3STLB

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlB01
1CG9A 2BNRB 5EBMB 5C0JB 4JPIA 1NUGA 1QBMH 3ZKND 4DKAA 5H35A 5GS0L 2D0HA 4HLZG 4BUGA 2GCYB 4B5EA 3GIVB 4YUEH 2ADFL 4P9HH 2AABL 1GVIA 5MEPA 2X89D 1DN2A 4MAYB 1CGSL 3PIQB 3SE4C 7FABL 1I9EA 1N59B 1MRCH 2EEAA 3HUJA 4Z7WF 4NWTH 3RVXD 4KC3B 1MJUL 3VRIA 2OP4H 1REIA 1XF1A 1GYAA 4P5MB 4N0YL 2EC9T 3OV6A 1C16A 5EU4B 3QDGE 1NCAL 5HDLA 3NCCB 1FZJB 4MDIB 2ID5A 1N7ML 3EYSH 3IS1X 3UPRB 4WW2C 1F90H 1KCLA 4JFDE 4POUB 5KZCD 3ZO0A 5E1AB 4Y4HA 4RIRB 3QISA 3IAQA 1F11A 3MRIA 3S6CA 3VGBA 3OJDA 3L3KB 2D4FA 4OD3H 5I73B 3SO3B 3GSVB 1S7XB 4OLWH 4NZRH 4OM0L 1KFAH 5EU7E 1UADC 5T3XH 1FYTB 2WBJA 3BGMB 4PGZA 4GSDH 5IB5A 3QIUD 3C8HA 4P2RB 5IB1B 1U6AL 2VISB 3KLDA 5IFAL 3QXAB 5IVZB 1TQBB 3S36X 3M07A 4P46A 1PLGH 5D1XD 5ADPH 4OI8A 5HHVH 4YXLH 5SX5K 4U0RC 3KR3L 3WEXA 4OJFL 5I16B 1BHGA 3V0WL 1CTOA 3RHWF 2MPAL 5C0BD 4OZFH 4K3DH 5IMKA 4P4KB 2BVQA 5FO9B 4UILH 3RWCB 5HI5C 3DJ9A 3MCLL 4WHTA 5D70L 1UA6L 2AJ3B 1YPZB 2VDPL 3EYFA 1IAOB 2DWEB 5TH2A 4XTRC 3QJFB 4FQJH 2R1WB 5BV7C 1Z9OA 3S3SA 1KV3A 1OT2A 1I3UA 4LQFH 4UV4L 5FV2A 5M95B 1UZ6F 1OARL 4U1IB 1UB6B 4DAGL 3EBAA 2ZP0T 4R26H 4PREB 5IP4A 3MGOA 3PP3H 2P1YA 3LKSB 4R97C 1P2CA 3IRZA 1IAKB 4UIKL 4L8SB 2QSCH 1ND0B 4AH2B 5T5NF 3KPRD 1KC5H 2DQTH 5D96B 2H8PA 4PRHA 3VXUE 4I1NB 4GKSA 4KUCF 4OIIH 2O5YH 2NW2A 4E5XB 3ZKNC 3U4BH 3QUMH 4H20L 2WAHA 2BP3A 2OTWB 4QHLB 3MV8A 2J88L 1CI5A 4RX4A 1IKFL 2GEEA 2Q8BH 4G8GD 4G5ZL 1AGFB 5TE4L 1NUNB 4JE4B 5INDA 3VMPA 1NCWH 5HBBA 2AJUH 1INQA 1PYWB 3EDKA 3GSWA 4LEXH 4KTDH 1KXVC 2DIJA 1JGEB 4U6VH 3JUZA 2X1WL 5FHAL 4N9OB 3TBYB 3V6FB 4X4YA 3VFOB 1SMAA 5DJ6B 2HT3D 4ZAKA 4F33A 3HPLA 4K94C 4ZO8A 1DL7L 3FFCE 4AK1A 4HBCL 2DBLL 3MJ9L 4WHYH 4AT6A 5L9DL 1BFOB 1TVDA 3U6RA 2AK1L 2W0FA 3MCG1 4JFYA 2C5DC 4JRYE 5IUSA 4XCYA 1S7QB 1QEWB 3KPOA 5E8OA 3F7QA 3MPCA 1DDHA 3NIDE 1WTGT 3E3QC 2EDKA 5E5RB 2VMFA 4NRZA 1ZLSL 3U4AA 3KXFA 5I75C 1A6UL 1TVHA 1ZANH 5L7XH 5FDWA 5DJZB 2LE9A 4BQ9A 3F65A 3KYNB 3VXRA 2YPKB 1XCTB 5FCSH 2IANA 3X3GH 4ORGA 3A67H 3Q5OA 1OM3H 1RK1B 2D7OA 3F12B 3B9VA 3QIUC 5GGSA 1XF3B 5D1XC 1KN4L 4HDIA 4Y5XB 4XVTL 2W60B 2IFFH 3BYYA 2V9RA 3MCKA 1O5DT 5IV2B 5A2FA 3BT2L 1FFNA 1MCIA 3KPSE 2JJTA 1JWUB 4QTIH 1J5OH 1U95A 2W9DL 4YE4H 5C0RH 4GMTL 4KJYA 3BZEB 5E99L 3SDAB 1KB5H 2FHBA 3MJ8A 4K3JL 4BK4A 1T1YA 1J12A 3DXAA 3PJSB 5HHOD 4PJ7A 4XH2A 4PJHF 4Z7UA 1T21A 1C8PA 5I9QB 4YDIL 1A7QH 1INDL 5CZXD 1EBPA 3BP6A 2Z91A 4V1DE 4P9MH 2BK8A 1D6VH 4GQ9L 1G7IA 1R5WA 4DOHB 3VFPB 4YDKH 4WFEE 5GRYA 4ONGL 2A9NH 5DJ8A 3A6BL 2VZUA 3HC0B 2AP2A 3ZKXC 1K2DB 1KPUA 3ROOA 2FBOJ 2XA8H 4HC1H 3BUTA 1U2CA 1MCWW 3QCTH 1C7TA 3QDMA 3OAYK 4OTXH 2DLEA 1QKZH 2IPUG 3VXSE 3MLWL 2ILLA 1ZAGA 4Z78B 1F45A 2B1HL 3QUXB 2MCPL 2YSSA 3O4OB 1LK3L 2NLJA 4QOKA 1RZKL 1NAKH 5F7EL 5KW9L 5HTSA 2Z92A 1T2XA 3BWUC 5F88B 5JPNB 1JNHA 1NJ9A 1J8HB 2FBJH 1DUYA 1I3GL 2F53A 4WWID 3U2SB 1BD2D 3KLAA 2EYSA 3DIFA 4LPCA 4LSVH 3LKQA 2XACC 1SJHB 2HT3C 4PJIE 2CJUH 4EIZC 4RISL 4D0CA 1F3DJ 1IEBA 2BSSA 4PJGE 4XPAL 3FOLA 3OJMB 1BLNA 1I9JL 1VEPA 1P5UA 3D39A 3O4LE 4NCDA 4WW2A 1EFQA 3UYOD 2ZNXA 2GJJA 1EZVY 1Z9SA 2YEZA 1MAJA 2E3VA 4LHUD 3QH3B 2HAZA 5D5MA 1MEXH 2X05A 3OBAA 5B8CB 1UJ3C 5D2LB 4L3EE 3WNKA 3QUZB 4PJCE 4YHOL 3O11B 4G80A 1JJUA 3UTTE 2V9TA 4GRWH 4KVNL 4R90H 4HSQA 1QSFD 3GSUA 3RZCD 3MLXL 2IH3A 3ARQA 4LPVA 1CYGA 1U8MA 2W65A 2XPGB 5D1ZD 43CAA 3CVHL 4JDTH 3U4EB 1CFQB 4OCYH 1MFEL 3IF1B 4GRLB 5HYJA 3PGDB 5K9OB 4WEUD 1YEKH 3QJHA 5EOQL 1BAFL 4HJGB 3FO0H 5SWZA 5DGQA 1NC4D 3TYGH 5IB2A 3DTXA 5IBUG 1P4BL 3WFZA 5IG7A 4NKIL 1YC7A 4RAVB 4R2GB 2UV3A 1NFIA 2MNUA 5FUOL 1VFMA 4RMQA 1SBSL 4ZQKB 5F1NA 3HZKB 3V5HB 1M05B 5JPMA 5CZXC 5DD1H 3ZZ1A 3GI9L 4QHNA 1F3DH 1FBIL 5BOPA 1D5BB 4R0LB 4BKLB 5DTFA 5A2LH 3SE9H 3T0EE 3KLSA 4X4ME 5FDYA 3H9SE 1V7MH 3TT1L 4DVBB 5TFSL 5MI0C 3G5XA 4JPVH 1GOHA 4QRRB 2FR4A 3GJFK 1D5IH 3K2UL 2GITA 2P24A 3HPJA 1GC1C 1IL1B 4UDUA 2ATKB 5F71A 1RIVL 2CQVA 1JYVA 5D7JD 3I75B 4OZGB 4F3FA 4MA1B 4LLVB 1N5YL 4U1HA 3REWB 2HN7A 3ARDD 1PKOA 3EZJB 3QXDB 2P8LB 2UYLB 2DKUA 4ZFGL 3MC0A 3O3BA 1WC7A 5A3ID 4HK3N 2Y23A 4KKBD 1BIIB 3RX5A 3FMGL 1PFCA 4JREC 4YNYA 3MXVH 4ONHB 5BRZB 3N06B 5C0EB 2ADJB 1Q9LB 2VXSL 4YDLB 3GKWH 2MOVA 4TOYL 4HQQL 5IEHB 1ADQH 1N6QL 4XBEH 2R8SH 4GW1B 1B0RB 2N1KA 5ITBL 2YUWA 3CLEL 3GSNL 3AGVA 4KJPC 1W0WB 3O3DA 2F5BH 5SV3A 2JELH 4Y19E 2JB5H 4LLUB 5MHSE 1FNEB 4JM2D 1JYXA 4EVNB 3OB8A 4GJTB 4LKXA 2EXYD 4P57B 3RI5K 5I1HH 4JN2A 4H26B 4HJJL 5EZJA 3QIUA 3DX8A 1R3HA 2XG4A 1DQMH 3RZCC 3IDUA 3ILPB 4NDMB 4YHML 4Y4FD 1HXYA 1DBJH 3I6GB 5I6XB 4N90D 3IB4A 5D1ZC 5DRZA 4NQUA 1BQLH 1UEYA 1N0XH 3ECBB 2NXZD 5ALCL 5C0BA 4ZYKB 3L3DA 3VI4F 1DVFC 2NY2D 4OV6F 1MF2H 2ZJSL 3QDJD 5KVFL 3QQ4A 5H8DA 3D18B 2LU7A 4HZLA 4HIEA 5FB8B 3UTSB 1I8IA 3VFSA 2BHUA 4JFFB 3CCHB 1EJ6A 2V2TB 4XC3H 4QGYA 2J7LA 1K4CA 2Y1VA 3TESA 3GFUA 4DWHA 2M8XA 5KBNC 1AY1L 3O2VL 2VQUA 3BVNA 3B9DA 3TNNA 1MCOH 2V5TA 4HT1H 5HHNB 3U0TA 4RBPH 3FKUS 3PDGA 3UX9B 1N3NB 4Z7VE 5TE6H 2JKXA 3KPRA 3UYRH 3AU1B 3STLA 5C0CA 4RQQB 2F19H 4M00A 4QKXB 3U48A 