4DP1X

The 1.35 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 4.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp1X00
2XXGA 4A68A 1NIBA 1BXUA 1ET5A 1JOIA 4DP7X 2H5UA 2IDQA 5F7BA 1JXGA 4CSPA 2TSAA 3OMIB 3NJJA 4FA7B 4HALA 2PPFA 1OE1A 1XMEB 2YAOA 1PLCA 2EIMB 4GP5B 4HCGA 3WKPA 3HEIB 3QJSB 4QKTA 1XB8A 1CYWA 1J9RA 3FSVA 5B7FA 3OMAB 2QDVA 2XV3A 4KNUA 4HCFA 2PPEA 4DP0X 2R7EA 3IE9A 4YVNA 3FU9A 3FQYA 1ZIAA 3ABGA 5I5JA 2GSMB 4A66A 1CC3A 4F7KA 3ZBMA 4A2EA 1AR1B 1PNDA 2A3TA 1FA4A 4G7QB 4RH4A 3N55A 1MZYA 3NJIA 5D4IA 5I6LA 4PCYA 1J5CA 3X1FA 1TEGA 2N0MA 1A3ZA 3JT2A 4ZK8A 2Y69B 4E9YA 4E9SA 1JVOA 2QPEB 3NYKA 1GW0A 1OV8A 2EILB 5PAZA 1NPNA 2ZXWB 5I26A 1IUZA 2X88A 1ZDQA 4HIPA 3UAAA 4A2GA 3X1EA 4AKPA 3ABKB 3ERXA 1A4AA 4UAHA 1J9TA 4YSUA 5E9NA 3NJNA 4YVUA 4BDVB 3AG2B 3EH5B 4E9TA 4HAKA 4JHUA 4NAJA 1TEFA 3BQVA 1BEXA 1NIFA 4EF3A 3OQRA 2XX1A 4P5RA 5B7MA 1ZIBA 2B08A 2PPAA 2GHZA 2Q5BA 3QQXA 1L9OA 3CZUB 1NZRA 2CBPA 4KO6A 3OM3B 3SBPA 4DP1X 2VW4A 3S8GB 3WIAA 1WS8A 2OCCB 4YL4A 1IKOP 3H4HA 1AIZA 1PCSA 4L0PB 1KYAA 4HCIA 5PCYA 2BZCA 1AG6A 2FQDA 2Y1AA 4KNSA 1MG3C 4DPBX 2HX9A 4GP4B 2DYSB 4YSRA 7PCYA 1MG2C 3WKQA 1CUOA 3AG4B 4E9WA 2AZAA 2GBAA 3H4FA 4W1TA 3X1NA 2HZHA 2XV2A 5B1AB 2JXMA 1A65A 1ZV2A 2BHFA 1AOZA 1A8ZA 4HHGA 3GXUB 3FYEB 3FU7A 3NT0A 2VSMB 1KDIA 4DP2X 1BYPA 4KO9A 1JVLA 3X1BA 1ASOA 3RYMA 2GB2A 3ASNB 4P5SA 3CVCA 3ABMB 3NJLA 3IN0A 3FQ2A 1OCOB 3FT0A 2BP0B 3QJTB 3EH3B 2DYRB 1DYZA 2HX8A 1A4BA 3MBWB 2PLTA 5B1JC 3ZIYA 1CYXA 2FT6A 4F2FA 1GS6X 2PPDA 2CAKA 3X1GA 3PLYA 2QDWA 3QJUB 2FJSA 5AZUA 1M56B 3CDZB 3TU6A 3FPXA 2I85A 4N4YB 2MTAA 1RCYA 1E5ZA 2FTAA 2BW4A 2CCWA 1E67A 3KW8A 1OE3A 5TK2A 2XWZA 4KO7A 1NINA 1ZPUA 1AZCA 1KCWA 1GY2A 3V9EA 2J55A 1QHQA 4DP4X 2UXTA 2PCFA 2YARA 4Q8BA 3MX0B 1X9UA 3TBCA 1E65A 3QPKA 2DY2A 3UADA 2MRYA 1KBWA 1JZFA 1AG0A 1F56A 4AKQA 4KNTA 4KOCA 2EIKB 3PCYA 1QNIA 3T9WA 4G72B 3T71A 1AANA 1KCBA 4NB7A 1ILSA 3SQRA 1GSKA 2BWIA 4PAZA 1SFHA 1PZBA 1NIAA 3CG8A 6PCYA 3NSFA 3SBRA 2VW6A 1RZPA 2P80A 4HZ1A 3NJKA 1AACA 2LLNA 5FC9A 3CDZA 2PCYA 1WA2X 2IDTA 2VM4A 2YAHA 2FQGA 2QT6A 1KGYE 1WS7A 1T5KA 2JKWA 5I5MA 4CSZA 2BP0A 2J57A 5A7EA 2XYBA 5LDUA 2AZUA 2IH9A 2AVFA 3NSCA 3FSAA 1OCCB 1SHXA 4G7RB 1GYCA 1AS7A 3EHBB 1NWPA 3FU7B 2IAAC 2NRDA 1XB3A 3QJRB 2DWTA 1SF3A 1AQ8A 4G7SB 1MZZA 3WNJA 3TASA 4G70B 3OD3A 5AFAA 1URIA 4M4RB 1JXFA 4BWWA 2EINB 3DKHA 4YSAA 2I7SA 4G71B 4E9XA 3T6VA 2RACA 2BWDA 2FQFA 1YLBB 2GC4C 2CJ3A 3SBQA 1VLXA 2JFCA 2CALA 1SFDA 6PAZA 2J56A 3PAVA 1WA1X 2YXVA 3UACA 4QLWA 4AKOA 1L9TA 5I6NA 1DZ0A 3BVDB 3EF4A 4BXVA 2WO3B 4E9VA 2DV6A 4BWTA 3ZX1A 3S3CB 1SHWA 2B3IA 3U25A 1SJMA 1SDDA 4YSEA 2VM3A 2YAPA 2PP7A 3N2JA 1X9RA 3DTUB 3FYIB 4GXFA 1PLBA 8PAZA 2HRHA 1L9RA 4A2FA 1BAWA 3NJFA 3TA4D 3KW7A 5F7AA 4K9JA 4YSCA 1AAJA 5D4JA 4F2EA 1PF3A 1V10A 2AANA 2IWFA 4ENZA 2W8CA 1EHKB 1V55B 1J9SA 1OCZB 3WNIA 3UGEA 1NPJA 1KDJA 1R1CA 1M9WA 2YAQA 1JERA 2E86A 3IBOA 2X87A 3NP4A 2ZWNA 2EIJB 1JXDA 4YSQA 3OMNB 4BXSV 2UX6A 5I6PA 3NJGA 1E5YA 1RZQA 5B1JA 3IN2A 4N8UA 3TBBA 1L9QA 3IEAA 1HFUA 2IWKA 1PLAA 2IDSA 2FWLB 1EZLA 3PXLA 1HAUA 1A4CA 2Q9OA 3T6XA 3AG3B 2R7EB 4DPCX 2HRGA 3ASOB 1KBVA 3L45A 1JZJA 1AZUA 3T6ZA 1I53A 5B3SB 3PAZA 4YSOA 5ANHA 4BWUA 2XV0A 2HLEB 3C75A 1N68A 2OV0A 4WKXA 3AZUA 1OCRB 4YSPA 1W6LA 4JKNA 4AZUA 2VSKB 1ZDSA 2XXFA 3D12B 4DPAX 1GY1A 4M3HA 2GIMA 2UX7A 1NWOA 1IC0A 2H3XC 4HHWA 3WI9A 4DP9X 1WAEA 2VW7A 1J9QA 4YSSA 7PAZA 3GYRA 4WTQA 1PZAA 1ETJA 1V54B 2QPDB 1L9PA 5I28A 1BQRA 2W88A 2XUWA 1NIEA 3T6WA 1NICA 1FFTB 3ZDWA 1CURA 2WSDA 5B1KA 4YSTA 1ADWA 3UAEA 1FWXA 2BP8A 5I6MA 1BXAA 1SF5A 1GS7A 2BO0A 3FU8A 2YQBA 4UF7C 2FNWA 5B7EA 1JZHA 1PMYA 1BYOA 3NSYA 4A2DA 1SDDB 2ZOOA 2UXFA 1OF0A 2H47C 4A67A 1QLEB 1E30A 1PY0A 3DIVA 1AZBA 2VN3A 5IY5B 1W6WA 2UXVA 2GI0A 4Q89A 1PZCA 3ABLB 3QJVB 4JHVA 3G5WA 1IBZA 2YAEA 2DWSA 3EH4B 2UXGA 1KV7A 1ET7A 3X2QB 1GS8A 5I5IA 1TU2A 3FPYA 2HX7A 1MDAA 2YXWA 1JZEA 1N70A 4BK5C 1PAZA 2P80D 1AZRA 1SNRA 1OE2A 3NSDA 2BZ7A 1AZNA 1BXVA 4GP8B 1BQKA 2BW5A 4DP8X 4KOBA 4NERA 4TXVB 1ET8A 3AG1B 2PP9A 3S8FB 1L9SA 1JZGA 1PNCA 1B3IA 3S3BB 3AY2A 3FS9A 2I7OA 2TSBA 5D4HA 1J5DA 5I6OA 1JZIA 1AS8A 1BQ5A 5B1BB 4YSDA 3AW5A 1NIDA 4BDVA 1W8EA 1OOWA 3CVBA 2OJ1A 3FSWA 4KO5A 1ILUA 3NJHA 2J5WA 4UANA 9PCYA 1WA0X 1ID2A 2CUAA 4W9ZA 2FT7A 4E9QA 2FT8A 1XB6A 3QJQB 2AFNA 3FQ1A 1TKWA 2WO2B 2HXAA 2FQEA 2IWEA 3V9CA 2YAMA 2XX0A 5EHFA 3HB3B 3PAUA 5TK4A 4DP6X 1HAWA 3FSZA 2IH8A 3GDCA 1AS6A 1ASQA 4FAAB 2VMJA 4DP5X 3NP3A 2BP8B 5AKRA 5I6KA 2GC7C 2YAFA 1IBYA 1M57B 4X4KA 4A2HA 2XVBA 2ZONA 2XLLA 1ASPA 1UATA 2IDFA 2IDUA 3JTBA 3UABA 2XU9A 3NJMA 4AI7A 2PPCA 3PPSA 3S3DB 4E9RA 1NTDA 2PP8A 3H56A 1NDTA 4MFHA 4GYBA 3CVDA 4GY4A 1GR7A 3WG7B 4AX3A 1RKRA
chains in the Genus database with same CATH superfamily
