3W56A

Structure of a c2 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
108
Chain Sequence
HMQLRLYNLRVRGLPSGITDGYVKVFCGSANLGETSVNHNNANPWWTEEFSHFKAQENDILRLEVHDEDTFFDDLLGVCQRQIKVGTHEHDCYLKEGGTLHYMYTLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords C2 domain protein
publication title Defining the interaction of perforin with calcium and the phospholipid membrane.
pubmed doi rcsb
source organism Scophthalmus maximus
total genus 27
structure length 108
sequence length 111
ec nomenclature
pdb deposition date 2013-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3w56A00
4F93B 4QAMB 2QZ5A 1K5WA 4AJWA 3QR0A 2FJUB 2A5UA 3CSTA 1DJHA 3N5AA 2WXLA 3PYCA 3W56A 1RSYA 4LCVA 1QASA 4FADA 2CHZA 3PREA 1DJZA 3FBKA 4WEEA 3QR1A 4URKA 5H4YA 1DJWA 4G11A 3CSFA 2QZQA 1CJYA 4EZKA 2WXRA 4FLHA 1W15A 4KZCA 1HE8A 4XE0A 4HVBA 2EP6A 3L4CA 2R83A 2CHWA 4LDCA 2K3HA 4KZ0A 3W57A 2ISDA 3GPEA 4ANVA 4TUUA 2K4AA 4NS0A 3TWYA 1A25A 3QJZA 3NZSA 2CJTA 3MJWA 1UOVA 3ZVVA 3ML9A 2DMGA 4Y1TA 5JHAA 2D8KA 2Q0ZX 4EZJA 4WAFA 1DJIA 4NPKA 4LT7A 2CHDA 2B3RA 4FJYA 2CM6A 1E8WA 4DNLA 1UOWA 2WXHA 4FA6A 4F1SA 3OAWA 4QJ5B 3F01A 1W16A 2WXPA 3T8MA 1E8YA 1DQVA 4L23A 3ZW3A 3OHMB 3F05A 1E8XA 2YRBA 3L08A 4V11A 4F92B 4WWNA 4A55A 3APDA 3PFQA 2CJSA 2CM5A 2CHXA 3SD5A 1QATA 4TS6A 2ENQA 3KWUA 2ZKMX 1BCIA 4NP9A 4FHKA 2LHAA 2RD0A 4ANXA 4MJJA 4TV3A 2K8MA 1BDYA 3QAQA 4L1LA 2Z0UA 3APFA 1E8ZA 2WXIA 4FULA 4ANUA 5H4ZA 4OVVA 3QK0A 3R7QA 4DK5A 4EZLA 2WXKA 2NQ3A 3F00A 2ENJA 2WXGA 4IHBA 4BFRA 1GMIA 4L2YA 4NPJA 2WXMA 3LJ3A 3NZUA 5G2NA 1RH8A 4FJZA 2WXQA 3RDJA 3TL5A 4KITB 4QJ3B 1WFJA 2N1TE 4GB9A 2FK9A 3IM1A 4AOFA 2NCEA 4ANWA 5EDSA 3M7FB 1V27A 4BGDA 3RPBA 3IBEA 1DSYA 4J6IA 4ICWA 1E7VA 1DJXA 3JZYA 2K45A 4XZ4A 3L9BA 3S2AA 2WXOA 2JQZA 4OVUA 2WXNA 3FDWA 3HN8A 1DJYA 4F91B 3L17A 3QARA 3B7YA 4PS8A 1BYNA 5G55A 3DPDA 4ICXA 1DJGA 2ENPA 2NSQA 1RLWA 5JHBA 4GNKB 2Q3XA 5KJ7E 4Y1SA 4JPSA 4PS7A 2KI6A 5CCJA 1TJMA 1E7UA 3APCA 3TJPA 2DMHA 3L13A 1E90A 4WWPA 4PS3A 4QJ4B 1UGKA 2YOAA 3L54A 2WXFA 4WWOA 3F04A 4IQHA 5CCGE 2A4ZA 3HHMA 3DBSA 3P2BA 4FHJA 5T8IA 4HLEA 3L16A 1TJXA 3ENEA 4XX5A 3R7RA 2V4LA 5CCHE 2UZPA 1WFMA 2X38A 3KWTA 3NSJA 4L1BA 1YRKA 3HIZA 3ML8A 3ZIMA 2Y3AA 3PS6A 2WXJA 3PRZA 2BWQA