4PS4H 2IFGA 4F2MB 5JW4R 3SDDD 3OB0K 1SM3L 4LKCA 3VG9B 2XN9A 5K9KA 1RAMA 3EYOA 5D7JC 2AQ1A 1H5BC 3PQYB 5JXAH 5JDSB 2W1NA 1FV1B 4MA3A 5CBEA 3VWJA 4X99B 2XZAH 5ILTH 4G8GA 5IOPA 4WV1C 4X98B 4N8CH 3KJ6L 3ARDC 4RAUB 3S5LB 2WP3O 2IADB 2ZUYA 4NP4H 3IFLH 1Q72H 2BOBB 2VRAA 5A3IC 4U1SB 4KKBC 4OSUH 4H88L 1FORH 1OGTA 4OLUL 2E5EA 5E5MB 5KTEL 4XX1G 4L5FL 4U1NA 1MHEB 4APQB 5AG9A 4HUVB 1D6EA 1MJJA 5DEGA 1VGKA 2AEPH 1YPZF 4CMHB 4AJ0A 5T1LD 2A83A 1F3JB 3D3VB 3KHQA 3VFWA 1JUFB 15C8L 3LMJL 1RJLB 1L0YA 4G7VH 2G5BB 1L7TH 3ZYZA 4RFOL 3F5WA 4ZNEA 4RZCB 1FCCA 1MREH 1HILA 4PJAB 2YD9A 1B2WL 2EXYC 3MRRB 2H2SD 2A73A 2COQA 2E9BA 5J12C 3ZMRA 4POZD 3I84A 3QQ9D 3RKPA 1P4IL 2VN7A 1T04A 4X9IA 4EBQL 3CSPA 4QHUB 5DHYA 4I48A 4UDTB 2NX5B 4Y4FC 4M62H 2ATPB 1CD1A 5ICZB 2X7LB 4D9QD 1F4HA 5DUPH 3VXPB 5F1OB 5T1KB 1R3JB 5FGSA 1QR4A 2GK0B 3W2DL 2NXZC 4ODHL 5J56B 5L2KE 5I8EB 2M1KA 1IM3A 3RY6C 2DBJA 2NY2C 4GAJH 1FE8L 1MIEL 3BPNC 1B0GA 2H26B 1S5IH 2NZ9D 1EA9C 4A6YA 4Y5YC 5DRNA 3DYPA 1BFTA 1HHJB 2N4IA 3MO1A 4GAGH 2QQQA 4BSVA 5JORA 3O2DA 3SCMB 1IJ9A 4WI7A 5HHOA 1CDHA 3OKEB 4RGNB 3GMLB 4X5LA 3D2UB 3O6KL 4PJDA 2J6EH 4GG6E 2A1WH 4R9HA 1H8OA 1N8ZB 3CX5J 4ZPVA 1RJYB 1UC6A 1TCMA 4N8VG 1PSKL 4DW2L 4Q6IC 4NQED 2OZ4A 4YHNB 5JUEH 4WHYG 4R3SA 5GISL 1EEUA 1UFUA 3QEQE 5DFTA 3C8KB 4X6FB 2VLRE 5A40E 3MODH 5IMLB 2OL3L 3GSQB 5FM5M 4LRNL 3FO9A 4M5YH 3U0WL 4KQ4L 1FVCA 2Z8SA 2FYYB 4XGZB 1S7VA 1EZVX 3JV5A 4Y8DC 2BY0A 2EIDA 1QFWH 1JGUL 1MHCA 3NFSL 1C1EH 1QOKA 4H1LG 4JQXC 3GSXB 5KSBE 3R1GH 3DURB 4PIRF 4KK9C 5DR5L 2VB5A 4F37K 4NO0B 3W82A 1BD2A 3PHOB 3CXDL 5CHNB 1KGCD 4CUCA 3QEGH 5D7IB 4G6ML 3CAFA 2YD4A 3BXNB 1KBGL 4OLXH 5TF1L 2VLJB 3CFDA 4KKNA 4MX7B 4LSPL 3VFMA 3S37L 2IPUK 3FO2A 2J8UF 3KDMB 2HG5A 3BQUB 1R0AH 4LHUA 5DHVB 2Q7NA 2CK0H 4K7PY 2CXGA 1PKQE 5GGTH 1OAUH 1E4KC 4FG6D 3WN5A 2AXFB 1F6AB 4L4TA 4BZ2H 4DTGL 4JHWH 5FKAA 5FK9A 2H2SC 4DZ8A 1QUNA 4AZ8A 2PYFB 3O6LH 1C5BH 4POZC 3QQ9C 4Q2ZA 1WCBA 3HE7B 2EDLA 2ZOLA 3PL6B 5FAAA 2ICWB 1QSFA 1RUAL 5GZOD 3RZCA 1JWSB 2X4QB 2CRMA 5T33L 3F7YB 1T1WA 5D1ZA 2J5LC 4PJEB 5F1SA 3D5OF 3RDTD 3VH8G 1JPSL 3IXTB 3OKKA 5FV1L 3ARBB 3D0LB 4MZ3A 5KSVB 2G60H 1G7PB 4BYHA 4WWKD 2OXGA 4XNMA 4F57H 2ZG3A 3HCVB 4ERSH 2H32A 1DVFA 4EI5D 2P46B 1EX0A 2NZ9C 1ZGLB 5GGRY 4RWYL 2DQJH 3TBSB 4PG9A 4PGDB 4NKMB 3QG6A 3IDYC 2XTJB 3LV3B 3S34L 5HDQH 1YECL 2Q7YB 3LQZB 2DICA 4YHZL 1G84A 2V17H 4OGYH 4OQTH 1KELL 2QR0A 3EYUL 4KK8D 3MV11 4NNXA 4MCYA 3FB8A 3KNBB 4PJ8A 2LAAA 3ARFD 1I1CA 1X6NA 1DBML 1JF1B 1EBAA 2HFFA 5CAYB 1P1ZA 3OKMA 2CKBH 3BKYH 3MRKA 4WEBH 2C3WA 4DKEL 4PTTA 4E9LA 1IEHA 1CN4A 2EC9U 4J6RL 1I7TA 1VB9A 2JCCF 2V7HA 2EYRB 4MXQC 1NAMA 2P8PB 5MERB 3SDXE 5CEXA 1H5BA 5D93C 2FLRT 2EEDA 3LRSA 2AV1A 3ILQD 4F7EA 2FATH 2Z31D 4PD4J 4X0KA 5JW3L 1LEIB 4WV1A 3Q6FB 4B0MM 4F9PC 5C8JB 3ARDA 1NFDA 1EHXA 3HA0A 4ZOAA 5EOTA 2AEQH 4FQIH 1WEJH 5HDBE 5DJCB 3OF6D 2W9EH 1I1YA 5IQ9B 2F74A 1X5YA 6FABL 1A3RL 3UP1A 1EFXB 5AWNH 2Z8RA 5J1AB 1A1NB 4AIOA 2B5IC 1A7OH 4FTVE 1J8HE 5I17B 4X4XA 3LEYL 4NJAL 3NZHH 35C8L 3SE3A 1L6XA 3Q6GL 2WWKT 3U9PL 4NZTH 1MWAB 3LQMA 4G9DB 4LLQA 3PF2A 4LCWA 1ZMYA 3MLVL 2OTPA 4G8FB 5CMAB 5CJBA 4OCXL 2VXTH 5FIEA 4TQEH 3VWKD 3JWDH 5L0QB 5GJTL 4LSTL 4O51A 4PP2A 1ZWIB 3W5NA 1A2YB 5CINL 4KQ3L 2BNQE 5GZOC 4UU9A 3ZE1F 2BOCA 1Q9KB 1EEYB 3VD7A 3ULVF 3O0RH 4PY7A 1A14H 2G2RB 4I2XE 3RDTC 2YMXH 3ZYOA 1S78D 1FNGA 4WWKC 3SQOH 1SEBA 25C8H 4JPKH 3NIFE 4OZGF 1SJEB 4NHCH 3H0TB 4C56A 4EI5C 3CZFA 5K9JL 4U2YA 3DUHA 4Y5YA 4U05A 3DSNA 3MRHB 5DD0H 2ADGB 1BZ9B 1FVDA 3ZT6A 1ZHNB 3BDYL 4JRXB 3NFNB 2OJEA 2C7UB 1UKQA 1Q8MA 1I9RL 5I1EH 1UB5A 3BEWB 4KK8C 4LGPB 5ECJE 5D8JL 3BEVA 3DVGB 4AEEA 1V3MA 2ZSVA 5IEKB 4JHAH 3F8UB 3QI9B 3IKCA 3ARFC 2DQFA 5LGHH 2ICES 3BSZH 3EYQC 3MUHL 2XY2A 4QY8A 1N2RA 4XBPB 4G6AC 4NO3A 5ENWB 1E4WL 2P5WD 3AAZA 1T2JA 5EU6E 4JY6B 4YHLH 1WISA 4X80L 1AQDB 2VZSA 1ORSA 3PWNB 5HGBB 3ILQC 1EEQA 2D9CA 3IGAA 2DAVA 4JAMB 4WFFD 2Z31C 4CADA 5HVHB 3AS0A 5GGRB 4HWEH 4NQDD 1MCDA 4F58H 4OCRH 4D3CL 3T1WA 3DMMD 4JQXA 1F5WA 4I0PD 3SY0A 3OKLA 1EHLL 4H5SB 3T4YA 4BQ6A 3I3BA 4R8WL 2BERA 5IFJB 3VXNA 2X4NB 3JVGC 5ICXA 3UJIL 2ZCHL 4X6EA 1MLCB 4IM8A 5ID0A 3PV6B 1ZEAH 1VADA 3FB6B 5GGUA 3DX6A 1SY6H 1JRHL 5DJ2A 2YPVH 4AQOA 1X7QA 3DV4A 3DVNB 1RJZB 3OAZH 1E4KA 2D7QA 1CG9B 4OT1L 5HGDA 4JPIB 5JMOC 3VGDA 2R69L 3NA4A 2F15A 1AE6H 3VWKC 3VE0A 5E2UL 5FOJA 1NDMA 5GGSY 4FN0A 2R2HA 1KOAA 4NUGH 4XPFH 3DYOA 2A38A 4HW6A 4M43H 3VFTB 4MD5B 3HUJB 3B5HA 3VRIB 4EDXA 4MMXC 1S78C 4TULL 1J1OL 2Y7QA 2AXGA 3BRFA 4ODTH 5J7CC 2D9QB 2ORBL 4O2CB 1Q0XH 2X9YA 1ZLWH 4HWBL 2IMMA 3TVMD 4JY4A 3VRLE 1MNUL 4PRPD 3WKML 3VFGH 2IGFH 4P49A 3X11A 1QNZH 1HYSD 4Y4HB 3QFDA 3PHSA 3G6JF 3WIIL 3EJYD 3HZYA 5DJYA 1F11B 2G5RA 3MRIB 2BJML 4ONFH 3UBXG 3OJDB 1Z0NA 3MLPA 3NPZB 5KN5A 5DUBA 3UTSE 4M6NH 5LCVL 2X4UA 2WBJB 5IB5B 4NQEA 1HIMH 2D7PA 2MQCA 2OMNA 4DGYH 1IGIL 2Q86A 3TJEL 4LAQH 4WUUD 2LU3A 4M93C 4XPTL 1EMTL 2CR6A 4IS6B 1C5DA 3DWTA 3I02A 2OTUA 2WBWB 3BZ4A 1HI6A 2V7NA 4FQXA 2JIXD 2ZNWA 5IMKB 1DLHA 2DQGL 1BWWA 1KIRA 2BVQB 4K7PX 1CFTA 