1HZHH 4MCYB 3V6BR 5TE7L 3ZTDC 2QVIA 1BAFL 2GI7A 2X88A 3RQ3A 2BNUB 4NHCH 3SD5A 3ZE1B 1NIDA 1XZ0B 2BVQA 1CYGA 2C9AA 1JK9A 3MLTA 4JDZB 5ABAA 5EEWA 1WA0X 5FLUA 4NB7A 1ORQB 1Z9NA 2IQ9H 3IKCA 2J3SA 4JFPA 2XKNA 1U91A 2Y22A 1MAKA 4OH2A 4X50A 1RUAL 3LRMA 4CSZA 2WAQA 4Z7WB 2EDHA 3C8HA 5I0VA 3QQ9D 4MAYC 1IE5A 5CD3A 1T80A 4JRFA 3L4XA 5CSZB 1JZJA 1I3UA 3AREA 4NHUA 2VDNB 2R0ZL 1JZ5A 3I3EA 1TCRB 2JK5B 4KQ3L 1AAJA 1RU9L 4UOW0 5CIPB 5HJBA 4MAYB 4OKVB 4JY5L 3QZWG 5DEFB 3BSZL 4YX2H 3M88A 4FFWC 2XWZA 3C6LA 1F1AA 3LXBA 2JE8A 1GAFL 3F8UB 4JFFA 5C8JB 2UY7B 3EYVB 4M1GL 5B1BB 5C0FB 1IAIM 3TS8A 1RIVH 1NBVH 2G2RA 2VDKB 3B5TA 5K1VA 2PPFA 4YLCA 1BMWA 2A74C 4NOBA 4NENB 5E1IA 1E2VA 3PJSB 5J57B 4FXKB 4I7ZC 4IMLB 1A6TA 4FHJA 1G7QA 3KHOA 3KWTA 4ZPTA 4PJGB 5GGQH 2A74B 2DIAA 2NQDA 2W94A 3FU6A 3MJGX 4PW9A 2B16A 2WTPA 5DJYB 3SZ6A 4NLHA 4ACTA 3SQOH 5E9DB 3LZRA 4KZ0A 2G4GA 4G80A 4ODXB 3ILDA 4PRBA 3W9EB 3Q01A 3B9AA 1LDPL 2EH7H 4ZOCA 2OMYA 2E27H 1O6SB 4HIQA 5LXVA 4P59H 4MHHG 4NKMA 4PYGA 5IOKA 3D0VA 1DZ0A 5IMMB 5KBKA 1QATA 4NEHB 3FUDA 1L7IH 1BJMA 3FOLB 4BQCA 3HLKA 2VLME 1I3VA 2MMXA 1ROWA 4JDTH 5MEND 2JIXB 3CLFL 3RWHA 1UWYA 4WI5A 4Y5VC 1XFPA 1PDKB 2WWMC 1ZS2A 4YSOA 5F21B 3LN4A 1KTCA 4YFLF 5H8DA 2O61A 5JNYB 1FNGB 4QWWC 4XMVA 4X6FB 2VITA 5AW1B 3UTQB 3WNJA 3GIVA 4Y5VB 4PRID 2FYYA 3WJLA 3ZHFA 2N7BA 4JHAH 1UA7A 1WH0A 4BGLA 2O5ZL 1BEXA 4LOUD 5D72H 4YSQA 1KB9K 1ZLVH 5JOFB 5DJCB 2QSQA 4IK7A 3G6DH 4PH8A 5FA4A 1YVLA 4XOAA 4MJJA 1LHZA 4M9PA 1EEQA 4GAYB 4CSTA 2Q9OA 4QF1B 4OQTA 2Q20A 1BVLB 3U30C 9CGTA 4QXUH 5L2KA 5DJ6A 4LSVH 4UMGA 5EU6A 3K71A 1F45A 2YPLE 3JWOL 5D2LB 4X7SH 5EV7A 1OHQA 1JAEA 3U30B 4YEFA 4MAUL 3ZKMD 1ET5A 4XP1L 3L5WA 1CF1A 3L9EA 4OSUH 5SX4I 3HLAA 1WFMA 4XNYL 3IGAB 1F8TH 3K72B 1M7IA 1N3NA 2CRYA 3H3PL 1BIHA 2Y7QB 3RWEB 1ERNA 2R23A 5I1HL 1DBBL 1S7XB 4LHUA 4N1CA 2Q1EA 5IQ7L 4PFEA 5DK2B 3OKLB 2X0VA 1E90A 4G72B 2ZXWB 1ZVYA 5CMAB 4ZXBC 1E2WA 3O6KL 5FO9A 1WCQA 4C4KT 1KGYE 4KK8C 1YEFL 4F33B 1HKLH 3QDJB 4UT6L 1IGTA 4DN3L 4FG4A 3QUMA 2V5TA 1KFAH 1YC8A 4IOIA 3IN0A 2CHNA 1E43A 4WQOA 4IOFD 5I1GL 1R3HB 2VXUH 3F84A 2ESVE 3BPCA 3GEFA 2FNWA 3CSTA 1KXTA 3W81A 4Z7UA 3DIFB 4NBXB 4R3SA 5IBUG 3VI3E 4G6AC 4HUKB 2IAMD 2G4EA 3L48A 5B38B 3W0WA 3RPIA 4BFOA 3L4ZA 3JWDH 1SHMA 1QBLL 1WS8A 3X1GA 1GW6A 2O72A 4PJ9D 3BAKA 1G7MA 5E8PA 5I9QB 1MPAL 4GY4A 4GNKB 1LNUB 4N8VG 4NPJA 1GSMA 1OP3H 2JQAA 4FEIA 3GNML 4ZX6A 1RZ8A 3O6FA 4GXUM 1DQMH 1U8OB 3D0LA 2AQTA 1JXJA 4JPSA 3RVVD 3ARBD 1LE9B 1KUMA 1IC0A 1OAKL 2EICA 2YUZA 1J0ZA 2CGRH 2V6HA 2LU5A 5AOMA 2D73A 2VMFA 5E9NA 3SDCD 3WAJA 1F97A 1I1AD 1QLRB 4PCYA 1AO7D 4FD0A 4LDLB 3OJDA 4WF7A 3W11D 1PY0A 4AYFA 4A2MA 4YHNA 4JLRA 4ODWA 1IKNC 3VFRB 1TZHB 1ACZA 3LNGA 1YY8B 4YVUA 3NGBB 3RX8A 4JM4H 3U36B 5KW9H 1I1FA 4MCNA 4RCAA 3ECVA 2WBXA 2ZWKA 3BI9X 1GJWA 1PVHA 2F7PA 3UP1A 2M26A 5DQJB 5KVFL 4K23H 2GSGA 5DD3L 3U0WL 1UZGA 4KX9A 2DWSA 4MDJA 4LLUA 4OCSL 2W91A 3R8QA 1DE4A 4RX4D 2B77A 2HFTA 1FQ9C 2JJSA 1XSKA 2CBTA 3MDJA 3NEXA 1DN0B 3INUL 4UIMA 3FULA 3IPFA 3KD4A 3QDMB 3G9AB 1J88A 4OAWB 1F3JA 1NCOA 1KNOA 3MRCA 1Z5LB 1W6WA 5IJVA 3GD1C 4LNRB 4KQ0A 2GK2A 4NWUL 2V2WA 4GBXC 4R8WH 4WFGE 1PAMA 5ACZA 5IWLA 5IMKB 1MFDL 3QIUD 5IUSA 3LRGA 3O45A 3Q2VA 4GBXB 5INDB 3PIQA 1MWAB 2OW7A 5DUMH 5F7DA 2XTJE 1XCTB 4B9YA 2EINB 3FONA 4JL2A 1QBAA 4WV1A 4YBQC 4NNYB 5FPIA 3FT3A 1CDUA 4YDVB 1MFEL 4KKRA 2JKLA 1BVOA 2CUAA 3FQWB 3KYKH 4U1KB 2XG5B 3RE0A 3QAQA 2PR9A 3EOTH 4U1SA 1HFUA 3Q6FB 3C6SA 2PW2A 2F58H 5KBMA 2XA8H 4YDKH 1LD9A 3LHPL 3NCYP 3QEQD 4IHOB 3ESOA 4EPSA 5CGTA 1FLRH 1B4LA 3FU8A 35C8L 4PJHA 4I87A 4J1UB 5TF1H 4DUWA 4M48H 4AQ1C 1T5KA 2CBMA 4X98B 5FHBH 2UVEA 1W72L 4E9RA 3R19A 4OR1A 3G6JA 4XX1G 1F90H 4N0FA 4AQ1B 4DZBB 3FTSA 5F96H 4NO2B 1SPDA 3O3DB 1AZVA 3MMEB 1J9TA 4H8WH 5T1MA 3D05A 4RGMB 4CVZB 1JV2A 5L2JB 2WXJA 4JGUA 3FQTB 3I74A 1JPTL 4H40A 5TQ0L 4YBLC 1KTRL 2WXFA 5CUSH 2R1YA 3DIVA 5DQ9A 3RWJB 3VRLE 5IP4A 3RZCA 2QKIC 4YSRA 3B83A 1KSRA 2WCSA 5F1OB 6FABL 4BUGA 1YCSA 3VM7A 5BRZB 4A68A 2O1AA 1C1EH 3L8QA 1JPFA 3QRFM 4PJCF 4JPWH 1I8IA 4YBLB 2H26B 4CMMA 5C09D 1XGUB 5GHWH 5C0AA 3O4LA 2QKIB 2ITEA 2K8QA 4L9LB 1YEKH 2K7QA 4QUOA 2VN3A 4UV7L 5IVZB 3UL4A 1QEXA 1PTZA 2WUCL 4L5FE 2DQGL 4LIQE 3P0GB 4P2QD 3UPRB 1K4DB 1DQDH 5HDBE 4YUEL 3ARQA 1F4YL 2PP8A 3V6ZA 1VZHA 1BFOA 3V5KB 1DBML 2WNWA 4MCZA 4HALA 3RHWK 2DD8H 2JKSA 1JTTA 2XXFA 1N4XH 3EH4B 3L3GA 3WCYA 3APFA 3QUHA 2XV2A 1A0QH 4AIZA 1GY1A 1G87A 3FUNA 3O6LL 5E6ID 5ABZA 2ZG1A 1S4IA 4FZEL 2NT1A 3EFDL 3C5SB 1HEZB 3PDOA 3BH8A 3LVTA 4E41A 2W0FA 1NDMB 3D39A 1L6PA 4XBGB 5DJXA 1XAUA 