3P2TA 5CEYB 5E5RB 3LJ3A 5E8PA 4G42B 4AIOA 1AY1H 3U1QA 5JZ7C 4UYQA 4CSPA 3OMIB 3GKZA 3QDGB 3GKWH 2B1HH 4KKRA 1EXGA 3HI6L 4QRFA 1TYRA 1J88A 1F13A 5KSVB 1T2QH 4R0LC 2XN9A 3DX0A 1T1YA 4XO8A 1B4TA 5DJ8B 5K59F 2CJUH 1VRSA 2R1YA 4GW4B 2CO2A 1LP9A 4P4KB 3PWPB 5DC4B 3QE5A 3KGTA 3RDTB 5D5ME 3S35H 3O6KL 3SPIA 2AQ2A 3DX6B 2KZBA 2GSMB 2Q3XA 1RZIA 1CC3A 4XTRC 3W82A 2F1AA 1F4AA 1QAWA 2W07B 1AR1B 4OCYH 1IX2A 3PL6B 5DJDB 4AOFA 5JYLA 3C5JB 4G7QB 1M1XB 3NDZE 3HMWH 4PLJD 4X8GA 1X6NA 3GMRB 4AH2B 3FDWA 4LQ1A 4YGVA 5CJQL 2Q87A 1BD2E 4LKCB 2NQDA 4POUB 1K6QH 1QOKA 1RZ7L 3MV7E 4LLUA 4P3DB 1GW0A 1YPZF 1HC1A 1GHFH 1NPNA 1RIHH 2VR6A 3CVIH 3ZDXF 1VADB 1IC5H 4FYRA 4RCAA 4O2EA 5CGBA 3N0PB 3ERXA 5GISL 3IS0X 5CGYD 2H26B 3IJYB 1S7QB 2AXHA 1ZLWH 3CN1A 5KVFE 4BV1A 3R06B 1C08B 2WUBL 4PJ5A 4BE6A 1JMZA 1EXUB 4BZ2L 4AL8L 3VG9B 4DSYA 4JHUA 3EJYD 5MEQA 2WOBA 3BQVA 3A6BH 4PRPE 1KJMA 1F4XH 5K9QG 4I5BB 3NIGE 5FGBC 5IROD 5E9DA 3IGKA 5B7MA 2R56L 2E7LC 3HNSH 1KG0A 3LV3B 2PYFA 1X7QB 3CCHA 1CT8A 4XH2B 1ZLDA 4YL9A 4A7GA 4DN4H 3ALWA 4FNPA 3MYJB 1T5XA 5IJVA 1B0RB 2AEQH 2LAAA 4P2YA 5EIIA 3RZWA 5D6CB 3O45A 1EGJL 5C8JB 2XOTA 3ARGC 4E42B 2XKSA 4LHUB 4AMKH 1B0WA 2P5WD 2RMNA 2VLLB 1ADQH 1EEUA 3MI6A 4YX2L 5ADPH 3DETD 4FLRA 1CFSB 4N2FA 4DK3A 1FE8L 2LTQC 3NPSB 1YECH 4FULA 2ZKWA 3MJ8A 2DBJA 2PR4L 3DSNA 4M4RA 2CSPA 2A6IA 4C56E 2CO3A 3TIEA 1H3XA 3N1FC 2EH7H 4L3CB 1E4KA 4MNQD 3RIFK 3B8SA 4WUUE 3FYEB 4LPTA 1UGKA 3D05A 1GJIA 5IQNA 2WB7A 4BFRA 2IALA 2JKJA 4XCYB 3RYMA 1OANA 5DQDH 4NNYB 4ANKA 1K85A 2HX8A 1P9MA 2XN0A 5I8EA 5IHBA 1YEDB 1Z0NA 4OF5A 1GS6X 3ZGIA 1FZKB 4FZEH 1J0JA 3B3IA 3IJ7A 5JHDD 3U4BL 1U2YA 2WKLA 1OB0A 4QCIA 3TA3D 3WXWL 4QDGA 5IFHL 2QQKH 1HNGA 4IDJH 3GHBH 2QQLH 1WAAA 4H20H 4J6RL 1U4FA 3BESR 5EORH 3U9UA 2FX9L 3QWOB 5EV7A 15C8H 3ECUA 4R97B 1R5VB 2CR0A 3FH5A 3HHSA 4HC1L 1JRHI 4K3EH 4ZAKB 3QBTB 3QUKB 1UH3A 4XI5D 2J55A 4FZ8L 3QXAB 5BZDB 1CICC 1IV8A 4P49A 4Z77A 3QG6A 4LP5A 5FA3A 1CBVH 4GAGL 1WG3A 3ROOA 3SE8H 1AYRA 3DO7A 3F12A 3Q2CA 4XX5A 4WW1A 4PREB 2OL3A 2AGJH 5HHQA 5HGAA 1A6ZA 1EAOA 1KBWA 1YJDH 2F5BH 2FZ3A 1CK0H 2EIKB 2HKFL 3HE6B 4PV9B 1ND0A 1OP3H 5BS0A 5E6RB 5GZNA 3T9WA 1S3KH 4YFLI 2IAMD 1VACB 3FB8A 1MY5A 2D8KA 3TWCL 1U2CA 5J6GB 1G7MA 1HINL 3HKZA 2C4XA 5KW9H 5JW4R 5D1XD 3TA3C 4PJ6A 3MRDA 2UY6B 3PYCA 3NJKA 4LT7A 2UWEF 4IRZL 3PWNB 1AACA 3MJWA 4NKIL 5F1IB 4E41D 2PO6C 2O5ZH 4HS3A 3MUGB 4ZJ9A 3UZVA 4FQCL 1YPZE 4JKPH 4KC3B 4ZYKB 1EFXB 5AKVA 5C0FA 3L3DA 3D0LA 1XF3A 1TJHL 5H35B 3SBWA 4AVHA 3V5HA 1JGVL 4CVXA 4XZUB 4DUVA 5MEPB 3KLDA 3RA7H 2XACC 4ZX3A 3RBSA 4JS7A 3EH2A 4XXWA 2YC1B 5LLIC 1AS7A 2Y36H 1AXTL 1NWPA 5BRQA 4LBAA 1ZHKA 5FB8B 1DE4A 5LCVA 4MBRA 4L18A 4M1DH 1P5VB 3CLFH 1UA6H 4JHWH 3T8VA 3V0VA 3QNYB 3IFNH 2XTJB 4F20A 4YSAA 3JYBA 3KPNA 4LCUB 4W6XB 1YEEH 3L5WA 4FNUA 2D2CC 1PYWA 4NFBA 3SCMC 2HT3D 3KLLA 4MMYA 2V5YA 3UO1H 5HHNB 2CUIA 3C60B 4Y2OB 3EGXA 1PW3A 3OXRB 4WFFD 4Y2OA 4DQAA 2NY5C 2X4TA 1BBDH 4LLVA 4HGKC 1LK2A 5D2LB 1V5JA 2FWSA 3V52L 4K2UH 4AKOA 4Q6YA 4KZDH 4JMNA 3FUNA 4NN6B 4E9VA 1YMMB 2G9KA 1LNUA 2R0ZH 4FQHB 1CLCA 2OMTA 3OG6B 1Z3GL 5BJTB 3V0VB 3R1GL 5A16B 4I4WB 1SJMA 4ODTH 2BOCB 4GQ9L 2W91A 4PWGA 2XVLA 2VO5A 3DTUB 1U8IA 2D3LA 5IB5A 1MIMH 1I3RA 2B4CC 4XBMA 5F7YC 3PGFL 3WFHB 3SDXE 5ERWB 1NJ9B 1OT1A 2VC2L 5EU4A 1D5MB 4ZUSA 2JJVA 5DK0B 1AHKA 1KENL 3TEZA 5GGRY 1AAJA 4KQ3L 5D4JA 1SN5A 2VITB 3F7YA 3I6GA 3QZOA 1EHKB 2AXGB 2AXWA 2DMHA 4OGQC 5I71C 1V55B 1J9SA 1DUYB 5EA0H 4I2XE 3TEUA 2PWDA 3MGTA 2I07B 3FNKA 4UAOB 2AQPA 1IQDA 4NRXB 3BN9C 5IG7B 1RD6A 2AJYL 2VLJE 2GBUA 1FYTA 1JF1B 1MJ7L 3HS0C 3ZGHA 1MW2A 5EU6D 3CXFA 5I6PA 3MCLL 4MNHA 4H7VA 4MXQC 4N2BA 2UYLB 5F89B 4HFUH 1BDYA 2A9CA 1KN2H 5B8CB 1T7XA 2X1WL 2YJQA 3ILPA 4YHYB 4X99B 3W1ZA 1QSFB 3CZSA 4MHHI 2GSIB 5ALBH 3L9YA 5AAWA 3PWVB 2YPLD 2EYRA 2Q7YA 4S1SH 3SDAB 1T2JA 5DGRA 4MZ3A 1VKXA 1RUPL 2R7EB 4BQ8A 1E40A 1BVKA 3DDGA 2WGXA 1WQVT 2X53A 4PIBA 3ROOB 3RVXC 1U8JA 3TT3L 4U1NB 5CEZH 2JMRA 4KX7A 3DPBB 3T0XA 1G5AA 4RAUA 1OSZB 2AV7B 1KJ3L 4QAWA 3BUYB 2QSVA 4A2LA 4XC1L 3D1MC 4W9CC 4PJFF 4A38A 5FUCE 3SPCA 1OCRB 1JHKH 3ZRCC 5I75B 1ZDSA 4P2RA 2K0RA 1VCAA 3MLUL 3ULUH 2GIYA 4OJEH 1Y6NR 1NBZA 1QP1A 3L4XA 3U9UB 4K3HA 2J8UE 2OMZA 4U7KA 4RAHA 4UQBA 2BCKB 2XZAL 3VXSD 3CDYA 3WS3A 3W9EA 4GSXA 1PD0A 1WEJH 3MLTB 2XA8L 1AJ7H 3B3IB 3JXAA 2AHIA 3MACL 4WEBL 5KVFL 3CZLA 4WTQA 3RWEB 1KJVB 2W92A 1BQRA 1IL1B 1XDTT 5JXAH 1CURA 4OY9A 3MNDA 3SDCB 1JCVA 1QBLL 1NCWL 1I9JL 5DO8A 5IT2L 1EVUA 1U0QA 2QTEA 1JZHA 3WFZA 1IM3B 1Q38A 2MCMA 1BYOA 1DQDL 3AREB 5E9DE 2OZ4H 2QKIA 4JN1H 3QHZL 1P4LB 3LPGA 2GI0A 3T2PA 1ACCA 3M86A 3NTCL 3QJVB 4GI9A 5DJ6A 1IILE 2Y2TA 1MRCH 4LSSH 1QZNA 1HHIA 4OLYL 4Q6IC 3NK3A 5E7FA 4HPOH 4L1LA 1JXJA 2CCVA 4AG4H 4I0PD 2W0LA 2NUTA 3BH9B 4LHUA 1RLWA 1HN1A 4LOEA 1ID5I 4GBXB 2HRPL 2OCJA 4Y88A 4YDVB 1LK3L 3VWJC 2BVPB 5ACZA 3HC0B 3ZTCC 2UZYA 4BEIA 3DJRA 4Y8DC 4MKMA 1CT8B 4OLUH 2VSDA 5F3HB 2V2TA 3BKMH 1KG0B 2ITFA 5EBLA 2NY2C 3V7MA 3NFSL 5DYFA 1JZGA 5E9DB 3ZYOA 3KLAA 5CILH 4LAQH 5JW3H 4BQ9A 2TSBA 1J5DA 5GRYA 3WGUB 5DC9B 4Q9CA 4MB3A 1KELL 1ZTMA 5EEXA 4W9LC 1GMIA 3S35L 2H26A 3O6KH 3GJEB 3DX1A 3VCLA 3TFBA 5AYUL 3BQUC 1MELA 3D34A 4E9QA 3Q2NA 1U21A 4HGWB 2ZKXA 2GIXA 5C0CA 5C6WH 2DQDL 4X4XB 3DVGA 1HXKA 4WTWA 5CLWA 2JK5A 2JELL 3HMXA 1I1AB 2BSBA 1XBRA 1FFPB 3PIQA 2YZ1A 2NNAB 4R96A 4UTCA 2CO7A 4GLRH 4BK5A 4P9MH 4F37K 3KLHC 