3LZNA

Crystal structure analysis of the apo p19 protein from campylobacter jejuni at 1.59 a at ph 9
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lznA00
2O6FA 3NRQA 3NRPA 5I0XA 3LZNA 3LZQA 2O6CA 5I0YA 2O6DA 3LZOA 5I0VA 3LZRA 3PJLA 3LZLA 5I0WA 3PJNA 3LZPA 2O6EA
chains in the Genus database with same CATH superfamily
5A3ID 2H3NA 1BXAA 1N70A 1OSPH 1RIUH 2VR3A 1A5FH 1E0OB 2NYZA 3EGXB 1F13A 3PABB 4KKPA 3HJ0A 4KX9A 1A6WL 3D48R 3FB8A 1F3JB 3DX4A 3L4XA 3MUUA 4HIJA 4A2MA 1RUKH 2R7EB 4OH2A 4U1NB 5DJ6B 1AS6A 1EVTC 4YSEA 1S5HB 3ARFD 1SUHA 2BWQA 2BZCA 3QZWA 3WFDH 4DKEL 4R2GC 5A2FA 4X80H 2X6AA 3FHEA 4OUOA 4TUJB 4AENB 4U6XA 4ORGA 4OLWH 2W94A 4BV1A 1K2DB 5FOBA 3WJMA 2D3JA 1E6OL 3SDYH 1BXVA 4DVBB 3PGFL 4MS8D 3MRKA 3PJSA 4FKKA 5JIKA 2B16A 3NVQA 1MPAH 4XPFH 4KQ0A 4FJYA 4YSSA 3FYEB 1ORQB 3QUKA 1DBMH 1IFRA 5EIVA 3KEHA 3B83A 2OX5B 2NXZB 2I07B 1RCYA 4QRPE 1NMCC 1PG7L 3H4HA 3JYCA 3UO1L 4WJ5B 1CFQB 3K6SA 1CLOH 1TEGA 1QVOB 1NJ9B 1A3RH 4P4RB 1FVCA 3RDJA 1AFVL 1H6TA 1RZQA 4XOBA 5I73C 2G0KA 5JORB 3NFPA 4J3OG 2J21A 5JZ7C 1HL8A 2JJVA 5CP3H 1BD2A 5IT2L 1U8MB 2WZ6A 2NY2D 3UTTD 3MFFB 1AZZC 4QAWA 4JRXD 3ZHNA 1AE6H 4OM0H 4KQ4L 5ALBL 5FAAA 2ZCHL 1L3WA 3BVTA 1KB5A 1QWNA 2FECI 1JYVA 3L3DB 4WK4B 1MG2C 4E9XA 1YNTF 3FQYA 1AJ7H 2WXLA 3DHJA 4WI9A 3C5ZD 2EQDA 1I4FA 3LKSB 1OB1B 2XQ0A 3HMXH 3GI9L 3V0VB 3B56A 1HFUA 1RU9H 5F89A 5LQBH 2YJQA 5IROC 4CSZA 3VFTA 3BQVA 5ITBL 1BQLL 5AVQB 3NSCA 4NQSB 1FORL 3HI6H 4W9ZA 2E6PA 2CR0A 1MH5A 4FQ2L 3CWGA 3COOA 5IP4A 2OI9C 1HN1A 2QV4A 4GLRI 3B1UA 3M1OA 5E00B 3IRPX 1OGAD 1QA9B 1ULVA 1ODAA 3DI2B 4M7ZB 4FULA 1N9PA 4K9EC 2DN7A 4CW1A 1KY7A 2B15A 4NUJB 2YA0A 3HBGA 3L5WA 3ULAB 1AR1C 3FU3A 3VWKB 2HTLD 3IDGB 3SKNA 2PWGA 1WA0X 4GW5A 1IEAB 3QJHA 3QAQA 5DLMH 5FYLL 2R51A 2WO4A 3U0WH 4G7QB 6FABH 1G84A 2VXTL 4XB3A 1RZKC 4L3EB 1BQRA 1DFBH 4D9LH 3Q2LA 3W39B 1KGJA 4LF3A 4WSKA 4XPTH 3NZHH 3X3FH 5A2CA 5JDSB 5IHUL 3KPOA 1ZLUK 1R5IB 1U3ZA 4XCCH 2V7NB 1XWVA 3NCCB 4BKLB 1QSED 2P5EA 2R2EA 2WYZA 3IJ7A 3K1KC 1IL1B 1I1FB 3BUDA 4KJYB 3VXUA 3W3BA 4CC0A 3PU7A 4YGVB 5GJTH 3ZW3A 1TENA 1EBPA 3TYGH 2QKSA 3VFMB 1QX1A 3HAEG 1KG0A 2AJYL 3MREB 1T0MA 4PJ8B 5CMAB 2F53A 1ZHLB 2B0SL 2YGOA 3I6KB 2MPAH 3I9GH 3HZ3A 2AZAA 3PWUB 4YE4H 2DJ4A 1N59A 1IGYA 3TO2A 3TT3L 4OD3L 4H8WC 2IWKA 3KPQA 3V4UL 2VISA 3LPOA 4PRPA 3AG3B 3U36A 5IKCB 1YMHA 2HCZX 2VN7A 5T3XD 3VI3A 1GC1L 1OAQH 1VERA 3FUNA 2X09A 3L2MA 2EYTB 4ZFFB 1A1OA 4U1IA 4WFFD 1JV5A 2YIHA 1CFSA 3SD2A 2PPFA 4P2QA 4YWGH 4GI8A 3UC0L 3NPSC 1JG9A 3BLBA 3N3EA 3C60B 1XVSA 1DQDL 3NIGB 4QRSB 3UCQA 2ZKHL 2R0ZL 3FONB 5E9DA 2APVA 4NO2B 4YMPA 4TNGA 3O0RL 3N1MC 4UCFA 1JPSH 5E7BA 2GSIA 2WZAA 2E7LA 3OMZA 4PI2A 5JW5B 2DQFB 4S1RL 1PD6A 4UBDD 1KYAA 5JQIB 4ADJA 1QBLL 4MA8H 5D1XB 1NANH 2HX9A 3GTNA 4ILDA 2UWEA 4I3GA 5JHLH 4HCRA 4ODUA 3KLAA 5C9JB 3IDJB 2DICA 3QQ9D 4G72B 4LSDA 4JQVC 1K5WA 4BK8A 5B8CA 1ETZB 4QTFA 4QHLA 4F92B 3BKCL 3L5JA 4JY5L 4ZUSA 3IGAB 2FL5A 4Z7OB 4X9HA 1C8QA 5ISZA 3QR1A 5D2NB 4BE5A 1KIRB 4U7KA 4J3OC 4ES9A 5FHBL 4I1RA 3GRWA 4OJFL 5EZOH 5GRVK 1KTJA 1EGJA 4WEMB 5ERWB 1MIEL 3P73B 4FLOA 3IXAB 3P30L 5EOCJ 1Q0YL 2WVUA 1T4WA 2JQMA 4KROC 5JNYB 3MV8D 1RK1A 5AVYB 3QEGL 2M2DA 1G7IB 4GKNB 4HOXA 4QHKJ 1MI5D 1NUGA 4KITB 1J0KA 2LV4A 4KKZA 4I0PC 3OPUA 2VDNB 5F0MB 4MLIA 5SX5K 4N5EC 1GCYA 1KCKA 4WV1A 4MBRA 3MLXL 2MNJB 3C6LC 5F3HA 2IADA 4KOCA 5IVXE 3FU0A 1XMEB 5GS0H 2V3EA 5EU4A 5HY9A 1CE1L 2X87A 1HYRC 2EKSA 1NC2D 4PMEA 3SE4A 3AXLA 3BGAA 4HJGA 4JRYA 3A6OA 3UTZA 1U91B 1MAMH 4ANUA 3GS7A 4XN9A 2NY1D 4KK6C 1XL4A 2C9AA 1DVFD 4XBPB 3TA3D 3KCWA 2Z92A 5HJ3B 1I8LA 4G8GE 3OJDB 3HC4L 1AMXA 4HWBL 1MFNA 4PY8I 3WGVB 4HHAB 4LCUA 5T1KA 4LEEA 1B2YA 4NX0A 3GZOA 4LLAA 1M6OB 1KPRB 1YEGL 1FAKT 3ZKQD 2WQUA 5CN2A 5IG7A 1NWPA 4NQEA 4I1PA 2DQUH 4IIQC 3UP6A 1DVSA 4M61B 1QSFD 3QC5X 5EWIL 4FQXC 4ELKA 1NCHA 3JBG7 3BKMH 3GXMA 3ZU8A 3HS0C 4LPTA 3UROR 3V5DA 2EDDA 4M00A 2F74A 4JHAL 3PQYB 1FO0A 3NCFB 5EMYA 4RRPG 1XH0A 5IFJA 1JWSB 4IRZH 3DTDA 2CO7A 1B0GB 2FX8L 3QNXB 1JAEA 3D7PA 3VFUB 3EFFB 3WN5B 2OS7A 4U7MA 4X7TA 4HG4J 3KLKA 4XPBL 4YR6A 4O51B 4B9IA 5EOQH 4PW3A 4Y19D 1CLYL 3FT3A 1KXHA 3MZGB 4PJIB 3EJJX 3LKOA 4DEPC 1ZLDA 2GUOB 3MJ7B 1KFGA 3VMNA 3G6JB 3F6IA 3MGTA 4PCSA 1JGEA 5FW7A 4B60A 3VD2A 1Q9LB 3FU8A 5I1LB 1H9DA 4EDWH 3H55A 3MRJA 4MWFA 4GEJA 5L2JB 1F1DA 3CVIH 2O6CA 1KIUB 5C07B 2QVKA 3SDCA 2R1YA 1ZK9A 2BXYA 1DBKL 4LVOC 3EYSH 5D6CA 3MRRB 3JWNH 3VFVA 1OAXH 1QSZA 2DWDB 1E3XA 2YAPA 3KLDA 3SBWC 5L2KE 4G7SB 3VRJB 4NQCB 5D1QB 3T3PB 1ANUA 3MSPA 3TZVD 1WWWX 2BSDA 4HUWA 3WFEH 3SJVB 3KPRB 3LZNA 3TV3L 4J3UA 1EFXD 1YQ2A 3UZVB 4CVZB 1ZWIB 1OCWL 2AQ2A 3FQXA 4GKOA 2LU3A 1SDDB 2YWZA 3K6DA 1BQHB 4N24A 2R29L 4PGZA 5ECJE 5JPNA 4HS8H 1KENH 1KEMH 2CO1A 1J8RA 1U4FA 1Z5LA 1GZQB 3MACH 1G6RA 3N04A 1PPIA 2ZCLH 3QRFM 1S2EA 2GKIA 4KI5F 2ZCZA 2BZ7A 4HK3J 1FL6B 1S9VB 3L3GA 5JO5A 1ZPUA 1PQZA 1RUAL 1I8UA 3O4OB 2AJUH 5TDOA 4TPRL 1SYSA 5E5RB 2WN2A 3WLWD 1CD9B 1Q9KA 5D4IA 3O8XC 4M8UA 2WSDA 4HA1A 4NJ9L 4FC3E 4O4YH 3MBED 1OGSA 3RL2A 4MNQD 4OTXH 5DLLA 4JO2H 4ZMLA 2AVFA 1BMWA 1TJHH 1NCWH 