4DP1X

The 1.35 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 4.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp1X00
1KDJA 2XV3A 1L9OA 2IDTA 2J5WA 1KBVA 2VMJA 1J9TA 1WS7A 3AG1B 1I53A 4E9XA 4YSOA 3SBQA 4JHUA 1E65A 3IN0A 5I6NA 5B7FA 1JZFA 2XXGA 1MG2C 4KOBA 1ET5A 1MZZA 2AZUA 3FQYA 2FJSA 4DP8X 1E30A 3H4HA 2B08A 2YXWA 4KNTA 3FU9A 1AZUA 4JHVA 2EIKB 1HAWA 1PLBA 2VW4A 2AFNA 1BAWA 1EZLA 4HHGA 4A2DA 4EF3A 1ID2A 1NIFA 3T6VA 4ZK8A 1TU2A 3CVBA 2GI0A 2XUWA 5ANHA 1OCCB 2VW6A 1HFUA 3OMIB 1J9QA 1OF0A 2HXAA 5AKRA 3FU7B 2ZONA 2XV0A 4YL4A 4P5RA 3UABA 1PLAA 3UADA 1E5ZA 2VM4A 4DP1X 2VSMB 3WIAA 3U25A 2DWSA 1MZYA 3ASOB 1GR7A 2YAEA 3QJVB 2HRGA 4E9RA 2UXTA 7PCYA 5EHFA 1SNRA 2AZAA 3OMNB 5I6KA 2ZWNA 1RZQA 1OOWA 2FT7A 5I5JA 1AZBA 1TEGA 5F7BA 2IWKA 4N4YB 1JZIA 1PNCA 3NSFA 4YSPA 1PZAA 1OE2A 1GYCA 3EH4B 2QPEB 4AKPA 1AAJA 4KNUA 1JVLA 4KO6A 4FA7B 2WSDA 3NSDA 4G7QB 2Q9OA 3TBCA 3CVCA 1CURA 2IDUA 5B1JC 2XX1A 4Q89A 1W8EA 1AANA 2FT6A 2FT8A 4QKTA 2BZ7A 2GIMA 4CSZA 1ZPUA 2OJ1A 2YAPA 2B3IA 2GC7C 2UXGA 1RCYA 4YSSA 1PNDA 2PPCA 4BWTA 1J9RA 3FT0A 1JVOA 3NSYA 4P5SA 1IKOP 2QDWA 1BEXA 2MRYA 3EHBB 2OCCB 3QJTB 2CCWA 5B1BB 3S3CB 1NIBA 1OCRB 1ZDQA 1MG3C 2YAHA 2PP9A 1AS7A 4DP9X 2GHZA 2VM3A 5TK4A 2AVFA 1L9QA 4G7RB 4DP2X 3MBWB 3ABGA 3UACA 4A2GA 5F7AA 3ZDWA 3CVDA 2H5UA 3IBOA 3NJNA 3FSVA 2YAQA 3IE9A 3WI9A 2I7SA 5I6LA 5AZUA 5A7EA 3OQRA 4HHWA 4BK5C 1ET8A 2N0MA 3S3BB 1CYXA 2JXMA 3MX0B 2DY2A 3V9EA 2TSAA 5I28A 4AI7A 2R7EA 3FS9A 3QJSB 4E9SA 1R1CA 1M9WA 3WNJA 3ERXA 1WA2X 4GP4B 1GS6X 4HCIA 3C75A 3SBRA 2YXVA 1GY1A 4N8UA 3X1FA 1VLXA 3X1GA 4F2EA 4DP6X 2TSBA 3NJHA 1ETJA 1E67A 4AZUA 2UX6A 1XB3A 2XX0A 4AKQA 4DPBX 4W9ZA 1DYZA 4A68A 2PPAA 4YSTA 3S8FB 1OE1A 2PP7A 4FAAB 4YSEA 1GS7A 1L9PA 4G70B 1TEFA 1SHXA 1TKWA 2Y69B 5I6MA 1NTDA 2JKWA 2IDSA 1PAZA 2GB2A 5B1KA 3X2QB 4BWWA 4GYBA 1AZNA 1BQ5A 1SF3A 1JXFA 2H3XC 2XXFA 2VW7A 1IBYA 2MTAA 4AKOA 4UANA 4K9JA 1NWOA 2H47C 2UXFA 1T5KA 3DTUB 1HAUA 5PCYA 2BO0A 1OV8A 1KCBA 4TXVB 3EH3B 2R7EB 1ASQA 4X4KA 3TA4D 2GC4C 1JZEA 1M56B 4G7SB 3FSAA 3S3DB 3ZBMA 1OE3A 3X1BA 4WKXA 4UF7C 3WNIA 2EINB 2PPDA 1NDTA 1XMEB 7PAZA 2BWDA 3CZUB 4DPCX 5I26A 1IC0A 1AZCA 2NRDA 2HX9A 1V10A 3DKHA 3PLYA 3NT0A 4F7KA 1GS8A 2BP0A 3ABMB 2JFCA 6PAZA 4A2HA 2XVBA 3AG4B 1AQ8A 3L45A 2QDVA 1NZRA 1ASOA 3ABLB 4YSRA 2UX7A 1NPJA 2A3TA 3EF4A 3NJGA 3BQVA 3NJKA 3OD3A 4L0PB 1CYWA 2YAOA 3PXLA 1A3ZA 1AG0A 3OMAB 3ABKB 2HX7A 3N55A 1KGYE 1ET7A 1PZBA 3NJLA 2EILB 2XLLA 3T6ZA 2BW4A 2XWZA 5LDUA 2YQBA 4E9YA 4CSPA 1SDDA 4HCFA 2BW5A 4KOCA 3NP4A 4GXFA 1QLEB 2FWLB 4YVNA 3WKQA 1BXUA 2EIMB 2YAMA 3NSCA 4KO5A 5AFAA 5B3SB 1SFDA 3WKPA 4BDVA 2E86A 3QQXA 1BYPA 1NICA 1AS8A 5I6PA 8PAZA 2CALA 1JZHA 1SJMA 2QPDB 1RZPA 2DYRB 1J5CA 4UAHA 2BHFA 1URIA 5B1AB 1GW0A 2BP0B 2IWFA 3PPSA 6PCYA 1KBWA 4A2EA 4GY4A 1KDIA 4GP5B 1A4AA 2PCYA 3S8GB 1V54B 2J56A 3AG2B 3QPKA 2CBPA 3PAUA 2CUAA 1FWXA 4PCYA 3WG7B 2I85A 3FYEB 1WAEA 4DP5X 1IUZA 1QHQA 1PLCA 3CDZA 4YSCA 4F2FA 2WO3B 3T71A 1ZDSA 2I7OA 1WA1X 1J9SA 4E9QA 2BP8A 2FTAA 4G71B 4HCGA 2W8CA 1SDDB 1FA4A 1JZGA 2VN3A 2DYSB 3KW8A 3NJJA 2LLNA 3FPXA 4DP4X 1N68A 4Q8BA 3BVDB 5TK2A 2W88A 5B1JA 1IBZA 4BDVB 1PMYA 4E9VA 2IDFA 4M4RB 1KYAA 1CUOA 3TU6A 5I6OA 2PP8A 1ILSA 4ENZA 1NPNA 2BWIA 2EIJB 2DV6A 1GSKA 3SQRA 4YVUA 1SHWA 3GDCA 1JXGA 4NAJA 4PAZA 1V55B 1SF5A 1J5DA 5FC9A 1SFHA 2PLTA 1KCWA 1CC3A 2P80A 1ADWA 2HRHA 1F56A 3CDZB 1AR1B 1MDAA 1ASPA 1PCSA 3D12B 1A65A 1RKRA 1KV7A 3T6WA 2BP8B 3IN2A 1B3IA 1NINA 3PAZA 3NYKA 4JKNA 3RYMA 2X87A 2QT6A 2VSKB 1ZV2A 3TASA 4M3HA 4W1TA 3NJIA 1YLBB 4YSDA 5D4JA 4HZ1A 1BQRA 5I5IA 3T6XA 2DWTA 3FQ2A 3FQ1A 2HX8A 5IY5B 3FPYA 1DZ0A 2PPEA 2FQFA 3ZX1A 2J55A 4HAKA 3ASNB 2FQDA 1NIDA 1X9UA 3QJUB 2Q5BA 2ZOOA 3QJQB 3AG3B 1M57B 4HIPA 5B7EA 3OM3B 2PPFA 1AIZA 1X9RA 3NJFA 1AS6A 3TBBA 2BZCA 1A4CA 3UGEA 1EHKB 3QJRB 5D4IA 2AANA 4A67A 4NB7A 2GSMB 2UXVA 3CG8A 1L9SA 1W6WA 2FNWA 3AZUA 4A66A 3AW5A 3FSWA 5B7MA 2XU9A 3H56A 4RH4A 3V9CA 1L9RA 1BYOA 4G72B 3JT2A 1PF3A 1NIEA 1PZCA 2CAKA 3GXUB 3ZIYA 4YSQA 3N2JA 2XYBA 1A8ZA 4BXVA 1AG6A 3FSZA 4NERA 4QLWA 1ZIBA 1XB8A 4HALA 2RACA 2CJ3A 5PAZA 9PCYA 2HZHA 4MFHA 3FYIB 3FU8A 2YAFA 3AY2A 4WTQA 1OCZB 1JZJA 4GP8B 3X1NA 4DP7X 5I5MA 2FQEA 1WS8A 4AX3A 1ZIAA 1NIAA 3G5WA 2IH9A 3H4FA 1A4BA 1BQKA 1QNIA 2IWEA 3HB3B 3KW7A 3X1EA 4E9TA 4BWUA 2FQGA 2HLEB 1W6LA 2OV0A 3NP3A 3DIVA 5E9NA 5D4HA 1JOIA 1AZRA 2IAAC 1GY2A 3IEAA 1AACA 2X88A 1ILUA 2YARA 3EH5B 4BXSV 2GBAA 1BXVA 1AOZA 2P80D 4E9WA 1BXAA 2XV2A 4KO9A 4DP0X 1L9TA 3GYRA 1JERA 3JTBA 3SBPA 4A2FA 2IDQA 4DPAX 3HEIB 3FU7A 3PAVA 3T9WA 4YSAA 2Y1AA 2IH8A 3UAAA 1E5YA 1WA0X 1XB6A 1OCOB 1PY0A 2PCFA 1UATA 2J57A 2WO2B 4YSUA 1JXDA 3NJMA 1N70A 4KO7A 3PCYA 3UAEA 1FFTB 1NWPA 2ZXWB 4KNSA
chains in the Genus database with same CATH superfamily