chains in the Genus database with same CATH superfamily
1P5UC 1S5HA 2NXYC 2B2XH 3ULUF 2EDEA 3EOAB 1G7PA 2I9TB 1A7QH 3OXSA 1M57B 1UACL 4BDVB 1JZ3A 4UINH 4XN7A 1U8PA 3MCKB 3VCLB 3OLDA 4U1MB 4EI5D 2CCLA 4YFLI 2HX9A 4J39A 3PWJB 3ARBD 2H47C 4IRJD 2VT0A 2IMNA 3MRPA 1E3ZA 4LMQI 2UXGA 4ZJ9A 1IGCH 3CCHA 3BOVA 5AALA 2OMZB 1CF1A 1HAUA 1UKTA 2CBQA 1F5WA 1KB5B 1FIGH 4R4BB 4JM4L 2Q8BL 4R4ND 2R23B 1RK0B 4OZIF 4DUWA 2VZ3A 1M7XA 2XOTA 2AI0L 3D0LB 1MFVA 1Z9MA 3P0GB 2DMGA 4J28A 3CHPA 2OMNA 3QWRA 1R3IL 4LSDA 3VXQA 3EYVB 3O6KH 2ERJB 3Q13A 1WGVA 1JHLH 2Y24A 5E9NA 1H3GA 2XQBL 3KGTA 2OZ4H 3C8DA 1UEMA 2YRBA 4DPRA 3B8SA 1RJCA 3UC2A 4PREA 4RNRB 1IL1B 4F2MB 4FMKA 3NIGB 4PG9A 3H54A 1B6DA 3X14A 4B9ZA 3K91A 2NSMA 1A5FL 1G5GA 3GBDA 2FQFA 3DYMA 1D6EB 1I3UA 2Y7SA 1GIGH 3DVNB 1ULVA 4UV7L 3X12A 4AQ8A 4Y16B 3TIEB 5IMLB 4PWGA 2ENJA 1JWUB 4Z3GA 2HJFB 1UATA 3B9DA 4L2YA 4X9GA 4OCWH 1BG1A 2XDHA 4MCZA 3O3BB 3TPKA 2JJUA 2EH8H 5KYXA 2UZYB 3IFNL 4RDQG 2B77A 3ZE0E 3N1PC 3QI9A 3O2DA 3H42H 4NNPL 4RMRA 3NCYP 2OYKA 3B8YA 2IPKA 5DRZA 5D7IA 2QEJA 3APNA 2NCMA 2ZG2A 3QCVL 1QX1A 1HNYA 5GGVL 1MJ8H 3PGDA 4OFKA 3AXLA 4FFVD 3H85A 5DVNA 3RURA 5EEVA 2OMUA 2QLYA 4OD1L 1II4E 5AWNL 3RLSA 5C9JB 1B4RA 1MCFA 4GEJA 2WQRA 1VACA 4XN1A 4ZW8A 1T83C 1TPXC 2AF2A 4PGBA 5EZJA 3BGFB 2X53A 5F93C 3B7SA 4MAUL 5CCJA 2I26N 3TJPA 1XD1A 2OX5B 1EFXA 1CCZA 4Z7AA 2G2NA 1P7QB 4AVIA 3EH3B 4JPQA 2PCPA 1FLRL 2X0VA 1HHIA 3C8KB 2QVTA 4LNVA 3NP3A 3D3VD 4HGWA 3MBED 4OZGE 3ZQ9A 2XNAB 4N6RA 3SKOB 1E43A 1W72H 3JWOL 1L0YA 4NX0A 3WJJA 4HCRH 4JO1L 1MLBA 5GSVA 1U95B 2CJ3A 4XXWA 2Y36H 2M8XA 3QJHA 4Z9KB 1A3QA 4YDLC 2DYPA 2NXZB 3BMVA 1RXLA 2P8MB 4FNSA 4HX1A 1R3HB 4YO0A 1BZ8A 1PKQA 2ADIB 3D0AA 3MLUH 3C60A 5J13C 2ZXEB 2NY6D 2V2XA 3MJ9L 2PP9A 1Q9OA 1N2RB 2QADC 3EJZC 4FTVB 2DF3A 3BPOC 3LH8A 1J12A 3UTSE 2IQ9L 1L6ZA 5AVWB 5LGHH 3IDYB 4GJTB 5FYLD 1Y18B 1CF8H 2ZSWB 3WIHA 3P3UA 