4DP1X

The 1.35 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 4.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp1X00
3GDCA 3OQRA 3PAZA 4DP1X 2BWIA 3JTBA 4KNTA 2IDFA 2GC7C 5I6PA 3PAVA 4PAZA 3WKPA 4BWWA 4DP5X 1AZUA 4YSEA 3NSDA 2IDQA 2JFCA 1M9WA 1W8EA 2XX1A 4GP4B 1J9SA 4QLWA 1A4AA 3TU6A 2AANA 2DV6A 2IH9A 5I6KA 2B3IA 4CSPA 2WO2B 2IDUA 1AZRA 1OCCB 1BYPA 2FWLB 5LDUA 2HXAA 4NERA 5IY5B 1R1CA 4HIPA 4E9QA 2VW4A 2TSAA 2PP9A 2GI0A 1IC0A 1OOWA 2YXVA 4QKTA 3UABA 2AZAA 2IAAC 3JT2A 1BYOA 1PMYA 4A2EA 2IWKA 1E5YA 2XYBA 3T6VA 1E67A 3FU7B 1ZIBA 3UAAA 2BZ7A 2BWDA 2VSKB 3AG1B 1IBZA 1PF3A 1CC3A 4AKQA 4DP7X 3FQ1A 1ET7A 5B7FA 5A7EA 4W9ZA 1I53A 3EH5B 2H5UA 4GXFA 2W88A 4EF3A 2IDTA 3CG8A 4G72B 3QQXA 2YAMA 1E30A 7PCYA 3HEIB 2HX9A 1CUOA 5B1JC 1L9PA 4WKXA 3X2QB 7PAZA 4N4YB 1J5CA 3SBPA 3WKQA 3FYEB 1WA2X 3FT0A 6PAZA 2XVBA 2YARA 3FSWA 3NYKA 2PCFA 1CYXA 1MZZA 2Y1AA 2ZOOA 1WA0X 1IUZA 1ASOA 1OV8A 3CVCA 3NT0A 1AZBA 1JVOA 4WTQA 2J57A 3CZUB 5B3SB 2B08A 4BXVA 2CALA 1BXUA 5AKRA 1W6LA 3ABGA 1NICA 1MDAA 4JHUA 1BXVA 4E9SA 3FSVA 3NJIA 1AR1B 1J9TA 2EILB 1CYWA 4YSQA 4YSDA 1JOIA 1JVLA 2I7SA 4YL4A 2NRDA 1BAWA 1NZRA 3QJRB 4KOCA 5I26A 4P5SA 3PXLA 4M3HA 3ASOB 4KO5A 4NAJA 1JZEA 1XB3A 4HCIA 1JZIA 4Q8BA 3BVDB 3NSYA 2OV0A 1KDIA 2QT6A 3IN2A 1ASPA 3KW7A 3OMIB 3NSFA 2PPEA 1QHQA 3CVBA 3HB3B 1M57B 3T9WA 1WS7A 2E86A 2WSDA 4HALA 4E9YA 1KYAA 3UAEA 2R7EB 2IDSA 1ET5A 3AW5A 1NWOA 4A67A 1E65A 1QNIA 1HAUA 2UXFA 5I5JA 5TK4A 2ZONA 1PLBA 2XLLA 1SDDB 1IKOP 3SBQA 4UF7C 2FT6A 1XMEB 3EH4B 1ILSA 2BP8A 2BW4A 2J55A 2PCYA 2VW7A 2WO3B 5F7BA 1SF5A 3UACA 4BDVB 2GB2A 1J9QA 2UXTA 3GYRA 5B1JA 4YSAA 3UADA 3X1NA 1EZLA 2YAPA 4BWUA 3ABLB 4KNSA 1ZIAA 2P80D 1AZNA 3H4FA 3NJFA 1KV7A 2Y69B 1NIBA 1X9RA 3FQ2A 1JXDA 2OCCB 3S3CB 1ET8A 3T6WA 4DP4X 1EHKB 3ZX1A 3T6XA 1TEGA 5B1AB 3QJQB 2XXFA 4GYBA 1OCOB 4GP5B 4DP0X 9PCYA 2IWFA 4A68A 2DWTA 3N2JA 3CVDA 3TASA 3T71A 1VLXA 2UX6A 4UAHA 4CSZA 1FFTB 4YSCA 1HFUA 2QPEB 2DYSB 4HHGA 4HCGA 2LLNA 4A2GA 1AANA 2TSBA 3S3DB 2VSMB 3RYMA 1SFHA 3ABMB 3N55A 2FQEA 3OD3A 2GIMA 1KDJA 2PLTA 1OCRB 2FQDA 1PCSA 1ADWA 1JERA 1PNCA 1SFDA 1F56A 3G5WA 2VW6A 2HRHA 2GBAA 4E9WA 1GS7A 4GY4A 4K9JA 2YAHA 3IEAA 2ZXWB 3D12B 3WNIA 2IH8A 4GP8B 1OE3A 3U25A 1V54B 2OJ1A 5B1KA 1JZHA 2X87A 3V9CA 2FT8A 1L9RA 3NP3A 1URIA 2QPDB 4HCFA 2BZCA 1TEFA 4KO7A 1A4BA 1B3IA 2PPAA 3DKHA 2DWSA 1RZQA 2J5WA 1ZV2A 2GC4C 1RKRA 1NIDA 4YSOA 2BP0B 4DP8X 1NWPA 4AI7A 3CDZA 4E9RA 3QJVB 2PPDA 1OE2A 1NTDA 3ZIYA 2PP7A 3H4HA 4AX3A 4ENZA 1WAEA 3FPYA 4F2EA 1GY1A 5B1BB 4KO9A 4DPAX 3OMNB 1SNRA 3FS9A 4FA7B 1A4CA 1V55B 2BW5A 2HRGA 3H56A 2AZUA 3WIAA 4E9VA 1X9UA 8PAZA 1JXFA 1SF3A 1PAZA 3L45A 1BQRA 4M4RB 2IWEA 1QLEB 1E5ZA 3BQVA 1KGYE 2Q5BA 2MTAA 4JHVA 5FC9A 1L9QA 1AS7A 1M56B 3NJMA 2CCWA 2J56A 2PP8A 1GR7A 2XV3A 1OE1A 2I85A 1BQ5A 4AKOA 3NJKA 2H3XC 4KNUA 2GSMB 2X88A 4G7SB 1JXGA 1DZ0A 2YQBA 1NIFA 3C75A 2AVFA 2UX7A 1FA4A 1BXAA 3TBCA 1A3ZA 5B7MA 2HX7A 4P5RA 4ZK8A 2YXWA 1GS6X 2VMJA 5ANHA 4DP6X 1YLBB 5I6MA 4Q89A 1V10A 3AZUA 1NDTA 2YAEA 1WA1X 3QJSB 4F2FA 1N70A 3DIVA 1T5KA 1NIEA 1KBVA 1W6WA 5I6LA 3S8GB 2FT7A 1L9OA 1AACA 4UANA 3T6ZA 4NB7A 3EF4A 5D4JA 4L0PB 5TK2A 3ZDWA 2PPFA 3NP4A 1NPNA 2ZWNA 1OCZB 3EHBB 3NJLA 1RCYA 1ETJA 1PLCA 3FU9A 1L9SA 2EINB 2EIMB 2I7OA 3S8FB 2XU9A 4YSUA 1RZPA 1OF0A 3FU7A 4YSSA 3MX0B 3UGEA 1PLAA 2JKWA 3MBWB 2QDWA 2CAKA 2YAOA 3V9EA 2BP8B 1GS8A 2H47C 1ZDQA 3KW8A 2XXGA 1GYCA 1SHWA 3FU8A 3AY2A 2BHFA 2VM3A 2YAFA 4HZ1A 2MRYA 3GXUB 4G71B 3FYIB 4N8UA 3AG3B 2YAQA 1SJMA 5I6OA 1N68A 3TBBA 1IBYA 1MG3C 4BXSV 1AOZA 5B7EA 4HHWA 5F7AA 2JXMA 2EIJB 4G70B 2VN3A 5I5MA 1XB6A 4A2HA 3AG4B 2FTAA 4YSTA 1ILUA 2AFNA 4E9TA 1GY2A 3IBOA 4F7KA 1XB8A 2VM4A 3QPKA 1HAWA 1JZGA 1AG0A 3WG7B 4BK5C 1A8ZA 2N0MA 4DP2X 1UATA 2BP0A 2RACA 2DY2A 5PCYA 1JZFA 1NIAA 3AG2B 3NJHA 2XV2A 1DYZA 1KCBA 1JZJA 3EH3B 5D4IA 1AS8A 1BQKA 1MZYA 5D4HA 3FSAA 2DYRB 2FNWA 2FQFA 1PY0A 1SHXA 5EHFA 2CBPA 2XUWA 4TXVB 3S3BB 2XWZA 3ABKB 2FJSA 3FQYA 4DP9X 2UXVA 4KO6A 3NJJA 3OM3B 5I28A 1TKWA 1L9TA 1AS6A 3IN0A 1AIZA 4G7RB 4YVUA 4JKNA 1KCWA 3X1BA 2CUAA 4A2FA 3PCYA 3PPSA 2XX0A 3FSZA 4G7QB 2FQGA 3NSCA 3PLYA 2HLEB 2XV0A 2R7EA 3OMAB 5I5IA 2CJ3A 3FPXA 1AZCA 3NJNA 4FAAB 1KBWA 2QDVA 4W1TA 4KOBA 4YSRA 5PAZA 3IE9A 4RH4A 1A65A 2UXGA 1ASQA 4BWTA 5I6NA 4AKPA 4YSPA 3ERXA 1SDDA 1CURA 3DTUB 1PZBA 3QJTB 4MFHA 2EIKB 1ZDSA 5E9NA 4BDVA 1AAJA 3TA4D 4A66A 5AZUA 3CDZB 2HZHA 3ASNB 1WS8A 2Q9OA 2A3TA 1PZCA 3QJUB 2GHZA 1PNDA 6PCYA 3SQRA 4X4KA 3X1GA 3ZBMA 4A2DA 2HX8A 2W8CA 3NJGA 4E9XA 1ZPUA 1GW0A 3WNJA 1FWXA 1J5DA 2BO0A 1AG6A 1AQ8A 2PPCA 4AZUA 4HAKA 1J9RA 4PCYA 5AFAA 1ID2A 3PAUA 1NINA 2P80A 3X1FA 1BEXA 1MG2C 1NPJA 4DPCX 4DPBX 1PZAA 3SBRA 1TU2A 4YVNA 3X1EA 3WI9A 1GSKA
chains in the Genus database with same CATH superfamily