3K0YA 5F71A 1AR1D 5DJZB 5FYJU 5ES4B 3QIWD 3WE1A 5EZIL 3NA9L 4O51A 1UB6A 3HC4L 3TFBA 1YEIL 2Q76B 4EVNB 4D94A 3D5OF 1JMZA 3K6SB 3VXSD 1SEQL 5B3JE 5GXBB 4QJ4B 2ZXQA 3GRWL 3NDZE 4CGUB 5IQ9B 4TLTA 4D9QD 2SODB 2OJ1A 1S46A 2EDMA 3IDYC 3LKRA 5D7JC 4PGDA 1IM9D 4HOZA 1EZVY 1UM5H 1UOVA 3CUPA 4QHMB 1UUNA 3FN3A 4PY7B 4MJ6A 3ULVH 1P69B 1SY6A 3WJJA 2GC7C 1MY7A 2BSTB 5HVWA 4OGAC 4C59B 4F7TA 5C6TH 3IDYB 5D7JB 3I9PA 4C54A 1M7XA 3FCTA 4FS0A 1Q94B 3S4SA 2DN7A 1A7RL 1NGXA 3PXHA 4FFTA 3D3VD 1OAZL 1X5IA 1FNFA 3BO8B 5KVDL 3BVUA 4OGQC 5A2BA 4R96A 3T0EE 5I8KH 4BWTA 4JO8A 1AS7A 4Y1AE 1WAAA 5HDRA 1RUPL 4RFNC 5K1NA 4Y0GA 2KQNA 1BVKA 3HE7D 4OZIE 2AEQL 3GT6A 3AUVA 4HPYH 1AO7E 1P84J 4XH2B 3IKCB 4RFNB 4ELMB 4BZ2H 1U91B 3AREC 1JDCA 1O9VA 3BT2L 4X7DC 3RJOA 2XN9A 4Y4HD 5E00B 1KG0B 3N6YA 4OIIL 1MFNA 1Q9LB 2NSMA 5AZ2L 1MJUL 3AG4B 3QR1A 4KJYA 3FB5A 2E59A 1J0JA 1UENA 1Y6NR 2JTYA 3C6LC 3NEOA 4WO4C 5JDSA 3ZTJH 2HSIA 4LL1A 5L7XL 2NY4C 3L3JA 3QCVL 5EMYA 3QDHA 2IVFC 4FL4B 1J05A 2D7QA 2K4WA 4F58H 1N70A 2AJYL 1UCBL 5K39A 4JVWA 4WO4B 4AVHA 4K9JA 1EVUA 3BKMH 3TBTA 1FWXA 1IM3B 4Y4KA 1CICA 4AEHH 1NBZA 4BM7A 4H88L 1USZA 2W07A 4FABH 4TVPD 1LMKA 3C9NA 4PD4K 5IGXL 1RAMA 4CADA 5FUOL 1A3RH 2W0LA 2FUQA 1A6TB 1ZK9A 4MDRA 1AR2A 2C3XA 2Z8SA 4RZCA 4PGCB 5E5LA 4G80B 1I9EA 1CF8L 1WHOA 3GSQA 3JZYA 2D03L 3RGBA 1ET7A 3TTYA 4N6QA 2NY3B 2UWEF 2OMYB 1BYOA 5JHDB 4APQA 3DMMD 1PEZA 5E8NA 5SWSE 3BFQG 1DEEB 2VDML 2HX8A 5IB1B 3ARDD 5D4QA 1JZ7A 5EZJA 4QXVA 2R2EA 2LW3A 4PGBA 3BRDA 4X9BA 4RMVA 4D8PA 1KGCD 3WJLC 1UD3A 2K3TA 5IR1B 1R3LA 2AJXH 1G9NL 1KXVC 5BQDA 5FF6B 1K85A 1FNEB 1QSFD 5PAZA 1GGIL 2JXMA 1EHKB 3RPBA 1BJ8A 4GAAA 3LZNA 4X6DE 5E56A 2YPLA 1KTJA 3CPLB 3VSQA 2YSSA 4HWUA 3W39B 5J56B 3WHE1 3QJHA 4FTVA 4GAJH 1HCYA 3GHBL 5FA4B 3V6OA 1ZDQA 4K7PX 4G2AA 4JJ5B 3B43A 3IJEA 3NTCH 1PBYA 5E5MA 4TNVF 5L2KB 1NWOA 2HXAA 4L2LA 4NRYB 3K71B 1YEWA 3KDMA 1N0LB 1GC1L 2XZZA 4DKEL 8CGTA 3FQXB 5E95B 5K9JH 5E4OA 4QKXB 3LQMA 1E0OB 4FQPA 4NQXB 5FGCB 5FYJL 5C09E 1PGRB 1KBGH 1YA5A 2XFXB 1Q0EA 4H1LH 4J39A 4LVOC 1XBRA 2GAZB 1MHEB 3PE9A 5B1AB 4ABVA 2H8PA 4NZDA 4IKKA 3BEVB 1W91A 1T89A 4P2QE 1MCCA 1DANT 3FBKA 2Z91A 4GEJA 1YPZA 2VDPH 4J3OG 1OPGH 4KTEH 3VCLB 3WNNA 2EIMB 1SGKA 5EPMA 5LGHH 4GO8A 3KLQA 1SUJA 2VXTL 4PJ8A 1RK0A 1RK1B 1IGTB 4Z7AA 3WNPA 4BELD 4JG5A 2UZIL 4WFHE 4XVTH 1AGBA 1G6VK 3Q3GB 1JD7A 4OCWL 3GTTA 4ANUA 3N0AA 4Q4IA 1MIML 4HWEH 1MHPL 5C07D 3EZJB 5DVPA 4R7LA 2PF6A 4Y88A 3NZHL 4P5MA 4Z7UB 4JO5A 3EUDA 1QKZH 3VQLA 4DESA 2OAAA 4U1IA 3QFDB 3T8XA 1T2QL 3HS0B 2B1HH 4W70A 4XN4A 2EILB 5TDPA 3W0WB 1FE8L 2OTUA 5C7XL 3ZDZE 2FJHA 1XBDA 4OFPA 1NDTA 2LQRA 1OAUL 3MODH 5GZNA 1BCIA 1PYWB 3O6FC 3N43B 4X0KA 4CAGA 2ZCHH 4DN4H 1LE5B 3O2VL 3VWJA 1KXQE 1RZ7L 4QYOB 3BW9B 4BV1A 4GKSA 1K72A 1RZ8B 1I85A 3MV9A 3O6FB 4D9QE 2WBKA 1PNDA 3NH7L 1YNTA 4A1RA 4Z7QE 3H2QA 4QAMB 5KN5A 3N1GC 4FLHA 1PG7H 4IIZA 3GMOA 3NCWA 4ZFFA 1Z3GH 1UURA 3LOWA 4RGNE 3D25A 12E8H 2AKRA 3BUQA 2P8PA 2YGNA 3OJDB 3DBXB 2WLLA 3RL2A 3BP6A 3KPRD 1HCZA 1MF2H 4RWYH 3HRZC 3WFCH 5I1CH 4LSSL 3GJFH 3OC5A 5EH1A 1QHOA 5JW3L 1S7TB 2VJ0A 3FT2A 2WSPA 2V9TA 5HGHA 5KUMA 5BO0D 1ETB1 4ZYKA 5GSVB 3HRZB 2CPCA 3H55A 1BAWA 3N2JA 4LLDA 1RZGB 1DLHA 1AQMA 3GTNA 4ONFL 1G9EA 2WAHA 1P9MA 2DQFA 3H54A 4MDJB 4JN1H 1DE4B 1RZJC 2UVFA 1U8PA 2X09A 5GS0C 4FKHA 1KB9J 2ZE0A 4WZ9A 3U82B 1RJYB 1I8MA 3EGDB 5IVNA 3LNHA 1U2YA 2EQDA 4N0YH 1NCWH 2BMKB 1VGKB 4J8RB 4YDNA 1XZWA 1KNOB 3MRCB 1BM7A 5IWLC 4GXUN 1BJ1H 4IRJD 1EV2E 4PRAB 4C83A 1FL5A 1ZLUK 3B9VA 3N9GH 1MW0A 4K5PA 1OCOB 1B4TA 2W95A 4UDUA 1AGEA 3KGRA 2V2WB 3MCG1 4JJOA 1RSYA 4WV1C 4BDVA 5ACZB 3IS0X 1T1ZB 3KBHE 5DZ9A 1GXEA 4PJDF 1YQ2A 5E2WH 1UADC 3PIQB 4EOWH 5HGAA 3BH4A 2IALB 3FUKA 4TVPE 3FONB 3RU8L 3VJ6A 2J6EH 3HMXH 4A7QA 4BZYA 4EZKA 1IFHH 4XXWA 4MLSA 4U1SB 4ZTPL 4LGSB 2X0UA 4G5AA 2G9HA 4KJPC 1PZ5A 5F7WC 2NR6C 2V7HB 4ELKA 4GMSH 5DJDA 1HINH 3Q8AA 5DZNA 1H9VA 1RZPA 3BX7C 3PJNA 5MENA 5AD0A 4Z7NF 5GGUA 3OPUA 4H20H 3BKJL 4UTBL 4NRZA 3Q8CA 5C7ZA 1BZ7B 4Q9CA 1J48A 5EBLB 1B6DA 2UYLB 4GSDL 1OVZA 5EIVA 4FI8A 4HEPG 1FO0A 3Q5YA 4ZFQA 4TL4A 1ASOA 4N0FB 1TVBA 5L4JA 4LP4A 1I7UA 4PRIA 3SD2A 3LXUX 3FTGA 3POCA 4CU8A 2AJUH 2IOIA 3DK0A 4N9GA 3QRGH 3P0YH 5D1XD 3QC6X 1JF5A 5ITBH 1ECYA 3ISWA 5HGDA 1BVZA 3RKDC 3BWSA 3FT1A 4OB5L 4HUUB 2DLFL 4JFYA 3S8WA 2F18A 2ED6A 5T1LB 4ZUTB 2I60L 1JPFB 5IHUH 3DGDA 4HKJA 4CMMB 1V7NH 5C0AB 3O4LB 3Q8EA 1UA6H 4R84A 1INEH 4X0NA 1ZHBA 4Y5XC 4QRUB 3ZR5A 1T6WA 3KYNA 2V17L 1UQSA 3S35L 5C70A 2BY0A 4ZS6C 1U8QA 2BW4A 3OZ9H 4GKOA 2O93L 1VEOA 1W16A 2VRKA 2B20A 3WFZA 4G6JH 