1IM3A 1T66C 2PNDA 1KGCD 3QULB 2MPAL 2BDNH 3K6NA 3OWEA 2ZSWB 2XV6B 2HT2C 3BKYL 4WI9A 1CQKA 3GTNA 3BIKB 1JHLH 3OX8A 5FUCC 2G5RA 1FQ9C 3DX6A 2GITB 4JEGB 3KWWA 4X7TA 3KYOA 5GISH 5I17A 1JZ7A 1OSPL 3ARGD 4BZ2H 4LCWD 3S3DB 1T1YB 4AL8H 2OMXB 2YPLE 2VDLH 4XBPA 1VF5C 3CC1A 2FWUA 3AB0B 4DN3H 4ISVA 3ZTNL 3UTQB 4N28A 4GY4A 3LNGA 5KYUB 1ZLUK 4G8IB 3US0A 2R1XB 3VFVA 3BZEB 4Y4FB 1UEMA 1NMCC 1UM4H 2LU7A 1ET5A 2NX5E 1NBZB 1XR9A 2ZXBA 2IBBA 3MNVB 3P4MB 5BPPA 2OXGA 2FECI 4CN1A 1HU8A 3MO1B 5D70L 5TDOB 2B39A 2B20A 3SODB 3VXSE 4B9IA 3VU1A 2OK0L 1ADQL 2NXYB 2Y6SC 4YX2H 5ADPL 1ZAGA 2EZ0C 1FNLA 4R4BB 2XN1A 2QDVA 3QS2A 3BLKA 2Z4QB 1M2VA 4U6HB 4UZUA 2KH2B 2EKSB 3SKMB 2WQXA 4AW4A 3JWDL 1M7IB 1SMOA 3ESUF 5KOMC 3H7BA 3I3DA 4EBQH 1PTZA 4Q4EA 1P2CB 3GINA 4GAYA 3VNZA 5J11C 2O5NA 5D8JH 1JTOA 1JK8A 4RMTA 3KR3H 1FO0A 3JV4B 3B2UD 2LLLA 1T6BX 3VGAC 1U8OB 4M03A 2MOVA 3X1FA 2XFXA 5GZOD 4JFYA 4L2LA 2HKHL 1FYHB 5C0IA 4KRNA 4B7LA 4AZ8A 5DZJA 4ADGA 2YK1H 1OAQL 3D2TA 1D3CA 1DUYA 1SZNA 1OB1B 4BSWA 3KGRA 4ORZC 4UDTA 2X28A 1EWHA 4B9GA 3BPOB 2QKSA 3NCWA 4N1CA 2X7LB 3BCFA 4NQCE 5TFSH 1F6LL 3LRGA 1DJXA 1Q72L 2HFEA 4GMSL 1UUNA 2PXYD 3SGEI 4GB9A 4H8WL 5ERWA 1IAIM 4N2DA 3GIZH 3IRZA 3S3PA 1M4KA 4ONGH 1QFWM 1U8IB 5EO1B 1BZ7B 4XNYL 3FU6A 4FDWA 3CAFA 4PJHB 1RPKA 4MRCA 1F4HA 2CBPA 5CUSH 3MOAL 1YUKB 3KBHE 3P0GB 3N41F 3QAZC 4LSQL 4UIMB 4Q74A 4IMLB 2DYPB 2X4OA 5TE4L 4JO5A 3PV7A 1DVFA 1Y6MR 2E3VA 4S1RH 3WJJA 1PCSA 4BK8A 2H32H 1KLFB 4KI5E 4PRID 2I32A 1CD1B 1UD4A 2BZCA 4RA3A 5D1ZB 3R8BB 2AJ3A 3T0BA 3L54A 1AD0A 4XVSH 1HH6A 4NGHH 1MXGA 2MCAA 4LDCA 2YR3A 2E27L 3B9VA 4JRYD 4NYLA 2CGYA 5C9KA 5HI3D 4GBXD 5IEHB 1AXSA 1DO5A 5DVKA 4GXVL 4ORGA 1P5VA 3T3MB 3FRPB 1EAQA 2ATKA 5L2KB 2J2ZB 2K70A 1AQKH 4WJ5A 5EIQA 1UURA 2VZSA 4HCRA 2LV4A 3FO1A 4NKIH 5M94B 1F11B 1KTDB 3DVIA 4JKKA 3G5XB 4LEOB 4A6YB 5HD8D 1X9LA 3FN0H 1ASOA 3IRCA 3VI3A 4N86A 4GS7C 1BFVH 4P5SA 4QPEA 2W95A 2VLMD 4XCFL 3MJ9H 3CPUA 3DIFB 4G1EA 2BVTA 2AKRA 2BP0B 2DLFL 1RZ8A 3HR5B 4JUTA 4XO5A 4YHYC 5B1JC 5FYJL 2R8SH 4ZYKA 3LEVL 2NXZC 3DGCR 3UYPB 1JPTH 3QCUH 5A2CA 3A4AA 4B41A 2WM0A 4L4VB 4ES9A 5SWZA 4HIXL 2G5BA 4OGYL 5IZ7A 2NQ3A 2OAAA 1D6VL 3WFCL 1FNAA 2GJ6D 2MPVA 2XIIA 3POCA 4RISH 2WLJA 5CWSB 3IPEA 4PV9A 4Q6KA 1CIDA 1I1FB 4W4OC 1RZJL 3SKOA 1YC7A 3CDGB 4XHQA 4PQXA 4QRQA 4NO5B 5F6IB 1P53A 4WI4A 3F12B 4JDTH 5F7WC 4TLUA 1VPOL 4HK3N 3GZOA 4PR5B 4U1SB 5IWLA 3QEUB 4OZGF 4QKXB 5IMOB 1AG0A 3POHA 5BZDA 4FRWA 1BZQK 1FC1A 4N2KA 1QBMH 4FQ2H 3KPRD 1KBPA 2PCPB 2EDMA 3T71A 3DC0A 2CNZA 5I1KH 4JG9A 4GQ9H 5HSFA 5C3LD 1E8YA 3QWOA 4JJ5A 4AQOA 1HHJA 5DURD 4ZFZA 2YD5A 1A8JH 3HZYA 4QHKJ 5F7HA 1A14H 2IO5A 1BD2A 3PGFH 1QSFD 3NIDE 1NFIA 1ZHBB 3BVTA 2CD0A 3DOSA 3PQYE 4JFUA 3F84A 5AVUB 1RJYB 4V1DD 1H15A 4WWKC 3DRQB 4KQ3H 4UQCA 4WFGE 1E4WH 4XBGA 3G6JA 4JDVB 4XMTA 3BFOA 2L0DA 1VAHA 4XX1E 5EU3B 4LSTL 2VQTA 3K2KA 1EA9C 3VYOA 4NHUB 3D09A 5I9QC 3FAWA 5KSBB 1TZGL 4YNYA 4C4KO 4GKNB 4YXHL 2ZOTA 1GYCA 4PN6A 3AC0A 2IAAC 4XN4A 4DZBA 3U48A 4HG4J 5BZWA 1NAKL 2X4QB 3THML 3OD3A 3HBPA 2BERA 4Y5YB 3ZE0E 3PP3H 4LU5H 4W9DC 1FL3B 5E51A 1KTRL 5A6IA 4B7IA 1N19A 2J20A 3QEGL 2H6PA 4FI6A 2CJ3A 2JKSA 5AVYB 2GFBB 1I4FA 3QP3A 4R7VA 3HG4A 5E8NB 5GGSB 4XVJL 4CBZA 1ZWIA 1P1ZB 4XOEA 4D0CA 1I3GL 4G3YL 2LTQB 1H5BB 4F8QA 5I16B 4I77L 1NGPL 5T5FH 3EZJB 1WP6A 4Y4KD 5D6CA 1DZ0A 4UM9A 3E6HB 3D33A 5DDHA 1JHKL 3UTPE 4F7PB 1AGDA 3S3CB 1JPSL 8FABA 3O3AB 2Z7ZA 4FQXD 1FVEA 2DD8H 3DRTB 5EOTB 1NAMB 2X2UA 1QTYT 4UDUB 3WTWA 3IAPA 3H3KA 2XZAH 5CSGA 2HRHA 3GMLA 2HH0L 3IDIB 1MJ8L 4H8WC 1Z5LA 4LVHB 4XCCH 3KVDD 2RALA 4WY7L 4IU3A 1F41A 2OMUB 3SDXF 1WSST 4OD3H 1TTAA 3KW7A 3MACH 4K9JA 4WEBH 3QRGH 2ZUSA 4YSCA 5FO7B 1HHHA 2X0UA 2RQEA 2DI9A 3T4YA 1MEXL 3IFLH 2IPUK 1OD9A 3CUPB 5JXAL 5D72H 4QOKD 1A7BA 4DT2A 2QPUA 3HI1A 4NEHB 1M9WA 5CEZE 5E6ZA 2E86A 3IBOA 4Y19B 5D2NC 5LB1A 3TX4A 2NY1B 2Z91B 5IT2H 1UC6A 3HHMA 3VXUA 2OP4L 4MMXC 2VJ8A 2Y3AA 3TURA 5C0BA 1I8MA 1KXHA 3FO9B 3KJ4B 3CH1B 3CSYB 4MTMA 3FL7A 4X80L 4AH2A 5L9DL 2WZ0A 3QUYD 1YEKL 5E9DD 1EANA 3IDUA 3L17A 5HPMB 2OJZL 4R7DA 4KGLA 5K39B 1JZ2A 4PJCB 1CGYA 2ALWA 3C5JA 4JFPB 5AVVB 5HGBB 1BJ1H 3DBSA 3JV6A 3J8F7 1U8PB 5C09A 4OIIH 1PLAA 4NQEE 3RTQD 1E0OB 1U8HB 5CJOL 3BGFB 4WHDA 3ZYZA 4ODHL 2Q9OA 5DRZA 4QLRA 2F61A 4AG4L 4MX7B 1LTXA 3ASOB 3CMOH 3UTZA 2V0AA 3QK0A 4MX7A 1JZJA 4N6RA 1PS3A 3RPBA 1IU1A 5ALCH 2ZPKH 5HYJD 1NGQL 3RZCB 4TNWF 2FGZA 3L4UA 1RK0B 1TNMA 3C75A 3QQ4B 2OV0A 3UTSD 2LQRA 2VT0A 1ZJAA 3H8NA 3H7LA 1A7PH 3HB3D 4NN7C 2AXJA 5A2IH 3DJSA 3BKML 3I6SA 3O3EA 1HK6A 2AQRA 2N56A 2A74A 1ZLEA 2QGCA 4OAWB 2J1WA 4P5TB 4MNQA 2ED8A 4V2BA 1PL3A 2Z31B 5I15H 4M6ML 1EV2E 4K7PX 5JLZA 1N6QH 3U2JA 5DD1L 4OLWL 1F90H 3T0EA 2ICCA 2FJHB 2W9EL 1CTOA 2ZCZA 3L7EB 2HLAB 1OK0A 1J5HA 1YY9D 3OKLB 2P5ED 3BP6A 3QDGD 2LFEA 4YXKL 3U79A 4F33B 5LXVA 3QYMA 3Q06A 1FNHA 1G5GA 2XN9E 3KHOA 1KYOJ 1PKQA 3MV9D 1IKFL 1I7ZA 1E43A 2B16A 3BVNA 3QIUA 3WO4B 4CSSA 3DRTA 1RP8A 5EPMA 3ZE1B 3ZKXB 3UP1A 3VFPB 4P9ML 3A6CH 3F62A 1NUDA 4X6FA 5JQIB 3KDPB 1E42A 4Z76B 5JHMA 3HB3C 5DDHB 5FOBA 4EOWL 1W91A 3GI8L 