3OWEA 4N6RB 3WN5A 4B9PA 3DIFA 3EOBA 5DJZB 3I75B 3DETD 2GJPA 4GMSH 3JTBA 5IJKA 2O5ZH 4HH9A 3NSDA 3C8KB 5FK9A 1KB9K 1XSJA 3KLQA 1OY3B 4FHBD 4FF9A 1P5UB 1N5AA 3U0WL 1AZRA 3LN4B 3RVTD 4G8EA 1SN0A 2R2EB 5C0BE 5DVNA 3HE6B 1E9PB 1WBXA 1TCRB 2BM3A 2BVTA 3N41B 3CH1A 4NQCB 5EO0B 3QRBA 4ZSOA 3PABA 4HLZG 1N0LB 1ZT7A 1FNAA 4Z6AT 4AV0A 3SPGA 2YPLB 1O7DE 1DJHA 3EJPA 1UA6H 2OW7A 4UQCA 5D70H 3T3MF 1UCBH 1ZIBA 1KBBA 4G8FB 3K4ZA 1TJGL 4TUUA 2DH3A 1I7RB 1K4DB 3V6ZA 4V2CB 3FFCE 1ZXKA 2VDKL 2VL4A 3B34A 2XKNA 4PJDF 1QACA 2B9AA 3SGKC 2QHRH 1FL3B 3E9TA 2PWHA 4GKSA 5E8OB 2CO6A 1U0QA 4GKZA 4Y7OC 1OSZB 4J7RA 1EZVX 2HA1A 4M1GL 2H32H 4GXVH 1HCZA 5LBSL 4M6NL 4E36A 1EZSA 1BZ9A 1L5GB 3ZYJA 4TN9A 1XGUA 3T5WA 1H6UA 3DVGB 3QQXA 2V7NA 3R06B 5EG6C 1G7QA 1Y6KR 3HEIB 4X6FA 3RWIA 1OM3L 5I0XA 4MWFA 3KLHD 4JPWL 2L4OA 4F7TA 3N85L 1MAMH 2A6JB 5KSBA 2BSED 2IBZX 4JM2A 2XQYG 1THAA 3SBPA 2MFNA 5D6CB 3NEEA 4NYLB 3L5IA 1NLDL 3II3A 4PJBB 4D7BA 25C8L 2XVBA 4PHXA 1TSHA 1KOAA 1E90A 5GGSY 1CICD 4QRSA 1IUZA 5LG1A 2VNCA 2XWJA 3JXAA 5F7KC 4KTEL 3UTPD 4WTQA 2OJZL 2LQRA 2NY2B 2AEOA 3CZUB 4O2CA 4JFZL 5TTRA 3U4KA 2CALA 4A7QA 1BXUA 4ERSL 2W38A 4B9IA 3APFA 5C86A 1A6WL 2YEZA 2RGSA 3NJIA 1T83A 2XG4B 1IGMH 1VERA 3KWUA 1XZ0B 1SZNA 5G5DA 5EBWB 1DTUA 1KTLB 3RWEB 1JRHL 4R4NC 5I26A 4R4FH 3HPJB 4PV9A 4XP5H 3ASOB 3SPCA 4U3SA 2OMVB 3CHXA 4QHNB 3FT2A 4L4VA 3O0RL 3LH9A 3JTSA 1VB9A 2HLFD 2OMNA 3IFNL 4JFFB 2NUPB 3P9MB 2QT6A 4UT9L 4TVUA 4MHHG 5I1LA 2Z7YA 5I1IH 4HCRA 4WUUD 4HALA 3ETTA 3M17B 3V5KB 2ICEB 4JO1H 3TVMD 1Z66A 2PCPA 3UAEA 3PWUA 2IDSA 4A67A 2ATKA 1JGEA 1OTSC 5I5JA 3JUZA 5E7FA 3SGJA 1LM8V 3FO1B 3P1VA 3QCUH 3ATDA 3MBWA 5EZPA 1MVUB 4NX0A 3SBQA 2AJZA 2G75A 2UWEE 1UKSA 3MZTA 1MFEH 3QCTH 4AK1A 1JAEA 2CPCA 1JI2A 4XT1C 4BDVB 1KXHA 5DUML 4UV7L 3ZTJH 3QWOA 4FQPA 2BS71 4UZGA 4AG4H 3VI4B 1FL5A 3U4BL 4ZFZB 3CZLA 1Q94B 2YAPA 4X7SH 4EUPG 2AABL 2BDNH 5E70A 5BO0D 1JF5A 2MCAA 4OBSA 3LVTA 3EFDH 1X5ZA 1NGQH 3QORA 3ZYZA 4WW2B 2Z7UA 2H3KA 3S3SA 4LRNL 2PABA 1RZGB 3ZGIA 4TNVK 1BM3L 3VWKC 4AIZA 2CM6A 2PTTB 5HHQA 3EADA 5C09E 2ILLA 2EKJA 1KTRL 1SBBA 4GSRA 1ZLSH 4UUJB 3HJEA 3TJEH 3JWNG 4P48A 2Q20A 3FTVA 4JLRA 1IAII 2AQSA 3OR6B 5B38G 2FWUA 4OV6F 4P46B 3AQXA 1PFOA 1FFTB 2CLVB 2QPEB 3WFCH 1GC1H 3HAEH 5DHMC 3WSQH 3ZHFA 1A5FL 2YOCA 5AWNH 1J0JA 4JJ5B 3SOBL 4NQED 3K6OA 3BKYL 4JM2F 3QA3A 2Q86B 3A22A 4PJHF 2FQEA 3B43A 2VQ1B 2GIMA 4JMNA 1A3QA 4XX1E 1M71A 4PJFE 3HZYA 3O6KH 3MUY1 2HRHA 1UXSA 5L8LB 3BKCL 5L9DH 4KKCD 4KDTC 2TRHA 4NENB 4DFIA 5E9DB 3FUMA 1KB5L 2ZXWB 1DQVA 1ETA1 2HT3D 1E4WL 3B9VA 1A9BB 4NUJA 4U6HB 3LIZH 2JJWA 3ETBJ 5EPMB 5FKPA 5FYLH 2I9TA 1OLLA 3QHZH 5I19L 1IKFL 1OD7A 1Z3RA 3LKRA 1T0MB 4OJYA 3SO5A 5D7JB 3HA0A 2YXMA 4LSUH 5F1NA 2EUZA 4OFIA 3MRKA 3KEDA 1MHPH 4ADIA 4RAUB 2PPAA 2DEWX 4UCFA 2GC4C 4UZSA 1U8JB 2HT4D 5EC1A 3BRDA 4PGCB 4WFED 3VXRB 3EGDA 3JV5A 4JHBA 2NT0A 4XVUC 1BECA 1E40A 2A0LC 4Y4HD 3U0WH 4AX3A 3SY0A 5FGCE 3SQBB 1XF3B 2H0JA 4HEPG 3OMNB 1EGJL 1A4KB 3D39A 2GBUA 4N2HA 3KL0A 1Z2KA 2AZUA 4FNTA 1J0HA 4I85A 1MCCA 3DBXA 3QZNA 4KJQC 1AIFB 3IM1A 2IWEA 5CHNB 1EEYA 4EKXA 1UENA 3CFBA 3BQVA 3CHPA 1AFVL 4L8BB 2RCSH 4JHVA 2BNRE 4JHZA 4LHJB 5J1TC 4JVPA 4S11A 4N3UA 2AQNA 1M3JA 2G2NA 4LRIC 3EZJB 4X6EA 5K59F 1MFCH 1WFUA 4CMHC 1YUHA 4QY8B 1ZT1A 3O3DB 4Q6IB 2VDKH 1XCTA 3B9KC 3C6LB 4GB9A 4M7KH 5DQDL 2APTA 1J0ZA 4PRBB 3IJYA 4X83A 1G7MA 4WSJA 3NA4A 2DD8H 3O2VH 4M1GH 1VF5C 4PJEA 5LBSH 1HCFX 1QFOA 4I9WE 1JPFA 1NDTA 2ESVD 4Y4FA 1FVCA 3FL7A 2I9LB 1A4JB 2ETWA 4M48L 1QBML 4CN6A 4AQ1C 4ZUTA 4YDMA 1UT9A 1HN1A 2OSXA 3BW9A 3SKMA 4JFVA 5JNYA 4DO5A 3KLKA 1NLDH 5JOPD 5GSVB 2DZEA 1XBDA 2CBOA 4NNPL 4AK2A 2EUXA 1L9SA 1SQ2N 2HTLC 3T4AB 3IDJB 3ZE1F 5ERWB 3S8FB 2MQ3A 3SDYH 4RIRB 2AQPA 2Z0UA 2XPZA 3CFEA 4E0RA 4J4PA 4Z7OB 4ERSH 2D3LA 35C8L 4IRZA 3D3VD 1MJ7H 2VKWA 1GS8A 3FT1A 4Z3IA 1EO5A 2ATPA 1J05B 4IMKA 3KBFA 1AKPA 4IU3A 4NRZA 4YMPA 4IJ3C 5I30H 4JY4B 4QRRE 1JNHA 1GYCA 3EOTH 1Q1PA 1M05B 1HSAB 2KS0A 4MXVF 3PUUA 3T2NH 1VFAA 1OTTC 4AOFA 3KPQA 5LAXB 5IQ7L 1Q4NX 3Q7JA 2F1EA 3BGFC 3DX6A 1EVTC 4CADB 1OGTB 3MV8E 5KBNC 3IFNH 4PVBA 5DUBB 3O4OB 3NABH 4R7DB 5B7EA 4WHCA 4ZUWA 4HJJL 5D7EA 4FQHB 4A2HA 2EDEA 2X53A 1MSPA 3EGXB 3JQOB 4LEXL 2FTAA 4PRDA 3I3BA 5EFIA 4DN4L 2FR4B 2EYRA 4HS8H 1L3NA 3QO0A 4L1LA 1A14H 4JZJA 1FH5L 4Y89A 3REWB 5MEPA 1GY2A 4KROD 5GJSL 3TBYA 1M7DB 1JZGA 3PNWA 4O4YL 1ITBB 3UX9B 3HG0A 1DUZA 1JI1A 1SHMA 1JFQH 5FFOA 5EC2B 4LOVA 3RTQB 3KPLB 3AADB 3ETBF 1Q0XL 2Y06H 1HVXA 1F4YL 1RURH 1BQKA 3JWNC 4P4KC 4UTBL 3M6DA 2FQFA 5CSBA 4MYWB 5HYJE 3O3EA 4ZW3A 4LF3B 4M93B 3EYQD 2WYZA 2AABH 5F0MB 3ABZA 3UJJL 3QFDB 4FXLA 3N50A 4YDLB 1ZGLP 1VPOH 1XF5A 4U05A 1LK3H 4F8OA 4LRNH 4Y5YB 3VMNA 4A2FA 2JKXA 4UV4L 1LDPL 1RUKL 2VDRH 2VXVH 5FW8A 4C56A 2Z3FA 1QW8A 2EP6A 1Y6MR 3VRJA 3FHAA 3SBWC 2AW2A 3WLBA 3K71B 4KOBA 1EZVY 3AAZA 3TIEA 4ATWA 4LCUB 3WN6A 5FW6A 2DMKA 1UJ3A 3LS4L 1PVHA 2GK2A 1XX9C 4FKHA 4P5TA 1KCUH 5IQ9A 3GSXB 3O9WB 4Y5XB 3CU1A 3MMEA 3SPJA 3A23A 1TZHA 3P3YA 1A5FH 1AHWB 3SOBH 4NI3A 3CDZB 2JJTA 1R5IA 1L6XA 3BKYH 5GRZA 1P7QD 2JI1A 3ARDA 2MPAL 3EJZD 3HI1B 4X6CB 2P7TB 1W72L 3QJUB 2GHZA 1PNDA 2H7WA 4NCC1 4MMZB 1KXTA 2IEPA 2N0KA 4N8VB 5EWIL 2DLGA 3BKCH 1QRKA 2QVKA 2YD5A 1EO7A 1LWJA 1NUDA 3NA9L 1FWXA 4MSWB 1H5BC 4WTZG 3WJLA 1B9ZA 5TF1H 1FGNL 1KB5H 4Q58C 3HS0A 1E4WH 4Q52A 4DPCX 3RFZC 1OAKL 4N8CH 1EDHA 2BRRH 4P3DA 2ZSWB 