2ZG3A 5BO1L 3CXDL 4Y5XB 1SDYA 4XTRC 3K6FA 3V6ZB 1BFOB 2VLKD 3ZIYA 1XWVA 2MQ3A 4TXVB 3M8OH 4TNFA 4M6ML 4YPGA 1E65A 1HH6B 3CFIC 1EBAA 4LCWD 4AIZB 5ESVA 3TVMD 5I5JA 2ZUTA 1H3WM 5HHME 3QI9C 1PLGH 2C9PA 2A5UA 2CIKA 4LEBA 3AS0A 1ZHKA 4TF4A 4X9IA 3S37L 4MWFB 1Z9PA 2NLJA 3BH8B 4C8XA 5CCGE 4E41B 3WTSA 3D39B 4YMPA 3LIUA 2A1WL 4NM4L 4QRPB 3QI9B 5A7BA 1NJ9A 1A66A 3QJOA 4CBPA 2GT9A 2WCPA 2Y6TE 4WTXA 2IAMA 3S2CA 3ZRFC 5EO9A 5AYUL 4ZW5A 3DX4A 4KAQL 4QRRE 1S7WA 1UKSA 3RWCB 3H7BA 4PJ9A 5CZVL 3E7JA 3RY6A 1XGYH 2DDQL 4XMPH 3FFDA 5DC9B 5AW4B 4Q6IB 2RQEA 2PCFA 2JI1A 1MW3A 1CGSL 4P57A 1EXUA 4A2HA 1RI8A 1F2QA 4YSDA 1LTXA 2IGLA 3DJTA 4A63A 1M6OB 3DVGA 3K7UA 5L6YH 1VKXB 3RFZA 1GKOA 5DMKA 4PG2A 2QSTA 2XZQL 4AXWB 1PX3A 4F7TB 3CN2A 1TYEB 4NQDD 3E8UH 5TPWH 1CLVA 3ARBA 3N91A 4U3HA 4R5VA 2AI0H 4XC1H 1K6QH 1YMHB 2P8LA 4NQVB 4R26L 1NGXB 1MKFA 1DVUA 1CFNB 4OCRH 1I1AA 3ZKND 1HWHB 1AO7A 1NBQA 1QRND 4QHNA 1D7CA 5FLVA 1O0VA 3D9AH 4UWQB 5KANI 2B14A 3DROA 5EF3A 1MCKA 3VQMA 3V0FA 4HU2A 4R4BA 5E6RB 3VD3A 2XBTA 2P4AB 1EMTL 5HTSA 4Z3EA 2N3JA 3S5LB 5JXAH 4P9MH 4R5TA 1MCDA 4N90D 5CF3A 4YHKL 2XLLA 1AY1H 4W9HC 5GGRB 1AOHA 1KBBA 3CMOH 2BIMA 2VUYA 1HKFA 4OTXH 3DC0A 3FRPA 3KPRE 4PJBA 2QQKL 4AMXA 4UYPA 4RX4A 4U3CA 3OLIA 3TEUA 1UJ3A 3L4TA 3B34A 4JG1L 1VPOH 3BD5A 5J11C 3IETA 3Q2NA 2HT3C 1KGWA 2J4WH 1OE2A 2FNBA 4KNTA 1JV5A 4Y4KC 3OKDA 3ZZLA 1J05B 3GLAA 4HLZG 4IBQA 4MVBD 1JZFA 1P4BL 3NIGE 4FFZH 4YZFE 2YHGA 3V2AR 5J11B 1AZZC 2I26N 2Z7UA 3T71A 2HKFL 1F58L 1V3LA 1RZKH 1BEYL 3WSQH 1NBZB 3ULUF 3BPNC 5HHNB 4JFEE 3C9NB 3NP3A 3E3QE 3W2DH 2H47C 1AE6L 3QIUA 1ESOA 4GRMB 1IEHA 4NC1E 3O8XB 4PEEA 1EAPA 4G11A 4DPRA 2NY1D 3DUSB 1XH0A 3BPNB 2OMZA 1BG9A 5C0JA 4RFOL 3MJWA 4APXA 2BZDA 4U1HB 4YE4H 5KVEL 1T22A 3KNBA 3KPSE 4RZCB 4APQC 4RNRA 4XAWL 4XPHL 2MIZA 3MRKB 4GRWF 5FXCH 2GBTA 4Z3TA 1FUNA 1X7SA 3HI5L 1GYUA 3QEQA 3THML 2WXLA 2AXHA 1LEKA 3VD1A 2DQEH 4DW2L 1XTLA 3MRRB 3EH1A 3ZMEA 1FC2D 3VE0A 4WUKL 2N0MA 3KYMA 2X4PB 4U0QB 4GUCA 4XGZA 1XEUA 4YVNA 5IFHH 1A4KA 1DBKL 4PGBB 1FIGH 3DUUA 1MRCH 3VU2A 3UH8A 1R3LB 3RTQD 3QWQB 3IAQA 4WJG3 4U6XA 2XPGA 5BS0E 1MCLA 3GM8A 4GG6F 2OXGA 3UZVB 1XH2A 4K71B 1N19A 4R97C 2Q8BH 3ZE2F 5F9JA 1J9RA 4NQCD 2YSSB 3L9RA 4KDVA 1ZGLA 5IKCA 3S5ZA 1S2EA 2D7MA 3QJHB 1QOKA 4JFQA 3EF7A 4R97B 5C09A 2BM3A 3AC0A 4CKVX 4MJ2A 2XWBA 5E5MB 5D1XE 1MCEA 4XZUA 3MX0B 2I9TB 1I31A 2HLAB 2CDFB 3KAAA 3KDMB 1EUUA 4PJIE 3SDAA 2VRAA 3KW7A 1PIFA 2GUYA 4C57C 4HMCA 4P2QA 1MNUH 3V5HB 4YXKL 3FO0L 2J73A 2ADFH 3ET9F 5EC1B 4OD1L 1T89C 3QCTH 3UJIL 3MNZA 3CN0A 5KSAD 4UQIM 1HSBB 2CK0L 3DETD 3GB7A 3N40P 3TCLA 4ZTOL 1XV8A 4HXAL 3FKUS 4PJ8C 2YD3A 1E5AA 3F05A 2ESVB 5E6IA 1I82A 2NXYD 2JVUA 4G42B 4GO9A 5F89B 3VI3B 5FFGA 2VLKE 1BQRA 4H13C 5B38G 1EHXA 4NJ9L 4PJ8B 1RK0B 3G5YA 1BSIA 1F4WL 5CR8A 1AGBB 2AFNA 3DSFL 2Q7NA 4LCWE 4G9DA 3B2DC 3WLWC 4DETA 1FBIL 4FGMA 4LBEA 4XNUL 4P5MB 1KXQA 1G0YR 1R9FA 2ICEA 5KS9E 4U1IB 4FMFA 3VXSA 7FABL 2B59A 4PD4J 3AY4A 5ESAA 5FGSA 3GRGA 2VLJD 5EFIA 2WSDA 2CKBH 2H32B 1X5KA 2GIYA 2OTUB 4HDIB 5AOZA 1OP5K 3U1PA 3UGXA 3V9EA 4BYHA 1IM9A 1NMAH 3S0PA 4I89A 2NW2A 2WTRA 2H2SC 3Q06A 1I85C 2B0SL 3FRUA 4X0KB 3ULVD 3KPOA 3A5VA 3IFPB 2YMXL 2J88H 4QRQB 2NNAB 2QMKA 5JIDA 3EFOB 3KS0H 2X6BA 4OM1L 1DUYB 2Q5BA 3MRMA 1HH9A 2X38A 2JF1A 4EI0A 3IGLA 2OSLA 5DEJA 1NSNH 1YNTB 3WELA 2FWLB 5GRXG 3S88L 2OMUB 4LP5A 2Y4SA 4E0RA 1HDMA 1WV7T 4A2GA 3D25B 4AEFA 1IILE 1DL7H 2AKRB 3GFUA 4Y9BA 2HMIC 2P8PB 3CX5K 3QNFA 3SKUD 4JDEA 2WANA 3RL2B 1AFVH 1JZDC 1KT2A 3HE7A 5DEGA 1LYQA 5ECJE 4UIKH 3J8F7 4OI7A 3QQ9C 1B0WA 3Q44A 4KHXL 3RWIB 1QRNE 3G08A 2OX5A 5LG1A 1DEDA 1P9MC 3L3KB 2ZX5A 2LVCA 4O02A 2Q2LA 4Y4HA 2VDKL 1SYVB 3CDZA 3KDPB 5EIQA 4AV5A 4DP4X 4GW1A 2Q10A 1T5WA 3BQUD 5TTRA 3ISRA 1AQKH 1QVOA 3DPBB 5LNDA 2X40A 1DVTA 5HVGB 4PVBA 2AVGA 3MBED 2CALA 2Y07L 5AZEH 1KB5H 2RMNA 4NAQA 1WZ1L 4BSWA 4ZUSA 2XTJC 1DO5A 3HC3H 1U8CB 4FG6D 1A1NA 4G6MH 3HHSA 3MNVB 3N06B 4N5ED 5TDOB 2FT6A 3PFUA 3PP4L 5LBSA 3HAEG 4I3SL 4M62L 3ABLB 3WIFA 2JKWA 2XTJB 4WNQA 1YQVH 3N85H 2FK9A 1RIUL 4G7YL 4MSWA 1MZYA 2BIIA 4LPUA 3MLZH 4NI6A 5ADPL 3CVBA 5DA0B 4YDZA 5DURB 1IKOP 4OLUH 1C5DB 3MTXA 4BDVB 1B3JA 3MRJB 3VDCA 4M5ZL 3FQ2A 4KV5E 4OD2B 3JT2A 5L8JB 5HGAB 4XXWC 3WS3A 1OCZB 3T3ME 4X4YB 2VDQH 3FZUD 1CT8B 1T04A 1VESA 1M6UA 4TSBL 3M17B 1WC7A 4B9KC 2VWEE 4WI3A 4FQXD 1OARL 5FUZL 1FFOA 2FUTA 5IK3A 2ATPA 3EGSB 4UB0H 5A40E 3V0WL 5I8OH 3DMMA 4XCNA 2VISA 1WBXA 2EIBA 4WNSA 1V8HA 3IDXL 3SQRA 4C56E 3ARDA 5DJDB 4AGPA 2D3LA 5DUPL 5I1IH 4G8IA 3IVKA 1EH9A 3EJSA 3PDGA 4OFYD 5AD0B 5GGUB 4LSQH 3HW7A 