4DP1X

The 1.35 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 4.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp1X00
2P80D 1SFDA 3FU9A 1PLCA 1KCBA 2TSAA 1NDTA 3NSDA 1M56B 1HAUA 4BXVA 1JXFA 1V54B 2YAQA 3IBOA 3N55A 2BO0A 1L9PA 2CAKA 3PAUA 4HALA 2FJSA 2BZCA 3G5WA 2QPEB 1JVOA 4DPBX 2PPFA 1WAEA 3ABGA 3WG7B 1EHKB 1J5CA 1A4BA 1OE3A 3H56A 4BWUA 3AW5A 4TXVB 2HX7A 5B3SB 2WO3B 1KDJA 4KOBA 1NZRA 1SDDB 3UGEA 3FS9A 1BQ5A 3V9CA 4DP5X 5B7FA 1JZHA 3EH5B 1TU2A 2W8CA 3JT2A 3QJSB 3FPXA 2RACA 2X88A 7PAZA 2CBPA 4N4YB 2BP8A 1BXUA 4E9WA 1NWOA 1KBVA 3CZUB 1SF3A 4G7QB 2XWZA 2IH9A 3U25A 3AZUA 3ASOB 2ZOOA 2IDTA 2XYBA 5FC9A 3EF4A 2UXGA 5IY5B 3PPSA 3ZDWA 2FQFA 4KNUA 4G7SB 2UXFA 1J9TA 2PCFA 2PP7A 5TK4A 3AG2B 2EIKB 4YSUA 1PCSA 4GXFA 5F7BA 1AS8A 1TEFA 1SDDA 2BW5A 4QKTA 2JFCA 3QJRB 4L0PB 3S8GB 3UAAA 3PAZA 3WNIA 1W6LA 3GDCA 1NPJA 2XXGA 1X9RA 2QDVA 1PF3A 1ASPA 2IH8A 1BEXA 1PMYA 1PAZA 1PZCA 3NJGA 3PAVA 3QQXA 2XU9A 1CUOA 1NIBA 2A3TA 1BYOA 1V10A 3OD3A 2B3IA 2Q9OA 3ASNB 3OMNB 2R7EA 1E67A 2YQBA 2IDUA 4YSDA 1RCYA 3CVBA 4HCIA 1AZNA 4A2DA 1GS7A 4YSSA 1MDAA 2OCCB 4F7KA 1GR7A 1GYCA 3QJQB 1ASQA 2PPCA 4GP4B 3AG1B 1NWPA 4FAAB 2VW4A 3TASA 3WNJA 4DP4X 1OOWA 4PAZA 3NP4A 4M4RB 5EHFA 4BDVB 3HEIB 1WA0X 1NICA 1E30A 3CDZB 5B1JA 3OM3B 3CG8A 4PCYA 4EF3A 6PCYA 4GY4A 2YAPA 1KYAA 1ZIAA 2PP9A 3S3BB 5I5MA 3S8FB 1JXGA 1GS6X 1PLBA 1SHXA 4DP8X 1AZBA 1UATA 3AG4B 1JZGA 1GY2A 4DP9X 2J5WA 4YSOA 2FNWA 1VLXA 3QJUB 3NYKA 4DP7X 1NIDA 2PPEA 1GY1A 3IEAA 2FWLB 3NJHA 2IWEA 2YXVA 3L45A 4Q89A 2Y69B 4WTQA 2FT7A 2MTAA 2GC4C 2UX7A 5I26A 5D4IA 5AKRA 5D4JA 2GIMA 2Y1AA 3NJNA 4G7RB 3FQ1A 4ENZA 2EILB 4HHWA 2ZWNA 2AZAA 4DP0X 1OCRB 3MBWB 4AZUA 1A65A 1A4CA 4BDVA 4E9YA 5B7MA 5I5IA 3TBBA 1M57B 1RZQA 4NERA 4BK5C 1EZLA 4UF7C 2DWSA 1MG3C 1I53A 2JKWA 3EH3B 3NSFA 3FYEB 3QJVB 3AG3B 2UXTA 1BQKA 3FPYA 1MZZA 1NPNA 4KNSA 3X2QB 2XV0A 5B1JC 1CYXA 2DV6A 3NJFA 5I6KA 2EINB 2OV0A 3PXLA 1ASOA 4JKNA 2BWIA 2N0MA 1JZJA 2B08A 4KNTA 4YVNA 4NAJA 2FQDA 2HX8A 1IBZA 4G71B 1BAWA 1OCOB 2J55A 4KO7A 4YSEA 1V55B 4NB7A 3QPKA 2BZ7A 1FFTB 3C75A 1XMEB 3GXUB 1J9RA 1SHWA 4F2FA 3H4FA 2CALA 4W1TA 3TA4D 2ZXWB 3UABA 3D12B 4E9QA 3FYIB 4BXSV 2CJ3A 1J9QA 4AX3A 1AANA 3FSZA 1SNRA 2P80A 5PCYA 1T5KA 3RYMA 1JOIA 2IWKA 3ZIYA 1PNCA 2IWFA 2EIMB 1WS8A 4YSTA 3PLYA 1L9OA 3EH4B 4FA7B 3AY2A 2PP8A 3GYRA 1AQ8A 2HZHA 2HXAA 1AAJA 2I7OA 5F7AA 2I7SA 2IDFA 3EHBB 3ABKB 1W8EA 3V9EA 3FQYA 4K9JA 2YXWA 3UACA 4G72B 1AOZA 2FQEA 1CURA 5I6OA 1IUZA 1AZRA 2PCYA 1QLEB 2YAEA 3IE9A 1OCCB 2BP0B 1L9RA 2GI0A 4HCFA 1FWXA 4AKQA 1OV8A 4AI7A 2H47C 5AZUA 3S3DB 4YSQA 1AACA 2GC7C 3FSVA 2XX1A 4A67A 4YSRA 1PY0A 4P5SA 2VMJA 1DZ0A 3FQ2A 1QHQA 1OF0A 3FSAA 5B1KA 1WA2X 1TKWA 5I6PA 3T6XA 4DP6X 2YAHA 1E5YA 5I6LA 1PNDA 2GHZA 4YSPA 3IN0A 1NIFA 1OCZB 2HRGA 3FU8A 3OQRA 1JZIA 3ERXA 2XVBA 2W88A 2YARA 5I6MA 4KOCA 2GSMB 4RH4A 3ZBMA 3NT0A 3WKPA 1M9WA 2XV2A 5LDUA 2FQGA 1FA4A 2VSMB 4KO6A 1R1CA 1WA1X 2QT6A 2BWDA 3SBPA 3ABLB 5TK2A 3DTUB 1F56A 4CSZA 1IKOP 2BP8B 2LLNA 3NSCA 3UAEA 4A2HA 4HHGA 1X9UA 1BXAA 4JHUA 1DYZA 3WIAA 1ZIBA 2DYSB 4GP8B 3WKQA 1N68A 2HLEB 3CDZA 1B3IA 5AFAA 2YAFA 4YSCA 5E9NA 1A4AA 3T71A 1BXVA 1KV7A 2AANA 3FT0A 4W9ZA 2FTAA 2TSBA 3DIVA 1BYPA 3T6VA 1BQRA 1RZPA 2JXMA 2ZONA 1ADWA 3DKHA 4E9SA 1SJMA 5ANHA 1ZPUA 2H5UA 4A68A 4CSPA 2H3XC 4G70B 4UANA 2XUWA 5B1AB 2I85A 5PAZA 2MRYA 3H4HA 1NIEA 4E9TA 4UAHA 3X1EA 2PPDA 3ZX1A 7PCYA 1ZDQA 1AZCA 1JXDA 3T6WA 1W6WA 2VN3A 3IN2A 2UXVA 1AR1B 1A8ZA 2DY2A 1SFHA 3JTBA 3SQRA 4HIPA 4DPCX 3ABMB 3PCYA 1NINA 4HCGA 2AFNA 2DYRB 1TEGA 3SBRA 1XB8A 2OJ1A 4A2FA 4GYBA 2AVFA 1XB3A 4E9XA 1CC3A 1PZBA 2FT8A 3FSWA 1ET7A 1E5ZA 5I28A 5I6NA 3FU7B 1ET8A 4E9RA 1MZYA 4AKOA 1ETJA 1L9SA 2DWTA 4YSAA 2R7EB 2IAAC 4X4KA 1JZFA 2HX9A 2VM4A 1JERA 2GB2A 1E65A 8PAZA 3T6ZA 2XLLA 4BWWA 3NJIA 1GW0A 3OMAB 1J5DA 1CYWA 1ID2A 1ET5A 2IDSA 2VSKB 1ILUA 2FT6A 1AG6A 4HAKA 3WI9A 4DP2X 4E9VA 9PCYA 2XXFA 1ZV2A 3X1BA 1SF5A 2HRHA 4YVUA 1JVLA 3TU6A 1JZEA 4A2EA 3NP3A 5D4HA 4BWTA 2UX6A 4ZK8A 1ZDSA 3NSYA 1AIZA 5A7EA 3S3CB 1MG2C 3BVDB 1IBYA 1N70A 2VW7A 1A3ZA 1KGYE 2XX0A 4KO9A 1HAWA 1IC0A 1L9QA 1NTDA 3CVDA 3NJMA 2QDWA 1RKRA 4N8UA 2PLTA 5B7EA 3FU7A 3T9WA 5I5JA 2BHFA 3KW7A 4P5RA 3KW8A 1OE1A 4HZ1A 3MX0B 1GS8A 3X1NA 1YLBB 4DP1X 2IDQA 4GP5B 2YAOA 4A66A 2NRDA 1GSKA 1XB6A 3N2JA 1KBWA 4AKPA 1HFUA 1NIAA 1AG0A 4JHVA 3X1FA 3NJLA 3UADA 2PPAA 1URIA 2VW6A 3X1GA 3TBCA 1OE2A 2J56A 6PAZA 1PLAA 4A2GA 4Q8BA 4DPAX 1L9TA 2E86A 3BQVA 3NJJA 4YL4A 4QLWA 2BP0A 3HB3B 1KDIA 3QJTB 1AZUA 2XV3A 2YAMA 3NJKA 1J9SA 2VM3A 4M3HA 1PZAA 4KO5A 1QNIA 2AZUA 2J57A 2GBAA 3SBQA 2BW4A 4F2EA 2X87A 2WO2B 5B1BB 3CVCA 2WSDA 4MFHA 1AS7A 1AS6A 2EIJB 1KCWA 1ILSA 2CCWA 2Q5BA 2CUAA 4WKXA 2QPDB 1WS7A 3OMIB
chains in the Genus database with same CATH superfamily