4U6TA 3Q2WA 4TSAH 4A6YB 1DBMH 1ZA3B 4MMXA 1NFDA 1UM6L 1CDCA 3HI6H 1ANUA 5GS1B 3RIFF 5D7IF 2YPLD 5E8EB 3V6OE 3NQIA 1UD3A 5EUOB 4XBEL 4Y19B 5A2KH 5JW3L 2DWEB 4M03A 1NL0L 5F9JA 1H6FA 3RP1A 4EZMA 5I2IA 3FTSA 3OZKA 1DBKH 4XVUC 3ZVVA 4GG6F 1G43A 4CC4A 2FJFB 4YZFF 1M05A 3TFKD 5DFVC 3DVGA 4PJ5E 4BFGA 2CDFB 1TETL 5F9AC 5A6IA 3QPQD 2VMCA 1JZDC 2HWZH 2IH8A 5F70A 4UQ2A 4WEMB 1NPNA 4LRNH 4WJ5B 3L08A 1E8XA 3WEMA 1HQRA 5CSZA 3KDPB 1DL7L 4F33A 2IOOA 3O2VL 1E9OA 4MZ2A 3SPJA 1PJ9A 2NX5B 4MTMA 2Q10A 1Q1JL 3N6YA 1MN4A 5MEPB 3Q43A 3W5NA 3MCLL 3UZVB 5FB8A 2XC8A 3HUJA 3UTTD 2G4EA 4JRYE 5T1LA 4OI8A 3IDNA 4ZO6A 1NAML 3A67L 1FNHA 4YSQA 3TL5A 2ZXCA 3CHXA 1ZAGA 3DXAE 1EWHA 1IKOP 1JGEA 5TFSL 2ZWSA 4W9DC 3TT3L 4HJSA 4UQBA 1PNCA 4YX2H 1T04A 1T1ZB 4YR6B 4JFYA 4KTEL 4ZS7L 5EBGA 3TA3A 2CO4A 1S4IA 2GSIB 1CL7I 2JQZA 4FQLH 2VDOB 4N5ED 2EDMA 5FYJL 5KBNC 3QO0A 1U58B 2G3NA 4JDVA 3VM7A 4AGNA 5LJYH 3NGBB 3R1GL 4TRPH 4IS6A 1KENL 1SOSA 4FABH 1NFDF 2VN7A 4A7VA 5SWSB 2NDFA 4FG2A 3ULVH 2MQ0A 1FAKT 1QHQA 3VYOA 1FDLH 1BFOB 3B4NA 3FQ2A 1ZA6B 4HFWB 1OCCB 1F02I 1WZMA 4Q9CA 2GBVA 1IGIL 3HHSB 1QKZL 4P9MH 1DBJH 3B34A 1EJFA 4B3EA 2CLZB 4XCYA 1KB5H 5T8IA 1E4XL 2VWEE 1YJDC 2JNZA 4YXKL 1LO2H 4AQOA 1XSIA 1NUFA 4BHUI 2F8XC 3KDMA 5LB1A 3ZDYE 1UWEH 4HH8A 1OCWL 5DF0A 2JKWA 3BUBA 5B1KA 5C0IB 5HSFA 3FZUC 1KB3A 2IWEA 1AXSA 5D1ZI 2IG2L 3JWNC 4MA8H 4K07A 4Y9GA 1B0RB 1HHJB 4XP1L 3HUJF 3VSVA 5CU5A 1W6WA 3H55A 1QABA 1SDDB 2FBOJ 4LLVB 2EVGA 2ZKHL 1AANA 3GMNA 4LHUB 4UT9L 2OXGB 5JDSB 2X4PB 4FQCH 3QIWB 4AUJA 1T1WA 5DWPA 1VZGA 1RIVH 3BGMA 2E6QA 4ZFGH 4OLUL 5GS3A 4JG0H 3VFGH 2Y1AA 3RNKA 6PCYA 5LXGL 4IGBD 1ZKAA 2CGRL 5DD5H 2EIEA 4GLRI 3VVWA 1FWXA 4G8GA 2IXQB 4V1DD 4NHCL 4R0LC 4JFPB 2AGJL 5HYJE 5DRWB 1CD9B 5I1EL 2HKFL 1KTCA 4GS7B 4IBUA 2DQIH 4PG2C 3BZ4B 4X6CE 4A67A 4LBEB 2JCCA 1LEKB 4OZ4B 3HHRB 3OKLB 3RFZA 3UZEC 2BOCA 2Q2LA 3VFVB 1U91B 4Q6IC 4ABWA 1T2QL 1X44A 4JE0A 4MJJA 3T0VA 5CN3A 4N8CL 1LK3H 5LDUA 4Y5VB 2NTSP 3DNKA 1MRFL 1O5PA 1OY3B 4I9XA 4KROC 2HKHL 3MKGA 2RACA 1PEWA 4MD0A 4CVXA 5GRVK 3NCEB 2CKNA 3LJ3A 3MROA 