3LZNA

Crystal structure analysis of the apo p19 protein from campylobacter jejuni at 1.59 a at ph 9
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lznA00
3PJLA 3NRPA 5I0WA 3LZQA 3NRQA 5I0XA 5I0VA 3PJNA 3LZLA 2O6EA 2O6DA 3LZNA 3LZRA 2O6CA 2O6FA 5I0YA 3LZOA 3LZPA
chains in the Genus database with same CATH superfamily
2EECA 2J8HA 5GSRB 5E1AB 1U8OA 2JCCE 2P5EA 4XXDB 5D6CB 2QSQA 4IOIA 3UG5A 3HZMA 3FULA 4P59H 2VXQA 3E3QC 4LPUA 4WU5B 1KPRB 4QOKB 5HI4D 3WFHA 2PMZA 1IAOA 4KWUA 1OW0C 1A4KB 2D3LA 5JXED 4H20H 1NKGA 1AP2A 4GP8B 5CNHA 5TE7L 4AMKH 3VJ6B 3D2TA 2QSVA 1QFUH 4CNIA 2QR0A 4YZWA 2HTKD 25C8H 2UUDH 4HSAC 1XVSA 5DHEA 4YSSA 5IM7A 4KX8A 2VDML 2BS9A 4ODHL 5GS0D 3DYMA 2MHAB 3OJDA 3D2UB 2PXYC 4G42B 3QJXA 4HIEB 3QEUA 3AREC 4F15B 2XPGA 4QOKD 4D0BA 4GBXA 1OWWA 2JB6A 4Z95H 5E08H 1MREH 4DP1X 2J71A 3W9DA 1INDL 1CG9B 5LAXB 1U8IA 3BIKB 4ABUA 2C3VA 3GSNA 1CB4A 1D5BA 3ABKB 1EGJH 2APSA 1IGJA 4OZIA 1N2RB 4DZ8B 2R8SH 2J8UE 1UM4H 4NKMB 3OLDA 4CADB 4MWFB 3HFFA 1GC1C 2WLNA 3KPQB 3U48A 2WINA 2YD5A 3MBXL 5KW9H 2TRHA 1A4JA 4RAUB 5FB8A 2I24N 1DQQB 1M3IA 4LGRB 3L3HB 1U8PB 1QVOB 4CL7A 3D2UD 3FCBA 3BOVA 3I02A 1CK0L 5DA0B 3RWEB 1TT6A 2YRZA 3FT3A 3U25A 3WJJA 1AI1L 2ADJA 2AW2A 4NNPL 4RAHA 5EZJB 4FA8A 3VSQA 5EH1A 5AALA 1Q1JL 4GUPB 1F90H 2VMDA 3TIEB 2E86A 1KTKE 3BEVA 2BIPA 4PRAA 5EU6B 3KS0H 5DEJA 1KY6A 4I0PA 5AZ2H 2JB5L 1C12A 5A43C 2CHNA 4AE1A 5FO8B 2E76C 1KXTB 3TNNB 2OTWB 3FOLA 3TBWB 2AP2A 4Q56A 3GO1L 3K4ZA 3O2VL 1DQJB 3QULB 4UM8A 4DGWC 1UZGA 4EI0A 5LB1A 3SGEI 2AEQH 1F3JB 1OT2A 4F8PA 1I9RL 4HHAA 2CKBB 5ITFB 3WEMA 1HI6B 1ETZB 3MLTA 4OZFB 2Q10A 1OGAB 2X6UA 5EU6D 4NERA 5B38B 3VGAC 2CO1A 3C8DA 1QBMH 1E40A 1NM9A 3K6FA 5FA3B 3GHBH 5I73B 2W81C 5FIEA 2DF3A 2QJDA 4PGDA 5GGTH 3SKNB 1QBLL 4MQ7A 3SCMB 4KZEH 1PLBA 3WEAA 2L8AA 4DZBA 1UENA 5CCJA 4NOFA 4KVCH 3AACA 1V27A 3VO0A 1IT9L 5F3BB 2BY1A 4YK4C 5C9JA 1BQHG 1QQDB 2XXCB 4OF8A 2VL5B 1UXWB 2GVYA 5I1AA 3LN4B 3MGAA 4KI5D 1MRCL 4PJIB 5DLLA 2OX5A 5IQNA 3N06B 4PJ9C 1OGAD 3QJFA 2ZT9C 4OCSH 1MUJA 5C7XH 1ZT1A 4WWPA 4X6CF 43CAA 1C5CL 3SDAA 2F6AA 1IEBB 4MA1B 3SCMD 1MFBL 5AW3B 4PFEA 4FNUA 1OSPH 2UYLB 2IGLA 3R7RA 1HILB 1XH2A 3IDIA 2ZUQC 4TUOA 2IH3A 1L3NA 3O9WA 2F8XC 4LLMB 5TF1H 1ES0B 4TSAL 5C09B 4JPIB 3KGUA 5H94B 1K9TA 2HKFH 3H2PA 2E74C 4LAQL 3LKQA 1RZGB 1W9XA 3BIAX 1OAKH 3APDA 5CP7A 5GRVK 4BZ1H 3WY3A 3EYVA 4PP2A 3OD3A 3ARUA 4CVWA 1DEEA 5EU4B 4ZMNA 4PJDB 2A4CA 4AL8H 5DDHB 3EDJA 3U1PA 1JFQL 3RUGE 2OMZA 2DQEL 5HY9A 1OWRM 1FV1A 4XNQB 4YXKH 2Q87A 5ABZA 1OAJA 1XCXA 4IU2B 4OZHB 4JVPA 5C09D 5BV7L 1RHHA 4FQQB 4XVUC 4A6YL 5IMKB 4E5XB 3VXNB 4ONOA 4HAFA 3TV8A 4OUUA 2PYEA 1G6RA 5EIIA 5FFOA 4JFZH 1JERA 1F1GA 3JWDH 3MCLH 4IM8A 5AVTB 5G4OA 5E5UB 2OSWA 5I0YA 5HJGA 1J9QA 1F8TL 3LD8C 2NSQA 2CRYA 2ZXBA 4MS8C 3LXAA 1EO8L 3U7YH 1UEMA 2YAEA 4QWWC 1G7PB 1QRKA 1NBYB 2AJZA 2G9HA 3MA9H 3MJWA 2ESVA 3NCJH 2HJLA 1U3JA 4AQEB 4DVBB 1QWHA 1D5MB 4GBXC 5HHQA 4JZJC 2G60L 4ZMQA 1FL6A 4WJKB 2Y1VA 1RPKA 1F3RB 1KYFA 3GSRA 4JANB 3WLBB 2OR7A 1UURA 1I8MB 4M6ML 3P11L 4LQFH 4NZUL 2OMWB 3T2NH 5K39B 3VI4A 5CFAA 1X5IA 2BMKA 4FULA 4B41A 3LZPA 5CXPA 3QJSB 3MV9B 3NSYA 2OL3A 4JBSA 2EVFA 4RWHA 2UWEF 3G9VA 5FLVA 2EDNA 2Y7QA 1BM3H 2BVQA 3WFZA 4MXQD 4LCYB 1YEHH 1U6AH 1W0WB 2E4FA 3PP3H 3VXPA 4L8CB 3MOAH 3QUGA 4YL4A 2J57A 4RGOL 3UROR 2X4RB 1AQHA 3ARXA 1HHIB 5K59F 3S96B 4I3SH 4LHQB 4AV0A 4PV1C 5FO9B 1VGEL 4F8LA 3H56A 3BP7B 4I0PC 2RFXA 5I6KA 4MD4B 4OB5L 1A6AB 4MXVF 4Q9RH 2APTA 3MV9D 1F13A 4Y9EA 2P8MA 3L9EA 1SXCA 2PO6B 5FUOH 3KDPB 1NCWL 4HJ0D 1X4ZA 1NDGA 4HPOH 1NFDE 3AG1B 2WXOA 4AZ8A 4OR1A 1NFAA 2XACC 4MMXA 1KIQB 1IM9B 1CN4A 3M07A 1BJMA 3RY6A 3SQBB 1MNUL 3L5IA 4LB8A 4G82A 3DV6B 4KZCA 2WSPA 3VWKC 3UPAA 4P2RA 3NACH 4UQ3B 4DQOL 3WL9A 3WTSA 4HWZA 3MX0A 4AMXA 4HPHA 3K71A 5KUMA 5AOMA 3UJJH 3LRHA 3QEHB 5FGBA 4ENED 2PCFB 2YAOA 1I9IH 1T0NA 3BP5A 1QFPA 4LCUB 2ITDB 3PJSA 3V0HA 1GZHA 1EZVX 1U4EA 3Q2NA 2QMJA 2PP8A 5JHAA 2PO6D 1OOAA 2K4WA 4FTDA 3VRLF 3H4HA 5LG6A 4LK4A 2C34A 3WXVL 5DUJA 4M1CC 4RAVA 2H6PB 4TPRH 5EDSA 2GQHA 1S3KH 2YK1L 3NGBC 1IM9D 6FABH 1NCUA 3BUTA 2B3IA 5ALCH 3BO8A 3P3TA 4NBYB 2DI7A 2K45A 4JNXA 1MJ8H 1MCSA 4NJAH 4F27A 4KXBA 5T3ZH 2NCMA 3EJJX 4WZ9A 1TVHA 1HNGA 4M8RA 3N43B 3UYRH 2WBJA 5I1IL 4NM4L 2GITA 2W60B 3MRCB 3SSGA 3ZE1B 2J6EA 2UXGA 1LDPL 3SYQA 2B4CH 1BECA 3O8XB 4J4PD 4NWTH 1E4HA 3KDMA 1ZEAH 4PJXE 4QRPE 3WIIH 3BLKA 5DGRA 3TP4A 4FQ1H 4NO0B 1CQYA 1JHTA 3D0VB 3WMPA 3HC3H 1JZ5A 1ILSA 4OIIL 1ZIAA 4X6EB 4JDTH 1OAXL 3I9GH 4HKZB 4V1DD 2ATKA 4BZYA 1MQKH 3CMOL 4FFYL 4RGNC 1R5WB 2HX7A 1B6DA 2VDRB 1XFPA 3BISA 3DROB 4K71B 1JOIA 4GSDL 4K7PX 1KIPB 1BAFH 3C5ZA 2WBWB 4P99A 3MV8E 3QRBA 5IEKB 2GB2A 2XWJB 3O8XD 1MI5E 3K2IA 5DRZA 3AXIA 4HS8L 1SGKA 2VNCA 1AD0A 5MEQA 3N40F 4PBVC 4PRHE 2X3AA 3NABL 3NMEA 4P4KB 4NO0D 3QDJB 5INDA 2NY2C 4UINH 1QFHA 1KC5L 5HYJE 1N59B 1YNTB 4XP4L 3ZTJG 5DZVA 2EDMA 5DFWH 3R4DA 2XOTA 3ULVD 4YDJA 2XZAL 2WXPA 1JJUA 5DO2D 4CVZA 1K8DA 4B9CA 4AYEC 4AEEA 5D7JA 3CSGA 2FR4A 1A6VL 3SOTA 3FZUC 4BGDA 1I8LA 5F7EL 5IFAL 3BUPA 4MXWH 2XIIA 4X7EC 4YBQC 3LQAL 