4GUPB 4JKMA 1OQOA 1A6WL 1H3PH 3DVFA 3N1FC 4M6OL 4J6RL 3ZSTA 1WYJA 1MW1A 4Y5XB 5EF2A 4KMTH 1EHLL 3APDA 4M1DL 1KB3A 2IAMB 5EU5A 1SLUA 2Q76B 5DCCA 1MHCB 3ZY7A 3BMWA 2CR3A 2GW5A 2C9RA 4GKSB 3W0WA 1F8TH 3G5XB 2LU3A 3UZEA 3ARSA 3MV11 4X6CA 4K8RH 5SV3A 1ES0B 4P2RD 1TCRA 3VG9C 3SDXA 1XGYL 1U3ZA 2JQMA 4X8JB 3X11A 1LLAA 2G3MA 3CE1A 1RZKL 2ZXGA 4GUCA 5JHLL 5EEXA 5D1ZA 1NJ9A 2J1KA 2ZAIA 4NUMA 5LXVA 1E27A 1RPQA 5I1HL 4L5FH 4XI5C 3FTWA 2RACA 1PYWB 4ICXA 1BFSA 4ZMYA 5I8CB 5L7XH 4GRMB 4HH9B 1BOYA 2D7TL 4IDJH 4K9EH 1WZAA 4GIAA 2AJ3B 1J1OH 4JEGB 1A7PH 2WKGA 1FAIH 4C47A 4O4YH 5IQ9B 1THAA 4HUUB 4OF8A 1JG9A 3K6SB 4D0BB 4IBVA 4XBEL 5CSGA 3ILEA 3VFTA 1DQJA 5DVLA 5EB9A 3T08A 3VMNA 2ICES 4JFFE 2F5AL 2UXFA 3EH2A 4PWIA 4PJGB 1VHPA 4EBQH 2C1OA 2OTUA 4K94L 1GC1H 4I5BB 5DSCA 2PWHA 1D9KC 4MXWL 4HS8L 1QUNA 4AQ8C 2CRMA 2OMZB 2X10A 1I8KA 4Y16B 2WBWB 3JXAA 3EDEA 2G75A 5HJBA 1GTNA 2VT0A 1UXSB 4WSGA 4QKTA 1DP0A 2HG0A 5GZNC 4JFOB 2Z35A 3UP1A 4M5YL 1JE6A 1JUFA 5SWZE 2KHAA 4CVUA 4AXWB 2DIBA 1IM9A 4D8PA 4HLEA 1CT8B 3GNML 3LYRA 2CUHA 1W6LA 1X9RA 3I74A 4I1RA 1BAFH 2C7UB 5F6IC 5C7ZA 2ZOWA 4EI5A 4FJZA 2DTMH 4L4TE 1IAKA 3V10A 1Q90A 5J1AB 3VQ1C 1OTTD 4IGBA 3TESA 2XXMB 1FBIH 3ECUA 2A1WH 1T0OA 5HGGS 4CGTA 4OZIB 2R0WL 1RZKC 5CIPH 4PU2A 4XN5A 4BFBD 2BSCA 4MNQD 3EFOB 4NIYE 4V33A 1BHGA 4W9IC 5E99H 3RGHA 2DYPD 4LLUA 2BH0A 3IU4L 5I30L 1IEHA 4PLJD 4CNIA 5C2BH 2ETWA 1GR7A 1T04A 3LKOA 1S9YB 4RGMB 4J4PD 1D7BA 1L0QA 2PPCA 3Q5OA 1WITA 3HPLA 2DM4A 2VW4A 4JM4L 1C8PA 2NZIA 3E8VA 3O3UN 2C9VA 4YLBA 5CKAA 1UOKA 1ROWA 1FLRL 2B3RA 1NEZB 5IMMA 2AKRA 3DGGA 3II2A 5JNYB 1E30A 5FUOH 4R2GC 4XN7A 4TSAH 3AU1A 3W9DB 4GY4A 1VKXA 4K94C 3MRFB 2IQAB 4N85A 3S3BB 2CK2A 4WHYG 5DLMH 4HS3B 4PJHA 4ZUVA 4P3DB 3DX1A 1S7SA 5BQ7B 2WYZA 1GH7A 4G80A 1INQA 3ZUNC 2VLME 3HFMH 2ZSWA 3KPNA 2NR6C 4I18B 3V6FB 4EZMA 5IJKC 3GMPA 5C08E 3T2NL 1DBKL 3IEAA 5GGSB 2AHIA 2DQUL 1MCIA 3EGXB 2WSPA 2D7OA 3T3ME 5KSAD 1INDL 5D4IA 4HLZG 3LEXA 4WEUD 3F7LA 2WBJD 4NLAA 3VFMB 1AXSA 1AXTL 2EEAA 3KR3L 3QZNA 3D0AA 1ZK5A 3A6BH 3P4OB 1ZXKA 5D2NB 5AOZA 2A4CA 3BPOB 3P4MB 4U1MA 5F7EH 1HZHL 4MHHI 3FDWA 5DYOB 2F54E 2V2TA 4XOBA 4MB5A 4PJFA 5F7DA 2JKWA 4DZ8B 1MFNA 4NLHA 4N6QA 1Y0LA 1ZV9A 1F1AA 3CH1A 3R06A 1MI5A 3VXME 1SYSA 2EC9T 1XF3B 4PJDF 4Y4KA 2RQ8A 4I2XB 1TJHH 3MJ8B 2NY1B 1VADB 3KHOA 2FEJA 4R7NA 2UV3A 1UWGH 2EDDA 2ZG3A 2V9QA 2YO3A 3O3BA 3G6JA 1J88A 5M7QA 1KCSL 1DQDL 4X4YA 2Y25A 4UTAH 3H55A 4HWNA 3MBXL 4JANB 3EYQC 2J55A 4KO7A 1TG8A 3CVHH 3GUTA 1TQUA 2QGCA 3B4NA 4JLRA 4ODWA 2EO9A 4S10A 3SPJA 4XVUD 3QPKA 3H1ZA 4PJ8D 1T3FA 2X2JA 3LZFH 5ANME 1I1FA 3WAJA 2R0KH 4HPYL 2JJSC 1UQSB 3P0VH 2FEEI 4PJBF 2JKNA 4MNHB 4Z5RB 2CALA 2EYSB 3TA4D 4B0MB 3EG9B 4G42A 4M6NL 3ARDA 1CYGA 3EOAB 2O6FA 4F37F 1XCXA 4P5TC 4U4IA 4DGVL 1J9QA 4K5NA 3SQBA 5CEYA 5DHDA 4HIIB 3NRQA 4M61B 4XWOC 5D7LD 1A7QH 3QQDB 5EPMA 3RYMA 4EE2A 4HK0B 4N0RA 4ANKA 5C0BB 4HCRA 4R5XA 4ZUSA 4YSTA 2DQCL 3NFSL 4XBGA 4P46B 5F9JA 5C0RL 3EOTL 2DBLL 2FHCA 3GYRA 5MEOB 2XWXA 5A3IC 3G5VB 3F7VA 3V4LA 4EDXB 1AFVL 3TO4D 3V4PA 3WIHH 4A38A 5ENWB 5HHXH 5JZ7D 4MCZB 2UWEB 3E6FB 4K9JA 1QEWB 1P4UA 1JHKL 1AOZA 4Y9CA 3T8VA 1OZUA 5D1XB 4DKTA 1Q1PA 5FXCH 4G6KL 3TBVB 5DQDH 1MVYA 1QLEB 5F9OL 4JE0A 2L7QA 4U1GB 2IANE 4DGWC 1VACB 5I1JL 1P2CA 2GPZA 3A67H 5DTFA 3V0GA 4AMXA 3FTXA 1OV8A 2NQCA 4OFYA 1HEZA 2CHDA 4HX1B 4PP2B 3FQTA 5AZUA 3VSVA 3PV6A 1PY0A 3PP3K 5EIVA 1CVSC 2X4OB 3PJSB 2PR4L 2VMJA 2EXYD 1K6QL 2FGWH 2LFEA 4U6VL 1E40A 3FUMA 3MTXA 5KVGL 2EH7L 1MLBA 4HK3N 2FB4L 4R3SB 4DH2A 1LEKA 1L3NA 4MJIE 2JJVA 3NCMA 1RUAL 3SJVD 4FF9A 4F8PA 4FCAA 4ODHL 1FNLA 4WQOA 1YPZB 2XVBA 2XWBA 2YARA 4U31A 5D7HA 4OCRL 2VDRH 2ZXBA 2CMRL 4BFOA 2OQJB 4G9FA 2DL9A 3FCTB 5FR3A 1CIUA 4ZMPA 4NCC1 4G6FB 3RVUD 1DJIA 3MLUL 1PG7L 5KSBB 5LNDA 2P44B 4KO6A 4ZUWB 1YN6A 1RK1A 4IYKA 2E5EA 3II3A 5IM7B 5SX4H 1YSOA 2X3CA 2BWDA 5T33H 3WS6A 1IGYA 3ZGHA 5IQMA 5C0ND 4E5XG 4NQDE 2ZNXA 1XR8A 2DS4A 3NSCA 4QXWA 1NCAL 3D50A 2BNRD 2QSTA 4BCXA 4LU5H 1ZIBA 4JR9H 4I3GA 3CFKA 1N68A 4DGYH 1W2KT 1B2WL 1MJ8H 2EICA 4JCLA 3S36L 5IF0A 3ARFC 2YAFA 3F04A 3UBGA 2ZG1A 4L2LA 1U2HA 4EMZA 2AANA 1TTFA 3ML8A 2VDLH 2WQAA 4UILL 3P0YH 4OBRA 1H5BA 4YHLH 1PPIA 4N90D 1P84J 2OP4L 4NEHB 1XH3A 4ZDHA 4QRPE 3QWQB 5ECJE 5EN3A 2OCFD 4U1LA 5FWQA 1N59A 3EUUA 4PY8I 5BW7A 4Z7QF 5JXEC 5DRXA 5ISZB 3FW6A 3QQ4B 4WK2B 2IG2H 1ED3B 1HKFA 2EE9A 3X1EA 1T21B 1FYTE 4PY8J 1DLHB 2DTSA 4HJUA 1BVNP 2OI9B 5E1AA 4D94A 4ZMNA 4U1SB 2ZOUA 4HOWA 4TMPA 3Q6GH 2Z4QA 4RAVB 2Y07L 3ABMB 4JFDB 3I9IA 2EXTA 2JVUA 4HBCL 3SDCA 5AW7B 4AYGA 3IDMA 5JIKA 1XB3A 4GQZA 1TTCA 2OMTA 1A47A 3CFCL 1FRGL 1O75A 2Z34A 4AKOA 1ETA1 1HI6A 3VXPB 2QGDA 4Y19D 1DCEA 3BYTA 1INEH 1JERA 2EEXA 4NYLB 1R47A 3WXVL 4BWWA 3JVFC 1E9OB 1QFPA 1GW0A 5IV2B 4JQVA 2Y7OA 1YQ2A 3EYUH 3ARUA 1XSJA 1VAHA 4U1KA 3KBPA 4LKCB 2OX5B 3KPSD 1TF4A 1NCIA 3MV01 3WJJC 2H2PD 4ZO6A 5E6YA 3K71A 4M7LT 1SF5A 1NDMB 4MAYC 5CJOH 1F1DA 5I1CL 4Q74A 2EIZB 3TZVB 5I71C 1PX3A 3VM7A 4P57B 5BZXA 3IETB 4JS7A 4B9JA 1T7YA 1NBQA 3LNDA 5DZ9A 3KNBB 1BZ9A 4XNYL 3Q8EA 3Q7JA 4ZPVA 1YEJH 3RTQA 3UPRA 2AJSH 1HZKA 4UM9D 2OULB 1NGYB 1UB6B 4MD0A 3OB0K 3SDAA 1MWAL 2CLRB 3CMGA 1X5KA 4X9IA 1KJMB 3B7TA 15C8L 2VDOB 3NGBB 1TZHB 1NGZB 5KOVC 3ZJAA 4LQFL 1NCBH 3QCVL 1XF2A 3N2JA 1D5IH 3PWNB 3FQRA 1TFPA 2X4SA 3RWGA 3V4UL 5FO9B 5F88B 1CFVL 4S1SL 2F58L 4TULL 3KYNB 3KZ8A 5IROD 3L4ZA 2Y36H 