3ZE0F 1G9MH 5CJXA 4LPCA 3HW7A 3O3BA 1ZT4B 3ZO0A 5AVQB 1VERA 1P1ZA 3DIDA 3OKEA 3NCMA 5CIPB 1TZ8A 5F97E 4Y4KA 2AVGA 3PRZA 3V5KA 4M43H 1B0GB 4YAQA 3DV6B 1FYTE 2R2HA 4XXDB 5FO2A 4U1IA 1LO4L 3KJ6H 1R3LA 1AZNA 4NO2B 3S4SG 3PJSA 3NK4A 1U33A 2X4QA 1TENA 4QF1A 4PY7A 1NMAL 4HLZG 3AG1B 1EMTH 3RB5A 1H9VA 4L8CA 1Q9OA 3A4EA 3WENA 3LNFA 1YHPA 2FD6L 2RCSH 4M93B 3AXHA 5D70H 3ZKMD 2NNFA 5DHMC 1BJ8A 1BMZA 1QSEB 3O2VH 4OLXL 1TJIH 4KTEH 1GAFL 3BAKA 3E2HB 1QLRB 2AK4B 4P2CG 5CIPH 5TDNB 5KSAA 1UB5A 1RZFH 2X89A 2E7DA 4TQEL 3O9WB 4KO5A 3NAAL 2BVQA 2DLHA 1UOKA 2EIZA 4Z95L 4OD1H 3RUGA 2FT7A 4OTXL 3F00A 3FKUS 2RGSA 4DGYH 1BJ1J 4YPGB 3WHE0 2M83A 1E6JL 2KT6A 1CFQB 4HIQA 4FG6C 3QR1A 2YAMA 1A9EA 1F18A 4D3CL 1JZ4A 2XA3A 4LCIL 4PRIB 4ZRGA 3K3QA 5J6SA 3HHRB 1HAWA 1B4RA 3ATFA 3D2UB 5F0JB 2ZX9A 25C8H 4P2AA 5DFAA 1OARL 5I6KA 5AKRA 2JLLA 4OLZH 4M7ZB 4AC4A 5LWYL 4JGMA 2IGTA 4OLVH 4ELKB 5IEKA 2IDUA 3C6LB 3WNMA 5HYSA 1P6AB 2ZSVA 3GBML 3NJMA 4PRPB 4Y5VC 4ZT1A 2OLDA 2L7UA 5ABZA 1HI6A 3SKOB 4UT9H 1QRNA 2WYIA 1PCXA 1NTDA 5I75C 5DZPA 2N7BA 5DQ9B 1DEEA 3RLSA 2GSGA 1MFEH 3CVDA 3BISA 2CRMA 1LDPH 3AU1B 2ZX8A 9CGTA 4KDWA 3MLZL 4G80A 4PG9B 3ZDYB 5MENE 4HETA 3IKCA 3UYRH 2H5UA 2ZCLL 5CUSL 2QLVB 3MV9A 5AL8A 5TF0A 2PPFA 5C2BL 1WFTA 3MA7A 2VDQB 1DEEB 4XAWL 4F9PC 2WWMC 3N85H 2ZG1A 1XGRB 3TONA 1AP2A 4MD4A 3FQUA 3H9HA 1A6AA 1MKFA 3I6LD 3AVEA 2H9GA 3LRLA 1IGCL 3KPPB 3FSVA 2VXQL 1CXLA 5MEOA 2RR3A 2YQ3A 5B21A 1OGSA 4GW5B 3QDJD 3U0TA 3VQLA 4RGNC 1KCVH 4YHOH 5DMIL 3ISWA 1ZPLA 1T83A 2NR6C 3G5XA 3W0WD 5J9PB 1EZUA 3M88A 5L4JA 3FCSB 4EJ1C 2A6KB 2DN7A 4QRUA 4GXVH 1FDLL 2WVVA 4PRIA 2DM3A 1U4EA 5D7EA 1AQKL 2AERT 4I18B 1CLZH 1AXSB 1V7NH 3WOVA 4ZK8A 3BP5A 1YPZB 1PPIA 1ZXKA 3IJEA 1U9KA 4G6JH 1HYSD 3ZDXB 2EILB 5TF1H 3HUJE 4YHZH 1UWEL 3CFBA 2FNBA 2Q86A 2YS4A 3VYPA 5BRZB 3GSNL 2R8SL 4HUXB 4LSRL 2WWMD 5E9NA 2GYSA 2AK4A 3PDDA 5TDNA 2X9WA 3VSUA 5E23A 3DJZA 5T8IA 5TE6H 1TYJA 3WTTA 1TEFA 5DXWA 5C08E 5KBKA 1T89C 4KROD 3N1PC 4V1DB 3KYKH 5FGSA 2FVNA 1LE5A 5FUOL 4NS0A 4PY7B 1OPGH 4AV4A 4RESB 3I3EA 1NZRA 1FGNH 4KO6A 4PJAE 5J6HA 1SY6A 4JPWH 2IQAA 5EEUA 2F53D 4WUUA 1RZJH 3U4EB 2V3DA 5EU6A 1WHOA 2JJTA 1SXNA 4AYID 2K9UA 1KPRA 1GKOA 1ECYA 4JDTL 4RBPK 5CIPA 2EXTA 3ZQWA 1KULA 3AACA 3WFDL 3V4PL 1WFIA 2P5WE 3QO1B 4K5OA 4YSRA 4AEFA 4D8OA 5K69A 4FQ2L 4KY1L 1MWAH 2C5DC 1X5ZA 3RY6A 1S9XA 3EDEA 4HK3J 2PW2A 3LS4H 4BZ1A 4FG6D 4S1QH 4ELME 1OALA 2P5PA 2HZHA 3GSXB 5GRUL 1OKEA 1X5GA 5KJRH 3HJEA 1PKQB 4H88L 2GABA 1F6AA 5IB4A 4DP2X 5JIQA 3BDYH 3EO0A 2DQIL 3BH4A 3CHXA 3PGCA 1YMMD 1E4WL 1RJLB 1TIUA 2EXYC 2IANB 4L3AA 2Z4QA 4QXGH 3V6ZA 4LSTH 3NG5A 5DMKB 1DQVA 4OZ4A 3C5ZD 4KQ4L 4K7PY 3BWUC 4PB0L 3KM1A 4XNMB 1OCWL 1TQVA 3PLYA 3QWRA 4U6VL 2EDFA 2AQNA 1EHNA 3VXQB 3FPXA 3MNVA 4N2CA 2BS71 2X0WA 1IJ9A 3E3QE 5KN5A 1CFVL 4RGMB 5HGDA 4HS8H 5DJXA 1T2XA 3V6OA 5HY9B 1GGIL 4JRLA 1BF5A 2X42A 4PRHA 1EX0A 3SKJH 4AJWA 5IV2B 3J27A 4F57H 3G9AB 4X7TB 3BWAA 3GSWB 3O11B 2WXFA 1DLHB 5EBWA 3W0WA 4RFNB 2LT9A 3REVA 5F8QC 4OI9A 4L8BA 4PHXA 4GSUA 1KCBA 1SOSA 4JKWA 4LLQB 3QDHA 5BQDA 4PAZA 3M7FB 3SO3C 1MH5B 1IB5A 3RIKA 2X70A 3SBRA 2LVCA 2OKMA 5J11B 1ZTXH 2HH0H 2JKNA 3H9SD 4PRAB 4C59B 3IAGC 2B0SL 3VFWB 1IBGL 1T21A 7FABH 4HGWA 4Y5XC 2F8IA 3LXAA 4MA7L 2FQGA 3V5DB 2QT6A 5IQ9B 1K5WA 4NQEB 2J8HA 4YXLH 3GK8H 4PTUA 3I50H 5D72L 1ZLWK 5FO7A 5F2FA 4TNWK 1MCIA 1ZA6A 4G7VL 3KG5A 5FCUL 2Y7QA 1ZVYA 4I3GA 3UJIH 1CI3M 1E3FA 3L4YA 4GRWF 5IB4B 3IDIA 4HQQH 1SBSL 2WUCL 3DK0A 4P46D 4QJ5B 2AJSH 1R5IB 5TGBA 3OB0K 5G5DA 1LEIB 1URIA 2A99A 2P49B 4E9XA 2PYEB 2SODB 5DD5L 4J3OC 1DVZA 4EQ2A 2X6MA 3QI9B 1XZ0A 3B9KA 4ODHH 5DD6A 1FN4A 2CALA 2NZ9C 3AREC 3SDYL 1LQBC 1IM3D 3BEWA 5D2LF 1T0PB 1ZWIB 5FYKL 5C0JB 1GGCL 1PBYA 1KPRB 4X98B 1AIFB 3MZTA 4FD0A 2R9HD 4TUOA 2QSCL 5FGCE 1DJHA 4D0BB 1A1MA 1A7NL 3G6JE 1OLZA 3HS8A 3RWJB 3CH8A 2ADFL 2ITCA 5JW5B 1S7WB 3G5ZB 1KLGA 2BY1A 2JKTM 2DJMA 3TBYB 3JWOL 3O4LA 3ARDC 2VM3A 3ZUNC 5IJKC 1XH1A 2KLSA 1X9RA 2BC4A 4J3SA 1CE6A 3U9PL 5J4MA 4JHAL 1RU9H 1YYMH 3ARDB 3RX7A 3VRJB 1ETZA 1OO2A 5DRNB 5E4OA 1GGUA 4PJDF 5IOPA 1F90L 3K4DA 4KI5F 4KZ0A 4ANXA 2XT1B 3MJ7B 4WI8A 4AQEA 4M9OA 1BREA 1AR1D 4XODA 4UILH 2AANA 4J3OG 3BJLA 3HG1B 4O02A 5GSRB 2VAJA 3HN8A 3K6FA 3WDHA 1TZAA 4QRRD 3KYMA 1LP9F 1D9KD 2X87A 4OQTA 3P11H 4PBWD 3OMNB 3R0MA 4PYGA 5D7IB 1I9EA 4ABQA 1WT5A 3ARBC 2D0FA 3A6CL 3D3VA 1E3XA 3K4AA 4Q2ZA 3SE9H 3MODL 3L81A 3GT6A 3FO2B 4EOWH 1FP5A 1G9ML 1QSED 1ZTXE 1WWCA 4CMHB 1NGXA 2IWKA 4R3SB 4Z5RA 1JV2B 2FLRT 3BAIA 1J8SA 3QEUA 1LD9A 2EVJA 1JV5B 1KB5B 1KNOA 2XXCB 1AGCA 4PP2A 1RMFL 4EUPH 4I0PC 1I53A 3CDGA 3FTXA 4LASL 1VKXB 3A0OA 1SJHA 1MCSA 1B6DA 4ZNCD 2E8ZA 2ZAGA 4KRPD 2YN3A 1KB5L 2NX5B 3KJ6L 4JZNB 3SD2A 1XXDC 3D6GA 4OJFH 3VFSA 2IADA 1INEL 1MCPH 1KYOK 4OCXL 3L4ZA 1EMTL 3EJRA 5HGHA 3EOYG 3CXDL 4M3HA 1D9KC 4PG9A 4RMVA 1FYTB 5I1GH 1NCAH 1MREL 4KUCD 4ZMZA 3MA9L 4U1LA 1DO6A 3VQMA 2AJZA 2ZX5A 1MPAH 3NSJA 2VDKH 5DHVA 2CJTA 4PYHA 4QRSB 4PUBH 3FUFA 4KK6D 2VXVL 4TRPH 2DIEA 1ACZA 4P2OB 1EEYB 3SDDB 2HFGH 4K5MA 4QHLA 5T1LA 4JGJA 4OTXH 4AGPA 1AXIB 4QD2E 4BCYA 