4XMLH 3GEWB 4NQVA 1M7DB 1W72B 3OG4B 4ZUTA 3OJ2C 5I1DA 5I6PA 1VENA 3WKMH 1WBXA 3E6FA 1I1AD 3CN4A 2W88A 3CVHL 3DARA 1UA3A 5SV4A 4JQXA 5GGRB 3V4PA 3V9EA 3ZKMD 3GKZA 5J57B 1PLGL 2ZD0A 3LXUX 1U95B 2J43A 4NS0A 3HR6A 4LK4A 4OSUL 5GS2D 5BXFB 3ESOA 4KJWD 5L88H 1AGEB 1GGCH 2X4PA 4JFEE 1G9MC 1EEQA 1N2RA 2APWA 2BOLA 1YNTA 3QEUB 1M71A 4R7DB 4Z3EA 1DBBH 1YJDC 2F15A 4GO9A 4QOKB 1KTDA 4AQ1C 3RY6A 2WLYA 2DD8H 1U8LB 4EKXA 1EJOH 3EHBC 1QRND 1M7XA 1L9MA 4C59B 3AAZA 3BKJL 3LEVL 1NAMB 2RTTA 4KGLA 4L0ZA 2I9LA 4HS6B 3UBXG 2FLRT 4UM9A 4PRBB 1BLNB 2NSXA 1E5ZA 2R59A 2JXMA 3QDME 5J6HB 1AP2A 4UOW0 4AGQA 3KGRA 4P9HH 4EN3C 1AO7E 1FCCA 3QIBB 3O11B 1OTTC 5K9JL 2DQDH 2G75A 3BPLC 3OXRB 4A7VA 4I48A 5CSZA 3GK8H 5B4MC 4M29A 2LGNA 1E4HA 3ATFA 2QADC 1RP8A 2JF1A 3IXTA 4APQA 1DJSA 1PKQB 3NPZB 2IPTH 2R23A 2XWTA 4NRZA 4XNQB 2XWXA 5CWSA 2EIZA 2XIIA 2ZX8A 5LCVL 5D8JH 1QYGL 5F9WB 1TJMA 1HQ4A 4XAWL 2N4IA 2Z35A 3OKNB 4G6MH 3EGSB 3IAGC 1ODUA 1MNUL 4K7FB 2ODIA 3STBA 4G2AA 2NY5L 5D7HA 4ZUUA 5JQ6L 1V10A 3H3KA 1X5XA 4W4NA 3HE6C 2GJ6B 5F7EL 4U6HB 2VTFA 4FAAB 2KL6A 3LTVA 3SCMC 4AQ8C 2FIKA 3QI9D 3MFGB 1V7MH 2IMNA 2YD3A 2MCMA 4AYDC 5JW4M 2RFXA 1TJIL 4FP8H 4F3FA 4E9TA 2Z31C 1KJ3H 1Q1JH 2K7QA 5J8OA 2ZOTA 1LDPL 4NM4H 2ESVB 2G2PA 5CZKA 3N41B 5DJYA 3Q8EA 5HVHB 1V3JA 4JFOA 2WD0A 4C4KO 5C3TA 1OEZW 5FEBA 4Y5YB 5CJOL 3UAJC 2IDCA 5DFTA 2DBJA 2PYEB 4GAYB 1FFQA 1CB4A 4N3UA 4ADGA 4GRLA 2VMEA 2QQKL 3DV4A 2AEQH 3DLQR 1GL4B 5KYXB 3ARZA 5HHXH 3FRPB 5CAYB 4O5LL 1U9KA 1EAOA 4M7LL 2NR6A 3JWDL 1RJZA 1A7QL 2ICCA 1T0NB 5IESH 3ZQ9A 1YAIA 3U25A 2DKUA 3LKRA 3I3BA 3ROLA 4TNVK 3RGBA 1EHKB 4PSPA 1DJHA 5H94A 4F20A 1IKFH 2EXWD 3KCPA 1P7BA 4JFDB 2F7RA 4X6DB 5CP7B 3IPEA 3CFEB 2L7UA 5EF1A 4MAYC 4P2YA 4RFNC 3FFCE 3VXRE 2BMKB 1GGTA 3GSXB 3KEDA 4CMMB 4JFYB 4BZ2H 4F1SA 1ACYH 2VDNH 1LWRA 3E9TA 4N2FA 1IRAY 1QNIA 3TJHD 3BQUB 2BWDA 2CDGB 2BLFA 5GJSH 4MNHB 3KM1A 3LH8A 3W2DH 1YECL 1YAZA 1X5MA 2DI9A 3TCLA 2WWNA 1U3JA 1U58A 3H9SD 3UBGA 1NKOA 3LSOA 4KY2A 1DCEA 3ERXA 4XI5D 4YSPA 3WYRA 5CLYA 3AREA 4BWUA 4ANWA 1X7QB 2Z0BA 2DLHA 3HG1E 2O5XH 1EBAA 4NPYA 5HI5C 5FLUA 3WTVA 1F6FB 1SPDA 4JPVH 3DIDA 3UC2A 3IMSA 3EZ8A 3EYUH 3LH9A 2H3NB 3QH3A 2AK4D 3ARVA 4PJ7F 1I7RB 4QXTA 4WO4A 3TO4D 1ET7A 2VDOB 5K39B 1WCQA 4GSXA 3HFMH 4OZ4A 3HVDA 2IWGA 2VN5A 2XU9A 1KPVB 1CDJA 1F90H 1A65A 1MWOA 5FO8A 3DURB 1NMAL 5A2AA 4U6XB 5TTRA 4PHZA 5KEZA 1BQ5A 1HKLL 4GLRH 3NSXA 4M48H 2CKNA 3GSRB 3QO0A 1FC1A 4PS8A 3T0VA 5E4OA 5MEPA 2ZWZA 1R34A 5B3JF 3QCVL 1O6TA 3JZYA 3FUHA 1J1PH 2EDEA 4OFYA 1J48A 2E74C 4W9CC 5CJ5A 2HUEA 1QQDB 2BH0A 1U8JA 2UZXB 1DN0A 4HMCA 4BSVA 4GRWF 2OTWA 1Z0NA 2HFGL 4GXUM 4QLRA 3VG9B 3WTTA 1DQQB 4ENED 4IGBB 4IRJA 2UY7A 4O02A 4MCZB 2PPDA 4PJDF 1JHKH 4LVNB 1F56A 1U42A 2X7LB 5L4MA 2ED8A 5JYMA 3KPLA 1TZIA 5D7LD 4AK2A 4HJSA 3BAYA 1F2QA 1TO5A 4PJGF 1SJHA 2Z1KA 3T0ED 4B95C 2QZQA 3EDKA 4P48A 3RDTC 2HKHH 3TEUA 2ICES 2BIQA 5C8JB 5LGJB 1E9PA 4JO8A 1JPEA 4PU2A 1MEXL 3ARGC 5J12C 3E80A 1H3WM 1L0XA 2VZVA 3FC8A 3PL6C 1BX2A 1U2HA 3NJVA 3ABZA 3NH7L 3TBYA 1MELA 5LAPA 1KTBA 2QZ5A 1A7RL 3JWNE 2R0KH 4K94H 4M6NL 3ETTA 2E46A 5LWYL 2MTPA 5BZZA 5C7XL 4K23H 5G4NA 4AIZA 4YDKL 4L4VB 3W5MA 2ZX6A 4HKJB 4PUBL 5EU7C 4ZW3A 2V9UA 4NCC2 1NGYA 4ZFZB 4WW2A 2C3VA 1JF1A 3BH8A 5KYUB 4AV5A 1WUZA 5IB4A 2ALWA 1AQKL 4GUPA 3CDYA 3FHAA 4X8JB 5JLZA 4G8FB 5D93B 3V0GA 3GBLA 3OBAA 4EZJA 4JO5A 4HUNB 5HYIA 3UTSE 2G0LA 2QQQA 4WGKA 1M42A 4ZG1A 5FK9B 4IBYA 3IT8D 4NXKA 5I6MA 1ZE3H 3NFNA 3GUTA 2DTSA 2F8OA 3ESNA 5BMFH 4QNPE 4LB8A 3BUYA 1VFOA 3UX9B 2WBJA 3ARDB 4RZCA 3K5RA 4P23D 4GW5B 4CBZA 3SYQA 1W72H 3QJHB 3V0HA 3V6OA 4U05A 3HS9A 2AJ3B 5I16B 2IH3A 5IIEB 1ZA6B 1U92B 1Y18A 3C5XA 2O72A 5CZVL 1T80A 4F8NA 1AMYA 4G42A 3CVDA 1PW3A 3QUMA 4XPAH 4LCCB 3QUZA 3FTZA 5DVPA 4EUPG 1JHTB 2HAZA 1EIBA 5ESAA 2BNQA 2XACC 3Q06A 4FEMA 1R0AL 2VKXA 4K3EH 3V8CA 2Y2TA 5C0AA 5C09E 5FGSA 5DHDA 2IXQB 2JELH 1Z3GL 3ECBB 4HQQH 2P5EB 2DEXX 1J8HE 4GS7B 3QIWB 3A21A 3NIDB 3FUDA 4ZUWB 1XR8B 3PAYA 1O9WA 3V4VH 1FPTH 2PW2B 2OZ4H 5DD5L 2F53B 1NAMH 1E8YA 2NCEA 3ILEA 4KKLD 5I75B 1GA2A 5DURD 3WIFA 1MOEA 4X42A 5B22A 3QWRA 3D0VB 4MZ2A 3KXFA 2VISB 1JSYA 4KDTC 1JXJA 2W0KA 4Y2DA 2OMZA 12E8L 4FJZA 4PBVC 2WVVB 4Z7WE 1P4LA 1NLDL 1VFBA 3VI3B 2FJUB 1HL9A 4N2CA 4BD4A 3KLSA 2EDYA 5IVZA 5T3XL 4LCYB 5HJGA 1DJZA 1L0QA 1NL0H 1OTSC 2FATH 3VD9A 1Z9PA 5I5IA 1JV5B 2YPKB 3EYOA 4KJQC 4PRID 1U3NA 4MMXC 3AB0B 4ONGH 2CDFA 4I3RL 4YHNB 1AHWA 3T3MF 1AVAA 2J72A 5FUOL 1NPUA 1IC1A 1SM3H 2DQTL 2MH4A 2XY2A 3Q3GA 4KHXH 1M05A 3DX9A 4Y5VA 4PS4H 5FWQA 3O3AB 2R69H 5D7JC 1F3RB 1WIUA 3CN0A 4B50A 3FOLB 2GSIB 3ZBMA 2QLVB 1F8TL 4PB9H 5DS8B 3WY3A 2ZOLA 4EI5D 5E1HB 2X28A 4Q9QL 3F2LA 2D7OA 4GMTH 3NP4A 3DXAB 3K5SA 1ZLVK 2XBZA 3FMGL 3VW3H 4FTVA 4H8VA 2VXVH 1FYTD 2OV0A 2YRPA 4M7LT 4GFTB 2Y7LA 4F24A 3WEXA 1P4IL 2GVYA 4R3SA 3WNMA 4L37B 4MFHA 1N3NA 4WWNA 3JT0A 4ZUSB 5ILTL 3X3GH 4KPHL 2OMYB 4G1MA 4RMRA 2F58H 1S7XA 4B9FA 3NIGE 2VJXA 3THMH 3DBXB 3IMRA 4FXGA 2ZXGA 5HHVL 1TCMA 3Q8FA 2VXQA 5GRXG 2ZAHA 3S35L 2P9RA 3SDDC 2JLLA 5CO1A 4J4PA 1T89C 5DMGD 5D1XE 1ZJBA 4L4TB 4AIEA 