1BMWA 3HPLB 4K9EH 1XH1A 1OE1A 1Z66A 3GZKA 1VGEH 5I1CL 2FX8L 2OXHA 2CMRL 3KPLB 4AMKL 4EF3A 4BH8A 1A4JB 1ADQA 5T3ZH 4I1RA 4X83A 2JK5B 2HFFB 2XVGA 3C5SA 4MDIA 2GJ6B 4P2QA 3L17A 3QW9A 3MNVA 3BMWA 1WTLA 2I60H 3OR7B 5DHYA 1CFMA 5C0JB 5F6HI 4H8VA 2OBGA 1ZT7B 2DQGL 5BO0D 4XP9H 4J6RH 4U3CA 3VG0L 4X6DF 3QQNA 2GQHA 4LSRL 4QTHB 2AK4E 4GG8B 4ODSH 4Z7OE 5FK9B 2NUPB 2WZPA 1S7RB 4XMWA 1NCWH 1ZGLB 4Y4FB 4A6YH 1DVXA 1OSPH 3ME0B 3SQRA 1UM4H 2X38A 2X4TB 5F7UA 3SJVA 5K9OB 3STLB 2RFXB 4PI0A 4HPOL 1U8MA 3F85A 2MEJB 4Y9BA 5CF3A 2VLJE 1DDHB 1A14L 2IDUA 3ZT7A 4DGVL 2H2PC 3LSOA 4Z1PA 2HUHA 1GSMA 4BZ2L 4DPAX 2O6PA 5I6MA 1TT6A 2W0FB 4EN3B 4PLNC 2X6UA 1E4XI 1EGJH 4F7PA 2OJEA 1FFPB 2YD7A 3ROOA 4QD2E 4Z76A 3SDCA 3V4UL 1NDTA 2VLME 4PJ5D 3ULAB 4OF0A 1J5IA 5E6IB 2XWDA 1N26A 4I48B 1DDTA 2R15A 3CZJA 2JIXB 1JGVL 4HJUA 4BCXA 1A8ZA 2WLNA 3FU6A 1TZHA 1HSBA 1HAWA 2Y5QA 5B21A 3LRSA 1ESOA 5GPRA 1P4BL 5DQDH 4M3KB 3O4LA 2P45B 1SM3H 1GZHA 2J71A 5HHVL 1YLBB 4A2LA 3SHSA 5E0QA 1QFPA 1HFUA 4LKCB 3CV5A 1X5ZA 4WTXA 3M1CA 2BSTB 1HZHH 4B9KC 3FRUA 5HDBE 3D18B 1A6VL 5LHDA 4MNHB 4K2UH 2A6KB 2G60H 2WYZA 3L3IB 3P2TA 5A3IC 4KX9A 5ALCH 1E3FA 2XA8L 4ZSOE 2J5LC 3GSRA 3HCVA 4DK3A 2HUEA 3T6WA 4OV6F 4WEUD 1WD9A 3DXAD 4WDIA 3WKNA 4NYLB 5EF3A 4XMUA 4Y4HD 2R56H 1P2CA 4JN2A 4F7KA 3TV3H 1CGUA 3ARRA 4WW1B 2A74C 4NBZB 3WELA 1N6VA 5IM7B 3GBEA 5C08A 1R0AL 1B0GA 2Z91A 4YGVA 3DOSB 2DD8L 1YN6A 5IVZA 4AV5A 5IFJB 2Q76B 1NAKL 1ZTMA 2VDQB 4LCCC 2Y7LA 3HKZA 1I1YB 4NQXA 1FAIL 1NLDH 4R7DB 1B4JL 3SBWA 5FGBA 1OT2A 3JV4A 1FP5A 2W8CA 3HB3B 1ERNA 5EO9A 1VERA 2KERA 3EF7A 3QEQE 4HEPG 1P5VB 2YPVH 2R29L 4HIJA 1NGZA 1HXYA 3GSWA 4IBZA 3DPBA 3IDJB 5KYUB 4HXAH 1TJGL 3E6FA 1MY7A 5JQ6H 2QFPA 3EYOA 4AW4A 4JHAL 1NBZA 4AUUA 1M7IA 5T5NF 4WV1B 2UYLB 2W9DL 2DTMH 3MREA 3LPPA 4K7FB 3DMMD 1EAOA 4ZAKC 4HUXA 5K9QG 1UASA 1ZS2A 3FFDA 5HPMB 4X7DC 3AUWB 5EU3A 4LPUA 1U8JB 4ODHL 1QSVA 1U8CB 2KLTA 4H8WC 2Z9TA 1PQZA 3HG5A 3MBWA 5C0CA 2YN5A 1G0DA 2PETA 2VL4A 4WUUD 4W9KC 5INCB 1M2VB 5J7CC 3VWKC 2F54E 2C26A 3TURA 2CPUA 3U48A 5T3XH 5T1MA 3MACH 1F3RB 