2ZNWA 3DSFH 2OSYA 1KLUA 1WHOA 2DKSA 4NP4H 2DQ6A 3DX6B 3GTTA 3WS3A 4PRBB 3ES6B 3FCGA 3WAJA 4LSQL 4XVOA 1YMMD 2NY5H 1E4XI 1E7VA 3AG1B 4RAVA 5HSFA 4YSOA 2AQ3A 5GSRB 4BHUI 3VGBA 4Q52A 2EIBA 5JA8B 2DOCA 1NDMA 3L5HA 1OZUA 5BRPA 2OMZA 1MCBA 3BAWA 5FAAA 3S2AA 1JPST 3PHAA 3PWVA 5C09B 4FQQA 1P4UA 5DCCA 4R4FL 1WAAF 2ITEA 5HPMB 1ZE3H 3FUKA 5F9WC 3QEUA 2CBOA 2V33A 1B4JH 4Y1AB 2QPUA 3K5SA 3L9RA 3BH4A 4Z7WA 1KXVA 4NQXB 4XCEA 2WNKA 3HZYB 5IV2A 4NC2B 2GI0A 4O2EA 5D7EA 1BP3B 2HXAA 4HEPA 3FU7B 5EU6D 3A23A 1F4XH 4RMVA 1QRND 1CFQB 2WKLA 4FDWA 3QJOA 4OD2B 4PV8B 3WUWB 4PGJA 1AGBB 3I3EA 5KSVA 3RWGA 3BSZA 5C3IA 2YK1L 5T5FL 2COVD 1UC6A 1BFSA 5E56A 4Q7DA 3U82B 2OMNA 3MV7D 4AL8C 1GW6A 1VERA 4N8PA 4TVPH 5I5JA 1AZBA 1T5XA 3M7OA 5DJ2B 3OVUB 2D3VA 4ANVA 4NKMA 4OFQA 4MDJB 5DD5L 5KOVC 5CM1A 5FB8B 4NCC1 4DKFH 4KJYB 1QLEH 1ZA3B 4BFFA 5LQBL 2WJ7A 3C9NA 1M1XB 5DUPH 3TIDA 1IGIH 1AAJA 1IBFA 1MAKA 3HC0B 4L4VE 4ZFQA 2AKRA 1V7ML 3PG2A 4NKIL 4WNQA 3DOHA 4K07A 1HILB 5GGTL 3THMH 1U8LB 5ENWA 1Q90A 2FWOB 4KQ4L 4JKKA 4HS8H 3HE6B 3QIBA 4GUCA 4M7ZB 4M3JA 1MIMH 4NM4H 2OZ4A 4DN4H 3IU4L 5FUZH 3EJYD 3LZPA 4F57H 4MX7A 3K8MA 5IFHL 5J11B 3R8QA 4PPTA 3ETBF 1A6PA 1XV8A 5E7BA 1MCNA 5CD5D 3KHOA 4F93B 4OM1H 5KBDA 2VH5L 3L1FA 3FAXA 1D7FA 1JS4A 5JLZB 3FT0A 4OZIE 2YPLE 5CSZB 3ILEA 2MRYA 4LU5H 5J57B 5J13C 3SHSA 2H26A 1OAYH 3AMKA 2DMGA 3ECBB 1DQKA 4LLYB 1KJ2B 4YAQB 4BSWB 1CICB 5F9JB 5I8CB 1TR7A 3UJTL 4JFQB 1CF1A 1RLBA 1G0DA 3GINA 4KV5E 4ZMNA 5TK4A 4IJ3B 2R0WH 4AQ1C 4K71B 4U1JA 3TZVA 3FU0A 2FLMA 5EC2A 3F01A 1YJDC 3A47A 4N8VA 2H0EA 5CJOL 3OR7A 5DJYA 3CVDA 4N2GA 3SCMB 2YAQA 4N25A 5MENE 4YZWA 3HFMH 4P2QB 3WNOA 1PG7H 4N0CD 4PTUB 2GIYA 2R0ZL 1RJZA 4QI3A 4DZ8A 2BY3A 3SGDI 4D0CA 1MWAL 1QYGH 3O4LA 1KYFA 2JELH 3B6SB 1MW1A 1HS6A 3CMGA 1B3JA 1MRDL 4N8UA 1JZ3A 1MHEB 3IFOA 4PRNB 4LPCA 2AJSH 2WP3T 3STLB 4ALAH 3TV3H 5JNYA 1WEJL 4GG6A 3GSVA 5C71A 3R7RA 4NHUB 1CGYA 5G5DB 3WXWL 2V0AA 1EEUA 1AKJA 1O0VA 2IPTH 3ISRA 3M1BA 4HZLB 4JR9L 4X98B 1NKRA 4FQ1L 3QUYA 4AVKA 1J87A 3ZU8A 3RL1B 1XVSA 1G6RB 3OV6A 3G6DH 5AOZA 2E4FA 5J6SA 1CFMA 3KD4A 1J1PL 1K2DB 1U8MA 1YEGL 2E27L 1OM3H 4G7VH 1XGUA 1KTBA 2JKWA 4HJ1A 4XNYH 3TBWB 5A2BA 4N9GA 1SHMA 1G9NC 1QLFA 2ZCHL 5EV7A 4AG4L 3B4NA 3OAWA 3Q6FA 3U4EA 1DVFA 2GJPA 3VA6A 4NM8L 2Y7LA 3H9SB 5DEFB 3S0PA 4J3WA 2D3NA 1NWOA 2GJJA 1RFDH 3MLTB 3UMNA 3GZOA 4JN1H 1QWUA 1RPUA 4MXQC 5J12C 5CMAA 3OX8A 4AGNA 2PTTA 5AW1B 1ONQA 1ASQA 4G7SB 3CBKB 4Q14A 4WUUA 3CZFA 1ZT7B 1A9VA 3P3RA 4NXSA 2XRAH 4G6AC 1YEIL 2ZSVA 3CC1A 4RFNB 3BXNA 1ZTMA 5DQJB 3HZKA 1E27A 2ESVD 5LBSA 3T0AA 1ZGLB 3PDOB 3GSRA 4I0PD 3NT0A 3VFNB 5ACZA 2X4QB 3CLFH 6PAZA 4OF7A 4PS4H 5D2LF 4ANWA 4HUUB 4R90L 4RRPA 3W9DB 4XMKH 3EAKA 3WJLC 2ARWA 5E4OA 3D0VB 2NX5A 3FCBA 5EPMB 5FDWB 5JW5B 1RIUH 1NCCL 3OMAB 5IG7A 2HJLB 4HJGB 1N6QL 4FNUA 3L5JA 4J12A 4UYPA 1LO0H 1XZWA 3NJLA 2HFGH 4HBQA 3QUZB 4CGTA 2W0FA 2WKOA 1YHPA 2ORBH 1DBML 3K0YA 4GMTH 1VEOA 3V4PL 4XXCA 3H9ZA 4F8TA 2FWLB 4Y4FD 1UHVA 1FFNA 2EIMB 3B5HA 4UQ2A 3RGHA 4X80L 2TRHA 5FM5O 2Y06L 5B3SB 4OM0L 5G2NA 3D3VE 4R5TA 1CR9L 1KB5L 1TQBB 2XTJB 5D1ZC 4PJ5E 4ACPA 3IVKB 2V2WB 5JIKA 5I9QB 1JBJA 3TCLB 2A73B 1T7YA 4RGNC 4AQ8A 1J12A 4ZMPA 1CVRA 1EFXD 2UV3A 4MZIA 1N64L 3QPXL 2ENSA 2EYRA 4M1GH 1BMWA 3WJJC 5BQDA 1AXSA 4OLWH 5LDSA 5KBMA 3VACA 4GP5B 2YS4A 4Z0BL 3QO0A 3BQUB 3L7FB 1F58L 3FFDB 4LHQB 4JGMA 2J56A 1IC4L 3NPSB 1CFTB 3CLWA 4U1HB 3MRQA 1XO8A 3EJUA 1Q94B 1MFVA 4MA1B 1BD2E 2DN7A 2XDHA 1NGYB 3O41B 4F2ME 3CPLB 5CEXB 1FL5B 3TFKC 1YNKH 4XVUC 4QHKJ 1W9XA 4OCYL 5CR1A 5LXGL 1JIBA 1C7TA 4DGYL 3EYVA 4WW2F 4GKNA 5KSBF 1C12A 1EHAA 3KPTA 3CSYA 4TSCL 5ELIA 2D31A 1SDDB 1JZGA 4OLVL 4YLBA 1HYSD 2AV7A 1JGVH 5DTFB 5IJVB 4OD3H 1A1MA 4OZGB 3DMMD 3MRDA 3ROOA 3ULUC 1WBXA 4EJ1C 1BQLL 5AVZB 3WEXB 5IROD 1LE5A 3HBPA 5T1MB 2NR6C 2H2PD 3EOTH 4HJ0C 2FE0A 4ZMVA 3D05A 1K6QL 2VDKB 3HS0B 1P5UC 1SBSH 3QEQB 3SPVA 4BH7A 3I02B 1X5FA 4IRSD 2F8XC 3B7SA 1NFIA 3TJHD 3GI9H 2DQIH 3FRPB 1HKLH 2EUZA 2ZOWA 4OCXH 4P46B 3HAEH 1XBDA 4N8CH 4NPKA 4LSPL 5IIEB 2JMRA 4XGZA 4NAJA 3O2WL 4FQ2H 4MZ3A 1KEGL 4PAZA 4QXWA 4HIJB 4KUCF 2GJZA 3HUJA 2W91A 3RP1A 4P9ML 4XPAH 4KVPA 3S9DB 2X1OA 4MBOA 1K4DB 2J2ZB 3MNWA 1WYJA 3D12B 4JHAH 1BZ7A 2AXHA 4PRIE 3Q6GH 4ZO9A 4ZUSB 3KLHC 1MCEA 3IN2A 1IAIH 1UG9A 2DMCA 4JKNA 2RJMA 4OF8A 4L1HA 4AH2B 3IFNH 2BNUB 1ODUA 5F1NB 4GUQA 3ATDA 3KYOA 4QGTA 2XG5B 1ZSDB 2UZXB 5HXMA 5I76B 3F7VB 2H0JA 3WY4A 3BPLC 3MV11 4K2UH 3RWEA 1KWKA 2HX8A 2MQ3A 1YEWA 3MTRA 3EIFA 4GAFB 2I25N 1NEZG 1HXMB 1P84K 4Y16B 3DROA 3OKMB 3X14A 2FQDA 1NIDA 4PCKA 2OMBA 3QJQB 1ESOA 1KCVL 4RMQA 4W4NA 3OM3B 4HWBH 2E8YA 2VL4A 4F9LC 1AS6A 4YH6A 2Z91A 3PWNA 3V7MA 1AGCB 4FCHA 3JT0A 1TQTA 4KUZL 1FH2A 2HLAB 1HZLA 1KWGA 3NPZB 5DUMH 5HYJB 5DGQA 4GI6A 4A67A 4AQAA 3QAZC 1SVBA 3GHPA 3QIWA 4A66A 2B9AA 4AZ8A 4DPRA 4JKPH 1RPKA 4K7PL 3S98A 3TGXA 4O9HL 2IO5A 4WW2B 1NIEA 2BRRL 3UTQA 5GZOC 3SDCA 3QDGA 5DFWH 2HT4C 1A66A 4D8PB 3VXNA 2HFTA 4LESA 2CK2A 4PJHF 3SE6A 1JGIA 4NXKA 4KXBA 2D3JA 3UO8B 1A7NL 2GY7B 1ZCRA 3VDCA 2X0VA 3D2TA 1BFTA 3FU8A 3LKOA 3NCEB 1OCZB 5C92A 3HFFA 1N3NB 1TITA 2N3JA 4XH2A 3RZCD 5FYKH 1D6VL 2Q2EB 2VC2L 2RQEA 3SEPA 4Y4KA 1NUDA 1A1NA 2IWEA 3KW7A 3C08H 3LH8A 3ULVD 3AT8A 2WXIA 3ZKQD 4E42B 2Z3FA 3QUXB 4XP5H 5IEHA 1A3LL 3IF1B 2X88A 4Y19A 4O58H 5E1GA 5HJGA 4QXUL 3VFRA 3RIKA 2FL5B 4L4VD 1V7NL 1XGPB 4DP0X 1B9ZA 3BZEB 4XCCH 3VFOB 