2C9PA 3GIZL 2EVHA 2IALA 3LNGA 4DPAX 3ILQD 1A6VL 3O4OC 1TZIB 2OBGA 3QHTC 1CLCA 3MRPA 4PN6A 5JOPD 4CJ1A 2B77A 5KSUB 3KYAA 2Y5TA 3LRLA 4JHBA 4RMBA 5BZDB 5IW3A 4FD0A 2GBAA 2P5ED 3MJGX 1CMOA 2E7HA 4NBZB 4HAGA 1GGBL 4TVPD 4EN3D 4BH7B 3IWVA 4WW1B 3UDWC 2V2XB 3EGDB 1GRWA 1IFRA 4FNLL 4LCCA 4R84A 1K9TA 4WKXA 5HYEA 1NEZG 2X09A 1D6VL 1AHWB 5MP6H 3QUMA 4HEPG 2PR9A 2DLFH 3N04A 1IFHL 1OSPH 2YAQA 5I0ZA 1GOGA 3CFDB 4IKLA 5INDA 5FOJA 2VRKA 2CAKA 4OVUA 4YLQT 3G5WA 4XXWC 4KQ3H 5CJ5A 2H4EA 4EI6A 5I19H 1A4BA 4NWUL 1S7RB 1KELH 1DTUA 4PRDA 4TLKA 3SE9H 1I9RH 2EDEA 4B60A 4E42A 5B4MC 3CUPB 3NDZE 1Q94A 1VESA 2VZSA 4OZGA 3GLDA 4NZRL 3VRJB 4BSWA 2GSGB 1MRFH 2OR9L 3MUJA 4OZHF 4Y8DC 4ONHB 4R0LB 1DQKA 4BGDA 5TQ0H 4OKDA 1RZIA 2XPZA 5JQ6L 2CBQA 4DWHA 3L3DB 4NM4L 4NRZB 4HV8B 2QMKA 3O6ML 5IB4A 2JIXD 3U83A 1JP5A 2FBJH 4XZUA 3ARBA 4OCXL 2GUOA 1RIUH 3WFBL 3L3KB 4GUPA 3AS1A 1F4WH 4V2CB 3MAWA 5FC9A 2ZUQC 3NCXA 2QSCH 5CIPB 2IAMA 4P2QD 2Q76A 5F96H 1A3QA 4XRCB 1UVQB 5CINL 1FFPB 4AQZA 1FZMA 1OTTC 4JFFB 5C09D 4JGMA 4FQ1L 1ES0A 3KPLB 2WMPB 1WCBB 1CWVA 4MMZB 3LRSA 2BM3A 3IU3B 3BD4A 1OT4A 1G7MA 5AVWB 3HZVB 1U8OB 2YKLL 3VI3E 4IBQA 1UG9A 1TZGH 4NUGL 3ZW3A 2F68X 9CGTA 1FNFA 3QFJE 4YXKL 3UIYA 1S6NA 1FZKA 4YZFE 4PLJC 3VDAA 1U8QA 1KTDB 2V6HA 2VXSL 5FO7A 4BZYA 3RBGA 5CCKL 1PYWA 4J4PC 4K4KA 2AQ1A 1Q0EA 1UXMA 1HN1A 4GRMA 5SWZB 4DAGH 2GBVA 4PV8A 1SMOA 1TKWB 3L4UA 3U1PA 2IH1B 2XPYA 3IDIA 1PMYA 2FX8L 5BVPL 5IQ9A 3NQKA 5J11B 2Z91B 1EAOA 3N42F 1E90A 2NY5H 4L4TB 4N0YH 3RPKA 1ZTXL 5DRZB 1HCVA 5KEZA 3WDHA 4P9ML 3EAKA 1BMGA 1ETB1 5IVOA 3GS7A 3SKMB 5CM1A 4JO3L 4MWFB 3WDIA 1I75A 2DQDH 4TNWK 3NFPB 1YYCA 1CJYA 3W0WD 1NC4B 4JAMB 4N0UA 1SN5A 1MIEH 3DX9A 3O6FD 1GJWA 1UXSA 3DOHA 3LZOA 4F58L 1IMHC 4J3WA 2IQ9H 1DVFB 4OBSA 2OKMA 4JPQA 1IT9L 1FIEA 5D1ZD 4V1DD 2CCVA 5KSAC 4QOKE 1WGVA 3WDJA 2WBJC 3OM3B 3RPIA 4EF3A 6PCYA 5CWSA 4YK4B 5DHYA 5M94B 3B6SA 2KDYA 4GO8A 4HJ1A 5J1AA 1RPKA 3ZRFC 3MBEB 2FLMA 1X7SA 3ROOA 2ZPKL 3SE8H 1Q1JH 2XNAB 3AXIA 4BIKA 5EEVA 1AZBA 1JGEB 4M6ML 2Z31D 3MODL 4XHQA 3NBNA 4QGYA 1ACYL 4QHPA 2EO7A 4UT9L 3VGGA 1VFUA 3PIQB 3QJUB 3N3EA 5DQJB 1HWWA 1G9NL 4G1EB 4DESA 4BFNA 1S2EA 5GJSH 4LSUL 5LGYA 3WKYA 4XPHL 2NUTA 3CVHB 3GJFA 4NXSA 4ZNCD 2FT7A 2OS7A 4WO4B 3N41F 4YC2C 1G84A 3RWHB 3T3MB 1FNAA 3GSNL 3SIKA 2MMXA 5JDSA 3S88L 1WK0A 1NEZA 3GMMA 3H3PH 1OGTA 2AQQA 4MSWB 2XZQH 2DAVA 4NERA 1IM9D 4XVUC 3QNZA 4PJ8C 4NIKB 1ZLSH 1MG3C 3ZMRA 3TBTA 3TEXA 1DZBA 2VLRA 3FQNA 1TYEB 4LAQH 1BQKA 4HS3A 5FHAL 3G6DH 1TYJA 2EJ1A 3G9AB 4Y4FB 2EVIA 4IGBD 1X5XA 4NP9A 3AXLB 3GMOA 3RFRA 3VXMB 5I1KH 2EINB 1CGSL 3ZTEA 3OLEA 3QUYB 1RD6A 2LHAA 2Z65C 4P04A 1CICD 3S5LB 3KPTA 5ESQB 4U3SA 4GI8A 4P9HL 3T4AB 4ZW6A 5EF0A 3T0EE 3STZB 2P8PA 4GT7A 4HWBH 4WW2A 1KN2H 3ZDXF 2ENJA 3EGXA 4UQ3A 1CTNA 1Z6JT 1G1CA 1M6OB 4YBQD 1HL4A 3DX7A 3OGCB 4M48H 4UOW0 4JFTA 3OG6B 4UQCA 3TO4C 3ESOA 5TE4H 4F7EA 5JZ7C 3GC3A 2E7LC 3PWVA 3VFGH 3S4SA 1VEOA 1J9RA 3P73B 3AM8C 5ANMB 4ETQB 5D70L 2CHZA 4FFZL 4UZUA 1CI5A 3WEXB 4XOAA 1JF6A 2AI0L 1Z9OA 1EXGA 3F05A 5T5FH 1G9NC 4I7ZC 1BQLH 4RGNE 4DZ8A 2B0SL 4NZTL 1RLWA 1QSFE 3RL1A 1RQ5A 4OLXL 3W38A 2SODB 2BOBB 2VR5A 4OZFA 2HTLD 3S96A 2EXYC 3MJ8A 1UA6H 2AMGA 2PF6A 3OGOE 3OXSB 3JWOH 2B5IB 4FQJL 4WY7L 1NUNB 2OK0L 1BLNB 1F42A 1C1EL 2C34A 2IFFL 4L1LA 5HHQB 4W70A 4AEFA 3VB9A 1XQ4A 5C0AA 4NN5C 2WYTA 4H4NA 4OLVH 1RJYB 3F8UB 1HC1A 4O2CB 1S7QB 4HEMA 5I1GH 1Z2KA 2ZYIA 5E2TH 1OAXL 2IANB 2CRYA 2A83A 3WXWH 4DHLA 5MEQA 1OWRM 4N3UA 4UYQA 4P9HC 4PW3A 2YRPA 4KX7A 1DZ0A 3QEQA 4Z23A 3US1A 1OF0A 5C0NC 4WEBL 1G7IB 1QWNA 3UFIA 3MLZL 1T83A 4UT6L 3TJHD 2BFVH 2X6UA 1QSVA 2VDLB 3NACL 3K81A 3BP5B 5MEOA 4MJIB 4Y4KD 1KTLA 2QR0A 3C5JA 4D0DA 3DECA 3B83A 3OJDA 4K7PY 2F7OA 4G8AC 2G2RB 2UWEA 5SWSB 1QEWA 5HHPA 2V9UA 2GBTA 2ATAA 1FL5B 3LZLA 4ZMWA 2GTZB 4R96A 2W0FA 3F5WB 4I8DA 3BEVA 4Z77B 2FQGA 1CU4H 5E2UL 3QRLA 2D2OA 4UAOB 3RI5K 1JGVL 4ZPTB 1FIGL 5KSVB 4LLQB 1YUHB 4HF5H 4PP2A 4MJ4A 4I0PB 2QFPA 1XH2A 4D3CL 3RQ3A 1LO2L 2J4WL 3WN5A 5LBVA 4NQDB 2K1MA 2DJMA 1V3JA 4NO0B 1W16A 3HHMA 2DF3A 4X6CF 4HFWB 5JO5A 5LGKA 4F57H 3T71A 1NGQL 5F0JB 3SDXF 1DFBL 1KV7A 1F11A 5KS9E 1TQCB 3MV9A 4MXVE 2A77L 2BDNH 4OF5A 4LO9A 3VQLA 2K8MA 5I82A 2W59A 2C9UA 1OP9A 1DBAH 4DETA 5ADPH 5I18L 4G5AA 4AIZB 2NW2B 4F5CE 2R4SH 3EJRA 2Y1VA 1LILA 1OKEA 4M8QA 5J7CC 4KXDA 1MW2A 4XPBH 5GJTL 1JN6A 2DIJA 4QRPB 3LRHA 4QYOA 4ZUWA 2E3VA 2N0KA 5B3JF 1JI1A 4QPEA 1S7TB 2IADB 4GG8A 4PBVC 5I8KH 4TVPL 1JV5A 2TRYA 3IFOB 1FYTB 1OW0A 4OFYD 3AMLA 2CKBL 2EDYA 4LXFA 1CGXA 2F19H 4RSYA 4ES9A 1N18A 1JDDA 2VDQL 1A8ZA 2IWGA 5C7XL 2H2PC 2O93L 4HCGA 3K72A 3GMLA 3Q3GA 4GKZA 4NRXB 5DK0B 1KB5H 2FUTA 3DRQB 3DMMA 3MRBA 4EZJA 4X4ME 2B8OT 4IK6A 2YD9A 3D39A 3MLTB 1BG1A 3U0PA 4NN6C 1X6LA 3OAUH 5E6UB 4OR1A 2CK0L 1QNZL 2IPUG 1EVUA 1ZVSA 2IIJA 1SJVA 4Y89A 5K9JH 1DANT 1R24B 5EU4A 3RE0A 1HQRB 4GQ9L 5TF1H 4AC4A 2FT6A 2R1XB 1U21A 1SPDA 2M83A 2VDKL 1QPPA 3WI9A 5D7JA 5LBGA 3WTVA 1UM4H 3LX9A 3F7YB 3UTOA 5B3NA 9PCYA 2WGNB 1DLHA 1KLFB 3V8CA 1WAAF 5DT1H 4OLWH 4Y4HD 3TU6A 5E2VL 4QGTA 2XTJE 4QAMB 1ZEAH 2NTSP 