5ICZA 3VRIA 3HCVB 1J9CT 1G7PA 5HDBF 4JMXA 4KRMB 4YK4C 4QHNA 1BJ1H 1A6AA 1K5NB 1KN4L 3DA0A 1LO3L 3HEIB 4KMTL 4R0LC 3RB5A 1DJWA 3QRGH 4JK0D 3FT2A 1HH6B 1ROWA 2VM9A 4XRCA 4YGAB 2GI0A 2IADB 5ADOH 5IFAL 2EO1A 3D07A 3F85A 3F7PC 1NC4B 4WFGE 5EU4B 3ZDYF 4JVPA 4N0YL 1A6VH 1QFWI 2YQBA 3T4AC 4Z7OE 1WA1X 3RWCA 5K59E 3CX5J 4F58L 4XNXL 4OFKA 4F9LC 5BW7A 1NFKA 2W65A 2X70A 3T0DA 4WU5A 7CGTA 3GSQA 1G87A 2DYPD 2IQ9H 4YO0B 4KJPD 3PWPD 1SEBB 2GG1A 2Z8SA 1S7WA 3DO3A 5JHAA 1WT5C 4NKIH 4ZPVB 1LEKA 1J0YA 3GMMB 3NTCH 1EZLA 1JZDC 3IJ9A 3I84A 5EZIL 4NQEB 1ED3A 1F00I 4N2NA 1M7UA 3TH3T 4OCXH 4WWID 4MMYB 2GIYA 4EIZC 4J8QA 1H8LA 3KWWB 1U3HA 4ICWA 2ZOUA 1SOQA 4TSBL 4G9FD 5AVUB 1RI8A 3T65A 2MQ3A 5E8PA 4LCIL 3MRNA 3F7YB 3EXLA 4OVUA 4NIYE 4JL2A 2R15A 5HGHA 2ZCKH 2J57A 4CVXB 2ZOKA 2UZPA 4R97C 2EC8A 3GM0A 2MRYA 4IOIA 4B97A 1C1EH 2NZ9D 1HQRB 1U8PA 4MA1C 3S8GB 1WS8A 1KTLB 4YR6B 3QA3A 4YNYB 5J5EA 4JVUA 4YL9A 4ODHL 4CGTA 1OF0A 5E2WL 5I8OL 2OL3A 5JIMA 1JZ7A 5JOEA 2B08A 4P46C 1KJVB 2ENQA 4EOWH 4WI0A 4BFFA 2Q0ZX 2B1HL 3S3BB 5HP5A 1QFHA 4Y4FB 3ARRA 3L3OC 4GSUA 3EYQD 1VJSA 4MWFB 4NJAL 3A6BL 5HI4D 2R4RH 2Q3XA 2VDPH 3N40P 5D2LB 1J1OL 2A1WL 2UYLA 3DBSA 1MWAA 5D6CB 4WI2A 4OB5L 1ZLEA 3VFVB 3ULUC 2IH1B 4OI7A 1NCNA 3V0AC 5F3BA 1EVUA 2GBUA 3LOWA 4HWBA 4N0FB 4YXHH 3JWOH 4QHUB 2GTZA 3QWNA 5HYQB 4JM4L 1BAWA 4FKEA 3ECUA 1NGXB 2JKWA 1RULH 4YLBA 3PXHA 4HZLA 4MCYB 1OHZA 4FHBD 1SFHA 4JFUA 3A67H 4FFZH 4PJIE 4PSRA 4ODVL 5F70A 2BPBA 4R2GD 3BAKA 5ESVA 43CAA 3CV5A 3QFDB 2I24N 3S36L 4L9LC 5SX5H 4OAWA 3TCXA 3TH4T 4OQTH 4HMDA 1D3CA 5FO9A 2CO2A 4IW4C 2XV0A 3C2SA 4WEEA 4AGPA 4I0KA 4E41A 3SGKA 3DRQB 5FHAL 5C07E 2JIXA 2JB6A 3H3PH 1QBML 1Q9KB 3GHPA 5A2IH 3DX2A 4K07A 1L6PA 3RL2B 2LQRA 4NQCE 3MLYL 4KTEH 3D39D 4NENA 3SPJA 2ED9A 3T3PE 1MJ8L 3IJHA 3U0PB 1G7LA 1DSYA 2HT4C 4JFXB 4WWOA 3SJVE 5DDHA 5BZWB 2NX5D 3T04D 3KPRE 3ME0A 5KWYC 3E6FB 3OAUH 3Q8CA 2P80D 1EUUA 4KRPC 2I32A 5CN1A 4PJDA 4HEME 1JDAA 5JZ7D 5IW3A 3O6FA 1IGCH 2ZIDA 1CGXA 4PJGA 1PDKA 3MTXA 4UT7H 2CRIA 1NEZG 2V3FA 1HSBB 3OAZH 1YNTB 4MQXD 1DQJB 1KELL 1TETL 4AV0A 1MCDA 1TU2A 1KTDB 2XTSA 2XBDA 1E4KA 1NCIA 3CNKA 1QI3A 1AIFA 4WNJA 3QQDA 5EEYA 3CDCA 4AG4L 3B4NA 4JHVA 1EHLL 4CN4A 2VE6A 1JZ4A 5J1AA 1YYLL 2OYMA 4TOYH 4XMPH 1RZJL 1WF5A 2N56A 1K8IB 3LS4L 1G0YR 4XMKH 1VEPA 5IROD 5EO1A 2R29A 2XVLA 4I4WA 1VA9A 3MNZB 5E9AA 4AH2A 5DUML 3U4AA 3SY6A 1D5BB 3RZCA 3WLBA 3DIFB 2QQLL 1URZA 3FQTB 3WXVH 1SEQL 2VDMB 3QUYB 3S4SB 1NPJA 3VGEA 1R3LA 4J3SA 4I48B 5CSZB 4N9GA 4L9DA 4V2BA 4NN5B 3IBEA 4HWZB 3IAQA 5TE6H 1XFPA 4XPHL 1A6UL 2V7HB 4NRZB 1FBIL 2R23B 4X7SH 1IM9D 1DVZA 1XZWA 4QOKE 4BA0A 1G9NH 2LVEA 4FQQB 1B9ZA 4HIXH 4JCWA 3S97C 5JW4N 4UF7C 1WQVT 3AM8C 2VC2L 4H26B 1MCWW 2UUDK 4UINH 4XVOA 4EAEA 3HPLB 3CVHA 1KGUA 3EBAA 3LXAA 5FO7A 3GPEA 5A6LA 4DUVA 4M5TA 4EO5A 2QT6A 2A77H 4IOSD 4UV4H 3VWJA 5I19L 3R8QA 5C0EB 4GFXA 3JUYA 1NEUA 5D72L 5F7LB 1X5ZA 3VCLB 3WJLC 2YFNA 4FI6A 3DGDA 4Z95L 1C8PA 1L6ZA 1YNKH 2NY6C 4DN3H 5TE4L 1N6UA 4M1DL 4PCKA 3VXTA 5T33L 1OF2A 5ACLA 4NWTL 5FM4A 4OCSL 3SKJL 4AKOA 2CMRH 4S2SB 4F33B 2YGNA 3ETBF 2FX9H 1PKQE 3NZUA 4FQ1H 3QEQD 1I8MA 3G5VA 3CXHK 1S5IH 4QRRA 4G1EA 1RK7A 5C0CD 4NYLA 5T1LB 1PF3A 5I66A 1F18A 2BSBA 1XGYL 1J10A 1M1XA 2H4EA 3QZLA 1UWGL 4FQHA 1Q9OB 4BK4A 2EDOA 2CGRH 4NCDA 3BUPA 4YXLH 3LD8B 1R46A 4FZ8L 1PY9A 3P4NB 2GJ6E 2Y06L 4KFZC 4PY7B 1PZCA 1LO2H 3WDIA 3MRFA 1L6XA 5DD3L 3S0PA 4BZ1A 3KVQA 2XG5A 2EXYC 1WISA 3NAAL 3HA0A 4HUCA 4L1BA 3EJUA 4OCWL 1VAHA 3RWIA 3TN0C 2O61A 2DQCL 1MCJA 3ROLB 1J1XL 5FGCE 1PSKL 4KI1A 5IUCA 1GJIA 3GFUA 1I85C 1XZ0B 1AHMA 5KVFH 4X4ME 2ESVE 2WSPA 4PJ5E 5HYSG 5B1JC 3VDBA 3HZKB 2GJZA 5LKNA 1BM7A 1ADQH 1CF8L 5L9DH 4JO3H 3CXFA 3NEOA 3KYOB 4P5TB 3KPSB 1E28B 3ABKB 1JI2A 1DUYB 3RU8H 1XF4A 2EO9A 2J8OA 2Y7MA 3BGFC 2BFVL 3ML8A 5J13C 1KJMA 5HHOD 6TAAA 4NAQA 5IB5B 1TJXA 1JK8A 1D5ZA 3FN0L 3MXVH 4HBCL 4IK6A 5CGYC 5ANMA 3WIHL 5HBBA 1ORSB 2CIIA 1OM9A 3FW6A 1TJGL 3QUGA 4UB0H 1NIBA 2P49B 5KYYB 5EN2A 2BNRA 1T7XA 5CD3A 2X4UA 5CHNA 1E2VA 3NG5A 4L0PB 2G5BA 1U58B 4U0RC 2HRHA 3LSOB 2ADGA 4JG1H 3TL5A 4MKMA 3EZJB 4XPGH 4LIQL 4IBSA 1FZKA 3IM1A 4J3OD 4TUKL 1KYDA 5CGTA 2VDLB 1BSIA 4NPYB 1SHMA 3FSVA 4BRJA 3LRSB 4JFDE 4X6DE 5AAMC 3GMOB 1HI6A 1UD5A 2IGLA 2ZWYA 5CEYA 4F7MA 2MSPA 4ALAL 1KCSL 4KHTH 4KROD 2YRBA 4E9WA 2DWTA 4POYA 3HNTL 1CDHA 2FB4L 1INDL 1T1XA 3NJFA 2AFNA 3T2LA 3D18A 4C83A 4WAFA 5AOJA 4HWNA 3RWDA 4MB3A 3F5WA 3ASWA 4I0PD 3HE7A 5FKPB 3U30C 1UM5L 1XGTB 3T8XB 3W1ZA 3LRLA 4R4BB 5HI3C 3RWGB 1A6ZA 2FT6A 1YN7B 3P9WB 3SE3A 5JR1L 2J5LB 3C6LD 5CLTA 9PCYA 2D2CC 2WUCH 3L13A 3EUDA 3V5HB 3GSOA 4FQLL 3TCTA 3QO0B 3ILPA 1K4DB 4XCFL 3GIVA 4TSCL 1I75A 5MEPB 4NLAA 2P5WE 4BFIA 2WP3O 4KK6D 3LN4B 5CJQH 2P46B 1JVOA 2XKSA 3RVXC 4YIQB 2VERN 5DYOB 3AQYA 1J86A 2X05A 1F1GA 5BRZA 1VIWA 5I8EA 4ZXBC 3MV9A 4Y2OA 5F96H 2APXA 2I7OA 1YUKB 4AEHL 3O3BA 2EABA 4Y1TA 2RIKA 4FABH 3QXTA 3OR7A 3P9LB 3CSYB 4GXFA 2B5IC 5FF6A 3RIAF 3KPLB 4HGKC 4FQXD 1BEXA 3HC3L 2CLRB 4UQ3A 2HB0A 1RMFH 4F7CB 2HFFB 2X4OB 3IGFA 3DJSA 2YPLD 4KGJA 3MOBL 5LGYA 1QKZL 5T5FH 1HEZA 1O75A 