3L4CA 3P9LB 2QVIA 4TQPA 3TIDB 3HG1D 3GD1C 2HX7A 3QZWA 5FHAH 5HYJD 1AQHA 2P5WE 3LS5L 1UUNA 2PTUA 1BEXA 4X7TA 3TBCA 3ARFC 1WFTA 5GRUH 3FFCE 5E1GA 5KANI 4IBTA 3DOHA 5I1IH 2A1WH 2XIDA 3ARED 4L8DB 4L0ZA 3RY5A 4DTGH 2A9AA 3MJ6A 4ABUA 2AV7A 3PWUB 5IW1A 1U8NB 1DCLA 5EPMB 5IMKB 5C2BH 2VO5A 4FQIH 1P4LB 3X11A 1MEXL 2ENQA 4L4TD 3D50A 1AGFA 4PJAA 5B39A 2FT7A 5E6SB 3EYUL 5GGSY 3WKQA 1R1CA 2CWRA 4KKZA 5IJBC 3GHBH 2D0GA 4N4YB 3S34L 2ENYA 4ZMLA 1F3DH 2C1OB 3A5VA 2HFGH 3QDJA 3FB6B 1G1YA 1NFIA 3A6OA 5F7BA 4AQAB 1DQDL 2Q1EA 2WB1A 3N85H 3V5DB 1BWWA 3VXMB 2MQCA 4PJEF 1FL6B 4R90L 4YH6A 1B3JA 2CU9A 2NLJB 4RFNC 4CUCA 4Y4KA 3GSNL 1N0LB 4XNZC 3SCMD 1IGFH 4J8RA 3ZE2F 2AK4D 3MRHB 2WJ7A 5FGCB 5LNEA 1UXWA 5IHUL 3HLAA 1B4LA 1G9EA 4NQTA 1WBYA 4F9PA 2OR7A 3HFFA 3MBXH 1QSZA 2XT1B 3KVDD 3FTGA 1MCDA 4M3HA 5C0AB 2VDLB 3CHQA 3HRPA 5AQ0A 5FYKE 2WK2A 4D0CB 5I5RA 1JGDA 3GMQA 3I9IA 3GXFA 4GBXC 2YMOA 2XG5B 2B08A 8PAZA 3WD5L 2HXAA 3LRLA 3VD0A 1PZ2A 2AFNA 4KVCL 4OR1A 4XH2A 1MREH 2VLJD 1QFHA 2NY4D 5DI8B 1OAYH 4HH9A 3UP6A 1KEML 3D69B 5FM4A 2B2XL 4GI6A 1OWWA 2B4CC 4DFIA 1A7QL 4NC2B 3HZYB 5F72S 1QASA 2PWFA 4UINL 1M7DB 1TSHA 1IM3A 4PJAF 1KEGH 1MI5D 3G04A 4DEWA 1FE8H 3A6CH 1WBZA 2Z4QA 2EECA 3BWZA 4HLZG 4IIQB 2HTLD 5GGRB 3UP1A 1E4KA 1I9IL 4O02A 4DZBA 3GWJA 1IGCL 1WIOA 1RZKL 2PKDA 3T1FA 3FU7B 3ZIYA 1NANI 1RZIB 1PLCA 1MKFA 1J8HB 3BXNB 3G5ZB 3L5XH 1FIGL 2PYFB 4NM4H 3U46A 2CXGA 4B41A 5IBTH 3DJRA 3GNMH 1XGYL 5D5MA 3MLVL 4JPIA 4JE4B 2W38A 4QOKB 1I82A 5JW5A 4DKAA 3IDUA 3PGFL 4HEMA 4LASH 4YDVA 3T0BA 4PI2A 4XPGH 3WN5B 5KG9A 2CO1A 1JHLL 2B3IA 1U8HB 2H6UA 3L1OL 5BZDA 2PXYA 2AAVA 1OCOB 1AYOA 3PWPA 1AHWC 2XWRA 3H9SB 4IOFD 3WO3B 2FQDA 3FCGA 2VDQH 2P24A 5D7JC 1HS6A 3WAJA 3L3HB 3HZVB 1SXAA 4ZXBB 2EXYD 1LP9B 1C08A 2R2BA 4FFWC 4QHLB 4XBPA 3CH8A 1NPJA 5J11C 4FFYA 1VZIA 3EJCA 2X6MA 1GIGL 4APQA 1OK8A 4YFLF 4BXSV 1SHXA 1JPSH 2CHNA 5CLWA 3T3ME 3NCBB 4OCWL 4G2AA 3VFOB 2EH8L 3CFQA 4O2CA 4MWFB 5D2NB 4JCLA 1HH6B 3RB5A 3U6RB 3SKMB 2AK1H 2KDGA 3QFDA 1I7ZA 3Q7JA 2OK0H 1YEJH 3ZTEA 5BUGA 3KPNA 2IDCA 4A2EA 4IBQA 