2DMHA 3NFPA 1F3JA 3DUSA 3PHOB 5FS5A 4AK1A 2QQKL 4BA0A 3O2DA 5T8IA 3T09A 1H3GA 1LDPL 5DT1H 1XEUA 1Z6JT 2GEEA 1GZPB 2VLKE 3NJMA 2DQDH 2V17L 3II2A 1ZVSB 2X3AA 2LR4A 3DURB 1NWPA 5F8QC 1S46A 2AJVH 5FGCE 2Z7YA 4JFUA 2YPLD 3HBZA 4NSKB 5D7LA 5AYTA 2ZOUA 2LAGB 3E7JA 5E2TH 1BF5A 4NQDB 3EHBD 2YD2A 4UM8B 4F91B 5JHBA 5I6NA 4QRRE 1CD8A 1DEEB 1JZFA 1YNLH 2I07B 4XXDA 3BT2H 3CCHA 4L1LA 4FFYL 2C9XA 4RFOH 3WHXB 5JHDA 3UO1H 5JQ6L 4NNPH 4QRTB 4XBPA 3VU2A 3O8XB 1AZUA 5GPRA 3CJJA 1I9IH 1YPZB 1U8JA 2B1AL 5H35B 1JNNH 4B9GA 1LP9F 4FYSA 4ELME 5I75C 1G4RA 2MKWA 4W9IC 3LPOA 4MQ7A 1I8MA 4KZEH 2R83A 5D1QE 3W9EB 5A2JH 2R4SL 1PLGL 1QKZH 4NPYA 4JO2L 2WCSA 3VMOA 1SEQH 1F2XK 2E9WA 3H53A 4PJEF 2ENQA 5I1EH 4KZDH 4GT7A 1J9QA 2P5WA 4PBDA 1CN4A 5B4MC 4JDZB 2R1YA 4PJCA 3FB8B 5ALCL 3SPGA 3TIEB 3WIHH 5BMFH 1ZLVK 1FFPB 3ASOB 3V7AG 3N43B 2WVVB 5E2VH 1WFJA 3NIDB 4WSKA 1M2OA 4IIQC 1MHCB 4D7PA 3P77A 2NXYC 1OOWA 3AGWA 4K8RD 2VT0A 2IWKA 3ESUF 4PJHB 4XCFH 2QMKA 1MVUB 4EZLA 1LDSA 3LEXA 3U9PH 2BNRD 1J10A 1SYVB 1MPAL 4JPKH 3CH8A 4ZX6A 1KY6A 3PQYE 5EEWA 2PR9A 4FA7B 4UQEA 3ZKSD 2JI3A 5JUEL 2J6EH 3D9AH 4X9FA 4G6KH 3RVTC 5KYWA 4FFVC 4X0KA 5LCVL 5TF1L 2PYEB 3QZMA 1OPGL 4WLCA 4YHYC 2X9XA 5LG6A 1PKQA 3FT3A 4OIFA 5E5RB 3V5KB 3I6GA 4N2HA 2NY1C 3OKKB 4TQ8A 2ITDA 4AIEA 1TJXA 1LILA 1TQUA 4YDKH 2XJLA 3TYGH 5FEBA 3TA3A 2X44D 4IMKA 3SYQA 5LAXA 2QHRL 2O5ZH 3KL5A 3T2NH 5C1MB 5L4MA 3LB6D 1JN6B 5F0MB 5HVHC 1JVOA 4PEEA 3SKMA 4UTBL 3VFGH 1G1OA 1YMMB 4PJFF 2VXUH 3S5YA 1BM3H 1MI5E 5KVEE 1I9JH 1XCXA 4FQCL 4LGSB 1CGVA 5FO7B 1DUYB 4M6MH 2YIHA 3V4VH 1E9PA 2YAHA 3VQ2C 2JIXD 1J8HA 3L48A 1KCSL 1TLKA 1JPSL 3GKZA 3LIZH 3TEYA 1A2YA 1J18A 2VQ1A 4I48A 4PIBA 1R46A 2UY7A 3FC8A 1YYCA 2QVTA 4K3EH 3B2DC 3C5ZA 1J5OL 4KFZC 3B9KA 3NJNA 3IE9A 1QLRA 1IRAY 3F05A 3FRUB 2HVJB 1F1AA 2I26N 2WZAA 5F3HA 3V9EA 2OQJB 1MRCL 3EOYG 4ECNA 3FCSB 4N0YH 1QRNB 5F96L 3ZZQA 2F58H 1J88A 2HYMA 5L88H 3F84A 4ZTOH 3VXUD 4KTGA 1D7CA 1WBZB 3KWWA 3SBRA 4B9JA 1UM6L 3OLIA 4ZUTA 3UCQA 1IMHC 3K0WA 2X6AA 2XVLA 3RUGB 4DESA 2WVTA 1HSAB 3KM1A 1MNUH 2E7BA 1DQQA 3D3VD 4ZXBD 2KC0A 3TN0A 4PUBH 4PJ5D 2OMWA 3WFHB 2XT1B 3QUHA 5AB1A 1CDCA 4FOMA 1BGXL 3UG4A 3OG6B 3Q1EA 2ZKYA 4S1DC 3SYCA 4UQBA 3GRWH 4KWUA 1UT2A 2NCEA 4YE4L 3CN2A 5HHVL 4DN3L 4YJZL 5A6LA 4GW5A 5I8KH 2CCLA 2OJEA 3PUCA 4MD5A 4JKLA 1W72A 5AENA 1SM3L 4WK0B 2QKIC 3QIBC 4JFZL 4LPTA 3UBXA 5F9OL 3PS6A 4HLJA 2H47C 4C54A 5C0DA 1HAUA 1SY6L 5PCYA 5CGTA 2VLRD 3MV01 3QQ3B 3ZL1A 4GOSA 4XN5A 3CZEA 1AH1A 4Z7VE 3BI9X 3X3FL 4APQD 2DZEA 2OR8A 1DBKH 3KGSA 4UYQA 2VDRB 2X4TB 4L5FL 5GGQL 3SY0B 3TURA 1XIWD 4Y2DD 4HFUL 2RTTA 4GO8A 1ROWA 4PIRF 1DUZB 1HEZB 2X4OB 2ZJSL 2NYYD 3GJFH 4KRPC 1B9KA 3LH9A 4M5TA 3HZMB 3B2XA 1IFHH 2LT9A 3DJRA 4AOFA 2WQSA 4P2OD 5HI4C 4CJ1A 2FLRT 3U4BL 2E6QA 5F88B 3N55A 3VXOB 1LHZA 2BCKA 1DBJL 4ZUVB 3ZE1E 2F54A 1NBVH 2YXFA 3PNWA 3KLSA 3MLSL 3V0VA 5BS0D 4OQ1A 4QOKA 1A14L 1FL3A 5E23A 3BWUC 3OZ9L 2OXHA 1U33A 3MJ7A 3QQ9D 1NUNB 1T22A 3U0PB 1QPXA 2KT6A 2X28A 3FTYA 4ONGL 4PRID 3QDMA 3VRJA 2J43A 5FW8A 3PP3K 1UXLA 4WGVB 1ORSB 4HAFA 2GK0A 2W9LA 2XZCL 5B38B 1V27A 2ATPA 2VWEC 1BYPA 1NICA 3QUYC 5D2NB 3X11B 4QHLB 2B5IC 4MJ6A 4EN3D 4M7KL 4GRLD 4ONHA 4AEIL 1JZ7A 2FJFB 4DZBA 5GGRA 5JHLH 4JGJA 3VX0A 5DQ9A 1GW0A 3LZLA 4P0DA 1HTYA 4U1IA 2RHEA 4WI6A 3LQAC 5FKAB 5ES4B 3MYZA 3ES6A 1OD7A 4PRBA 5KS9E 4LIQH 4GY4A 1M53A 4N5EC 1DVFC 1RZKH 2YQ3A 4MDIB 1JCVA 2WWMC 4NLAA 5JO5B 2DTML 3BIKB 1PG7W 1ZLWH 4YHOL 5CJ5A 3SO3B 3BGMA 1WIUA 1JPFB 3NOIA 1ACYL 3EYFB 2FX9H 1BFOA 5HYFA 4NQTA 1ZDSA 4L4JA 1CFNA 1E9OA 5DUBB 2EIZA 1EEZB 2QLVB 4TMPA 2FEDC 4E9QA 4GQZA 1HWWA 2ESVB 4Y1AA 1CG9A 1FRGH 4FP8H 4TTDD 3F7KA 5TPWL 3WLBA 5D6CB 2X4PA 4Q97A 1Q0YH 2A6KA 3MUY1 5A6MA 3P4LA 2DQTH 3RDTD 1P5VA 4ZOEA 5KVGH 5T1DL 1SVCP 4AGLA 1NM9A 4ZO6A 1GGIH 1CFQA 2Q87A 3BH8B 1U58A 2ZKHL 4M4RB 1CVSC 3MVSA 3GJEB 3M7FB 4KKCC 4OD2A 4QWWC 4J27A 1AGBA 1OAXH 1CT8A 3REWA 4KI5D 4HLEA 1KLGB 3MRMB 2MCG1 3ZE0E 2X6VA 2YD8A 4MD0A 4BH8B 2GTZB 3C12A 4W9JC 1M2VB 4YE0A 4H88L 4PLKC 1BEYL 1WUZA 3DX3A 3SE8H 4YVUA 5IHBA 1UT9A 3UZVA 2VXTH 3L3KB 2R2BA 1MH5A 1E5AA 2UZPA 3TX4A 1MIEH 4Q0XL 2GSIA 2Z65C 4HT1L 3GGWB 5I15L 3TPUA 4OSUL 2CPUA 3G08B 3NH7L 3TJEH 4Z8FH 3WDHA 5F1KC 3ESVF 3HR5A 5ID0A 1JRHL 1BWWA 4LLMB 3AWEA 2FB4H 1RUAL 1G9EA 2YGPA 2MQ0A 1OO2A 3K91A 4N90E 3ARED 5FF6B 3SSGA 1LO4L 3GSNA 1SUHA 3GSOB 3B5TA 4YN3A 4DGWC 8FABB 3FO2A 2D0FA 1EFXB 3MRHB 3NJIA 1TDQA 3PWPA 2GJ6E 4X4XB 4HZ1A 5H94A 4PJDB 5JLZA 4WHTA 4F8NA 2VLKD 2NTFB 4OKVB 1DZ0A 4OLZL 4NPJA 2B14A 2WXKA 4R26H 3ECWA 4AUJA 1E4KA 3NRQA 4DH2A 4I85A 4N2MA 1M57B 4BJLA 1CICA 1LO3L 1AC0A 4TUOB 2MPVA 2C1PA 1K8IA 3H6JA 5DR5H 1OM9A 2CCVA 2H6PB 3CC5A 3B9AA 4L3EE 1AKPA 5MEOB 3D7PA 5A7BA 1JWUB 4R96A 4LLUB 2GHWB 2IV9A 2VE6A 1QI4A 3VXSE 4WDIA 2XOTA 3EGDA 1MDTA 2XN9B 2ZAHA 4M8VA 1COBA 1UWXK 4GG8B 2WLLB 1IC5H 3A4FA 3Q8BA 2E56A 4JMNA 2XZQL 4RQQA 4BQ6A 5LHDA 3W2DL 1GMEA 2HWZH 1MAJA 2VKWA 4J8QA 3SJVA 3IGLA 1OAUL 4KXCA 1S9XB 1AJ7H 3MNVB 1PZCA 3GXUB 4I9WE 2AQTA 1WAAA 4WFFD 3S3PA 4IBWA 4IRSB 5DMIH 5T1LA 5CGMA 4BXVA 3SDDD 4LASH 