4NC0B 3IXTA 5IROC 5ITBH 5I0WA 2WZAA 1R34A 3IJSB 1ITCA 4HQQL 4KTEL 2FL5A 1A3ZA 3ILQC 3SO3C 1UCBH 3HCVB 1ZS8B 4CVXB 2P47B 3FQXA 4ODSH 1GCYA 3U9PL 4HUVB 4F7TB 5CJQL 3MR9A 1Z5YD 3IYLW 3MJWA 1Q9WA 4LL4A 1X7TA 2ALAA 4OGAD 4XVTL 3PXJA 3MX0B 4EOWL 3IK2A 4UMSA 4EN3C 3CDCA 2CH8A 5IV2A 4E41A 3WU1A 4OV5B 1NUFA 3F01A 1E5CA 2I69A 4JDTL 1E6OH 1K5NB 2LU4A 4LCWE 3X1FA 5LQBL 1NPUA 3AWEA 2OMUB 3U48A 4M7KH 2VWEE 3KJ6L 5HHVH 4KKZA 4XT1C 4LIQL 4M4PA 2AV7A 3P30H 3PHSA 4KDTC 3BDXA 4JFHE 3D09A 2P1YA 3HHSB 3IDNA 5IOPA 4PRPA 4AGPA 3NJKA 4QMEA 5D7IF 3C5ZC 5HDBB 1YN7B 2CO4A 4XBMA 3JYBA 1Z9MA 3KNBA 4WUKH 1P5UA 4NFCA 3SDCD 4DN3L 3RVXD 1AS6A 4WV1B 5C2BL 1FNGB 1UM6H 2Q5BA 5AAMA 3E3QC 4PGCB 2GKIA 1NGYA 5EEWA 5KVDE 1UB6A 1KY6A 1KNOA 2CLRA 4ZRGA 3QJZA 4A7UA 4U1JA 3NPSC 1M9SA 3PP3H 1W0WA 1JXFA 2ADGA 2VQTA 3DLQR 4KK6D 1DL7L 3Q5YA 2BO0A 2QZQA 3GSUA 3PWNA 3BSZL 4JFQA 1DN0B 1KCVL 4CN6A 3ABGA 2VXUL 5AZEL 5ICXA 1PSKL 1LNUB 5DZLA 4PJFF 2HX7A 1HL5A 5IFAL 2H0JA 4MCYA 3WTWA 3EFFB 3FO9B 1A02N 1F00I 4IRSD 5I66B 2LT9A 4JY5H 2IPTH 4PHZA 2H2SD 2JTYA 3K74B 1CF8L 3S0PA 2KMWA 1JZHA 2D3NA 4F37K 3JT2A 3ZKQD 2Q3XA 1CLYL 4KJWD 1KGCD 2BIQA 1EJ8A 3VI4A 2CBPA 3VW3H 3LJ3A 4Z3GA 2YMOA 3G6JF 3L4WA 4DKDC 4KX9A 1BD2A 1RUKH 4IIZA 3RTQD 3I6LD 4R97B 4YOKA 1BZ7A 3FUEA 3QWRA 5HXMA 2AS5M 4G7YL 1D5BB 1AHWA 1XGRA 2YWYA 2ZOOA 2FWOA 2ZCLH 4ZX4A 1MELA 4Q0XL 3SDAD 2IBGA 3CDFA 4PJXB 4ZFFB 5KVDH 3EUDA 4JKLA 3CFDA 4KNUA 1UTDA 3REVA 1J1PH 2ZTBA 3NIFE 2X38A 4BCYA 4FA6A 1QA9B 3BDBA 2WPGA 4K2UH 2LQRA 3BP6B 2BS8A 3O9WD 1A25A 5CUSH 3GINA 1PCSA 4C83A 2HKHH 3MN8A 5AWNL 3KWTA 5CZXD 3S5LG 4JG1H 25C8L 2JFCA 2K4AA 3VRJA 3QXDA 3VI3B 2GSGA 4LCYB 1ANUA 1JZ2A 3BAYA 4ONHA 4R0LA 4WHCA 1DQQA 3QFJB 2DWDB 5E9DE 3FB7A 4AJVA 3O6FC 2UZIL 3S37X 1F4XH 2EH8L 3T0AA 1NPJA 5KJRL 1TNNA 5F1SA 4WJ5A 4X80L 2QHLA 3K4DA 2IH8A 4JZOB 5E0FA 4AH2B 1PAZA 1SXSA 3DURB 4GKOA 2A9CA 5A40E 3D0VB 4L8DB 5L88L 1QYGL 1S7VB 2IOIA 3N6YA 4ANXA 2YFNA 2OTWB 2ICWB 3BUYA 5C0DA 1QBML 5CIPA 5KTEH 1TIUA 4GSXA 1K4CA 4NJAL 3CZJA 1DSFL 1DVXA 4JFFA 2FDBP 4KV5F 4RVBA 4TQEL 1PBYA 4Z7VA 4OLUL 2Z31C 5FYJL 3CVBA 4DKFL 4MMZA 5ICZB 2XVKA 3CFUA 4X8CA 4RAUA 2OCCB 1CL7H 4XPGH 3P3UA 4NT6A 2OSWA 3HZVA 1U8OA 3WFEL 4FCHA 3E9UA 1ZV5A 4FQIL 1YC7A 2CO7B 1R5VA 3HI5H 3FTGB 2JKJA 3K4AA 4U33A 2WLKA 1AGDA 1SOQA 3ATEA 3BAEH 3D48R 4MASA 5IQLA 1QR1A 4KU1A 2G3NA 4IJ3B 3T0BA 3CLEL 1J8SA 2VR7A 3APNA 4QOKB 2FATL 5BRZA 5DJDB 4ELKB 4U05A 1F3RB 4GMSH 2YAPA 3GXTA 4NOBA 5E23A 1HTYA 5IFHL 2PP9A 1J8RA 4GQRA 1QFWL 4QHLB 5T3XD 5BV7H 2E47A 1JSYA 1GS6X 1HKLH 1PLBA 1MFEH 4GW4B 5HGBB 4DP8X 3B2DC 4X7SH 4JKPH 1BQHA 3L5XH 3G04B 4OT1H 4JB9H 4AJ0A 4YLCA 3KLSA 3GXMA 5J1TC 2R2CA 1RSFA 4NQSA 1N9PA 4XO9A 3O0RH 4WIQA 2QKSA 2XOTA 4IGBC 4I4WB 2ZKHH 4OI7A 2MOVA 4YGVA 4N0CD 3W5NA 2DQIL 2ZJSL 4TL4A 2C9AA 1SLWA 4Z18A 4ZG1A 1A14H 3TVMA 3PGCA 1ZHBA 1CICC 2CHWA 2GT9B 5AEAA 3I50H 2DQFA 3OB0H 4WI0A 4UTBH 1WUZA 4PMEA 2DMCA 1MFMA 4HHWA 1FJ1A 2NXYB 3B9AA 1ZT4B 4BHUA 4YBQC 4EDWH 5B7MA 4NFDA 1BIHA 3SQOL 3BHBB 1XXFC 4ACTA 4M9PA 3VVVA 2BVYA 1MXDA 4IOIA 1O9VA 4NC1E 4FQCL 3FSOA 4O2EB 4IKNA 2NY3D 1ZS2A 4WO0A 5GRVL 3M17A 2HCZX 5GGVH 1HSBA 2AEIT 2XNAA 4QHUB 1NSNH 3QP3A 4EN2A 4PS7A 4DEUA 4QRUB 1ZLUK 1EXHA 1OAUH 4M00A 3DSFL 1KLUB 4UT7L 4GKLA 3NJFA 4PJ7E 4OM1L 2Q8AH 5B39G 1GZPA 3K5RA 5DQJA 2G9KA 1EVTC 4G1EA 3BXNB 3RURA 4XPAH 2CJSA 2HX8A 4GO9A 4OQTL 3S2CA 3T0EB 2HTLC 4YE4L 4X99B 5LNEA 3TJPA 2I07B 3FFCE 4XCNB 4XAKD 4NQCE 5K1VA 4ONGH 2RGSA 1WZLA 3D2UA 1WZ1L 3ZL4H 2GVYA 1N10A 4KDWA 5DUPL 3KLQA 1U58B 4M9OA 5CGTA 3LOWA 2XQBH 3NA9H 5E94B 1KPVA 3KM2A 4N2IA 5IVXE 4IOFD 3HNTH 1MQKH 3RGBA 4BELD 1R3KA 5I5RA 4FLSA 2ARJB 3VXOA 5LGHL 4KDVA 2H1PH 3LN4A 3Q8FA 4FXLA 4RGNB 5A6IA 1ZXQA 2O72A 3W5MA 1LWJA 4WNQB 4TOYH 4IIQB 1DANU 1EFQA 1QSFB 1JK8A 2AABH 3WE1A 1PY4A 4WKZB 3FCUB 3VD0A 4A04A 3RNQB 3ZLQC 3GHEL 1IB5A 3CLFH 4CSSA 3MGOA 4DT2A 2H8PB 4F3FA 4XMLL 3FTYA 1OM3H 2V7NA 3H2QA 5E8OB 1EZUA 3TJHC 5EU3B 3DUSB 3LQAH 5LHDA 3OZLA 3SOTA 1M6OA 1I7ZB 2YXWA 2XJLA 4HIXL 4L1HA 4Y0GA 3AJ7A 5FUZL 4Y4KC 2Y5QA 2PCYA 4JZJB 4U7KA 3Q6FA 1KPUB 4ETQA 2V7HB 3D87B 3PHQA 3JWNG 2H47C 5I1LA 4UZSA 2QELA 3BD3A 3ZDZE 1IAOB 3KBFA 5E6RB 1X3DA 4CJ0A 1NGXA 4ZX5A 4HUCA 3F58H 4ILDA 5H2BB 1JPGA 2BIPA 4J3VA 5I6PA 2ZOKB 2YA1A 1EBPA 3LEVL 1MCPH 1XEDA 3QRGH 4XR8C 4APQB 3VWJD 4FG6C 1AQHA 2WOBA 4HXAH 4O58H 2NY6B 1TJGH 2IMNA 3INUL 2VLLB 3MRJB 3ERXA 1HXMA 3N85L 2WJ7A 3KWUA 5EZOL 5HHQA 2FSEB 4B97A 5BCAA 2J5LB 1EAJA 4JK0D 3WO4C 1I3RB 2R2EA 2VMEA 1WV7T 1DQMH 1TQBB 4H8WL 2A9MH 1QRNE 4RGOL 3VXSA 1A7BA 1NCGA 4IS6A 1G0YR 5KANG 2WWNA 3C09B 2C1PB 3DYMA 5JHDD 4AVJA 3ZOAA 5I15L 3H0TA 3TNNB 5BUGA 2O5NA 1EIBA 1ZGLP 2YPLD 1CE1L 2HPOA 1KLGA 5A2JH 3D25A 1KB5B 2APTA 1JL8A 5I74B 5IIEB 5EOCH 4NKIH 5E4AA 1G7IA 4LE8A 2ZUYA 5DJ8A 5GGUB 5E2JA 3RIAF 3QC5X 1NFDA 5E9NA 5IMOB 1V3LA 2OSYA 1DQLH 1QFUH 4ZOCA 1D5XB 2OJEB 4JQXA 2I60L 4K07A 4ABVA 2Y72A 1BYPA 2X2HA 1NLBH 4OZGF 5CJXA 4RZCB 4U2ZA 1AGEB 1UCTA 3FUNA 5SWSA 1BWWA 4XP9H 4BBWA 3O41A 3FH8A 3PNWA 2X5PA 4M6OH 4WTXA 1TTUA 4CMMB 2X9YA 1EHLH 3HG4A 