2V3EA 2HFEA 3QO1B 4ZQKA 3VGGA 1MRFL 3OQRA 4JDEB 1SXBA 4BFIA 2Y6SC 3PHQB 1G7HB 3L3GB 2VO8A 3MZGB 5HI3D 3QEUA 1RZIB 1JZ4A 4YHKH 2BXYA 4QLWA 5ABZA 1G9HA 2EUVA 1KY6A 2IOMA 3N40P 5I6KA 2IFGA 4QYAA 4B5EA 5E6ID 5HYSB 2HXAA 5GGRA 3LNDA 3VXUE 2VW4A 4RMVA 4C83A 2V3DA 4CC4A 3NUKA 1ND0B 3ULVE 3GBEA 1YEIH 3C5XA 1JDDA 4HK0B 3SJVD 1BZQK 5C0CE 3SKOA 2SEBB 4HIIB 4NQTA 1A66A 4XXDB 1P4BH 4JG0H 4GUOA 3VB8A 1BJ1H 1DFBL 1AFVH 1IKNC 2XC8A 4J3UA 1N9PA 4CN1A 1E67A 3VXPB 1NQBA 1R4XA 5HHME 3SGEI 2XTLA 1DVSA 4QRQA 2BZ7A 5I17A 3CFDA 4QI3A 1XR8B 3DHPA 5GGTA 4LEBA 3GMQB 5DQ9A 2OULB 5J0BA 4UMGA 3F5WB 4HYTB 2YEVB 2OQJB 1ES0B 4ZUSA 3EH5B 3QUYA 1UACL 1SOXA 2VZOA 2W92A 1I9IL 4NPJA 2MHAB 4OUUA 1QTSA 2K7QA 3E38A 1BYNA 3ZTCC 4LBEA 4A7GA 4J3VA 3HMWL 2X1WL 1MRDL 3LEXA 2ICCA 1KPUB 4GQ9L 2QVFB 1E8ZA 1QBMH 4N4YB 1BQLH 2FIRT 3TNMB 1OKEA 1OQOA 3LPPA 3NOIA 5TE4L 1KGIA 5D55A 5DHVB 4EEEA 2CHNA 3Q43A 1J7VR 3PHSA 5E5MA 1S5HB 2ZUWA 1ZCRA 5IESH 4HFWB 4NKMA 1U95B 3CVCA 5JIIA 1AZBA 3ARSA 1F6AB 2C26A 3K5RA 1GHFL 1I3UA 1H15B 2B08A 3OSKA 3EXLA 3QEQE 2UUDK 5CD5C 1INDL 4J3SA 5DYFA 1BXVA 1S78D 3L5JA 1WP6A 35C8H 4AH2A 1N18A 2IPTH 4F57H 1SRDA 1KJMB 2H6OA 2OMTB 5KG9A 4N2BA 5SWZD 1THCA 3HPLB 3ZJAA 2DQDL 4P2QB 1SEQL 2QQLL 5F7EL 1PKOA 2MWCA 1BP3B 5K1VA 4L9LB 4ZNEE 3KPRB 5GJTH 3PXLA 5DUPH 1EXHA 2N7SA 5IQ7H 5MENE 5HHOA 1NL0H 2V2XA 3WKYA 1OHQA 2GUOA 3OMIB 5D93C 1XQ4A 4PCSA 4XX1G 3KBEA 2ADGA 2WSDA 3L3KB 3TO4D 3IMSA 4LEXH 5EF2A 1JWMB 5K33A 1U93B 1XIWD 2C5DC 2R0LH 5I73C 3FQRA 1NOAA 1KJVB 5DEZA 2R4RH 5E4AA 5TK4A 2IOOA 3RX5A 3R1GL 1U3HA 3O8XB 5IOPB 1LE9B 4O4YH 4RDBA 4PD4J 5ITFB 2DBJA 4B95C 2Q3XA 5C08E 1J9QA 3G3LA 1V3LA 3GYRA 4PJCE 4XMKH 5JLZA 2HN7B 1F4YH 1QUNA 2G9HA 1DQMH 3P69A 2DICA 4UTBH 2VIRA 32C2A 4NO0A 4WWKB 3P2TA 1O7DC 2ISDA 1C16A 4J3OC 2J6EA 2OMYA 1G9MC 5EUKA 3BUTA 3MGTB 2UZPA 3EOYG 1U8LA 4JZOA 2WM0A 3BKML 3PL6D 1HINH 2MCG1 2J1ZA 5EOQH 4XWGL 5D1QB 3MRQB 3C5JA 4A2MA 3RY6C 1E8WA 1IC1A 2CNYA 2YN5A 1KN4H 1RUKH 4Q9BA 4UV4H 1LEIB 2WP3O 3ARBA 4ABUA 3D2UB 1N64H 1AXTL 1FJ1A 3GTVA 5CCHE 5IV2A 1A8JH 5GQBA 3O11A 2R0ZH 3ILQD 3B56A 3T71A 3WHE1 2FZ3A 4BA8A 3BAEL 1E7VA 4WGVB 5I2IB 3BZFA 5KJ4A 3LS4H 2VDPL 4TS6A 5HPMA 3DSNB 2VDOB 4UOW0 3FH5A 5HI4D 4NCDA 4Y16D 3DBSA 2JI2A 4P06A 2JJSA 2G2PA 3F65A 3M45A 4DUVA 3TBSA 1JSYA 5T1DL 2AMGA 3FAXA 3KM1A 4EN3A 2VW6A 1YNTA 4WV1C 3ZQXA 3V4PB 3QWRA 4JGNA 3BI9X 3FTYA 3PWJA 2QKIB 4LPYA 5EU3B 2E7LA 3EKCA 1U8NB 2YRLA 4DGIL 3NA9H 1ACYL 1QFUH 1U8OB 4PV1C 5CILL 4XAKE 1FGNH 3VFTA 4RDQF 3SYCA 1GKEA 3QJZA 6FABH 1Z3GH 2WGNB 3H6JA 4DIXA 5BQ7A 1R9FA 3AABA 5DTFA 5I75B 4NFDA 4F20A 3WFBL 1Q9KA 4LGPB 1ETZA 1OAKH 4LO9A 1XF2A 1GZQA 2B3RA 1W91A 3CVHB 4MRBA 4XO3A 4NJ9L 5ISZA 1N4XL 1R3IH 2OZ4H 3VXOB 1K2DB 1NC2A 5F1OB 1TNMA 4JRLA 4HCFA 1LYQA 4RAVB 4X4ZA 3IJEA 4HLZH 3D2TA 4MMXA 2WZAA 4Z7QF 1SVBA 4YXHL 2BP0B 4ISVB 5DO2C 3A24A 3V0JA 3DK2A 3OGCB 4LLUB 4ZAKC 3ZDXB 4JFEA 4G2AA 4GW5A 1KGXA 3N6YA 2PP7A 3RPBA 4PJ5E 5CFHA 3ASWA 2Y7OA 5INCB 1QO3B 5EIIB 1TVBA 1SNRA 4UNVA 2D03L 2OMUB 1ZV9A 5SX5K 1M7IB 4FYQA 1JXFA 1TETL 1ADQA 3OKNA 1RIVL 4M4RB 3VSVA 5KTEH 4ZS6D 1P1ZA 5EU5A 3UPAA 4PJAF 4GBXC 5HGDB 2AXGB 4KZ0A 2ITCB 1P7KA 1VGEL 1S9WA 3NFPA 4KPHL 2ZNWA 1OE1A 1I1YB 2WGXA 1WQVT 1HHKB 3W0WE 4ELDA 1NKGA 1NOLA 1XGYL 1UM4H 1YN7A 3HZVA 4NQSA 5EA0L 1NGYA 3G6JA 5HP5A 2K9UA 3FT4B 2GSMB 2FJFA 1OIOA 1DZ0A 2HKFL 4D9RE 5C0RL 3OKOB 2AVFA 3T1WA 1NDMB 1NFAA 5AUMB 3TTYA 4BZ1L 5ILTH 4N8VG 4LLWB 3IXTA 1TO5A 2VMJA 4JPIA 5KVGL 3LH8A 5ECJE 1UACH 3KR3L 5KVFL 2AJ3B 1AR1C 1HHJB 3AACA 3FU6A 1QSVA 1NIEA 5SV3A 5EDSA 4QTHB 1HSBB 3N1GC 2X9WA 3QP3A 3HHRB 5AZEL 4PVMA 4GQ9H 1HQ4A 1S7RB 5K1NA 1QFWL 5E2UL 5L7XL 5T5NF 1IC7L 4FQXA 3NJLA 1PLCA 3F7QA 3FQUA 4FQJH 4IYKA 5FECB 3VXSD 5AAWA 1TTCA 3HLAB 2OYLA 2Y5TB 4WKZA 4DO4A 4KAQH 1YEFL 1GHFH 2X4TB 1J8HA 4PY8I 4U49A 2VSDA 4FTVD 4ZX4A 5HYSG 2Q3AA 4NHUB 1F8TH 1ZANH 2QDWA 5F0JB 3SE3C 1CDJA 3DXAB 3MBEB 3I9GL 4ZMAT 2JH2A 3TF7C 1RIUH 4X9YA 2R8SH 3FZUC 2AJUL 3W9DB 3CPUA 3FCTA 4L0YA 2BJML 1CJYA 4G71B 3BVNB 3OXSB 3ZUNC 1SEQH 4OKVB 5LDSA 2Y7NA 4GI9A 4KZCA 5F7EH 4IBYA 5C0NC 3QZWB 3D6GA 4IRJA 4OJCA 1MW2A 1IBFA 4XVJL 3R8QA 3IDNA 4PRNB 4NFBA 5I8CB 2VLRD 3K3QA 1IFRA 3VACA 2XTSA 3P0YL 4WW1B 1KBPA 2DAVA 1L7TL 2WZ0A 3S0PA 4TNGA 4X5XB 4J12A 3TV3L 4YHNB 2EDKA 1FSKC 5HD8C 2Z91A 1FORH 4UWQB 2B39A 5CZXD 4ELKB 1EX0A 2QR0A 3PY9A 4U1MB 4DWHA 1DQQB 3GRWA 3LZRA 3QUXC 4NXKA 3I6KA 3FRUB 4EUPH 2WQWA 1XB8A 3KZ8A 2GK0B 2W65A 3DURA 4LOUC 5FGSA 1EXUB 2G2RB 2KT6A 2WTPA 4NBZB 4R4ND 1UM5H 4X4MA 2QPSA 3BSZL 4UTAL 3H9HA 1DEEB 4HLEA 1F6FB 5F9OL 1CU4L 4W9EC 3S2AA 4JUTA 3LRKA 1DP0A 3T77B 3QJHA 3VFGL 4NZRH 4FXGC 1V05A 2IH1A 3P0VH 3D30A 2EVGA 1XH1A 2H6PB 4F8PA 3PGDA 4IRSA 2MOVA 4QIRA 3FAWA 1GOHA 3AU1A 1EVUA 3KE0A 1Z9SB 3JWNH 3KYNA 2APVA 4K7PX 1CDGA 1F4XL 1IGTA 1OTSD 4U1IA 4UINL 3L1EA 3O81A 2NPLX 3TPUB 4EIZC 5CCJA 3VTAA 3OJMB 3MRPA 1G9ML 4XPTL 1BLNB 3EBAA 3BKMH 1QP1A 3TH2T 4XWGH 4QYOA 1ERNA 4XNZC 5DC9B 2ZT9C 5EIQA 1HHIB 3SQOH 2VWEE 1WJ3A 3VNYA 3K80A 1PX3A 2NW2B 2XV0A 4PRPD 2Y24A 3OMAB 4JKPL 1AXTH 2PYEB 1ASQA 