5EU4B 4OQTL 4KNQA 4LEXH 5T1JA 3TJHC 1XGUA 5SWSA 4LEOA 4A6YA 4IRSD 1FZOB 4NJ9L 4R7NA 1MCJA 4L05A 1WBXA 4PWFA 2XPGA 4LCIH 3WLWD 2C9AA 4LQFH 5HHME 1BP3B 4HEPA 5BJTA 4HJUA 4FQHA 4TUKL 3FB7B 2XG4A 1I7UB 1W9XA 1MFBH 4KKZA 1GPOL 3F6IA 3T77A 3SDCC 4GUQA 4L1TA 4LMQI 5D1ZA 3GGWB 4F7MB 3LKQA 4DKEL 4H26A 4UT9L 3T2NH 3MV11 1YSOA 1TMCB 3DVFA 3SYOA 3DYPA 4DHLA 4IOFD 3EOTL 2YXWA 4LVOB 4IYKA 4UIMA 3FB7A 2LR4A 4LCYB 1CDUA 1H5BC 1UWXK 4WI3A 3IPBA 3BO8A 4FQQA 2JE8A 2LVEA 2AJUH 4H2CA 2LW3A 2H6OA 1NCBH 5DI8A 2EVIA 2CK0H 3DA0A 4W6WB 2I7OA 3NVQA 4XAWH 1NC2D 3MBEB 3M17B 3AWFA 3N85L 4GLRI 5B1BB 4KKCC 4CVXB 3QUXC 4PGCA 1MW3A 3H0TB 4LESA 4QT5B 5F9OL 1W2KT 1PZDA 1KBKA 4F7CA 1JNNL 3NJHA 3QUXB 3I6LE 2IAMB 1A4JB 3BOVA 1ID2A 1KTLB 5C0EB 1KCVL 4YHOL 4XB8A 5F71A 2XRAL 4HLZH 2VMCA 1ZSDA 3VXOB 1MJJB 5L8JB 2WJ5A 2GY7B 2J73A 5L4FA 4EEEA 4N0RA 3ZTEA 4XPHL 4RX4A 5LVEA 2CPCA 2XSKA 5AW6B 5HHXL 1N5YL 1G6RA 5JOPE 1CLZL 1V7NL 4FGMA 2WBXA 2FIKA 3SDXB 5I1AA 3KL0A 1NDMB 3GEFA 1DLFL 1F4WL 1USZA 2EO7A 2NX5A 5TTRA 3SGKA 2HFFB 5BS0B 3OZ9L 1UA3A 1ONQB 3IJHB 4PJGB 5JIKA 4X4KA 4NC2B 2EUXA 1M2VB 3GSNH 4U6HA 4JL2A 3JQOB 2NR6A 5KZCD 4G8GB 4ODSH 3I9IA 1IGYB 2ICEC 3CSTA 3K81A 4HEMA 4XP6H 2V5MA 4XXCC 1LD9B 3OAUL 2BINA 1EEZA 4KJWD 4X9GA 5DO2C 2WMPA 4NT6B 1P7KB 3F7VA 2V7HA 3BP4B 1CVSC 1FFRA 4PRHE 2FEDC 5FUOH 1WTLA 1JIBA 3GRGA 1QLFA 4WHTA 4HBCH 5I1DB 1BV8A 3EFDH 2D03L 4LK4A 3RPKA 3KYMB 3QR0A 5HYIA 3JTSA 2MWCA 1WWAX 4QKTA 4TTGA 1XB8A 3GMOA 3WEXA 3IDXL 1V3MA 2DI8A 4HYTB 5JIHA 3EFFA 2WLNA 2DF3A 1OM3H 4KX9A 4PJCE 2XV3A 3JT0A 3KYOB 1FIEA 3MJ7A 3AUWB 1QR4A 4AQEB 2Y06L 3EOAA 1M2OA 1RJZB 4Z7UF 3VI4F 2NPLX 1QRNE 5EEZA 1U8PA 4TOYH 1V3LA 2C3GA 2VUYA 4HW6A 5HPOA 3K1KC 3ZXAC 1J5IA 5GRUH 3QRBA 2VZVA 5K39A 3ARGA 4P5KA 1KLGB 5D4IA 1KPUA 1J5CA 2FAUA 2N0MA 3F58L 2ENJA 4Q0XH 2Y23A 5EH1A 4LOUD 1MF2L 1L0YA 6TAAA 1CMOA 2C3WA 5C0CB 5PAZA 4DUWA 1A9VA 3BUDA 3ZE2F 5KVDL 1X7SA 4ECNA 2ZD0A 4KQ4H 4XNBA 1A6WH 3CIAA 3T4YB 3FRUB 1P4IH 2NSQA 4M1GH 3FTGA 4GPVA 4XNUL 3SDDD 4FADA 2CRYA 3OV6A 4QHKI 3QI9A 4L29B 4OCSH 3I84A 1KLUB 3ARYA 1JF6A 1B0RA 4G6AC 5IW1A 1O6VA 1BEXA 3OQRA 3DTXB 1ZIBA 1ZA3B 1S8DA 2G9HB 5EOTA 2V2TB 3CCHB 1LEKB 1LO5A 1NGZB 1RK1B 1YN6A 1T1ZB 4AQZA 2NTFA 4DP1X 3HC0A 3TV3L 1KJMB 4MNGE 1XSOA 2DLEA 4M48L 2NW3A 4GRLB 1OW0C 4X7SH 1MFDL 3R06A 2NTSP 2YLKA 4G5ZL 3BPLC 4P57A 5CJXC 4ES8A 4MCYB 1O6SA 1MJUH 5IF0A 2ZYIA 1VADA 3TJEH 2VUOA 5E5MA 4ZMAT 2H6PB 4XB7A 2R29L 4M7KL 2DKMA 3ZKSD 2VDPL 3ZHFA 5CEZD 2GT9B 3T1WA 1MLBA 4HF5L 4BM7A 1FL3A 2WXLA 3OKNB 4IBYA 4PHZA 4PFEA 1MAKA 4ZO9A 5D96C 3VXPA 1XGPA 3HE6C 5DS8A 3ARGB 4P5KB 4P4KC 2YUXA 4BQ6A 2BOLA 4FTVE 5SX4I 2DQGH 1IAOB 1LJMA 1L9MA 5KBDA 5DLMH 1IBGH 3FB5B 2P26A 2WW8A 2R0WH 2H32B 4UOW0 1JVLA 3T09A 4FLHA 4MWFB 2GB2A 1K9TA 3CVCA 2BRRH 4LLYA 3SYPA 3VFGH 3QJTB 3N41B 3PWPA 1A4BA 4F2FA 2NYYC 4H4NA 4XBGB 2CAKA 1T7ZA 3ARED 5EBMB 2WXJA 1CGWA 3B7UX 1E2WA 1NBVL 5KSVA 4MQ7A 1SBSH 5ENWA 3WBDA 3PNRB 2VAAA 3QXUA 3T3PF 2UY7B 2L04A 4NRYA 2FTAA 2PWHA 4NBYB 1LWHA 3HI6H 2P45B 3E7JA 3J2PA 3BQUB 1G9EA 4Z18A 2B5IB 4AYMC 1GY2A 2CA3A 1FV1A 2EDXA 4LSUH 1EEZB 4IS6A 1TTBA 4ZO6A 4UQIM 3SDYH 1HHKA 2QMJA 3BSGA 3FHQA 2K1MA 3GNML 5LXGH 1GGCH 2QV4A 4M1CC 4N68A 2BVOA 4NHCL 2OR7A 2EDQA 5GS2H 1S78C 4RMQA 3BZ4B 1ONQA 4A7SA 3D3VE 5KUKA 3PCYA 4GO8A 3O4OC 1LWRA 3WKYA 3O3UN 3ULUE 1NUFA 3JWOH 1CL7L 4JAMA 4YBHA 1PG7L 3NPSC 3MXWH 4MJID 3Q1SL 1JWUA 4YDMA 4KY2A 5KJ4A 3SEPA 5JIMA 3QQNA 4MD0A 4Z7VE 4A39A 2K3TA 5BZXA 2VWEE 2B7DT 2R1WA 2EXWC 2OMVA 5C0EA 1FGVH 3NGBC 3QO1A 5DHVH 4GAAA 5ES4B 3MOBL 4P2QD 2MKLC 4A7VA 1FFQA 3G6DH 4L9LA 4I0KA 3K2UH 1GW6A 1EO5A 1U42A 3H2QA 1KJ2L 3BVVA 4PI0A 2Z0BA 4PVLA 4Q56A 2IF7A 3F6LA 4JO1L 3BRDA 1INQA 5IJKA 1KEML 4MQXC 3S37L 1F11A 1KTDA 1KTBA 2Y22A 1CO1A 2WBKA 4JMXA 3IJ9A 3GMMA 2O5XH 1XB3A 3QJRB 4HWBA 1YNTA 3RILA 1QG3A 5AOKA 4BBWA 1DFXA 4JFXA 4GMTL 2MEJB 3TASA 4ZSOA 1DL7H 3GM0A 4PJ9B 5DYOB 3WE1A 4BWWA 2BRQA 4C55A 2JI1A 5I1EL 4HGMA 5EO0B 3U0WL 2B9AA 1DSWA 3PGDA 3T6VA 2VDMH 3OTTA 1SXBA 1D5RA 1MRFH 3OZLA 1QKZH 3E80A 2XQYA 4Y19D 3MMEB 3VD9A 5D2NB 5JYMA 3GGWA 3OXRA 4UQ9A 4P04A 4PMEA 1ORSA 3CFKA 3ZDZE 1U41A 4G9FD 1RUAH 3NIFF 1EERB 2Q8AH 2Q76B 4I0PA 2OM5A 1BVZA 2JWYA 3QVAA 5EZPA 2KZ1B 5I6NA 1FLTX 5I0YA 4ANWA 4GQPH 1GIGH 3UIZA 4UOQA 2ICWA 2B3IA 3PP4H 5HHVH 1Z0MA 2N7SA 5LNDA 3QZLA 4DGUA 3FBKA 1DE4B 2BHYA 2YAPA 1ZHKB 3RWHA 3M1OA 3MA9H 3FU5A 1ZGLB 1R47A 3BVUA 3MLRH 1L9RA 4AIEA 5ABDE 5CN3A 4WSGA 3FU3A 4E5XB 2ERJC 3RHWK 3CHOA 4HG4K 3TA4D 4Y16A 1JPFA 3BX7C 3MRHA 2AQ3A 4LHUD 4RQQA 4YWGL 4G9FE 3ULSA 4ZI8A 2IWFA 2VDQH 1D5IH 3NCJH 2I69A 4LEXL 3B6SB 2QQKL 4PCKA 3O2DH 4YE0A 3P3UA 4XHJD 5GRJH 5JHDE 4RGMC 4U1LB 2RIKA 2EIJB 1R3IH 5H37A 2ARJB 1FHNA 2CRIA 2YSSA 2F54E 3IKCB 4LQFL 1G7MB 4G8EA 4MAYC 1RULH 2DICA 3VAEA 1FO0B 3CU1A 1QACA 4OZHF 2HVKB 1S6NA 3CE1A 4HJGB 4OCWH 5BO1H 5KYXA 4GAGH 2R2BA 3HI5H 1IE5A 2IDSA 3BZ4A 1SJHB 4QUOA 3RL2A 1NFKA 3W9DA 4Y4HD 43C9B 4PREA 1MVYA 2A9AA 3MOQA 2AGJL 3QCTL 4KAQH 4ZFFA 2BVEA 4ZX4A 3A24A 5IFAH 3EOTH 1JGEA 2IMNA 1UM6H 1EAJA 4ZQKA 4CU7A 3WEBA 4PJGE 