5DJAB 3STLA 1S78C 4B27A 4PW9A 2H2SC 2AEQL 2KZKA 2OLDA 4O2CB 4WU5B 4JFFE 1DFBL 5G5DA 5LBGA 1S5HA 3JTTA 3LZFH 5AVWB 4HKJA 3RWHB 4ZFOA 1IL1B 3RL1A 1BAFH 5INDB 3C87A 1G6RA 4LEXL 5KYNA 3DYMA 1CO1A 4JGNA 1K2DA 2DICA 3EYUL 1A64A 1QNIA 3UTOA 3RVUD 5AVSB 1QEWB 1EXGA 5HHPB 3N1QC 1REIA 2OXGA 2F8OA 4N9OB 4FQXA 2Y6SD 2XC8A 2E0PA 1DSFH 3IGKA 5ERWB 5MEPB 4EZMA 3PQYD 2XWTB 1KGCD 4X9IA 2ODHA 3FO9A 1AOZA 3DSNA 3VDAA 1KJVB 2OYLA 3NN8B 2QBWA 2R0KL 2IDQA 3SE4C 4FXGB 1NMBH 1GZQA 5IMOB 5JHMA 3U2SB 4PJBF 3PAVA 4UBDD 1OCOB 4KV5F 1ZT7A 1WBYB 1UWGL 1AP2A 4NN7C 2PWEA 4U05A 1HSBB 4MS8D 5CS7A 3PCYA 1BVLA 5DSCB 1U93B 5KVDL 3V6BR 4M6AA 2EO1A 2W07A 4X7DC 1FNFA 1KDJA 1O6VA 2LABA 4UOW1 3WHE0 1FSKB 4NZFA 5L9DL 3CMOL 1T1XA 4LCWD 5DMJB 4DCQB 1WS7A 4ZYKA 5KUKA 3Q2VA 2AXJA 3GMOA 4JHUA 5I19L 2BFVL 3DHJA 4N2DA 2XXGA 4MJIE 3G5YA 3OB8A 5CFHA 4L8BA 3F6LA 5E9DB 2Y1YA 4OFYA 4G1MA 3KNBB 2H1PL 1IIIA 4IRJC 3LZOA 3QIWC 4R4BB 3D4ZA 2AFNA 3FFCD 1MXGA 2QADB 3PHQA 4RFEB 5LNEA 3V0JA 3SE3C 5DRNA 1KCRH 2XN2A 3L4YA 5I17B 3LV3A 2IG2H 3L3HA 5FYLL 5DO2D 1KOAA 2VSCA 4KTDL 1E4XL 1NC2D 3I2CL 3IMUA 4U1SA 4YC2C 3P54A 5C6WH 3QRFM 4NI6A 2DLHA 3C09B 3AU1B 2FEEI 2ISDA 1OF0A 2WGXA 3ME0B 4JFEE 5C0BD 3UTTA 3P4MB 4HV8A 4HGWB 4OCSH 2BERA 1S9WB 4YDIL 5DJZB 1CD1A 2PCFB 5IJKA 1DFXA 4HUXB 4LSTH 5B21A 3VWJA 3BPOC 1AGDB 4S11A 5F8RC 4M93B 2YWYA 1FDLL 3S88H 1NLBL 4U1KB 1R75A 1YQVH 2Y7QB 2EDEA 4I4WB 4LHUG 2HSIA 4Y4KC 1S6NA 5EHFA 3MLYL 4LCYA 3QI9B 5LNGA 1MCSA 5BZDA 4XBEL 1T04B 1D7BA 1UCBL 4AWJC 1JZIA 1EH9A 3Q06A 1JV2A 5BZWA 3T2OA 3BQUA 3EO1A 3FFDA 4JG1H 5GGRY 4K23L 1IBHA 4AYEC 3AT9A 3GIZH 5C6TH 5HYSG 1LK3H 4Z3TA 3TBCA 1YRKA 4HKZB 4U6HA 3ZPDA 5B3NA 4JLRA 3CFKA 2LU5A 3QUKA 5SX5H 3UIYA 1OWRM 1YN6A 1OANA 3FO0L 2BZ7A 4EPSA 3KJ4C 4DKEL 2XETA 1F4WH 3MJ8B 4WWKD 2JB5H 2IAMD 4KQ3H 4WI4A 4X4YB 5F7FA 1ZS8A 2QDWA 1G4MA 5EO1B 3EHBB 2EVHA 3LS4H 3CFCH 4YOKA 5TDPA 3QCUH 4YIQB 4JY4A 1MCDA 4PJBB 1G5AA 1ZA6A 2B8OT 4J8RA 4LDCA 4U33A 2WZPD 4I13B 4PTTA 1ZVYA 1A9BB 2XWBB 3GEWB 1AS7A 2NY4C 4WJG3 2GHZA 5DQDH 4PGCA 1L0XA 1E28B 1Q9WB 1TETH 4HIXH 3FRPA 4A2GA 4C83A 1EERB 1EANA 5FK9B 2A4CA 2H5UA 3EJRA 4HQQL 3UC0L 3FSVA 1A6UL 5EIIG 5D2LA 2OTUB 3MBEA 4CNIB 4HIJA 2C26A 3MV9E 3OLEA 1IGCL 1ET8A 3V4VB 4LCVA 2G9HB 4FYQA 1I31A 4PJAE 2XIIA 1GVIA 1KEML 5E08L 4QIRA 3QFJD 4Y4HD 4TLKA 2NUPA 5L7XH 1K4DA 1A3QA 1X5JA 1HDMA 1M9WA 2X7LB 1S7WB 4XX1G 5FKPB 2NY0C 1CFVL 5BNXD 4NBXB 1FCGA 1LM8V 1U6AH 4GMSH 1TVBB 3O2VH 4DP6X 4TSBL 5EUKB 2D9QB 1W16A 5EU4A 1ZSDA 4HJUA 5CZKA 3MOAH 1NDGB 2C7UA 3KPSE 2BNRB 5GZND 5AAMC 1G9ML 1F6AB 3HC4H 2HTKD 3OGOE 1SUJA 3N1PC 5E6RB 2AJ3B 4R7XA 2APXA 3OB0K 4G9FE 5B1KA 5DFAA 3O6FA 4LRIA 4DOHB 1DO5A 1KELH 1AZNA 3DX8A 5KN5B 4QHUA 2VW7A 1XF3B 4UANA 2WYIA 3ECQA 4IGBA 4FFWC 1UA6L 3I6LE 4OLYL 1T5WB 3CN0A 4EIUA 2VDMH 4HC1H 5DYOB 5KOMC 1KF9B 4LAQL 1AGFB 1F3DH 4NBZB 5CIPH 3TA3C 4IMKC 1KCBA 5D8JL 3WMPA 1U91A 2C4FT 3O81A 4ZT1A 1R3JA 1JFHA 3ZBMA 4NN6B 1OE3A 1EXUB 3GBML 1J5HA 3OSKA 5HHME 4UF7C 3IJHB 3HI1B 1PJWA 3L2LA 2YSSA 5EBLB 5A16B 3NQKA 4F3FB 4WW2A 1JVKA 4U1NB 1NC4D 4F7MB 1OB1A 1KN2L 4MS6A 5JMOC 4JY6B 5KSBA 3US0A 3APNA 1TYEB 1I1AB 1I8IA 2CO4A 2WQXA 3ABMB 2VOTA 3HOGA 1IAOB 3ABLB 4ISVB 4JPQA 1UD4A 1NCUA 2EDWA 3DVNA 3ULSB 4B9CA 3MLWL 1IAII 3B9KC 3NDZE 3V8OA 1SJXA 4UT7H 4X99A 3ARGB 4Z7OB 2NQ3A 3VE0B 4OJCA 1CDGA 1SXCA 2NNRA 4MNHB 2B4CC 4KKAD 2F53A 3IGFA 4BKLA 1E5CA 4UT6H 1ADQA 1OGAA 1MCRA 3TF7C 3E1ZA 4GEJA 2B20A 3WOVA 5J9PA 3VG9C 2NY3C 5ISZB 3HNTL 1GAFH 3GJFB 2CJUL 3QUXA 4KY1H 3VXUB 1KN4L 3IF1A 3FQRB 4KVCH 4PD4K 1ACZA 4NO0A 4MAUL 4H20H 4AIXA 2YAMA 1ZLUK 2AQRA 4KO5A 5JXED 4ZXBB 5FLUA 5KYXA 3TN0C 2E86A 5ESVB 1M7DA 3L9EA 1GYVA 2HN7B 5ABZA 8PAZA 4XX5A 2Y7OA 3KG5A 2VGLM 1TJGL 2NLJB 2GJ6D 1FNHA 2IJ0C 4HIQA 2BMKB 2IWFA 2YJQA 4MZRA 4DKAA 2ERJB 4NSKA 4JREC 3LN9A 1HH6A 4PRHB 3AUWB 2J12B 4UM9D 5ADPL 4LPXA 15C8H 3MNZA 5CWSB 2CUAA 1QOKA 4YGVA 2FD6L 4YHPA 3W3BA 1RIVH 1SPDA 2B39A 3CLEH 5DK2A 1HL9A 2VLRB 1PLCA 1IQDB 3PL6D 3RJOA 4NQUA 5T1KA 1EK3A 1TT6A 3T0WA 3LS5L 3WGUB 4JRYA 3VXSD 2ARJA 3UZQB 1K85A 4XNBA 4GSRA 2W8CA 5JDSB 4ZNCD 1FA4A 1LQBC 3RIFF 2KI6A 4P4KD 3LRGA 3IKCA 3MGTA 1NGWA 5SWZD 2PXYD 5ID1A 5SWQB 3I6SA 4JQIH 1TQVA 5JORA 4EI6A 1IKFH 2FJGB 1R4XA 1AO7E 4XN4A 2AITA 3QE5A 3LKRA 3G6JE 5B8CA 1CUOA 2Y22A 2RQ8A 3DBXB 4LEOB 2WVVA 3FF7A 4LF3B 3G6AB 1A1OA 1D9KD 5H37A 2VMFA 1RU9L 4YDLB 5JXAH 2LV4A 4FL4C 5DHYB 1N9PA 3RY6C 3L13A 4JFFD 5JYLA 1URLA 2F1AA 1OSYA 4PJHA 4PG9B 4FABL 1T21B 4P99A 1MVUA 5BS0B 4XPGL 3U9WA 1S9YB 2XXMB 4WEUD 3D51A 5GRJL 4LPUA 1MJ7L 1SYVA 3B9VA 3W39A 1GGBL 5H2BA 3T65A 4ZO8A 4LBEB 3L3OB 4FCAA 5CD3A 2A5UA 1BSIA 5CINH 1G0YR 4KHTH 3VFVB 3T6WA 2BP8B 3ALPA 2EC9U 5E0FA 4DUXA 2XI9A 4EN3B 5I24A 1M71B 3NYKA 4O2FB 1XSIA 1DJIA 1OAKL 1F11A 1BV8A 1NGPL 2JQMA 3QQ4A 4XNZC 4L48A 4MJHA 1OF2B 2CE6A 2XA8L 1ZJBA 5DJCA 3HN3A 1CE6B 5DFVC 3PHSA 5DHVH 1G7MB 1RK7A 4JO1H 1YMMA 1MFCH 2Z0UA 2J55A 5C0EB 4K3HA 4LQFH 3ZTNL 3QJUB 3D85B 2C3HA 2QMJA 3CXFA 5CN2A 4ELMF 3HC3L 4LMQE 4KROB 3EJQA 3E8UL 1EAJA 2YLKA 4GXVL 1KTLB 1J0JA 1A5FL 1IC1A 5ETUB 