1MJ8L 3BJ91 4JZJB 2XSKA 5HHNB 3H9HA 4YHNA 1EZVX 5MI0B 1YMMD 4DP0X 3S4SG 2EYSA 1U92A 5D5MF 1MIMH 4Z77B 1H3PH 1I7UB 3HN8A 3J07A 5AYUH 3SPHA 5FPIA 2C34A 1S7VB 5JO5B 2HP4A 3HMXH 2N3JA 1NICA 1H6EA 1T1XA 3QJQB 2XG4A 4GXUN 1OOWA 4XOBA 5DMGC 4ONFH 4N0CD 1J5DA 2MKWA 1CFVH 2JE8A 4KWUA 1W72L 4NQCE 4YE0A 4Z3JA 5KSBE 3GINA 2DZEA 4PHZA 4Z7QB 1LK2B 2Y36L 3CFEA 4LFHG 4PGDB 4CVWA 5CCGE 1U8KB 5F1IB 4S1DD 3ROLB 5KSAA 3QYNA 1T7ZA 3EBIA 4DEPC 1DQJA 1OAJA 3X3FH 4WW2B 5J57B 4FZEH 4G70B 3GUTB 5F7DA 1AOZA 1A2YB 3MLUL 1YCSA 3NJFA 3ZRFC 4AQEB 4WKXA 5FDWB 1CVRA 1MQKH 3ZZ1A 2IWGA 4OI7A 5I0VA 5GRJH 3JWNG 4ZQKB 4H26A 1N7MH 4UYPA 5LGHL 4G59C 3GI9H 1ADWA 5MP6H 5C7ZA 2GJRA 4P23A 2R0LL 3FFCD 1MAKA 4FYSA 4IMKC 1ECZA 4OIIH 3HS9A 1HCFX 1IVLA 2OP4L 3BYTA 1O7DE 3IT8D 1W0WB 1YHPA 4R9HA 1DBKL 4YAQB 2WWMD 5E00B 3KWWA 1K5NA 3AG2B 2H0FA 1I8LA 1K8IB 3A21A 4LLUB 3T8XB 4X6FA 2ZX5A 4C56B 15C8H 2RMNA 3CDZA 4OLVH 3IDXH 3DVIA 1JNHB 1MXDA 3RGBA 2NT0A 2WVUA 2F7OA 3AXHA 2HWZL 4HJ0D 4OZGA 3DUSA 6PAZA 3KM1A 4QWWC 3DX6B 3QYCA 1N10A 1FZOB 4GI8A 4LRNL 4NQVB 4UT6H 3QIUA 2MQGA 3FYEB 4GQPH 1FBIL 1X9UA 3D2TA 3IPBA 4KMLB 1A64A 1WJ3A 1NIAA 1XCQA 3OV6A 1ZVSB 3OM3B 1D7CA 4F9LA 3BSZH 5CKAA 3TS8A 1EZUA 4Z7IA 1AR2A 3IAGC 1UQSB 4WIQA 4G8EA 5ETUB 3GSUA 2VLRB 3IFOB 2VDLH 3BPLB 4G6MH 3V5HB 2LU4A 4MKMA 2QSCH 3N1FC 4QXGH 3MV8D 5DJYA 4RDBA 1JHTB 4M7ZC 1AD0A 4TTDC 4YX2L 1MVYA 3MV7E 3ZE0F 4ZPTA 1IC7H 4FQLL 3IU3A 4PRNA 2N1TE 4ANWA 5A2JH 1ZANH 5FYKD 1S9VA 3CFTA 1XSOA 4JRFA 4LLMB 2WVVA 3SQBA 1J0ZA 3FUJA 3FQ1A 1H5BA 2YSSA 3JZYA 3EGXB 3STZB 1MCPL 5IB4B 3QC6X 5IHLB 3ULVL 1YYLL 2J1YA 2M2DA 1FDLL 1K4DB 1I85A 3ARGC 2LLGA 4WHTA 3F5WB 2Y22A 5ITFB 1UXMA 5KZCB 1M53A 4N20A 5D9SA 1DBJL 3IKCA 3WL9A 3BIKA 5IB1B 5IJKA 4JQIH 3HI1A 1KB5L 3M1BA 4R26L 1EQWA 2DKUA 3TO2A 4JY5L 4JFUA 4OZGF 3GF8A 3QWOA 1LO2L 4XNUH 2BC4B 4XAWH 1OP5H 3KYOB 3PWNB 4QHKJ 1D2PA 3U9UB 1UWEL 3T65A 4QCIB 4DKDC 2YA1A 1A6WH 4YSAA 1XR8A 3EJUA 3ARUA 3HC0A 4GRWE 1TVHB 1G9HA 5L2KE 1ZXKA 2HLEB 5KSVA 5F7WC 4KKAC 4YXLL 4LLYB 4MA8L 4QAMB 4S1SH 4XMXA 4P5TD 2R7EA 2B9AA 3L3OB 