1QFWM 4R96A 1X9QA 4WHTB 4HF5H 4WI4A 4P2QD 3EYFB 4ZOEA 3L6FB 2PUQT 3X14A 2HYMA 3LD8C 2HRPH 4YBHA 2WUCL 3NMEA 4K8RH 2NY1C 5J06A 2ZUQB 3V5DA 12E8H 3ULUE 3DLQR 3MGOB 1DQQA 3OPZH 1LP9F 5ESAA 3DX7A 1P2CB 5KJRL 4YDJA 3HS0A 4WJ5A 5AAMA 2Q76A 4MNGE 1A9EB 2FRGP 4JY5L 3V95A 2H8PB 1KCKA 3WIHL 5SWSD 1E28A 1FO0L 3TPUA 2BSRB 1CT8B 1CFNA 2E7HA 4GKSB 3JV6B 2NW2B 4NBYB 3MV8B 4I18A 2FO1A 2DMBA 4ELKA 2BCKA 3ISWA 3KPMA 2GY5A 2VH5H 3MRNA 5MEQA 2XKUA 5INDB 4EOWH 4HCRA 5JIHA 4KWUA 5C7XH 3KLHD 4OZIA 1KYOJ 4JZOA 5GGQL 5FM8A 3RDTA 1QBAA 4X4YB 3MRQA 4CAGA 4WWKA 2JJSC 2NX5E 1EERB 4LNVA 3CUPA 4ZAKB 4F33B 3HPLB 4UB0L 5E4IA 3TVMC 5LXGH 2Q8AL 2QHLA 5ETUB 3S36H 4AT6B 1T0NA 4JJ5A 1JFQL 5C1MB 3JZ7A 1N4XH 4GG8A 4MHHI 4L8BB 4JFYB 5I74B 4N0CD 1DBKH 1HOCA 4XCYB 3KPOB 5E8OB 3S4SG 3EJYC 4JO3L 3SEPA 3TO4B 1KUMA 1RQ5A 4NRZB 1BVZA 1VKXA 1TVHB 1LDPL 2ZPKL 5FDWB 1W72L 4OCSH 4YPGA 5GGVY 1MH5B 3SHSA 3OZ9L 4XP9H 5FUCC 2IANB 3ARFA 1CICD 4ORGB 3MGTA 3T2OA 5KAQG 2O93L 5I1LA 4WFGD 5GGSB 2HJLA 2NY7L 3VJ6B 1CLZL 3B5TA 4AMKL 3V4VL 4HDIB 1BQHA 4JM2F 4UTBH 4L9LA 4XXDA 1VHPA 3MCKB 1T20A 1KENH 4IJ3C 4XP5L 4LU5H 2EEBA 3V4PL 1BQSA 4URTB 1U95B 5INCA 3KYOA 4KJYB 2Z31A 3KJ4B 4GSDL 4FFYL 4YBQD 4Y4KA 3RGVB 1WBXB 5FHBH 1ZHLA 3DXAB 5IW6A 1JMZA 4WU5A 4Z7UB 5E56A 4GOSA 1T21B 1V7NL 4YHKL 2UZIL 2X1OA 2L7JA 3RWGA 1HNFA 4XNUL 1FC1A 1PBYA 2XT1B 1I85C 4UTAL 4K3DL 3AFLA 3WFEL 4Y5VB 1ZOXA 5JW5A 1G7IB 1R5WB 4OD1L 4UILL 4OKVA 1RZIA 1MI5D 1GGIL 1OQOA 5FFLA 2DJ4A 4AG4H 1L9NA 5DJ8B 1MPAL 3SKMA 3IJHB 3LN4A 5D7IE 1LO5B 5EA0H 4NQXA 1D7FA 1KPUB 3ROOB 4W4OC 3LPWA 5F7HA 1AD9A 3RRQA 3GMPB 4XNQA 3H42L 4ZUUA 3DSFL 3T04D 3H9HB 4KY1L 2GIYA 3C08L 2C3GA 2YSSB 1FRGH 1XGRA 1WJ3A 4QOKB 1JHLH 2Z92B 3KLHC 1IQWH 2EE9A 2EDHA 1YQ2A 4FQLH 3P11L 1JNHB 1NJ9B 1CU4L 3LQAC 3F6LA 1DUYB 3QFJD 4P2CG 5MENE 1FZMA 3KLAB 2FEEL 4KZDH 2J8OA 1J0HA 3LKQB 3U4BL 1F4XH 1R3IH 3MV9D 5IK3A 1PX4A 1W2KT 2RGSA 1IEBB 1B88A 4G42A 4D0CB 3W0WD 2Q8BL 3T2NH 1YMME 5IVXB 3RBGA 3ZE0F 1BLNB 4O58L 5JQ6L 1OF2A 3D39B 4K71C 3IDJB 4WW2B 4NYLA 4N0CC 5FYKH 1QPXA 2AJUL 2YEZB 4WTZG 3PDOA 5GS0D 1QRNE 2VLKE 2E9IA 4NKOA 1KLFA 1TCRB 2V5YA 4WDIA 2XTJE 3ARWA 3PXHA 1NCDH 1U8HA 1Q9OA 4G80B 1CICC 5EPMA 1MJ8L 2FCBA 3GSUB 5JMRA 1U8MB 2W65B 2FEDD 2Y25A 4QT5A 43CAB 3VGGA 1TQCB 1Z3GL 5J0BA 3MA7A 5HYJB 1DBAH 4RRPG 3QJHB 4WTXA 3FT3A 3BKCL 5I30L 4Z18A 3EJZD 1YYLH 2RAMA 5SWZB 3BRDA 1TJGL 4ZFOA 5IB2B 3DTXB 3BHBA 1ZT1B 3A67L 5FOBA 5IG7B 4YBQC 3SGJA 2EDRA 3FONB 3WSQL 3QDGA 5F89A 1S7TA 1NFIB 5EN2A 5F8RC 5B4MD 1HXMA 1E6JL 3MNZB 3ES6A 5F9OL 2DTSA 5JPMB 1CXLA 3OWEA 4RFEB 1CLYH 5F3HA 3DBXB 4QHNB 5IB4A 4G6KL 2RQ8A 5DTFB 3TA3B 2QQKH 3CK0L 5EIIA 3GRWL 3MXWL 3RTQA 5FA3A 1YNLH 3H3PL 4NN7B 3SPVA 1BEYH 2FR4B 3W9DA 4QRUA 5BVPL 1R3KA 1WT5C 4YFDB 1LE5A 1D5ZA 2GITB 2P24B 3HPJB 4TSBH 2CO6B 4V2BA 1BOYA 5T3XD 2Z8VC 4UDUB 4JFOA 2X6MA 5T5NG 3HAEG 2V2WA 3T0BA 2OJZL 1U2HA 3CFEA 4F3FB 4YDKL 1I4FB 4U1HB 1FG2A 5E8EA 3EGSB 1UCBH 4C59B 3D85D 3JWOH 4M3JA 1EAPA 3O3BB 4FFWD 1WC7B 3WHXB 3SKJL 1RZJH 3UTQA 3QWRD 2JJSA 2YHGA 5I1IL 4FNLL 4W6YB 2KL6A 1SYVA 2DLFL 2GSGA 2RCSL 4RMRA 5BS0D 5C0FA 2P8MA 2HTLD 4PJHE 4PRPA 3WDHA 1AR1D 4K9EC 3O3DB 2FHFA 3QHFH 4KI5E 3RWDA 3TWCH 5GS0C 3EO9L 5C9KA 2W91A 4FQ1H 1CDJA 2V6HA 3RIAK 2YKLH 4PJFF 2CLZB 4LKXB 4N0UA 4JDZA 3O8XD 1F42A 2VDMH 4JN2B 4NM8L 4F7TA 4Q9RL 4PJBE 1IARB 1J1PH 3H3BC 5EZJB 3X12A 3QIUB 3DX8B 1R3HB 3E1F1 4MLSA 2ESVD 4N1HB 1HXYB 2X4TA 2FJFA 4N1CA 2A9MH 1UACH 3WBDA 1LQSR 2GTWA 3VI3F 4LVEA 5IWLA 4BQBA 4P9HC 3U83A 3OKYA 5E8NA 5C0BB 2JIXA 1XR9A 3MJ7A 3EJZC 3L3DB 4YK4B 3MUJA 4I8DA 3B9KD 5K9QG 4HS3A 3B83A 3QQ4B 5C71A 4R90L 2J4WH 4P2QA 4HZLB 4HIEB 3SN6N 2HRLA 2ICEA 4DEPC 3VFSB 5B4MC 1GGTA 3L3IA 5GSVB 3FAWA 4JDTL 4JHZA 5K59F 5D4QA 2HKFH 2E27L 3WUWG 1K4CB 2VNCA 1OW0C 2FWOA 3RX7A 4MJ6A 1TIUA 5IJKC 4XCCL 1GIGL 1QHPA 1XCQA 5E8DH 1QBLL 3BVNB 1IM9A 1PG7X 4ORZC 1I85A 4B50A 2AERT 3U0TB 2PTVA 3OKNA 3I2CL 4JKLA 4JFEB 5F6HI 3S35X 5LG1A 3EDDA 3U7AA 4JZNB 3B3IA 4XZUA 5JW4Q 3KPRB 4BM7A 3FZUD 2AJSL 5C0CB 3STLB 5SWSA 4BUHA 3RPKA 4FQ2H 5T1DH 4PB0L 1WWAX 1WFUA 4LKCB 2XN9B 3P9WB 1GGBL 5CBEB 4MA3B 3O2WL 3VWJB 1C5CH 5CILL 4G8GB 4DQOH 5IOPB 4LDOB 5IW1B 1CGTA 3QZWA 3V2AR 5FA4A 4WFHE 4X5WA 1S9VA 3LH2H 1QD0A 5FGBC 3MTRA 4HUNB 2CD0A 3QG7L 3HUJE 3QR2A 4U1NB 4JCMA 1OWWA 1D6EB 5DEGB 4LSRH 1VGKB 4V1DA 4KV5E 1DUZA 1ZTXH 4ODVL 3P4MA 2A83B 5IHZB 4KTYA 4L29A 2WK2A 2ARJA 2GW5A 3L5HA 2DTMH 3BIKA 1LE9B 4PRAB 2F54B 1HILB 5JHDD 4GKZA 4OKDA 4NJ9H 3O8XC 2NNAA 2A73B 4DN3L 3MA9H 1T04B 2AJZA 3U9UA 1TMCB 3FFDA 5DHYB 4I48B 4KDTC 2HWZL 4M6AA 1CD1B 2CMRH 3ELAT 2JELL 2RJMA 3T3ME 2Q87A 1IC1A 1YEEH 4Z7OF 3QNZB 2F9BT 3NVQA 4G7YL 1TZHA 1U3ZA 1IM3B 1TFHA 1LNUA 4EN3B 5I1HL 1RUKH 1B0GB 1AO7E 1PAMA 4LF3A 1X5LA 2NTFB 4A6YB 4PJIA 5DRNB 3LRHA 2OQJA 4QRPD 3NCJH 3QDHA 2FECI 1S9WB 1HKFA 3LSOA 3MO1B 4XCFH 4GT7A 1HKLH 3AMKA 1VGEH 4BSVB 4DUXA 4B7IA 4MCZA 4IRJD 2A6JB 5CEYA 1RULL 4NC1C 5GSRA 4PJDB 4JZJC 3FQWB 2I5YL 4ELMA 1JZ4A 5LQBL 4LARH 3U0PA 4MJID 4NQSB 5I18L 4ZPVB 3WV0A 1U3HD 1T7VA 4YO0B 1S5HA 1WAAF 