4F3FB 2FX7L 3QUKA 1NCDH 2EIDA 2OXGB 5IB2B 5GRXG 3Q8BA 2DEWX 4YHIA 2NDFA 2BWQA 4YSPA 5KW9L 3F05A 2XQYK 1R5VA 2AJUL 2NOYA 3OSVA 4LDEB 4AENB 1ES0A 3B2UC 4K9EH 4I87A 3HG5A 1RLBA 2O5ZL 1E2ZA 4FQCH 5BS0D 1MFCH 4TNFA 5ENWB 1RJCA 2KC0A 3GSUA 3WI9A 1BGXL 1A6UL 2C9PA 4YBLB 4Z7VF 4UUJA 3TVMB 5F9OH 2F1EA 2XTLA 1JNNH 2YBGA 5F96L 4DF9A 5LAPA 4LLYB 3KWWB 2EVHA 3CNKA 4Y2DD 3O41B 1JI2A 1G6RL 4AYBA 1FFTB 3V0DA 1BWWA 3EBIA 1CE1L 4NOBA 4ZPTB 5INCA 5ISZB 5SV3A 4XPHH 1N64L 3BCDA 4G6KL 1RUKH 5I71B 1LO0H 4L3CA 4A2DA 2NNAA 1CR9H 4R96B 1L9NA 4OB5H 5C0AD 2UXFA 3WXVH 1ZT1B 1JP5A 1QASA 1AZBA 3VI3E 3L1OH 1ZSHA 3OZ9H 4FXGA 4PJ7A 4XP5H 1H3PL 3TH3T 4IIQC 3T5WA 3UZQB 5GIRA 4FFZL 2NMSA 4WDIB 1NFDE 3NZHH 1URZA 5LBSL 1AIFA 3EH4B 5IQ7H 4AGMA 5KSBF 5E70A 3V52H 1BQHB 5GPRA 1KIUA 1F02I 2Y25A 5C0BD 4QRRE 1TU2A 5JXEA 4IJ3C 5D55A 1ZRUA 3ZTDC 3L3JB 2NW3B 3P4OB 3DNKA 4UWQB 4GSQA 1SNRA 1GYUA 3HTLX 3NSDA 4KMTH 4RSYA 3HZ3A 1QTPA 5IMLB 2N1TE 2KZKA 4OFIA 3NMEA 5JDJA 4Q9QH 3CSFA 1T1ZA 3P30H 4HIIB 1E50A 1S8DB 2G9HA 2F7RA 4JHBA 1CGSH 1CWVA 3RWCB 4TLTA 2VC2H 2VIRA 1KXQA 1LVEA 2BVPA 4LCWB 4LPXA 1UD5A 5DWPA 3IDMB 3HG0A 4AM0Q 4CUCA 4ESKA 1JZIA 3OWRA 1EXUA 1GOGA 4X6DE 1W8EA 1OOWA 2JB6B 3IMSA 1FZMA 3FTGB 4BFIA 4FQPA 3HUJA 1DP0A 3FRUA 4NAMA 4OZIA 1ILUA 3WY4A 3EDDA 2GQHA 2ZF8A 3O4OB 4A6YL 5C09E 1RHFA 5D7JC 3BSZL 4FHJA 3AS3A 1J48A 4WGWB 2HLFD 2AFNA 3OHXC 1ZS2A 4AE1A 3CC5A 2YO3A 2Y7LA 2IWEA 1F3JB 4F37F 1UWGH 1J8KA 1PSKL 3KPLA 5TK4A 1KIPB 3F58H 3LB6C 5ALBL 4W4OA 1RZGA 1SQ2N 2ICWJ 3QZWG 4M6NL 4S1SL 4DP5X 1QO3A 4YHMH 3AITA 3GS7A 3VO0A 1FNGB 5D7LA 2PF6A 1RJZA 3UO8B 2MNUA 3W0WB 3WAJA 3LQAC 3O11A 5J3HD 1TG8A 3WCYA 4JFEE 4EIZC 1BQSA 2XWEA 5C08B 3MV7B 1M71A 1LP9B 3B2MA 5DJ8A 3V6OC 1XEUA 2XN9B 5C09B 4KXZH 4FYTA 4BRJA 5I0DA 4J3BA 5HGBA 2JCCE 4PJ9C 3B4NA 5MERB 1PFOA 3DHPA 2H7WA 1XHHA 2WN3A 1HILB 3GJFB 1K8DB 2YQGA 3CH1A 4RGOH 2LABA 4NKMA 4FQXC 5KN5B 4G42A 1HWGB 2CMRL 5KVEE 4LLMB 3NJJA 3FU0A 4F15B 1G9NC 1D7BA 3V7AE 3IDGB 1WGVA 1XMEB 5TE7H 2L8AA 2PXYB 3VGGA 2WBJC 4OF6A 1XL4A 4NO3A 3BUYA 1HL5A 4X7SL 1MFDH 1MI5D 3HEIB 3IETA 1OSZA 2Q3AA 2AV7A 1F58L 1NAML 2VR9A 1XTMA 4NIYE 2HAZA 2O5YL 3ZYJA 5DU7A 2EDLA 3FQRB 5C70A 1ZIAA 3E1ZA 4J3UA 5I5JA 5KVGL 4A2EA 4AIXA 5C07B 5AW8B 1XD0A 4PU2A 2EYTA 2JCCB 3QHZH 3MUJA 1CDYA 1MHPL 4Z7WF 3KPSD 5E2JA 3HE7D 3MV8A 3P1VA 2C3VB 3MRFA 1NDGB 2Y69B 3ZPDA 5BCAA 1MRCL 2EEDA 3RPIA 5FS5A 3FTSA 4FN0A 3SE3C 4UM9B 5CBAA 4LOFA 2A6JA 2J6WA 2QQQA 3QDMA 2ZXWB 1OD7A 4HIEA 3S3JA 1KTLA 4LLDB 5E6ID 3P69A 1M3IA 2RTTA 4KITB 1W16A 3ABKB 4QT5A 4F7CB 2X2HA 1DDHA 1G7JA 2VMDA 5G4OA 5F1NA 5AW4B 2HJLA 3WJJC 3ZR6A 2CBOA 1UB6B 3K1DA 3FQTB 3KWXA 3KPRE 2WBJD 2VL5B 1WICA 4ETYA 4U1KA 4JPSA 5CAYB 3CLEH 4GSDH 4F15C 4HIJB 5BUGA 4MJ5B 5JW3L 3NSXA 1K4DA 1LE5B 4H2AA 5FWQA 4XP4L 4V1DA 4BA8A 4Y4KC 2QVTA 5T5FA 2V3FA 3BAEH 3OSKA 1KB9J 1JXKA 1V8HA 4DJMA 2YKLL 1SYVA 4XPAL 1SVCP 4Z7VB 2VTFA 5BV7L 4BUHA 1E9OB 1TJGL 3H4HA 3QDJE 4KUZH 4P9HH 3WJLA 3DYOA 4BQCA 2X4TB 3HN3A 2TRHA 4U33A 1ORSB 3CFKB 3UTSB 4NHCH 4P3CL 4GUPA 3G6JB 4JDVA 3S5YA 4GP4B 2DQDH 2LOEA 2DQTL 3QIBC 5FHAL 2ESVA 2O26U 1XGQA 5GZOC 3WE6B 5EO0A 4KU1A 4EKJA 3HZYB 1CL7H 1S9KC 3GZPA 2G3XA 3O2WH 3NCFB 1T20A 1TTUA 4AQ1B 4D2NA 3WIHA 5FB8A 1T03H 2H1XA 3GMMB 1LILA 2A6KA 4F8NA 1MW1A 4R26H 1N8ZB 1S46A 5IMOA 4X5WA 4NP4H 1B2YA 3ASNB 4L8DB 3GSQA 4L3ED 3II1A 4GOSA 4K0OA 2YA0A 3QHFL 3AMLA 3KH3A 3RL1A 3CJJA 3MRMB 4NQCD 3VX1A 4DN3L 5J56B 2MQCA 1Q9KB 2CLZA 1KEMH 3O3DB 4HWBH 4QRPA 5D1QA 3K71A 3KPQA 4OIBA 1CI5A 2AJXH 1EAPA 4J3OF 3Q7JA 1EVTC 3S37X 4Z7QB 1G0XA 2O5XL 3MRDB 4P4RB 4JR9L 4C83A 5D1XE 4N0FA 2F54D 2ZYSA 5E4IA 1R0AH 4FQ1L 3D4YA 3WIFB 2XWZA 4L4VA 4L9LC 4NPKA 4FA6A 3IB4A 2A1WH 4J1UA 4M3JA 4XB3A 4OGAC 3ORJA 2HRLA 5E1HB 2ISDA 3MRMA 3TBVA 3UC0H 2FO4B 2XYCA 2HVJA 4WW1B 2RA1A 3TBCA 1FL6B 3GLZA 3KH4A 1AGCB 1E65A 3N91A 1UFUA 2VXTH 4L8DA 4ELKA 2Z1KA 2MRYA 5D8JL 5AZ2L 1KYDA 2XG5A 5M7QA 5D96B 4ZAKA 1A2YA 2E9WA 2P42B 3FO2A 3QA3A 4IBTA 5C7ZA 2LU5A 4RETB 3VXUE 3OGOE 4WUKH 3BT0A 3W39B 6PCYA 4L2YA 1ERNA 3I6KA 4XMWA 2DQHH 1RZPA 5AW9B 5IMKA 1COBA 3PNWB 3RIAK 1QR1B 5AW2B 4HIHB 4HWNA 1VFBA 2DEYX 3EJTA 5L6YH 2K6YA 4HBQA 2X6VA 3KDMB 1P5UC 4YWGH 1QMUA 4WFFE 1OP5K 2X4UB 4GMSH 5FGRA 5IFJB 4G43A 1OP9A 1KLFA 1AKJA 4LPVA 4EAEA 5D7IE 3VTMA 4BKTC 3BEVB 4GIPD 2X05A 4B5ZA 1SYVB 3AQZA 4JO2H 4MWFA 4CDHA 1ZLVH 2WWKT 3QW9A 1SHXA 5CN2A 5K1VA 5E6IA 3RFZC 3TCXA 4N2AA 3LKOA 4HDIB 3VXMD 1IAOA 2G3NA 4HOZA 2CGRH 2PMZA 5FK9B 2V2XA 2UWEA 4DW2H 4HIJA 1BZ7A 4BZ2A 1XGPB 3VWKB 3G5ZA 3D85D 2W9LA 5AFAA 3MJ8B 3DKHA 1D6EA 1MLBB 5BRZE 1A1MB 3RVWD 3V5KB 4PG2A 4N0YL 3TVMC 4AL8C 2HJLB 2XWXA 1FBIL 3D5OF 5E5MB 1J8HD 4OT1L 1DDHB 4XVSL 2AEOA 5F9AC 5ELIA 4X6EB 1A5FH 4BSWB 4FFYA 5BV7C 2YHGA 4I3SH 2P8PA 1H0DB 4IOIB 4E42A 2K9FB 5KBPA 2WNXA 4IOSA 1T4KB 2WO3B 2Z7YA 4QNPE 4LDOB 1XEDA 2J1XA 3EADA 4Z3JA 4PWKA 5DZLA 1NKGA 3NEOA 4JG0H 5TGBB 4PJCF 2R0KL 3UBXG 5FFLA 2VLKB 4YDJA 3UTTD 4FTVA 3P3RA 1I7ZB 3FN0L 1JK8B 1MFCL 3ZUCA 3OLDA 3RI5K 1CG9A 1XGTA 4IIQB 2I9TA 2GJ6B 3D25A 4NO0A 3W37A 3UAJD 3DBXA 1A47A 1TR7A 