1P6WA 2PTVA 4XP5H 1FZOB 3F7QA 2TSAA 4A6YA 1Q9WA 4WHTB 1SMAA 1IAOA 3MV01 1FO0B 3WEAA 4QXGH 1MHCB 2OL3A 3FTUA 3R4DA 4JAMB 4LOUC 4TMPA 1QSFA 3T1FA 3N1FC 3RY5A 3NIDF 3T6QC 3GLDA 1NQBA 2O26U 4LFHG 5IB4A 1I8LA 4K3GA 3LEYL 3TFKC 1E9OA 2RALA 1JF1B 5HGDB 2MEJB 2MH4A 2VE6B 2NQCA 2UUDH 2VXSL 1URIA 1UCTA 3MUHL 4L37B 2PO6D 5E2TL 4CC1A 4G6FB 3ZKMC 3S6CA 1NEZA 1B9KA 2PTTA 4AQ8A 4LAQH 4FNRA 1KF9B 5HYJD 3CXHK 3QUXB 2E9GA 3MBXH 4UOJA 5AKSA 4BKTC 4NBZB 2AEPL 5K59E 3BD3A 4LNVA 2JCCE 3VGFA 2XDHA 1HYSC 5CINH 1EXGA 4P23C 5I18H 3AT9A 5KVGL 3GXMA 3PABB 4I13B 2J57A 2J8UF 5TE6H 3ZDXF 2VIRB 3K6DA 1R0AH 2Y3NA 3BIKB 1TQCC 3PNWA 3ZL1A 2X9YA 3N1MC 3GK8L 1M7UA 4P23B 1N5AA 5C3LD 3QUGA 2CXGA 2A9NL 3D4GA 1RPUA 2EEBA 2CO6A 4AGQA 1WGVA 4DCQA 1IU1A 1TQCB 4Q8BA 5DFWH 1KLUA 1T03L 2Y1ZA 1BQKA 1XCXA 1IGCL 3EF4A 2V7NA 3W9DA 2VR6A 2VUKA 4PS8A 5J1AA 5C07A 3TV3H 3CFBA 2V5RA 4WKXA 3MV7D 2OFQA 1NFDF 2CK2A 2GKIA 2Z4TA 3CN4A 4UU9B 2P49B 5BOZG 4PJ9C 5DRXA 4F5CE 2DQMA 3RY6C 2VERN 4QYAA 2CLZB 3FCBA 5EO9B 5I5RA 2BXZA 1BZOA 2A7BA 2N01B 3OLGA 1ZY9A 4ZO7A 3GSNH 5TQ2H 4PJ9B 3RFZC 1JYVA 4PG2C 3FFDB 2Z93B 1EAQA 2JMRA 3QZBA 3RVVC 4P57B 3ARBC 1CLZH 4LARL 5CXPA 1HHGA 4FA7B 1KBKA 3MLWH 2ZCKH 5DT1H 2VLJE 4KH2A 3T0EB 5KSUB 1AGDA 5F7HA 1I1AC 4Y1AB 1CFVL 2BIPA 3Q43A 2H1LM 3BSHA 1R5VB 1TVDA 3ARBB 4N0UA 4UOQA 5H35B 3W11C 3CFUA 2BVUA 2BY1A 1LGVA 1IGYA 4OZIB 2DICA 1NDGA 1OSYA 2HZHA 1AO7B 4TTDD 4OLYH 2YO3A 3VXOA 2BVPB 3MRHB 4Y7MA 2QZ5A 1BM3L 3KPRA 3DROB 1A9EA 2AQ1A 2H6PA 1WSST 3BVVA 5LGYA 2CR0A 3LPPA 3VVWA 3PV7A 3HUJF 5ACMA 1RMFH 2WB1A 4WNJA 5JPNB 1TOXA 3T08A 5HYQB 3GBML 3FU9A 1UJ3C 3VGBA 4RISL 3ZL4L 2BP8A 4KDTA 4XVSL 4Z8FH 5BMFL 4JANA 1UZ8B 2FL5A 5E7FA 4W9ZA 4XVUD 1F2XK 2CIIB 5ANME 3LEVH 5DFTA 3WOVA 4K94L 1RP9A 2G5BB 4BFIB 5IHZA 2WYHA 4F8NA 5ELIA 4J6IA 4HIHB 1VGEH 3GI8L 3OKDB 1I9RL 4TQEH 4GKNB 4KKCD 3VAEA 4PBWD 1BREA 1KELL 2NUPA 4IRJA 2FSEB 1BIIA 1XO8A 4M7LL 1ZWIA 4ZFOA 2VH5H 5BZWA 2P52A 1J1OL 3UO8B 5HY9B 1Q8MA 4M5YH 2MCMA 3KEHA 3OLEA 1NBYB 4U6HA 5JW5A 4GB9A 3EJUA 4QI3A 5K9OA 3V0DA 5D71H 2WJ5A 1BW8A 2G5RA 3I3DA 3K74B 1CMOA 4XRCB 4W68A 1LWHA 4X9HA 5C0JB 1JPST 5SWSB 5CFHA 5HYSB 4FKKA 3MYJA 1SFHA 2Z31D 1SYSA 3EYOA 4N3TA 3TN0D 5I66A 1JNHB 1T22B 5HI5D 2E75C 2C7UA 1RL1A 2CPUA 5CGYD 5KYXA 4NXKA 1QUNA 1ZDSA 3OKNA 4PJ7E 3OKEA 3WNOA 1J0HA 2IWEA 3UEQA 4JO4L 3U7YH 1CTNA 4O5LH 4X8CA 3VE0B 5F1SA 3KYMB 1ZTMA 1WUNT 4A37A 3ZRCC 4XGZB 4X6DB 3RI5F 4AG4H 2GIXA 5DO2D 2FHFA 2L7QA 3C2AL 3LKOA 3PV6A 4L8BA 3PJLA 3FN0L 3ROLB 4U6XB 2XPGB 4ZMQA 5IFAH 3LRKA 3ZOAA 1JHTA 1M1XA 5D1XA 1LP9F 1D9KD 5HHXH 1FNSL 1MVYA 3IU4H 4GI6A 1MELA 4R83A 5EUKB 4PI2A 1V54B 2RD0A 2VRQA 4PJEF 1ZGLB 5FOJA 1PS3A 1NCJA 4M00A 4X9FA 4OFQA 1CFQB 5T5FH 1IC5L 3PP3H 3HR6A 3SDAC 5FYKH 1IB5A 3C8DA 3NCYS 4TNWF 2J44A 1JN6A 2HJFB 5C0EB 2GCYA 4RMQA 4IBLT 1EFQA 2C1OB 3WFDH 4W9GC 4LHUG 4K7PH 3B2XA 5EU4B 3SDAB 2BWQA 3EXLA 1GJUA 1JZGA 2HN7A 4R6UA 2X2HA 4P5KB 4GS7B 5FWRA 2VLKA 2VDRB 1D5BA 3RGVB 3T65B 1EGJH 2J71A 1L6XA 4FZ8L 5LNGA 3QPXL 4ZDHB 4PB0H 1Z9SB 4MX7A 3MNZB 4I77H 2IPKA 2K8MA 4Q6KA 4W6WB 2GEQA 3GB7B 4LCWA 2YMTA 4OCXH 1XGQB 3TVMA 2AGJH 5E94A 3SGKA 4AKQA 5KS9A 2GK0A 1AR1C 3OHXC 4NQQA 2LHAA 4GAGL 4YHPB 4X4ME 5C0CE 1IQWL 2XIDA 1P0SE 3ZDZB 2ICEC 1YDPA 4R7VA 2IV9A 3OHXB 4ERSH 4HV8A 4I18A 4M3KB 1AQDA 5K33A 3U4BH 43C9B 4P06A 1OLLA 1DJIA 1FYTE 4HWBH 1OM3H 3PHOA 2ICEB 1ZKAA 3P30L 4XC3H 2IV8A 1JPEA 2IH9A 3ULUH 2B59B 3AUWB 4IU2B 4TQIA 1EVTC 2PCXA 5DK0A 1J8RA 3RJDA 1CD0A 4Z7QB 2FJGB 3DDGA 1IM9B 2HTKD 3F12B 4PAZA 3SIKA 5A3ID 2NW2B 3S97C 1RFDL 3MO1A 1Y1UA 1XH3B 1ES0A 4RGNB 1TSRA 3BZFA 3MRDB 4NQDA 1EFXB 1U3HC 3HCVA 4FQLL 3WFHA 3OSKA 1F6AA 2YGQA 3CHPA 2FEEI 2OSLB 2AABH 3NJLA 3KW8A 4GRWH 4JFZL 1G1CA 3DNKA 5JXED 4JG0L 4DFHA 1QRNA 5I71C 1U3HB 1TU2A 1U6AL 2O6FA 1BX2B 2O5YL 3EO0A 4ZMNA 2VW6A 3RA7H 4HOMA 3DJ9A 2L7JA 1ND0A 2CKBB 4LCIH 4JDEB 1BPVA 4NGHL 4P2RD 4AYMC 1HZHL 1KT2B 2CNZA 5E5RB 1BQSA 3A0OA 4A7GA 4TULH 5DA4A 3P3RA 4NHCL 3BIAX 3G08B 2PYFA 4Y4FD 2OX5B 1QBBA 1RHHA 4PRHE 4M8QB 3QZPA 2AITA 1P5VB 2HTLD 3CFKB 4WU5A 3VRIB 1IGIH 1OF0A 2IQ9L 4PREB 4Y8DC 1V3MA 2ZNXA 4GW1B 1T5WB 3P73A 2V8MA 1QVOB 4R90H 4R7NA 1QR1A 1UT2A 2VZOA 5BZZA 4P9HH 3EBGA 2C7FA 2VLRE 1XD1A 1VCAA 4FQIH 3AXIA 5GGTA 2PNDA 4ZUSB 1Z7JA 4WFFE 3FMGH 1U8LB 2F1AA 1A1NB 1AXTH 4MNGE 3IMRA 1MEXH 3U7AA 3EH2A 4YX2L 3KLSA 1L9OA 5LAPA 4JZOA 2QTEA 4WWID 3DO4A 1XVSA 2JELH 1J8HE 3OC8A 1XSJA 3NUKA 1JWUA 4M02A 4MMZA 1RIVL 1NBVL 2W38A 4EZJA 1DO6A 2VXQH 5HDWA 1YYMH 1BFTA 3NJMA 3QHFH 4UANA 1MHHB 1JS4A 1NCUA 3B7RL 1H9DA 3F3HA 2EXYD 