3DPBB 4PRHD 3L6FB 1D9KA 3UPCA 2VLKB 2E56A 4UNIA 3ZO0A 2BERA 2CBTA 1U33A 2NY3B 1PMYA 1A4JA 4MMZB 4PR5A 1LHZA 2XPZA 4UM8A 1MRCH 3TBYB 3VVVA 3RWJA 2IALA 2P7TA 3FSWA 3OAYK 2BDNH 3MXWL 5L4JA 1NWOA 2APSA 4AIZB 2XDHA 5JXEA 5IEKA 4Y1AD 3LB6C 2DLFL 3VFWA 1O0VA 1JF1B 4YH6A 3R06A 4HUVA 3ARFA 3OGCA 5DT1L 1T83C 3MA9H 2E9WA 1LO0L 4IMKC 1BD2E 4LEBA 3QNYA 1XF5A 3D3VD 1MCQA 5AZEH 1N19A 5M95B 2F5BH 4QYOB 4HX1A 2WAHA 2PCPA 4XCNA 5AWNL 3SZ6A 3BDYH 3B9KC 5F7KC 1LMKA 1EX0A 3QS3A 4KXZI 4B3VA 1AC0A 2ATKA 2BSRA 1PZ5A 1AZBA 2DQ6A 5LO7A 3VGBA 2VLLA 4ZK8A 3AJ7A 3HZVB 4MDRA 5BO1L 3LHPL 3TIDA 1Y6NR 1YY8A 4LLWA 1S7UB 4HW6A 1AGDA 2WY3B 5MHSD 1BOGA 4LLQB 3EOTH 5IMLA 2YUZA 4LASL 3GSNL 1DQLH 3D1MC 2Z65C 4XC1L 3U9PL 4PYGA 4L4VE 5AD0B 4U6YA 5B7FA 1XMWA 1DQKA 5DSCB 3WCYA 4AW4A 5GISL 3CU7A 4LOFA 5AZ2L 1ZLSH 3ZE0F 3O45A 1QPXA 3UTTA 1CD8A 4JRXA 5IHWA 1G7QB 1FGVL 2IAMC 5INCB 4AL8L 4DW2H 5IM7B 1BGXH 2VXSL 4Z6AT 1XH1A 1NGPH 2A6JB 1E6JH 2X4RA 35C8H 3CHOA 3HJEA 4OIIL 3MRQA 5E6YA 4KZEH 2VW6A 4DVRH 4JAMA 4YUEL 4QCIB 4RWHA 5D9SB 4ZFGH 3EIFA 4RGOH 3O8XD 3C5ZA 1WD8A 4X6CA 4OZFA 4ZJ9A 2DQHH 1IAKA 3TT1H 2A0LC 5C6TH 1DSWA 4DCQA 4JLRB 1LEGB 1NMBL 3KXFB 2XV2A 4M03A 4ZTPL 1RK0A 5IBLC 3VB8A 1ZAGA 2Z4TA 4Y2DB 4ZQKA 2Q6WA 3ZYOA 1JXDA 5EUOF 4ETQA 2XWBB 4YHIB 3TM6A 1KYFA 2A74B 3DTXB 4HPOL 4TSAL 3CUPB 1X6LA 3EGDB 4JRFA 4WU7B 4Z0XA 3VD7A 1OGAA 1RAMA 3H56A 3W0WA 2RCSL 3VMPA 2B4CL 2EE2A 2P5EE 4L5FL 2CDFB 1JNLH 2W92A 2E86A 1RSFA 3VXUE 4BINA 3LEYH 4ODWB 3NIDE 1W0VA 2XTJC 3VQLA 2FQFA 3MU3A 5ITFB 4KVNL 4QKTA 1R75A 3Q3GB 1M05B 4FNRA 1ZY9A 4JREC 1BMZA 4PB0H 5ABAA 3RVVC 2OTUA 3EHBD 5C0IB 2B8OT 4QJ5B 2EDRA 2F53E 1UB5B 2BRRL 4G7RB 4QR7A 5DHXB 5HGDB 4BEIA 5ES4B 3BH4A 5E08L 4EI0A 2GY5A 1DO5A 4ANXA 3IDXH 1EO8L 1BZOA 5GGQL 2W9EL 2R4SH 1A9EA 5C0BB 1WGOA 3BI9X 4PRPE 5F6IC 3WKYA 3LN5A 2XWCA 5IHLB 3MODL 3VI3E 3SE8H 4EN3D 1PL3A 4B96A 2A9BA 4P2OB 2VQ1A 1OTTD 3EFDH 4WFHE 5LNDA 3SBPA 1JE6A 1QSEA 3BHBB 3G9VA 3D0LB 2X0WA 4P2QE 3ZRSA 5B4MD 2X4NA 4X9YA 4WHCA 3AADB 3QXWA 1CR9H 1YEHH 2QADD 4JFFD 5AW4B 2Y4SA 1WAAF 1UWXK 4XX1E 5HDRA 2AEPL 5JXEC 1UOWA 5E9DE 4MHHI 1FI8C 5B1AB 1T7YA 1E2WA 3MCG1 4CVUA 3HRZA 3B7YA 2J6EL 4LT7A 4WTWA 2Z8VC 1IAIL 4EI6A 1AI1H 1NIEA 3HNVH 4LGSB 1MLBB 3DXAE 1BFTA 3HE6D 3VRIB 1G7PB 3UG4A 5AAPA 5CEZD 2HH0L 4GEIA 1NLBL 4OZGA 4OZIB 5KUMA 3I02B 1NUDA 4YX2L 2OYKA 4X6BA 4H88H 2DWEB 4A55A 4JJ5A 4L29A 2WJ5A 4YVUA 2Z31D 2YSSA 3OZ9H 4CDGC 3KE0A 2J56A 4JDZA 2EINB 1V7NH 4UTBL 3QPXL 5ISZE 4PFEA 3MLUL 3VFOA 2OAAA 3JV6B 4G82A 4PH8A 2X70B 5BO0D 2ITDB 3BAEH 2G2RA 4HF5L 3W9DA 5KVFE 3MBWA 2V8LA 4YS4A 4P07A 4RDBA 4AIXA 5T5NF 3AS1A 1S7WB 1NFIB 3F3HA 5I6NA 3TH2T 1DVYA 1FNSL 1QP1A 4DK5A 1FFNB 1SJMA 1ECYA 4L4TE 1RZIA 1E27B 2OCCB 3V7MA 3K6NA 5TPWH 1EK3A 3V0DA 5HPMA 1O5PA 1N4XH 3REWB 1GSMA 3VE0A 3H2PA 1CBJA 1XAKA 4UANA 1DFXA 1Z5YD 3K72A 3PP4H 5CSBA 5CZXC 2B3IA 3TBWB 4J39A 2BNUA 3QFJB 1TCRA 3QZMA 2JQAA 3LPWA 3T65B 3EO1B 3FCSB 5EA0H 1M57B 1UGNA 2VDLH 1KBKA 1XEDA 3X11B 2ORBH 2V2XB 3D85B 1KLGB 2R39A 4RMTA 4BZYA 5HHNB 3HB3B 4U1KA 4IOIB 4FNLH 5EUKA 5EPMB 3L1OH 1U8PB 4H0GA 3SY0A 4NNXB 2KBGA 3QXDB 1NA8A 3MV8A 3KYMB 4W81A 5CU9A 2EIJB 4GW4A 4LKXB 1MI5A 3ZJAA 2C1OA 4NQEE 1EA9C 4LDOB 2AQTA 2OP4L 2VLME 1B4TA 4XN4A 4XXCC 3QZPA 5AYUL 2XRAH 1A14H 3CSPA 3C6SB 2Y7OA 3PGCA 3AY4C 3WL9A 1D5XA 4NOFA 2XX0A 2EVFA 4Y8DC 3ZTJH 1OPGL 1NC2A 4F57H 5T1DL 4AW7A 4NGHL 1CDGA 1N0LB 3TA3A 1DVFA 2L04A 1LE9B 4G7VL 5AB1A 4UT9L 5F0JB 5HI5D 3SKOA 1PZ3A 3DVGA 1FVDA 1ITCA 1H15A 2C9SA 5AYQA 4PJ7B 4XNZB 3VFRA 2AC0A 1XH2A 2ZSWB 3IDMA 4XVTH 3O9WC 5E2UL 4ZMVA 4TV3A 5I15H 2G5RA 5KTEL 3CXHJ 3G5ZB 3LNGA 4D0DA 4ZS7H 3FSAA 4WJKB 1MFBL 2GK0A 4P4KC 1JZJA 1G43A 1Y07A 4MXQC 4R5VA 4BFOA 4MTMA 3TU6A 4E41B 3Q6GH 4DZBA 5D2LE 1BVLB 2OTPA 3FN3A 2FNBA 2JB6B 4NSKA 1VESA 3RLSA 2FTAA 4PBDA 1EHNA 3O6KL 4N68A 4OLUL 1TYRA 3IRCA 3TTYA 5ID0A 4UQDA 4B9JA 3CG8A 3KBHE 5BVPL 1DSFL 3ME0B 1A2YB 1J7VR 3KNBA 2VH5L 2H6OA 3O41B 4GKZB 4U1GC 4XBMA 3BAIA 4UOQA 5B38A 4UTAA 2ZUSA 3O6LL 4UAHA 2YAFA 5LHDA 3DMMB 1F4YH 3CIQA 2FO1A 3PGFH 1NBZB 1R5WA 1WH0A 3IKCA 2VT0A 5IW6A 2GCYA 1RJLA 2FJGB 4FYSA 1OT4A 3OPZH 2ZSVB 2DMGA 3RDTD 4UAOB 5DZLA 4KXDA 1GXEA 1EJ6A 3FQ2A 3LIUA 3BEWA 3D69B 4EZLA 3BDBA 1UQSA 3ARGD 1PG7H 1WUNT 2HG5A 1S9XA 1O7DC 1A6TA 2D0FA 3V8OA 5FYJE 3HC0B 4HUKB 3TZVA 1VB9A 2HFEB 4LNVA 1AFVH 2IOIA 2SEBA 5J1AB 1S9YA 5IWLC 3VXSD 2V2WA 5EULV 2ZOWA 2Z1PA 1GAFH 2WKLA 5IT2H 3BIAX 2JKSA 1NCAH 3WTSA 2LU4A 4F2EA 2K7PA 2C9VA 3SGJA 5K9QG 1KF9B 5KSAC 3EOYG 3QAZB 1B88A 2HJKA 2PTVA 2OMTA 5C0GA 4AYMC 3TP4A 2XQYA 1T3FA 3RZCB 1VEMA 2PXYB 2A9ML 5AFAA 1Z66A 2H6PB 4QTHA 3UOAB 3C5JA 1NICA 3CZGA 4GBXB 3FTUA 5GZNC 1IARB 4E5XB 2BCMA 2J88H 2C4XA 3JWNC 4ZOAA 4FLRA 4K9EL 2VL5A 3GI9H 15C8L 4I89A 3MBEA 4Q7DA 4MNQA 2GSGA 3FB6B 2F5AH 3SQOL 2XBTA 1XCQA 2YWYA 2VLRD 1EEZB 1I1AA 2DMBA 5GRJL 3WO4C 2F0CA 3K80A 2COQA 3FU5A 4K3HA 3K2UL 4KO6A 1RZKL 4DT2A 3QJTB 5IOPA 2LE9A 3FUMA 2YD1A 2O30A 5E9NA 4G8IB 4QXUH 3VSUA 1KBWA 1LK3L 3AUWB 1SVBA 4UQ2A 2D7TL 2R2HA 2WLLB 2XUWA 7PCYA 4LLYA 4NZTH 1IEHA 2BY3A 2BOBB 