4WFHE 2J5LC 2DIBA 4WI0B 2YLHA 1BJ1H 5KBNC 2OMUB 4OGZA 2H45A 1A4CA 4MJID 1ZS2A 4ATWA 1I3RB 4WRLA 5DK0B 2PABA 1DDHB 3NACL 4FS0A 4WUKH 5FA4A 3ZUCA 3PRZA 5BJTB 4HEPG 3QFDA 1A8JH 3RDTB 4G8GE 2Z1KA 1MREH 2AEPH 4MASA 4YXHH 3O3UN 4Z7NB 4HOMA 5EU6A 4JANA 3S36X 5J5EA 4RH4A 5GRUL 1QRNA 1DLFH 2ZWLT 1DN2A 2BVPA 1P4IH 1F0LA 4QT5B 1LP9A 2SEBB 5IR1B 4HIEA 1F86A 4XPTL 1IAMA 4S2SB 4JFED 1JGUL 4ZW8A 3MV7A 1HESA 1UWFA 5FOBB 1JDCA 1WTGT 3VO0A 4PJEA 1LE9B 3T0BA 1KXQE 1KG0A 4GJTB 3DX9A 2F68X 2F8VA 4L1BA 2MCMA 5B1CA 1RZGA 3QZWG 2EICA 3AXLA 1PPIA 3L95B 1WS8A 3H42L 3QNZB 1DBAL 1JPTH 5K33A 1EJOH 4JZJA 1Z0NA 3SGJA 3H4FA 2JWYA 4TQEL 3GSXB 3IGUA 5K39B 1F5WA 4CUCA 3QJFB 1JF1A 3JWOH 3GB7B 4HFWB 1AXIB 4PRPD 2A77L 1A0QH 1GY2A 1F3RB 1XCQB 2CK0L 3AREB 3IEAA 5J0BA 1S9KC 2WWKT 3QQDB 5GJTH 5JIQA 3WN5B 1KJ2L 3SE9L 1KGXA 4EI5D 4R7NA 4BFIA 1FO0B 4ZOBA 1MHPL 5JR1H 4KRNA 1U36A 5F0LB 5I0DA 4CN6A 2ATAA 3T9WA 1RP9A 3BUBA 3GSWB 3U1SL 3IETA 4BRJA 2Y5TA 5T5NG 1UATA 2WLNA 1CDHA 5IMLB 3VXPB 5MHSE 3DV4B 4P4RA 4P5TC 2AGJL 3F8UB 3RQ3A 5IW6B 3GO1L 1ZAGA 1J1XL 1B0WA 1XCTA 1N5AA 5TDOB 1IEHA 2X4OA 3QISA 2Z8SA 4W9LC 4N8VG 5DZNA 2HKFH 3IN0A 5FO2A 4Z7UE 2NXZB 5J3HD 3EBHA 4AC2A 1FVDB 4PJFA 1QBBA 4WV1A 3D25B 5E94B 4ELKA 4M8UA 1RI8A 1CDIA 1XGQA 2YXWA 3HB3D 1ZEAH 1S3KH 5J1SC 1KC5H 2B15A 3VXOA 4FULA 1G6VK 5LQBH 4BZ2A 1CDUA 1X5MA 5GIRB 3AM8C 2Y36H 1A7PH 4EF3A 3KPPA 3IPEA 3EH2A 1NL0H 3BO8A 4HBCL 4NKIH 4K3DL 2YFNA 3MV9D 3W0WE 4U3CA 2B2XH 3V6ZA 4BFGA 1OCCB 3SDDB 4TULL 4JZNB 4YDJB 1P7QD 5FV1L 2QZ5A 5AKRA 2CLVA 1H5BA 1ROCA 2ZP9A 3KDMB 1R5WA 2EEDA 4ZBJA 2CIIB 1AMYA 4DP1X 5AAWA 3BAIA 5F70A 3VGAB 3L7EB 1KPVA 2WNGA 4MXQD 2LTQB 1X5HA 5EO9B 2CWRA 4DO4A 1YJDH 3FB5B 1NANH 2CDGB 3RVXC 4Y5XA 3OMNB 3U48A 5I6KA 5HGGS 1YEEL 3FZUD 3C5SA 2EDNA 2J1XA 3GTNA 4RZCA 3KPSD 1T2QH 2EE6A 3DBSA 3GHBH 3HI6H 3OQ3B 4G6AD 5EZIL 3UJTH 5TF0A 1YY8B 4W9GC 4L05A 3ZDYB 2VLJB 1NEZB 2C4FU 3BUPA 5C0NC 3BYYA 1GYCA 3D08A 3IS0X 4MDIA 2DQFA 3KLLA 2WLIA 2WXGA 1HL5A 4Z7VF 4L4TD 2KZ1B 1UJ3B 4YWGL 4YBQC 5DA0B 1BPLB 1JPFA 1P4LB 1G9HA 4AJ0A 3AAZB 3JTSB 4YHLL 2V8MA 3WEOA 1W8NA 2AK4A 4G7YH 1UTDA 3I6LD 2ZT9C 4P3DA 1YDPB 5IB3A 2XFXA 3CVHA 3N91A 4AQOA 4LVOC 3TO4C 1ZT1B 1UT1A 4I0PA 3DWTA 4ES9A 5KYUB 4XO8A 1E4WL 2PPCA 1G5GA 3EDJA 5HHMD 3KH3A 2HUEA 2ZAGA 4L8DA 4RRPG 2XN0A 2XWRA 5B1BB 4ZFGH 4WY7H 3VUAA 5ESAB 2X2HA 4HUMB 5F93C 3DOIA 1PY9A 4V1DE 5BW7C 3GJEA 1CK0H 3ZE1F 3ZLQC 2QPSA 2PP9A 3CU1A 5FO9A 3WXWH 3SOTA 1KZYA 3PGCB 5A2CA 1XFPA 2VMDA 2WUCL 2AVFA 3MUUA 2LGNA 2GTZA 4HIIA 5DRXB 3FFCB 4JHWL 3HE7D 4C4UA 5DGRA 3VGHA 1GJWA 4OLXL 5DVMA 2V7NB 4OGAC 1WVZA 1TF4A 3OKNB 5IMMB 3L3KA 3WI9A 2XG4A 5CZRA 2ZCHH 4PWHA 3P4NA 2J8OA 4RGND 4DW2H 3ARRA 1BVKB 3NFNB 4FHJA 3MX0B 2VDPH 1IGJA 3ARDB 1SBBA 4Y4FA 5I28A 5C0BB 4XCNA 3H2WA 2NNAB 5KG9B 5FHBL 3COOA 2RMNA 2NW2A 2W95A 1QSED 1ZTXH 4OJYA 2BOBB 1CU4L 3GQFA 2Q86B 1MLBA 3N1MC 1Z7JA 4HX1B 4EE2A 3A4DA 5GS0L 3MMEB 1FZJA 2HVKB 5KS9F 2BVUA 2E47A 2XWEA 3O3EA 4M6OH 3TFKD 3ESNA 4XVUD 4KHXL 4BCYA 3KPNA 2WMPA 1CJYA 4UTAL 4KRLB 5FLVA 1OY3B 4A68A 7CGTA 5KVGE 2X4SB 3J7HA 3T1FA 1MCCA 4M1DL 4YSEA 5C0RL 1MW0A 5CU9A 4HCRA 3MJ9L 5T3XH 1HEHC 4IOIA 4N0FA 1TEFA 1TKWA 4IU3A 5AW2B 4MNQE 2F5BL 2GUYA 2DLIA 4GYBA 5JPNA 3ULUD 3OJDB 5ICZA 1KMGA 1AGEB 4X6CE 5HGDB 4Z7QB 4AC4A 1Q9LA 2NR6D 2VAAA 3F00A 3CH1B 4HJ0D 4LLUA 1N6QH 3HHSB 2VTFA 2JXMB 4UV7H 2VDKL 1INEL 2UZYB 3L2MA 2Q6WA 3HPLB 4YBLC 5EORH 1B2WL 1U92B 3DMMA 5FHAL 2X10A 4ZSOB 3ZE0F 5IROA 2PPDA 3Q5TA 3L3GA 2CKBA 4A6YH 2XQ0A 2J8UE 4HJJL 2I9TA 1PQZB 1TJIL 4OF6A 3FSOA 3MNVA 3Q2LA 2NDFA 2IADB 2Y06H 4K0OA 3QYNA 4EDXB 4IRSA 4WQOA 3RWJB 4NNXA 2WM0A 2YD0A 5BO1L 4R4NC 1HNFA 1G94A 2XWCA 2ZXAA 3K72B 4FLSA 1VGKB 5C0CE 1HZKA 2RCSH 3U4AA 4LNVA 2ICCA 4PJGB 2VWEE 3ZMEA 3LZRA 4K94L 5HP5A 2XNAB 2QPFA 1Z1WA 3FN9A 3IDJA 3IE4A 2AXFA 3RWHA 2HKHH 5INDA 2BPBA 1YC7A 5K69A 1HQ4B 2CO1A 5LNDA 3CPUA 4YZFE 3WYRA 4Y4HB 3QFJB 4R9HA 2BIOA 5HHPA 4K5LA 4B5EA 3LEYL 3MRBB 1P9MC 5D93C 4TNWF 3KPQB 3NCXA 3Q3GA 5EIVA 1JWSB 5D7JD 3NP4A 4X2UA 2DS4A 1G7IA 3KLDA 4R3SA 2C4XA 3I75A 1BXUA 4NQVA 5C08D 4F5CE 2YEQA 3RBGA 4KDWA 2Y23A 3ZKXB 1RY7B 3NZ8B 1BG9A 1MNNA 5IMOA 4Z18A 4BDVA 5LWYH 4PWKA 1QAWA 3QULA 4FE9A 4PGDA 3FB6A 3QZLA 5E6IB 2VLLA 1H9DA 2VXQA 1X7QA 2P24B 4MVBC 1LTXA 4UT9A 5B1AB 2LQRA 5IQ9B 5GS2H 1JHTB 3GK8L 1CF8H 3T8XA 4Y8AA 3FUHA 3O6FC 1EEQA 4LRIC 4OQTL 3BSHA 2VDNH 2PWGA 2F6AA 3OWRA 1K6QH 4RGOL 4DCQA 4Q6YA 2ZG2A 1Q1JL 4IGBC 2P8LA 2CBPA 2HT4D 3WG7B 1QVOB 3A21A 2I85A 4HMDA 3EZJB 4OFVA 1FP5A 4E36A 2ZYSA 4R4BA 4WFHD 4LAJH 4UQCA 5FUCC 3ZSTA 1HHHB 1INDH 1DQMH 4RFEA 4OGXL 2R8SL 1VACB 1OAJA 1TTCA 4JM4L 4N0UE 4FLRA 1ZVHA 3FO1B 4B9PA 1LD9A 4UV4L 2VRQA 4A7QA 3FQWA 4G8GD 1QA9B 5IQNA 3MXWH 3Q1SH 4DP4X 5I1DB 1WZ1L 1HHIA 2EE2A 3U6RA 4HWEH 2OFQA 3VXME 2BVQB 2J21A 5FECB 1UXSB 3VI4E 2R69L 1EAPA 3DJSA 1S9WA 2GW5A 3G9AB 3QT2A 4HGWA 3RAJH 1H15A 4R8WL 1DE4A 5ACMA 3RZCA 4X6FB 3TU6A 3ETSA 1GH7A 3JVGA 4I4WA 3RIFK 4PS7A 4WVRA 4S1RL 3EOAA 4NWUH 2DYPA 3QCVL 1T89A 2Q8AL 4HXAL 3VAEA 2CO6A 4NZRH 1V55B 1B0RB 1X9QA 4OZHE 4Q2ZA 2JKSA 