4P4KD 5FM5M 2KZ1B 3AC0A 3QDJD 3S3BB 2E56A 2VLRB 3PYCA 4LASL 4ANVA 4XAWH 3D8MA 1MEXL 1JGEB 3WY1A 2F53B 1E7VA 4OZ4B 4NIYE 1BVZA 1OV8A 3IDYB 1C8QA 2G9KA 1IC5H 2CLRA 3M8OH 4PJAA 2X6MA 5C1MB 5B8CA 4AC4A 4B6ZA 2BO0A 4Y16A 3S88L 1CF1A 1MFCL 5KBKA 3UAEA 5J06A 1U8MB 1KEMH 1XHHA 4APQB 4NAJA 1PZSA 3U1SH 3P69A 1A3LH 1CLOH 1W16A 2JTDA 1T6VN 4UF7C 3UTSE 4PB0L 3ALXA 3RBGA 5EF0A 2BLFA 5TDNB 1RSYA 4U6TA 4MJ4A 4XN8A 5JA9A 5LLIC 3WTUA 2F53D 2XX1A 1MCHA 2H1PL 4PMFA 4HUUA 5PAZA 4BIKA 1N0LB 4MCYA 3MRDA 1DBML 3F2LA 3VD3A 2QADB 1KBVA 1VFMA 1TMQA 3KPOB 4PW9A 5D4IA 1EGJA 4MVBD 2B5IB 5E0QA 1NLBL 4K94H 2GCYA 4APQD 3MR9A 4NENB 4JKPH 5E8OA 3RZCA 1NGXB 3A6BH 3DX3A 4EIZC 1AGEA 1RVFH 3RY6C 1Z3GH 1RJLA 4LARH 4Q6IB 3ZSTA 2E5EA 2OULB 2W0KA 5GGQH 1ZS2A 3MNZB 3UG3A 2DN7A 3GHEL 4MLIA 3MBWA 2GABA 1BD2E 1G5AA 1T2QH 2Z9TA 3DYOA 2EE2A 3MLRL 4M3KB 2EIKB 4JZNB 3QG7H 5FGBC 3OJMB 3FKUS 3KLLA 4M43L 1KNOB 4XPFL 2HUHA 2QADD 5EUKB 4WUUB 2GUOA 3VFNB 2A1WH 4M9OA 4HLZH 4GFTB 2IH1A 1R3JA 5DD1H 4P2OA 2H6UA 4TV3A 1EBPA 1LLAA 5DWUH 1FDLL 1ACYL 2HT3D 4WK0B 5CEXA 1KGYE 5AW9B 2X4OA 4CN4A 4PJBF 1KCRH 3AWGA 2HRLA 1T22A 2FO4B 2O4EA 4RFOH 4WDIA 3FONA 2HX8A 4M7LH 5IB5A 4BH7B 1J7VR 3NN8A 5I30H 2FLMA 5CJ5A 3CHXA 4JFUA 2F74B 1S5HB 2HT4C 5C71A 5IOKA 2VDQL 1SFHA 2FJHB 3FFCA 3LNGA 1BBDL 4WSKA 4WUUD 2DKUA 3GD1C 4AYMC 3GNMH 3EH3B 1EEYA 4OV5A 3HC4H 2FEDC 1RUMH 1G7HB 2DICA 4GOSA 3F04A 3QDGB 1CXHA 4EZJA 3D34A 3R18A 1DJYA 3WS3B 3VVVA 3RURA 1WHOA 1QEWB 3EOYG 4P06A 4Z7QF 3QUYA 5GGTA 4F9PA 1GW0A 4JDEB 1L9MA 4RA0C 2BX5A 3S0PA 4A63A 1CFBA 5EA0L 3FO9A 2VDMH 1QLRB 5AUMB 2FBRA 3KWWA 3ZRCC 1CL7I 3ZW3A 2P48B 3QQXA 3BAYA 3KPSA 5JZ7D 2AV1B 4D9RE 4YIQA 2H1XA 5LDSA 5MERA 5ID1A 4HOMA 3RP1A 4FQIH 4HU8A 2FB4L 2FNWA 3DJ9A 3L3OB 2J5LB 2VQTA 1MFDH 2HXAA 1HDMB 3QDGD 5LN4A 3V5KA 3L3KA 2I5YL 1BLNB 3W56A 2EDRA 5BZDB 5EO1B 1NJ9A 5I66A 3QUXA 3BWUC 4NNYA 2FJUB 4FL4C 4IRSA 5KSAB 3E8UH 2DPKA 4NRZB 1IBBA 4DFIA 4NQVB 4M5SA 4N2HA 1CF8L 3C6LA 1XCQB 2ZWLT 1CK0H 1NMCC 4ZFFB 3DGGA 3OKYA 2K6YA 1GVIA 3ZIYA 1HHJA 2Q20A 3CVIL 1E3XA 4X9YA 2YOAA 4S1DC 4NKIL 5EUOA 1IMHC 3O3AB 4BZ1A 1FNLA 4KUZL 3QPKA 1JV2B 1Z5HA 1RUPH 5AKVA 4ALAL 4X5LA 1EVUA 2Y22A 2LOEA 1CD9B 3QNFA 4F9LA 2VB5A 4NQEE 5CJXA 4JQXA 2XWDA 4ZO8A 2ZF9A 1NH6A 1OHZA 3G08B 4GH7B 5JPNB 1R75A 3BGMA 4P3WA 3GO1H 7CGTA 3MRHB 5B8CC 1CFQA 4TVUA 3RVTC 4RDQF 1PIGA 5AZEL 1EUTA 3D4CA 2ED9A 5F1IA 5IVOA 2MCAA 1A8ZA 4AEFA 3ZU8A 4UQBA 1I9RH 3BKCH 4JFOB 3BGAA 3TPUA 4ZYKB 3LS4L 3F6JA 1FIEA 3GM8A 4KRNA 1JNNL 4G83A 3QO1B 4R0LC 3FRPG 2COQA 1KENH 1J86A 3FQWA 2NRDA 5B1JC 3IF1A 3RTLA 3NZHL 1FPTH 4RISL 1QBLH 1QACA 4JFDB 4P3CH 1KLGA 1O9WA 4PLJD 3GBNH 1ZPUA 1IT9H 4P2QA 4UT6L 3K2KA 3SKOA 1SDDB 1ZT4A 7FABH 4YDVB 1F45A 3G5ZB 5T5NF 4PR5A 1FAIL 4LSQL 1IQDB 2VJ0A 1YEIH 2VISB 4Z3EA 1MRCH 4NC0B 3V0WH 4J2QA 1TCRB 4XAKE 1HAWA 3GMPB 3TN0B 3RZCC 5DQDH 2B1HL 3VXME 4HIJA 4FJ6A 2NR6C 3P40A 1A3ZA 2FH6A 1YQVH 1C5CH 5BS0A 5AAMC 4NN7B 4KKRA 1MFBH 4JFDD 4OGXH 4QXUH 5K9OA 1CYWA 2CM5A 3CVHB 5E5MB 1O7SA 2FX7L 3ET9F 3PWJA 5IOPA 1A9BA 1J5HA 2KQMA 4TSAH 1JZFA 2H0JA 4AV5A 3WFBH 3WMSA 3OKOA 4LAQH 3TN0D 4R8WH 1P84J 1O9VA 3NCYP 1RD6A 4JG0L 3HG1B 3PXHA 4P05A 3NFSH 4WI2A 1VRSA 2KLRA 4AENA 1ZTXL 4OLZH 4UQIM 3BDXA 4LNVA 3RVWD 1S46A 1WA0X 2IANE 1UH2A 2H2SC 5IP4A 4YSDA 2EICA 1D6VH 1Z6JT 1JFQH 1OSZA 1IARB 3EOTL 1HIML 1NAMA 5IIEA 2BWQA 1K6QL 3FMGL 5C07E 2J44A 3Q44A 5BV7H 1RZKH 3B6SA 1TZHB 1HHKB 2BFVL 1T1ZA 3K80A 1XB8A 4NUGH 4OF5A 5CUSL 5F9WB 4A6YH 4EOWH 1X5GA 2G4EA 2C8NA 2APBA 3HG1D 4ZRGA 1F8TH 3H9HB 3QUYC 1T5WB 4F9PC 5L6YL 1YDPA 5EBMB 1Z7JA 3P3UA 2OMTB 3I9AA 4NUPA 3P3SA 1OP3K 1MWOA 4NKDB 4LSDA 3L7FB 2R56H 3IGLA 3I75A 4WKZA 1BZ9A 3GBLA 3QFJA 2I27N 4KTEL 4H26A 3QK0A 4XMWA 4NXKA 1K2DB 1P4LA 3QNZB 3LMJL 3A22A 1OALA 3P11H 2E9WA 3RGVC 3VG9B 3L9RB 1J0KA 2GSIA 3H3BC 4IRSC 4J3OH 3IMBA 4H1LH 2EXYD 2JCCA 3D85B 5EIIG 5IVNA 3C6LC 4Y9BA 3ZE2B 4XCNA 2RCSL 1CBVH 3X1BA 4MKTA 1ZVYA 5AOIA 2WO3B 5L9DH 4RGOH 1GGTA 3AJ7A 2I9LA 2JI2A 4DO6A 1E9PB 3MMEB 1KGJA 4Y2DA 5C0AE 1NCHA 1O6SA 3AM8A 4KKBD 1PNCA 2DJUA 3H85A 3QEQD 1I7TB 2QVKA 4OB5H 2VLMD 2NW3A 2A73B 3D85D 3IDJB 4OLUL 4X0KB 4F9LC 6PCYA 5KJ7E 2ZPKH 1K5WA 4KOCA 3WELA 3MRLB 2AZUA 2PTVA 2AAAA 4OW6A 4EDXB 2R0WH 2PXYB 1JPSL 4FMKA 5EZOL 1OTSC 5BZXA 1ZA3B 4I48B 3SDXA 3NVQA 2UZIH 4D3CL 2ZYRA 2Q1EA 3AREB 1MNUH 1WZKA 3PWNA 5FHBL 3JWDC 4U1IB 5FGRA 5AB1A 3QIWB 1NCNA 1QHPA 1PDKA 3VD0A 3PL6A 2IDUA 5IQ7H 1KTBA 5CGTA 3TEZA 2V33A 3GGWB 2IOOA 3ZK0A 3AROA 4TOYH 5J6GB 1AXTH 4BRVA 4ONHA 3MBEA 4F2ME 5CM1A 2QPFA 4OCYL 5FM4A 3RWGB 3O0LA 4M7KL 2W59A 1GHFL 3ZT6A 4J1UB 2YJQA 4CMMB 4G7YL 3K6IA 1Z5LA 3OZLA 1UJ3A 3VXQA 5EU3B 2PXYD 2XZCL 5HVFB 3QRFM 1QI3A 1AXSA 4NUJB 2EIDA 4NQXB 3HZKA 2E27L 1D2OA 3ARED 3PQYB 4UT9L 2OMUB 1PLAA 1D7BA 5AVRB 2IGFH 4YMPA 3QIWD 1MJJB 3QJHB 2CDFB 3B2VH 1JGDA 5JORA 1RUQL 3IETA 1LEIB 4KMLB 2G0KA 2FJGB 1A22B 3VYNA 1OP4A 4MQXC 3QZLA 3CMGA 4NM4H 3L3DB 4X6FB 5C8JA 1E3ZA 5D5MF 4MJIA 5DQJA 4R5XA 3ML9A 2Z1KA 3CE1A 1HWWA 4UDUB 1DBBL 2WNWA 1M56B 2JKLA 4UU9B 3DTUB 1ZTXE 3PQYD 4X5WB 1GXEA 5DVNA 4QRSB 