3V0WL 4LCWD 3H7BA 4XP6L 1B0RB 1FZJA 3GSUA 4PJ6A 2XFXB 3IDIB 5IB3A 4G3YL 2EUVA 5FYLH 4N22A 4RETB 3TASA 1QRNA 3V6ZA 1HNYA 4U1HA 5I66B 3CZSA 5F72S 5GGSA 5A7BA 2XZZA 2ZUQB 5DVOA 4UT6H 3PF2A 1AHKA 2AJXL 4H8WL 5IHUH 5L4IA 2E8ZA 2J4WH 4UDUB 4LNRB 5EUOA 2H3KA 1ZT4A 2BP8A 3L4UA 4WJG3 3UXFA 2VMFA 4HK3N 4Q4IA 4XO8A 1F6AB 5F7BA 4JFSA 2XYCA 1OTSD 3BZEA 4GRMB 1CDIA 3L3HB 1FWXA 3JSSA 4WCYL 1UZGA 4MLSA 5SWZD 4LU5H 1F2XK 5FOJA 2X6VA 3T3MB 5A6IA 3O2WL 5CIPB 1A3QA 2K8MA 2O61B 5ANHA 2PYFA 5GS1B 4GKSB 2B0SH 3FN9A 5GRWA 3VWKC 1R3IL 1MN4A 5I26A 3RTQB 3L3JB 1Q94A 3B37A 4G6JH 1CLZH 4TYUA 1EXGA 2GFBA 4OD3H 3GWJA 1OP9A 2X40A 5CBAA 4PJCA 4AJYV 4FZEH 3D12B 5AKVA 4X6FA 2H41A 5D7JD 4MJ5A 5BV7L 1F5WA 5FB8B 1GC1H 2NT1A 4RBPK 2XZAH 1TIUA 2YZ1A 4N8VA 4UILH 1LP9F 1R3JB 4PJBF 1OAYL 4P9HC 4DN4L 3LVEA 3NEEA 3OKLB 1TKWA 2CIIB 1HINH 3QI9A 4XO4A 1YNLH 2BNRB 3LS5L 1MHHB 1CGSL 5CD3B 4KUZH 1MNNA 4LP8A 2PP7A 3ZKXB 3MRMB 4G8EA 1BFVL 1QEXA 2ZONA 4BSJA 2ADGB 1D7DA 2CO4A 1WAAA 3U0TA 5A16A 4KC3B 4PJ8C 3IWVA 4Y89A 4F91B 4UNTA 3C8DA 4S1RH 4DP0X 1LO5A 1LDSA 5LBSH 4C47A 5KUKA 3WKPA 3I9IA 2K3HA 4NT6B 2HZHA 1AG0A 1HI6B 1SMOA 4ZYKA 1ZS8B 3GMRA 1AH1A 2XVBA 4LLDB 3SDDD 5F21B 1WFJA 3V95A 2F7QA 3P9MB 5DQJA 3D18B 2H1LM 3RIAK 2EDBA 4WEUD 4BFBD 1KC5L 2YS4A 3F5WB 3BKCH 2E0PA 3GKWH 3APMA 3HE7B 3CFBB 1KJ2L 5F9JB 1UWFA 5C0JA 1TMCB 1WIPA 3QUHA 4QKXB 1TQBB 1RZ8A 2HRPH 3GTVA 3HFFA 2FJHA 3C60C 5I1AA 1BQHG 2G4GA 3E1ZA 4I1NB 4DNLA 1VGKA 4GQQA 3PP3K 5KSBB 1MIEH 4DOHE 1IZKA 4QTIH 4WZ9A 5INDA 4P9MH 3DJZA 4BKTC 3OAWA 3VXNA 1O6VA 5FYKU 5D1XC 2GW5A 2Y07L 4LEXL 1ND0A 1DQML 5TF0A 2XG4A 5AALA 2R56L 3SB3A 4AOFA 2AEIT 1FGNH 3BP5B 4TUUA 2X89D 3WIHA 3MBXL 2XQYK 1X5AA 1QO3A 3K46A 3PV6A 4MD4A 3G7TA 1T66C 3OR7B 5GRUH 1I9IL 4NKMA 2ZWNA 5CCJA 3WN6A 5FF6B 4CILA 1L7IH 4WUUB 1WBZB 1M53A 1D7BA 3MJ8B 3QQ4B 5C92A 4FG2A 5D2NC 5CCKL 3DOSA 3H9SA 3TBSB 5GXBB 3C08H 4NKDA 5K5YA 1HEZB 3GLZA 3B2VH 1MFEL 4LBEA 2EEAA 2FR4A 1S7QB 2Y3NA 1A4JB 4PR5B 4B3EA 4NAJA 2DMHA 4O2FB 3MRLB 2ADJB 3MRDA 5FV1L 3C9NA 5MEND 4F5CA 1SLWA 1YEGH 2P7TB 2VDQL 2XXMB 2E9GA 5F7AA 2EDHA 4L3CA 2AK4A 3T2OA 4NHUA 5D7SL 4AYID 4LOUC 5B39A 2PTUA 3BO8A 4KQ3L 1HILA 3TO4A 5IMOB 4ANVA 4NN7B 5J6GA 4LEOB 1A8ZA 4AXWA 4I77H 3OGCB 3T0AA 1ZT1B 4P46D 3S34L 4JHAH 1U6AH 1UM4H 2OMVA 3ZTNH 2XPGB 5AB0A 2NY7L 4KBPA 2YMXH 5L7XH 1I7TA 1G7MB 1H6UA 3MUGA 1IJ9A 3ULUD 2ATKB 2BSRB 1CI3M 2JMRA 2VLKE 1CXEA 1PVHA 2WWKT 3GJFK 3LRMA 2VLLB 2YD5A 3LKNB 3RVWC 2Y1VA 1BW8A 3VGHA 1NCOA 4Z18A 1CLYH 3CBJB 1MCHA 2V17L 1I1RA 4HKXA 5HDWA 1AGDB 3C5SA 5IMLB 2IFGA 3KG5A 3WS3B 2RHEA 3CVBA 4U6YB 4LSTL 5C3IA 1MF2L 3U9WA 3MUY1 4OCRL 5HVWA 2P8PA 5C70A 4JY4B 2NY2B 4N0UB 3GDBA 5D7LA 4ZBJA 1L9QA 3T0EA 3U6RB 3GMNA 4U1LB 3PWLA 2K9FB 4GXVL 4HCGA 2X4RB 1RHHB 4XMXA 5DJDA 3G6DH 4XC3H 2NW3B 4PV1C 1E8ZA 4PG2C 1MJUL 3WN5C 2P28B 3MGAA 2DQIL 4OZFB 3WEOA 4JFHE 1OCWH 2CCWA 1KTKE 4IIZA 2ZG2A 3NRQA 2R29H 3U79A 2OMUB 1RK0B 1X44A 2K0RA 1HOEA 3QJFB 2ZP8A 3HBZA 4C8XA 4W1TA 1BBJB 1FNGA 5CZRA 1A4KA 1D6VH 4XP1L 1HHKA 3LRHA 2ATPB 1KPUA 4W9GC 3M88A 1LEIB 4YC2B 3NRPA 1JTOA 1FDLL 1OGAB 1RUAH 4YXKH 4KI5E 1S78D 1JNHA 4NQXB 1XB8A 3BVWA 4TPRH 5HVGB 1TFHA 4ODTH 3RWHA 2ZICA 3O6FC 4NZRH 3L95A 1G9ML 1U8KA 2VW4A 1TNMA 1W0VB 5D1QC 1UD2A 2G30A 2ICWA 4QRPD 2E27L 1WS7A 2J8UB 5GZOC 1YJDL 2J1WA 2X3CA 3I6LE 4K94C 2CBOA 4ZNEA 3Q05A 1KULA 4RQQA 4CADA 4P23A 2YPVL 3WKQA 1IO4C 1ZT7A 1F3DH 4M7KL 4E9VA 3KL3A 1MFDH 3U9UB 1A9EB 3KXFE 1G4RA 4XN2A 1A9BA 2XCMC 4R26L 4ABUA 5KN5A 4WHTB 1XGPB 1OKEA 1T5WB 4X4ZA 3IDNB 4HEPA 5D1ZC 1I8KA 1THCA 5BRPA 1P6FA 4IBTA 4E0RA 4ERSH 1YEDA 5FDWA 2ZNWA 3VNYA 3L7EB 4PJAF 1ZE3C 3BMWA 4OCNC 2YSTA 3ZKNC 3QIUA 2P44B 2X4NB 3DK2A 1QR1A 5E2TL 5D7KE 4B5EA 3L54A 3BKJH 2CLZA 1J5HA 4QPEA 3EBIA 3BJ91 4X9BA 1YCSA 2DPKA 3Q43A 1P4UA 3FCBA 1KLUA 5FYLE 3D2UD 4BE6A 1IIIA 3S5LG 2C9QA 3VXQB 4FCAA 2AQ3A 3P1VA 1SHSA 2E47A 3BRGC 1OP5K 4IM8A 1MCOL 1DP0A 3K4ZA 4EI6B 2WYIA 3QJUB 5D5MB 5LXGL 1WJ3A 2NNRA 2HT3D 5K9JH 2F19L 4O00A 4FTVE 2ICEC 1KXQE 2JCCF 5L8JB 4WUKL 3L4TA 2HJLA 5CEZL 2NY6D 3R1GL 4Q9RL 5CIPH 5DVKA 4PRIA 3T6XA 1IB5A 5LCVH 3N1PC 3BDXA 4JDZB 3TA4D 3W5NA 2BVQA 5F7FA 1TSHA 3Q2WA 5E8EB 2MKWA 4JZJA 2A6IB 2HVJA 4BUQA 1D5MA 5LNGA 4DAGH 5JQ6H 4PREB 1FG2B 3CPLA 4N4YB 1AYOA 2EEXA 4EI5A 1ZTXH 5TH2A 1CZ8H 3TVMB 2JFCA 3EXJA 5ICXA 3RHWF 3F7QA 1FYTA 3QJXA 5LGHH 4YJZL 4PRNA 1NDGB 3DYPA 1GRWA 1LD9A 2P43B 5DTFB 4BBWA 2FDBP 4OZIE 2EXYD 3PHQA 4KKQA 4IMLA 4G80A 3UPAA 2YQ3A 3P4OB 2BNUB 2WXHA 3TN0D 1JXKA 4JFZL 5F9WC 3R7QA 2E5EA 2QLYA 4YQXH 1PD0A 3NIFF 1E9QA 1FN4B 4J3OF 3FCGA 4LAJH 5H4YA 1A3LH 4U1KB 4P3CH 2EKJA 4LRIA 2NNAB 4XVJL 3ETBJ 5DD0H 1IKOP 1KCBA 4DZ8A 4Z7UF 5J3HD 2IPKB 4Q6IA 1SY6H 5BS0D 4PJBA 2GB2A 3X1NA 2Q7YB 5CGYD 3MGOA 1BAFH 1A7QH 3KPMA 5LGKA 1RERA 2YR3A 3FT4A 3HI5L 1PZDA 3B2UC 4PPTA 3RBSA 3CZEA 5DMKB 4OCYL 1FQ9C 3PPSA 3ZR6A 4LSPH 2FT7A 3B5GA 4P2RB 4Z0BH 3WL9B 4UTBA 1NCBL 3QFJE 2HMIC 2HYMA 4L2YA 3V79C 4Y5YC 4YHYC 2DIAA 5C08B 3UZEC 5AW5B 4FNSA 3REVB 1N0XH 2DWXA 2NY1B 2X4QA 2WW8A 3TA3B 3ARYA 3WD5L 1SQ2N 1SJVA 1IFHH 3H42L 1W80A 3PWPA 