2IOMA 1CF1A 5DRXA 5F7AA 1AOHA 4I18C 3NEXA 4WENB 3SOBL 5ETUA 4NOFA 3DI3B 4HV8B 4UMSA 3K7UA 3LEVH 3U6RA 3KCPA 4Y4HC 4QYAA 4DAGL 5IQ9A 1FYTD 1CFTB 1KXVC 5EDSA 4MKTA 4XMUA 4MNQB 1T21B 4OAWA 4M8QA 1IKNA 4YSQA 2ZX7A 3CN4A 5CJBA 3WFCH 4E0RB 2G60H 3NQKA 4MQTB 4AIZA 1YMHB 3WXVL 5KSBE 5LGJB 3EO1A 1XGYL 1SYSA 4NUQA 4RISL 3MNWA 4ZZFA 3IN2A 1AD9B 1L9QA 3P2BA 3MSPA 3RZCA 3B5TA 1EZLA 5EBWB 3EOAB 2LHAA 3RDJA 1Q8MA 1H6TA 4LMQE 3UTZB 4FLQA 2EUVA 2RH0A 5CSZA 2EDDA 3EG9B 5AD0B 5EF0A 4GW4A 2OSYA 1C12A 4PRHB 3FW6A 3O6FA 5H2BA 5SX5H 2GEQA 3CBKB 4PB9L 1DVXA 3OL2A 1PJ9A 5EU7E 1N68A 3JV6B 3ARRA 4HJSA 1NOFA 1YNLL 2ZYRA 4MNQE 4Q9QL 5ID0A 2BSDA 3MNWB 1FRGH 3MLWL 2ZJSH 4UQAA 3KPLB 3D12B 2R2EB 5EN2A 1I9IH 3N43F 4RFOL 1DQML 4WI7A 1HZHH 1NWOA 1LE9B 4AE0A 2C7FA 3DVGB 5IVOA 3QZNA 1WT5C 5IHHA 3QORD 3US1A 1CFTA 5ICZA 1KF9B 1FVDA 2VW7A 4L3FA 1J9QA 7PAZA 3FHEA 2IPUG 3MXVL 4I48A 5CHNA 2OTUB 1JFHA 3U6RB 2K7QA 4BFIB 4WNSA 1G87A 1XQ4A 2W88A 3LQAL 4L0YA 3GMPB 2DM4A 3HAEB 3NGBB 3IVKA 3VMPA 4KKCD 2GJ6A 1GS7A 4G1MA 1RVFL 4P5TC 1NDMA 4WWKA 4JCMA 3ECBA 2VLKA 4YDJB 3PAYA 4LU5L 3MTXA 1E4JA 3UBXB 4HS6B 4WZ9A 2QQNL 3TH4T 4YDVA 3TJHD 1S9XB 5GGTL 4PJ5D 5LN8A 3LKSB 1I3GH 3DURA 2FJGB 4G3YH 3RJDA 1W72H 5A3ID 5D6DA 3KLQA 1A4JA 3BAXA 4NQVA 1HHIB 2FUQA 4MDIA 3L6FA 4OZIF 1BYNA 3BGFC 5GIRB 1HQRB 4WVRA 1MRDL 4CC4C 4N8VB 1AZRA 3WUWB 3FTZA 3UGXA 1A22B 1WBZB 1WDAA 2CDEB 2BZ7A 3D39D 3B9KC 3L3HB 3T2LA 2UWEB 4D9RD 4NERA 1JGDA 4LSVH 4M5YH 2PP9A 5FF6B 3VFNB 2RBLA 3L7FB 4OD3L 4UM9D 5KTEL 3AY2A 1P69B 3QRGL 2A5UA 2EE9A 5FHBL 3HC4L 1F58H 1ZLUH 4AQ1C 3CBJB 3FB6A 1E5BA 4K7PL 4LHQB 3IFLL 3NZ8A 2O5YH 2O6FA 3BDBA 1KJVA 4NQDE 2KYIA 4LRIA 5L8KB 1SEBB 2FR4B 5BRZA 3G5VB 2ZP9A 5JMOC 4LARL 3JVGA 1TTGA 4UQ3A 3ZKNC 4PJXF 5L88H 3WO4C 1OQOA 4Y2LA 1SMAA 1AE6L 4PLNC 3QDJB 3IJEB 4HA1A 4N2OA 2WGNB 1YPZA 3PNWA 4MYWB 4WFEE 1QR1A 1XMWA 1NFDF 3I6KB 1L7TL 4I18A 4Y9GA 5A6MA 5IMKB 4EQ3A 2IQ9H 4JJ5B 1IRAY 4FQJL 2Z35A 3MQIA 4F7EA 3FSZA 4CC4A 3T1FA 3RDTC 4BD4A 2QSTA 4ZXBA 2F7PA 4OIIL 1QYGL 1WTGT 4M9PA 4NX0A 4W9HC 3VGFA 2WP3T 4MD5B 2WYHA 4R83A 1L0XA 2WQ8A 3O4LE 1C5CL 4RAUB 3V0AC 3CMOL 3A3YB 3M1BB 1ASPA 2B59B 1W8OA 3VM7A 4QRQB 4ALAL 3BKJL 1C8QA 1D7FA 5T5NG 3SDAA 1U8NB 2JH2A 1A6AB 4AUYA 2K6ZA 4XMLH 2BJMH 2QGBA 2XNAA 1RZJC 3OAZK 1A7PL 1AKPA 3LS5H 3R7RA 2XC8A 4GSDL 3WG7B 4FFTA 5FDWA 1T7VA 3DTDA 5JUEH 2F19H 2E7LA 1HDMA 3WS6C 2YIHA 4AGLA 3WFBH 4M6MH 2J8UF 3ESOA 5C2UB 2X4SB 4PI2A 4GP5B 4XPAH 1KCRL 1FPTH 5BV7H 5D1QB 3QJSB 4KUZL 3V55A 2XNAB 5E03A 2IDCA 4Y1AD 1YY8B 2CO1A 2HT4D 4FJZA 4FKKA 1U8NA 2JJUA 2KMWA 3OF6A 4X83A 5E1AA 3RL1B 3UJJL 3VD7A 4TNVK 2DWXA 3V8CA 2KHAA 1UACH 1QI4A 5CZKA 2ZSVB 5JO5B 2CBQA 1PX4A 5DSCA 5BVJB 3P9WB 4EIUA 1JV5A 1EHLL 2BIMA 1E6OL 3LX9A 2OMNA 2H45A 3NIGB 5GGTA 2F68X 4W68A 2D7NA 4MXQD 4DOHB 2P7TA 4BFOA 5JOFA 4R0LB 2J2ZA 1AGEA 3KM2A 4XXCA 3N55A 4YHKH 1HX0A 3S36L 1FIGH 4N90D 5I6LA 1G4MA 4MSWB 3QC5X 2CRZA 2YD3A 3EFOB 4PJFA 2QPEB 4IRJA 5EU7C 2X2JA 1YJDC 3QIUD 4PJDB 2QZQA 4WO0A 4WU7A 2VR7A 2X88A 4HIPA 4JM0A 3U82B 1SEBA 2Q8BH 3UTSA 3QHFH 4AKPA 2FR4A 1FG9C 3O9WA 1YNKH 2EDNA 2CK2A 1I31A 4MMYB 5E56A 1DQLH 5CFAA 5BMFL 3L2MA 2ZT9C 5IOPB 3DV4B 4QAMB 2RHEA 4K7FA 3U7YH 2XN2A 3FCTB 3SHSA 3P3SA 2PCXA 1UXMA 2AEWA 3T65A 1PIFA 2OSXA 4K5PA 5EO1A 4PJAF 2XDHA 3GMNB 4U1KB 4ZTEA 3SE6A 4ODXB 2ZCHH 1GAFH 1WBZA 3D2UD 4XBEH 4Y16C 3S8GB 4LGSB 3DUUB 5D2NE 2GUOB 2NW2A 5SX4H 1B0GA 3MC0A 4D0BA 4OZFA 4Z7AA 1RV6X 1I8IB 1NL0H 4Z95H 5F0MB 1IKOP 2ZUQC 5F1NB 1WIPA 2BNRE 4FHBD 4MDIB 1HCZA 3FFOA 5CGMA 4KJQC 4ZTOH 4NQVB 5LGKA 3PWUA 4NQDD 1ZLSH 3RUGF 1FN4B 4J12A 2D73A 3H53A 1OF2A 2OR8A 1XTLA 5F1IA 4E9WA 2WWNA 5J1AA 5C0IB 2GUYA 1JWUB 2ZUTA 4BFJA 5DK2A 5I76B 3UG3A 3PUCA 1CICA 1JG9A 4FXKB 3OAYH 1RUMH 1AOZA 3FB8B 1Q1PA 1CCZA 4YDKH 3VJ6B 2WANA 4FCHA 4F7TA 5CF3A 3BW9B 1BXXA 4KHTL 3G08B 3PWJB 1DHKA 1MVFA 2Y7QB 4LSPL 1MXDA 2X1QA 3X1BA 1F5WA 3GMPA 3BUTA 5HDRA 2E9IA 2EACA 3ZK0A 1QWHA 1G7IB 5E4EB 1UD3A 1HHKB 3VFMB 1CYXA 5JHDB 4OKDA 5EOQH 5DF0A 1FVCA 2IV9A 3W11C 1INDH 1JNLL 3V4UH 4E2OA 1M7UA 2ED7A 5FGBA 3GSOA 3UYRL 3VFWA 5DA0B 2ZCLH 5CCHE 3INUH 4XNQA 4DW2L 4XAKD 5C2BH 2X3CA 1VENA 1T0MA 1B0IA 4TQHA 3BZEA 3LQZA 3VQ2C 1REIA 4LLQA 3RAJH 4G8AC 4HKZB 4OUOA 5HDWA 3SB3A 4MQ7B 4ZW8A 1KCWA 3JUYA 1BQUA 1T0OA 2UXTA 3ZL4H 3DJ9A 4FXLA 3MBWA 5HDBB 3EHBC 2Y5TB 3S5LA 3A67H 5FEBA 2UV3A 1GJUA 2VLRA 5J3HC 2H1LM 4H8VA 4JFSA 4XCYA 1HSBB 3EYOB 2ENSA 4KNTA 5AW5B 1QO3B 4GRMA 3QULA 4Y89A 5ICXA 1AANA 2IBZX 2VMFA 4FFWD 4JG0L 4XVUC 3ZZQA 1U8KB 2R0KH 2JXMB 3OPUA 3DMMC 5EUKB 2JKRM 3FO9A 2VW6A 2DM2A 3WLWC 1IGMH 2MKWA 4L37A 2P80A 1S4IA 3CC5B 3HNTL 5FW8A 1AHWB 1WUNT 4YR6A 5T3ZH 2FJFA 2IDTA 2NXZD 3C2AL 3HZVA 4M7JL 3SOBH 4H5SB 1SJEB 2LLGA 1PU0A 2VDOB 1NUGA 5BRPA 1B90A 5D7LD 3BD4A 2HKAA 3RX8A 1XH3B 2VLLA 4TLSA 4K73A 4D9LH 4DAGH 2J57A 1FZMB 1U8LA 3LDBC 3RE0A 5ETUB 5GRVL 4L4TD 2K45A 3RGVC 4MBOA 4ZMPA 4PW3A 1UUSA 3STZB 1OCCB 2V17L 1H8OA 1HSAA 1TSHA 1XCWA 3HRZA 2I9TB 2VIRB 3FUJA 1DVYA 1ZEAH 2H0PA 3MYJA 2DI7A 4PJEB 1RPQA 4IRSA 5T1KD 4FTVB 4NZUL 4HIIA 3R8QA 1NGZA 1RK1A 3D7PA 