2EEAA 3TBYB 4FOMA 2H3KA 4UTAH 3CH8A 5FYJD 3RIKA 4JZOB 3WENA 4LVOB 2F8IA 3L16A 4YJZL 1IQWH 1OAXH 5IMLA 3V4UL 5IJKA 3CMOH 4FFYH 1VACB 5HYQB 3VGAB 5A2KH 3BD4A 3KWVA 5F1KC 3KYNB 2WJ7A 4H0IA 3IJYB 3VU2A 4BFOA 4Z7WB 1KCSL 1WA1X 5F88A 4ZOCA 3WNJA 4EN3A 4HJGA 4HS8H 1UCBH 3BP6B 1G7MB 1I3UA 3MLVL 4X6CE 4AV4A 4N0FB 2QKIA 2DWEA 7TAAA 1IKNC 4YSUA 3OMIB 3VI3F 3M17B 4BSVA 2O61A 5E2UL 4AIXA 2NYYC 4DP5X 4WGVB 1H5BB 2QPEB 1I9JL 4XP4H 2CUMA 3QAZC 4YSEA 4UANA 1T7XA 4QDGA 1A6WL 2DWTA 3MUHL 3HPLB 2J6WA 3M86A 1T7YA 4L1DA 4PJ9B 3T0EC 2F1AA 5ICYB 15C8L 2DTSA 2EYTA 4CVUA 2AXJA 5GGRA 5E8EA 3W57A 2MNUA 2YMOA 2F0CA 4Z18A 2D3JA 1ZGLA 1M1SA 1BLIA 5ESQB 3CSFA 1A6VH 3FQUB 4L3CA 1RIHH 2GSMB 3QCTL 4YBLC 4CVXB 1JYVA 4IQHA 1U2CA 3BI9X 4AOFA 5IFAH 1NIBA 4GSXA 1K4CB 1U8NA 3F58L 3LQAH 3LPFA 4G3YL 1EZVY 2YXVA 4MA8L 3EG9B 2ZOLA 1LK2B 4LASH 4A7GA 4A2FA 1VERA 2VLLB 2VR9A 3K6SA 1OPOA 3FU0A 1DLHB 4GG8A 3TYGL 3V6FB 4EQ2A 4PJ9D 3L54A 2CWRA 3ZBMA 4F7MA 3ROOA 1TTBA 3B43A 4JL1A 4WW2F 3S88H 1K3IA 3PDOB 1NCCL 3RUGA 4KVNL 2CLVB 4AZUA 1MFCH 4R7DA 5HI5D 3LH2L 3P9LA 4J3WA 1F4WL 1U8OB 2FUQA 2P5EB 2Q6WA 4IOIB 4OLWH 3HZMB 3RI5F 1TVDA 3R1GL 5AKTA 3Q8EA 5KYXA 5EF2A 1KYUA 4PB0H 2R0ZL 3VM5A 5KYUB 4GSUA 1IAOB 1GZPA 3ZY7A 5D2NC 1I3RA 4MQSB 4Y2DC 1AP2B 1SDAB 2LHAA 3ES6A 2AQPA 3HKZA 3CFQA 2N4IA 1U8KA 3BUIA 2W0FA 3WY4A 1DBMH 3HRPA 4CNIB 1M05A 2QR0B 5IM7B 1JNLH 3LD8B 3LKOA 5JOPE 3V52H 3GKWL 1NLBH 2XICA 2P5ED 3DYPA 3IFLL 3MO1A 3NT0A 3OJDB 4J6RH 5F89A 1XEDA 3B2DC 3WAJA 3VG0H 2XC8A 3QEUB 3AVEA 4KXDA 5TQ2L 2XPGB 1T7VA 3PUCA 4OKVA 4D0BB 4GBXB 1L5GA 3NDYE 4JZJB 2JB6B 4ODTL 4NPYA 1WFIA 4XVUD 5IK3A 3W9DB 3PL6C 1U8IB 5GIRA 3GHEH 4HMDA 2C3VB 3GSNB 1D5BB 2UWEE 3N44F 3BPLB 2YC1A 3MLRH 1IGJB 2GC7C 4OZIB 1R6VA 3AGVA 3MBEC 4A39A 4H4NA 5FFGA 3ZX1A 4W93A 2BW5A 2WINB 5K5YA 5L8KB 3U0WL 1PZAA 4MS8D 2EACA 1UD8A 1YY8A 5K59E 3FU3A 3VXUB 5FB8B 5L4JA 2A4EA 1BBJA 1JCVA 3E6HA 1UJ3C 1HJBC 1DR9A 2G2RA 1FDLH 1ACYH 3I02B 4AG4L 5KSVA 4JKWA 3FT3B 4MXVE 3CX5J 4GBXD 1UWYA 4O51A 4XB3A 2ADJB 3WKQA 5IHHA 2GTQA 2PWGA 2XVBA 4B3EA 5LNDA 1CXKA 2HZHA 3CPLA 4GRLC 3J8F7 2VDQH 3BEVB 4R97C 2QHRH 4B96A 3O6LL 1SLWA 3PFQA 3FBKA 3NPSB 4OVUA 4PRAB 2Z0UA 2IBBA 1IL1A 2BNQE 4I0PB 4LLUA 4F8TA 3S97C 2DQUH 2HVBA 2JF1A 4FFTA 2CHWA 3VXUD 1C12B 3ZDYF 1NFDA 1GCYA 3C8HA 1NC4A 1IJ9A 3FOLB 4DP6X 5FYKU 5I15L 4MMZC 4HU2A 5DZ9A 3T71A 4XMLH 4ZX6A 4UM8B 1FNAA 4X4XA 1U58A 2XQYG 3Q5YA 4Z78A 5TE6L 3L4VA 5JLZA 2QLYA 2HT2C 5EA0H 3VRLE 4HHAB 4X6DA 3WJMA 2FEEI 1QI5A 4I1NB 1NAKL 1E4JA 2AJ3A 3LEYH 3MRMA 5H35A 1O7VA 4E9VA 3SDYL 4I0PD 3IMRA 2IDSA 4K94C 2FB4H 3TFKD 1N19A 2K78A 3L1FA 4WUKL 4PGDB 3VMOA 3EH4B 4MQ7B 1CFSA 2I5YH 3WFCL 4DZBB 1Q90A 3GFUA 4XE0A 2QKIC 2CBTA 3V10A 3W11C 3WNKA 2IBZX 4R4BA 5KBPA 5C9JB 3NGBB 1ODAA 5I1AB 4ZW3A 2Y06H 4JPSA 4ZTOH 1YY9C 4MCNA 3ZT7A 1J0IA 3KH3A 3S2CA 2OX5B 4QR7A 3S3DB 1TETL 3QJFB 3FOMB 1JV5A 5DHXB 1MUJB 3ZR5A 1TZIA 3FHEA 5KJRL 3CVIH 43CAB 4IRJC 3SDAB 4ZW7A 5HYSG 1ACZA 5TGBA 3E0GA 4DKEL 1AMXA 1SHWA 3V4VH 2BY0A 2Z8WC 4QRPA 4U1KA 3IDIB 2XU9A 4M1CD 3DGCR 2A5UA 1KELL 2O30A 3B34A 2IH3B 3NESA 4I85A 4TUOB 4G9FE 3O9WB 2EDDA 3BDYL 4A2GA 1E50A 4ZMOA 4F2EA 5CLXA 2GSGA 2CKNA 3BQUA 4GQPH 2AXWA 3LKQB 5KS9E 1HINL 3ARQA 2A9NL 5CP7B 3WKNA 5E7FA 3B1UA 4A6YA 4JFQA 3EYVB 2W9DL 5AZEH 4PP2B 4EVNA 2CIIA 3SDAD 3GSWB 1DEEB 5CSBA 5D70H 4LCWE 2XJKA 4MRBA 3L9YA 4DOHE 2OMZB 5HY9B 1SOQA 4PRHA 1FV1B 4DNLA 4L0ZA 5IGXL 4XPTL 3O9WD 1WD8A 4KK9C 1AFVL 2LVCA 4ODXA 5AVYB 5HYJA 1RHHB 4GO9A 5GZNA 3WKML 4ZZFA 1T6BX 3SOBH 4HZ1A 3V0AC 2NY2B 5H4YA 2R4RL 4OUUB 2PYEB 1G6RB 4HLJA 4PRIA 2FWUA 1P7HL 4UT6H 4QY8A 1BZ8A 4ABVA 1U42A 3ZRSA 2EIBA 1HEZA 2YSSA 2ALWA 3PXJA 4U3SA 4DCQA 3CLFH 1I8KA 2WYZA 5EWIL 1YPZF 5GGVL 3ETBJ 5DUPH 2ZKHH 4XPAL 1IBGL 2AJZB 2G9HB 2E9BA 3ARDC 2CA3A 3QB7C 2ESVB 4LE8A 3NCMA 4H1LA 2HJLB 4IOSA 2WQAA 3TM6A 5HHQB 4S1RL 3EJSA 4LL9A 1FL6B 3FN3A 4H40A 5ERWA 4I4WA 2NY2D 3GSRB 2VAJA 5F72S 1DSYA 1KIUA 2PYED 4P9MH 4IHBA 5IW1A 3SY6A 3F62A 4NBXB 4UAOC 3ZYOA 3VI4B 2FX7H 2YGOA 4F58H 2BMKB 4MB4A 2NYKA 3ZTEA 4DP0X 2CJTA 1JWSA 5CLWA 2YGVA 2OL3B 1KCVL 2Z4QA 3HZYA 4IS6A 1NL0L 2ESVD 3BWZA 2VJ8A 3UTSA 4JG0H 4U1MA 3FZUD 2O26U 3OX8A 2Y7QB 2A74C 2BVQB 1N5YL 4YBQD 5HHMB 3SBRA 3VXPB 3ALWA 2WGNB 4HUVA 3TPKA 1DO5A 3LHAA 2E7MA 4X4YA 2TSBA 3FUNA 5KVEL 2K7PA 1MLBA 1AGFA 1T5KA 4P5KA 3U6RA 5CR8A 1HIMH 3UTTE 1EO7A 3VD4A 1K6QH 2RFXB 1LTXA 1A3RL 3FMGH 3FQTA 4N1CA 3S4SG 4LOEA 5LXGL 4Q9QL 2X1OA 2VN6A 1ZCRA 4QXWA 5CUSH 4TLSA 3QXWA 1R19A 2P8MB 1OK0A 2GTWA 4CKQA 4ELME 3DKHA 4K5OA 4RZCA 4QLWA 4U3XA 4BRJA 4AE0A 1NDGB 1NMAH 1CVRA 4ODWA 3H2WA 4N2AA 4PTTA 3GHPA 1DANT 4WQOA 4AZ8B 1ZGLP 1AO7E 5L6YH 2PPEA 1HOEA 1NPNA 4KOBA 4MMXB 5HHMD 5J1SC 1BF8A 1BAWA 2J43A 3DMMC 3GBEA 5JHBA 2B15A 5I24A 2CALA 4CDGC 3LH8A 5E8DL 4P2RB 5CGYC 3WL9B 1GMIA 4F24A 4PJBE 4HWZB 3MX0B 2DIJA 2Y3NA 3TGXA 3K71B 1AS6A 1PAMA 2CXGA 1B3JA 5HGHA 1T0NB 1ZANL 3BP5B 2GJJA 4KJYB 4ELKA 3PJSB 3LMJH 3R8QA 5F9JA 5GRVL 1ETJA 3D25B 4N24A 3OXSA 1PGRB 5BZZA 4RAVB 2D2OA 3SDDA 1DQLL 2BOBA 1WSST 2WZ5A 3HG4A 2QFPA 5I1KL 2L0DA 3C2SA 