4L4VA 4PJ8B 4BSJA 4C8XA 1ADWA 5DD1H 2PYFA 3JBG7 4KUZH 1RUPL 4CL7A 4QGYA 2EH8L 3W56A 1AE6L 4HKZA 2DTSA 1K4CB 1SJEB 1A6ZB 2GCYB 3L5XL 4WI8A 5CP7B 3H9YA 4KVNH 4ERSL 4J3TA 5TDNA 4ZMAT 5I73C 4CMMB 2CKNA 3FL7A 5GSVA 1R5IB 4L2YA 4Z0XB 4XNUH 2N1KA 2HH0L 3FOLB 3RY5A 1W80A 3W11C 4NRYB 2YPLA 3VFMB 4CDHA 5A3IC 4KXZH 4LT7A 1CFSB 2BXZA 3LXUX 4HPOH 1NAMH 3KM2A 1FG9C 4NP4L 2WB1A 3GSUB 4LXFA 2TRYA 4RGMB 1MCJA 2ZSWA 3N44B 4HAKA 4HSCX 4X4ME 1OTUC 4OFDA 2ZYRA 4PJBA 3H3PH 4O02H 3WNMA 2Q5BA 2NY5L 5I1HH 1KXTA 1XT5A 4LO9A 5CLZA 1I8LA 1U42A 4GEIA 3U36B 4GSDH 2AAVA 3NFSH 2V2TB 4QXTB 5B4MD 1A6TB 4W9HC 5C3LD 1D6VH 2QELA 3GLDA 3NABH 4PRDB 1QABA 5DHVB 5DJ6B 2MQGA 2DLTA 3OKOA 3UGEA 2CNYA 3FUJA 2DI8A 4TLSA 3QAQA 1FZKB 2QVFB 1B4JL 4OZFA 3WNLA 2B7DT 4ZQKB 2WN3A 2C3WA 1KTKE 4LLWA 3RRQA 3VFTA 1ITBB 1XGRA 1SQMA 2YOCA 3BKYH 3U0WH 1KYOK 5BOJA 1WICA 1T2XA 3REVB 4NAMA 3T4AA 2D0HA 4YFLF 1F4XL 2B16A 1DQLH 4TS6A 5B8CC 2A83A 4YQXH 2XYBA 1EZVX 1PDKB 1PD1A 4LNRA 4QRQB 1D9KB 2BS9A 1GOFA 3KPMA 2DH3A 1T0MA 5LO7A 4NERA 3LVEA 3VD7A 3RVTD 4J5VA 3ML9A 2CDFA 3WV0A 1X5XA 2Q2LA 3C8DA 4N6RB 2CJ3A 4IKJA 2GY5A 1V3LA 2WPGA 1ORQA 5JZ7C 5F7EH 2OKMA 2NY1D 3IRCA 1NDGA 5AYUH 2WTPA 4QDGA 4TVPL 1OGTB 5GGSB 3QZNA 2WZ6A 1LWRA 1GOGA 1HWHB 2UZIH 3MUJA 2EE0A 5KSUA 1T7XA 2I5YH 4ODUA 4DKFL 4N2AA 1QLEL 1U3HB 2FQGA 5IW1B 2BY0A 2PF6A 3NP3A 5DUPL 1IGIL 5D4HA 3ZDZB 2EVIA 3WE6A 1EGJA 1I85A 1KT2B 3WSQH 4N2BA 3THML 5HBBA 1AACA 2W38A 5IBTH 5IVXE 1B6UA 4NUGH 1K8DA 4X5LA 4HS8L 1R47A 1T20B 4GBXB 4YPGA 4FFTA 1MIML 3NEOA 5ESQA 3SKOB 1SEBB 5FUZL 3SBPA 1AGFA 4ZPTB 4DN4L 2K3HA 4F57L 2A9AA 5F9WB 1W0WB 5DVNA 1EXUA 1S7RB 4OM1L 4X5WA 1OP3H 2J57A 2P47B 2Z7ZA 4JRXB 3TM6A 5E99H 4FFZA 2X9WA 4LU5L 1FFTB 4BQCA 2B1OA 2ZXWB 1CPUA 2JIXA 4NJ9H 1UEMA 3SDXB 4HVBA 4JY6A 2E7CA 5I8EB 1OAYL 1HCVA 2IDTA 1KBVA 4U6XA 2AV1B 1D6EA 3T77A 5I0VA 1FHNA 5CSGA 3UYPB 1Y6KR 3OL2A 4V1DD 1RH8A 3ULSA 2R0WL 5E6ZA 3R1GL 2Z92A 4P57A 3FQYA 2VAJA 2F8IA 1FL6B 3OZKA 1CIDA 1HI6A 4JHVA 4MNHA 8CGTA 3QWQB 1GOHA 3HFML 5K9KB 1EZLA 2IALA 4PJ7E 1FAIH 4QRSB 5L0QC 3FUDA 1PG7L 4XC3H 3VD9A 3T6VA 3D30A 1NFDB 3UROR 1JGDA 4OB5H 4S1DD 1QTSA 1QYGL 1S7UA 2JELL 2VW6A 4PB0H 3MV8D 1O7DC 2ZONA 2K4AA 4BFKA 3QIBD 4QHPA 3D3VA 2DLGA 2KLRA 1A4JA 1EX0A 3IDMA 5DEZA 4ZXBA 1NCAH 4XWGH 3V6OC 2AJSL 3MKKA 4PJ5A 4ALAL 4CC4A 1OARH 1ZHBA 4N6QA 4MB4A 1MZYA 1NCNA 3DECA 3IPBA 2IPTL 4XO5A 1LEKA 4JZJC 1PL3A 2MFNA 2VDQH 1D5XA 3HBQA 3G6DL 4F80A 3DPBA 4AVHA 4F8LA 1T4KA 1SN0A 2VIRB 2YQ2A 4K7FA 4PRPB 2FEEL 3ALWA 4G7VL 4PLOB 1OM3L 3UBXG 4OBSA 3BWAB 1PNCA 2YHGA 4IK7A 2WQAA 3NSFA 4FZEH 3EJYC 2VDRL 5EOQH 5C8JB 1BD2A 4ATTA 3K74B 4F2MA 4MNQD 3BE1H 2JB6A 4PN6A 4AQ1B 3BEVA 5AUMB 1RFDL 5MERB 2TAAA 3B1UA 2CDEB 4I0KA 4KRPD 3FU3A 3PGFH 3BSZH 5EZLB 1N5YH 1RZ8B 1FV1A 2FT6A 4APQA 4QKTA 1NCBH 4B9IA 3KLQA 5LGJA 3L1OH 1MRCH 3BDYL 1SLUA 4WNSA 1XIWA 1YMHA 4QPEA 4Y2DA 1S7QB 5HI4D 5IHWA 2XRAL 1OPOA 3C6LA 4NC1E 3HBGA 4QAMB 3FMGH 3ILDA 3QNFA 5HHNA 5JPMA 5JOEA 1HHKB 4LGRB 3BVWA 2H6OA 3O4LD 1BM7A 1HOCA 1NIBA 4KDTA 1RULL 2H0FA 3CLFL 4CU8A 3LXAA 3RTQC 4NRZA 5B3JE 1IT9H 4PS4L 2WLMA 4WV1C 5FYKU 4DFIA 5BVJA 4I87A 4P2OA 5L2JA 3V6FA 5CLWA 2RBLA 2V9QA 2WXMA 4LEOA 3FQTB 1GJUA 3PABB 2OZ4H 4LF3A 4XMKL 4M9OA 1PVHA 4N0CC 3FH8A 3LQZB 5C0CD 1RIUL 3CN4A 4LEEA 2QV2A 2XKNB 3NQIA 5DYFA 3IKKA 2EYTB 4EAEA 3QUYD 1EO8H 4DN3H 5BXFB 3HI5H 4D0DB 2FX7H 3PWLA 1ZV9A 4BK5C 4QRPB 1SM3H 5CKAA 3O4OC 4Y0GA 4X5RA 2ORBL 1P7QB 3OAYH 4XBGA 4GMTL 4IS6B 5TE4L 4QYAA 1H5BC 4UAOC 1ND0B 4PRIA 1DSWA 3A22A 4FI7A 4N5ED 4HJTA 3W5NA 2HPTA 4MCZB 4NEHB 3OHXB 4RVBA 1RK1A 4UMGA 4P5KA 3C8KB 3L17A 3ULUF 3WO4C 1G7HA 2YXVA 4GRLA 2WUBH 3MODH 4TLTA 1MFEH 4Y7OC 4LLVA 2ZG3A 4HUNB 1BLIA 2OMTB 4CN1A 2XX0A 1CE6A 1VA9A 1CGXA 1V3KA 4ZPVA 1I1YA 2Z35B 5D71H 1TZGH 1CDBA 1FUNA 1NKGA 3O3BA 3OMZA 4ZUUB 4M1GL 1LVEA 3IGAA 1M6OB 4OFKA 4OLWL 3VD5A 2DWEA 4KKBD 2Y69B 3V5HB 4L4TB 1E9QA 4MQTB 3JWNE 5FA3B 4GB9A 2D03H 3VQ1C 2KH2B 5DI8A 4S1SH 1YNKL 4KKCD 4QWWD 5FYJD 1BWMA 2ZUQC 4ORZC 2UXFA 4G8EB 43C9B 3C6SA 1OTTC 2CD0A 5KVFH 3BPNB 3TEWA 2YPKA 5DK0A 2ADIB 2IV8A 5K1JA 1NCWL 5FO8B 3K7UA 1OW0A 2R7EB 3MLSH 3TA4D 1EDYA 1DVYA 3G6JF 2JSFA 3MRFB 3MYJA 3OR6A 2OYKA 3VFWA 1WZMA 4WKXA 1FN4A 1D5MB 1A9EA 2A99A 1MXDA 3EGSB 4XMUA 5DDHA 1AQMA 3CZUB 1ZLSH 4OD3L 4ODTH 3LNFA 3GWJA 4I1RA 2NRDA 3LQAH 2YUVA 3QWOB 4NO5A 5HDBE 1S8DA 3UOAB 3F7RA 4GRWH 4KXAA 5JIDA 4I2XB 5D9SA 3EOTL 4Z78A 1KUMA 3L45A 3G5XA 1SBSL 1XMWA 5D1ZB 1YEHH 3DX2A 3GKWL 5E2UH 3GI9L 2DQIL 5IM7B 1HKLL 1P1VA 5F7YC 2Q20A 4QTHA 4UQDA 4ANKA 4AENA 1AG0A 4OCXL 3TXAA 5DRZB 3ZHFA 2X4RB 4XPHH 4N8CL 4A6YB 1PZSA 2NUTA 4LHUB 4FQ2L 4Y4FC 3QXVA 5E7FA 4WF7A 1JHKL 2VYRE 1LK2B 5LBSH 3T3MB 3T6ZA 3WS6A 4ZW5A 2DTMH 2L7UA 1QSEB 1BQHA 1EBPA 4ZW6A 4NZUH 4XPAL 2YQBA 1XCQA 2EXYD 1R3KA 1U2CA 4GXFA 3Q6GL 3ULAB 2E75C 3WN5A 2QKSA 1IAIL 2ICWJ 1FO0A 2C9PA 2N56A 3NSCA 3APMA 4GAYB 3QSKB 5EO0A 1X5AA 4DQOH 5AYQA 5TE7L 1FZOB 2W80C 1HE7A 3IFNL 4HD5A 3UGUA 5AFAA 3MACH 1O9WA 1YAIA 5IEKA 1VF5C 2VLKA 3L4XA 4OLUH 1TCRA 3D18B 2VABB 4HS6A 3RDJA 5IMLA 3ZE2E 4AXWB 3F6IA 