1MCDA 3EAKA 4KHXH 4L3AA 4LVHB 4NWTH 5DZ9A 3ERXA 3CWGA 1ZK5A 1INQA 3D25A 2ID5A 2B15A 2FX8L 2Q7NA 3L3DA 3T6QC 3QEHA 3TT3L 2GY5A 4JREC 3VWKD 3VFNA 3OLEA 2C1OB 4R7NB 2Q9OA 2X89A 2VISA 3HB3D 5D2NE 4ZOCA 3GPEA 4N24A 4R9HA 2MCMA 4WTXA 1KJ2B 3RGVC 5C0EA 4I0PC 4A2DA 5T1DH 2BCKA 3O4LE 1QEWB 1EK3A 4GNKB 1OAQL 3CFJA 5D7IB 1HH9A 2NSQA 3FB8B 4ODUB 3CDCA 4LBAA 2FJHA 4BKLB 4FA8A 4FE9A 3VFMB 3W81A 4M1CD 4DGIH 5E5LA 3X14A 1EIBA 5CILH 4LDLB 5L8KB 2IANE 4WCYL 3BWUF 1BWWA 4WTWA 5E00B 5JR1L 2VITA 3SZ6A 3N43F 5HGAB 3RIKA 3WFZA 4M3JA 3GDCA 2EO9A 5D1ZB 3LAFA 5DU7A 5KAQF 4ZUVA 2A4EA 1DJYA 4QMEA 5DJ8B 3KBPA 5K1JA 2CO7A 5ESAA 4JFDD 2D7OA 3W38A 1KUMA 5CEZH 2BY2A 2F74B 3CSGA 2KUTA 1QRND 3PDGA 3P02A 1FYTD 1NCBH 1A4AA 1DFXA 4UILL 3PP3H 3IRCA 4JDTH 3GLEA 1DVFB 3NIDB 4HKZB 2EE0A 4WNJA 1W9XA 3BMWA 4WU7A 5LDUA 2WKOA 4BINA 3RRQA 1UVQB 4XBGA 2OL3A 4ZPTA 2JJUA 3L5WB 3MREA 4W9FC 2TSAA 3J2PA 1PQZB 4JCWA 3TO2B 3IT8D 3QQ9C 1D5IL 1KT2B 1U8IA 3TA3B 3TNNB 5KSVB 5AW1B 5DRNA 5CJ5A 1IC0A 1OOWA 4ORGB 4O02L 3W56A 4PP2B 4H20L 3JT2A 2DQUL 5CP7A 3L7FA 2GJ6D 4NQVB 4OBRA 1OSEA 4R5VA 2IWKA 4QXTB 2F54B 5DJ2A 4XVUD 2WBXA 2A0LD 4N90D 3FU7B 3CLWA 1QVOA 1N19A 2Y7QA 4P23C 3A4EA 4RBPK 4F8NA 1SMAA 3KS0J 1OTUC 1XGYH 5CBAB 4QF1A 5EA0H 3S4SB 2WINA 2XVLA 2V5TA 1TDQA 3I02B 4N2EA 3ZHNA 4KJQD 2XIBA 3BPNB 5JORB 4JY5H 1CR9L 3AWGA 4BZ1H 2BX5A 1ZVSA 2P5WA 3B2DC 5F88A 2WNWA 5CJOH 3KR3H 4OGYH 1AD0B 4RGMB 4LPVA 5IT2H 3IAPA 2FEEI 4NKIL 3HE7A 5LGJB 4GQQA 2HFFB 4WKXA 3X2QB 1NGPH 4J8QA 2QGEA 1XSOA 1PBYA 5AZEH 3B7UX 3FYEB 1U30A 5EB9A 3B9KD 6PAZA 4QAWA 2D3NA 1CG9B 5E2UH 3KYOA 2MSPA 3ILEA 2R2HA 4AQ8C 4IMLB 4JFSA 5I16A 1OV8A 1XMWA 3DX7A 4NSKA 4L8DB 2NY3C 1HOCA 1ZHNB 1MIEH 5I1HH 1CXEA 1FC1A 2WQRA 1YEFH 5FM5O 4L4TE 1T1XA 2HG5A 2JCCE 1YCSA 1E0OB 3RWGA 1O9ZA 5C9KA 2FLMA 4WU5B 5JDJA 4LLMA 5E03A 4FOMA 5EIIG 3I9GH 1H6TA 1RMFH 1YMMA 2EILB 2XY2A 4HX1B 4PJ7E 3OGOE 3ELAT 2EE9A 4H1LA 1LP9F 3ZR5A 2HTLD 3OF6D 4I18A 1X5MA 1YYLL 1NZRA 4YO0A 4KOCA 3CJJA 3QDJA 1AOHA 5HYQA 4MTMA 4BD4A 3A67H 2CG9X 3VXMD 1BJ8A 3BVDB 1CGTA 2OV0A 1KDIA 3KW7A 1VCAA 2O26U 3HFML 4H0IA 4DKEH 5FM5M 3CXHK 3FN0H 3TV3H 3QXDA 4OJDH 3LRSB 2WN2A 1A9EA 2I24N 3L7EA 2LOEA 3NCJL 4XO5A 2X4QB 3HG3A 2R0KL 4X8XA 5EBLA 1OTTD 2JB5L 4PW4A 5DXWA 2YS4A 1IQDA 5AZ2H 1N67A 3RWDB 1QTPA 2PO6A 3IAGC 1AGBA 3BSZH 4UTAH 3LHPH 3MFGB 4PJGA 3EH4B 1A2YB 5T1LA 4CW1A 1CU4H 4Z7VA 5F7BA 1SF5A 1JWSA 3ZE0E 3Q8FA 2Y36L 4YWGH 5GGSB 5HDBB 3EO0B 3VFGH 4PRAB 5DK2B 1R3KB 1SXZA 3HUJB 3ULVC 2DMHA 5F9WC 3ZKND 3X1NA 4MKMA 5IGXL 3KMDA 3L3IA 1JG9A 4D8OA 3ATAA 2COVD 3RZCA 3H7BA 4URKA 3MAWA 5IJDC 4Y88A 1YEHL 1F4XH 5GGVL 4N1HB 2DL9A 2WLKA 4S2SB 3LXBA 3I74A 4I1RA 4XPTH 2DI9A 2KKQA 2A7BA 4X6DB 5JDSA 3WCYA 1F00I 3OPZL 4HFUH 4ZT1A 3M46A 5J12B 2EEBA 5F6IC 2VXUL 4P4KD 2VABB 2YN3A 5E8PB 4EO5A 1U8QA 2W0PA 2WPGA 2F08A 3G9VA 3OC8A 4G7VL 1QX1A 4UT7L 4JKPH 4TQEL 4HWBH 5MP6H 4IGBB 3F6IA 4U6VL 2WSPA 3GSUA 3QIWC 2DYSB 3VGAB 3MOQA 4WI6A 3OAYK 4A2GA 2IC2A 4Q14A 2PWGA 4NT6A 4E5XA 2FX8H 2TSBA 3DMMA 3S3DB 3T0ED 5D1XE 1PD1A 3HR5A 5TQ0L 3TT3H 4NZDA 5LCVA 1NCNA 2OSWA 4URTB 2FX7L 4CGUB 5CEXB 5J1AA 1JHTB 1OCRB 1NCAL 2OTUA 1IAMA 4FFVC 1DLFH 1TYJA 2QBWA 1KIRA 3ZOAA 4PRIE 2GBAA 5BVJB 4YDNA 2Z35A 5BZXA 1P2CB 3SE6A 5CCKL 1KPRB 4XAWH 5I1AA 1EERB 1N2RB 2EDMA 2HJKB 3OKKB 4WI5A 43CAA 4BFNA 5CD3B 2W0FB 4N2IA 3W57A 5C8JB 2DBLH 2OLDA 1ONQB 4GG6E 5IBUB 1REIA 1S7XB 3NN8A 2JXMB 1EEZA 4XC1L 5CJXC 1JD7A 1EWHA 3EYSL 4BZ2A 3BAIA 3P77B 4GRLC 1AQMA 4MAYB 3VI3E 3I9PA 2CQVA 4R5XA 2Z7WA 2AK4A 4RMWA 5DA4A 3MLSH 3S96B 2ENSA 3UIZA 3SE9L 1IM3B 3V2AR 4NQCE 4P2YA 2Q76B 4XNMA 1ZRUA 4C4BA 1KYUA 3QISA 1RJLB 5KW9L 1BQUA 2CUIA 1YHPA 2GTWB 4NUGH 3UG4A 1MHCA 3EW3B 1P4LB 4NM4L 3T3MB 1U41A 3FFDB 3MV7D 2R69A 3BKJL 4ENZA 3FPYA 3LZOA 2WZ6A 3D5OF 4F7PA 4FI7A 1VENA 3E6FB 2CDEA 2DJMA 2Y6SD 1AO7D 4PJDB 5DA0B 1AH1A 1CTOA 2VXTL 3Q1EA 3MJGX 2DWDA 4YS4A 4BV1A 1JTPA 1CXHA 2N1TE 4YHOL 5IJVA 1XBRA 4CSTA 1U8HA 2MTAA 4H20H 1ZSHA 2DQUH 2XWBA 3CHQA 4TV3A 4Z7WF 4JANB 1K72A 1JCVA 4FFYH 3EH1A 2BVOB 4S1QL 4GG8B 4NI6A 5GGUA 3W9EB 4FC3E 3ZVVA 3CK0L 3SYOA 4I1NB 2C1PB 4ZSOE 3AM8A 4X99B 1JXGA 1NIFA 4NPYA 5I1CL 1MW3A 2HJLB 4CU6A 3D85A 4GQPH 3RDTA 1WFTA 1MHEA 4Q89A 2ERJB 3H0TB 4HOZA 5IMLA 2P42B 2XFXA 4FHKA 5IHZB 2L3BA 4Z7NE 3RI5F 1T22B 4NKIH 1XXDC 4UANA 3T6ZA 1FPTL 4JO4L 3UG3A 3SE8H 5AG8A 1A1NB 3FB5B 2ZCKL 1EUUA 1JNNL 3FHEA 4G8IA 4L0PB 1JPSL 1RIHH 2V17H 3PIQA 4AYDC 1B4RA 2JKTM 3F2LA 2ZWSA 5KANI 4A6YA 5C1MB 5HGHB 4XCEB 3FO2A 4JG1H 3S5LB 3D33A 5EEVA 5DK3A 1UKQA 2BMKA 3BQUB 4EI6A 3L1OL 1N7MH 2JKWA 3MO1A 3DI2B 1QBLL 5FIEA 2NUTB 1IEAA 3TH4T 3N91A 2CAKA 3DIFB 2YO3A 4W68A 1Z0MA 3GHBH 4G6FD 1ZDQA 1B4JH 1YMHB 2XXGA 3DOSB 4K0OA 3BD3A 5CJBA 4HUMB 2IGTA 4G8AC 1T1WA 3VXTB 1YYLH 2A4CA 2VZUA 3SODB 3UC0L 1KGCD 3GXIA 4UQAA 4L1BA 5CD5D 3OLGA 2RTTA 3RWHB 2WQXA 1WBXB 2QPUA 1I4FA 3S88L 1JGVL 3TBWA 1IMHC 4WUKL 4TPRH 4JFOB 1CXFA 5DVMA 1ZT7B 4PUBL 3S4SG 5EEZA 1S7WA 1TJXA 2Q7YB 4EI5C 4JFHD 4KRNA 3KCPB 4EI0A 3TC9A 2J1YA 2R0KH 2F8XC 2JB5H 2J4WL 2DQJL 4FP8L 4Z7UA 3BZEB 2F53D 1DBMH 