4P3WA 3F5WA 4M1DH 4NAMA 5J13B 1OAQL 2QKIB 3UCRA 5KAQG 5C0AD 4ZPTA 4L48A 4HKXB 1FPTH 3U46A 4NI3A 1YUHA 4OM0H 1XGYH 1F6LL 7PCYA 4I0PA 3KPRA 3CSYB 5KVFE 1TPXC 3BKJL 4M02A 3D30A 5B39A 1IC4L 5I1AA 1O6SA 1F90L 5B22A 3V79C 2OJZL 3ZE1F 4H25A 2DYRB 3WS6C 1DE4A 1XB8A 4Y4HC 3QEQD 4HFWA 5I1HH 3DDFA 2Y7QB 1IAII 4DKAA 1S3KH 2D7TH 4H8WC 5I28A 1OZTG 1EDHA 4XVSL 1F18A 3VFRB 1MZYA 1PTZA 3AQDA 3ME0B 4ZXBD 3QO0A 3W39A 2ZCKL 1PZ3A 1O5DT 1M71B 1XHHA 5EO1A 2XBDA 3VXRE 3TPUB 3R0NA 4UQDA 5CSBA 1MCEA 3WKNA 1BGXL 4L2YA 2YD1A 3AFLA 2XG4B 4OGAC 1SOSA 5DEFA 2J7LA 5CJ8A 2GITB 4PTTB 2ZIDA 2SEBB 2YEZA 4FMKA 3UMNA 4LRNH 4WWKA 1R3IH 3FT4A 1IGTB 5EIIA 4J39A 3MXWL 5AYQA 5A16A 1AO7A 1Z3GL 3MACL 3IKCA 2AAVA 1KXQE 3NP3A 2QGEA 4HWUA 2M8XA 2XTJB 3OAYK 4L1BA 4WI2A 4PLNC 3BKCH 5KVFH 4ABQA 4LEXL 4CW1B 2VL5A 3G6AA 4C59B 1HL8A 1T0NA 1I8LC 3GNMH 2C5DC 1KB9J 1BZQK 5B7EA 3O3DA 1HYRC 4JDVA 1J0KA 1UXLA 4HZ1A 4QRTB 3MRNB 4OLZL 3MV9D 3ET9F 1A6AA 2WWKT 5C9JB 3SDCC 2HWZL 3TFKD 3RVXC 4Q6IA 4HOXA 1IGML 3BP4A 3OX8B 5GRZA 5LN4A 3RJDA 2BSTA 1QO3A 2VZOA 3MA7B 2R0WH 3W37A 3IDGA 4MXQD 1AMXA 4LZKA 3NJLA 3MRDA 2XN9E 5MEPB 3X17A 1NC2D 1UJ3B 3QIWB 4KK6C 4LCWB 4URTB 4HMCA 2JB5L 3QE5A 2MPVA 3IU4H 4UUJA 2A4EA 6PAZA 4G8IA 3IJEA 4CMHB 1TVBB 1R46A 3L5WB 5EUOA 4C56E 2GJRA 2BP0A 3K80A 5FKPB 3HB3B 1RK0B 4ATWA 1F2QA 3D3VE 1J8HD 1T7WA 4YPJA 3WHE0 4B3EA 1HOCA 1J9SA 5HYSA 4JM4H 4RDQG 3MRRA 4IRSC 4A6YH 1QNIA 2XDHA 1C8QA 4X8XA 1FLRH 2H2SC 4HFUL 4CVXA 3HCVA 4I9XA 1ZS8A 5C71A 5ID0A 3HMWH 3TA3B 2WINB 5KUMA 3DMMD 1OGAA 4R7VA 4KJWC 2BOCB 3FMGL 3OMIB 1U95B 4TUOA 1UACH 1KCBA 3JTSA 3MCKB 4LVNB 4W9JC 1T89A 2VMDA 2X4PB 1Q72L 1QI4A 5HVHB 3SPHA 1HAUA 3FBKA 1TLKA 4GSDH 3RTQC 4MQ7B 4ECNA 5EOTB 3N55A 4M5SA 3U4AA 5H4ZA 2PCFB 4DPBX 2HFTA 4NZJA 3PRZA 3OKKB 5BO0D 2F8VA 3SDAC 1ZT1A 2OMUA 2W07B 1B88A 1TENA 4NRYB 4TXVB 3T2NH 5D7JD 2ADIB 2GY5A 4GPVA 1JGLL 1UWXH 2I27N 2JB6A 4KOBA 4K3DL 2ROXA 3RILA 3UGEA 5C6TL 5A2FA 2VJ0A 3O9WC 2CLZB 1INDH 1UYWL 5F7WC 5T3XL 1KXVC 5AZ2L 4QXTA 4YL9A 3WFDL 5TE7L 3ES6A 1AXTH 1UUNA 3LKNA 3L9RA 5CZXC 4N4YB 5IJCC 1UKSA 4RLDA 4Z95L 4WW2F 3MYZA 5LGJB 4G7QB 3QDJA 4TSBL 2X2YA 1HZHH 3WIIL 1CDUA 1H8LA 3ARGB 5AOIA 2UXGA 3MNVB 1LEGB 1T4KB 1CXHA 3BLPX 3MA9L 3PPSA 4J3TA 1A7OL 3TEUA 5IMLB 1I8AA 1WC7B 3ZL1A 4PG2C 4NWTL 4UOZA 1DJHA 3ZK0A 3NIFB 1BMWA 1TVHA 2BWQA 4E41D 1X44A 2WCSA 1G6RA 4FQQA 5EBWA 5D93B 3EFFA 1KCSH 3HE7B 4HT1H 3SN6N 4I85A 2OXGA 3K0WA 3MBXH 5HSFA 3IVKB 1FL6B 4RMVA 4Z7AA 3ILPA 1KXTA 5EC1B 3BGMB 4X6DA 3RRQA 4GEIA 4XP1L 5D5MF 1KV3A 2ZNWA 3BW9B 4FS0A 3WTXA 5FS5A 4PRPD 2ZD0A 1NCOA 3BVNA 5AB1A 5E9DB 1L3WA 1RULH 1VCBC 4ZTPH 3TT3L 1KCRL 1XH1A 3L3GB 5DU7A 5BV7B 4M6NH 3QR1A 4F8OA 4W6WB 3FONB 5LWYL 1LTXA 1DR9A 4YDJA 4WSKA 1FH2A 3G3LA 4PJXA 1KPRA 4ZO7A 3RJOA 3RFZB 1R3LB 4O02L 3RDTB 5E8NB 2AK4A 4RFEB 3NFSH 3QDAA 3Q1EA 4KQ4H 5C0RH 3RZCA 5DJYB 1HSAB 4R4BB 4PWFA 1GS7A 5DA4A 5KZCD 4FTVE 2F5BL 5E6ZA 5IHUL 4F7KA 2VXQL 4RZKA 1AFVH 5JIMA 2YBGA 2IOMA 1NAML 4KJPD 4NQED 4XMXA 3ARPA 4N0CC 1OOWA 2R9HD 5F9OH 4TUKH 2Y2WA 1F02I 3KG5A 5CD3B 1FYHB 4LAJH 1H9DA 1QTPA 1Z5HA 2YUZA 5CILL 4HJIA 5JW5A 4BINA 5DI8A 1EQWA 1L7IH 1MREL 4L8DA 4F8LA 3CZSA 2H6PB 3LKQB 4Y5VC 1BD2D 5ESVB 4I1PA 2PTTB 2OTWA 2ICWA 1K6QH 4QF1A 3KD4A 4YDKL 2NY3C 4U6VH 3BE1L 1YEDA 3V0HA 2FB4H 2YGNA 1IRAY 1WO2A 3GPSA 3MLWL 3OG4B 5ICZA 2NCMA 1RUAH 2XWTB 4B41A 2IWEA 2ZX8A 3K8KA 4Q89A 4UNUA 5J12B 4ODHH 3KGRA 4P2OB 3BIKB 3EOYG 1FGVL 3V9FA 2H3NB 2ZOLB 3ARXA 2CO7A 4OCRH 1LDPL 4RQQB 3FTGA 3RX8A 4ERSL 1MCLA 2WLNA 2WJ5A 2YN5A 4AJYV 2W9DL 2V17H 3VRIA 4L8BB 2YWZA 2WXIA 5IJVB 3N1PC 3OKYA 5BXFA 4JBSA 3O2DA 1GCFA 1ZPLA 2DQJL 2JH2A 5D1QA 4JKWA 3OKLB 4NZDA 2YC1A 4PJBE 1VF5C 2FIKA 4MJ5A 3C9NA 3ESMA 3OWRA 3CZEA 4QHLA 3IF1B 1SZNA 1BBJB 4G8EA 3ARWA 4GW4A 4NKOA 5GGQL 3IAQA 4GRLB 4KNSA 4IOFC 3C6LD 2P42B 3BZFA 1XL4A 3VXNA 2YOAA 3LAFA 3PABB 3EJTA 3M6DA 3NCBB 2YUVA 4P2RE 1D6EA 4YGAB 3FOLB 2EE3A 4OLYL 4KKLD 4PJ7B 4HWBA 1C9SA 4HW6A 1UD8A 3EGSB 4I4WA 4RMSA 1E9PB 3EJPA 1MRDL 4UILH 5IFJB 2RFXB 2G0LA 4RAHA 4PRHD 2ZYSA 4RFNC 1SY6A 5AVRB 3FFCB 3DIFB 4B9PA 3JVGA 4NQCB 4LHUD 3BH8A 5J9PA 2IV8A 3FQWB 5MI0B 4DEPC 4WTZG 3D52A 1JXJA 2MTPA 3SGEH 1UA7A 1EO8L 4AVKA 5JPNC 1GXEA 2GJ6A 2BCKB 5BRZD 2HFEB 4X2UA 1BMZA 5IVXB 4M29A 1TSHA 3RB5A 1SQMA 3KHQA 1Z32X 3VG9B 1TZAA 2COVD 2NCEA 4ELMF 1ZHKA 3KS0H 3EKCA 3QUZD 4HBCH 3KLAB 2Q8BH 1R33A 3DPBB 3R1GH 4JO2H 1URZA 1TQWA 3BXNA 3CFCH 4OU3A 1TJIL 2XZAL 3WSQL 3VWJC 1VGKB 3HG2A 2I07A 3GK8L 1VSCA 1JK9A 1YECH 4X0KA 4Y1AE 3S34L 3QG7H 1S9XB 2D03L 5DVNA 5I76B 3DJRA 1U58A 4KTDL 4WW2C 3BWZA 2V37A 1C16A 2WLYA 4D9QD 1M7IB 4D7PA 1AACA 2GC7C 2VABB 4OKVB 1HCFX 4FKHA 3IMTA 4HIJA 5AW5B 4A67A 4AVIA 2ARJA 3ZDZB 5G55A 3ZTJH 1F3JB 1MJUH 2ZUTA 4LKXB 4C58B 5I1CH 4IHOB 4X4XA 1WD8A 2YPVA 1D9KB 2VZ1A 4MNQE 3PWUB 4Z1PA 3GFUA 3RNQA 4YDMA 3EO1A 4XNYH 4AOFA 4U1HB 2GQHA 1VGEL 1T5WB 4J2QA 2OZ4A 1AQMA 1B9ZA 4O9HL 2GTWB 4RH4A 5CN2A 1T0MB 4UNIA 4C4KT 3WMQA 5FOBB 4HIHA 4JZJA 5LAXB 1CR9L 5F6IB 2OXHB 3WIFB 4YR6A 1M7DB 4PIBA 1QRNB 1KPUA 4DGIH 5LG1A 4QKXB 5TJWK 5J8OA 1GGCL 