4PJCA 2WWKO 3EJJX 2IG2L 5MI0B 4R3SB 3CZJA 3FZUC 1OAQH 2YA0A 5B3JF 2P5ED 4AIXA 3HMWH 3TC9A 5HYEA 3PWPD 5C0AD 3ULVH 4NO5A 4LL9A 1RUPH 3V8OA 1B4JH 5C07E 2Y36L 3S98A 2GUOA 3FO9B 1UWEH 2VERN 1FVCB 4FFZL 4M7LT 1S7VB 4PRHE 1F8TL 2YPLD 4XNZC 1X5ZA 1A64A 1GZPB 1W8OA 1QLRB 2DD8L 1MHCB 3UYRL 3KVQA 4ODWB 2F19L 2AS5M 4MQTB 3VI4E 5I1GH 3UJTH 3QFJA 5IF0B 3P0VH 3KPQA 1BD2B 1INEL 4M5ZH 3OAUH 3RZWA 5DQJA 3WLWD 3MRPB 3MV9A 4RA3A 1AI1L 2VZ1A 4U1MA 4XP4H 5DMIH 1X4XA 1QFHA 5E6ID 5HGAA 3CFDB 2DYPD 3V4UH 4KJWD 3FO2B 3H9SA 2HG5B 4LHUB 4DZBA 5AZEL 2XZCH 5DZNA 2VDLH 4MGXA 3WN5B 3PE9A 5FYKE 4L4TB 5J9PA 5FKAB 5FK9B 3SDYL 1FFPB 1RZKC 5BQ7B 4GXUM 4Q2ZB 1WCBB 2ZOLB 3RPIB 1ORQA 3BJLA 3ZDXE 1TPXC 3KXFE 2Z0BA 4EUPG 3RZCB 1KJ2H 3BN3B 2X44D 5I1KH 1IT9H 4MA7L 5EZLA 1T1WB 2WLZA 3VXRE 2DQCL 2AI0H 3I6LE 4MDJA 3RUGF 2IANE 3DX9B 3OKKB 4G7VL 4Y0GA 1QG3A 4XNMB 4XPGH 2E9WA 2VDKH 1JP5A 2VXUL 1DVFB 1SHMA 4XXCC 2VDQH 1IAII 4PG9B 1JI2A 1FCGA 4M62L 4LLAA 3CMGA 3QG6B 2R29L 4HFUH 4NCC1 1BOGA 3T4AA 4IRJC 3VGHA 4PTUA 3E8UH 3SGKC 1OW0A 4Y19A 4PJ5D 5C09D 4OLZH 2QR0B 3DXAE 4NNXB 3MRGA 5B21A 4OIAA 4MCYB 5IVXF 4PJ7E 4PJ8B 4Z7UE 5CUSH 3RWJA 1FGNH 5HYFA 1UXSA 4Z76A 4LVHB 2HFFB 1P1ZB 3MRKB 1FAKT 4UV7L 4RGMC 4U6HA 3STBA 3NPSC 5D7LA 1U58A 4LSUL 1I7TB 3RGHA 2V7HB 1FP5A 1HQRA 5DD3L 3WXVL 1RK0A 1JV5A 1NAMB 4TSCH 2PCPA 3VXMB 5CEXB 2OCFD 2AV1B 4X6DF 4F7EB 1UQSA 1XFPA 3B8SA 4X0KB 3C2AH 3DROA 4WV1B 2PO6D 3G5YA 3QDME 2ZSWA 5HDOA 3ARDB 1NFDB 2NY0D 2AK4E 2ZUUA 5EOTB 4QWWD 4P5TA 1K5NA 3VFNA 3DGGB 1M71A 4JFHD 3MODL 3QUKA 3BKJH 3WO3B 1I1YB 2PYEE 5C9JA 1RVFH 2F74B 4MNHA 3E0GA 4IDJL 4RA0C 5ANME 3WLWC 3CVIH 3H9YA 3HI6H 4NO2B 3GSOA 1A22B 2YD8A 1HH6A 2F53E 1IEAA 1ACZA 2YD3A 4F37F 4Z7VA 4LLQB 4LCWB 3ULUL 1T5WA 1U8LA 2QEJA 3WXWH 3OR7B 3IU3A 1U8KA 5D5ME 3O8XA 1H3TA 2D03H 4Z7NF 5J12B 3P4NB 4OCLC 4HH9A 4PP2B 1VFAB 1JWMB 4UU9B 3HRPA 2BOCB 4KDTA 4HG4K 4LPUA 2ESVA 1AFVL 5E00A 4P3CH 4PY7B 3VFUA 3P2TA 3QUMA 3C6SA 1ZVSB 3TBTA 1EHAA 1AIFA 3CMOH 4PYHA 3BOVA 3LPGA 2NXZB 1FNGB 4YDVB 1HINH 2WANA 2DS4A 1SEBB 4RFNB 4JQIH 3V7AE 2XWTB 1MFAH 4C56B 3CZFB 4IHOB 3EFFA 1MQKH 4NZUL 4NKDA 2H32H 3BPNB 4Y5YB 3SOBH 5ACMA 2NZIA 2ZCLH 5CJXC 1JGVH 1H8NA 5HYJE 5DEZA 1OTSD 1N26A 5SWZE 2OJEB 3SKNA 4N8VA 2VLME 1TTUA 3E6FA 2R1YA 1I9IH 2XFXA 4JZJA 1UB5B 3IDXH 2BXZA 5DUML 5JHLH 3BEVB 2J8UE 4JKWA 3IKCB 3WFDH 5M94B 1F4AA 2DQFB 3CVHB 4WU7A 4LRIC 4QY8B 5DURD 5DK2A 1K8DB 4NO3B 1J1XL 4I3SH 4XAKD 3HMXH 5HDQL 2R15A 1HE7A 4MB3A 3V0AC 1QR1A 1G9NH 3MUGA 1U93A 4Q97A 1ORSB 4JCLA 4ODUA 4OI7A 3LDBC 4LSQL 4M48L 1DQJA 3IGAB 1G0YR 3C5SA 5HHMD 3QRGH 4CADB 2PO6C 1U8JA 5EBWA 5F97E 1JVKA 3PGFH 2NY0C 4ZTOH 4EIGB 4RNRA 5K93A 1G6RH 4OLYL 4QWWC 1EO8L 2NMSA 2R0LH 4M4RA 2FX7H 3SDCD 4H0IA 3SY0B 3OKLB 1QSVA 4LASL 2EH8L 5FUZH 3T4YB 1FIEA 3ARUA 4D0BA 4YWGL 5IFHH 4PUBH 1KB5A 1J0KA 5IHUL 4QRQA 3VXNB 3WS6C 5ICXB 3VU2A 1G9MC 2FX8L 2PNDA 4X6EB 2YD5A 2VR5A 5ID0B 4XC1H 5I1DA 1VADB 1DANT 4O5LL 1BJ8A 5GGUB 4MXVE 3DX6B 3UC0L 5FECA 5DJ2B 2X4PA 2AEQL 1MLBA 1QRKA 1F58L 1X7QB 1IZKA 5CCKH 4ZOCA 3QPQD 3QEQA 3N9GH 5HGDB 3KYMA 5C0IA 2VLRA 1MY5A 1VFUA 4K7FA 5JHDA 4UAOC 3QHZH 3F7RA 5AWNL 2BHYA 4JG0L 5KS9F 3VE0B 3IFNL 1NDMB 2R2HB 4S1RH 3IJYA 4HC1A 3E3QE 1MFDL 3SGDI 3C5ZB 3V5KA 1KLGA 1CVSC 3OG6B 4RMUA 5E03A 3RNKA 1DFBH 4EDXB 2PR4H 5BMFL 3NA9L 3L5WB 5SX5H 2Y7QB 2AXGB 5KSBA 1B4RA 4TPRH 5IBTH 5EZOL 4Y2DD 4TQEL 1P9MC 1ACYL 1P4LA 4CN6A 3HE6B 4XXCA 2PXYB 2GAZA 5ADOH 1A21A 5GRWA 5C0BE 3X11B 1OTSC 5J6HA 3IDYB 1KPRA 3MLSH 3QFDB 4FABH 4IRJA 2YMXL 3NAAH 3HZYB 5DJYB 3SGKA 1EAJA 3JUYA 4X9BA 1NLDH 3F58L 2VLLA 3OR6B 3Q1SH 2X4UB 3VD9A 3NCFB 1KIQA 4NQEB 2WQ8A 5DJAA 3S8WA 3W11D 3OX8A 4Y16D 5F6HJ 2Q86B 5ELIA 1GOGA 4F7MA 1AHWC 1GHFL 3IJSA 4S2SA 3DUUB 2DIBA 4Q0XL 3V6BR 5EUKA 1C5DB 3I02B 4HH8A 2OTUB 3BZ4B 2UZYB 2V7NB 3KPRE 2C4FU 1AXSA 3L3OB 4FQXB 4JO2L 1DLHB 1KIRB 4LCIH 2H2PD 3OJ2C 1JPGA 3MLUL 5IROC 4XPHH 5I19H 1CFTB 2AVGA 4R96B 1RV6X 3BSZL 4AL8L 1MCPH 1NGXA 5KVGH 2CR3A 2DL2A 3X14B 3MBED 3SDCC 1XF2A 1P7KA 2Z4QA 2O5ZH 4JFDD 2BVPB 3MLYL 4G8GE 4HS6A 2NY4D 2WSKA 2OK0L 4GG6F 3HC4H 3EFDH 3ZTNL 4UINL 4F8TA 3V5DB 1T5XA 1DQQB 2B5IB 2DQEL 4KFZC 3FQUA 1NMAH 3DX7B 5ESAB 4HIXL 4YDJB 2DYPA 1FFOA 5B39A 1OL0A 5LGKA 3ZDZF 1E28B 3TPUB 4Q9QH 4AEHL 1GPOL 3GJEB 3HLAA 3CH1A 1WF5A 3BYTA 3U7YL 2IBZY 4I18B 4ELKB 1NGQH 3SE8L 2ZCKH 2BCKB 4JO1L 3KPMB 1KCUL 4FQCH 4CNIA 1J9CT 1G1YA 1IZJA 2IAMD 2ZG2A 5EU3A 4ZNEE 2Z35B 3MRNB 5MEQB 1P7QD 1W0YT 5DJ0A 3TBWA 4OZIB 1AGCA 4TRPH 2E6PA 5I8KH 3IETA 4JZOB 1ZA6A 1QP1A 3K4AA 1MWAL 2BRRL 4IOFD 4X7CC 1TTFA 5GRZA 4WWKB 2D4DA 1KXTB 4Y2DC 2CDGA 3CUPB 3WMSA 3AREA 3DRTA 3RWIA 5HVWA 2VXVH 3VGAB 1OSZA 4TN9A 1ZE3C 1T0NB 4OGZA 3T8XA 3GBMH 3LKRA 4M1DL 5CJXA 4GG8B 4UT9H 3NABH 1YEFH 2NY5C 4WO4C 1HOCB 1O7SA 5TDOA 2OSLA 4JM4H 4LGSB 2VDOH 2CO7B 1AC6A 1ADQA 1CXFA 3CFCL 3MBXH 4G3YL 5EG6C 5H37G 3ROLA 1VKXB 4K7PH 4XCEB 5C09A 1DEEA 4YPGB 2VE6A 1K6QL 5HHOE 1RIHL 3ZHDA 2L0DA 3ARFB 4JG1H 3MGTB 1XR8A 2ENYA 4PJDE 2HT2C 5I1LB 2HJLB 4LRIA 3W11C 4Y16C 3FHAA 1A0QL 5F9DC 2B7DT 2ZUSA 