4PWEA 2PW2A 4OZGA 5CAYB 4FX5A 4DGVL 1RD6A 1BFOA 2D2CC 3QDMA 3ENEA 2XV2A 5JZ7C 1KCBA 1C8PA 2E5EA 3STZB 3C9NB 2Y36H 5E56A 3VMPA 2ZXGA 2D9CA 5AW6B 4GKZB 3ULVL 1IZKA 1QR1A 2WZ5A 3IDMB 2CRZA 1M7XA 3NJJA 5AVWB 3UTSA 2NY0C 4LSPL 3RU8L 2FGWL 1YEHH 4TVPH 4JDVB 3KEHA 2RQEA 4APQA 1BJ1J 4GSXA 5C0BD 3NFNB 4N26A 1KCWA 1KLUB 4DCQB 2K78A 2YMOA 5EUOF 4JM2B 2B0SH 1A25A 4PJHB 1EANA 3B3IB 4AL8H 1TQBB 4RRPA 3AY4C 3MLVL 3T3PE 3OL2A 1ZA6A 3NJNA 7CGTA 1ULVA 1P9MA 1XEUA 3AREA 4OKDA 1BVZA 2UXGA 4F33B 4HIXL 4UT6H 4OFKA 5GRUH 3DTUB 2AC0A 5HDOA 2X9ZA 3KPSA 1PIFA 2VN6A 4U6VH 4O2CB 3H9SB 3PWLB 2PXYB 4KQ3L 3SCMC 5ACZA 3IMBA 3MCLL 4KKAC 3L81A 3AUWB 1SJEA 1CD1B 3CFTA 3FFCD 5TQ0H 4EIBA 3EZ8A 4HF5H 3PDOA 5EN2B 1PZCA 1F0LA 2UY7B 2YZ1A 5G4NA 3SO3C 2X0WA 4WVRA 3SE4A 4NZFA 4ZOAA 4HXAH 4HT1H 2VN7A 4NN5B 1DSFL 3NJGA 4IQHA 3VGFA 2HWZL 4XXWC 2NNAA 3EOAB 4QHLA 4PV9B 4MNQB 3UTQB 5I8KL 2R1WA 2PPCA 4PWIA 2CGRL 5JHAA 4RISL 3K1KC 1DE4B 1NCDL 2B7DT 4NRYA 1YPZF 1D5ZA 2BOBB 2OTWB 2A74C 3CDYA 3TN0A 2NR6A 3C60A 3KWVA 5KYYA 3HMXL 3QIUB 4XC1H 5CGTA 2GJZB 3VFOA 3PAZA 4GIPD 1ORQA 1C1EL 2XY1A 3LZFH 1IC4H 3H1ZA 4LLVB 4N0RA 4BWWA 4D9QD 1IAOB 2YEQA 4JMXA 1UFUA 3WNPA 3NPZB 2DQEL 2XX1A 3SE9H 5IHLB 4F7MB 1MFDL 2EDRA 1JGDB 2K45A 4Y9CA 4MZ2A 1HC1A 3SGDI 4P57A 1NCJA 4TSAL 2QSVA 3WE1A 3LQAC 2VQUA 4N2CA 4HEMA 4NM4H 1UD4A 5LBGA 5ICZB 1CWVA 2JE8A 3BKJH 3QWOB 3Q01A 3UIYA 4E9QA 4ILDA 3LXUX 1IVLA 4V1DE 3OMZA 2DTML 4HS3B 3DV4A 4MD5B 4OZIA 3V4PL 2VXQL 1M4KA 1E4KC 1XGTB 2IV8A 4CDGC 2ARJA 4GQRA 2X2IA 5BJTA 3QORB 3PP4L 5DO2D 4Y7MA 5HSFA 2J5LB 2O61A 4YHOH 3KWWA 1HHGA 4O2FB 4ZAKD 3IDUA 5IB4B 2WZPD 4AIZB 4FRWA 3GJEB 3OKMA 4OZFB 5I6XB 1MCOL 2JIXD 3GZQA 3BP6A 2JMRA 3Q8EA 3SDAC 4N0UB 3UAAA 5HHQB 3VD3A 3DYMA 5IQLA 3D39E 3EJYC 3CK0H 4FJ6A 1IC5L 1PF3A 4JY6A 4YOKA 1L9NA 4U1NA 4R3SA 2I07A 3X11A 5E9DD 5AEAA 4MA7H 3GT6A 4O5LL 4F9LC 3ZE1B 3VM7A 1T20B 4GBXD 4EF3A 2BVQA 4U3HA 4GINA 4ZPVA 4QT5A 3ZTNH 3QJFB 3QXVA 2YUVA 2BIOA 5C0JB 1D9KA 4HUWA 5FDYA 2VWEC 4BCXA 3DJRA 5IBUG 2P45B 1UT2A 1PZ3A 3MNVB 3OR7A 4ZMOA 4JO4H 3WKQA 4F58L 4UOZA 3B6SA 3SSGA 3VGHA 5C97A 4NQDA 1XVSA 1RK0A 1JNNH 4NZ8A 2B1HL 5F7DA 1JPSH 4B3VA 4AJWA 4Z23A 1X6NA 1HL4A 3ARGB 5K9JL 2AI0L 1J11A 5EEWA 4PJEE 4Y19A 5GS2D 4N5EC 1AR1D 3PREA 2A1WL 4BXVA 1DJWA 4OLVH 1NKRA 3QUZB 4I3SL 2BIIA 5D2NC 1W15A 3HR6A 1VEMA 4JHUA 4KXCA 5EZLA 3HI6H 5C09D 4Y2DB 3P3SA 4BGDA 3MV9B 4JFYA 1K8IB 3ZYIA 4MLIA 3WUWB 5IIEA 2O5YL 1BREA 3BEWA 5DJAA 4GPVA 4YUEL 3RG1C 4PTUB 4B9GA 4YHML 5AW0B 2WJ5A 1NEZB 3UC0H 2B77A 1B2WL 3VQ2C 3TYFA 2EIBA 4DK6A 4OCXH 4LCCC 1Y18A 4ZFQA 5E24E 1CL7L 1K5NB 4ZYKA 2C7UB 3LN9A 2D0HA 4GO8A 2ZCHL 4FMFA 4X9BA 3S88H 1I7UB 3FZUD 4WUKH 3VXNB 1E4XI 1CFSB 1KYAA 5DHVH 1U8KB 1IIKA 1VHPA 2R7EB 2XA3A 5JO5B 1CBVL 3FW6A 2A9AA 4HWZB 3MRNA 2KZKA 5BRZA 1JGLL 5EOTB 1RY7B 2VLKB 3QRLA 1UXLA 1FHGA 3SPVA 3H9ZA 4AZ8A 1SHSA 4FP8H 1AGFA 3UMNA 5T33H 4F27A 3EFOB 1QHOA 2VMEA 1RI8A 3EYVA 4B7LA 3BAXA 3UACA 5FV2A 1S8DA 3TZVC 2GB2A 5F93C 1ZHBB 1X5LA 4ELME 5I1KH 5HD8D 4MB5A 1G0YR 1I31A 2WBJA 3LKQA 2ICWJ 2VR3A 5DRXA 4NLHA 3QUXD 3I6GA 2YMXL 5E2JA 1AP2B 1JN6A 3MV11 1FN4A 3MLRL 4LOUD 4YE4L 4JNXA 4LSPH 3S5LG 2FGWH 2FLBT 1UA7A 3AQYA 2J44A 3LV3B 5A43C 4MJ6B 2OCCB 4W9JC 3BC9A 2KQNA 4DP4X 4FMVA 5CLXA 3ESOA 1RJZA 4FL4C 5EU6A 3RLSA 3CE1A 2EDQA 2WKLA 4PJ9B 4ODWA 3W3BA 4AQEA 3ZTEA 2UZYA 4XNDA 4QD2E 4KBPA 2PR4H 1G1OA 1FVEA 2G4GA 3LTVA 9PCYA 1H9VA 4CKQA 4GRWE 4J2XA 3LXCA 2AJYL 1DUYB 3E8UL 4TSBL 4TVPD 5ESQA 3RVVD 3HOGA 3V4UL 2BNRD 3D69B 4AENA 1X5XA 3X3GL 1H8LA 4K2UL 2QFRA 5L2KB 3RWJB 5KYUA 4C56E 1C5DB 1SFHA 4M6MH 4XNQA 2ATPB 1HZHL 2GITA 3G08A 3LKSA 3QH3A 2CKBL 2VUOA 4ZS7L 1PJ9A 1JERA 1JNHB 1MLCA 4HIHB 3V8CA 3KDMB 2V3FA 3M1BB 3TBVB 1ZE3H 4Q9CA 5SX5H 2ODHA 1EJFA 1UD2A 4M5ZH 1DSFH 4FQCL 5LXGL 3IVKB 2HWZH 2MEJB 4I9WD 5A2CA 2VLMD 4FMKA 5D7LA 4NOBA 2W1NA 3IAQA 3QXTA 3RTQD 4GKNB 4YDKH 3UBHA 1JYNA 3VFWA 1ZLEA 2CJUL 4JB9L 4L29B 4NQXB 1V54B 3KH3A 3VX0A 2IADA 5F3HA 2G5BA 5DD1H 3BGMA 2UYLA 3HMXH 5KS9F 1EAPA 1HK6A 2EYRB 1T5WB 2R23A 1URIA 1IJNA 3T8XB 1FZOA 3ZDYF 4PW3A 1EFXA 1IBGL 4ONFL 2R4SL 4PRHB 3MLUL 5IMMB 3I6LD 1RZFH 2VN4A 3HG1B 5E94B 1BHGA 1W0YT 3HC0A 2DLEA 2VDOH 4HIJA 2W60A 5DEFB 3BP5A 3GSNL 4A55A 5D8JL 4NXSA 1EAOA 3BPCA 1WITA 3LQAL 4M7ZB 5AB0A 3F04A 3LEVH 4QRRD 3G5ZA 1KEGL 1KJ2L 1UGNA 1UZ8B 4FXKA 2KMWA 3C6SA 3GGWB 4H8HA 5JA8B 3C5ZA 4U0RB 1E5UI 2HRGA 3MJ7A 5MEQB 4RX4D 3NCMA 3PQYA 5T3ZE 3V4PH 1IT9L 1IV8A 1PZ2A 3SDDB 1QI5A 5AVUB 4L5FE 1QLEB 2NTFA 1PZUB 2PCFB 3ISWA 4TF4A 1S46A 3MV8D 3TTSA 2DQIL 3T65A 2X4NB 3ZKSD 2X7LB 1FRGH 4F1SA 1FV1B 1NCWL 2I85A 2WWOA 5C9JB 2PETA 2W9EL 3WLBB 3CVHH 4KV5E 2OK0H 1IC5H 3QQ9D 5C0AA 1W16A 2AJVL 1NFDF 3PS6A 2E7MA 4LT7A 1BXAA 4HS6A 5EU4B 1JHLH 3GSQA 3IFPB 3Q6FA 1QQDB 5I6MA 4NC1E 4I3RH 1QZ1A 4QHKJ 5LBVA 1T5KA 4NFCA 3I50L 2FT7A 4P23D 4NB7A 5D4JA 5HDWA 1OTUD 2NLJB 2ZYHA 3WMSA 5HYJD 4AIXA 4PLKD 1Y0LB 1YVLA 2XXCB 3WEBA 3VWJB 1ZPLA 1LL1A 2WLIA 1FFQA 2GIXA 3ZZQA 2VMCA 5KZCD 4X8JA 1JK8A 2EIMB 3J27A 5DUJA 5AVSB 1XF4B 2AI0H 1EBAA 3QB7C 1VEPA 2ED6A 5B8CB 5D1XC 3PFQA 