5HYQB 1CZ8L 1MZZA 4EXKA 3BZ5A 1FNEB 1RFDL 2YRZA 4JG5A 3T6QC 5J12B 4WFGD 4DGVL 3E6HA 2RACA 5EZOL 5IJCC 2BWDA 2CQVA 2FQFA 3O81A 4R5TA 4IOIA 1KV3A 4GAJH 1J1XH 3V4VB 4X2UA 3NRPA 2DIAA 2CE6A 5I1JL 3GB7A 1OTUC 4ENED 4YS4A 1RY7B 1NOLA 4N9GA 2X40A 4FABL 1KCSH 3N0AA 4JN2B 4J6IA 4ONOA 4NPYA 2VLRE 3O9WC 3SYCA 2O6DA 1YNLH 2YUWA 1W0VB 3GBNH 3HMWL 5J6HB 4WGKA 2QKIB 4YGVB 3TZVD 5C0AE 4JRXB 4FX5A 1DQMH 2V2XB 2Y3NA 1K6QL 3OG4B 3BDYL 5F7LB 1XR8A 3PL6A 1CLYH 4L48A 32C2B 3BT2L 5INCB 3IF1B 4YNYB 3D9AH 4HOXA 4YO0A 2CKBA 2F53B 2CKBH 1PKQE 3HOGA 3MXVH 1D5XA 1ROWA 1TTFA 2DDQL 5EU5A 1MCRA 4IKJA 5EU3A 4ENZA 5BW7C 1Z3RA 1F8TH 3D85B 4M29A 2X4UA 2W0PA 2YWZA 1OCZB 4GS7B 1J1PH 3KDMA 3WIIH 3CQFA 3PP3K 4P2OD 3A6BL 4JBSA 4IM8A 1A4KA 2ZWNA 4OI7A 1YG9A 1DANU 3V4LA 1WC7B 5INDB 4HS8L 3ZE2E 2NZIA 5FLVA 3F01A 2A38A 5EB9A 2C1OB 2EQDA 1E5YA 3INOA 3VXUD 4EI5A 2DQJL 4N0UB 2OQJB 2AEQL 4PTTA 4RGNE 1IEAA 4Z8FH 4GG8B 2WTOA 3FCSA 3L3OB 2GKIA 2PCPA 4N8UA 3IKKA 3QUMH 3IEAA 4NT6A 4RFEA 2VMEA 3DPBA 4AMKL 4F57L 1YY9C 3QJHA 5DZ9A 3U1SH 2VLKD 3ZIMA 3ZHKA 4KK8C 1DJSA 2H9GB 3LZFH 3PAZA 2Q7YB 2N3JA 1JHTB 3FQUB 2ATPA 4J1UB 4AM0A 2HFFA 4MS8D 4PCSA 3NZUA 2ZXDA 3Q8CA 5G4MA 5LN4A 5CM1A 5SWSE 2WXNA 3HN5A 4LSVL 1TCRB 1GY1A 1IGFL 5HXMA 1BLNA 4N0FB 3RY5A 3G5YA 4DNLA 1VESA 5FHBH 4JPKL 3HC4H 2Q2EB 4K23L 3Q1EA 2DIBA 2NY4B 1MJJA 5FCSH 4DP9X 5F88A 4QRPB 4R2GC 4NUJB 2CO4A 3QR2A 2KBGA 2QADC 2WLIB 4WSJA 5E99L 3QUXA 3CXHJ 3BHBB 1RZ8B 1HIMH 1JWMB 1ZGLP 2HUHA 4UNVA 6FABH 1EPFA 4K8RH 2PW1A 2WNWA 4HQQL 1NJ9A 5B1KA 4NRZA 2OTPA 2WUCH 1NMBH 3OKDA 4E5XA 4X6BA 2Y5QA 3GHBL 2BX5A 3CV5A 3N44F 4HUUB 4Y5XA 2YQBA 5D1QD 1WH0A 2EC9U 2FNWA 5E8DL 5IK3A 1EZVX 1P5UA 2WYTA 4AQ1A 2VN4A 4RWHA 3BI9X 2WKOA 2ICWB 1E4XI 3BDXA 3ABLB 1IM9D 5AVWB 3H9SB 3F5WA 4YQXL 5AAWC 1C5CH 4UCFA 2YD4A 2J1KA 1RZKH 3R7QA 3T4AC 3VB9A 1HH6B 4KHXH 3S5ZA 4HWZA 5AVXB 2VRQA 2UZXA 4Z3TA 4ZMYA 3EHBD 5TQ0L 3X2QB 3SD5A 1A7NH 5I8OH 5D7JB 3CD4A 2WINA 2ADFH 3FPYA 4L4TB 4TV3A 4WJG3 1JZEA 2APVA 5DUML 3G6JF 4P23C 5DFWH 4KTDL 1WZ1L 1TQBB 5JUEL 1E9PA 3LSOA 4HJTA 2F19L 1T0NA 1A3RL 4GP8B 4ZAKD 4L8CB 2GTQA 4KKNA 1DUZA 1IARB 2E7BA 2XPGB 4G8GD 4Y4FC 3WFBL 3U30B 3FUDA 3TBWB 1PNCA 5B39G 2A4ZA 2OA9A 2BP5M 3NUKA 1M7DA 1CF8H 2MNWA 3OKDB 3QCVH 3D4CA 1FORH 2YPVH 3HMXL 5MEPA 3AW5A 1ETB1 2EICA 4Y4KB 3SDDA 1UACL 3ABZA 3DO3A 3F7KA 1ZKAA 5F70A 4I1RA 4D8PB 4MJ4A 4FQXB 5EIIG 3RWDA 3AXIA 1MQKH 5MI0C 2AJZB 2Y36L 4X7DC 3S48A 5I74B 3MFFA 1JGIA 1GMEA 4QXTB 5FKPB 1J5OL 1NDGA 2ZCKH 3H42L 1OAKH 3CLFL 1UA6L 5MHSD 1HL9A 2VDRB 2IH8A 2QFPA 1ITBB 1ASQA 1Y1UA 1VACA 2D3VA 3DX8B 1VFUA 5T1MB 4CSTA 5CD3A 5C07A 5A7BA 2YPLA 2GC7C 2CIIB 1M7IA 3VFOA 2OL3B 2ZONA 2B1AL 2BVOB 1IAIH 3JTBA 4GKZB 2CA4A 4PP2B 3E0GA 35C8H 1KNOB 4HK0A 3KPSB 4N1EA 2DIJA 2B4CH 3QXAA 2NY0B 3HLAB 3W2DL 5ADOL 2OZ4A 4NO3B 4GYBA 1Z3GH 5A2BA 1GC1H 1IEAB 2D4DA 1TDQA 3HHSB 1LGVA 3QG7H 4OSUH 1AGBA 5JPMA 4OZHB 1NCAL 3JVGC 1GOHA 3L1EA 1TITA 2EEFA 5FFGA 1TOXA 2Q7AA 4QHNB 4NFDA 2ZCHL 2VAAB 2VDKL 3VFVB 1KFAL 4HALA 1A4KB 2A77H 4YDZA 4L1SA 4W9JC 4WHYH 3DMMB 3OHMB 4R6UA 4HXAH 4B3EA 3X14A 2HFGL 3ATDA 1UM5L 5DT1H 1DBML 4PVBA 4OV6F 3QPQC 5T3XD 5EU5B 2BFVH 3I2CH 3EKCA 1DQQA 5ACMA 4OFQA 5EA0L 1SLXA 4AK1A 3EYSL 2NY6C 2PETA 4NXKA 3E8UH 2ZSWA 4TF4A 2BCMA 3Q01A 4P48A 3ZBMA 3WTYA 2P5EE 2BNUA 3VRJA 4IRZA 3HR6A 3FB5A 1PZ3A 1WFJA 3IJSA 4RH4A 1BMWA 3LKRB 4DEPB 3VSVA 3TBYA 4N85A 5I1IL 1N4XH 2A6IB 5D1XC 5C0BB 3PQYB 1I8MB 1JFQH 3MUUA 5JPNA 4JPVL 2BSRA 3D07A 3NYKA 4LOVA 2EC8A 2XJKA 3T08A 3QQ9D 3AS1A 5AOLA 5I26A 5IB3B 1H9DA 4NJAL 1MLCB 4G59C 2V9QA 3LZLA 4M8VA 4GH7B 3EUDA 4UT7L 1RIUL 4GXUM 1SVBA 4B0MM 1MAJA 2JB6A 3IJ8A 1MUJB 3EH5B 3DGGB 4OFKA 1A66A 3HC3H 3EDFA 3GMLB 3NA9L 4P5RA 3WNKA 4F91B 1R9FA 1LO5B 2CK0L 3MGOB 2MQGA 5L2KE 3ALPA 3AWGA 3RAJL 4PJEA 2CPUA 3EO9H 2R51A 3ES6B 1KGIA 5IMLA 5IW1B 3CTTA 4JM4L 4F7PA 1WEJL 3ZL4L 5E8EA 2YSTA 2YKKA 4OI8A 2QLYA 1H5BA 4UTAH 2AMUA 4KNSA 2Y1AA 5E5LA 3N42F 5GGSA 1SOQA 5J1TC 3QDAA 4WKZA 1USQA 4G9FA 3V5DA 1UZ8A 4R4ND 4WDIA 1V3KA 3SKNA 5IESH 3S9DB 3JWNH 2J71A 1TZHA 5EOCL 1WAAF 3F8UB 5HHPA 1IC1A 1OGTA 1N5YH 3P40A 4IBUA 3WV0A 3D87B 1BZ8A 3IDYB 4FQIH 3N1GC 4HEPG 4F1SA 1TVHA 1O9ZA 4PJEE 5I0VA 5KEZA 4JN1L 3O0RH 1WCQA 4YLCA 1J0YA 1URLA 5GGRB 3EJZD 4TS6A 5IVNA 1GZQA 5ISZA 2UZPA 3JZ7A 4GO9A 4MDRA 3AROA 4KO9A 4GKNA 4LSSL 4S10A 3REVB 1O9VA 4RX4D 7TAAA 3FT9A 1UH4A 3VTTA 3GSWA 5BVPH 2BY0A 4CMMA 3MUZ1 2OBGA 3CFCH 3FT0A 3OAUH 3VFRA 4D9LL 2W60A 4BCXA 3EH3B 3EFFB 1XH0A 4OBRA 5I23A 4NLHA 3UTTB 1TQUA 5I73B 2QDWA 2EXWD 3O8XC 5T33L 2FJSA 3V0IA 3BPNC 4G6FD 1ZEAL 3PREA 1NCUA 4AUUA 4E41A 5I19L 2I85A 4HKZA 4N4YB 3P4LA 5DGQA 1RCYA 3L95B 1AMYA 1X7TA 2F5AH 1HCYA 1BVNT 2CCWA 5TDPA 1H3UA 1JI1A 4ZSOE 5JQ6H 1LL1A 4LBEA 1OE3A 5TK2A 3ARPA 4DGVH 4DO5A 4R4NC 3IDXH 2YEVB 1XFPA 3CZKA 1OTTD 2E4TA 4GAJL 4OFPA 5T3ZE 3MHZA 3J7HA 1G7IA 3O2DA 5FYJE 5KZCB 3MX0B 4IHOB 5JW4M 4JGNA 2VYRE 1KCSL 3IXAA 1RJLA 2V5SA 5DVNA 5ICUA 3W9DB 3WNLA 5JMRA 2EYRB 3BWZA 2R2BB 3BW9A 3FF8A 4KOCA 2NY0D 3C9NA 2G2NA 3N3EA 4ZPVA 3S88H 5KOVC 1K72A 4O00A 2V33A 5T1M