2BNQA 4NN6B 3L3HA 3GUTA 1BQHB 1WLHA 4I3GA 4L9LB 2LTQC 1IAMA 5DJDA 4ONFL 2ZUXA 4I2XA 3OAYH 3WS3A 1T20B 3CIQA 1CF8L 4HXAH 3PWUB 2H6PA 2H2PC 2F8VA 2DMCA 3KYOB 3H9ZA 4LEOA 2Z31B 4LMQI 3M8OL 4Y4KB 5D1QD 4A2LA 2ADIA 1ZHLB 5IW6B 1IGJA 4QXUL 3MBEC 4M7JL 1MIMH 3ZYIA 4WU5B 3KPNB 2NY4C 1JE6A 3JXAA 3C8DA 1FZKA 5IR1A 2B4CH 1AXTL 3CPLA 3WS6A 1GCFA 1RZFH 4XP6H 1CBVH 4YXHH 5JW5B 4LBEA 4OKVB 1RZIB 4I9WD 1K3ZA 1BD2E 3G6JE 3QNXA 4K23L 5CP3A 5KVEH 3SKMB 2HLFD 3V0VA 2GT9A 3LN4B 5CGTA 4L8DA 2UWEA 4IRSA 2FO4B 4KUCD 4AEIL 3KWWA 1AD9B 4XNQB 3MLZL 4ZUUB 2EDNA 3GK8H 3VG0H 5I2IA 5DVNA 4PJ9D 1XGRB 5E08H 2IAMC 3BP7A 1IFHH 3TH4T 1NCCL 5E2WH 5EORH 2WUBH 1FH5L 2MHAA 4OB5H 4ZS7L 4MAUH 1HHGA 5D72L 1FZMB 2GJZA 4IOFC 1P5VA 1QLEH 1QSFE 3I50H 1KJVA 4DGIH 1P9MA 4HUUA 4B41A 4GUPA 3N85L 4OFPA 1X4YA 4YHIA 5JR1H 4U1JA 1MHPH 1NEZA 4E41D 2ZZUT 2YXMA 4NYLB 4BJLA 3GM8A 4M7LL 4WFED 4HV8A 5EZIH 4AENA 3PDOB 1A5FL 1AKJD 3TO2A 3NFPA 3RAJH 3S5LG 4HWNA 3RA7H 2R56H 3ZSTA 3MLTB 4WDIB 1U8HB 4HBQA 3T0WA 2APXA 1Q9OB 4Y8AA 3GO1H 5EPMB 4HGWA 4HPOH 5DA0B 2D7TH 4XMKL 3O3AA 4MD4A 4CKVX 4BQ8A 4I77L 2M2DA 3GJFH 4QT5B 5DD5H 5K33A 1AHWA 3OGCA 3QXWA 3EHBD 3TIDA 4ZXBD 1UG9A 1IGTB 5J13C 3MA7B 1UWGL 1PQZA 2H1PH 1AQKH 3FT3B 4XCNA 3O6FD 2X41A 1CDUA 3MNWA 4ZFOB 5HHQA 1EH9A 1FNFA 3BHBB 5FOBB 5DC0A 4X6CA 5D1QC 3K1KC 1E4JA 3QDGB 4G9FD 5F89B 1KJ3H 5EN2B 4ZUTA 1HXMB 4H8WL 2VQ1B 1FC2D 1TJIL 3P0YL 1RMFH 3O4LD 5C92A 5D7SH 3SDCA 3ES6B 1WZ1L 3LD8B 3TYFA 5F3HB 1NFDE 4AEFA 5IB4B 2NY1B 4Z77B 4MZ2A 1TVBA 4GQPH 5EIIB 3JBG7 1JNLH 3ARTA 3RTQB 2BY2A 2FGZA 5DK3A 1IAIH 2GTZA 2HLFC 5FA3B 3SPVB 1UEMA 2J6EA 5I66A 4QRUB 1R3KB 1D5ZB 2P45B 3T77A 4JFOB 2N7BA 2V2WB 5MEOA 1DBBL 5D71H 1BVLA 4YZFF 4PJ9C 4P5KA 3CFEB 5BXFA 3AB0B 4KK6D 2QQNL 3TV3L 2PF6A 2R9HC 3MSPA 4TUOA 5E8EB 1JNNL 4NOFA 3SJVD 4FOMA 3RL2A 4TUKH 1PY9A 1JHKL 1EAPB 4POYA 5E70A 3VMOA 4C54A 3THML 3UTQB 1EJOL 4PFEA 1TNNA 1NCBL 1OAKH 3BJ91 4N90E 1TZIA 3S4SA 1FRGL 1SYVB 4LHJB 2GSGB 3O41A 2P8MB 4PBWD 1UZ8A 3TN0C 1GSMA 2XQBH 4WO4A 4X6BA 2XNAB 2C9AA 5I1JH 4K8RD 3S3JA 4ESKA 1EIBA 3O6ML 3QDJE 3RWDB 4MNGA 2DI7A 2XZQH 2GJ6D 2MMXA 3VXUB 4N0UB 4JDZB 4XVJL 1T7WA 5D6DC 4F7TB 1LO3H 2CIKA 3L95A 4K3EH 3P73B 2NTSP 3X12B 5GGTA 1DSFH 5EWIL 5E24E 4M6MH 4W81A 1NMCC 2X09A 3S37X 1F6FB 2GTWB 3EHBC 2B0SL 4XVSH 4ZXBC 1YNTA 2R0WL 1S3KL 1CL7L 2P4AB 3OB0H 4K3GA 3O6FC 1XR9B 3MJ7B 2CSPA 3UDWC 4IJ3B 3CDGA 4UNVA 4HS3B 4G8EA 5JTWA 1NMBH 5C6TL 2HKHL 3RU8L 2OR9H 4O02H 4QHKI 2ICEB 2DQIL 5ISZD 3LKOA 3UTPD 3L3IB 3MBEA 2IBZX 1QLFA 4LVNC 2FWOB 4GH7B 4MJ6B 3BO8B 1IGMH 1XCQB 5MP6H 1HHIA 1IM9B 1UXWB 5FYLL 1BX2A 1WIUA 3G5ZA 2VXQH 3LB6D 2EE2A 3OKNB 4MJ4A 1MHHA 3DV6A 1FFRA 4MNQD 2QHRL 5BCAA 4IBLT 3B3IB 4GRMA 1YJDL 1E6OH 4OQTA 5SWSB 1UVQA 5DWUH 1DR9A 1HHKB 2VAJA 4NM4H 4HGMA 4Z8FH 4P2OA 5D7KD 1MRDL 1BF8A 3QUYA 3O9WC 2FH8A 1CLYL 3CD4A 1IBGH 1NL0H 3EW3B 2MKLC 1QSED 2CKBA 4PV9A 1IQDA 3FAXA 3IDIA 4KK6C 3VXTA 3K81A 3N1PC 3BZFA 3P77B 1KG0A 3T2PA 3MRBA 4GBXD 3FQNB 4Z7WA 3X3FH 4Y1AD 1NBVL 1NPUA 4UT7H 3QZWB 5FA4B 1CK0L 4X5WB 1S9VB 5IQ7L 3HNTH 1GZQA 4OD2A 5CS7A 2HJKB 1LEGA 1OTUD 3C09B 4WTZA 3TP4A 3EYVA 3T08A 5HPOA 4U1GC 1F4YL 1SVZA 2EDEA 4K2UL 3V9FA 2ITDA 2GSIA 4M03A 4P23D 1IE5A 1QVOA 3ARGD 4V1DB 1T83C 1DUZB 3R06A 1BIHA 5IVNA 1BFSA 5DJXA 1UCBL 3P4MB 2B1AL 3QIBB 4K8RC 4L29B 2FD6L 1HSAA 4YHYC 2ARJB 4F8QA 4H0GA 4UNTA 2O5XL 3DYMA 4LLYA 3BIKB 2X4OA 3MRCA 4M7KH 3J8F7 1VSCA 2NNAB 4XNYH 2YWYA 1DN0A 3VXSB 2AJZB 3U9UB 4J3SA 1LVEA 4FXKB 1WBZA 2FGWH 3HI5H 1RZ8A 1CFSB 4R7DB 3GMNA 2BNRD 5FYJL 1PG7H 5BO1L 3RIAF 5I71C 3Q0HA 2MQ3A 4NQEE 4XMLL 1X6LA 2EDWA 3G6DH 4JN1H 3S35H 1TZHB 2R0ZL 5MENA 4ZMAT 3H3KA 3GNMH 3BE1H 2VDML 3SKOB 4PJIB 3KYKH 4ALAL 2OQJB 4FP8H 4L9DA 5C6WH 3VW3H 5D1QA 3L9RA 3BKML 2EO1A 4TUJA 3LSOB 4TSAH 1JGLH 4QYOA 4ZUWA 3P30L 4MCZB 5CEYB 2X5PA 1D5XB 5CIPH 1G6VK 5GSRB 1C7SA 4NHUA 3MACH 2ERJC 1L7IH 1TJHH 4CW1A 1QRNA 2VLKA 3C60C 4HIIA 3LB6C 4MSWA 2BVOA 2K3TA 3U0PB 3BD5A 5EUOF 5JDJA 3BP5A 4KJQC 4L3EB 4YR6A 5SWQA 1SYSA 1S5HB 5GGVH 4PJCB 5E2VL 1OP5K 3FTGA 4OF5A 1KGCE 4QXGL 1N0LA 4AIZA 1DE4A 1OP3K 4U1LA 4JKPL 5B3NA 4HS8H 3WFCL 5HHXL 2HKFL 4NO5B 5BV7L 5GS2D 2GUOB 2W38A 2VN4A 5CWSA 4KKAD 3I3DA 1FYTD 1JPTH 4QXTA 5DT1H 5ABDE 4P2RD 4PJ9A 3NGBC 3RWEA 1F2XK 3VI3E 4J7RA 4KROC 3JSSA 1XGPA 1Y6MR 5I8OL 1WK0A 3QFJB 1A6ZA 1FGVL 2W0KA 4KU1A 4RMWA 3KPQB 4P4KD 4RSVA 4OCWH 4OLVL 3LQAH 3G9AB 2NXYC 5DQJB 2YRZA 3VD5A 1J10A 4MQ7B 4GMSH 4DCQA 4OZIE 3ZLQC 4RDQF 3EZ8A 4U1MB 3LS4H 4P23C 4DQOL 3ARGC 2X4SA 2DQHL 5K59E 4E41A 5HGAB 3TN0A 2E7CA 3STZA 5CZVL 3H9SB 4TNVK 4M02A 4DZBB 5F9WC 4J1UA 2A0LC 2QQLL 3WFBL 1RURL 3A6CH 3M1BA 4N8PA 3SBWA 1OAXL 1HZHH 5J9PB 1NEUA 5B38G 2H9GA 5D6DA 4BSWB 1SY6A 4K94L 3RL1A 1A1OA 1ORQB 1ZTXL 1O0VA 3MV7D 1OD9A 2R23A 2AQ3A 3ZL4H 1YEIL 4OF0A 4FZ8H 5EZLB 1KCVH 1A1MB 4AM0A 4MDJB 4WHDA 4PJXF 5FYJU 3L3JA 2IBBA 5L88H 1NGPH 1OAZH 1DANU 3FCTB 2FL5A 3L5XL 2BSTA 3UDWA 1XGYH 5AYUL 1AR2A 2XWBB 4RGOH 4TVPL 3WUWA 3LHPL 3OXRA 4PRID 5HD8D 5L8LB 2XI9A 1A02N 5DLML 4HXBL 1RZ7H 4G9FA 4KHXL 4DEPB 1BOGB 4PJHA 