1I85A 4XVTL 2FYVA 2BIHA 2A1WH 3GSVA 5FO8A 4UU9A 2H26A 4DKFL 2JK5B 4UNIA 3Q2LA 2WN3A 3AUVA 3L3OA 4KZDH 1B90A 1WG3A 2WKGA 4QOKB 4IOSA 4WI9A 3FRPB 3FU8A 4HW6A 4BE6A 1C7TA 4HZ1A 4YFLI 3CAFA 1OQXA 4M43H 3GXUB 5DHDA 5DMYA 2NY3D 1M2VA 3RWFA 1GZHA 1S7QA 1TUPA 5T1KD 3VE0A 5H2BB 5DFWH 4W9IC 1Z9LA 3BP7B 3CZNA 1A6PA 1Q0EA 2E46A 1RAMA 4N68A 3PV6A 3NESA 2D8KA 2ZCHH 3WJJC 2GEEA 2XWCA 2YOAA 1QNZL 1UXWB 3MJ8A 1OANA 1WEJL 2B20A 4FD0A 5D71L 2NNFA 1NAMA 5GS1C 3WIIH 1DDHB 5KSAB 1OF2A 3REVA 1JGLH 1DANT 1R3HA 1T7YA 2UZXB 3OAWA 5K9KB 3MODL 3FOLB 2XOTA 2XXMB 4NUMA 3MJ9L 4L8CB 4KUZH 3WN5C 3LPGA 5IJKC 2DI8A 4U1KB 2B1AL 2QV2A 4TNWF 4ZMZA 4KO6A 4ANKA 2Y7LA 1QBAA 3L08A 1XGRB 1CLZL 4YE4H 3C8HA 4P2OB 2WWMD 1A3LH 4EDXA 2EKSA 2IH3B 3GDBA 4WJKB 2JKSA 4DEPC 5I23A 5IM7B 3WIFB 4PWJA 3HTLX 5DURB 3ULVD 5I8OH 1PD6A 3G9AB 4X4XA 5ANMB 5BV7C 1F3JA 1VFBA 4LAQL 5I0VA 1G6RB 2AJYH 3DV6B 2G9KA 4IIQA 4TSBH 3ZQ9A 3NIGE 2CRYA 3V4UH 1Z6JT 5IW6A 3CN0A 2WXHA 1JPTH 3X3GH 1BJMA 2EIKB 4GS7C 5HHMD 3D7PA 1L7IL 1MCRA 4XI5C 3MRGA 1NEZG 5JHDB 4Z0XA 2NYKA 4AH2B 1VIWA 3IDYB 4LP5A 1O6TA 4DGYL 2FL5A 4P2RA 1XT5A 4OZHA 4L8SB 3ZDZE 4K8RH 1AY1L 3UEQA 2DYPB 1ACZA 2XZQL 1E4JA 1R24A 1NJ9B 3I9IA 3ES6A 1AQ8A 4Z7QB 1J88A 3QIWD 5IB3B 2VZSA 2A6IA 5HHOB 3UBXI 2GQHA 2Y6TE 2P48B 5DD3L 4ZNCD 2L0DA 4JM2C 5HPOA 3FB6B 4JB9H 2VL5B 1EZUA 3PGCA 4FFVD 3QI9A 4L2YA 4CVXA 2EYSA 1HIMH 2ROYA 2APSA 4FHJA 4E68A 2QFPA 4MXQC 2DQFA 1I1CA 1TVHB 1HQRB 1U3HB 5CUSL 4WEUD 4AJ0A 4DFHA 2VTFA 1W8EA 3OKDA 2OTPA 1HDMA 4PJAB 1RK7A 4XNYL 3QEQD 2UVEA 1UCTA 3A4DA 4NDMA 3FOMB 1IGJA 1PGRB 4IBLT 2V9UA 5J13C 4PG9B 3F7RA 1F1DA 2GSGB 4FLSA 2A6DA 1SYVB 1T83C 4GXUM 4QHUB 5FUZL 1GPOL 4EBQH 5ISZE 4FLRA 4ZUUB 5DK0B 3LKOA 2HVJA 3F3HA 2K8MA 4GRLD 1KEGH 1KJ2H 2CWRA 1F11A 4CVZA 4NN7C 1CI3M 1T1YA 1KB3A 4Y0GA 1JTOA 1C16B 5ALCL 3Q6GL 2R51A 3RNQA 4EXKA 2AZAA 5HXMA 5MEND 2Y07L 4WEBL 4ALAC 4R2GC 5DD0H 4JFEE 1PMYA 3V4VL 4M03A 5EEUA 1T89A 2A9NH 5F96L 3VO0A 4BSWB 4HETA 2XQBL 4V11A 3TF4A 1PL3A 3OJDB 4KK9C 5KEZA 2XWTB 3BPLC 3CFIC 3PDDA 1DQJA 2K8QA 4Z18A 1EJ8A 3SHSA 3MRJA 3RY5A 2X4PB 4FFTA 4P9HC 3SGJC 4B5ZA 3EO1A 3KLDA 4YDVA 5T1MA 1FZJB 5D6DA 1M6OB 5J57B 1HXMA 3N0AA 2H5UA 3N3EA 2D2OA 4J1UB 5DHYB 2BNQA 4LDOB 5GRJL 4G83A 7PCYA 1GJIA 3LRGA 4MNHA 2AXFB 3PGFH 1HL5A 5DEGA 4J8RA 4N2DA 2V37A 5E2WL 1CUOA 5GIRA 1FCGA 4NHCL 3QUML 2TAAA 4P59H 3G6JE 1DCEA 1ORSB 2XN9A 3WJMB 2CBMA 4GAFB 1NBZA 1RU9H 3IPFA 2W95A 1WA2X 2FYYB 3VD0A 2BIMA 4ZG1A 2AP2A 5CNHA 4KFMA 2BXZA 3QORC 3U30C 1QLRA 1MZZA 1OAUL 2HB0A 5CWSA 3CNKA 3N1MC 2AEPH 3MBXL 1I8KA 4OD2B 4GW1B 5E99L 1YYMH 4JHAL 5INDA 2EAEA 5AKRA 1CICB 4J6RL 3QG6A 3ZRFC 3ABGA 4BH7A 2Q3ZA 2V2WB 3HLKA 2IPUK 5KYNA 2ZYIA 1T7WA 2HRPH 3FSVA 3TCLB 3UBXB 5FAAA 3W5NA 3K6SB 1O6SB 1GCYA 4HPOL 3RL2B 1WBYB 2VR5A 3TVMA 4WK2B 1OXYA 4EOWL 5FYJE 5FCSH 1I3RA 3QVAA 1FO0A 3L4CA 3BUYA 1JNLL 4WK0B 2E6PA 4TOYH 1J8HE 2JSFA 2DPKA 4NN6C 2A38A 3G5YA 5IEHA 3G6AB 1TVBB 3EYUH 3FUHA 2VE6B 4K3DL 1UOWA 1KBKA 2ZAGA 4JGMA 5HBBA 1BQSA 1NCCH 2D4FA 1IFGA 3FHQA 3FUIA 5CU9A 1P1VA 5DLML 3MR9B 3B9DA 4NRXA 1QNZH 4XBEH 4WI4A 3QWNA 3WIHL 1KJ3L 1QNIA 2IQ9H 3GK8L 5D71H 2AKRA 3CFKA 1WTGT 1X5GA 3N9GL 4WUUB 4K9EC 3P4NB 1SDDB 3ROLA 4Z5RA 1JZDC 3MODH 1BG9A 1KPVB 4PD4K 3OAYH 1YN7B 5HYIA 1E2WA 5BRPA 1ZD6A 4G1EA 4TNFA 1I9JH 3VG0H 2CIIA 5J06A 1P0SE 2QV4A 3Q8AA 4Y1AA 3KPNA 4AGLA 2B1AH 3CVIL 3P4OA 4EI5D 1NGZA 2N7AA 5A2FA 4X4ME 1I75A 3OKYA 4PJ5D 1JXDA 4YXKH 4DJMA 2QHLA 2XICA 4X5WA 3MYZA 4M29A 1F58H 2F7QA 3W39A 3K0YA 1CFTA 5JZ7D 1R75A 1K85A 2EXTA 1BM7A 2XWRA 1CXLA 3GXNA 3K0WA 3QFJA 2Z31A 5AENA 1F13A 2CNZA 2YUZA 3FQWB 5BV7L 1Q0YH 4ZRGA 5DJ0A 4JK0D 4XMUA 4OQTH 4PJBF 5C2BH 3WFDL 4KQ0A 3QIBC 4XNXL 1AE6H 2ADJA 3IXAA 3KM2A 5LNDA 1LQBC 3J8F7 1AQHA 5EORL 2P43B 4IU2A 4WI2A 2DIBA 2FEJA 3IU3B 4KJPC 4BYHA 1F3RB 1MXDA 2ZOTA 2MQGA 2NXZC 2PLTA 3N43B 4DGYH 4G43A 4F5CA 1F56A 2CO3A 4I3GA 4NBXB 3ZXAC 1UASA 4LIQE 4NQEB 4E9WA 1AY1H 3S34L 1NM4A 1C12B 4D0CA 1CQYA 2YAHA 3APCA 4WHTA 4Y4FC 2QLYA 2ZOKA 2ENPA 1X5AA 3SCMD 3QAZB 4WJ5A 5AB2A 4PGDB 5E8EB 2E7CA 4KKAD 4J3OF 3UYRH 2VB5A 3U25A 3GO1H 4OT1H 5E8NA 5DD3H 2MCPL 2DWEA 3QHFL 1F1GA 5DZAA 1EO8L 3FTZA 3MYJA 4M62L 4M8VA 1PLGH 2BZCA 4FYTA 5FF6A 4U1GC 1A4BA 1CFNB 1JK9A 3BPOC 1E43A 4QJ5B 5FO9B 3HZMA 4J4PC 1WC7B 3F58L 3GMPB 1IFHL 2ZKHL 4IMKC 3IYLW 1CD0A 2C9SA 2EEDA 1GPOH 2CO2A 2X9YA 3U79A 3ARUA 5DJXA 3IFOA 3P3RA 2BSBA 4Y4HB 3UJIL 4U1IB 3DO4A 1W0VA 3Q6GH 4X0KB 3MRPB 2BNUB 4LQFL 2JV6A 4IEFB 2UVFA 3L95A 4RRPM 5ID0B 1F4WL 2Y07H 5TQ2L 3RWCB 4ALAL 2AJSH 4UOQA 1M56B 1AS7A 4RDQG 3S48A 2A9MH 2XV3A 1ECZA 5AOIA 5IVNA 2B59A 2OMXB 2XQBH 3G5XB 1O7VA 3UTTA 1BQ5A 1UURA 1ZGLA 4HCRL 1RUMH 3BLBA 4JZJC 2QPFA 2H3XC 3LPOA 4U1LA 2AEIT 3CFQA 2CUHA 2B5IC 4X7DC 5BS0E 4G9FA 4HDIB 4P9HL 4ZK8A 2YXWA 5J89A 2X41A 3PYCA 1FAKT 2VJ8A 3OG4B 5SWQB 1YNKL 1WE5A 3QJSB 2OYPA 1RHHA 3VFNB 4YGVA 1D5MB 4FYSA 3UZVB 1MEXL 2VISB 4FQLL 3SDAD 5FEBA 4HJSA 4RFEA 5E2WH 3S3PA 1T6VN 4NHCH 5KVEE 3EJYD 4F24A 3NZ8A 1AKJD 2ESVB 1FBIL 2IPUG 4N86A 1TNNA 4JN2A 3F8UB 5K9OB 2PNDA 1X7TA 4N9GA 3AMKA 3O3UN 