4V11A 3EG9A 1SBBA 1RVFH 2ADFH 2VSCA 1AKJD 1MQKH 3ECQA 2WCSA 2NTFB 4NERA 1GVIA 3PAZA 1I3GH 1QBAA 3VVWA 4X99B 1UB6A 1RUQL 1IFGA 4GAJL 1UFGA 5FC9A 1ZGLM 1K8DB 4WI5A 1HL4A 1QSFB 1E8XA 3MMEA 1WZMA 2J8HA 4F15B 3RFZB 2JJSA 1JZEA 4WTZA 1JCKA 4G9FA 3DX6A 4HIPA 4DZBB 5BUGA 1SOSA 5KJ7E 3O3EA 3P0YH 5TDNB 3WFCL 1LK2B 2V2TB 4HC1H 1WFMA 1HOCB 3VQ1C 1G1CA 2JKXA 4FXKB 4Y4KB 4XO3A 3V4LA 5HYJB 5I1KL 5KS9B 1E9OB 3BT2L 3BUIA 2CG9X 3N0PB 3LV3B 5AYTA 1F86A 2VMDA 2YO3A 5DJCA 5DZOA 43C9B 4OT1L 3AC0A 4PJ7E 3S5YA 4Y19B 3QQ3A 4ZXBD 3DUUA 1PY4A 2HN7A 3BQUC 5B38B 2VM3A 4ONFH 3TXAA 3IPBA 4JDTL 1IM3A 5T1KD 4N8CL 4A68A 1BPVA 3IRZA 4KWUA 5I76B 3ECVA 1R5WB 5TDPA 1CIUA 4RAVA 1F0LA 5IVNA 2BVUA 2DS4A 1P9MA 2WBWB 1DR9A 2Y7SA 3NDZE 2R8SL 1MRDL 1R24B 3DC0A 3ZYJA 3VFNA 4Z7VF 4E41E 4XH2A 4NP9A 1UQSB 5HDQH 4HGMA 4FHKA 4M6ML 2XKNA 2HG5B 4HIEB 5B3JE 4Z5RA 4UT9A 2Q8BL 1A6TB 1HL5A 2E7HA 1K4CA 3QHZH 3TZVB 3LRKA 4R6UA 1HYSC 2SEBB 3P0VH 4FMFA 4HPYL 4PIRF 4GRWE 4JKLA 1EFXB 3OKEA 1WZ1L 4QEGA 3CAFA 4N1EA 1X4YA 2NW2A 5D96B 2E9IA 4HBQA 2DQJL 5E99L 4PMFA 2OMTB 4NZJA 2Y5EA 2K70A 1WZAA 2VQTA 2WIIB 4QTHB 3QO1B 1IJNA 3HN8A 1X9UA 4PJGE 2UV3A 1MEXH 2BHYA 4TRPH 1R5VA 1QHOA 1P4BH 2VIRB 3NH7H 1SUJA 4H25A 1ASOA 4N1CA 3B9KD 4JMNA 2RB8A 4PJ9C 4OZFH 2CDEA 2VL5B 2HTKD 4N2GA 4A6YB 1BHGA 3G6AA 3JWOC 3D39A 3VG9C 2WLHA 2PW1B 2QHLA 4IGBC 4U6VL 5C71A 4GG6F 2H2SC 1I1AB 2ZXQA 3HUJA 2P80A 3D87B 4NRYA 3VJ6A 4RX4D 5C2BH 2YXMA 5IOPB 1OOWA 2IC2A 3UFIA 1ZHNA 3CFDA 3ZE0B 4ZI8A 4UQ2B 2C3HA 1FP5A 2E7DA 3GGWA 3GHBL 5AKRA 3UCRA 5KJRH 1KIPA 5DQ9A 2R2HB 3L1GA 4FNTA 1E5AA 3BKYH 2K9UA 2IAMD 5KG9B 3ROOA 1JPTL 1MFAH 2HX8A 3NBNA 4J1UA 3ZZQA 3VG0L 5ESQA 2D31A 3R4RA 1EJ8A 4FFYH 1TMQA 2AJZB 1P7KB 5GGTL 1ES0B 1PAMA 1OT1A 1T22B 2CO6A 5HGAB 1PKOA 4L8BB 3FF8A 3SQRA 1QRNB 3HG5A 3D2TA 5DUBA 1TYJA 3VFGH 2A0LD 2A4EA 2BS71 1KV7A 3GJFB 1NOLA 1WYJA 3MLZL 3A24A 4POZC 1QASA 1L9TA 3ZDZF 1Z32X 5I2IA 5IROA 5DUJA 5JIHA 2XWJB 1UVQA 2ZNXA 4OD1H 2BP8B 1Z3GH 5D93C 3N2JA 1I9RL 3KBPA 2XXGA 2ZJSL 3IS0X 1TQCC 4FD0A 2GJPA 2AXFA 3V52L 2MNWA 2Q9OA 3FULA 4LARH 3B7RL 4G6FB 1A1MB 5EORH 4YAQA 3A5VA 3K6IA 5A6MA 4PVNA 3ARDC 5DD5H 5DK2A 4UOW1 2GIMA 1FZOB 4LLMA 1IM9A 1Q94B 2XTJD 4XXDB 5FECA 2XLLA 2AW2A 5CBAB 3AZUA 2DQMA 5AZUA 2RD0A 2EDJA 3RVVD 1XCWA 1RFDL 3VYPA 1I7UA 4QRRE 2GC7C 4A7UA 3DV6A 4DPBX 1OWWA 3MA7A 3CH8A 1VEOA 1NLDH 2OCFD 3N1FC 4LCCC 3TNNB 1D6EA 4K7PX 3VH8G 1DJIA 4K3GA 1PZ2A 1QFUH 4IOSA 4IKKA 1I9JH 4MJIB 1RIHH 2X6BA 1XSOA 2ZUYA 4ISVA 1CYXA 2EDLA 4ZW7A 2CRZA 4GS7C 3QIWC 3CCHA 5EIIG 1ZV5A 5AKSA 4JPIA 4PJAA 5IHZB 4A67A 1TQWA 2DQTH 3N85L 2DWSA 3T3ME 5CNHA 2R1XB 5DEFA 4L3FA 1G9NC 4MA7L 4FYRA 5D7IF 3WDHA 3WTXA 4JCMA 3QEQA 1F8TH 5I75C 3ZKSD 1JWUB 4XNYL 5C0CA 2FHBA 1IGIL 3L9BA 2IDUA 5B1CA 3X14A 3T6WA 1MHPL 3M1BA 1VGEL 5AQ0A 2FBRA 3CLFH 4PW4A 3GUFA 4UQ9A 1PFOA 3J07A 2GY7B 3U4EA 4F1ZA 3PHOB 4J23A 3V9CA 2BZDA 3ECWA 2IJ0C 2JCCA 4ONOA 1Q72H 5A40E 4KPHH 3AB0C 3C09B 2V33A 4XNUL 4G5AA 1WEJH 2DDQL 1RLBA 5C0JB 2JCWA 2BNRE 2P47B 3BVDB 1XGRB 1SXAA 2GI7A 5DQDL 3BW9A 1S7RB 3OHXB 3RVUC 4DGYL 3DO7B 2HKFH 2P52A 3JTTB 3RJQB 1YYCA 4ZSOB 1YEJL 4MQ7B 3GMLB 5FV2A 3VXNB 1FVEB 5I1EH 2FJSA 4RAUA 4KU1A 3BPNB 3ZGIA 2F1EA 4BCYA 2LFGA 3WFBL 5FYKH 3IMVA 1JPFB 1BJ8A 5I0VA 4GQZA 4NM8H 1BFOB 1KN4H 4KMTH 5HHOA 2AS5M 3NZ8B 5DCCA 3V0EA 2VITB 5SWQA 3QJVB 4XX5A 4JQVA 1E67A 1FHNA 3KH3A 4YHOL 4A7QA 2H26B 4M4RB 2KZKA 2ZX5A 5CZXD 2WTOA 3ZDYE 4K7PY 2V5TA 5IVOA 5I5JA 3ZL4L 2VRQA 4OKVB 4LQ1A 1BG9A 1T1YA 2VOTA 3BUQA 1KXTA 3IE4A 5HHMD 3RNQA 2XA8L 4WGVB 2FLMA 5I8CA 1UC6A 3C9NB 1FZMA 4K8RH 2V5SA 4NRXA 3DOIA 4PV9B 2WLKA 5JXAL 2Z93A 3D06A 1JGUH 2JKIS 3NACH 2AK4B 1T5XB 3CDZB 4XZUA 1BIIA 1CDCA 2ITCB 1COBA 4ZW5A 1UXLA 4P57A 3TO4B 5CD5D 1NSNL 3FB7B 3IGUA 4RBPH 1UCBL 1MZYA 3ZDWA 5J6GB 3MV9E 5EO0B 4M93B 4OD2B 5HVFB 4X5WA 3NT0A 2GYSA 5IR1B 2H9GB 3CFKA 3P3YA 4I0PA 4TVPH 5ACMA 4TSBH 4CMHC 1S8DB 4OGXH 3D05A 4GQ9L 5F88A 2NUPB 4JQIH 1CVSC 4LCIH 2WZ5A 4PCYA 4Y16B 3TNMA 1J18A 3C6LA 3KD4A 1QUPA 3MX0A 2ZKXA 3P77A 4AV4A 1IAII 1I7TB 4I9WE 3GI8L 5EBMA 3ES6B 3KLLA 3ZUNC 3QDGD 4R7NB 2FYYA 4DEWA 3GRGA 3O81A 3EJZD 3ULUL 3DSFL 3KGTA 1FV1A 3ARED 3ZZ1A 1OGTB 4BM7A 3U2SB 4ODHH 3CVCA 4GSQA 4YBQC 3QYCA 5E2WH 4JVWA 4E9RA 1RUMH 4XAKE 2MOVA 3O6MH 2EEFA 2F54B 2B1HH 4FYQA 2DJMA 4L2LA 4WF7A 5H8DA 3DDFA 5KANG 4IIQA 2X4TB 4NJAH 1EJFA 2IPUG 1AGBB 3W9EB 4MSWA 1GH7A 5GIRA 2NCMA 5BUAA 1TQUA 4FQXA 3OMAB 4P4KD 4MXQD 4NO0A 4I7ZC 5I1GH 1SZNA 3T0EB 3HS0A 3GMNB 4LPVA 2YPLA 1BF8A 3F6LA 4PRHA 3RY5A 1FL3A 1T04A 3FUKA 2P8LA 3M6DA 4LAQL 1YZZA 5IF0A 1GW6A 3L3KB 4PBXA 2VXUH 4K3DL 5F1SA 3GS0A 3N6YA 1QFPA 1FC2D 1SOXA 1UD6A 1QLEL 4LQFH 1OM3L 5AOIA 2Y7QA 4LSVL 2QQNL 5HD8D 3QJOA 4APXA 2QKIB 3DI3B 1GZPA 1XV8A 2C26A 4IBQA 4X4YA 1FE8L 2YKLL 1YYML 3GJEB 1E30A 1QLFB 4Y1AA 5FUZL 1KNOB 4Y4FC 4YLCA 1T20A 1T21A 2YEZA 3KJ4B 1KPUB 2YXVA 4PRDA 1AQDA 3SKMA 3UJTL 4NBXB 1U8HB 4N0UE 3CZJA 3KPPA 3UTTE 1XF2A 4OFIA 3FAWA 4JRXE 3MLTA 4DKTA 4AE1A 5AOLA 5CLZA 4Q97A 4WWKC 4HS3B 3RWHB 3UYRH 4Z7VA 4FCHA 2BS8A 5EU6D 1XIWB 2FQGA 3IVKA 4A6YH 3AQDA 3TBTA 