3BO8B 2WXFA 4P2RD 1KJ3L 3EOAA 2DMKA 1JMZA 1FAKT 2RCSH 4PM1A 3E9TA 4GKOA 3NCEB 3SKJL 1OP5K 3FQ1A 4Z7QE 3P0GB 5BVPH 2WBJB 1D5IH 3T6WA 4DN4H 2GITB 4OGQC 2P5WE 2WQRA 1QFWI 2ZUYA 5KTEL 1EO5A 1XAUA 3HI6L 4FFYA 5EFIA 3VE0A 5DUBA 5AD0A 3IWVA 5E9DD 4YN3A 4EXPX 3M45A 2X42A 3KDMB 3G5XA 3NAAL 4XGZA 4IDJL 3BQUC 1JHTB 4LCVA 1RERA 1UG9A 4K4KA 4PGCA 2HT4D 2NQDA 5CSGA 1RZKC 1LO3L 3NRQA 1JPSH 2ATKB 2BP8A 5EZOH 3VGHA 3ZJAA 5JIIA 2WBJD 2M8XA 4FQCL 2EDKA 4NI6A 1VZGA 3QZBA 4JVWA 5FHBH 2QQKH 3C5ZB 4ESKA 3MLSH 3P0YL 4XN7A 1UZ8A 2FEDD 2B9AA 2EZ0D 5DRZB 4M61A 5IROC 2DH3A 1BVLA 1S7QA 4HUWA 4R4FL 5MEQB 1AD0B 5EC1A 3Q13A 4XI5D 4LPVA 5GZNC 4FL4B 4Q14A 4M7KH 5INDB 1GHFH 1T1WA 4PVBA 1B4JL 1U8HA 3E8VA 2FDBP 4G7YH 5B4MC 3T65A 3BN3B 5JTWA 2GJZA 1RJYA 1QSEA 2FJSA 5T3XL 4GQZA 1JD7A 4YL9A 3UBXA 4YDJB 4N0UB 4KTDL 1ZPLA 2E27H 3GKZA 4UT9H 3C5ZD 1H9VA 4CVZB 4AJYV 4J3OC 1JHKL 3JQOB 4QLRA 4XPBL 3T2QA 2CBOA 5D7JB 3FNKA 2FR4B 2COVD 3GZQA 3WAKA 1RUQH 2FX8H 3PAVA 3N41B 5K1NA 5AKSA 3OV6A 3AQXA 3S98A 3VB9A 1F11A 1NPUA 3NIGB 1SOKA 1VHPA 2OMXA 3H1ZA 1KYDA 4L3EE 4DAGL 1TTGA 2NXYB 1DVTA 4HD5A 2A6IB 2BWDA 3LAFA 3MHZA 1UD6A 3VGDA 2CLRB 1F58L 4FG6D 4PJAB 5B8CB 2F19H 4Y16B 3IRCA 3OQRA 5DMIL 4I8DA 2G30A 2RQEA 1EAPA 1RI8A 5D7JD 2X4NA 3JWOL 4PS3A 1J0JA 4S1DD 5KVEE 1JTPA 3GB7A 2VXTL 3V4UH 2QT6A 4WRLA 3FN0H 5KYWA 3ARRA 1S7SA 1NPJA 2Q5BA 4EIUA 3RA7L 1KIRB 4XTRC 1ZY9A 3L7EB 3NJHA 1WUZA 1IZJA 3N1GC 4QJ5B 2FT7A 5IQ9A 3UJTH 5I75B 4LPTA 1JPGA 2R2CA 3HA0A 3ZDZB 1BFTA 3EJRA 4HUUB 4LQ1A 1J1PL 2EYSA 4MCYB 1E4XL 3MLVH 3FCUB 4ZW8A 3MRDB 1UOKA 4Y16D 4W9EC 3RVTD 5E2UH 5KZCB 3FCSA 3O3EA 2ADFH 2MOGA 1WAEA 4N5UA 3VXMA 2R27A 1QI4A 1HL5A 1I9JH 3B2MA 2GCYB 1NOFA 3MR9B 2NTFA 4JB9L 3V2AR 3DUHA 5E8OB 1A6WH 3RZCB 4R2GC 2H5UA 3Q06A 1AGEB 2YSTA 3IN0A 5DR5L 1RJLB 4XNZC 3PPSA 1T0MA 3DBSA 1NFKA 2MFNA 4UTCA 1V3KA 4N2OA 4FNLL 4C55A 2KT6A 4UOW0 3GLDA 1AANA 1J05B 3MBWB 5KAQG 2NXZC 4NNXA 3QCTH 4POZC 2M1KA 5LO7A 5DVPA 5CJOH 4ZFZA 3UZVA 4F5CA 2R0LL 4NCC1 3F58H 1ZSHA 2GUOB 2B1AL 5KZCD 1PG7L 1BX2A 4Z9KB 4G3YH 5F9DC 4MA8H 3WHXA 2ZX6A 3GXFA 1IGMH 2IH1B 3UAFA 1MNNA 1R3JB 4P2OB 5MI0C 1ZE3H 5L88H 3X1NA 1TDQA 4UQAA 2IANA 1GYAA 5CEXB 2YKLL 2CMRL 3TYGH 5J1AB 5E6YA 4NPKA 2X4OB 3RZCD 4KZDL 1IGYA 1T22B 5B3SB 2OYMA 3N5AA 4PSRA 5D9SA 3CXFA 4IIZA 3KH4A 1NCCH 4KVNH 5IB5B 1ZRUA 2N1KA 3NN8B 3SPVA 1D7DA 1F86A 3QBTB 4PJGA 3LH2H 2XBZA 4M7JL 5C07A 3U4BH 2C3WA 4H8VA 1HQ4A 3FFCB 3IGUA 1U41A 1EQWA 1BDYA 1IC4H 1ID2A 2R0ZH 1PG7W 1MHCA 5F71A 1EEYB 4OV5B 12E8L 5HHNA 4WEUD 1LHZA 2HB0A 4QHLA 1ACCA 2N56A 4P2OD 3CFBA 4KTGA 3TT1L 1W8NA 1W91A 2EH8L 2WNKA 2V5SA 3U9PL 1UD5A 1AZRA 1PD6A 4LSVH 1J8HD 3QUYB 2DMCA 5D7EA 1J1OL 2AK4E 3O4LE 2H2SD 4WVRA 1ZGLM 3FO9B 3GKWH 3KWWB 3EUUA 3ECBA 2ISDA 3KPSB 4WCYL 4G70B 2OMVA 4YIQB 5MERB 1SEBA 4HZAA 4KDTC 3U7AA 4WHYH 5LGKA 3QO0A 3S3JA 4BYHA 5D1ZA 2FK9A 1P9MA 4DO4A 3SPGA 4OBRA 2EEBA 1I1YA 4ODTH 3DX0A 3NH7H 2BDNH 2BINA 1UWXH 2IPKA 5E94A 1I8AA 3V5KB 3L3KB 3PAZA 4N2CA 3D39E 4GB9A 1NJ9B 2XTLA 5T3XE 3QUXB 5I66B 2D7OA 4NNYB 4IRSB 3QUYD 2YLHA 4AYID 1AG6A 1IGIL 3K8MA 3DUUA 3U0WH 5AFAA 3QUZA 4GAGL 1C5BH 5IJDC 2MEJB 5I8OH 2H7WA 3N9GL 1H0DA 1T1YA 3KPSD 3C6LB 4LLVB 4M03A 4NO5A 3LQAC 4BFEA 2C3GA 4AG4H 2LLLA 5FF6A 1AHWA 1KPVA 2YPLD 2ICES 3UTPE 3DGGB 4E68A 1KTJA 1SJEA 3SBPA 3FTVA 3FU6A 1HHJB 3OLEA 3RWCA 4BQCA 5C0AA 1SZNA 1SHMA 1G7IA 4Y1TA 2K4AA 4TLUA 3HLAA 1BZ7A 2PWEA 2JKRM 3OKMA 4ODSH 2ZXEB 5EUOB 5A2JH 3RGVD 2WXJA 2P43B 1Y1UA 3IPFA 3QUXD 3U9UA 4ZNEE 4XC3H 3ILQD 4PLKC 3P54A 4WI3A 4IRSD 4FYRA 5BRZE 1J8RA 4FN0A 1KB9K 2HFEA 4OQ1A 4F7KA 4N0YH 5FM8A 1HZKA 2ZSVA 3C6LD 2ZOOA 4QAWA 1X7TA 4GPVA 5I15H 1JZ6A 3BGMB 1KTDA 2FTAA 3V4PH 2A9CA 1YYLL 1CFQB 3FUDA 4JFHD 3AS0A 1CLYL 1PZBA 3I6LE 1KFGA 1Q8MA 1FYTE 2FZ3A 4M9PA 1MJ7L 4PJ5D 5F1IB 5TE6H 4DEPC 2CBPA 3TPUB 1SVCP 1KY7A 4UT6A 4HEPA 1NAKH 3MV01 4F2MA 3DJZA 2J4WL 4YBHA 4BK8A 2I7OA 1NKRA 1YEWA 3SDYH 3T6ZA 3FQWB 1SBBA 2BP5M 4LKXA 3TNMA 1JVLA 3F7LA 3IF1B 1Z9NA 1JE6A 4HX1A 2AMGA 2PCPA 4WUKH 2KL6A 2AJVL 4YNYA 1QSFA 2H47C 3TF7C 4CSPA 3JYBA 3FTXA 4H0HB 4P2QB 4MYPA 3SKOB 4DN3L 1ZT4B 1OTSD 3MNWA 2AGJL 4PR5B 3IPEA 5D5ME 3SGDI 4JHVA 3UERA 2I07A 1PX3A 1YZZA 3BAKA 3CXDL 3LNEA 2N59A 3EFOA 1KV3A 2N7BA 2J56A 3EJQA 1TETH 1IBFA 4HIJB 4FERA 3KL0A 4QNPF 5KJRH 5DI8B 1A7OH 5BS0B 2FX9H 1UD4A 4JO2L 5HHPA 1TTCA 5K9OB 1E6JH 1ZLVK 4DESA 3CQPA 2A77L 2EUWA 3DVFA 2ENSA 4P2QD 4UV4L 3VFPA 3PWJB 3TWCH 1NCTA 1R24A 2AZAA 4UWQB 5IOPB 4GG6F 3JWNH 4TNVK 1A9BB 1SNRA 3BDYH 1KZYA 4LGSB 4XMXA 3OKOB 3PWLA 4LO9A 4FABH 2V0AA 1MG3C 1HINH 1L7TL 2E75C 4S10A 1G9NH 4BK4A 3L9BA 3VI3E 1CYXA 2BZCA 2UY6A 3A21A 4GRWH 3FO0L 4O02L 4MQXD 3PJNA 3HB3B 1VZIA 2F5BH 3NQIA 2X9YA 4X6CA 4GAYA 1OSZB 2XQYK 2DWSA 4TNGA 3BFWA 5IGXH 1NAMB 5IIEB 2WWKT 3N1MC 5C6WH 1FVCA 4FC3E 4XPTH 4G59C 4G6FD 3B5HA 4OQTL 3WKMH 5CHNA 3B6SB 4AGMA 1T1ZB 2QZ5A 4LF3A 3SYCA 3UFIA 3EIFA 1C8PA 2R4RH 3E2HB 2EVHA 1JXKA 5D7IA 4CN6A 1OSEA 4W68A 1WIUA 3QAZB 5DT1L 1OCWL 4WO0A 43C9A 1ZDSA 1OKEA 1YDPB 1KCBA 2Z35A 5EWIH 3HB3D 1XMEB 2YHGA 2G3NA 4L4VE 5GGVH 2YD7A 1IBGH 