5KUKA 1RCYA 1ETJA 1WGVA 1AD9A 2P5WE 1L0PA 1LP9B 4KZEL 2AAAA 5LN8A 3K8MA 4HOWA 3GBNH 4XPGH 2H32B 3UGEA 5E99H 3B2VH 2CLZA 4KMLB 4LARH 3CUPA 4J6RH 2UWEF 4OCRL 1E6JL 1AQDB 2PW1A 4QXUL 3FUDA 5I1JL 1U4FA 1HEZB 1GSMA 1UA3A 2CO7B 4R0LA 4HPOH 3NCCB 3CSYA 1PKQA 1RULL 4WNQA 1UJ3C 4EOWH 2IPKA 4R26L 4P5TC 2CLRA 3UGXA 2V7HA 1ZXQA 5ICYA 4Z76B 1SJMA 1JNLH 1LVEA 1FZMA 2JJTC 3FFOA 4N5ED 1AQKH 3ARDC 2Z64C 2XV6B 4CMMA 2OXGB 2CK0L 3SYQA 4LSQH 2Q8AL 4MA8H 2J88H 4POUB 2FJGB 3F7YA 3GXDA 4G82A 3O4LD 3OB0K 4G70B 2VN3A 2VZVA 1YMME 2D31B 4PN6A 3B83A 1ACCA 4XBPA 4ATTA 3MLPA 3WJLC 3ZLQC 1WFMA 3RA7L 2Y25A 2EZ0C 3K6DA 2X1PA 4KVCL 2F8OA 5T5NG 1AGCA 3TV8A 4PGZA 3GD1C 3HS0C 4ZTOL 5C92A 3WIHH 4OZ4A 5C7XL 3HUJE 2J20A 2IAND 5AW8B 5AD0A 3INUL 1L9MA 1GRWA 3N9GH 5DJDB 2EDTA 2EDOA 3LJ3A 4K9EL 2NX5A 3NFSH 2C9XA 5JPNB 2Y7QB 4KROB 5EIVA 1MJ8L 5BRQA 3I3DA 3BXNA 1TR7A 2AMUA 4AEHH 3LN5A 2XTJE 1V3JA 5I71B 3VA2C 1BBDL 3D08A 3TFKC 2BINA 2X4UB 3WGUB 4ZO8A 4MB3A 3MQIA 2ZXDA 2WAQA 2D7MA 4PJFF 2A9CA 3RPIB 4HSAC 4XP6L 3BSHA 1U91B 4H8QA 2V8MA 4U1HA 2B4CH 4YDIL 1ZLVK 2V9TA 4ADJA 1IQWH 4GAYB 5TDPB 1HE8A 2KERA 4PJGE 4YVUA 2F68X 4JKNA 1CFQA 1F2QA 1QLFB 4JQXC 3NACL 3SDXA 4LP8A 4CC4C 3MACL 3TZVD 4QRPA 4YXLL 3NSCA 3WFEL 3PWPA 4DOHB 3HW7A 1IAIL 1JDCA 1M42A 1E9QB 5G55A 1LO3L 5G4MA 3LCYA 3HAEA 3FF8A 1JHKL 2A73A 4NSKB 5DD0L 4NC1C 2IQAA 5BV7H 4XMLL 1MCEA 1PCXA 1UEYA 3WFDH 3TESA 3KVPA 3KYMA 2VDMB 3OX8A 5I74C 5HYFA 2HG5B 3P73A 4LVNB 2DS4A 5IVXE 1O0VA 3LKPB 3ML9A 4BFBD 3D0LA 1NLBL 4JEGB 4TLKA 1JF1A 4ONOA 3HNSL 1BZ7A 3QUYC 2DEYX 4E9XA 4K4KA 2XIIA 1P7QB 1TJHL 1QASA 4PLOB 5C0IA 4H25A 1JWUB 3LIZA 4G9DA 4POZC 4IS6B 1IU1A 2AQ3A 1LGVA 5HJ3B 1G7JA 1DBBL 1BEXA 3MCYA 1NPJA 2GTZA 3BH8A 3PRZA 3GM8A 2FGZA 3KPOA 3V5DA 1NBVL 1WWCA 2RD0A 1KLFB 2ENQA 4JRXA 3RZWA 3ILPB 1KLGB 3DYOA 3HRZB 1I8MA 1ZA3A 1TEYA 1A6ZA 4M62H 1FZKA 1HXYA 2P8PB 2ZNXA 2LU3A 1G7PB 3P30H 4PAZA 4YSEA 2H41A 4X4YA 1XD0A 2WXRA 5LXVA 3B3BA 1CGXA 3FT3B 1AGBB 1FCCA 4AVIA 1ZS8B 2ITDB 1SLXA 2ZAIA 1MH5A 4F37F 3MRBB 4HXBH 4PTTA 1V27A 1YN6B 3U0TB 4Z7WB 3ZT5A 4IRZL 5AAMA 5M7QA 1XXFC 4TYUA 3E9UA 2VAAA 3KXFE 5TDNA 3MGOB 3W1ZA 2P4AB 1A6AA 2NCMA 1L0QA 2BSTA 3CXDH 3Q8BA 1XH3A 5E6IB 2AK4E 3S97C 3TH3T 4TUJA 2J1WA 3U7WL 4IGBD 5AOKA 3VCLB 4PGEB 2J8UA 3FK3A 3UJIH 1H0DA 3HZKB 5DJYB 3F62A 3ZT7A 4WFFE 3PFUA 4PIBA 4BCZA 4PB0L 4NZTH 2CHDA 3GHEH 4LMQE 5JDSB 4Q2ZB 3MRCA 1F4WH 2CXGA 3SJVB 4ANVA 4ALAH 1BW8A 1J1XH 4KK5C 3QG7L 1OT1A 4BSVA 4ES9A 5KYXA 2WXKA 1YSOA 3H42H 2WP3T 2X3BA 4JFQA 4HCRH 3QNFA 5DD5L 3D9AL 1FFNA 1MCWW 1T5XB 4LEEA 3GF8A 3EYOA 5KAQG 1U3HC 4KDVA 1YY8B 3GSUB 4P9HH 5BNXD 1S9YA 4X9FA 4E5XB 5C07A 1BQHA 3B37A 3P11H 4N2OA 1BBJA 2HUEA 3U2SB 1MEXH 2FIKB 4XB8A 3GJFB 5DZLA 1PG7W 1P6AB 4XOAA 3QQ3A 4Y4KA 4ODTH 3GSOB 1A7OL 3LRMA 4GW4A 3GMMB 2MQ0A 2XRAH 1CGWA 3HC3L 1A6VL 2MNUA 3VXUA 3FONB 1EJOL 4WHYG 5F1IA 2XBZA 1BD2A 2JJVA 5E1AA 4LHUA 2DQGL 2OFQA 2OJEB 4UB0L 3E2HB 1JV2A 1R17A 4J6IA 4DHLA 1MQ8A 3ZRCC 3ARBC 5DRZB 4HU8A 2J2ZB 4G6AC 1CDBA 2GPZA 4WLCA 1HX0A 5AW2B 3IMRA 1BVNT 1E6JH 4M5YH 3T04D 1E9OB 4QXUH 4KTDL 5I1JH 2N1KA 2VR9A 2ITFA 1QD0A 1RULH 5FO7A 3UBFA 2EO1A 3S37X 3QJRB 4R26H 3MNZB 4LEOB 4BM7A 3L9BA 5SWZB 5D1XD 2JJSC 3MI6A 4QTFA 1WFOA 3UYPA 5KJRL 4Q8BA 1IM9D 1UKTA 1X5IA 2HKHL 4U6YB 3BJLA 4EN3C 1FL6A 3NSFA 4PRID 1QHQA 5F9JA 1RP8A 3APDA 5D2LE 3ZZLA 5DRWA 3QXAA 5GGVY 2E7LC 2BS8A 3MFFA 2DWDB 1K8DA 1QSEA 3F7VB 3RA7H 2AQTA 1NWOA 1YEJL 4K5PA 4KVCH 3A6CH 1U8PA 3PL6A 4U2ZA 4ZTOH 1PLBA 2PN5A 2WXPA 5FM8A 5C7XH 4CA4A 4QR7A 4NO2A 2DJ4A 4S1SL 3TO4B 4KXBA 3V9FA 4ONGL 4PYHA 4K9EH 1XIWB 3RI5K 3L4WA 1TTGA 2BP8A 1AXIB 4MQ7B 4HUVB 5H35B 5EUOB 4J2QA 2PWEA 4YFDB 4AV5A 1FFPB 4YX2L 4PY7B 2X4SB 1KSRA 1IL1A 3BIKB 4MMXC 1EZLA 5T3ZL 2EDXA 3ZGHA 5E1IA 1I1AA 3FB7B 2VDQL 3AFLA 4L5FL 2ADFL 2EC9T 4MA1C 4Z7UE 5IMLB 2ZWZA 3U6RB 3BIAX 1PEWA 4OZGE 4YDZA 1FIGH 2F58L 2ORBL 4NC2B 4MJIA 3VFPA 3BCDA 1IGIL 3JZYA 3OZ9L 3ZSSA 4ZMYA 2J1KA 1VZHA 3QDME 3JTTA 1NMCC 3V6FA 5J6GA 2XKSA 3HKZA 2C3WA 3GJFK 4H2CA 5CSZB 1CLYL 2LFEA 3B1UA 3B7SA 4YDJA 3MACH 2UY6A 2Y7SA 4PGBA 4YXLH 4GYBA 5F97E 4JQVA 3JV4B 3IKCA 4Q4IA 5K93A 4A6YB 5EN3A 1D7DA 3D4ZA 3UTSE 4BH8B 3FO2B 1JYWA 3ATFA 3NPSC 1JHKH 2QGDA 1BLIA 5I8EB 4XMLH 1GGIH 1HFUA 1ZHKA 1A7PH 2X5PA 3CBJB 1Z5LA 2FO4A 4OF0A 3BFQG 4YIQA 1YPZB 2F7IA 2K6ZA 5K69A 4GO9A 1ZWIB 4I9XA 2RHEA 4ZXBB 4KXAA 5GGTL 3O41A 3RYMA 1DBKL 4JFTA 4R8WL 1BZEA 3BDYH 1BVKB 1UH2A 1H3VA 2O72A 3MUGB 3BN3B 5JIQA 1XR9A 3RUGA 1S4IA 3CFNA 4IKLA 4Y16B 1E6OH 2DTSA 3HNSH 4GY4A 1UC6A 1OARL 3GXFA 3KLAA 3SDCA 4S0HA 5DMJB 3L1GA 3V6OE 3WMQA 3KPSE 1C5CL 4PJCA 3RQ3A 2Q7AA 3ULVF 2EH7H 3KJ4B 3CLEL 3OHXB 4QO1A 4QRUB 4Y9GA 1V7NL 4Z3EA 4XI5D 4GUPB 2E27L 3ARVA 3RNKA 1JNJA 4DQOH 1HILB 2COQA 4LLYA 1HS6A 1ICTA 2VXSL 2ZX8A 2XA8L 4FQXC 4X7TA 5HHXL 4R96A 4WO4A 3W11C 4BK4A 7TAAA 4QJ4B 4CDHA 4ZMPA 3RY4A 4ZX5A 5AAWC 1S5IL 5TGBA 2WWKO 1DQKA 3WUZA 1ZV2A 3UP6A 1KCRH 3CZGA 5KOVC 1OB1A 2SODB 1LWHA 1JPGA 3GB7B 1ZSDA 1K3IA 4G8GB 4AI7A 4JJOA 4MX7A 4HP5A 4XX5A 4JFWA 2VDLL 2YBGA 5H94B 3ZIYA 4JM2D 1KB5B 2WIIA 4ZFFA 