1MAML 5LWYL 3HZVA 3HB3C 1TZGH 4PTUB 2YA1A 2XKNB 4Y19B 3HFML 4PB9L 3TCLB 1GAFL 3MRGB 3BD4A 5JLZA 2CLRB 4OLEA 1UXSB 4LIQH 4Z76B 1IAIM 1AD0A 4N1EA 1QFUH 2JE8A 3MRDA 4JR9L 4PJBA 5KAQF 4U6HB 4OZHF 3K3QA 2WNGA 5D7LB 1CQYA 2R0KH 3NH7H 3MRFA 4KKLD 5I73C 3SO3C 1IILE 4KZEL 1BECA 5HYIA 1JV5B 3O9WA 5AZ2L 4LARL 1GGCH 1CGWA 1DQLL 2N7AA 1MRFH 4HZAA 1UQSB 1CFVH 1TQBC 5IESH 1TETH 3DROB 1FL5A 3UBXI 1YEGH 4IMLA 2ZSWB 4MJ5A 5E2TH 5D6CA 2CRIA 3TT3L 3SJVA 4X7SH 1OCWL 5I15H 2HFGL 4P5TB 3VFNB 4OZFB 1M71B 5DSCA 3QUKB 4ZO6A 5DD6A 3O3UN 5C9JB 4P4KC 1MSPA 4MNHB 1CLOL 1YA5A 2IPTH 3SDAD 4KXZI 4JO4H 1BF2A 1HH6B 4OUUA 1T83A 1FLRL 3BI9X 4XVUC 2D2OA 4KAQL 4HLJA 3BWAB 4Z7VB 1EPFA 4K9EH 3QULA 3TZVD 3K8KA 1T5WB 2GJ6A 4X7DC 3RVUD 5GS0H 1B0WA 4X5XA 5DHXB 1WAAE 5J11C 5E7BA 3IU3B 3FQRA 2AABH 1JHTA 1TTGA 2R2EA 3CDCA 5B3JE 1CGSH 4HH9B 5D96C 3IDNA 2J3SA 4NNPL 3V8CA 1MJUH 3GI8L 2KQNA 5F7DA 2ESVB 3L7EA 5E00B 3VFUB 3QUMB 1J05A 1FVEA 5IKCB 5F7FA 5DC9B 4N0YH 4QTHA 5J6GA 1BFVL 4F9LA 1WUNT 3QUXD 1NCAH 3BH8A 5TGBA 2AXHA 4M7ZC 4ZO7A 1A6VL 3BGFC 4JANA 3EFFB 1N7MH 2P5WE 3JWOC 3OKOA 4NKDB 3QEUA 4EDWL 3MROA 5HD8C 2I9LA 2VC2L 1S7UA 1RZJC 5ISZA 1L6ZA 3SKNB 4YGAB 3K4ZA 4M3KB 4ZPTB 4WFFE 2E6QA 3E6FB 2R1YB 2ARJQ 2XFXB 4NQDE 4OM0H 1Z5LA 3C60A 3NCMA 3DPBA 1U6AH 4LLWB 5IFAH 2VDQL 5LAXA 3WIFA 1IVLA 4WU7B 4A6YL 1S9XA 4YBLC 5DK2B 1TENA 5JNYA 3KR3H 4OJFH 3V0WH 4X9HA 3O2DL 1DLFL 2MPAH 4KKLC 4PYGA 2OX5A 5F7MC 1T66D 3QUZD 1QR1B 4JVWA 2FDBP 3MUGB 1U93B 1QFWI 4ODUB 3GMOA 3D9AL 5D70H 2AGJH 1UA6H 5L2KB 4OV5A 2VDPH 1DQJB 3C5SB 4XNZB 3NACL 3RUGE 5I1CL 1U8JB 5EBWB 4XBGA 3MOQA 4G6FB 1AO7A 2OZ4L 4I5BA 4Y5XC 1JK8A 4R6UA 4RNRB 1CR9H 4UV4H 2EH7L 4GRLD 2LAGB 2ITCA 4YLQT 1OARH 4DAGH 1KACB 4CJ1A 5GQBA 1YEDA 3QB7C 2VZTA 4OBRA 3R8QA 4IIQB 1KB5B 1GC1L 4ODSL 1A7PL 4C58B 3SDAC 5JOFB 4UIKH 4GG6B 3BMWA 4P23A 5I1DB 4Z0XA 1ROWA 4L8CA 2O61B 4LSDA 2IC2A 4XRCA 1SEQL 5FECB 5JOPD 2CLVA 5I9QC 3PWJA 5TDPA 2X4PB 1M7IA 3UO1L 3K8LA 4ZFFA 4R4FL 3TZVC 5I8CA 4H20H 3RVUC 5FF6A 3QEQB 2J88H 1HQ4B 3KYMB 1RVFL 4PRPE 2VLRB 4GKNA 4K7FB 3CVIL 5C07A 1Y18A 4G5ZH 1PX3A 5TE4H 2IQ9L 4JFZL 3G08A 5L2JA 4QRRD 2ZWLT 3K80A 3IJYB 4BK5A 3ULVD 1TPXB 2G9HA 1XIWA 3V5KB 1KLGB 2X70A 2RFXA 4U7KA 3RNKB 3IFPA 4N0UE 5FHAH 2BNRA 1U3YA 5EBMA 1FL3A 1BM3L 4CN1A 5FUCE 1H3VA 5KSBB 1DL7H 4U6XA 3QUXC 2DBLH 3O4OC 4HBCH 3MJ9H 2GCYA 1S8DA 3GIVA 5LJYH 1P4LB 2GI7A 2AK1H 3QIWB 4WUUE 1N59A 3A6OA 3RVXC 2WBKA 3OGOE 1BP3B 4ZUVB 5J6HB 1YZZA 1BBJA 1KPRB 1ZLSH 4S1QL 4QHKJ 5H2BA 1A6UH 5BRZD 4I0CC 2APBA 4P2QE 5EU4A 1CE1L 1PKQB 1AGBA 1FAIL 1QBBA 1NDGB 3UPRA 5GZND 3T65B 1KCRL 1KIQB 2MQ0A 1KN4H 1ULVA 2ZCLL 5IJVB 5JIIA 3OX8B 2AV7A 4XVTH 1IC5L 1ZLUK 5B8CC 4RGMB 3KS0J 1UYWH 4F7MB 3S88L 1T1XA 1MJ7L 3K74B 3GBLA 4S2SB 4KVCH 3QUZC 4BZYA 4Z7NE 5EUKB 4GRWB 5A2IH 1AXSB 1YNKL 3BGMA 4H1LH 4L4VD 5SWSE 4K3JH 5LKNA 1G7LA 4P2RA 2VISA 3T3PE 5DMYA 1JPGB 5F1IA 1H0DB 1NGXB 2CUMA 1ERNA 4YDIH 1NC2A 1INDH 1XF2B 2Z4QB 2Y5TB 2F58L 3MYJA 1ZS8A 1MY7A 5ICYA 4M1CD 4P4KA 4GQ9H 5FO9A 3RWCA 1NAML 1F2QA 3EOAA 5F44A 4ONGH 2AJ3A 5LVEA 2OI9C 1YPZA 3DETD 4D9LL 1IAOA 3A6BH 1M7XA 2DWEA 5EOCL 3HG1A 2A74B 1ONQA 4JFFD 4PJGF 4XT1C 3JTTB 4KMTL 2DYPB 5B39B 5CEZD 3GBNL 5JXEA 5SX4I 3AM8C 4U1IA 5AUMB 1T6VN 2FX7L 1QSZA 1ZSDA 4S0TD 3HLAB 3MLWH 1PZ5A 2B1HH 2MCPH 2ED8A 4IMKC 1LK3H 4OIBA 1IAKA 2NR6D 4JB9L 3QEHA 1ND0A 2CGRL 3RWFB 4AH2A 1RZKH 5F7EH 5KW9H 4XAWL 3SDXB 1DCLA 4CNIB 5EU3B 3IDGB 3ULVC 1ZVYA 2R39A 3MV7A 3KS0H 5EU5A 5DJ0B 1NBYB 3TBWB 1NFKA 1I3GH 5ACLA 4IOIA 5E9DD 3IETB 1ZA6B 1RUQL 2AK4A 4QHLA 3PQYD 4WFGE 4JQVC 3B2VL 1EUTA 1HSBB 2CDGB 4XPAH 2PYEA 3AREB 3DRTB 1Q9WA 1OSZB 4PRIA 3BH9A 4HKZA 5DMGD 5ANMA 3T8XB 3SE4A 2FJGB 1DJSA 5JIKA 3ULUD 4FTVB 1F4WL 2I07A 4HMDA 5TDOB 2CUHA 1QPPA 4LVOB 4HHAA 3VFOA 3PV7A 4APQD 1NSNH 1OSPL 1XF4A 1MFCL 3RX8A 1J86A 2X40A 1I3RA 1BFOA 2VE6B 4KVNH 2AW2A 4YEFA 4WHCA 5J57B 3OG4B 1P84K 3MLXH 5GZNC 1XR8B 1NLBL 2C4XA 3D3VD 4WY7L 1LEKA 3ZE2E 4ELME 4QRTB 1IGFL 5EBLA 2R4RL 1MFEH 5GRJL 2R4SL 2BNQB 1JIBA 3QO1A 3L3HB 3GUTB 1BAFH 4LIQE 2C3HA 5DJDB 4KK5D 4I2XB 3WS3B 1VEMA 3DI3B 1NLDL 4PBVC 1IC7L 1P4BH 2JJVA 4CBPA 1RK1A 2H6PB 1MCLA 2NX5D 3HI1B 5I6XC 4JPWL 3MR9A 5KOVC 5J1SC 2Y07L 5FUOH 1SBSH 2UUDK 2ADIB 4Y5XA 5T1KD 2NY0B 3PP4L 4OQ1A 1IGJB 1T4KA 3GI9H 4X9GA 1CDGA 3NIGF 1FBIH 2AJVL 5HJ3A 4M1CC 3V6OC 1FZKB 6CGTA 5IR1B 1EK3A 4Q7DA 3CPLB 3TT1H 4XPBL 3R0MA 3SDAA 5IIEB 5TFSH 1KN2L 3DETC 2EZ0D 3QFJE 4FS0A 3PJSA 4OAWA 5DA4A 3QNXB 3SCMD 2J8UA 1TDQA 3V0VB 1PY4A 4RGND 2GT9B 3MV9E 4L8DB 3D2UD 1UT9A 4IRSB 4L4JA 5K9QI 4S1SL 1RIVH 3TZVA 4LMQE 3KWWB 3VD3A 2EKSA 5TQ2L 1RUML 4Y88A 3K8MA 1J87A 4NBZB 4OFYA 4S1DD 4QNPE 5KANI 3PG2A 5EU6B 4LDEB 4UAOB 1N5YH 5I2IB 5L6YH 2NR6C 3MUZ1 3U1SL 5TPWH 3VFVA 4M1GL 4DVRL 2WMPA 3RNQA 4ZFGH 3H6JA 2DN7A 3ARRA 3HR5A 2VDNL 3F7PC 4HWZB 3FMGH 2MHAB 4TNWK 3UEZA 3VG9C 1HHGB 3QP3A 5BJTA 1OPGL 4N68A 2GJZB 4PRDA 4TOYH 2CUIA 4HQQH 1YEJL 1N6QH 2AQ2A 1LO4H 4HUUB 3GIZL 4GUPB 5ITBH 4XWGL 3CLEH 2X89A 3GSNH 5DMGC 3NN8A 4U1JB 1NEZB 4FQCL 2J12B 5CBAB 3H7BA 5C0DA 1UGNA 1AC0A 