3CK0H 3MJ9H 2BIPA 5E6IB 3SBWA 1N10A 5H4ZA 4PJXF 3PDOB 4ABVA 4LSSH 4CL7A 3AY2A 4MQSB 1YA5A 1OOAA 1JBJA 3GSNB 2FEEL 2CIKA 1J8KA 1F4WL 2NY4B 1CGWA 5ABZA 3CQPA 3DX3A 3EO0A 4ETYA 3WMQA 2MNUA 1B0IA 5MP6L 4Z8FH 4PGJA 5GS2H 1I8KB 5IGXL 5KSAD 4U1MB 3DX8A 1CK0H 1GYCA 3I6SA 2KQNA 3CSTA 3T0WA 2B59A 2GK2A 1CXIA 5FDWB 1TETH 1OGAE 2BIHA 1CYGA 4NUGH 5IOKA 5DK3A 4D9QD 3S37L 1OV8A 4NZUL 4GW1B 3QULB 4QO1B 3L9RB 1T03L 8PAZA 1J11A 1Y6KR 1QWUA 3CPUA 2VAAB 1YYLH 2J8UE 3O8XA 2EVIA 3ZHLA 3GJFH 3STZA 1RZJH 1KLUB 3NEXA 3Q9PA 1L9RA 2J7LA 5DURB 1C5BH 1KACB 3RHWK 2A6DA 2ICWJ 3EJTA 4Q0XH 1R3KB 5HHQB 5EO9A 1L9NA 1PEWA 2W0LA 1PX4A 2YGQA 1GYAA 3EDJA 4XPHH 1E5UI 1O5DT 5H2BB 2HX7A 1FBIH 1TZHA 3JV4A 5DO8A 3RAJH 1NUNB 1QSEE 4XCYB 3I74A 3D4ZA 1TEFA 2CJUH 4W9FC 2CD0A 4HJTA 2BFGA 2YPVA 4AQ1A 4JZJB 2BSSB 4AZ8B 1K6QH 1DEEA 2A6KB 1KT2A 3PWJA 2M83A 1YDPA 3OC5A 3RA7L 4QXGH 4U2ZA 5HGBA 5I18H 5I19H 1ONQA 2CH8A 2YRLA 5ID1B 4JNXA 4EZMA 1FLRH 5D70L 4I5BA 4L3AA 3VX0A 1BQKA 2CA3A 4Z95H 1H3PL 3ZTJG 3JTSA 3QCUH 2OR9H 4H20L 2B1AH 4N8UA 5T3ZH 5T3XE 1FYTB 3OZKA 4U3SB 4C4KT 2WB1A 4OLEA 4PRNB 2PPCA 4GUCA 4NP4H 4OCSH 3SKJH 4EN3A 4YSUA 3QYNA 4KNSA 1PCXA 4ELMF 1A1NB 1KIQA 4HKZA 2VW7A 1N8ZA 4LPXA 4L8DB 1HDMA 5CJ8A 3R0NA 4AC4A 5HYEA 2DM3A 2YD8A 1JIBA 3EJYC 3VWKD 3ULVD 1TSRA 3FB5B 3BIKA 1MCBA 3CX2A 5BUPA 1E9QB 1TF4A 1XGYH 4UIMB 5F1KC 2P3YA 3EYFA 4IBVA 2XKUA 1VFMA 3GIZL 2EXSA 2AV7B 4L3ED 3MCKB 4NCC1 4PV8B 2DL9A 4FZ8H 4DZ8B 5L8KB 4NNPH 1LP9B 2ZWSA 1AACA 4BELD 1MUJB 3QYMA 2X6MA 2YAQA 3HE6A 3NAAH 4RRPA 4M7JL 3D34A 1LQBC 1Y0LA 5KVDL 3K2MC 3U2IA 2AHIA 3SCMA 4AQ8A 2DLIA 2FE0A 4RIRA 1J1XH 2VABA 5CS7A 1N5AA 1V5JA 1MREL 2AI0L 3ULSB 1VFAB 2X0VA 2XQBL 3DVNA 4HCRL 5ACZA 1A7NL 2O6DA 4AT6A 4U3HA 1RZPA 1ZHKA 4XBEL 5D7IA 3VM5A 1II4E 3VAEA 1INEH 4PJ8D 4LHUB 3DSNA 4L1TA 1S9WA 3UP1A 4RISH 3VQ2C 1B3IA 2X2IA 3MR9B 2DYPB 1VACA 3VX1A 3HG3A 25C8L 5TFSL 1GZHC 2QPUA 4DPAX 2BFVH 3HHSA 4J2QA 5CINL 2WVSA 3UAJA 4LHJB 2DWYA 4HBCH 3WIHH 3O2DH 1EEYA 4CN6A 5DC9B 3ZSTA 4LGRB 4GB9A 2WC7A 3GRWL 1X5IA 3MV8E 5E8NA 3MV01 2ZXEB 1MVFA 3LKPA 4KVPA 1OHQA 5HHPB 5ELIA 2I9TA 3MMEB 3WXWL 4K5MA 3NCEB 5I0XA 3BWAB 3QDAA 3Q1SH 1FNEA 3PRZA 5JA9A 3C60D 5BVJB 1OGPA 1CG9B 1KGWA 3H6JA 4FMKA 4P2RE 5EHFA 1UFUA 3MN8A 2VQUA 1LWJA 4NNYA 4G6KL 1KEGL 4NN6C 5CR1A 4P5TC 4ALAH 5C0FA 3Q1EA 1JV2B 3KWXA 5AB9A 3ARBB 3HNTH 2C7UA 4Q6KA 1P1VA 3LKQB 4UNUA 1NGWA 4HP5A 3VA2C 3UJIL 1HEJC 4MAYA 5DJCB 5GHWL 1ROCA 2G9HA 1YN6A 3GHEL 4JDVB 1UM5H 2H1PH 2AKRA 1ACXA 4IKNA 1CXFA 4ZT1A 4LPWA 2HN7B 3F58L 4L8SB 4HXBH 1P0SE 5DJ8B 3TF7C 5FM5M 4AGOA 1T66D 4L1DA 1TFPA 3G04A 4M6AA 1QSFE 4WFGD 9CGTA 1X7TA 4FQLH 4O2EB 1Z2KA 4XCFH 1HAUA 4TSCH 1C08A 3WNNA 1S7SB 5DWUH 3UEZA 1MHEB 3G9AB 1CFTA 1RJYA 2KKQA 4L05A 3W82A 5F1IA 2FIRT 5IVXB 2XKNB 4RSYA 3ULUF 4ODXA 4Z5RB 1YEEL 4B9YA 1NBCA 2VR7A 3BCFA 3ZMNA 4N0CC 3DUSA 1AXTH 1E40A 2PWEA 4N2HA 5IK3A 4R5XA 1YC7A 4GINA 2AABL 4JPKL 4MDIA 4ZFQA 4Y19E 2NSQA 3OKMA 5IHBA 2B77A 2WOYA 3M46A 4F37K 3EYVB 3H9HA 3IJEB 5F1NB 1IT9L 1OD9A 4R2GB 2XNAB 2VO8A 1WFUA 3PY9A 3Q5TA 4GQRA 4MA3A 5E1GA 3LJ3A 1IMHC 2R2BA 1MFUA 5ENWA 3MRGB 1JZHA 5I8KH 3RNKB 3UBXA 4CSSA 5KSUB 4KMLB 4DP4X 1UUSA 2N7BA 2W60A 4JN2B 4ONHA 3KWTA 3SGDI 4GMSH 2CDEB 3QPQC 4OIBA 5DEJA 1RZFL 3E9UA 5F1OB 1J0JA 1HXMB 4OF3A 1ZSDB 5DUPL 2FWOB 2CRMA 3DETC 1UKSA 1FIGL 3PIQA 2W5PA 2NX5B 5DT1H 4WNQB 3L16A 1RIUL 1LO0H 4NRYB 1A5FL 4PD4K 3VI4F 5DZAA 4Q2ZB 2Q76A 1RUKL 4Z3JA 5AW3B 1IQDB 1XH3A 3FS9A 3GGWB 3WFDL 3BP6A 1TTCA 3PQYD 3QEHA 4NBYB 3BVNB 3LRGA 3KJ6L 3UDWC 1ZA3A 5MI0B 3RDTA 4J1UB 4N2EA 4HFUH 2W0FA 4MMZC 4NDMA 2NY3C 4GSDH 1OLLA 3LHPH 4N1HB 3B2MA 3RX8A 5BO1H 3ARGA 1MPAL 4XPFL 4BH7A 4EVNA 3PL6A 1U8CB 4LSQH 1Z6JT 2A99A 4LASH 3GSNH 3U9PH 1A4BA 3AMKA 4N0RA 5DUBB 4MNQE 3AWFA 5L2KB 4I2XA 1A6PA 3HR5A 1W91A 5GISH 3VXSA 1RPUA 5DHYA 1CLOL 3R0MA 1HZLA 1WVZA 5E1IA 4AYFB 4KK8D 4QDGA 1JERA 3RE0A 5IB1B 1G7JA 1FGVH 2V9QA 1FIEA 3WGUB 3ZE0E 2VXSH 4AL8H 1HCVA 1DDTA 4RGNC 1CYWA 1TVBB 3CDGB 1EDHA 2CZNA 3G5YB 3JVGC 4JB9H 4JFPA 5EBLA 4OM0L 1JYWA 1M2VA 2HJFA 2AXGB 3O6FD 3ISYA 1E7UA 5F2FA 4NQCD 1IM9B 5I0WA 5D1QD 3OXSA 4AM0A 5FECB 2I26N 4EPSA 5GZOD 1AJ7L 2LU7A 3AQXA 3QXAA 1QRNE 2V4LA 2JKTM 3ABMB 3CZUB 4BCZA 4LSUH 1CVRA 1GIGL 3HMXL 3BP4A 2VLRA 3HN5A 5LQBL 1RU9L 7FABL 4TSAH 2YGPA 4OR1A 3IJSB 4BGDA 4WTZG 5I71B 5EUOE 3HI6L 5D1ZD 4KI5C 4KXCA 4Y1SA 3GTTA 5JOFA 2JKLA 1PS3A 4LFHG 4JPIB 4FMVA 3QNZA 5KYNA 3ARUA 4PJEB 4F8QA 4K71B 4LCWA 4PRAB 2JKJA 5GGTA 3CH1A 3ZKND 1YHPA 1UD8A 4JFEB 1BIHA 1UKQA 4K2UH 4XNMA 5F97E 4FFTA 2D03H 2AGJH 4GSRA 1EO8H 2D7NA 2CJ3A 2PF6A 2W9EH 2J20A 3AWEA 5AEAA 3V6FA 1ID5I 2H47C 3FTGA 4X6EA 5DK0A 5IQ7L 5DLML 4Y2LA 3M1BB 1HS6A 3U0WL 4YDVA 3SPGA 2OK0H 2YBRA 5C0RH 3BUBA 4KDTA 2A74C 4P04A 1DFBL 1CU4L 5IB2B 4D9LL 4MNGB 5BQDA 2ILLA 2VN4A 1OW0C 3NZHL 1CXLA 4X7CC 5ALCH 3X3FL 3WEMA 4CC1A 5T3ZE 2VCOA 3QDMB 3UGEA 4KV5F 1BYPA 3F00A 2E6JA 1FH5H 4XCCL 5DO2C 5E4EC 5HDLA 4MMXA 3OQ3B 1ERNA 2LHAA 3GDCA 4NKOA 2F6AA 2R0WH 4OGYL 3P11H 4AVHA 1X5GA 5D4HA 1CFVH 5GJTL 2APFA 1WAAE 4HH8A 1BZ7A 2GUYA 3TYGL 3N43B 