4S1SH 4TULH 3H54A 1F56A 4J1UB 4YH6A 4Z7QE 4I0KA 2A9NH 2LLNA 3GIZH 4F91B 2YD5A 5EU6D 4YDIL 3FT9A 4I87A 1MFCL 5AVUB 2TRHA 5H2BA 3CDZA 4Z76B 1KGJA 3KL3A 3BIAX 4XVOA 3CVIL 3BVXA 4PCSA 2E9BA 2QJDA 3HMXA 4NX0A 3LV3A 43C9A 1MCWM 4ZFZA 2CDGB 3LEYH 1WTGT 1CK0L 4M93C 3PWLB 4WUUD 2FR4B 1VCAA 2H32H 3UAJA 4FN0A 2VLLA 3T6VA 2AV1B 3MRJA 3LNEA 4AG4L 4FNLH 5C07B 4AGLA 1G1YA 5BJTA 3T8MA 2L8AA 3LPPA 2HG5B 5J6HA 4R2GB 3RX7A 1OB0A 3QJOA 4H8UA 1CFBA 2OMWB 4ZXBC 3V0DA 2H3XC 4OJFL 1WWBX 1IFHH 3GBDA 4OFPA 4X6BB 3HE6B 4OFIA 1IAIM 4GJTB 1HHGA 2I9TB 3DETD 4AQEB 1DUYB 4X6FB 3KYMB 2DI8A 2C1PA 4PWHA 1AZCA 2ZCHL 2HFGL 4R9HA 2JKTM 1CE6B 3MBWA 2X7LB 4XNXL 3VQMA 3B5TA 4Y9GA 2ADYA 1WF5A 1QW9A 2BNUA 2DY2A 4FFYA 3QXAB 4NZRH 1G5AA 5IIEA 3RHWF 1TEGA 1E28B 2ZF8A 4DKEL 5F7YC 5GGUA 5I6XC 3G7TA 2AVFA 5JQ6H 3US0A 2CXGA 1D5XA 1YYML 2AEWA 1G7LB 3CHSA 4NO3B 1ET7A 1RIVH 1T0PB 2OMVA 3WN5C 3FU7B 1BIIA 2L7UA 3MV7E 3M1CA 1ETJA 1ZTXE 3B3IA 4RZCA 1AGEA 2L04A 4OCXH 2J6EL 3OJ2C 3ZKMC 1R5IA 2E46A 3WFBH 1AC6A 4X9GA 3QFDB 3KPQB 3IXAA 3LIZA 1ORSA 5MHSD 5BVJB 1OD9A 1J5DA 4AQ1A 3VXRB 2WAHA 1D7FA 5EA0L 1F6FB 5CINH 1ZLUH 3TFKC 3U4BL 1E0OB 3KL0A 4L4VA 5IQNA 4C4BA 4HKXA 4FQ1H 4E9VA 3VXSD 4F8TA 1FE8L 2XJKA 2HRHA 1AJ7L 5D7LE 5FGBC 5CKGA 5CEZD 2YKLH 3VFUB 4IQHA 5FKAA 2JCCF 4NUGH 4A6YB 4LRIC 2CDFA 4NS0A 4EPSA 2RAMA 2V33A 3S3CB 5HYJE 3VFSB 5IEKA 5F9WC 2EIEA 4JDEB 2DD8H 4Z7VF 1XGUA 4ES8A 1IE5A 4KO9A 3RB7A 5CCKH 1CXLA 1NM4A 1QZNA 1PL3A 5E56A 3VYPA 3FC8A 1T2QH 5FUCC 4G7VH 4ADGA 3DHJA 4JY6A 2FX8H 3L9YA 1M71A 3BWAA 3P77A 1A2YA 1BPLB 2JLLA 2B1HL 1DJZA 1ZTXH 3J07A 3V4VA 1LO3L 3TPUA 3V0JA 4P9MH 4A66A 2APVA 1GSKA 1H8NA 1I8IA 4ORGA 2R27A 4KJYA 1B6UA 1ONQB 4P5TB 2GITA 3EO9H 4PTTA 4UIKL 3MRKB 3BZEB 2E27H 4PI0A 1H19A 2XN9B 5DK2B 1IGTA 2DMHA 3EFDL 2JI2A 3L9EA 1OXYA 3BUDA 1IZJA 3CK0H 1TVDA 3F6IA 1M7XA 3BAIA 3QG6B 3I6SA 3KPRD 1Q38A 2NT0A 4OCNC 4C56B 4ZOEA 2VLJD 5D7JC 4UQEA 2OFQA 1PZAA 3D3VB 3UG3A 1UT9A 1K2DA 5AENA 4F2EA 2B1AH 1E5BA 1U8NB 1S5HB 4OZHE 3SJVE 1PAMA 1KTBA 2CO1A 1ZA6B 5C2UB 1WQVT 3FZUD 5J1SC 4N86A 2VXVL 3UBHA 4APXB 2FO4A 2UYLA 3UPCA 4WDIB 1C08A 4FHBD 3H7BA 4M1GL 4PLOB 1XGPB 3PAUA 2J25A 3MODH 5K9KB 1UOWA 3GRBA 3GUFA 1E7VA 3UTSA 2J8UA 1WAEA 4UT9H 4KUZL 5MEPA 2ZSVB 3U7WL 5AG9A 3QIWA 4G9DB 1CZ8H 4BA0A 5B3SB 1B6DA 4HWZA 1KDJA 3FRPB 1RUPL 2YD3A 4QHMA 2BNRE 3OHXA 3DVGB 3F84A 3QHFL 2YD6A 4W9CC 4WWKD 2QVFB 5DHVH 2B4CL 3VFWB 3IJHA 1AO7D 4NHUA 2JE8A 3K6DA 3L81A 1DEEB 3GSNH 3HA0A 5DD3L 1DJYA 3QQ9D 5EBGA 4B53A 2BP8A 1N8ZB 2CRZA 4OB5L 4DUVA 2WINA 1G4MA 4L3CA 4R90L 1XWVA 1JNLL 3QH3A 2VKWA 2BOCA 3JZYA 3QQ3A 2QQQA 1BREA 1ZWIA 2CO3A 2R0ZH 5D8JH 3EF4A 3CXDH 5FHAH 1E6JL 4MB4A 4V2BA 3FB8B 4HJGB 3T1FB 1J9TA 2V5TA 2XQYA 1BSIA 5CBAA 2PCFA 4KHTH 1CGSH 3VACA 3W9EB 2P24B 4JL1A 4PGJA 5DMKB 3MJ9A 3AG2B 1G7PA 1SN0A 2X4RB 3ARFB 1U6AL 3NOIA 3M86A 3D06A 1MN4A 2I9LB 3Q5TA 4D0CA 4B9IA 3RG1C 4XWGL 2MSPA 3D18A 1PD1A 2HUEA 1M42A 1K8IB 2LLGA 2WTPA 4JUTA 4MJ6B 3ZYOA 4DVBB 3PAZA 4QT5B 3RNKB 4KJPC 3IRCA 1PF3A 4Y19E 2ED6A 2R9HC 5LAPA 2AQNA 4PW9A 3DVIA 2AI0H 3ARGA 3Q0HA 3VSQA 3HRPA 1KENH 3X3FL 3WV0A 4NZTH 1P7QB 1DDTA 4AIXA 5IMLA 1FG2A 4YEEA 5EO9A 1GHFL 2B4CC 1K3ZA 2Q6WB 3LN9A 3MGTB 3NIGF 3KPSE 2IDUA 4FYQA 1Z9PA 4G1MB 2VLKA 4KMLB 2DJ4A 1AZNA 4FJYA 5KYWB 1GYCA 1GOFA 3HE7A 4FTVB 3EJZD 3UGXA 2R2HA 2OK0H 3IVKA 1FL6A 1RH8A 3DBXB 3KVDD 1SJEA 4BD4A 2JELL 1L5GB 1CLZL 3BVUA 4M4RB 4A37A 1N4XL 3TNMB 5GGTA 1NICA 2EZ0D 5E9DA 1BJMA 3HNVL 2AVGA 4FP8L 1BJ1H 2IMMA 3GBNH 1OAXH 3N5AA 4QHNA 1P4LA 3RIAK 3UJJL 2WC7A 1DVTA 2CWRA 2WVVB 3FONA 4Y2DD 2P48B 4ELDA 3IFNL 5IHZB 3QDJD 5I5MA 2PKDA 4DOHE 3ZZQA 3THML 2DWYA 1JZGA 4BKLB 1YMMD 4K3EL 4PWJA 1C5CH 3RDTA 3K6FA 4MAYB 3QXWA 4P2CG 1GY1A 3NACH 5I71B 2AGJL 4OD2A 3C6LC 1E5UI 1A1NB 1CPUA 2CIIB 4M7JL 3UC0L 2GC4C 2QVIA 4KKLC 1AOHA 1JCKA 5JOPE 4MBOA 2F53A 4U6HA 1WBXB 1MHEA 4QTIL 2Z8RA 3QCTL 3ZDXE 2EILB 2YZ8A 2HVKB 1NFDF 2ZWNA 1B0RB 4DP0X 2CNYA 2P5EE 4JY4A 1A4CA 3TJEH 1YEEL 3PXHA 5BQDA 3BPLB 5ID1A 1ZGLM 4TVPE 5CD3A 5E4OA 5E2UH 3A3YB 3M07A 2R4RL 3KLDA 3UBXA 1JGVH 1FHGA 3CN4A 3I9AA 1FIGH 1JPFB 1VZGA 4LL1A 4X7DC 4Y1SA 4QY8A 3VNZA 3ZHKA 2AXJA 4DJMA 4D3CH 1SYVB 1BZDA 2ITCB 2W0PA 1KTKE 1VZHA 1LO2H 2J4WH 1QBBA 2VUOA 3M8OL 4K7PX 1JCVA 1NPNA 3FF8A 1EUTA 1BF2A 1KBGL 5GGVY 1WP6A 1IKFL 4HS6B 5F9DC 2X4NA 3ROLA 3L9BA 5LXGL 1FCGA 3VXUE 1NGQH 3O4OB 2QQLH 4P2RB 4W4NA 5EC2B 4RWYL 1NBYA 1G9ML 4XH2A 2AK4D 1EAPB 5E6IB 2XWTA 3ECBB 1XIWA 3QUZC 4P2OA 2F15A 3FF7A 3HVDA 3TIDA 5H94B 4J3XA 1I7UB 5I18H 1PZUB 3A6OA 4RQQA 3K2UL 3F7PC 5C9KA 2V4LA 3E3QE 2Z7WA 4ZJ9A 5BUAA 1SHWA 4ZS6D 5K1JA 1S5IH 2CM5A 2NNRA 4XOEA 3FFDB 1ZSDB 2V5SA 3ZRCC 1CBVH 1BECA 4TVPH 5TH2B 4DVRH 3O4LE 1AANA 3ZSSA 3FSZA 4FQLL 1SNRA 2HJFB 1CDCA 1W0VB 1W72L 2ENYA 2NX5D 3IDXH 3OXRA 4HZLB 4P2QE 2VDQH 1PNCA 4GRLA 4QTHA 4POZD 5C3IA 2BHYA 2EE6A 3GSOB 4M3KB 5C09E 1BVLB 3FO1A 4NSKB 1F3DJ 1A9EB 3D8MA 3P11L 2E76C 2YMXL 4L8SA 3CN3A 4IBUA 3L95A 2WLLB 4Q4EA 3QIBC 3ULSB 2J1WA 2CK0H 3IMBA 1V7NL 4L29A 3IMWA 3DRTB 2WVSA 3DIFA 5TTRA 2EDLA 2XKUA 4Y1AB 4PS4L 2AQTA 3KYKH 