5JPNA 4KTEL 3GSRA 3ZTJG 4NO0D 1B6UA 4HV8B 1XF5A 4AENB 5FGCB 2FNBA 3NFPB 4APQC 3QAZC 2VYRE 3MOBL 5IM7A 4HJJH 4UOJA 3LRGA 4CMHC 2VLJD 4PGEA 2VXVL 2LQRA 4YHMH 5ACZA 5T3ZD 3FN3A 4HGWB 1IC4L 2OBGA 3BQUD 5F1KC 3QH3A 1DQDL 1QYGL 3NABL 5DURB 4WI9A 1MCRA 3O3AB 4MD4B 4M9OA 4CU8A 2A77L 5B8CA 5I76B 5ALCH 1K8IA 1LO2L 1AHWB 1QA9A 2SEBB 2QTEA 2JCCA 3TIDB 3WHE1 3QUZA 1PQZB 1L0XA 1VESA 3OL2A 5KVFH 1URLA 4XCNB 3KPTA 3PL6D 3MNWB 3HC3L 5D7LE 5HHQB 5IT2L 1FL6A 4ISVB 3NZ8A 1TNMA 5D1XA 1PG7W 1UWXK 4X6CB 5T3XE 5IMOA 2HMID 3U4EA 5HYQA 3D69A 1KT2A 2FLBT 3ARBD 4ZUTB 5SV4A 5TQ0H 1AY1H 5GHWL 3O2VH 4HJGA 5J1TC 3TYFB 3ET9F 1LWRA 1MCNA 1TVBB 3KPPA 5C70A 4ZDHA 2EZ0C 2QV2A 1F97A 4S0SD 1G9MH 4ZTPL 3SCMC 1CZ8L 3BPOB 4ZQKA 5CP3H 2GTZB 2VJXA 4RGNC 5I66B 2W0PA 4NNYB 1ZLVK 1SM3H 5BS0E 4LLDA 3T77B 2VZ3A 4S1DC 1U91A 4IMKA 4S11A 5C6PB 1BVLB 1RZFL 4XP6L 4P5KB 3KJ6H 5BXFB 1UM5L 4QRRA 2X1XR 4TUOB 1G9NC 3RL2B 2H41A 5CP7A 1IL1A 1I1FB 4H88H 1HHHA 4OLUH 2BDNL 4JHBA 2F8OA 2HH0L 3I75A 3UTZA 4L5FH 5KTEH 2YD7A 1WZKA 4WEMB 4OZGA 3LZFL 4JQVA 4IDLA 4XMPL 2ESVE 4LNRB 3VG0L 1TZIB 3Q48A 3S4SB 4J3OC 2QLVB 4GAFB 3CGTA 1I7RA 3O41B 1OB1A 3MRJA 15C8H 3LMJH 1XGUA 4WO4B 4X6BB 4HCRL 1BIIA 4RFOH 5GS3A 4OB5L 1KJMA 4MNGB 1YN7A 3PWVA 1B2WH 1EFXD 1WIOA 4ZFZA 3I50L 1P4IH 4GW1A 4O9HL 1B0RA 1FG9C 1HH9B 1YQVL 4EBQH 5A43C 1XH3B 3EDEA 4Y89A 3LPFA 3BPLC 2P44B 4KXZH 2CIKB 4DN4L 4NC1E 2ZKHL 1MHPL 3BQUC 4N0FB 2DQUL 1BMGA 4LLUA 5C2BL 1YDPA 5EZIL 3W2DH 1UJ3A 4JM2C 4ODHH 5FCUL 4CVUA 1RD6A 1T1ZB 1N64L 1YNTB 3QA3A 2LTQB 3IVKA 4Z6AT 1FE8H 1CIDA 1KIUA 1MIEH 5F7YC 5DQDL 3CDGB 3PL6C 1KJ2A 4HX1B 4L4VA 3CH8A 4G8EB 4YFEA 2FB4L 3GKZA 2HMIC 3ARBC 3ECBA 3O6KH 1EGJA 5DI8A 1T2QL 2YN5A 4OFIA 1KEGL 1HHIB 1BX2B 4DW2H 1PSKH 3G5ZB 1YMHA 5LBSL 3QNYB 1OHQA 3O3EA 1NANI 5GISH 1MHHB 3DV6B 3P9LB 1IRAY 4JRXD 5FB8A 2V2TA 4GRMB 3HN3A 2OL3H 4LPWA 3GEWB 3I9GL 3TH2T 1UVQB 4LRNH 3GB7B 3U0WH 5GJSL 3OHXA 4KQ4H 4XP1H 4P2OB 5HPMA 3OTTA 3MMEB 3QUYB 1FNLA 3QI9D 3TH3T 5IMMA 2CKBB 2W0LA 4PV9B 1IQDB 1JGUH 3IDIB 1QFOA 3VXTB 3NFSH 4KHTL 4RQQA 1J0YA 4Z0BL 1KG0B 2OS7A 4Z7WB 5JHDE 4I3RL 3PHQA 3QT2A 1C12A 3MGAA 3P0GB 5I0ZA 5E6YA 3SDDC 4FFVD 5E9DA 1GZQB 3PQYA 2Y4SA 1LEGB 1Y0LA 4NFBA 3EYVB 1KBGH 4NWUH 3DRQB 1KTDB 2ITDB 5TF1H 4RMVA 2CIIA 2GSIB 4LSPH 1OD7A 4RAUA 3S5LA 1QVOB 3S37H 2YZ8A 2DDQL 3R06B 5DJXB 3FN0L 3AY4C 4XNXL 2NY5H 1SJVA 3G6JA 1HSAB 4ONOA 4JRWA 4DTGH 2NY3B 5F96L 4J4PD 2B8OT 2EDJA 1U8PB 3MRCB 3MRLA 4LSSL 9CGTA 4ZSOA 4LPYA 1UH2A 4WUKL 1RUAH 1DN0B 1ZGLP 1SVCP 1F3JA 3D3VA 5T33H 2VL4A 1WBZB 1RZ8B 1I8LC 1JPSH 3GMNB 4NQCD 4MQXD 2G5BA 2KUTA 1WITA 4PBXA 2XZQL 3CXHK 5J13B 1FIGL 4NGHL 5L0QC 1NGWA 4RWYH 5MENB 4WTWA 2P5EE 3QO0B 4IRZL 4LP4A 4P48A 3SDXF 3PWPE 2UY7A 5TDNA 5C0AE 2ATPA 4ODXB 4OFDA 3S34H 5D1QB 3L9RB 4PV8A 1YECH 4GRWE 4TUJB 1YMMB 4YHZH 4WCYL 1GL4B 4ZUWB 5CJOL 1TLKA 1KELH 1BGXL 2YPLE 3EYUH 5HDBF 4LCYA 4Z95H 1P6AB 4NHUB 3EOTL 1NC4A 2H45A 4O00A 4CW1B 1QRNB 2VLKB 4MSWB 2Z93A 4LP5A 1LP9A 1DBMH 2XKSA 3BP5B 5SWQB 3Q3GB 4YR6B 3RWHA 1SYSB 3T0AA 4ZFOL 1T89C 4ZO9A 3SCMA 4Y4HD 4J6RH 2VDRL 2Y06L 3GMLA 4UT6H 4AIZB 1DE4B 3D2UA 4U1LB 4O4YL 4WNQB 1N8ZA 5E7FA 1EV2E 1RJYA 1EVTC 1JCKA 3CU7A 3QI9C 5CSBA 2D7MA 2WBJD 5JW3H 2YRPA 1FDLL 3HMXA 3RWEB 1RIUL 1CE6A 4X9FA 2ED7A 2YA2A 3BW9A 5D2LF 7CGTA 3GSQA 1XGPB 2KBGA 1Q0YL 4FFVC 6FABH 1A3RH 5D7JA 4NM4L 3FB7A 1LDSA 4Z8FL 5IGXL 2QSQA 5HHPB 2X10A 5D2NC 4LQ1A 4U1KA 2Y5EA 1D3CA 4DCQB 1WICA 3NIFF 3LEYH 4NJAH 4L3CA 1G6RA 1BVKB 35C8H 2X4SB 3Q6GH 3JWNC 3U9PH 1X5FA 5CKAA 4YAQB 3GSXA 3TN0B 4KRPB 4BA8A 1UM6L 3DURA 3STZB 3MLVH 2B4CC 4NO0A 3RIFK 1QQDB 4UT7L 4J1UB 5GRUL 4HFWB 2XRAL 1KCSL 3HNTL 5CHNA 4J4PC 3EDJA 3M1BB 4LSTH 1A7NL 3IDMA 1H3PH 1A3QA 2VZVA 5CINH 4KQ3H 4PP1D 3GHBL 3RL1B 1I75A 3INUL 2BFVL 1A1OB 3BQUA 4PJ5E 5C09E 2R23B 5FXCH 4FG6C 4MQXC 1A6WL 4NRYB 1NMCB 1VPOH 4HG4J 2AXFA 4JM2A 5SX4H 2I60H 4AM0B 2GYSA 1MCCA 3DI2B 3L3JB 3RP1A 3MV8D 2PYFA 4RX4D 5K9JH 1GGYA 2BSTB 1EXUB 4Q74A 5FKPB 4BZ1L 3PL6A 1YN6A 4D0DA 3WUWB 3OXRB 1AJ7L 4Y4FA 3BDYH 5GPRA 1I7ZA 3F7YA 5BW7C 4G9FB 1RU9L 4NC0B 3IXTA 1JMXA 4PJHB 3ARBA 3D0LA 1I9RH 2VIRA 3HZVB 4ZAKD 3RY6A 5D8JH 2FX9L 5M7QA 5DVMA 4NKQB 3QDJA 2PTTB 4GW5A 2F5AL 1ZK9A 2VITB 3TBSA 2Z8WC 4HD9A 5JLZB 5A16B 4CU6A 4MYWB 1E4WH 3OKDA 4Y4HC 3T1FA 3WD5L 4BELD 4MA8H 1AD0B 1FHGA 3HAEH 3LQZA 1JGLL 2VSDA 4PJBB 3TO4D 3QCVL 4BFBD 1GGUA 4X80H 4N9GA 4BH8A 3MRFB 3M45A 4M8VA 1QHOA 3OXSB 3O9WB 3I6LD 2IAND 2WBJC 3V79C 4Q6IA 3GM0A 2UWEE 1XEDA 3B4NA 1CIUA 3EOBB 3IXAB 2BVUA 4D3CH 3GHEL 4OGXL 2B2XL 5EO9A 5D6CB 2A2QT 2DQDH 5FYLD 3SDDA 4YC2B 4R8WH 3VFRA 5DSCB 4KPHL 5DD6B 4J2XA 5MERA 3UJIH 4ZD3L 3PNWB 4OUOA 4U1GB 4LCUB 1LEIA 2DLHA 4ETQA 3RGVD 3I3EA 2DLGA 5C8JA 2YN3A 3DXAD 1SMOA 2AEWA 4OUUB 1JRHH 4GS7B 5HYSA 5TE7L 2ZOKA 3VRLF 3CC5B 1KULA 1I3VA 4OT1H 4P99A 3QULB 2YK1L 3VXOA 4J3WA 2R69H 1ZHKA 4X5XB 5J1AA 3LQAL 4DGVL 4HAFA 5E2UH 3VRJA 4FZEL 1RFDH 1AP2A 3FQRB 5DQ9B 1JHTB 5FGCE 2CRZA 2GHWB 4PP1C 2R2EB 5T1LA 4WIQA 4HGKC 4JFXA 4TNVF 3ZKQD 4MMZC 5F7DB 3L7EB 4TULH 1J1OH 5E6ZA 3E2HB 4G8FA 