2Z7ZA 1BXAA 3C12A 4HCFA 1ADQH 1J1PH 3DMMC 5A6MA 2EDYA 3IDGB 4WKZA 1WC7B 4CU6A 2J5WA 3KR3H 5GGQL 4CA4A 3ARDC 1MN4A 2Y5TA 3BISA 2AQQA 5AW2B 5B7MA 3DGCR 1XCWA 3WMPA 4KGJA 3REVA 3JV0A 4LLYA 2EH7L 1NFIA 4UBDC 2E27L 2RJMA 4ANKA 4AX3A 4GSUA 2KHAA 4HSQA 4P59L 2BFGA 5IEKA 4G8IB 4R2GD 1L7IL 2EE3A 2DZEA 3OBAA 3IE9A 4JKKA 3RIAK 2K7PA 3N5AA 4YR6B 4JDTL 4A6YB 4Y1TA 3RTQA 1CBJA 4CNIA 1IAOB 1L7TH 3A3YB 4ZMXA 3C5JA 3TBCA 1BYNA 1CK0H 4UAHA 2OL3B 5D7HA 3WKPA 2B1AH 1QRKA 2DEWX 5EF2A 3SE9H 2IIJA 4NQTA 4NAMA 1JCVA 5BV7H 3FOMB 5AOKA 2O6DA 3SE4A 4AMKL 3L7FB 4NQCA 1YUHA 2EKSA 4FNLH 1BLIA 4JHAL 1A7OH 2Y1VA 4ZSOE 2FWUA 2FVNA 3SDDD 1NFKA 3PPEA 5D72L 2BSCA 4Q56A 4J3VA 2BSED 3WN5B 2M1KA 4OGZA 3G6DL 5DZVA 1NLDH 4XPBH 3X1BA 2WNGA 2OZ4H 2H4EA 3CQPA 3F7RA 1S9VA 2FECI 3HR5A 4QXUL 2Y7OA 3CX5J 4BQ8A 3LNEA 2KI6A 5HVHC 2EE9A 3DRTA 4ZFZB 4B9JA 4X7SL 1L3NA 2HKAA 3WO4C 3KM2A 4G9FD 3VI4A 1VZGA 5F3HA 4PP2B 5HHMB 1KXHA 4OSUL 5HVHB 3TASA 5KSAA 1TJGH 4F80A 3S7GA 3QG6A 1TF4A 2BS9A 3PNWB 4C4KO 3WO4B 3TT1H 2RR3A 3LD8C 1XXDC 5CZKA 2Q6WA 2YD7A 1UKQA 4FXGA 1D2OA 1J5IA 1OCRB 2AK4D 4HK3J 2CO6B 3AMLA 3IK2A 2XQBH 2YFOA 5A7EA 3MXWH 4I5BA 3LD8B 4QTIL 5TE7H 4QRRB 4RQQA 1BAFH 1IT9H 1GIGL 4HJTA 5HHOE 3QBTB 4QHUB 1GGBH 3QO1B 5HVFB 3ARFD 5DJ2A 1KFAL 3CFBB 4HFWA 1Z0NA 4D8OA 4Q97A 2NMSA 2ZX9A 3FHAA 3VYPA 5DUBA 4AQEA 4I48A 2C9VA 3F65A 1DR9A 5DRXB 2VXUL 4V33A 2EVIA 2VLJA 1I8KA 2A9BA 4W4OA 5C0DB 3QR0A 4MDIB 2AW2A 2K3HA 4AI7A 1WISA 2WZPD 3KGUA 1NIBA 4KQ3H 1P6FA 4NSKA 2YWZA 3MKKA 4HXBH 2XN1A 1JUFA 2P5PA 3EGXA 2WP3T 4M3HA 2R29A 1AGDB 5FGRA 2MWCA 1TTRA 3DHPA 3S96A 1WFOA 1NINA 4W9KC 1HHHB 1XIWD 3VFOA 2OXHA 4PJXE 1DQML 4JFUA 5DJ0A 1L6ZA 3BWAB 1G7PB 1IGYB 2X2UA 5MEOB 4CRPA 2DQJH 3P4LA 1CE1L 1HQRA 3T2LA 2N1KA 4HZLB 2CGRL 1ID2A 2OJEA 4WTQA 3VXME 2WXNA 1C08A 3P69A 1TEYA 3KPRB 2C9RA 1BZ8A 3F6JA 1EHAA 1E8ZA 2EUVA 1E9QB 2J8HA 1CG9A 2WOYA 3BP7A 4KDTC 5EOTB 2QR0A 3QT2A 4UZGA 1PEWA 3FUHA 2CDEA 5GGRY 5I6PA 4BZ2A 2A0LD 4HJGA 1R3IH 2GITB 2NX5E 5KW9L 3FQ4A 5EUOE 1PQZB 3BQUA 1BZ9A 2Z64C 4P2RE 3E3QC 3NIGB 4KGLA 4KK9D 1OT4A 3MBEA 1CQYA 1HWWA 1NICA 4H25B 4NC1C 1U3YA 1ETZA 1RUML 1O5PA 3ALPA 4K23L 4MKTA 2NCEA 3TO4B 2BS71 5EEVA 4IRJC 4GW5A 4JFEB 5IHZB 2DQIH 2F54E 4L4VE 5F8RC 3AMKA 4JCWA 2R0KH 3UEZA 2WXIA 2NUPB 4ANWA 3EH5B 5JO5B 3CH1B 1AP2B 4HETA 3CXHJ 4AYID 4MD0A 1ZWIB 4FDWA 4L8DA 4TOYH 1X5GA 2PYED 2APTA 1UOWA 5SWZD 1R34A 4X5WA 3KPSB 4LZKA 1CWVA 1KCKA 4HWNA 5JW5B 1UWXH 2JQZA 4R8WL 4MD4A 5GRVL 1IFRA 1R5WA 4I9XA 3QNYA 3TURA 1ZE3H 43CAB 4JRXD 1QAWA 1XB6A 4PJ7A 2DJSA 5MP6H 2OKMA 2X4UB 4KVNH 4DIXA 3EYOB 3JWNE 3CHRA 4FQXA 5DUML 2QV2A 4KFZC 4GSQA 4ETQB 2YSTA 4ISVA 2BK8A 5ERWA 3QNZA 1JZ2A 2C7UB 1RP8A 3LPGA 3HBQA 4PLNC 2E7LA 1R5IB 2Y25A 4LLQA 1UXMA 2COVD 3W1ZA 4TQPA 4P8QA 1A8JH 3GSVA 1AS8A 2F58L 1K5NB 2WYIA 2XA8L 5BS0B 2ZF9A 3L6FA 2E47A 4OFYA 5IVXF 1XF1A 4Q52A 2EXSA 3P11H 1VFAB 3O41A 3FO9A 1FLRL 4ZMOA 1XXFC 5TF1L 1B0RB 4M48L 3U2SA 2ZKWA 4EUPA 3UJTH 3PV6B 2OCCB 5MEPA 4XNXH 5D1XC 5IJKA 4IU3B 4W1TA 1YRKA 1T5XA 3DBSA 3MRLB 5C9JA 4UAOC 5EEZA 3ULAB 1YY9D 2WWKO 1KTDA 1WZMA 1NCTA 1G6RH 1F90L 2CCVA 4O2FA 1IC4L 3RRQA 2VL5A 1FL3A 5BNXD 4GG8A 4XNMA 1JHTB 1M1XB 5D1XB 4ZUVA 4NO0B 3MREA 4H8WL 3IDUA 3MRGB 3B7SA 4UAOB 4BFEA 4PJIB 1H3PH 5I1GH 3DX8A 2JKIS 3NFSL 2PO6A 3B5HA 5TH2B 1JZ8A 3DX9B 5G4NA 4BFJA 5CUSL 2W65A 4XR8C 4U1GC 3JZ7A 4KROD 1JN6B 4BA0A 5HYJA 3V6FB 1M2VA 1NKOA 3L7EA 5JUEL 1ZIAA 5CBAA 4JPWL 2XWDA 4Z77A 5GHWL 2D7PA 4N2NA 1QSED 3ZHDA 2ZKYA 4U1GB 1MPAH 1KIUA 3OJVC 3JVGA 3SYCA 3QH3B 3HNVH 3KBEA 4M61A 1BQ5A 1YEKL 2HN7B 2H3NA 3ARUA 3DOHA 1P53A 1SBSH 5D70H 3TEXA 4V1DB 4GUPA 4MX7B 3P9MA 1IBFA 2CRIA 3QNXA 4LF3A 4HHAA 5IQOA 1G9MH 3WTUA 5F7NC 3KZ8A 4KX7A 1MOEA 3FCSB 2AV1A 4EN3D 3ZIMA 1OF2A 2DD8L 4NQUA 5E94B 3BUIA 3A4EA 3KGTA 2LABA 4I18C 3PWJA 3FQUA 1U58A 4UF7C 3RAJH 5I19H 2MPVA 3MV7A 2Y06H 1OB0A 3JWDC 1BVNT 2G75B 4J3OF 4HV8B 4I18B 4RSYA 4W9FC 4Z78B 1DVFD 4WEMB 5HDQH 1NUGA 1TNMA 4JRYD 4MA3A 4JFXA 5EIIA 3P3YA 2DIBA 1ZGLM 4E68A 3VXRD 1JGDB 1OD7A 4OCSH 3IE4A 5DK0B 4RFEA 3STLA 5KAQF 2XA3A 3B2PA 4YL9A 4EDWH 3OKYA 1HIML 3FSVA 1A6ZA 1EZSA 3VDBA 1ILSA 1ES0B 1OTTC 4GT7A 1G7HB 2BSRA 1UM5L 3BZFB 5I1AB 3BGFC 3ULVL 1FJ1B 1X7TA 3AADB 5K93A 3O3UN 5IHWA 3WFHB 3WEXA 1KPVB 3VFPB 5C0BD 2GFBB 3AG1B 2C9XA 3HG0A 3L3IA 4FHBD 4YEEA 3ZK0A 5C6TL 4NWUH 1QRNB 1TFPA 3BGFB 5M95B 1F6LL 2PPAA 3EAKA 3TNMA 1TU2B 2B4CL 5AAMA 4NPKA 1NGWB 5LDUA 3X3FH 3US1A 1TMQA 1NGZA 4WRLA 1ND0B 3GQFA 4N2CA 2Z1KA 5I8KL 1WRFA 2E7HA 3E38A 4G1EB 4PTUB 4ADIA 2A4ZA 4AWJC 4AW7A 4YSCA 1JMXA 2V2XB 1D7BA 