3CK0H 5D2LF 1NIAA 1MWAL 3I75B 4WKZB 3SKMA 3SPJA 1MFEL 1BZQK 5J56B 3QFJB 2HRGA 2MOQA 3KYKL 4H26B 2KPWA 1P4LB 5AKRA 4HBCL 1UCTA 4ZMXA 2NYYD 2DIBA 1QSZA 4IBZA 1A4BA 4JN2A 4MD0A 2VZSA 3T0VA 4JKLA 3ZQXA 2GSIB 2OP4H 2IBZY 4FXKA 3BGFC 3HUJF 4HFWA 1N0XL 1E8XA 1S8DA 2UX7A 3QUZC 3H4FA 1OCZB 2JCCB 4GSRA 1KCVH 2WVTA 4X7SL 2EILB 1AHWC 4K5LA 3KBEA 1F2QA 3QNXA 4XCNB 5GRZA 3BQVA 3QFJD 5JIKA 4YC2C 5JPMA 3MQIA 2A4ZA 4Q6YA 5T3ZD 1H8NA 3OLGA 1DFXA 4RSVA 3LPWA 1HEHC 2I9LB 5KVEH 4MBOA 1X6LA 2W88A 4Y2DB 1EDYA 1O6SB 1FQ9C 4PVNA 4Z7OB 5DS8A 5E8PA 5AB0A 4G11A 4Q9QH 5LXGH 2NW3B 2C9PA 1E4KC 1E90A 2VABA 4Y4FA 4ZFOL 1A4CA 5I1CH 2WVUA 3OZ9L 3QHZH 1PMYA 3VDCA 1HHGA 2CRIA 1LXMA 2VR3A 3ZYIA 4G6AC 4MDJA 3SDXB 1OPGL 1XB6A 3NJGA 3UABA 2FD6L 3WO4C 5J8OA 3WDHA 3NZSA 2UWEA 3MPCA 5ESVA 3PWNB 5DS1A 3KVDD 4PD4K 1HT6A 2XWRA 3SE9L 1PDKB 3PL6B 4Y2DD 5ANME 1VCBC 1A6PA 3NP4A 4GO6B 1RZIA 5FEBA 3OKLA 4UT9A 2J1YA 4ERSL 4UOW1 3KXFB 2C3XA 4ONHB 3MBEB 3P3YA 5ISZE 1JF1A 3KYAA 3BH4A 4LDOB 4FNRA 4QKXB 1DBJH 2KZKA 2XN9E 4YHOH 5HGDA 5DVMA 1GTNA 1Z5LB 1UJ3B 4KRPC 3VXQB 4GQ9H 4ZD3H 2NNFA 2YD8A 4Q4IA 1AXSB 5F7YC 1DQLH 3HZKB 2SODB 4PJ7F 1LO4L 2X9ZA 4L18A 3P2TA 3IEAA 4JEGB 2WQSA 4DIXA 5E6IA 5EEVA 4FEIA 2EXSA 1HFUA 1D9KA 2YAPA 1WT5C 2OSLA 3D1MC 2R0KL 2J5WA 3PL6D 3UJIL 4S2SA 2BNQA 1JGDB 2Q0ZX 3SKJH 3KXFD 4JDVA 1OCCB 3IETB 4HD9A 1LD9A 3MBED 2H32H 2GW5A 4Y5XA 1OO2A 4UQ2A 1P5UA 5C8JB 3VXSE 1IGCL 3FFOA 1XGRA 4MJIB 5DQJB 3ZGIA 3L2NA 1WWAX 1F56A 5EG6C 5TF0A 1A7PL 4DW2L 2AEOA 3K5SA 4HGWA 4KY1L 1S3RA 2WXHA 2F58H 1A1OA 5F6IC 1LO2L 1I53A 4V2CB 5A7EA 2EO9A 1JZ4A 3VX0A 1LYQA 4HKBA 4XE5B 1XGQA 1XH1A 4ETQA 3V79C 1IGFL 3HN3A 1J1XH 1FLRL 1CC3A 5IMLB 4JAMA 2XT1B 5IB4A 4RNRA 3MJGX 2WAQA 1QPPA 4FQCH 4WO4C 4XCFL 5KG9A 2ZX8A 3RQ3A 2KZWA 3P0YH 3M1CA 1KXVC 2YRPA 4MJID 1BMWA 4U1JB 3STBA 4I3GA 4X0NA 5F88B 1FBIL 3BUDA 4ATTA 1N5AA 4YHNA 4HJGB 4EN3B 4R4FH 3BP4A 3GRBA 3MRQA 2QKIB 2DWEB 2DYSB 2LGNA 3BJLA 1AKJD 3SO5A 4BSVB 2O61B 1OSYA 1QASA 2ZF8A 1IBZA 2HT2D 3CPUA 4C56E 3LKPA 1HESA 3IAQA 4KTDH 4E42A 2WBKA 2EYTB 2X09A 3OHXC 4BCXA 4OFIA 2JI3A 3K2UH 4JM4L 4ODUB 5GGRB 3TONA 1JHKH 4IRJB 2IDCA 4XPBH 1ZGLB 3KEDA 4UILH 5CLZA 2HWZL 5E4OA 2OYKA 2F15A 4G9FA 4L3CB 3ZMEA 3WBDA 1BV8A 4XXCC 2FBJL 1H19A 1T5XA 4JVUA 1KUMA 4AH2A 2YD3A 1U8NB 4PS7A 1OCOB 2CA4A 2Q2LA 2XWTA 5F2FA 3EFDL 4WFEE 5KS9A 2ZOLB 4LLWA 1HC1A 4PG2C 4NKOB 2RMNA 1YY9D 3K6SB 4GG8B 3VXOA 1P1VA 3CDCA 4DEWA 4F7MB 4R90L 1F58H 4GP5B 3ROOB 1A8JH 2EIMB 4Y88A 3T3PB 4BFGA 4WNSA 3RUGB 5DMIH 4IRJD 1AZVA 1SLVA 4LESA 4R7DB 2XI9A 4UCFA 3P9LB 3QQNA 3UBXG 1G43A 4F7PA 4HOWA 2D03L 2Q6WB 2VXTH 4LCIL 4OF3A 3T09A 1T21A 1ZWIA 3UIYA 1CE1H 5KYXB 5CZXC 1ZT7A 4BA0A 4PRNA 2VDMB 4KJPC 1YPZE 3T0AA 3PGCB 4PRPE 2ZWSA 3W39A 3ZTNH 5L2KE 1K5NA 1GZPB 1U4FA 4FQJL 4JFYA 1I3RB 3RU8L 1KLUB 1R17A 3HE7A 3ZHLA 3ES6B 4LFHG 5F8RC 1E4XH 1U8KB 4L8SC 3WKYA 2W0FB 3OMNB 1M05B 4AYFA 1MFAH 4UDTA 3LKOB 1E28A 1A7RL 5BZWA 4N9GA 4WTQA 4PGEA 3MO1B 3RVXD 2VZUA 5F89B 2D7TL 4TSBL 3LS5L 3KLAA 4L4JA 1J9SA 5DR5H 4OKVB 4KK9D 1OGTA 2PPCA 1BPLB 4WI0A 1L5GB 5LDUA 3DOSA 4NPYB 1IILE 2Y07L 5IK3B 1DLFH 3FT2A 5GIRB 5I0VA 3CQFA 4FNLH 5TQ0L 5FK9B 2VN7A 2CJUL 2YC1B 1I85C 2NCEA 4H2AA 4R4NC 2P45B 3ZRFC 1WFUA 2QDWA 4JKMA 4PRDA 2R2EA 1TQCC 1RZFH 2B1AH 3ULUC 3H42L 1PG7H 1YY8B 5JIPA 1BBJB 1A7QL 3E6HB 2FRGP 1OM3L 2G2RB 4PGJA 1UXLA 4M4RA 3UCRA 2YKLH 2CMRH 2A6DA 1VFBA 5KSVB 1L0XA 2VQ1A 1GZQA 3BKYL 4GKLA 4O51B 1D9KC 1MZYA 2JKTM 3C60C 1GGIL 3QZOA 4JFFE 3UTTA 3V4PA 3CPLB 4M7JH 4KGJA 5D96B 4BHUA 4JY5L 4RETB 3FB6A 4PJ8A 4TSCH 1HYSC 2Y24A 4LCCC 4LLUB 1IL1B 1P5UC 1XD0A 5C70A 4Z7VA 2V2XA 1WP6A 4ELMA 1NFDB 4PB9H 4X8CA 1NC4B 4HK0A 2V9RA 4Y19E 1WBXA 1AO7A 1QWUA 5T5FH 3RPIA 3SIKA 5I8CA 5L2JA 2EH8H 1BEXA 2H0PA 3U9PH 3L95A 1URZA 3UADA 4X4XB 3A67L 3SQRA 3W82A 1U58B 3WJLC 2FBOJ 3NJVA 1NCDL 2R1WA 3MNMA 3FCTA 1H6FA 4X6DB 3HI5H 3WJMB 5DSCA 4M1GL 3MRMB 2AJ3B 4RFNC 3RTQC 4I18C 4H0LC 5H35B 3BJ91 2C4FU 3RY5A 3B9KC 3CHQA 4NZJA 1Y6MR 1E4WL 3WEOA 2AV7A 2X4UA 4EPSA 1KSRA 2NY5L 1NC4D 3PXLA 1CFSB 3PIQA 4HGMA 3KGRA 4N0CC 4ZPVA 8FABB 2PPAA 2VTFA 2ENQA 2HKHL 1G1OA 4HEME 4KO5A 4R4BB 3FUIA 1IGIH 3V5HA 4FA6A 1BG9A 3S36X 4GAGH 1TO4A 1DJGA 2GHZA 3N9GH 1DQTA 1GRWA 1XF5A 5CGYD 1XF1A 2YZ8A 1OM9A 2OJZL 4N90E 1Z32X 1JV5B 1WYJA 1V5JA 1ECYA 3V9CA 1RQ5A 1TZIB 2P5WA 1IBDA 2EDHA 1ZE3C 3ZKMC 3U9WA 2G2NA 4LL4A 3H2QA 1TZAA 3FO1A 4JFPA 5TGBB 3DI3B 5E4EC 5HJBA 1FI8C 2DD8L 2X3CA 4B60A 5CLTA 4M62H 4QRPB 3TYFA 4YSQA 5LXVA 4U1KB 1GKOA 4A2HA 2AFNA 2PLTA 3G04A 2X4PA 3CWGA 4HSCX 1Z9MA 2VMFA 2HFGL 5C2BL 4W9GC 1NCAL 3X11A 5SX4I 4CDHA 1BQRA 2GSGB 3BQUB 5DD3L 2OS7A 4KI5F 5E4AA 4JHAL 3RIFK 1NGYA 4OM0L 3SBQA 1YYLH 4UNTA 5BV7B 4FNPA 1OZUA 1JYWA 4A6YB 2YUXA 4JFQB 1CLYH 1GIGL 3ARZA 5DC0A 3V0VA 1UT2A 2AVFA 2CIIB 3OMZA 4EVNB 5DD5H 3GIZL 4MZ2A 4DGYH 4K3HA 4QRPD 4W9IC 4PRHB 5D55A 2J4WH 2ZOUA 3CN2A 3FU8A 1TU2A 4NYLA 3VGFA 4ODXB 5HYJB 3K2MC 1T2XA 3OMAB 5JW5A 2ENYA 4KAQH 1XSIA 3BQUD 2AJVH 3OB8A 3HE7C 4P23A 3UP6A 4Z7AA 1DJSA 2ZNXA 4PRIB 4PJIF 1QYGL 1WGOA 3GIVA 2DQDH 1M6OA 1PF3A 3LXCA 4IRZL 