4GQ9H 4HCFA 4LIQE 2X42A 3BFWA 4H5SB 3PGFL 4NJ9L 3DO7B 4AYSA 3MRMA 2QEJA 3DO3A 3PWJB 3QNYB 5CU5A 5FIEA 1MCQA 4POYA 5C92A 1V27A 2VC2L 5D1QD 2MPAH 4P5SA 4YHZH 1G9MC 2HFEA 5IVXA 3HS9A 4WAFA 1A6UH 3GJFK 3NPZB 4M3JA 3M46A 4JVPA 3SO5A 2FO1A 1EK3A 4FQHB 3HBZA 4KTEH 4HU2A 4PPTA 5MEND 2H32B 4MNQB 4XE0A 1MNUL 3W0WE 2GHZA 2J12B 2WZ0A 4AMWA 4X6CE 3PWPD 1SBBA 1KCUL 4JFEA 5SV4A 4QIRA 3SDXE 4ZYKB 1LO5A 4GI9A 1XF5B 3GXNA 1T1YB 4LVHC 5EF1A 5C3LD 4UIMB 3B1TA 5CEZL 3QISA 1F4HA 1MRCH 4ZMXA 1KTJA 3DDGA 3GHBL 4V1DE 2NXZD 3RKPA 1CTOA 5I76A 3PAYA 5GRXG 1DVSA 4DCQA 3BKYL 4XB8A 3APFA 4JDTH 5DGRA 5LQBH 5DD0L 3AADB 1M7IA 1RI8A 1WWAX 2Z4TA 4Z7WF 5A2KH 4E0RB 3KJ6H 4LDEB 4LIQH 5HI5D 3BDYL 4JGUA 1JNHA 4OKVA 4Z7QB 4MZ2A 5B3JE 1IIIA 1CLOH 2DBJA 1F3JA 5AW0B 4GP8B 4PR5A 1YNKL 3WJMB 3CC5B 4JG9A 2F74A 1LE5B 4HH8A 3BESR 4N68A 3X3GH 5C1MB 2OL3H 1M2OA 5HHOA 3ELQA 4AQ8A 5HVFB 1A1MA 2CDEA 3S35X 1EA9C 1Q9OB 3NEOA 4XPTL 3R19A 2ZYHA 4CVZB 2BVOB 4AVHA 4DFIA 1DBBL 3JTTB 3HOGA 4DN3H 1H0DA 5GZNA 4PS8A 4ZFGL 1B0GB 3UO8B 4ZTOL 1B4LA 4DO5A 2AC0A 5KSAB 1GPOL 4DSYA 1TSRA 1JV2B 1JNNL 5KVMC 2WBJB 1U3JA 3O45A 4G70B 2CLVB 2XUWA 1DL7H 2FX9L 1M7DA 2X4UB 2FEDD 1GVIA 4JPWL 5PAZA 4X5XB 4FXGB 3BSZH 1FFOB 3KGTA 4GAFB 2JQAA 1KCVH 1KN4L 2Z93B 3MCLH 4UM8A 4BH8B 3DYPA 1EFXD 2VXUH 3GT6A 5ALBL 3S5ZA 4MD4B 3KPMB 1MJJB 1PSKH 1SXAA 3EJUA 2BIHA 2UXVA 5JHLA 4OGYH 1XVSA 2OZNA 1ZA3B 4P4KB 3ARQA 3JTBA 3ATFA 4HIPA 1CVRA 5KBMA 4PGDA 3SQRA 1WAAE 3VX1A 4GXUN 1CF8H 2YLHA 3BT0A 3KLHD 4YHNB 1WAPA 4NENB 2D3LA 1CLYH 1QSZA 1ECZA 3S3PA 3BO8B 3FSWA 3TV8A 2O5XL 2TAAA 1Q9KB 1HYSD 5I6NA 1I1AD 2MCPL 1RZ8A 1KFGA 1VFOA 1A3RL 4MA7L 2AXFB 4X98A 5EO0A 1NAKL 2IAAC 1MEXL 5C07A 7TAAA 3O2WL 4B6ZA 4ANWA 4X6DF 2WWOA 5C0FB 5T3ZD 2HG5A 3KE0A 4U6YB 1HH6B 1IGJB 2IH3A 1JZ4A 3BSHA 3WS3A 4FQPA 1P6FA 4PJ8B 4Y5YC 2ZF9A 3F6LA 3GSWB 1RVFL 4MJJA 1KTCA 3DGCR 2XACC 5HD8C 1AI1L 1RY7B 2ZCZA 5JQHC 2VDPH 4MB1A 1D5ZB 1FVEB 2BMKB 4P5KA 1OTSD 3L7FB 3CHXA 2VISA 5AWNH 4BWTA 1DCLA 2GCYA 4FNTA 5D7LB 3QXAA 3SOBH 4PJHE 1XV8A 2OYLA 4AE1A 1E28A 1AZVA 2Q0ZX 5HYJB 1CDGA 2UZIH 2HT2D 3NJMA 2QDWA 1G7LA 5KJRH 1CD1B 5TPWL 3VFPA 3FU7A 5I5JA 3OKMA 4PH8A 3TO4B 4OCYL 1GS8A 3QFDA 4H1LG 3KPQA 2WZ6A 1GSMA 1VFAB 2IDQA 1CDBA 5BVJA 3FZUC 1QBMH 1CXEA 4OSUL 3VXRA 1KBWA 1RV6X 4NKQB 4TQPA 1NIAA 1DSFH 2FZ3A 1KEML 2BLFA 3VE0B 4IU2B 2HT3D 4TQEH 1LO4L 1RUMH 4JE4B 4JVWA 5F1IA 3VCLB 5DHVB 4AJWA 3IJYB 2AJYH 1IC1A 2ZAGA 4XMTA 4M7LL 2Y7NA 3PP4H 1KF9B 1MKFA 1IGIL 1JZ6A 2Z8WC 4GBXB 3WFEH 4PJFE 3ZKND 1Z0NA 3G9VA 3GSNB 4L1SA 2W65B 4AM0B 2GIXA 4JDEA 4MS8D 1MI5E 1UKTA 4JX0A 2WO2B 1I9IL 2KT6A 1I8UA 4MFHA 1AC0A 3LPWA 4OZHB 3SJVB 3CLEH 3F12B 1U8KB 4YSUA 3QQ9C 3VXTA 4NN5B 2EXSA 3G6JE 1LK3L 3MLXL 5IFHH 1G7JB 1DUZB 2ADFH 3MSPA 2JJSA 4TNFA 5D72L 3WY4A 4JPKH 2A74B 5KYUA 1YYLH 4H8HA 3ZMNA 4RMUA 5HDQH 1LWHA 2X0VA 5IBTL 4MX7B 1K4DB 5BZWB 2DDQL 1H6FA 1UH4A 2FNBA 5T5NF 1T22A 3WG7B 2EIDA 3DX8A 4QJ3B 2X70B 2XN9A 3HZYA 1M53A 4L4VD 2WYIA 3DJ9A 1BFOA 4PJEF 5DK2A 1CGUA 5AW4B 3WTUA 4MDRA 2DQIH 2ZJSH 3FS9A 1CFNB 4ZUTA 3QG6A 2BNRB 4FQ2H 2DKMA 1MFBH 3VJ6B 1ZRUA 2EIBA 2HVJA 2MIZA 5IVZB 4AW4A 5F97E 4Y16D 2QGBA 7FABH 2XIDA 1U8NA 2YD7A 2HKFH 5DS8A 4HWEH 3BLKA 1U8HB 4TQ8A 5EBLB 3FTSA 2G30A 3QXTA 1KXHA 1QMUA 4GAJH 3ZTCC 1H15A 1C5DB 2C8NA 1KWGA 4UCFA 4LP4A 2YQ2A 5F89B 2XYBA 5K39A 1G6RL 1Z1WA 5AG8A 4YBLB 3CAFA 2FQFA 1U8IA 1J05A 4UT7H 1BQUA 3N42B 4OM1H 3Q43A 3TN0A 2ZSVA 2W0KA 3ABZA 5TK4A 2WBKA 4YXHL 2EIKB 4G9DA 4HKJA 5F7BA 4ZMZA 3FUDA 4YAQA 4MB3A 1K85A 5AUMB 4OQTH 4JFXB 3GEFA 5IW1B 3IMRA 5IK3A 2LFGA 3VFWA 3LN5B 4NUJB 3S8GB 1U8LA 3MRCA 4GMTH 5IKCA 3IFLL 4PYHA 1N8ZA 5DUPH 1IGCL 1XTLA 3JUZA 1MCBA 4KFMA 4N2GA 4HCRH 1B4RA 3NJGA 3FT3A 3FL7A 4CU8A 1N5YL 4Y19B 2EZ0C 4H44C 3ECQA 2R59A 1XR9B 3SKNB 4WFGD 4RISL 5LGHH 4BUGA 1H3VA 3HPJB 3L5JA 3ZTJG 4G9FE 2B3IA 3V4PH 1JWMB 1EEZA 4PJ5D 4Y2DC 2XT1B 3CHRA 4KUCD 1BOGB 1IQWH 1N5AA 3OMNB 4LLVB 5EORL 1E67A 4HUWA 4R5TA 3W9EA 2P24A 5DMKA 2B9AA 2FD6L 3KPSB 1YEFL 3UTSD 4YSSA 4XMLH 3V6OA 3AG1B 2KBGA 4CUCA 3N9GL 1YY8B 2NUPB 5FUZH 3D69A 1X5JA 1XMWA 2B14A 1K8IA 1WFUA 2A6KB 1MCOL 4DVBA 3N41B 3A24A 1HESA 1O6TA 1QTSA 1S78D 2FO8A 4K5LA 4UNTA 5J57B 3VD7A 2R69L 3GBEA 4H1LA 1HQ4B 2HYMA 5JPMC 4F7MB 1GGYA 5JIHA 4KROD 4EUPA 4PGBB 1LJMA 3F85A 1D3CA 2QHRL 5GS1C 3V52L 4DOHB 4HYTB 3CV5A 4XO5A 1ICTA 5JXAH 2DKSA 5JW4M 1MXGA 3KCPA 5J6SA 2LLLA 3A47A 2KLTA 1KFAL 1KGXA 3LEVH 2D0HA 4G6AC 4G2AA 1FN4A 2VTFA 4HG4J 1RLBA 3U79A 2FVNA 4AQOA 2ZQKA 1OD7A 2D8KA 4G3YL 4Q7DA 3CTTA 4I77L 2UX7A 2XY1A 1X9LA 4BGLA 4UDUA 4NI6A 4OGXL 1AD9B 4X5WB 3SO3B 3AQYA 2ZUVA 1P6WA 1I82A 4U0RC 1T03H 3ZDXB 4E9YA 1M2VA 2VDMH 2ZP8A 3LQZB 4H8WH 2P5EB 4YWGL 2PYEA 4JDZA 3FOMA 2EDXA 5FV1L 1A9BA 2V3FA 4LSTL 5DWUH 5F7NC 4BK5C 3MNZB 1LWRA 2P5WA 2QQNL 3L4YA 4EN3B 3CFQA 5TDPA 2G2NA 1LP9F 2YA2A 4ZS6C 4RNRB 5IHZA 1ZSHA 5EF3A 2VDQB 1KOAA 3AG3B 3NSJA 3NCEB 1D5RA 5DFTA 3V5KB 1CE1H 4K7FA 3WUZA 3HR5A 1U42A 3WJJA 3SPGA 1AGFB 4TM9A 5I6KA 5L0QC 1SY6L 2N0MA 1JZJA 1N0LA 1HHHA 5CLYA 4POZC 4N2AA 1CFQA 3VXUB 4PD4K 3CZFA 5E00B 1NMAH 3GXPA 