1TTUA 2P8MB 2X1OA 1ZANL 2PYFB 4HUMB 4IBTA 4NP9A 5BQ7A 4HPYL 3I50H 3AABA 3JTSA 4J8QA 5ISZE 3PL6D 1OAYH 5DVNA 3LHPH 4BH7A 2DM4A 4S1SH 5D7IF 4R7NB 5FYLH 5I1KL 3R06B 35C8H 2YKKA 2NXZC 5CLWA 4PUBH 1FFNB 3MOBH 3O4OC 3WKQA 1BD2E 2HB0A 1BWMA 3GS4A 5JHMA 3N40F 5IB5B 1QNZH 1W72H 4PV9A 2NXZB 4F37K 5CEXA 2VWEC 4XPTH 2MNJB 3O4OB 4MMZC 2R9HD 2NY1C 2X4TB 3OAWA 4FNSA 4F58L 1MZZA 1CI3M 1I1YB 4QTHA 1DZBA 3X13A 3BKML 2DMHA 5D2NE 1N59B 4MMZB 2NY1B 4FABL 4L0ZA 1JXDA 1JPTH 2VC2B 1BZEA 1Q4NX 4M56A 5L0QC 2RFXB 1A3RL 2BIQA 2AMUA 1IBGH 3KCWA 4OLVH 5FW6A 3TN0A 2Z31A 3B2VL 4C56B 7CGTA 1KYOK 5SWZE 3BDYH 1N7MH 5AKRA 5CEZE 5T3ZH 3C6EA 3GGWA 4ZMLA 1KN4H 1XF5A 1NGQH 4WKZB 5DGRA 1P1VA 1URZA 1NMBH 4BXVA 1A65A 3V0VA 3W3BA 1DFXA 5FECA 7PAZA 4HUCA 5CS7A 3QK0A 4NQEB 3HI1A 5K9KA 2DQGH 1A1OA 1H3VA 3RTQC 3GSXA 5INCA 3M86A 5KBLA 5E1AA 1LVEA 3G5WA 3KPPB 1YEJL 3OZLA 5KJ7E 3TESA 1E40A 1DQLH 1PZSA 3RTQB 2GYSA 4JY4A 5ICZA 3SE4C 4F1SA 2OYMA 3C5JB 4EE2A 3QUZD 3O6LH 2AJXL 1ZVHA 3X14A 4FZEH 1D9KA 3LQZA 1M56B 2R69L 3RUGE 1HZKA 1ZT4B 1ZVSB 4WGVB 3TM6A 3BH9B 4Y1SA 4XN2A 2F53D 3GIZH 5IFJA 1D7DA 2DWEB 2JCCB 1OGAD 2P24A 4K5LA 3EJRA 5EZIH 1MLBB 1JF6A 1HOCA 4FLRA 2JFCA 1YEIH 4GAJL 2W9EH 5EBWA 2FRGP 3MACH 1KJ2H 3AXLA 3NTCL 3EBAA 3UYPA 4FQQA 3HR5B 1A02N 5T3XE 5JZ7D 3JV6A 5AVTB 5KSAC 3SY6A 1K2DB 3BP5A 3K81A 3DVIA 5B1JA 4QY8B 3SB3A 2OA9A 3BAIA 4FXGC 1OTUD 3NQIA 2NXYC 25C8H 1HILB 3QO0B 4PQXA 3L3OA 4Z9KB 3QG6B 1KBGL 2FR4A 2I25N 1X5ZA 1I1CA 2ZUXA 4PJAF 3RY4A 2Q6WB 1EJOH 1W2KT 3BP4A 3IJHA 2NXYB 2OMTB 3QFJD 4DGUA 1KEMH 1Q72H 3KL0A 3ZQWA 2GABA 4AT6A 2EH8L 4I5BB 4FA8A 1E8WA 2VDPL 3SKNA 4MCMA 3PF2A 2EDNA 1RUPH 4A39A 4WK2B 1EAOA 3ARGD 1E5UI 3GYRA 5SV3A 3TH2T 5LGHL 1QTSA 2CDGA 4WWOA 2A83A 4XVTL 3SO3B 1ZEAH 5DUBB 1VFOA 1SBBA 4HWEL 2AK1L 3EOAB 1UWEH 3ULUD 2H0EA 2VLJB 4WW2F 4AZ8A 5ICYB 1QKZL 5DC0A 4FJ6A 3FSWA 2BCKA 2B1HL 1BBJA 2EDWA 1YN7A 1EQWA 2VGLM 1IUZA 4FLSA 3EXJA 4AIXA 1EEZA 5JQIB 5L7XH 4HGWA 5KSBE 1A21A 2EIZB 3QCVH 4JRYE 4LPCA 4NSKB 5DS8A 3MODL 3MGTB 1DJYA 2BW5A 2ZCHL 4DN4L 1CD1A 4ZNEE 1UCBH 4NZTH 5D7LD 5F3BA 1XF4A 5JXEA 1RJZA 5GGSB 3S96B 1Z2KA 5IOPB 2ITDA 1X9LA 2OXHB 2VDLH 1JZEA 3M46A 2PKDA 4TVSa 4XCCH 3FFOA 1MFBH 1RHFA 5FUOH 4LPYA 1PG7L 4X7TA 5EUOA 1D3CA 2QGEA 2OJEB 4C4UA 1E5ZA 4P2RA 1Z3GL 4NNXA 3ZE1F 4XVOA 5B39B 2AAAA 5C0BE 12E8L 3OB0H 2PLTA 4Z7VE 3LNDA 3V4PB 4XB7A 5HJGA 4Y4FA 5ANMB 3WFCL 3GMMA 4RWYL 2QR0B 5I1CL 3MBEC 4F7KA 4JFVA 5E23A 4Z7WF 3EUUA 4JHBA 3U2JA 1HOEA 2A6IB 1JXKA 3AB0C 3FF8A 4FG6C 3MBEB 1WK0A 1UD2A 2YUWA 4N5EC 1ETZB 3IMVA 2YD5A 3LQAH 2GC4C 3DARA 1E2ZA 1MCFA 3WIHL 2ZYIA 1EERB 1IEBA 5EZOH 5H94A 3W5MA 4FFZA 2I7SA 2HJKA 4RA0C 4PJCA 4ZTEA 5I26A 2PN5A 5FAAA 4XCYB 1WWBX 4K8RH 2QSCL 4KZCA 2I07B 4Q2ZB 4O9HH 4Y19D 4N0YL 4MD0B 1OCWH 4Z76A 4MNHB 4CC4C 1S9XB 1AC0A 3NCFB 5ID0A 4X5WB 1PLAA 3LNFA 5GPRA 3FZUC 4M7ZC 1MCPH 5I6OA 1FCGA 5BUGA 4MD4B 4M43H 4FQXC 1KTKE 5HJ3A 4PJ7B 4PJGF 2IANE 4XN7A 2E7LC 4TM9A 4M7ZB 3X2QB 5E2WL 5CO1A 1W8NA 2ZOUA 3GC3A 3WTVA 5E6YA 3LKPA 4LVHC 5BUAA 1S9YA 4ISVB 4LGRB 3QDGD 4XPAL 4GP4B 1PD0A 3LYRA 1ZV2A 2J6EL 5BXFA 3HMXL 5GS3A 5T5NG 4L3EE 3W37A 1IFHL 3HZKA 4LLQB 5JA8B 2NCMA 4LVHB 1TR7A 2ISDA 3U25A 2BZ7A 4MHHI 5FYJH 3D85D 4AVIA 3L6FB 3GEWB 1FORH 5IJKC 4GMSL 3FO9B 2B9AA 4RDQG 4M8UA 3LRSA 3PAVA 4DP1X 5JDJA 2XY1A 1R6VA 3CDGA 1H15A 4EUPB 3HC0B 5CWSA 1QMUA 4H20L 1T0OA 1U8JA 4H26A 3GMNB 5MEPB 3NEEA 4E42B 1GJIA 4K5OA 2A99A 1T5XB 2E74C 3DTXA 4L0PB 1R24B 3NJJA 1FH2A 1JXGA 2PO6C 3AG3B 4MB3A 1Y1DA 5FM5O 1FRGL 3ALXA 5BRQA 1IAIH 1NLBH 4ZUVB 1YEDA 3P9LA 3MREB 1GGYA 3QXTA 3P0VH 4JMXA 2WVTA 1KCVH 1T7ZA 3QRGL 4GUQA 3SDDA 5D5MB 3L4CA 3P0YL 1DDHB 1F1DA 4J3TA 4LCVA 4BKLA 3C8KA 5DMJB 2BSEA 3K6IA 2W65B 5ADOH 3L95A 2E8YA 3ECBA 3JVGC 4HKZA 4ANVA 1QPKA 1M2VB 3OKKB 3P77B 3L7EB 5D2LF 3T4AA 5IHUL 3KVDD 3NZ8A 3NJIA 1V7NL 4IIQA 1OGAE 2X4QA 3WY1A 4AE0A 1UA6L 2B15A 2E4FA 4IBWA 1KIUB 1Q38A 1INEL 4FMVA 1P4LA 1AYOA 3O2VH 4G9FA 3AQDA 1RZ7H 3A6OA 4LAJH 4KOCA 1AIFB 1TLKA 4IQHA 3VG0H 4EIZC 1M71A 4NKOA 4GUPB 5C0CB 2ZOLA 1NC4D 3S3CB 2MCAA 1S78D 4LF3B 3GSWA 3F2LA 4HHAB 2AK4A 1UOLA 2A6DA 4HG4K 2XI9A 3HPLA 3M8OL 4BSVB 1CL7H 1OSZA 1FAIH 1WTGT 1O9ZA 1FYTB 1SXZA 4WHCA 1SUHA 3K2KA 3PWJB 2OPCA 1MNNA 3FQUB 1EHLH 3FTYA 1U58B 4YPJA 3ARFA 1PLGL 2X9WA 2EDLA 1QLEH 4HJJH 5AEAA 5E99H 4W6YB 4M4RA 5JW3H 3GSUB 4BBWA 1DQJB 3CQQA 2HVKA 2Y7LA 2CMRH 4B5EA 2W8CA 4JFDD 4Y2DD 4PLJC 4OF5A 2WZPA 3EYSH 3STLB 1QFWI 4XO8A 1W8EA 2IJ0C 1KIPA 1XGYL 4XMPL 3L13A 3OL2A 1WPCA 4NN6B 3KPLA 4QRTA 4ALAC 1X5FA 4HUXA 3WI9A 2WQSA 1S7SB 4TTDC 3SOBH 5L6YL 