4DETA 4R3SA 4DN3H 5CZKA 4L8DA 2EE9A 2YSSB 1HEZB 4M3JA 2YGQA 2AGJH 2X5PA 4DCQB 1I8KB 1GS8A 4G1EA 4H8HA 3CXDH 1NCIA 4PRHD 2WXLA 1KOAA 5CO1A 4H1LB 1H6EA 5AB2A 4X5RA 5E6UB 3QPXH 5HYJD 2J3SA 1JAEA 2NW2A 3QA3A 5GZND 2BIHA 4I4WB 2V9UA 3NG5A 4JO2H 1TQUA 5D7LA 3CQQA 3WXWL 1FJ1A 1KIUB 4PRID 4JPVL 4IW4C 5IW1B 5B4MD 4QRQA 2ZOKA 3F7VA 2A77H 4C58B 4TNVF 4OIAA 4OV6F 5D8JH 2ED8A 1XGYL 1MCWM 2AQ2A 5EN2A 3EDEA 1JWSB 2E47A 1WQVT 4J3OD 5B3JE 3DWTA 3FK3A 3HPJA 4BZ2L 2Z4QB 2IDTA 3HZYB 2LLNA 4IS6B 2B0SL 4WAFA 4CBZA 1JG9A 3RE0A 1K3ZA 2VZOA 3GSVA 4U1MB 1UH4A 4IOSD 3OX8B 5HDQL 2OSXA 1Q9LA 2CO6B 4FKKA 1DJIA 4XMKH 4O02H 1MCCA 4P0DA 4OZHF 4U31A 2LVEA 2JKNA 1LK3L 4AVHA 4X4YB 1D5RA 3IGKA 1MLBB 1AGFB 1MHPL 4P5KB 3U6RB 1YHPA 3UZEC 1E9OA 5JUEH 5FXCH 3WUWB 3FQTB 3DPBA 1ADWA 4NQDD 4P07A 4UZSA 3MTXA 1YO4A 3S5LG 2NYZA 1JS4A 3QIUA 2GTWB 5K9JH 4RZCB 4U0RB 4ODWB 5BW7A 4KDWA 4PTTB 3JV6A 3A6CL 2K6ZA 3HTLX 3OJVC 4PTUA 4WFGE 1RPUA 2A38A 2VDNL 4AUUA 2EE6A 4WNQA 5C0NC 2DL9A 1E30A 2ZG2A 1YC7A 4HJJH 2DKMA 4FQLL 3FT0A 1MWAH 2FATL 4MFHA 2CHDA 5C0RL 3QJVB 3EDFA 4N2GA 3U30C 3O2DL 3KYKH 3C5XA 3AG2B 5HGHB 4UIMA 5FECA 3DECA 4ELKB 4HBCH 3SPHA 1QRNE 3FH7A 5F9JB 4OVVA 3R0MA 1RP8A 1BREA 1ZSDA 5MI0B 2AJUL 3OXSB 2H32A 4ZX4A 3FXIC 1WTLA 4AQ8C 3SDDB 3WE1A 3RX5A 3VFTA 1DCLA 3BX7C 1ITBB 1KJ2L 1N0XH 1MW3A 3CJJA 5I71C 3P3RA 3DGDA 4ZUWA 1UB6A 5H8DA 2O6PA 1NCOA 4X7SH 3EOAB 4ZMLA 3NJJA 5KVDL 3JWNC 3MN8A 4POZD 4MAZA 3TVMC 4N68A 4BXSV 3TFBA 3EW3B 3QQ9C 5C6TH 2DEWX 4MCZA 4HWEH 1X5MA 2GT9A 3IS0X 2OAAA 5KBDA 2ZZUT 3PHQA 1G9NC 2FYYA 5DJCA 3BYYA 2RALA 5BQ7A 5EFIB 3J2PA 3VE0B 2XA8L 5DUBB 3O4LA 3SDDD 1HSBA 3H54A 2VMEA 2Z6FA 3VNZA 3WD5L 3D3VE 4D0CB 1ZHNA 1D7FA 2Y25A 2GBVA 5D4HA 1ERNA 4M5YL 2VUYA 4NC1E 1A7BA 3ETSA 4XGZB 4G80A 1PU0A 4K55A 3RBSA 4LSPL 1AC0A 3ZYZA 4PGCB 1GSMA 1VEPA 3SGJA 2FQDA 4MJ5A 2IJ0C 5JW4R 3H6AA 4J28A 2BP8B 2WLLA 1HQRA 2FD6H 4N8VA 3L5XL 1YEGL 5DZJA 3WOVA 4A68A 4D94A 3D39A 1CQKA 2OTUA 1UZ8B 3SE9H 2NX5D 3C2AL 3U0PA 1J87A 5CZVL 2ZXWB 4M61B 2X4SA 1UOWA 4NLHA 4Q8BA 3UL4A 1S7QB 4HUWB 3FH5A 3CZFA 5EC1B 2W9EH 3KHQA 2JKIS 3KPPA 4XX5A 1CGSL 1PSKL 4CUCA 3VXRA 2R1XA 1BQKA 1GY2A 1T1WB 5ITBH 5BQDA 3L4CA 1U8HB 2VR5A 4PY7A 1Y18A 3KVQA 3T65B 1L0PA 2W91A 2GJZB 1RJYB 1QSEB 2YJLA 4HWBL 4N87A 1U3YA 3UBXB 3CFTA 3TBBA 4F7TA 1KT2A 3LN9A 1LO4H 5JIDA 4B9KC 4J8RA 2N01B 5GJSL 1QEXA 4HC1L 2CCWA 4ZNEA 2R0KH 4FDWA 3MUY1 4ZOAA 4LSRL 5SWZE 3UJIH 3ZE1F 4J5VA 5GSVA 3GLZA 2LFGA 3VRIA 2Z8SA 4HUMB 5JIQA 3BRGC 3PABA 1F11B 4OJFL 4NHCH 4L05A 2DQIL 2VH5L 2OMXB 3VGGA 5G2NA 1YQ2A 1E5CA 1YEKL 5INCA 1LGVA 3QZWG 4BSWA 1QSED 1KGUA 1A7PH 3DK2A 5C0EA 1FYTA 2VUKA 3CU7A 1OP3H 2HKAA 3F5WA 3FUMA 1M42A 3ULVF 1LO2H 1QP1A 3EJPA 2E7HA 4OTXH 2CH8A 1CURA 3GS4A 1EAPB 3FQNA 4AVKA 4DEPB 2X4NB 1N8ZA 2DLTA 1IGFH 2OLDA 3A4AA 1FLRH 1YUHA 3GB7B 4MDIA 1XGPA 4RCAA 2FHFA 1KF9B 4PLKD 5KYWB 1S7SB 5I19H 3KPMA 4XCFH 3VWJA 2CG9X 3H7LA 1BGXL 5IQ9B 3ZSSA 2BNRE 1JPGB 3LNHA 2D7PA 2R39A 1FBIH 3Q2VA 4ES9A 1YNTF 3NEXA 3CFMA 3QARA 5AL8A 2EYSB 3MCKB 1VJSA 3JV0A 4G8FA 4QNPE 2YMTA 5G55A 1ILUA 3FCSB 1KGWA 3O3EB 4XWGL 4AI7A 5IHWA 3VXMB 3MZTA 3V5DA 2FE0A 4GY4A 1IFHL 2NTFB 3MLXL 1EZLA 1E6OH 4GG6E 1URIA 4JM0A 2V2WA 4N8UA 4RGMC 2IV8A 2NDGA 2HWZH 3R4RA 4G7QB 3W0WA 3BD5A 5HI4C 3IS1X 4ZI8A 1YYMH 4NNXB 5JXEC 4EI5A 3UZVB 4ZFZB 5JQ6H 2FBJH 2R15A 1TTFA 4K9EL 4K3JH 5J89A 5DURD 1V3JA 1FGNL 3OWEA 4XAKD 1BX2B 3WHXB 3LDBC 3VXMD 2AJYH 2GI7A 2VDQB 4ZZKA 1HSAA 3GRWL 5HJ3A 3VI3A 4F37K 3VQ2C 1SY6L 2IANB 2YPKA 3D30A 1XXDC 4X7DC 5KVDE 2X7LA 1IGYB 4R90H 1WA2X 1X4XA 2TRYA 3CHPA 5D9SB 3V6BR 5IB3A 1A1NA 2Z7YA 4AKOA 2W8CA 4ZMPA 3SPVB 2YUVA 3RKPA 2VXVL 3BRFA 2H3XC 3K3QA 4PJGB 2EC9U 2X1XR 5MEOA 4OCNC 3T0BA 2EYRA 2D03H 4QEGA 5C07B 3QHFL 5CD3A 4DT2A 1HQ4B 2Z92A 4LCIH 1IEAA 5BXFA 1JN6A 1BFVL 1MHCB 5HHNB 4QHLB 5F0JB 3CFBB 5D2LE 2IAND 4AEHL 5MEPA 1IX2A 5E6ZA 4O2CA 4AGLA 1CD8A 4Z3HA 5DA4A 3WMQA 5DXWA 3F83A 4L4VA 3BW9A 1PBYA 4FJYA 4Y2NA 1WC7A 4L4TE 5FWQA 4GP4B 4F15C 1BIHA 1A4AA 1NCJA 1NEZB 2DMHA 3ECBB 3SGJC 3LZFL 5C07D 2DS4A 3PHSA 4E41E 2D7TH 4TSBH 2OMVB 5EBGA 4ENZA 3VFRB 2D4DA 3CHRA 1SEBB 1WFMA 3HUJE 1CLCA 4FYTA 5FYKH 1UM6H 3QO0B 5D1ZB 3I6GA 4U1HA 3MLUH 2FWLB 1A5FL 1KZQA 3LPGA 1I1YB 2ZCLH 2Y07H 5D7KD 2IPKB 5E94B 4KKAD 5TQ0H 4KRLB 1SXNA 2EVJA 3CD4A 2RACA 2VDPH 2XN2A 3FO2A 2B2XH 4U4BA 4ADJA 2P7TA 1JVOA 3MGOA 5CKAA 2BCMA 4X5QA 3IDMA 3DUUB 2G75A 4UNIA 4PW3A 3QUZB 1L9RA 1QLFA 4UNVA 1OM3H 2EP6A 2BP0A 1H0DB 1T1YB 4RSYA 5IWLC 4NO5B 5C08E 3BD3A 5FF6B 5E9NA 4AVJA 1AHWB 1KPVB 2DDQL 1XXFC 4KMTL 2AKRA 3KM1A 3BKYH 1SJEB 2PCXA 5FKPA 3IJ8A 3MOBL 4YC2B 3U6XA 2W1NA 1MELA 4XC1L 5C0AB 5JQHC 3LX9A 5C0CE 3SD2A 1GGIH 1GGBL 1EWHA 1G7IB 3KBPA 2Q8AH 3HLAB 1BZ7B 4MB1A 4BEIA 3OKMB 3BKJL 4LSTH 2AQRA 3L2LA 2IFFH 4JY5H 3U9UB 2JLLA 3BN9C 2KQNA 3OR6A 3Q6GH 3BFOA 5DJAA 4QXTB 2HFEB 2HMIC 2OK0L 4CGUB 1GJIA 1CUOA 3QUZD 1NANH 1JVKA 1QNIA 3L3IA 3SE8H 1IAIH 2ZSVB 3HHSA 4ZOEA 4RMRA 4F92B 3WLWD 1UWEL 4XXWA 5MHSE 4E0RA 3AG3B 1DBAH 1KTDB 3K6DA 4U7MA 4PWHA 3H3PL 4LHUD 3LZNA 3A67H 3WO4B 5C0AD 2FZ3B 5ANMA 3SE3C 3T77A 