3VD4A 3MC0A 4IRZH 5HI5C 4LCWA 4KVNL 1PFCA 1QA9B 4P5KA 2WWNA 3CCHB 5AB1A 3WIAA 8PAZA 5TDOB 2VLLB 1SF3A 3LSOB 4MXQD 3VYPA 4M61B 4MZRA 3T1FA 5IEKB 2J6WA 4IRJC 2CO4A 4PW9A 4OV5A 2EDFA 5IZ7A 1OSYA 3W5MA 2PXYD 3WMPA 5GS0H 1KIUB 5E5UB 4PB0H 1HEJC 3VJ6B 2H1XA 2A6KA 3NK3A 4HEME 1QSFA 3KLLA 4ONHA 1R33A 3CZJA 4F7CB 3AREB 4OZIE 5J56B 3D4GA 5DD5H 3IJ8A 4DK3A 2YD0A 1FC2D 1CT8B 4H1LG 3VG9C 5DMKB 2GAZB 3GUFA 3EUDA 3CDFA 2R1YB 1MQKL 1UQSB 4L4VD 4A1RA 3KYKH 3WS3A 4R2GD 4L3EA 3LRLA 5BOJA 4M7LT 2YQ2A 3UZEA 1IEBB 3VYNA 5JHLH 4KK9D 1QPXA 1MLBB 4IRSC 4MDIB 5AL8A 4OAWA 4MA3A 1J8SA 3ISYA 4DGUA 4LU5L 1S7UA 2BIQA 1WK0A 1MI5A 4BFKA 2J6EL 5IFJA 1M9SA 4XCYB 4KQ4L 4PREA 4KMQA 2VYRE 4L48A 4RGNC 3A5VA 5D7HA 2CIKA 4MMYB 4YSUA 4QWWD 4C4UA 1QLEH 1I7ZA 2OR9L 3VFUA 5DMGC 4MDJA 2VLRA 5AVZB 3B9EA 2DQHL 2Y3AA 4XP1L 4F2MA 3AVEA 4Y5VA 3VXSB 4JG9A 4BIKA 3HI5L 3B2PA 3VFOB 2CJTA 3IFLH 1G7LB 5EF1A 1W0WA 2WLLB 1A6UL 4NQDE 3EG9B 3MN8A 1QFWM 4IIZA 5CIPB 5AQ0A 3RILA 2UV3A 3VXQB 1UUSA 4FTVB 3QORD 4PJCF 4KTDH 5HDQL 5KVMC 3QZPA 4FFZH 1M1XA 3NCBB 5BZWA 4EIGB 4HUCA 3ROOA 4Y19E 3ZY7A 3OJVC 4IOIA 3S36X 1UADC 1UB6A 5I6OA 2OS7A 3D0VA 3OLIA 3QPQC 3L13A 4XPAL 2EYTA 3H2PA 4JGJA 2ZOLA 4HKBA 1Q9WA 3HVDA 2WXJA 3GI9L 3T8VA 3STLB 1RZ8B 1OGAE 5KSUA 1OAXH 4TKWA 5MHSE 1WIPA 4E42A 4W81A 4W6XB 1JMXA 3V6OA 1TENA 3IBOA 3MCG1 2FVNA 4QXWA 2XSKA 5FW7A 1BIIA 4TUOB 3EBIA 4EZLA 4ANXA 1UATA 4PR5A 2G3NA 2L7QA 4HJIA 4E5XG 1YQ2A 5DYOB 4ONGH 5I1GH 2YGOA 3ZL2A 4B9JA 4HUKB 3UTZA 2CU9A 2WQSA 3NZUA 1HCVA 5SWSA 4AEIH 2BHYA 5LAPA 3M7FB 4R3SB 2N7BA 3O6FA 1HI6B 1OP9A 4W6WB 3TWYA 2H0EA 3P4MB 4TSCL 5BRZE 3NZHL 3ZL4L 3MLZL 5A3IC 2BVQB 3U1QA 2DKMA 2L7EA 2ADFH 4HWUA 5MEOB 1GGCH 4H0HB 4Q0XH 2NW3A 1SXNA 4G7RB 4V33A 2QEJA 5DFVC 3CSPA 5A2AA 1IGIH 3U46B 4RA0C 4ZMXA 2AXWA 4AITA 2FQGA 3TEWA 3B6SB 4GAGL 2VMFA 4LNRA 3PLYA 4UQ2A 3IETA 5F7DB 1OSPL 4FAAB 5IJBC 3X12B 1ADQL 1U3YA 3NQIA 2GG1A 3R18A 2Q0ZX 1ED3B 3EO9L 4KFZC 15C8L 1T0NB 3CDGA 4PRPB 3TIDB 1OO2A 1S3KL 4B50A 3VVVA 4M8QB 4M7JH 5A2KH 2BSRA 5EU6E 4P8QA 3D39D 5L4IA 1WS8A 4OD1L 5I71C 1FUNA 5IKCA 4R8WH 3FNKA 1UFGA 5KS9B 4MS6A 3GEWB 1YEKL 3ZBMA 5DCCA 1GGUA 3VWKB 3Q3GA 4P4RA 2WCPA 4DEUA 4UQ9A 4G42A 2OP4H 4MNGB 1OARH 3L2NA 4ZDHA 1PJWA 4JBSA 4O51B 4XXCC 2QSQA 1C5CH 2EIZA 3HE7C 2HJFA 3VGDA 3CLEH 2AQQA 3JUYA 1MAKA 2OZ4A 3MLXL 3ZHDA 5HGBA 4LVEA 4KJPD 1TU2A 5FA4A 4QPEA 2AV1A 1KG0B 2NXZD 3DSFL 3R0NA 1S9XB 4FJYA 4PS7A 3HKFA 2XA8H 1I1RA 1C08B 1GA2A 5FYJL 4BQ9A 1SM3H 4DP5X 4CU8A 1W72B 3IJHA 1T04A 5DD6A 1S5IH 5D7LE 1QTYT 4JVUA 2GBVA 2JFCA 3ARYA 4Y4FD 4QCIA 5DS2A 1E28A 1G6RH 3ZZ1A 3IGAA 2YPVH 2WO2B 2XPGB 4PM1A 4UIKL 1HHHA 2RA1A 4AQAA 1T1ZA 4NERA 1QRNB 3FUJA 2GVYA 2GCYB 4MHHI 4ZD3L 4Z77A 1QWNA 5TPWH 1ZVNA 4UBDD 1FYTB 1BGXH 2H8PB 3T8MA 4KVNH 3RJOA 2YFOA 1JGUH 2BSSA 3Q05A 1HEHC 4I18C 4PIRF 2PTVA 3I84A 1FN4B 4M3KB 1NFDB 2QZ5A 4YPGA 2OXHA 1DVQA 2CA4A 2FD6H 2Q8BH 1BG1A 2FRGP 3T2LA 2EVJA 5ABAA 2IAAC 1NCOA 4J4PD 3SY6A 3DTXA 2RFXA 2B14A 3C5SA 3AT8A 4QHMA 5B39B 2XTJC 3ZE2E 1RFDH 3EJQA 2A77H 2GJ6B 4LL9A 1NKOA 1CC3A 5DT1H 1MVYA 4IDJL 4LFHG 4S1DC 4AKQA 3GRWL 3MUZ1 3PQYE 1TTUA 3LY6A 3FQ1A 1ET7A 4FNQA 2PO6C 4MJ5A 3RBSA 2ICWB 4GXFA 4YHIB 1G1CA 3WL9A 1R3LA 4JAMA 3UZQB 4W70A 5BMFL 2NY4C 1E30A 4L18A 2E6JA 3G08B 4HMDA 4CGTA 2X09A 4LKCB 7PAZA 1ZHLA 4XCFL 3RZCC 2BVPA 3O3BB 3LQZB 5CJQH 5C0AE 3DK0A 4MCNA 4LU5H 3TBTB 2BC4B 5EZOL 4EN2A 3NYKA 3L4UA 4YR6A 1MREL 4PJ8A 4CMHB 4O2EB 3LD8C 3OXRB 2NNXA 1N59A 1JVOA 3B9KB 2J57A 5CGMA 2DJSA 3NCXA 4KGLA 3VD5A 1U92A 4WQOA 4AYEC 3NJVA 4WDIB 2DQHH 2EDDA 1BEYH 4M00A 2Z92B 3HI5H 3PWNB 1XWVA 1MRCL 2WNXA 2BSDA 1BFVH 5IB2B 2XDHA 4B9CA 2JCWA 4LIQL 4UIMA 3G5VA 1SXCA 4LPTA 3PNRB 5EBMA 2Q6WA 4ZFGL 3VQ1C 4Z0BL 4AQ1B 3VSUA 3D09A 5HDQH 3EDDA 3EIFA 1QYGH 1WWBX 4GKOA 1UOLA 5D7SL 3DMMC 5B3JE 2G3XA 1PDKA 2YGPA 1F90H 4C56D 1XB3A 2W60B 1OZTG 2KH2B 3M8OH 2P49B 3PHOB 1BOGB 3BPCB 1VACB 1QOKA 5GGQH 5C0FB 5C2UB 1ASPA 1DR9A 3LDBC 5I0YA 1T80A 3GI9H 3WEXA 4K73A 4LZKA 4RRPG 4EUPA 4OIFA 3DO7A 1MF2L 2BS9A 2XJKA 2F19H 4PBWD 3VXMB 4PLNC 5C3IA 4FG4A 3U9PL 2BFVL 2YFNA 2OZNA 4P5TD 3CC5B 4G6ML 5FYKU 1ZGLM 2ZONA 5IQNA 5L6YH 1GKOA 1WISA 2VRKA 3ARFA 3E0GA 4IJ3B 4D0DB 2FSEA 1NFIA 2FT6A 3HZ3A 2J55A 2DM4A 1X7QB 2VW7A 3T0BA 2R59A 1TO4A 3GMOB 2G3MA 1KCVH 2E9WA 1FE8L 3JV6B 2APXA 4PS3A 4XP4H 5ESVA 4Z78B 5B1JA 3BGFB 3SPHA 4PI0A 4A39A 5B38A 2P26A 4ETQB 2QTVA 1XGPB 2H9GA 2JCCA 4FLHA 3ZZSA 3RHWF 5ADOL 4HKJB 3ZUCA 5L2JA 1XO8A 3QZMA 1GGBL 4TSCH 3BT2L 3ZL4H 1GIGL 3NJFA 3VM5A 2Y69B 3A0OA 2P5EE 3T0EA 1XTMA 4PJIA 1LJMA 1HZKA 4LNVA 3VVWA 4G1MB 2OL3L 5FOBA 3F6JA 3ZL1A 4AMXA 4I2XA 1XTLA 2B2XL 3MRFB 5MERB 1GOFA 3TFKD 5DZVA 4Z3TA 1OSPH 2XQYK 3DYPA 3JWDH 2IWFA 3E1ZA 2F9BT 4NWUL 1ADQH 1NA8A 4GI6A 4HGMA 3MRLA 1E5CA 2IXQA 3EO9H 1I8IB 3GTNA 4K7FA 4P4KB 2Z4TA 1PW3A 4LGSB 1CTMA 4LSTL 5TH2A 4D0BB 1S3KH 3HHSB 2VLJA 4LLDA 2NSXA 4ZZFA 2DQTL 4DGWC 4U3CA 2JLPA 4XCNB 3N55A 5KVEL 3AM8C 3OD3A 5A2BA 4OD1H 1L0YA 1KDJA 3MRDB 4F3FB 2ENYA 1ID5I 4XMPL 4E41A 1CFVH 4POYA 1U58B 1C9SA 4AYMC 1Z9OA 2Y5EA 3V0WL 4JL1A 1GS7A 4XE5B