2O61B 4K2UL 4QEGA 2WQWA 4H5SA 3VXRE 1ECZA 1DQDL 1KJ3H 1RVFH 1QATA 1EJ8A 1XGYH 1QQDB 4LDEB 3WJMB 5JPNC 3LHAA 3U0TA 3RL2A 5D4QA 2PCYA 4HWBL 1IQWH 4QRRA 2P5EB 3QHZH 3RPBA 3AXHA 3V5DB 2NYKA 3WDJA 3NIFE 3ILPB 3QP3A 4XVTH 3EH1A 5D7SL 5T3ZH 1P5UB 1U8HA 2KHAA 1FWXA 4AT6B 2XPYA 4J4PC 4JZOB 1B0IA 3JV4A 3WFBH 3ASWA 2WBJA 2DH2A 2ZUTA 3WTUA 3P4OB 1HYSC 2V5TA 2H2SD 3BH9A 5DUML 4NQEE 3DMMC 4ELMA 3ARZA 2I7OA 2RALA 5DUJA 5I15H 5G4MA 5D1QA 4TQHA 2EH7H 5BZZA 1NCHA 1UQSB 3KYMA 3WIFB 4GFXA 1C08A 4C56E 4JKPL 5EIIB 3WFEH 1S7SA 3GZKA 1QSFB 4C4KO 1EO5A 3D39B 4N86A 5AW4B 3L4WA 4YDJA 1N0LA 2Y4SA 1XSJA 4N2OA 3FTVA 5B1JA 1LO4H 1PMYA 4LSRH 2P8PB 1XL4A 1JMZA 1YAZA 1PD0A 1KYAA 3GUTB 5CEYA 1N10A 3QCTH 2YMTA 1H3VA 4KX8A 4ODBD 2EIJB 4X0NA 1GSKA 2YGOA 3BPLB 2JF1A 2IH1B 3CNKA 4UILH 3H2PA 4JKWA 5CUSH 4P5MA 3I6KA 5F9AC 5FYKL 4F7EB 1JXGA 5F7UA 4P23B 1P2CA 4L3AA 5FCUH 1NFDE 1E2WA 1HH9B 1XH3B 3C08L 4PJIB 4TKWA 4FEIA 4GI9A 1SF5A 3PQYA 3P02A 4GIOA 2A1WH 3POCA 1SFHA 4XP5L 3FUEA 2JKIS 4KITB 5C08B 2O93L 4X7SH 1NBYA 3NCJH 2XVGA 1PSKH 4RNRB 2EC8A 4JFDE 4M8QB 1P4LA 2BSSA 4LCCB 4H7VA 4XP6H 1P0SE 1U0QA 1UZ8A 4XCCL 1NINA 2JK5A 1QFWM 1S9VA 4XNMB 3LKSA 3T1WA 2QT6A 5AVYB 4QD2E 1HJCA 2XZQH 3AS1A 5DD6A 1TQWA 1PZ2A 5GRYA 5DT1L 4D9RD 2FSDA 1YLBB 2Z7WA 2LU3A 4IRJD 5E00B 3L16A 4Z7UF 3FTGB 3ECUA 3QIWD 4M6NL 3BW9B 4ACTA 5EU5B 3T6XA 4LCWA 1MI5A 4XTRD 3BLKA 1J0IA 4M5ZH 2BSTA 2AJVL 3TFBA 1H6FA 3OPZH 2OI9C 3WIIH 4LLDB 2W65A 4W9CC 5E2TL 2OTWA 3KDPB 1O9ZA 3BP6A 3BD4A 1T0NA 2CSPA 4GIAA 2ODIA 1DFBH 3OKYA 1GYAA 1YNLL 2DMBA 1JDAA 2GT9A 4OVVA 4Z5RB 3MLPA 3BT2L 5I18L 4YHZL 2YQGA 4M8RA 3IB4A 4RFOL 3ARPA 2PW1B 3UO1L 4NNPL 4EMZA 2DLEA 3EYUH 3TBTA 1CLOH 5DC9B 2OMXA 3Q8EA 1I9IL 5F6IC 1NAMB 1JNNL 3QORB 4NFBA 3SY6A 1L0YA 2BINA 3T2PA 1NC2A 1RXLA 3RE0A 1WT5C 5FW6A 4JN2A 1JYWA 1NANI 4JJ5A 4KZEL 4O02B 2Y24A 3EGXA 1U8QB 1QKZL 5C0BA 1YEFH 3NCWA 3ULVL 5KG9A 1EPFA 3EJPA 5I1EL 2BIMA 1ZHNA 4KZDL 1UA7A 3QH3B 1MY5A 1PAMA 2BOBA 4Y19D 2Q86A 4BUHA 4HX1A 4PGBB 4P2AA 3MCKB 2X2UA 3RZCC 2DWDB 4EOWH 2FYYB 3WIHL 5BMFL 2CJTA 5DHDA 1MCFA 2A38A 2FVNA 5DMKA 3UH8A 2WB7A 3BRFA 4O51A 4LK4A 1T89C 2VN7A 3EF7A 3DXAB 4DP7X 4RZKA 4Q6KA 4YX2H 4AX3A 4XCFL 2F9BT 1A3RH 3S96A 3U9PL 1ZHKB 2HLEB 4PJ9A 3TYFB 4JPKL 3VXQA 4NI3A 4ENED 5HHQA 3EYSH 1EO7A 1U2YA 3DIFB 3CU7A 3DRQB 3O9WD 4WU7B 2I9LB 3F7YB 1SJVA 2J6EL 5FUOH 2W9EH 4G6KL 3ZYZA 4AVJA 4IIZA 2DM3A 2GAZB 3I9IA 3RWDA 3CH1A 1CZ8H 5ANMB 3MCYA 2XPGA 1BXAA 1J05B 2NY4D 5JHDD 1EHXA 3F65A 4WWKA 2UYLB 2IAMA 3F7PC 4NYLA 4YDKL 3C2SA 3TYGL 2Y1AA 5I75B 4Y7MA 4Z7VA 1BBJB 2F7IA 4DVBA 1L3WA 1T83C 3GMMB 3T2NL 1QSZA 2D0GA 3HLKA 3TV8A 4XVJH 5EEVA 4PWEA 3VFGL 3KPLA 2VXUL 1PQZA 2WZPA 1BM3L 3IDYC 1I9JL 4R5XA 1VFBB 4LFHG 4M6ML 4W6YB 3V4VL 1EEYB 4OCLC 2GTWA 4KAQH 3SDYH 2J5WA 3FRPG 3R18A 3K6IA 5IREA 3T0EC 1G9MC 1NLBH 5JOFB 3WFDH 3LIZL 4G6JH 1JWMB 3LHPH 4GS7B 2IQAB 3F6JA 2NSMA 4IIQB 3O2DH 4K3EL 4JUSA 5D5ME 3BMWA 2NXYB 5T3XE 1HQ4A 1UFGA 2NNFA 2ARJQ 5I0YA 4K23H 3WNKA 4L8CA 5DHXB 4NCC2 3VGGA 5KEZA 4HK0B 3T4AC 4N0YL 5AVXB 1TU2A 2F58L 1G1KA 3LKQB 4TLUA 5L88L 3EBIA 2JJSA 3QG7H 1E0OB 3PJSB 4P59H 4DT2A 3K2MC 4LSVH 5ICXB 4K8RC 1IM3D 1XL6A 5IUSA 1TJHH 2VSMB 3QNYB 4FFWD 1MNUL 3U25A 5GZNA 3H54A 4H25A 4NDMA 2P24A 3TA3D 4PUBL 4X6CF 1KLUB 3WS3B 1SYSB 1ZWIA 4BZYA 4DO6A 5HVHB 5IQ9A 3QARA 1S3RA 5D1ZI 3ZRSA 1GXEA 2LAAA 4IKNA 5KS9A 4Y89A 2M8XA 4JO4H 3S34L 4EUPB 5L2KE 3O0LA 1I85C 5I8KL 2X70A 3BAEH 4M56A 4W9DC 1N8ZA 3KL0A 1PZAA 4BKTC 3RWFA 2OMZB 3S4SA 1EAQA 1HNGA 1J8HD 4V2CB 4QHMA 4XO3A 4G80A 3TVMA 1VFAA 1VFOA 1DCLA 2J8UF 3PWVB 4FADA 5J6GA 2FSEA 3QWRD 2QVMA 3LB6C 1KNOA 1YO4A 3QEUB 1HQRA 1FNEA 2VDQB 3BWUF 2V37A 1IGCH 2DQHH 1CQKA 3L9RB 5CN3A 4Z7WB 3WUZA 2AXWA 4XCEB 2AQ2A 5DURD 4F8PA 2V5SA 4ZDHA 4BFOA 1XF1A 4HULB 5IV2B 1NC4A 4HKBA 2DPKA 1HIMH 4UCFA 2WLZA 5CEZH 1DBKL 2BRQA 1H3TA 4BE6A 5JW3H 2HUHA 4MMYA 3UAJC 5CBEA 1X6NA 4QYOA 2ED7A 2BVQA 3LN5A 3ESMA 5FECA 2Y7SA 2Z7UA 3NCYS 2HT3D 3OAUH 5KSVB 4YZFF 2VO8A 2XBZA 2V3DA 3N40F 3TT1H 5DVKA 2X40A 1LQSR 5IUCA 1UXWA 5E5LA 3ZR6A 2N01B 1T5XB 1GC1C 3AY4A 2MNUA 5E8PB 4NKMB 4XNAA 2BXYA 5C0JA 4LGPB 2ID5A 4EVNA 3C9NB 1HHJA 3TIDB 3UJJH 1NBVL 1PD6A 2AKRB 3F7LA 4WNQB 4OCWH 2ZAIA 2DY2A 3MV8B 3PF2A 5ENWB 4TUKH 3FS9A 3J27A 5CZXD 2QKIB 3E3QE 4UZSA 3QIBB 1JCKA 1JZDC 1MY7A 4H0LC 3WNJA 2EACA 4XX1E 5D8JH 4MX7B 4OCNC 3ZGHA 4N0RA 4PSRA 2IAND 3ZYIA 4A04A 2D7MA 4IDLA 1T03H 4L9LC 2D73A 3W57A 5CCGE 3U79A 2H4EA 1VLXA 4HD9A 3X1FA 2GJ6A 4KH2A 3WLWC 2VMEA 1ETJA 3TCXA 1WIPA 1MFDH 1LEGA 2GPZA 1XB3A 1E6OH 1KGWA 1RK0A 4LKCA 2AS5M 5JHLL 1DVZA 4S1QH 1OSZA 2H26B 2CXKA 1EZVY 2PPAA 2WAQA 4R7DA 4WI2A 4UM9A 5EC1A 2PP7A 3S8FB 2CO7A 4G70B 1S7VA 2WXPA 4LIQL 4WHCA 3VXRD 5EF2A 3VX1A 3EYQD 1RZKL 2GQHA 4FTVE 5C2BL 1QI3A 4KRPB 2V6HA 2RB8A 3FULA 1WCQA 3PL6A 4U1JB 1SF3A 2QTVA 4L3EA 2DIAA 5EC2B 4D3CH 1TO5A 4N8VB 1C5DA 5GRVK 1IBYA 3OR7B 5DJYB 3VXSA 4X7CC 3QK0A 2JH2A 4APQC 4YR6A 2FX9L 1T5KA 1XIWC 3AXIA 1L9MA 3P40A 3T3PB 1I1RA 4P4KA 4XN8A 3VI4F 2P5PA 3C6LC 1RJZB 4DZ8B 4NQED 3ZTJG 3V9FA 1D2OA 1FRGL 4FP8L 5JPMC 5EN2A 