4XMUA 4CC4C 1NCDH 3V0EA 3GRGA 1WZAA 5I73C 4Q0XH 1TKWA 5ISZA 4F2MB 3DDFA 3EYSL 3FU5A 4NUQA 4PJ7E 3I6KA 1EXGA 1OAUL 1SLUA 1LEGA 1XF3A 5DF0A 3VWJC 1U2YA 4FFZL 5IG7A 3IMWA 3NJIA 4LKXB 4ZUUA 3TNMB 1I1FA 3O6KL 2PCPB 1VAHA 5GS0L 2P52A 1N4XL 5D71H 4FFVD 4YLQT 1TMCB 4YNYB 3QIBA 1QSFB 4KRPB 2BRRL 4LEOA 3OAUL 2BSBA 2NY0C 3MNWB 1WK0A 4HIHA 3JUYA 1M7DA 3CZEA 3GUTA 3EFOB 5SWQA 4H0GA 3FT1A 4MA1C 2LT9A 1NIDA 3B3BA 1HH6A 3VXSA 2OA9A 3VH8G 4XCEA 3AQZA 5HHPB 3ILDA 4X9FA 2DD8H 2WZ6A 1QSFD 4HG4J 3NRPA 5M7QA 3TBVA 3EJCA 1ZDQA 2MQCA 4KRPD 4L5FL 4O02A 4KPHL 3VFPB 3B5TA 1R24B 1WZ1H 2HFGH 5ICXA 3RX7A 2WJ5A 3TZVA 4Y1AE 5F6IB 1NCAH 4YDIL 3ATDA 4F1SA 2F8OA 3PWLB 4HISA 4H8WL 3RIFF 2DMGA 3ZTJH 4DEUA 3ESVF 2AABH 4NT6A 1I1AA 1FN4A 3VFGL 1C9SA 1IVLA 2UY6B 1JGUL 2YAQA 5E51A 1GIGH 4R7NA 3U46A 1HNYA 1MH5A 3P4LA 1CFVL 2IAMA 3GIZH 1UA6L 3HBZA 3N6YA 2E7LC 4X6CB 4GAYB 1ZV5A 2C1OA 4IHOA 1PCXA 3LJ3A 5FS5A 1LNUA 4YZFF 1FVCB 5DHMC 1PAZA 3A24A 3GMQB 3ALPA 4C56A 5J11B 2Q3ZA 2VXSL 2XG4A 4LPWA 1MPAL 2F68X 4LF3B 1MWAA 2UZXA 4XP6L 5JHLH 2GY5A 3EZ8A 5D7IB 4U6VL 1XX9C 3KWTA 4I2XA 1QYGH 4CRPA 3CU1A 2X2YA 1K85A 4OLVL 4IRZH 4WEBL 2R29L 4WI6A 43C9B 1IIIA 4JPKL 4G5ZL 4HCFA 4WO4D 1U92A 5F21B 2Z35B 5JIMA 1QA9A 2HYMA 4WWID 1DJWA 3RL1A 4MXQC 2BOCA 1J11A 3IDUA 5EPMB 1DL7L 4MMYA 3MRFA 3SKMB 3MGTA 5AVWB 5I0WA 2CXKA 3CN0A 2KI6A 1UD3A 1H8OA 4KI1A 3DO7A 2CRZA 3OXRB 4PP1C 4RRPG 3WXWH 4JN2B 4MD0B 4POUB 3WDJA 1WO2A 1SYVA 1FO0L 4FXKB 5D7HA 3NJMA 4KJWD 3AU0A 1KPUA 1S8DB 1XGYH 3OTTA 4AIZB 1EK3A 2NY7L 4BZ2H 5C0BE 2X70A 4ES8A 5FUZL 2R2BA 3QNXB 4NZRH 4OAWA 4PRPA 1H3WM 5L2KA 4ZFOA 5JPMB 4G8EA 3ILPA 2V3EA 3KPLA 4RDQG 4IEFA 4QHPA 2IQAA 1GY1A 2Y6TE 1MDTA 4NQTA 2B14A 1KBGL 1AHKA 4TL5A 4AVIA 1MHPH 4HPYL 1MZZA 5DS8B 5E8PB 4OKDA 3HG0A 4FAAB 2IIJA 2WZPA 4Y4FB 2VABB 1IC1A 5HHXL 2EAEA 2ADGB 2W95A 2IPTL 2VRQA 4D8PA 5ACLA 2BS71 3GSQA 1LO5A 1T6WA 1UC6A 1HHGB 1Y6KR 2Z3FA 1S2EA 4MDJB 3KWXA 4PHXA 4ZQTA 3NCCB 4XBGA 1AJ7L 2UWEB 5ESVB 5CD5D 5J7CC 4JMXA 5T5NG 5E2WL 4LEXL 2PNDA 2NZIA 1IUZA 1H3PH 4R7VA 1BIIA 4FA7B 4HXBH 1RZIB 3HNTL 3OKLB 5C0RH 3Q7JA 5JOPD 1LQSR 4FXGA 4GMSL 3O2DH 4TLKA 1GPOH 2CIKA 2DIAA 1JF1B 4QOKE 1TQCB 4Y4FD 2YLKA 1X5FA 2B3RA 5ENWA 2IMNA 1I7ZA 1WGVA 3TXAA 3QIBC 1NBZA 3CSPA 1ZVHA 5HGDB 4KFZC 4TNFA 3LCYA 2AJUH 2R23A 5I0XA 3ZE2F 3D08A 5HD8C 2AI0L 4UB0L 4UNUA 3D9AL 1R5VA 3QR0A 1KJ2H 2WN2A 1OP9A 4UIKL 1B2WH 1EEZA 1P7KA 4I0CC 5E6IB 3H6JA 1TQWA 1D9KB 4Z7IA 2OSLB 1IVTA 3C60B 2KERA 1W72L 4S2SB 2BNQB 3L5JA 4GYBA 4JDVB 4L5FE 1BQHA 4R4ND 1ZLUH 1LD9B 1JI1A 2GY7B 4HS3A 4Y5XB 5KWYC 1N3NA 1E5ZA 4Y19A 4UQ2B 5C92A 1P5UB 1X44A 2EDTA 2AS5M 2H2PC 2DLFH 4ZOBA 1P53A 1XGRB 1SOSA 4NS0A 3W2DH 3HBPA 4FQ2H 4J7RA 4HGWB 4EUPG 3CFEA 3C09B 4NB7A 1A1OB 3L4WA 5KVGE 2CAKA 1KTLA 5IJBC 1B6UA 1D9KD 3C60D 4YLBA 3FT4A 4HKBB 1XGQB 4ETQB 2BNQD 1I1AC 1MCOL 3QWOA 4JHWL 5DO2C 5IMMA 4ZMWA 5F7FA 2MNJB 4JAMB 4HETA 4L9LA 1SDYA 4RFNB 5IB4B 4RNRB 3BT2H 2WUCH 2RBLA 4ZXBC 3HS0C 1HYSD 1YEGH 2XIBA 5KG9B 2IAMC 4Y8DC 1WWBX 5CZRA 5AB9A 3S6CA 3FTSA 4G8AC 2ZG1A 2C7UA 3C2AH 3EJTA 1MFVA 2WKOF 3QRGH 4HEMA 4P4KC 4WI8A 5CZVH 1N5AB 2DJ4A 3PFUA 3TO4A 4YHNB 4PWIA 4TQ8A 4Y89A 5I8EA 3FJTA 3BP4B 2FQEA 5EU6E 5EIVA 3JYCA 4KROC 1CGSH 1R46A 1IV8A 3VQMA 2CD0A 3RGBA 2XWEA 2Y7MA 1T20A 3CX5K 4MA3B 4UT7H 4Y2LA 5IF0A 1JZIA 4HWBH 1UT9A 3RTQD 1I1CA 1UYWL 5BNXD 2WWMC 4E42B 2EKJA 1FFRA 4MJJA 1SBSH 4KI5E 2CJSA 4LSRH 1OVZA 5E4EB 3HHMA 4G9FB 4R9HA 5AZUA 1G9HA 4N0CD 4ZTPH 3T0XA 2FGWL 1OGAE 3EF4A 1T5XB 4AH2B 5ANHA 3IDYC 3S2AA 2XWTB 4YXLL 4FQPA 1AD9A 2QQLL 2DQIH 4YQXH 1SEQL 5KS9B 4LLWB 2X44D 5FUCE 4FCHA 2W65A 2VJXA 1YEKH 4N6RA 1BVNT 1TTUA 1DBKL 3VXOB 4QTHA 4ELDA 2JELL 3F84A 2X2IA 1V7MH 4APQC 3D6GA 3FUEA 5BOZG 3NCXA 4OI8A 3ZKMD 2AEPH 4PJIE 5EORH 2EABA 3NOIA 1WUNT 4Z0BL 5LNGA 4JFVA 4F7PB 4FHBD 1XSJA 3DBXA 1EA9C 2FWOB 1T21B 1ZWIB 2P49B 2WQ8A 4PRNB 3MLYL 4WHDA 3W39B 1K5NB 1BGXH 1CD0A 4JFYB 3UO1L 1IZKA 2QADC 5LN8A 3I3BA 4AX3A 1CE6A 3HE7B 2ICEA 2IMMA 5GGSA 3VD1A 1H9DA 1NBQA 3F65A 2DQHL 2WXNA 2IGTA 3UACA 2HT3C 3GDBA 4AYFB 3BEWA 5C09E 4UDTB 4ADGA 1E28B 4XWGH 5A3ID 5BZWB 4N9GB 1OP5H 1FC2D 4Q6IC 4YHKH 3QXTA 4PGEB 3KBFA 2WY3B 2BS8A 1IFHH 3MLXH 4Q6KA 3KLAB 2NUPA 1LWHA 1UB5B 2VC2L 3B3IB 4LNRA 3WIHL 4NKQB 3S3SA 1OGTB 4MZRA 2QGBA 3SQOL 2ITCA 4WI0B 2H8PA 4GQRA 3ISYA 4JL2A 4XNAA 3HE7D 3AB0B 1A14L 4HUKB 1VLXA 3RWDA 3N0PB 3ULVL 4A2LA 4PRDB 3LKRA 2R2EB 3O41A 1FGNH 2A9ML 2R51A 3CXHJ 3NYKA 5E7BA 3DK0A 2EVGA 1EBAA 5IZ7A 3GRWH 3HFML 1SY6H 4M4RB 4HKJA 2I69A 4MA7H 3MI6A 1NINA 2A6DB 3O3DA 1VFBB 2VQ1B 3MUJA 1GZQB 4A55A 3BHBA 2ZJSL 3AT0A 3DSFL 5JZ7C 2J88H 1LDSA 4E9SA 1UTDA 2VXVH 4H88H 4PJEF 4Y7MA 3V4PB 4BA8A 3V9EA 1HXYA 1OOWA 3QHFH 4HALA 4WKXA 2OW7A 3U79A 3FB6B 4PJ8B 4U6XA 5DK0A 3Q9PA 3AS3A 5FGSA 1BFVH 4Z7VB 1CDUA 2V2XB 4HH9A 4ELMB 4WWOA 2FECI 4RQQA 1S5IH 1U95A 4HK0B 3Q2WA 2NMSA 1WBXB 3EJZC 1RIVL 1WD9A 1XCTA 3RPIB 5L2JB 4D9LH 1R3IH 3AZUA 4ZX3A 3L95B 2P24A 3L81A 1NGWA 3O2WL 4WV1A 4WJG3 3V7MA 3F7YA 2R1WB 3PAUA 4N3TA 3FCTB 5HDBF 5K33A 1DYZA 3UZQA 2XUWA 5DSCB 5FKAA 2FL5A 4LGPB 1ULVA 