4X4KA 3SBQA 1XIWA 2G2NA 5AAMC 3WEXB 2UWEA 3SGDH 1DQTA 2K9FB 1CD9B 3E8UL 3S8GB 3C5XA 1FN4A 5TPWL 4XC1L 1K6QL 1ZPLA 4AVJA 3TNMB 3PWNB 3SQBB 4PRHB 4F9PA 4NC2B 4OCRL 4UT7H 1K8IA 2LGNA 3D9AL 3P4OA 1NGZB 1GZPA 2VN4A 2W59A 4L1HA 3TNNB 2LTQC 5FO2A 5D9SB 2YPVA 1MJ8L 2VLRB 1BGXH 2X6UA 5JXAL 2DI9A 4P9ML 1SNRA 3VGDA 2XV3A 3HOGA 1R47A 1Z3RA 3SJVD 3BUYA 5MHSD 4Z6AT 2Z65C 2LTQB 3NACL 1AY1L 1J9QA 4MNGB 1HQ4A 1T4KA 3CMOL 3DIDA 1HTYA 5HGBA 2OSXA 4UMSA 3PYCA 1KB5A 4JRLA 4YK4C 4KKCC 4BH7B 5CHNB 5T33H 2Z7YA 1J8HB 3JTTA 3L5IA 5G5DA 1HXMB 3K8MA 1U8NB 4M5TA 2HP4A 1VPOL 4YK4B 3BKJH 1WVZA 1DUZB 3E0GA 3HE6D 2DLIA 4GLRH 4KO5A 3A24A 4DUXA 3ESNA 4NZJA 2PYEA 5I76A 3B56A 4FFZL 4UQEA 4U1NA 5SWZA 4FCAA 1EWHA 4QTHB 3G5XB 4V2BA 3X13B 1WP6A 1FH5L 1TKWA 3HBZA 1I3RB 1RZKL 3E1F1 1TQVA 4WWNA 3WSQL 3TN0C 1PY9A 5EEYA 2Z31C 3FU3A 2FWSA 1RULH 5HI5C 1AJ7H 4JRXA 2CUMA 3IRCA 3IPEA 1AH1A 3QPQD 3WEBA 2EYRB 1LP9B 3ASNB 3RWDB 2IGFH 2GQHA 3TN0B 4LLWA 2XKSA 2ROYA 3MKGA 3FB8A 3QQDA 3F5WA 3BZEB 3N50A 2YA0A 4YE4L 4CVUA 4PTTA 3OQRA 2BFVL 3B6SA 4WHDA 3QARA 1MVFA 3V0VB 5FECB 3B9KB 3GSRB 3HPJB 4OUUA 5DO2C 4Z1PA 4CSPA 1WCBA 1A1OB 1QW9A 2NOYA 1C5BH 3EYFB 1WDAA 1SN2A 2ADGA 2DQEL 3GSXB 3QDGE 4YHIB 5IQLA 1FG9C 4D9LH 4J3OH 3RUGA 3NT0A 4LEEA 4M6MH 3L9YA 3O11A 4R5XA 1HHIB 1D9KC 3L2LA 4ZSOB 4A2EA 1FIGL 3KCPA 3QUYD 1CS6A 2DYPB 4KKBD 1QA9A 1MRCL 2YFNA 4N24A 4HZAA 3LKNB 1KB3A 1NEZG 3X14B 2SEBA 1D9KB 3CQFA 4LVNC 3QEUB 3OR6B 4OW6A 2HH0H 1Y6KR 4N9OB 4LCUA 2A1WH 5FKAB 4HIEB 4K9EC 3BAXA 4WI6A 2Q8BL 4U1JA 3JUZA 4LVEA 4LVNB 2NTSP 3QC5X 1FVCA 2J1ZA 2IBZY 4FQCH 5AYUH 2FWOB 4KAQH 1BF8A 1X3DA 2WWOA 2R4RH 3DX2A 4M93C 1H5BC 4OLXH 4J3WA 4DO4A 2P7TB 1QSEA 2KL6A 4WSJA 1VZIA 2YD4A 5B1JC 5A6LA 4RZKA 3ETSA 1UUSA 1XGTB 4L1TA 3ROOA 1CGSH 1H5BB 1T21B 2E56A 2R1WA 3FB7A 2HCZX 2A4EA 2KKQA 3IFNH 1MNUL 4XE0A 2MRYA 3ZKXB 4CMHC 3M1OA 4G3YH 5T1KD 5HHOB 1ILUA 5KZCB 1WJ3A 2ADFL 2HLFD 2X5PA 4EN3A 4YL4A 2VDOH 4XOEA 3RVWD 3BP4B 4MMYA 3FUMA 5DO8A 4P2OD 1UXSB 2DMGA 4N22A 2NSXA 2VW4A 5D6CB 4AT6B 2F8IA 3MZGB 5CEYB 1ZA6A 2EE2A 3SKNB 1U8HB 3DOIA 5D6DA 3PHSA 1T0NA 4TNWK 5KG9A 5SV4A 4W6XB 3IBOA 2A83B 1DVFA 4BZ1A 1QSVA 4JRYA 1JVLA 3L3HA 4AKOA 1TVHA 3GXFA 4QO1A 4ZNEA 3GSNA 1JGEB 3VXRA 4AZ8B 3NZUA 4BK8A 3PY9A 1HEHC 2BHYA 2BC4A 1E9PA 4HEME 4PJDA 4OVUA 4XXDA 4XT1C 3QQ4B 2CKBL 1CXHA 3JV4A 4JNXA 4PJXB 1PW3A 2A6JA 2AQPA 4HGWB 4U7KA 2NQ3A 1G7LA 5JXEC 4BD4A 3GM0A 2EDXA 1KYOJ 2D0FA 4ZG1A 2OMVA 4WWKB 3VXMB 4OJYA 1HN1A 1P4BH 2CRMA 3FH7A 4UINL 5EN2B 2APSA 3WN6A 2J88L 1MCRA 2K6YA 2YBGA 5C0BA 2ODIA 3MFFA 2YEZA 1NM4A 1BFVH 1TZIB 4C58B 4Z7VA 4PJ5E 2A2QT 4BCYA 3VACA 5IMLA 4CDGC 1NSNL 2ZAIA 3ARXA 1WYJA 4HH9A 4XNQA 2NX5B 5EUOB 5TE4H 1FVDA 4P2RB 3ZTEA 3D0AA 1DQIA 3PWPD 4L3FA 2BNRD 3CHQA 5EC2A 5FB8B 5GJSH 1E4KA 3MNWA 1CB4A 2AC0A 1GZHA 1ZGLP 5D1ZI 1AFVL 1CL7I 3WLBB 4ELMF 3OWRA 2CHDA 4H0IA 3EJCA 4FERA 4R7XA 1VFMA 3MPCA 3PL6A 4AUJA 2F54B 4HU8A 4L4VB 4CUCA 2VQTA 3SDYH 3MUGA 1BQHA 1CTMA 4IW4C 5C0GA 5FYLD 4KRLB 3AGWA 1TLMA 5FV2A 1AQKL 1C5CH 1SXAA 3I9IA 4NPYB 5DLMH 3UGUA 2W60A 1KY7A 2OYLA 3SJVE 3DSNB 4G70B 5AZEL 5LNEA 5MHSE 1O7SA 3QG7H 2MNUA 1GA2A 5LBVA 2HJKB 1NKGA 5TGBA 3JWNC 1EEUA 3LIZH 3DV4A 3HC3L 1PG7W 3ZE0E 4A2FA 4EBQL 5FM4A 1QI4A 2WLZA 1W0WA 3GWJA 3QYCA 2HG5A 2QGCA 1QP1A 3D34A 1EO8H 1NOFA 2P1YA 3B8YA 4LHQB 2Z6FA 4AH2B 3MLZL 5TDNB 1F4XL 2OMWB 3VB8A 4OLUL 5HJ3B 3O0LA 5JR1H 1JNNL 1UGKA 4KXZH 5AG8A 3HZYB 3IXAA 4HS6B 4PGJA 1AANA 1JK8A 5ILTH 4GIPD 1GOHA 3OMZA 3UJJL 2NY5C 3OAUL 4AMWA 4HA1A 3MA9H 1VERA 5EOCJ 1QQDB 1YJDH 1AMYA 4HCRH 4R2GC 4Z3JA 2WTOA 4YNYA 3IDMA 5A2KH 2BINA 3QYMA 4N2EA 3WYRA 1A6PA 1Y6MR 4DVBB 5DD1H 3HZKB 3K4AA 2Z8WC 1DSFH 4UB0L 5I8OL 4YHMH 2YD2A 1TJHH 2HRPH 4JQIH 3P3UA 2EDKA 2XVLA 2WLIA 3C09B 3UJIH 3UTTD 2OI9B 3UPCA 4D2NA 5EF0A 3QHTC 3TX4A 5I1IL 4U49A 1KIQA 2APXA 2EYTB 3CDGB 1H15B 4ZTOH 4LSQL 5CWSB 4TN9A 2ZXBA 3TBYB 3GS0A 3QUZA 3I2CL 4XP5L 3P4NA 2FLRT 3EW3B 2X1QA 4TUJB 4CBZA 5HXMA 3VH8A 3IRZA 3DTXB 3RIFK 2P5EE 4AIEA 1HI6B 4H2CA 1TCMA 4ODUA 1AVAA 1NCNA 3I85A 4LLVB 2HT4D 4PMEA 3WNMA 4D7BA 2F53A 3DSFH 1PZBA 1OGAA 5T5FA 4FF9A 4UQ3A 3L81A 4OKDA 3C8KB 4AGOA 2HRLA 4E9WA 1KYAA 4UM9D 4X6BB 1EBPA 1ANUA 1KLFA 1AXSA 5LDSA 3G5VA 3FQNB 1TTAA 1JRHH 1SJEA 3OXRA 2KQMA 2X12A 4P2AA 5DI8A 1AXIB 5J3HD 4LAQL 5BZDA 1EK3A 2X4QB 4YHYC 4DP7X 3MBXL 1REIA 3V7AG 1P4LB 3CIQA 2Y5EA 1EGJA 3I02A 4DUVA 2YMOA 3KE0A 4TV3A 3LDBB 4LCYA 5I1EH 4OM1H 3HG1D 5CINL 3BVWA 3MSPA 2N1TE 5I18L 4NKOB 1KYFA 5E2UH 4YHYB 5B8CC 4OLEA 5TE6L 3P02A 3DECA 1R0AL 1EZLA 3GSWB 1H3XA 2G9KA 5JQHC 3VFWA 3ARPA 3F7YB 