2YXMA 3O4LB 5SWZA 2PXYA 1Q0YL 3UZEC 3L1EA 3BMVA 4KDTC 2DQTL 4K3GA 1CXLA 4C56D 3V8CA 5KVGL 3HG1E 3KXFE 4NBYB 1CIUA 1W72H 3ZDXE 2VM9A 1GGIL 3IFOB 3NJVA 2YGNA 5H37G 4GG6B 5JNYB 4A7SA 3GSVB 2CR3A 1VB9A 1OAXL 4OZHF 5FFGA 1AKJB 4JFFA 4N6RA 4NIYE 1NPJA 3QDJE 3QUYB 3NJKA 2B5IB 2OMYA 4K3JH 4B6ZA 1U21A 1U8MB 4PBXA 3SE8L 3KWVA 2WYTA 1XGUB 2VXTL 4Q6IA 4N9GB 4M3KB 3QQ9C 1QLFB 5DFVD 1MIEL 5IB5A 3Q6FB 4JCMA 3TESA 4KXZI 3U4EB 1DVFB 1VZIA 3O3AA 1WPCA 3FHEA 3H85A 4CSTA 3TJEL 2YUXA 4TVUA 1E6JH 2FB4L 1KJMA 2QSQA 2I24N 5CMAB 3OX8B 1AQDA 4GRLC 5C0AE 4JFPB 1PW3A 4YVNA 5E70A 2PTTB 5H4YA 1ONQB 4QTIH 4XNQA 4JFDD 4WUUB 5DS8A 3CZFB 3QQXA 2ZSVB 4FI8A 3VW3H 3BXNB 1D5RA 1E27B 1N59A 1QZNA 1H0DA 2F61A 3QFGA 1G1CA 3GSRB 4WGWB 1E40A 3BD5A 1R17A 1C8QA 3LRSA 1LJMA 3M45A 3HE6C 1TYRA 1KDIA 2AV1A 4LOUD 3MUGA 4GI8A 1Q38A 2NX5B 5DR5L 1RU9H 4MJIA 4B96A 4D9QD 3ZVVA 1II4E 2GBUA 1XAUA 4ODVH 1I7RA 3K1DA 5IG7B 1IE5A 3MRRA 3CZKA 4E5XA 2EEBA 1OW0C 1ZT4A 3W1ZA 3US9A 3QHFH 3T71A 2DLFH 3E0GA 1EV2E 1MJJA 2DBJA 4XHQA 4QRSA 1IC5L 1BVNP 1URZA 1GGBH 5IJCC 1H19A 2LW3A 2V7HA 4A7GF 2HWZL 1M3JA 2IMMA 4Y1TA 3SKJH 4KDVA 4G9DA 1FFNB 1JTPA 2APVA 1OZTG 1AJ7L 4UQ2B 4JFEA 3VXTB 3ZTCC 1RERA 4K71C 5E8OA 1MVYA 3K3QA 4FZ8H 2Y25A 2P1YA 3QGVA 3WTYA 4JFYA 2VJ8A 5DMIL 3SPHA 4LASL 1ECYA 5FIEA 3EOBA 5F72S 1FVEA 2VLME 3STBA 4PYGA 3LZFL 2BWIA 2E46A 3ZTEA 2EYRB 5IVXF 1IFRA 2YA0A 4L8SA 1BAFL 3VGEA 1TTBA 1CBVH 3WS6C 1I75A 1QX1A 2VIRA 2LVCA 3FW6A 3QO0B 4PRPA 1FLRH 1XBRA 4P5TD 2B9BA 3MRQB 4MTMA 3S37X 4BBWA 2CRZA 5EB9A 4EI5A 3CSBA 2MOVA 1DSFL 2ZWKA 4FERA 5I82A 3B7RL 5F97E 4AQ1A 1UB5A 1UH3A 3F85A 5AKSA 2EDKA 1YC8A 1C12B 3KCPB 5EZLA 3CSYB 1RZ8A 4X5XB 3I84A 1NMBL 2D31B 3I9PA 3MRKA 2CMRL 4I18A 2G5BB 2AV7B 1MLCA 3DHPA 2WGNB 2XY2A 3HLAA 1A1MB 1MWOA 4L23A 3X17A 3MRDB 3ROOB 4ZMTA 4RAUA 1WBXB 3FUNA 1LE5B 1RUMH 1PTZA 4IRZA 1DL7H 5CR8A 2ZOLA 1R24A 1UJTA 4FMFA 5E4AA 3AG3B 4TYUA 3ATFA 4BH7B 3V52H 3ELAT 3UG5A 2WBJC 1ETA1 3PPEA 4GKZA 3VH8B 4YLCA 3ABZA 5DZ9A 3GSNH 2X89D 4PJXE 2DIEA 4XGZB 3P2DA 4EXPX 3MAWA 5D1QC 2VISA 2VR8A 3CHXA 4AY0A 5ITBH 4FQLH 4CBPA 1A22B 1FYTE 2GJZB 3MV9A 3VFPA 3NTCH 1CL7I 2GG1A 2QSTA 1KCRL 2FNWA 2IEPA 1P7QA 2IG2L 1EZUA 3MNWB 4DFHA 3ZRFC 1BZ7B 1ND0A 4NNYA 2E9IA 1KJ2H 5B38G 1DQJB 4XB3A 5DZOA 3LQMA 4Z6AT 5JQHC 1NMAH 4OCSL 1RJLA 3PJLA 2QR0B 4MNGE 5E03A 3VYPA 1YN7A 3FSZA 4LSTL 3BUYA 3MXVH 4YBQD 1T0PB 2AGJH 3CHPA 2D4FA 3RWEB 3S88L 2W60A 1YQVL 3KPSA 4NN7B 2ITCA 2HFFA 2Y6SC 2Z35A 3DROB 4JJHA 3X14B 4GP8B 2YSTA 2NTSP 4ZUUA 2FQEA 3MOQA 3TO4D 3FCTA 5D96C 3K6OA 2ZP0T 2LU7A 4G9FA 1EQWA 3RHWF 2OX5A 3IJ7A 4OY9A 2Z91B 3PWNB 4JG1L 1ZLVH 5FOJA 3GIZL 5C6TL 1R3LA 1AZRA 1LK3L 2VR5A 4JUTA 2XTJC 4S0HA 1RL1A 2A6DA 5AVRB 1ILUA 3EH5B 4Q9CA 3GM8A 3HAEA 2G2RA 1MFNA 1Z2KA 3LN4A 1KYUA 3GYRA 3SDAA 2C5DC 3QIWB 3VDBA 5HDWA 4AZ8B 5FO8A 5MEQA 2K7QA 4IOSA 5B3JF 25C8H 2IH8A 1F4WL 1G6RH 1MJUH 1XR8A 2XCMC 4OF3A 4AQZA 4OGAD 3LNIA 2JB5L 2J3SA 4KQ3L 5E6YA 4PVBA 4KO7A 3QDGB 4YC2B 1QHOA 3LS4L 2R29H 4P48A 3VXNB 4Q89A 4MA1C 3QCUL 3GPEA 2ZXCA 5AOKA 4E41E 5L4JA 4E0RA 4WAFA 2YWZA 5KSAD 1EXHA 1IKNA 3HE7A 4Y5YA 3FFOA 3LKOB 1E65A 3BPOB 5DQDL 3RX5A 4LHJB 4ZMXA 5I1AA 3V6OE 2K45A 1DJZA 4XH2B 1DVTA 3RFZA 3P9MA 1TETL 3MZGB 4XMPL 4HIXL 4Y4KB 2JCCE 3QUMA 4NFCA 5IB2A 1L6XA 1A1NB 1VIWA 2X4RA 3FU9A 1ODAA 4XOBA 2ALWA 2Z0BA 3HZVA 5EOCH 2DQJH 2C3GA 2DQGH 3LZNA 3PGDA 5M7QA 4X8CA 2ZXQA 5IEHB 1LK2A 4XT1C 3K4DA 2OP4L 5AWNL 3TLRA 4Y19B 3VFRB 1DR9A 1FORH 4X6DE 5DD3H 5D1XE 5L7XL 1HE8A 6FABH 2X0WA 3SOBH 4N1HB 5J1AB 3NFPB 3VVVA 1P6WA 2JLLA 2XV0A 1F3JB 2DEYX 3DUSB 4ZD3H 3AC0A 4ADGA 4FKEA 1VFMA 4JQVA 3T8VA 1U6AL 4GMSL 5F1SA 3O2VL 4D9LH 1VGEH 5AVUB 3ZGIA 4ABQA 1IJ9A 3BZ4A 5DJDA 1Y1DA 3LAFA 2H8PA 3MOAL 5I1JH 2AZAA 3CSFA 5D7LB 3HC4L 3L6FA 4PJ9C 5F7BA 4AGMA 4WI3A 3WKYA 1QQDA 2LFGA 4GRWE 4K94C 1A25A 3LDBC 2J44A 3GHEH 4LL4A 2NR6A 3MDJA 1KELL 1MUJA 3BEWB 1VSCA 2NY4B 5GS1A 2NY6D 4JHWH 4K73A 4U1MA 4W6WB 3ZKMC 5JHDB 4XO4A 1HINH 1E8XA 1U8CA 4HC1L 3MJWA 5HDBF 4P2YA 4MQ7B 3TNMA 1AANA 3DRTA 3OXRA 1I8MB 2H0PA 4FNPA 4Z77A 1BXXA 5E95B 2GIMA 2V5YA 4NPYB 4GQ9H 1ZPUA 5HI3C 4MCNA 3QDHA 5EZJA 3JWDL 2K8MA 5FHBH 2CQVA 1JK9A 3DVIA 1BJ1J 4AK2A 5SX4H 2P5WB 4JDEA 5HY9A 1QNZH 2NT1A 3MGOA 4YDZA 5GS0H 2R1YB 4PJCB 1S2EA 2NY0B 5FXCH 5IVOA 1FG2B 3HG1D 3KXFD 5IK3A 3G6JA 4WO4D 1KCUH 1INQA 3RBSA 3RKDD 1MG3C 5BO0D 2DMKA 1DP0A 4NUJA 3HPJA 2CXGA 1A4KA 3CXHJ 3P77B 3VMNA 2WVSA 1LWJA 3OKLA 4UT7L 3BLPX 1K5WA 1A6WH 3FUFA 4IQHA 4JM2A 4BSVA 3ZZ1A 1L5GA 2D7OA 3H3KA 3IU3A 5HGHB 5EBMA 4X8GA 5IFAH 4MVBD 4UNVA 3JYCA 4ODXA 1UENA 2HT2C 2N0MA 5D7JA 3S3BB 4R97C 1GAFL 4KY1L 2JJSC 5KYWB 3LXBA 4X0KB 5C08A 3ZE2F 4KVCL 3OG4B 5LGYA 4QUOA 2MMXA 4H20L 1PKQB 3CSPA 3FT3B 3I6GB 1C16A 1GGTA 2ITDB 4IK6A 2VDKH 4V2BA 1DQVA 3K2KA 4Q4IA 4EQ3A 3CSTA 2BVOA 2FO8A 4U4BA 1UUSA 5CLYA 2BX5A 3O0RH 3TA3B 1PEZA 4NN5B 5LAXB 4YXKH 4ZMQA 4KRMB 2EEFA 3G9VA 3SKMB 5JW4N 1MCIA 3NIFF 4X7TA 1HOEA 3T04D 3GDBA 5CGYC 4AKQA 3GSQA 1RZ7L 2GKIA 3JV5A 1R3IH 4MSWA 3P69A 2HCZX 1E9PB 4LLDA 3WO3B 1GS7A 1J8HB 4A55A 3CHQA 3PP3H 2IDSA 4XNXH