2NMSA 5MERB 3K0WA 1W0YT 4MX7A 4ONOA 4ELKB 1RCYA 4M9OA 2Z8RA 4FQCL 5ACMA 4L9LA 4BBWA 1IZKA 3DI2B 5GGUA 3MJ9A 3HVNA 3PHQA 1RIVL 3HE7D 4IRSA 2ZOKA 2N59A 2BMKB 4PJFB 4ZFGL 4DFHA 1QQDA 2FX9H 4JG0L 1XX9C 3VFGL 1BYPA 2AQSA 3BPCB 1OB0A 1Q94A 4G71B 2DQTL 2VZUA 4B3VA 4G83A 5DD5L 3BKJH 4JUTA 3Q3GB 4XPFH 3QWRD 1D5XA 1JNLH 3IRCA 5HYSA 5B3NA 3LKOB 4WRLA 3V0HA 4OLYL 1MHEB 5CZRA 2WBJD 3Q05A 2DQIL 3F84A 5TE4L 1EIBA 3OKOA 4JFWA 4L3EE 3FUEA 1FYTA 2FL5B 3E6HA 2NR6D 3EKCA 1FRGH 2VXTH 4CA4A 3KJ4C 1AP2B 1F11A 3V52H 1LK3L 3GSXB 4I0PA 4NHUB 4JGJA 1Q8MA 1KFGA 1ZLEA 1QBMH 4LPCA 3SYQA 1AZNA 2VR9A 4GUPA 5F9WC 1BDYA 5DJ6A 1L3WA 3FUHA 4LDEB 3U2SB 2D31B 1TZIB 5CKGA 4RMUA 4APXA 1B6UA 5FF6B 5I6NA 5CLXA 4NQEA 5T3ZL 1NAMA 2VUKA 4X9IA 4K8RC 2CA4A 1SFHA 3DX9B 3BYYA 5C0EA 2AV1B 4R7NA 2YEQA 3FO1B 3QIBB 3QQ3A 4UQ3B 2I60L 4QY8A 4B9GA 2WTRA 5DDHB 2EQDA 2D7OA 2QPEB 4PW3A 5D1QB 2WIMA 4WQOA 3EZ8A 4J6RL 4XP9L 2UVEA 3TH4T 1IGJB 1EFXD 2IAMC 2XWJB 1Z2KA 1HHGA 1R34A 5I8CA 4QKTA 1OTSD 3E8UH 4IDJH 1EJOH 4PGCB 4J2XA 3H4HA 4A6YL 3NBNA 1OSPL 3DX8A 2ZWYA 2WXFA 1EJ8A 1CLZH 1C7SA 4PRIE 4LOUD 2EXSA 2NOYA 4HD5A 4WO4D 4ZFZA 4JO8A 1FFNA 5DHXB 4ZUTA 5EIIA 3DUUB 2YBRB 4HSAC 1GZPB 3UBXG 1QP1A 2HVJB 3SO3B 3VMOA 2ITDB 2DYPD 5C86A 3CUPB 4X4YA 5FEBA 1XQ4A 4TVPH 6TAAA 3WNMA 4M93B 3C60D 4AJWA 5CJQL 5DZOA 1EGJL 4ZBJA 5PAZA 3KWVA 1RIHH 4N1HB 3EYQD 2FO4B 4PY8J 4RFEA 4GW5A 4S0SD 2GFBA 5E9DE 3L9RA 4DP2X 2NSXA 3FH5A 4MQXD 1NGQH 4LPXA 3KGSA 2O5YH 4X4XB 1M6OB 3GMRA 4UT9A 4BQ9A 4RMQA 1DUYA 2KZ1B 1WAAA 4ANVA 1AKJD 5DU7A 2E56A 5DT1H 2DEXX 1D7DA 4IRJC 4PRDB 3NJKA 5F7NC 5J0BA 3KNBA 4PY7A 1HZHL 2FEJA 2H1PH 2H1XA 1L9PA 3IU4H 4LVOC 5CJBA 5FO9B 3VFWA 3MLYH 4K2UL 2G60L 5K33A 1S3RA 2IBBA 3HAEG 4UM9B 1J88A 5CMAA 1HXMA 5ALCL 4KGLA 3RTQB 1RU9L 3T2QA 4CADA 2VDOL 4R4NC 3DO3A 4M4RA 2FJSA 4KTGA 1A6TB 4QT5A 2XV2A 1EVUA 3W3BA 4AEHH 3DC0A 5I1LB 1P4UA 4UDTB 4HHWA 5FKPA 3WY4A 1XSKA 5HJGA 4LLQB 2R56L 1OP5K 1QATA 1PKOA 2X9XA 5KVEE 2YPKA 3TV3L 1NCAL 4GUCA 3CE1A 3RAJL 2W65A 3D30A 2A9MH 5I8EA 1KOAA 2HH0L 4I2XB 2Z0UA 1WCQA 5T1LD 4J3SA 