4KY1H 4F8LA 5GSRB 1JHLH 2JKNA 2IH8A 5LB1A 5BV7B 2J6EH 4YSOA 5ICUA 5D7JA 5EU5A 2MPAL 4OV5A 3BSZA 5IBTH 5E6ZA 2FLBT 3I2CH 5IZ7A 1HVXA 3U1PA 4WI7A 5DJ0A 2P8MA 2CHNA 6CGTA 3GZPA 4PGEB 3LNHA 4P2OC 4YSCA 1N26A 1OAQL 2P48B 3GO1H 4K3JH 4ELMA 2H32A 4HDIA 2UY6A 3ORJA 2QPFA 4UTBH 3GMPA 4KTYA 1MG3C 2UWEF 5SWSD 4DKFL 4HCFA 2VLJB 4N6RB 3MZTA 3MROA 3ZSSA 3ZX1A 3MYJA 3L4VA 1QZNA 1TLKA 4YWGL 5HYFA 1BLIA 4HF5H 1KXTB 4MX7B 3KS0J 4ZSOE 4JKPH 1FFOB 1C12B 3W56A 4KZDH 1FZMB 3F64A 3NYKA 4C4BA 1Z9NA 1PJWA 2JV6A 2UXTA 2XN9D 1JPSL 2CKBB 2Z93B 3MAWA 3NCMA 4Z7UB 5DHVA 5TD4A 1N68A 4ADIA 32C2B 3LQZA 4ZRGA 2CHXA 3SDDA 1BIIB 4B5ZA 4MA8L 4Q9CA 1UJ3A 1T89A 1OAZH 4I18C 2W9DH 3FTWA 1WIOA 4K5OA 5JHLL 1KJ2B 2BCKB 4G7YH 1UWYA 5EG6C 2IG2L 2KERA 1XXFC 2PWDA 4AQAA 1KLFB 4R0LA 4HK0A 5F88B 1U2YA 4JPSA 4WK2B 3SDAC 1P1ZB 1XCTA 1IBHA 4WK0B 5CEXA 2ESVD 4Z76B 2PKDA 5I0YA 1TTFA 3H9SE 4Z78B 1EAQA 4DESA 2NT0A 3T4AA 4DO4A 4KH2A 3WSQH 5CKAA 4LIQE 2YEVB 3EOBA 3HLAA 1SRDA 4F9LA 4X4XB 4XMVA 4HT1H 5EZOL 2ED7A 4E5XG 2PYED 2RALA 5AUMB 2X4SA 4F5CE 1CQYA 1WC7B 1SXBA 3OKDA 3CFTA 4N8PA 1EZSA 3MNWA 4HJIA 2X89A 2AK4E 1MCPH 1WT5A 2OP4H 4XGZA 5E1AB 3RGVB 3B6SB 1JNNH 2VDRH 3OJVC 4C58B 5JIQA 1JYXA 2XIBA 3KH4A 3FO2B 1SDAB 4QY8A 1HT6A 3SPIA 1FYHB 3FQ4A 1V3KA 3V7AE 7TAAA 3UEQA 1OPGH 2LAGB 4KX8A 3B2DC 5EOTA 5T1DH 4NGHH 5G2NA 1O6SA 5DGRA 4MQTB 4WDIA 2Z7ZA 4PP2A 2AMUA 4YN3A 4Z1PA 1C5CL 4HKBA 2PR9A 3GT6A 4F2MA 4EUPA 3PNWB 4JFDD 3K74B 4OBSA 3HVNA 3L8QA 1MAML 4JANA 1IVLA 2VDQB 4WSJA 1PY0A 3TWCH 3APFA 2ENJA 3GB7A 3AXIA 2VGLM 4DP7X 5MENA 5E2UH 2CXKA 4CU6A 1SJEB 3WJJC 5EZLA 4L4JA 2Y7QB 4XVUC 1O9VA 1FL5B 4OY9A 1OXYA 4YDLB 2WQXA 1UWEL 4QUOA 1THAA 1F4XH 5EC2B 3WE6A 1R19A 1K3ZA 2KI6A 3ASOB 1UZ8B 3RY4A 3WFHB 3HAEB 4WKZB 4P46A 4ZMOA 2DQUL 5BRZD 3E6HA 3P0GB 3FRUB 3NCXA 4OI9A 4W4OC 4YSAA 2K3TA 5IJKC 3D3VB 1HH9A 1XF2B 3DDGA 3L3OA 3MLTB 5D7LE 3TTSA 3BKML 3LQAH 2WXQA 2XVKA 3T0EE 3BRDA 2O6PA 1QBBA 4R8WL 4LVOB 3V55A 5CUSH 4QHKI 5FA4B 1PNCA 3PDGA 4Z7NB 3N0AA 1GOGA 2DY2A 4ZFOL 1IKNC 1DSFH 2Z64C 3MRCA 4MAUH 4XNZC 5E8OB 5KW9H 2WINB 2WWMC 1HYSD 1L0PA 2WMPA 2IDSA 4DJMA 2CIKB 3LXBA 3VXOA 2XWDA 1SVZA 3EO0B 3EKCA 3FU7B 2ZPKH 3G08A 3SYCA 1LO4H 1XB6A 4ZW6A 1X5LA 3WUWB 5CN3A 5L6YL 3DX8B 2XSKA 4FLSA 3FQWA 5JXED 4HUXB 2YQGA 3Q2VA 4P5MA 4L9LA 4XBGA 5HGGS 3K71A 2KLRA 1XGUA 3P2BA 4EDWL 2D0HA 1YEKL 1CDYA 4WGWB 4OZHF 4X5XA 3WE1A 1N64H 1G7HA 3IGLA 4PJ9D 3EYSL 2X9ZA 1OAXL 2IFFH 2IAAC 3F01A 4IRSB 1I1YA 2C1PB 5LAXA 2BVTA 1J0IA 4U1SB 4ZNEE 5JOPD 3I9PA 4JE0A 1LE5B 1E4XL 3NGBB 3WFEL 3HPJA 4GG6B 3T2PA 2I5YH 2B3RA 4IGBD 1P5UB 2H2SD 3UGXA 2DYSB 3VI4A 3UBXI 3QHFL 3DMMC 1PD1A 3QCTH 4TLUA 2AQPA 4A7SA 1KENL 2WXOA 1KEML 1RZGB 2FJFB 4GI6A 3II1A 4PS7A 2ZCLL 5FKAB 3QUML 2O93L 4B9ZA 3JV4B 5F0PB 1SYVA 1UOVA 4KDWA 1LNUA 2V8MA 3FFOA 3SZKC 5J4MA 4DP8X 3C75A 1AXSA 1XGZA 4ZMPA 4TM9A 3FSZA 3UTSB 4QRPA 5GGUA 2AJUL 2HLEB 4FE9A 4HGWB 3SQOH 4M5ZH 3EHBB 2GSMB 4O4YL 5DRXA 4AJ0A 3MNDA 1GPOL 3A6CL 3DUHA 5GRJH 3K91A 5LBGA 3GLDA 4L4VD 2OMWA 4OTXL 4ZAKB 3ZDZB 4POZD 5FM5O 1TJHL 1NCWL 4XMLL 1CBVL 2DTML 2QFPA 2BSTB 3OSKA 4HXAL 1JD9A 3WKML 3FOMB 4OUUB 5D71H 3SO5A 5D6DC 3UTQB 2PXYC 1T2QL 5AAWC 1AAJA 4B27A 2ARJA 4JJHA 3IMUA 1OCCB 4EN3B 4FNQA 4GBXC 4MXWL 3O4LD 2WXKA 1T1ZA 1KIQB 4HKZB 5E8DH 3RUGF 5L88L 2YOAA 4G3YH 1H6EA 4L5FE 3S3SA 4A39A 4NO3A 1UUNA 1GGCL 2J44A 3KGSA 4PRIE 4PTTB 4UYPA 4XP5H 5C09B 2ZQKA 2JQZA 3LIZA 4Z3TA 3RFRA 5MERB 1W0YT 1WWAX 2QADB 3MJWA 4JFFB 4ZPTA 2E8YA 3S9DB 1CDUA 1NDMB 3W0WD 3K8MA 1J8HB 3NCJH 3BSHA 3ULVL 3MLSH 1KCRL 3EYFB 3MCLH 1YQVH 3AM8A 4LL1A 3CHQA 2AJXH 2P42B 3D2UA 4O2CB 2I27N 2BSCA 3NN8A 4XCEA 4DGWC 3Q01A 3HI1A 5E2VL 1SHXA 1TZOA 4MJ6A 3SSGA 3C8KB 3A4DA 4Y4HC 3HE6B 4WCYH 1WBYB 1P5VB 1Y0LB 4H4NA 3WJLA 5L0QC 1FYTE 1XGQA 5I17A 3VD1A 3O2WH 2BIIA 1NCCH 4Z7WB 3QIWD 3ZTDC 2BVPA 2VABB 3VD5A 1QLRB 2DQDL 3DVNB 1IBFA 3G5XA 4FYTA 4YHPA 2Z31B 1HHGA 5DEGB 1FRGH 5I0DA 4IS6A 4AT6B 3GK8L 4PD4J 4UMSA 5D7IB 3BVUA 3FZUC 3DSNB 5BV7H 1JFQH 3I6GB 2YAOA 1WSST 2IWFA 3PJLA 4NKQB 1KZYA 2ZUQC 3ALPA 5D8JL 1NOFA 4KMQA 2D73A 3TIEB 1JPST 4ORZC 1EAPA 4RWYH 4ZDHA 4G6ML 4MRBA 4I9XA 2IBGA 1I8AA 1EEYB 4JG0H 4P2CG 3CFJB 1HZHH 1LP9E 1GCFA 4NUQA 4PJBE 1W9XA 1M6UA 2AJSH 2WTRB 4I3SH 3Q6FA 2EH8L 2JK5A 2O5YL 4U1JA 2VXQL 1X4ZA 2J2ZB 1QOKA 1AGCA 4POUB 1CCZA 2IOOA 4YE0A 3ML9A 3KR3H 4OLZH 3RTQC 4TTGA 3TN0A 5EFIB 1HHJA 1A25A 2IANB 3RVUD 3U2JA 3V0FA 5PAZA 2KHAA 3BN9C 1Q1JL 2YK1H 2B14A 1BAGA 1I85A 5CILH 5EDXA 4NM4L 5AVRB 4IEFA 3S96B 5B1JA 2A9CA 5MEQA 4MB4A 5PCYA 3QNFA 5ICYA 2CKBH 2C3WA 3P3SA 5MEOA 1NBVL 2C7UB 2Z4QB 4PWIA 4X9GA 1NGWB 3DXAD 2FX7H 1U8OA 1DUZA 3HS8A 3WEBA 4UUJA 3CZFA 1D5IH 5BS0A 1KJ2H 2AKRB 4BIKA 3KPNA 2BHZA 4N9OB 4H1LB 1WO2A 2WP3T 5E23A 3OG6B 3VXPB 4M8VA 1UACH 2N1TE 4IBUA 1YMMB 5DF0A 1OSZB 4EDXA 1CD1A 3AITA 4F7KA 1QI5A 5IESL 3IWUA 2IV9A 1KBPA 1U8NA 1RJYB 1HIML 2Y07H 4LEXH 4S1SL 4R84A 3TEWA 2FEJA 1IKFL 3QWOB 1C5DA 3MBXH 4D8PB 1DVTA 2CHDA 5CU5A 3QORB 5AAMA 5AL8A 4L4TD 1NEZA 1AKJA 4ZTOH 2ZUXA 3N44F 1MCSA 4AITA 3SDXF 2EDWA 1FFPB 3UL4A 5H35A 4PGBB 1ACYL 2VDNL