4RCAA 1J05B 1P53A 5CJQH 5I71B 2ORBH 5H35B 2DMKA 4QTHB 5J6GB 2VZOA 4HWBH 3TBVA 2AJYL 3BH8B 1UM4L 5TGBB 1A4KA 1NUFA 1ZWIA 4JANB 4XAKE 5MEPB 4ZNCD 1MNUH 3WKMH 4QOKD 3DGCR 3OKOB 3QEUB 4JGJA 3MROB 2I9LB 3UPAA 1KTRL 1S7UB 4DKFL 3L3GA 1FN4A 3WIIH 3BAEL 4HUXA 1A3LL 5CLWA 3MRMA 2OR7A 2QBWA 4ZAKC 4X6CE 3ULSA 3NTCL 1C16B 4DUVA 5LCVH 1VFOA 3C60B 2AXJA 5F6IC 3D39D 5I74C 1O7VA 3ULUF 5FYJD 4FQHA 2DL9A 1IGIH 5LAXB 3TJEH 3NFNA 1T89A 1S9XB 4E42A 4F7PA 1EEZA 4U3CA 4XPTH 2NQCA 3TO4C 1EMTH 4XHJD 1LO0L 3VDAA 3BEWA 2J2ZA 3EDFA 1TZGL 5C08D 1Z9MA 4YPJA 3QPXL 1BBDL 3GMOB 4OV5B 2ZG1A 3ME0A 2BY3A 3IU4L 4NQVA 1IGCL 2CK2A 4P46B 5EBGA 1JTPA 1YEHL 2AEIT 1AO7B 5ID1A 4KROB 1JK8B 3WEXB 4JY6A 4PJAF 2ITCB 1FJ1A 2WUCH 1AGEA 1YEDB 3AROA 2YR3A 3PWNA 5D2NA 2NXYB 4JAMA 4UUJA 3KJ4C 1BQHG 5GGRA 4NN5B 3RGVC 4F9PA 1YYML 1CFVL 5TH2B 4JY5H 2W92A 1XT5A 3DMMC 4Z0XB 3WIHH 2XYCA 3AXLA 1FO0H 4I0PC 4XRCB 1E4XL 3KAAA 5E2TL 5B38A 1P7HL 2CLVB 2NY6D 2XQYG 4MB4A 5TDPB 1MFBL 4O2FA 4RDQG 5ALBL 5F9WB 5I8CB 1CGYA 1G0XA 4PJFA 4YEEA 2X4NA 4J4PA 5FF6B 1L0QA 4HPYL 4Y5VC 3TA3D 4GKNB 1MLCA 4OF6A 1Q1JL 3PV6A 5C07B 1Y18B 5EC1A 4MWFA 4ZS6D 4P4RA 3G08B 5L2JB 3ETBF 5JQHC 1OP9A 4PRHB 2G9HB 1XIWB 5GGQH 2V5MA 3DVNA 2X70B 4NQCA 3IFPB 5T5FH 1FL3B 2HFTA 4K9EL 4YXKL 1Z0MA 4UB0H 3UZVB 4U6XB 2Q8AH 3UAJD 1S8DB 1JFQH 4MD0A 3U30B 3VFTA 1EO7A 4MD5A 3U7WL 1INQB 1PEWA 3GSWB 4P59L 2CPCA 3ZKSD 5BW7A 4JO3H 2BSED 3V52L 1BBJB 1JZ7A 4YQXL 4M6OH 5H2BB 1QBML 3K1DA 1LDPH 2ZPKH 4O2CA 1W72H 4NC2B 4CVWA 1A6PA 4EI5A 3OZ9H 5DF0A 1AGBB 2VAAA 4YUEL 4P9HL 3U6RB 4CJ0A 4JKKA 2W0FB 2NY7H 2YWZA 1SJXA 1CLZH 2I26N 4ZG1A 1U9KA 4AMKH 1FFQA 1HYSC 1MRCL 4NWTL 1HK6A 3E6HA 2OP4L 1DDHB 3V4VH 2AV7B 2XTLA 1DP0A 2IALA 4HUMB 4XHJC 2KZWA 3KXFB 1T1XB 3AUVA 5D7IF 3G6AA 4TVPD 4XP5H 3VXRB 1U8IA 3K7UA 3V4PH 5EO0A 1R5VA 4FFYH 3EYSL 5F70A 1G7LB 3OQ3B 3F62A 1F90L 3GJFA 3MZGB 5F1IB 5KOMC 2Y6SD 1TQCC 4X8JA 1V7NH 4YHKH 4BQCA 2UZIH 2HTKD 4IS6A 1NC2B 3R8BB 4OD3L 4XNUH 3MYJB 1ZS8B 3WO4C 4UTAH 4OLWL 5ICYB 4NZRL 1KFAL 3WFEH 1FFNB 2A6KA 4Z7WE 5T3XL 4OD1H 1F6LL 3MJ8B 4JVUA 1GGIH 3EOAB 2AGJL 1T1YB 1MPAH 5ADPL 1PLGL 3MNVA 4PJEF 3HG1B 1ONQB 5HHVL 4PJ7B 2LVCA 1DQTA 3L6FA 4XH2B 1Z6JT 4YXLL 3OF6A 2NY6C 1CR9L 1P6FA 5ESVA 3LS5H 3H42H 3BP6B 1ZSDB 2Z91B 3DSFH 3SGEI 3JVGA 4XI5D 1PZ5B 4KY1H 3C08H 3TA3C 4EUPH 5J11B 4JFED 1JPST 4ZOBA 4ZS6C 3QEHB 3UJJH 5JO5A 1A9EA 1NANH 4NN7C 1JPFA 5C0CD 4FQJL 1NCUA 3MV7B 2BSRA 1CT8A 3P11H 5EU5B 1CU4H 4LQFL 3JV6A 4IOIB 4D8PA 3QDMB 2XN9D 2IJ0C 1U0QA 4R26L 3WKNA 2AK4B 3MLRH 5F7NC 4J23A 4FA8A 3VWKA 4DFHA 2BZDA 5H94A 3UAJC 3VWJD 5E95B 2PYEB 4M7ZB 2NLJB 3PUCA 4O58H 2QSCL 3BGFB 5JQ6H 1Q9WB 3UCRA 1KC5L 2FH6A 4PRIB 3BH9B 3ARSA 4HKZB 5ANMB 2DQTL 4WW1A 3JV4A 3FRPG 4R7NA 5ESQA 2I07B 2F53B 4R4BA 4D9RD 4GXVH 4OIIL 2O5YL 2EYSB 3DIFB 4HHAB 3QUML 4FQQA 1FYHB 1XF4B 2BSSB 5ETUA 3FOLB 2AJXH 1I3RB 1MJ8H 4PR5A 2C3VA 1WAAA 4L8BA 1NCWL 1UZ6E 4LEXL 5D5MB 1LEKB 4F15C 4KTDL 1JF6A 1Z3GH 2C26A 4YBLB 4U6VL 5EBLB 3TO4A 4J3VA 3QO1B 4H25A 2F54D 3BKCH 5I30H 4I9WE 5EO1A 1MH5A 1TJGH 1AXIB 5GS2H 3LIZH 3WSQH 1G7MA 5DRXA 3VJ6A 2IH3B 3MR9B 5BZWA 1E6JH 2LU4A 1JGDA 2P5WA 2Y6SC 1EO5A 2LFGA 4U0RB 2G75A 5F9OH 5GIRA 1KNOA 1YUHA 1MUJA 2HTKC 1T4KB 3MOAH 1UYWL 1ZANL 5CD3A 5L7XL 2EDYA 2I9TA 4GW4A 4KVCL 4YK4C 4G6KH 1X5HA 5HJ3B 4EN3D 4G43A 1ZVHA 2WINA 3CK0H 3X3GL 2NCMA 3GRWH 1OM3L 4NQDA 3MXWH 3RGVA 3RVVD 1WBXA 3H3PH 4OAWB 3DMMA 1GRWA 5BVPH 2JJWA 5BV7B 2J8UB 4I0PA 3B9EA 5F1NB 2D3VA 4ZUSA 2BVTA 2GK2A 2IFFL 3DO3A 2VR4A 3TZVB 5EC2A 2EKSB 3HZMA 4KI5F 2OJZH 4XI5C 4E41E 5ERWA 4QTIL 4Y5VA 1J5OL 4B7LA 5C0RL 4YE4L 4JFQA 4R97B 1KB5L 3RVWD 3G5XB 3HTLX 4J8RA 2ICWI 3IAPA 4LDLB 2E9JA 3IJHA 3VFVB 1LO5A 4PJBF 3RNQB 3HR5B 1VACA 3GMPA 3SKJH 3RUGA 1A7QL 5F7LB 5BZDA 5F9AC 3EOYG 3H9HA 4P9ML 5BJTB 4PRDB 5I1IH 1D6VL 4FNLH 3VWJC 2DLFH 2RCSH 5I1AA 2A9NL 2BC4A 2HN7B 3NN8B 3MYZA 1NKOA 3H7BB 4FXGA 4LK4A 4U4BA 5C0DB 2XA8L 4HC1L 3EO9H 3GSRB 1XF5B 3QCTL 4YNYB 4PGJA 4OTXL 3TCXA 2WIIA 1QKZL 3TVMA 1ED3A 2C1PA 4G9FE 4NM8H 5IVXA 3QZWG 5IM7B 1RHHA 4Q9RH 1ZV5A 4PGEB 2Y9RT 2PKDA 1NAKL 3IDJA 5ACZB 5KZCB 4KJPD 2FBJL 1K8IB 1JI1A 4L4TD 5I75B 1QA9B 2WLYA 1TCRA 4CVZA 4LSVL 2JCCB 5C08A 3W39A 2CJUL 4OFVA 1NSNL 3NCYS 3IYLW 1QTYT 2L4OA 5F7KC 3M17A 5DDHA 3DHMA 4X6DA 2QSTA 3QSKB 3WJLC 1KB9K 1FL6B 3NZ8B 2FEDC 5D1XB 3CSGA 5DRZB 1MEXL 3KGRA 5IMOB 1QFPA 4WUUA 2E27H 5HYQB 3D69B 1KT2B 4XCCH 3WLBA 1GIGH 4HIHA 1QBLH 1KF9B 4EEEA 5DGRA 3WE6A 3DECA 4E0RA 1DVFD 4EN3C 2V5RA 3I2CH 3SJVE 1ZT1A 3WNMA 5AAWA 2YUXA 3DARA 3FONA 1J88A 5DFVD 3HUJF 3KPPB 3RVVC 2OI9B 4ZDHB 5KANG 2AJSH 1I8IB 4U6YA 5CIPA 1S9YA 4OF7A 3MNZA 4KV5F 4PB0H 4OCYL 4NSKA 1D5MA 1FSKC 1YEKL 5C0GA 4RFEA 1U8NA 3TNNB 3DBXA 4LLDB 3FO0L 3VXQA 1GGBH 3MZTA 1H3GA 5KSAD 3TYGL 4PJ8D 3TA3A 3O2WH 1U91B 5CILH 3P9MA 2R2CA 3RVWC 4HUKB 2GJ6E 3ZKXB 4NUJA 4W4OA 1F3RB 1K3IA 1J0JA 5CP7B 1T80A 5DD1L 1ZXQA 5K9KB 3FL7A 1HHHB 3EYOB 1U3JA 3PABA 3QG7H 3T3MF 3VXMD 5C0ND 3UTZB 3SE9L 5DYOA 1V7ML 2APTA 2XQYK 5L6YL 2VKXA 1I4FA 4L3AA 4JPVL 4ODVH 3EGSA 3L5JA 4NPYA 5HI4D 1I7RB