4JUTA 4UTAH 4ORGB 1IZKA 1CFSA 3ARFC 5DVKA 5B8CB 4PSRA 5EO1B 2QPDB 2VDNH 3SHSA 3WTWA 4KMTH 4FTDA 3US0A 1NFAA 2PPDA 4D0DB 5CIPH 1ET8A 4N2AA 5CJQH 3ARGA 1F18A 1U4FA 2D7TL 1QO3A 5FHAH 4KDWA 1SEBA 3SDXE 3ARFB 3EHBD 3SKOB 5CN2A 4I9WD 4KHXH 2BERA 4Z7UF 2OYKA 4AQOA 2IC2A 2XZAH 5I1DA 2VDKH 1VEMA 2O6EA 1WFIA 3M6DA 5AOLA 3FQRB 4GMTL 2FZ3A 4XWOD 1Y18A 3UTPD 2C4XA 1A3LL 1I7ZA 4LSTH 3IM1A 4Y5YC 2WUBL 4LEXH 3LKQA 5IVOA 3N43F 4F8OA 5IM7B 4L8CA 3WHXB 5TQ2L 5D1ZB 3U2IA 1KIPB 4QHLA 1XIWC 3O9WD 5KVFE 3NPZB 3VVVA 4AYEC 5J89A 1SXCA 4Y5YB 3S3JA 4TQHA 3KPLB 4QRTB 5D7LA 1DANU 3ATDA 4XMKH 2WKOF 2RA1A 5ALBH 1NM9A 4M62H 3MLWL 1XIWB 5DT1L 4F9PC 4IBSA 5EOCH 3F04A 3DHUA 1X6LA 1FL6A 5I16B 4PM1A 2IOMA 2XQYA 2I24N 1ACXA 3A67H 4NYLB 1QYGH 1VLXA 2YUXA 2IXQA 2IADA 4KPHH 2A0LC 2B8OT 1UHVA 1NCGA 2HX9A 5MI0C 5ISZB 1P1ZA 3P4OB 4OLYL 1XR9A 1IAKB 1UVQA 2ZSWB 2OCJA 4DPAX 1M9SA 3NCBB 4KK9C 4OUOA 5EG6C 5E4IA 4JFFE 2FATH 1INQA 2X44D 3K2MC 5CP7A 5AVXB 1RMFL 4M29A 4PW4A 2HJLA 1RQ5A 1BD2B 4XNDA 3UP6A 4GG6A 3PWPE 5DJ8A 1JCKA 3H9SB 2YS4A 1X5LA 1KBWA 1S7VB 4Z8FL 4P4RA 5IIEB 1JGIA 2H9GB 2HFEA 3HTLX 5DUPH 5I0WA 3S35X 5AW5B 4PVMA 3TIDA 2PXYD 5D2NB 3KXFD 4MJID 2OS7A 4X9GA 1JYNA 3C60D 3LEVL 3TGXA 4RLDA 5CBEA 1AKPA 4K8RD 3TEZA 5C2BH 4Y19A 1VFUA 4TQEL 3B3IA 4JPKH 4F7CA 3VMPA 3KPNB 4H8UA 1B9ZA 4AENA 1I7RA 4ZW7A 3MRBA 1UD6A 3V4UL 2G3NA 1OP4A 4PWHA 1JGUH 2NY2D 4GFXA 3LEYH 4M5YL 1NCBH 1ODAA 2ICWJ 5HSFA 4JBSA 1CJYA 2A6KB 2R7EA 4YDJB 2ZWNA 2ALAA 4LKCA 2WIMA 5I0ZA 1ADQA 2VXSH 1SVZA 5F8QC 3QDGA 4MB1A 3FB8B 4NO3B 3UC2A 2XWCA 3F7VB 3NRFA 3D07A 2P5WD 3OX8A 2LU3A 3QHZH 3D85A 2QJDA 3S36X 5FYJD 4EI5D 4K5MA 2ATAA 5AVVB 1QFPA 3TJHD 2D0GA 2F8XC 3L3DB 3MLYL 2BWIA 3RUGB 1TPXC 4NBYB 3O11B 2R2CA 5F7FA 4FXTA 2A9NH 3MNMA 5DHEA 2WD0A 5EU6E 3KCPB 4AITA 2AEOA 3T8MA 5LCVA 1QA9B 1S7RA 1TPXB 2Z35A 2VR7A 4N68A 1IGCH 4XCFH 3OVUB 4HS3A 3H4FA 5IFAL 4KROC 1WFUA 15C8H 4QGYA 3ZUCA 4AGMA 4GQRA 3EBHA 5ESQB 2JV6A 5HHXL 4CN1A 4U1JB 5CZXC 3HB3D 1BOGA 2BHZA 4HIIB 2OZ4A 5DYFA 5HD8C 2YA1A 4YO0A 2FO4A 5C6PB 5IT2H 1UGNA 2GVYA 3CFDA 5FYKL 1UFUA 3WXVH 4L8SA 4HWZA 3CFTA 4PVNA 3EADA 2FYVA 2ATKA 4KJQC 4U3SA 1J18A 3NFPA 2UX6A 2VQUA 3WFDL 2WQ8A 4K7PL 1H0DA 1QHPA 1WD8A 3UTSD 4EN3C 4FN0A 4KUCF 1NC4A 1JBJA 3LRLA 5AENA 5A2AA 5EU3A 1Q9OB 3CZFA 5E9AA 2GBVA 1ZT1A 2G3ZA 3QQNA 1M4KA 1EGJL 3CVHB 4XP4L 5GIRA 2IDCA 2WWNA 3T6ZA 1CI5A 4PB0L 5KSVB 3PXLA 1HXYB 1QPPA 5I73B 4MMYB 1NKRA 5D6DC 1T1YA 1IL1A 1VCBC 4NKQB 3QXAB 4OCXL 3HG1E 5IZ7A 2WIIA 4YGAB 1DVFC 4IRZH 2AGJL 3UYRL 4PY8J 1AQ8A 3OZKA 1KCBA 2CUHA 5IV2A 5DHYA 2W80C 3GBLA 4WWPA 3IEAA 5BUPA 1S7QB 2G60H 3K2UH 5KVDE 3HBGA 2DM7A 3M45A 1DVFB 4QRFA 4JM2D 5KSBB 4FI6A 3GBMH 1SJHA 5EA0H 4JRYB 3V5DA 2W0PA 3G3LA 3L3HB 4JFDA 4Y2DA 4A7VA 3DURB 1T0PB 3AAZA 3ZYJA 4ERSL 1TVHB 2EXWC 4PBXA 2PWGA 2D31B 4QLWA 2EO7A 2VB5A 1G4RA 1SOSA 4HWBL 4JFWA 1KYUA 2D2CC 2WY3B 4XC3L 5D96C 3U4EA 1E9PB 3ULUL 4QRBA 1JFQL 2AJSL 1MWAH 2Y24A 4I0PC 4CU7A 4YAQA 2DWXA 2WVVA 3TC9A 3VW3H 4DVRH 1R3KA 5D96B 3GI8H 5CD5D 3MFGB 3G6AA 1JRHI 4XX5A 3PU7A 1X5HA 1OGTA 4I0PB 4U7SA 1ADWA 5GGSY 4M7LH 5C0BB 2DQUH 4P07A 1M3IA 5CLTA 4BK5C 4Z7VB 4ZQKA 2IPTL 3B1TA 5K9QG 3QJSB 5IMLB 4MQ7A 2AABL 4OZFA 2W9LA 2ZG2A 1E4KC 4XNQB 4HH9B 4HLJA 2ZKXA 4GQZA 1GZHC 2OP4H 1IGJB 1QFOA 1OHZA 2DTMH 3N44B 4Q4EA 3ZVVA 4YHZH 1QFWM 3OAZH 4HF5H 2CUIA 4HP5A 5E0FA 3RA7L 1KJVA 3ILQD 3ARWA 2W88A 2JB5H 3MNWB 3PL6C 4P5TD 4LCIL 4WFEE 1QEWB 2HVBA 3C5ZD 5FM8A 3ZT6A 1TITA 1NCCH 5F1NA 3SJVA 4TULL 4PN6A 5SX4H 2OM5A 3V9FA 2ZTBA 3PL6B 1XH1A 4CW1A 4YH6A 3QXDB 1F0LA 4KI1A 3I75A 2EDOA 2BNQD 4JHWH 4HAGA 5AUMB 1IEAA 1B0IA 4GW4A 4U1LA 2FEDD 1CC3A 2W60B 3HE6A 4HX1B 1A7BA 4P9HL 5TGBB 4XP6L 1JJUA 2FDBP 4FQIL 3STZA 3ASOB 4ZW3A 4QEGA 3EBIA 4JKWA 2IANB 4OCNC 1JTPA 1MG3C 1MEXL 2OQJA 2FHBA 3RBGA 4XBEH 4BFGA 5EZLB 5CU5A 3I6KB 1CTOA 1M1SA 2VL4A 4PJHE 4ZJ9A 3BUDA 3WDIA 4P3DA 4KTDH 1UASA 4R7DB 3LZPA 3TOPA 4L3EB 3C75A 3QUKA 2VXQL 1NC2D 1YYML 3IXAB 4XI5D 3G6JE 4K15A 2Q7AA 3VFTB 3V4VB 3DA0A 3CFJA 1ADQL 1D6EB 1J1PL 2MOQA 4RESB 4EUPG 4X5LA 3VG9C 4IRSB 1P2CB 1TO4A 2RGSA 5L4IA 4XO3A 3VWKD 4DPBX 3IF1A 4Z5RB 5C0RL 1QWHA 2GJPA 4HOXA 3VG9B 4URTB 1IGMH 2H7WA 4N0RA 3I6GB 3WMQA 4WIQA 3QUYA 1OSEA 1G6RA 2G0KA 3VH8B 1K9TA 4UT6A 1E4XH 1L7TL 1WEJH 2VT0A 3WUWA 5GRJH 3CGTA 4GAGH 5FO7A 2B1AL 3H1ZA 2JCWA 2ZWSA 5I8EA 5I1JH 4NM8L 3PNRB 3SE9L 5E1HB 3II3A 1GOFA 2APWA 1JPGA 3MA7A 5BV7L 3U46B 1P7HL 2AJZA 4G7SB 3OG6B 1OGAB 5E1GA 4Z0XA 3NSFA 2OTWA 4KI5E 3U83A 2XV0A 1KULA 3AS1A 3IRPX 4FNLL 4NC0B 5JZ7C 2DQTL 3MJ9L 3O0RH 3TIEB 3P30H 1YHPA 1KLFB