4OZIF 4PJ8D 5F7LB 5C2UB 2F18A 1QRNA 2YD0A 1OTUD 3U30B 4S0HA 4IBVA 2AV7B 2D7NA 2X4UB 2Q8BH 5KSAC 3LIZH 3IPBA 2OI9B 1IKOP 1X5JA 2IDQA 3IVKA 5FPIA 3PIQB 5E56A 1ORQA 4ZPVB 1V7NH 1ZA6A 4Q9BA 3CFCH 4FI6A 3IAGC 1CICA 1FZJA 3V5HB 2F7OA 1LL1A 3MJ7A 4G72B 4Z76A 3UH8A 2WBXA 1XF5B 3ECVA 1YNLL 1JWUA 4P9HL 2DDQH 4FYSA 1HNFA 4KMTH 1KB3A 4A67A 1F1AA 2P5WB 3QDME 2AQQA 4YLCA 1RXLA 2OSYA 1GCFA 3MOBH 4XC1H 3ABMB 2BJML 1GGBH 4JFPB 3D3VA 3QWRA 5IW6A 3TYFB 5JO5A 1W6WA 3WG7B 5B39G 2ZICA 5CINL 1MAKA 2JJTC 3G04B 2X4PB 1DVSA 2EC8A 1YEEL 4GRWB 1RZJC 3DHJA 4N2IA 2OK0H 5KN5A 5FCUL 4C4KO 2WUBL 2JLPA 4W9DC 3X11B 1RCYA 4P04A 4E9TA 5I0DA 5TE4H 1KFAL 3TCLB 1NGYB 1KDIA 1WEJH 1OHQA 2P5WD 3H3PH 1M4KA 1F6AA 4FZEL 3V0VB 4HXAL 4WTWA 1E0OB 2YEZA 3RAJL 2DBLL 4WI9A 4IRZA 3VFMA 3FFDA 3MNDA 1WH0A 5EV7A 1L9OA 2WLKA 2BSDA 3EYSH 1MRDL 1KWGA 2C9RA 4YSRA 5HSFA 1LE5A 1OAUH 4V1DE 3RKDC 2Y36H 1TU2B 3ML8A 1N7ML 4FFZH 4NYLB 4N6QA 1HCYA 1S7RA 3MSPA 3O6KH 1OD9A 2YAFA 1JYNA 3HG3A 3T8VA 4XOAA 4P23B 4OM1H 1GAFL 3QE5A 4GXVL 1KCUL 3GIVB 1ONQA 3OPUA 4R3SB 4OFVA 4L8DB 4XN1A 1ICTA 4GFXA 4AGQA 4DUVA 3TBTA 5SWZA 2WXIA 4GIPD 2XJLA 1JCKA 4G1EB 3HAEH 5IB2A 2D0FA 4PWJA 4NFCA 5GS1C 1ED3A 1SQMA 4F93B 1JPTH 4U2ZA 2I60H 1TG8A 4K3DH 5AW0B 4D0DA 3ULVE 4BFIA 1PQZA 3X2QB 1DSFH 2NW2B 3QA3B 4BZ2A 2QVTA 3MJ6A 1CZ8L 3FN9A 3LPOA 3MV11 5D7LB 4P23D 4TF4A 1FJ1B 4RWYH 1NCBH 3FHQA 4QRQB 2ZOKB 3F7VB 3BWSA 4PVMA 5F3HA 1FRGL 4KPHH 3LB6D 3JVFC 4JRLA 5E03A 3GXDA 1IC0A 3QDJE 4WWKA 4PVLA 5EN2B 5IBTL 3AY4A 3HPJB 2G5UA 1CBJA 4CSZA 2OJEA 3GSVB 4JRYA 3LEXA 1FNGA 1JL8A 2L7QA 3BVDB 5DMGC 1JGUH 5EEXA 1Q9LB 5KVGH 2BNRA 2C7FA 2KC0A 1JBJA 4E9QA 2R1YA 1M6UA 4TUJA 5D7LD 5ADPL 5FOBA 3P77A 1ASPA 1O7DC 1JXGA 1A0QL 5AW1B 1GMEA 5F9WC 3U83A 5H37G 1E9OB 3L8QA 3G5YA 2IWGA 1GS7A 1GJWA 2DAVA 2Z7WA 2WXMA 3L1OL 3DPBB 3U4EB 2K8QA 2DQCH 4HHWA 1UWGH 2VDLH 4GG6A 3QIUB 3QJQB 3UBHA 1P4BH 5BVJA 3O2DA 5EN3A 3L4YA 3I50H 4RA3A 3Q8FA 2R29H 4PTUB 2MPAL 4G5ZH 3QJRB 2M2DA 2KLSA 3BMWA 1C08A 3P1VA 3F3HA 3CVBA 1A6UH 4WNQB 4XO9A 3MODL 3ZE0B 2EDXA 2XVGA 4QT5A 2RQ8A 4F57H 2PTTA 2OBGA 3PHAA 2YQBA 4QRRE 1QLEL 1KJ2A 4TTDC 1TQSA 3OLIA 2AC0A 1AZCA 4YFLI 3D18A 4UIMB 5FECB 2R59A 2CBQA 3PWVA 2EDWA 3LDBB 4LOFA 2IH8A 4J3BA 1T83A 1ZSDB 3ZUCA 3ZQ9A 2H32B 2WIMA 1JDAA 4O58L 1FO0H 2G3MA 3IRPX 3VFTB 1RP9A 4MX7A 3OKNA 1OLZA 1CR9L 4TRPH 4BFFA 5FDWA 3TS8A 4ZUWB 1UB6B 3L48A 2NY7H 3VYOA 4ODVL 5ETUB 2EEDA 2OMYA 2VZ3A 1F0LA 2R4SL 1ZK9A 2EDFA 1E5BA 5D2LA 4C59B 5IFHH 4MCZB 4B9FA 2GT9B 3G7TA 3PHQB 1Q0EA 1BMGA 3PV6A 4K23H 2FYYB 4XZ4A 2XQBL 5DJCB 3VDAA 1KBGH 3MROA 1IC7L 3O6FA 5BQ7B 5HBBA 2BNUA 4I3RL 3CLWA 3LV3A 4NC1C 2DQJL 4U1SA 3O4LB 3W5NA 1HSBB 1X5KA 3BZ4A 4L4TA 4NRYA 1N10A 3N42F 4LSSL 4K5NA 3BRDA 4PJHF 1ZHNB 2CR0A 1R0AL 5JYLA 1II4E 1XH3A 1NFIA 2CO7A 3EO9L 4E41A 5CLYA 3ZLQC 4G80B 4Q2ZA 1UA3A 4YR6B 4C4UA 3HUJA 1Z9OA 1BEYH 3GT6A 1RK0A 3QIWC 4MJ5B 1B0RA 5I1LA 3V8CA 2WLLB 1NGPH 4BQ9A 1HQRB 2ARJA 4FI8A 4N8VB 3NFPA 1ZLVH 1AJ7H 4DPBX 4K9JA 2I85A 3D39B 3L6FA 4IIQA 5E2WH 4AGOA 2OTUB 5B22A 4HWBA 4I0KA 3U0PB 5HGAA 2VGLM 2VUOA 2X4SB 3O4LD 2V5MA 1FE8L 2C4FT 4YVUA 2V2TA 3KPPB 4QCIA 5BUGA 3ISRA 4W4NA 1TJMA 1U30A 4PG9A 3VXRB 1XEUA 2DI9A 4W9KC 2R1XB 5F7UA 5C08A 2O5XL 1WAAA 1Y18B 4PY7B 3SBWC 1LE9A 3OVUB 1E9QA 4G43A 3FRPA 5GGUA 2P9RA 4OI9A 1BP3B 4UB0H 4JR9H 4F7TB 1KT2B 3D9AH 3DDGA 3BVVA 1RUAL 5C0CA 2X0VA 4UIKH 4J8RB 3K6NA 4EKJA 3D39D 5LUMA 4JM2A 4RMUA 5DD0H 1BQLL 2D4FA 1KJMA 3LZQA 5ILTH 4YUEL 1OT4A 1W72H 3KCPA 3LKSA 3A47A 2DB8A 4P5MA 1J5OL 3VRIB 2NSXA 3PABB 3VXRD 3TV3H 1O9ZA 4FD0A 1IFRA 3CZUB 3UTPD 3L3GA 3N3EA 5INCB 5F6HI 3K1KC 4BSWB 2VDKH 2XNAA 2APFA 5C0EB 1FYTB 3AG4B 3IMSA 4PPTA 3GJEA 4LVOC 5HVWA 2J20A 3F5WB 5IB1A 4WWKC 3RJDA 2KDGA 4V11A 2D2CC 1JRHH 4BSJA 4ZS6C 3FQNB 3E6FA 2Y72A 4PJ7A 1N8ZB 5CEYA 1MCOH 4JHWH 1UZ6F 2A83A 4MDIB 4KFMA 1XGPB 1MFNA 3LRGA 3BN9D 3DHPA 3LKNA 3FSZA 2Q3XA 4B27A 2HMID 4P5SA 3KPMB 3BWUF 3VWJB 3T2LA 4YWGL 3AWFA 3EJUA 3EXJA 1H5BC 3I6LD 2X89D 1FYTD 4YHMH 5I5IA 4N1HB 4JMNA 2MNWA 4G8FB 5J3HC 3CFDA 2MTPA 1TFPA 4FEMA 1NUFA 3VRJA 1OQXA 2V3DA 3FQ2A 2NY0B 3M7OA 4L2YA 4OZGA 2CHXA 4MNQE 1QNZL 4XPGL 1DQKA 2WTOA 3BPNC 3V5DB 4NSKA 1L0QA 1PYWA 4FLRA 4OLXL 5TFSL 2BZDA 4G1MB 2BVPA 5KSBA 5AVXB 1G84A 3GSXA 3FRUA 2V2WB 3GZKA 1HXMA 3N41F 5HI5C 4NP4L 3VWJD 3DNKA 3Q1SL 4FZ8L 3GRWA 1EAJA 5HPOA 3NIGF 1SY6A 3AUVA 1JWMA 1BJ1J 3W0WB 3KYMA 1RL1A 2DZEA 3MYZA 2AK1L 1HZLA 1HKLL 4Y1AA 2V5TA 3GTTA 3KNBA 4EI5B 2LU3A 5E8NA 2P5PA 1IAKA 2WCGA 4X99A 5C86A 3TEWA 5F7HA 1BAGA 4PJAF 3ESUF 3GZOA 2NY0D 4C47A 1QPXA 1SEQH 4LMQI 4Z6AT 1N64L 4ZW5A 1HSAB 3GS0A 3HRZC 4JFDE 4FFWC 2ZONA 4KXCA 2CUHA 4JG5A 3GJFK 4XMZA 5HJ3B 3U36A 2YPKB 4JPWL 5F97E 1FFNA 4YZFE 2XX0A 2BSRB 2LTQB 2AAVA 1DVXA 1KEGL 5IB3B 1A1NB 1GC1L 5LQBL 1EVTC 1SXZA 4KK8C 3SO3B 1AY1L 4DK5A 3V9FA 1NEUA 4TUKH 3W0WD 5MEOB 3QC5X 4WWNA 2EYRB 3WNNA 4EI5D 2G3XA 3ZDZF 5CD3B 2Z92B 1KACB 1IEAB 1EUUA 5BXFB 5F7KC 1JN6B 2JJUA 2ZCKL 5IY5B 3RPBA 4K8RH 2X10A 2QGEA 1R9FA 2JCWA 4PV9A 3UO1H 4Z7UE 2VSMB 1XF2A 2PP7A 1TUPA 4DUWA 1PEWA 5K9KA 4O2CB 4GLRH 1ZVNA