4FC3E 4PJDA 2CIIA 3NABL 1MCDA 5DUML 2VLKD 4S0TD 3QNFA 4OJYA 3UYPB 2W81C 4B9ZA 3DOSB 2WLIB 1CCZA 1S7XB 3QA3B 5IR1A 2MQ3A 3BZ5A 5E08H 4UDTB 1U8JB 1BV8A 5GIRB 1BM7A 1SXCA 2EDBA 5G4OA 4K71C 3IDUA 1OARH 2H1XA 5D7KD 4E9QA 1JPSH 2Q86A 3MLYL 2JIXB 3NPSB 3OPZH 5EBMA 2H0PA 3UO1L 2C9SA 3VG0L 1P4BL 5FYJU 4PJBA 3O4LB 3GIVA 3BKJH 3H9ZA 1J7VR 2ZOTA 4Z8FH 2O6CA 4H0LC 2B1OA 1IC4H 4TLUA 1F90H 3EDDA 1KSRA 4P2QB 3U2SA 5IB2A 5D1QC 3L1OL 1BJ8A 2D7MA 5AD0A 1WEJH 5C09B 1CO1A 4PJGF 5IB3B 1YNLL 1PG7X 2XFXB 1OAJA 2R2BA 4XC3L 3CH8A 4JPIA 3CIQA 1EAPA 4NO2B 1SM3L 1T6VN 1W8EA 2AK1L 2XVGA 4HIQA 5HI4D 4P4RB 5SX5K 5L4JA 2PO6D 1WH0A 4XXCC 2N1KA 5CSZA 3TYFB 1BF5A 1I7UA 2ZCKH 1H3TA 3EZ8A 3BUBA 4FQXD 1PDKB 1QFWM 2Y1YA 2O61B 1AKJA 3UDWA 3H9SA 1G7QA 2F9BT 3FO2A 1NMCB 4N26A 2X05A 3S36X 5ABAA 1YEGL 5CN3A 1HHJB 3EW3B 5C3TA 4JO8A 5K69A 4RSVA 2NLJA 2NXZC 4Q97A 2RMNA 4YSRA 5TH2A 3MXWH 4L9LB 4DN4H 2HJFA 3MACH 3FQ2A 1W0VA 5FDWA 2OL3B 3FSAA 4XXWA 4I9WD 5T3ZL 3KDPB 1SUHA 5HI5C 1UWFA 3TL5A 3GSOA 3VA2C 1BVLA 4OZIF 1QR4A 5I6LA 4LEXH 4J3OD 5EU5B 4X0NA 5FYKU 5C97A 5JQIB 3W0WB 3B34A 2DEYX 4X6CB 3PS6A 1MWAA 1EANA 1TCRB 3SDXB 5E5LA 3ULSA 1LHZA 4KOCA 3MNDA 3O6FB 3P4LA 3X11B 1UWEH 1XIWD 4OZGE 4YXLH 2HWZH 3DRTA 3WKPA 1S4IA 4LESA 5E8DL 5AOLA 4YX2H 1KJ2L 3QAZB 4FG0A 3TO2A 4K3JH 3SD2A 3VSTA 5KYXA 5D1ZB 4V1DB 1NJ9B 4H5SA 3UEZA 2B39A 4FKKA 3DTUB 1JDAA 2WP3T 2GABA 2B16A 3HMXL 4LLMA 4OTXH 2JB5H 2C3WA 1J86A 4KUCF 2FEDC 1RP9A 4WK4B 3RVVD 3FB5A 5FA3A 4CC4A 1QHPA 2X1OA 1JFQH 3SGEI 1BM3H 2HLEB 2CA4A 1GIGL 4FADA 3SKOA 1S9WA 4FQHA 3ZKXC 1LL1A 2J8UF 3ZHNA 4YSCA 2DQTH 4QCIA 3VFTB 1DQJB 5CLWA 4EIBA 3QUMH 5K93A 3ZE1E 2DYPA 4CBPA 3KLHC 1JPTL 2CR0A 4ZYKA 4ZZFA 2JXMA 2YD4A 1OALA 1SHSA 3FMGH 5DSCB 3J8F7 1QUNB 3KS0J 4J4PA 1HYSC 4RFOH 1I8KB 1I1AC 2OTPA 1Q72H 5F9AC 2RB8A 1B4TA 1UXWA 2G75B 2JI1A 1SVBA 4R5VA 1N12A 3GSRA 5DJ2B 5B1AB 1L6XA 2VDPB 1MVUA 3QHZH 1NIEA 3C8DA 3PDDA 1N19A 1JUFB 4P3CL 3KJ4C 4YHMH 1CGWA 1HJBC 1L9NA 1IM9B 3TCTA 4D8PB 3BPNC 1ACZA 2VN3A 4NNXB 5GRYA 3X13B 5IMKA 2NNCA 5JW4Q 2BIMA 1YDPA 1EWHA 1IAKB 3CC5A 3L3IA 1OP3K 3HRZC 1GAFL 1UYWH 1OTSC 5DURB 4IGBB 5AZ2H 3SBRA 4MBRA 4AEHL 5GRJL 3WFDH 2XRAH 4RX4D 3HBGA 4OV6F 3TZVD 3CZLA 4GAGL 1CICB 1E5ZA 2BVOA 3MRLB 3TH3T 4OD1L 1ET8A 4N9GA 4J8RB 3JTTA 4Z95H 5FX3A 3V0AC 1UD4A 5D71H 4YHOL 3DTDA 4I0CC 3W81A 4N0UE 4LLUB 1JZFA 4S1RL 4X4KA 3ZVVA 1SDAB 2HT2C 2GB2A 3GI9H 2H6UA 3T6ZA 5KSAA 2BZDA 1ZGLA 2FRGP 1T04B 4M56A 1RK7A 3MA9H 4X7CC 4XP4H 2MQGA 1CGYA 2W38A 5CLXA 3SY0A 3CLWA 4XMPH 1HIML 3RTLA 4HJSA 2Q87A 2AKRB 5IMMB 3PYCA 3QEGH 3N43F 1JZEA 3GBML 2R29A 3AU1B 1ZA3A 3F6JA 2HT3C 4Y5XC 4AUJA 5I1IH 4ZK8A 1VKXB 4QRRA 3HHRB 4S1QH 4YHNA 4ZUVB 4PJHB 3IRZA 4ESKA 1NUGA 3CNKA 1L9QA 1S7SB 3ZKNC 3BO8A 5HHOD 4B9FA 4G80B 1INQB 4N8UA 1TO5A 2ZSWB 2PCXA 3DVNA 3KPNB 3T9WA 2D7QA 4P5RA 3KW7A 1KCRH 3TT3H 4MS8C 4D9LL 1ADQL 2AXFA 3CX5J 1PQZB 4BZ1A 1F97A 2WUCL 5LWYH 4A2LA 5C0FA 2BCMA 4OGQC 3X14A 3DX0A 2FX7L 1MPAH 1IGJA 3U6RB 1IM3D 1TJXA 1F4YL 3LEXB 3OZ9L 4JHVA 1A21A 1EH9A 1AXSB 2ZXEB 3TBCA 5D6CA 3WY2A 1UB5A 4HMDA 1PLAA 4Q8BA 2F5BH 4U1MB 3ILDA 3P3RA 4AQ1C 2LVEA 3MOAL 2VLRE 4U6TA 2V2TB 1DLFH 1VFBA 4XMWA 3Q05A 1QEXA 4PJFB 5F7DB 4DUXA 3IGLA 2NY0D 2J57A 3P4NA 3KGUA 1Y0LB 2IPKA 3R06B 3CVCA 5LCVL 1SYSB 1TNMA 5A6LA 1CD1A 1KYDA 4Y4KB 2CCLA 3KXFD 4Y16C 1YEHH 1BBDH 1RZ7H 1T20A 1YPZF 4JHWH 2VITA 4R7NB 2E7LA 2WXHA 1SVZA 1WDAA 3O3BB 2GK2A 3G6JB 4X4YB 5CCGE 1I3GH 4PWGA 3GUTB 4YDKH 3GJFH 2FJSA 3L6FB 2ERJB 3BE1H 1JTTA 1NFIA 2W80C 1T3FB 3H6JA 3HLKA 3LH8A 3RL2A 2CO2A 5JHDE 1I1FB 3ZTNL 3NZ8A 1IL1B 3GSXA 3MLWH 4Q2ZA 3VCLA 3HI6L 3B43A 4WENB 1BFVH 5IW6B 1JWUB 1ZAGA 5DRWA 4G42B 3TV3H 1MLCA 1FGVH 1MF2H 4J3OF 4RESB 1NA8A 2IBZX 3QJXA 3AT9A 3HZMA 3SQBB 1LDPH 5CEYB 4JFWA 4ERSH 1AP2B 5EPMB 4ODTL 3ZE0F 2F1AA 1NWOA 3GHPA 1ODUA 4KXCA 2CBTA 3CIAA 4ZUSB 5DS1A 4JQIL 4XBGB 5F9JB 5CGYC 3WO4B 5D4QA 5DYFA 2Y3AA 4RGMC 3LZNA 2IDTA 3F7VB 2ZXCA 1G7JA 1ZOXA 3MJ9L 4F33A 2GIYA 2PYFA 3V4PB 3E1F1 2C4XA 5DC9B 1OWWA 2WAQA 4KRMB 1IGFH 1XSOA 4Y2OA 5C0AE 3UC2A 4U49A 3SZ6A 2WXNA 2ZX5A 5TDNA 3LHPH 3VGDA 5ACMA 4HEME 4O5LL 3BKMH 1P2CB 2BVQB 1E43A 5DTFB 3S3JA 1MRDH 2GJPA 3U2IA 1HEZB 4U1IB 1UD5A 4LPTA 2Z9TA 1TZOA 2AJXL 3BP7A 2ODIA 3QEQE 3EYFB 3BN9D 4I18C 3RBSA 2ZWLT 3CSBA 1Z9SA 2WQ8A 1MCJA 4FFZA 2XI9A 3CX2A 5EBLA 5JDJA 3RWFB 2O5ZH 1FNSH 4LSRL 4N22A 2KZWA 3M7OA 3UTPD 5ADOH 3GKWL 4OZFH 1EO8H 2XU9A 4NCDA 3GZOA 1S78C 2Y06L 4H26A 4CC0A 4KY1L 1U91A 1REIA 1NIBA 1EZVY 3CHPA 1NCDH 1X5YA 1L6ZA 2XWBB 1KBKA 2RJMA 4KROC 2KLSA 4A7GF 4G9FB 2JKRM 5D2NC 2VR8A 3RIFF 4EIZC 3MBED 1IC7L 5JHAA 1TPXB 4GXVL 2W9LA 2ITFA 1OHZA 2MFNA 2XWJA 4Z3IA 3CFJA 1YN6B 1RK1B 5H37G 3QJQB 3HG1D 2K9UA 1IGYB 2J8HA 4GP4B 4Y4HB 1F41A 1NWPA 1KZYA 4PJ9D 1XR8B 1XGQA 2K6WA 2VDMB 3GK8H 3EYOA 4BKTC 3WTYA 4NUJA 1NCWL 4P59L 4PAZA 3S34H 5C08D 3STBA 3EJQA 2AITA 3CFKB 4CKVX 5B1JA 5IF0B 5E24E 1UT2A 2NY7H 2J2ZA 4KTDH 4Q9QL 2R39A 1G87A 5DR5L 2CBMA 5AW6B 4RIRA 2EVGA 3MV9E 2BHUA 3HZKA 1BX2A 1XR9A 1SHXA 2MCMA 2WOYA 5A2AA 3Q2WA 1XCQA 3HPJA 4UT6A 2XZCL 1UH3A 2FNWA 3K2IA