2KC0A 1I8AA 1OP4A 3M17A 2JB6B 4IHBA 2ITCA 4OI9A 1NLDL 1YPZB 2X4NB 5K39A 4NUGH 5EUKB 1K9TA 1KGIA 1QRNA 1U3ZA 3QUYA 4HPYH 4XP4H 5B7MA 3QRFM 2FIKB 1GCFA 2YPVL 1E9PA 1W8OA 4R83A 4FLSA 4IRZH 4G7VL 5EZOH 1DN0B 2G30A 3MCG1 3GJFB 3MGAA 3LN9A 2BVPA 1PX8A 1UFGA 1HH9A 1XF4A 2WLYA 4HXAL 4WJKB 5GJTL 5ICXA 3QUXB 1NGYB 2E9GA 3TEYA 1FCGA 1L0QA 4JFDB 1BFVH 1SJHB 2JJSC 4E9VA 5AUMA 1J9SA 5H37G 2DTML 4F5CA 4D0BB 1IVTA 2PNDA 4XNMB 4FFVC 1ZMYA 3N41F 3QXWA 1N5AA 1RZGA 2VERA 1JVOA 3HE6A 4N0UB 3VTAA 4FHJA 5DUPH 5KS9E 5C6WH 3R7RA 1ZLDA 2XHNA 3B3IA 4H0HB 4JRXE 3O6FB 3UJTH 3FOLB 4LGPB 3L6FA 3SY0B 1IGTA 2EXWD 2ED6A 3MNZB 1ORSB 2G9KA 1ILUA 3MBEC 1T4KA 2WQSA 3PY9A 4KH9A 1KCLA 3MUGA 3FCSB 3OXRB 4N1EA 1PLAA 5T3XL 1A4AA 4ZMOA 2YGVA 3MACL 1N3NA 4HIXH 2AXHA 4BZ2A 5KVMC 2XA3A 3I74A 4GOSA 2AXJA 2COQA 5FHAL 3UTZB 1CIDA 4OT1H 4XNDA 1G7MA 3B9KB 3QEQA 2RR3A 4IK6A 3LXBA 2B14A 4OJYA 4CVUA 5IMOB 3MV9B 3F7LA 1SN0A 2L4OA 3TO4A 2NY6C 3MFGB 4YHZH 3FOMA 3LRGA 4OGZA 4NN6B 1U93A 3TYFB 2A1WL 5ID1A 5H94A 3SDDB 5ADOL 4MAYB 3OAUH 3IMVA 2BS8A 4YC2B 3KYMB 3SGKC 1ZVNA 1XGPA 2YUWA 4IBSA 4LPYA 5EFIB 2X1QA 4ZX5A 3I75A 3JT2A 4X8GA 4HAKA 3FHAA 4U1IA 3NFPA 5IF0B 5C2BL 4B97A 3B9AA 2R9HD 4WK2B 4JM2F 1FO0B 5DK2B 1T7WA 5HDRA 4BD4A 3F05A 1UZ8B 2HRHA 2R1WA 3ESVF 5E1AA 3GHBL 3BZEB 1N59A 2A6JA 5CINH 4WTWA 1W6LA 1OW0A 4YIQA 2HFGL 3JWDH 3KPPB 2UXVA 2YN3A 2AJUH 2AKRA 5HGBB 4KY1L 1P5UB 3CFCL 5LDSA 2NXYB 3MA7A 1GOGA 1EXUA 4W1TA 3U7YH 4C57C 3ERXA 4BSWB 3NZUA 3MYJB 1M56B 4JREC 2OJZH 5DURB 5BQ7B 3F2LA 3MRMA 1JV2B 3O6LH 2FSEB 5DZJA 4Z7UA 2J6EA 5IG7B 1YYML 3MBXL 4W4OC 5JMRA 2JI3A 3QVAA 3EFOA 3TTYA 4LARL 4PRBB 4NP4L 4PRID 4XN2A 1TIUA 2FB4H 2VM4A 4N0RA 2CDGA 2DQHH 2E6JA 2Y0SA 2R29A 3MRLB 1BVLB 5GGQH 2D03H 3BLPX 3CXDH 1MREL 4HUKB 1DUZB 1MUJB 2ZT9C 4NENB 1TJMA 4N5EC 2WZPD 1G7HA 1JWSB 2ZOUA 3V7AG 4UIMB 1A4CA 1ECYA 1X9RA 4H8UA 4IQHA 3EYSH 4M43H 3DHMA 4OKVB 3VD1A 3ZZSA 1Y7VA 5H2BB 4Z23A 2DLFH 4OBRA 5LBVA 1KEGL 3MNDA 2X4OB 4NUJB 1FE8L 3D9AL 3KLAA 5JOFA 3V4LA 3TCLA 1G9MC 2M26A 1PL3A 4TNGA 1YEFH 1B4TA 1OT1A 3L5XL 3UGEA 3AMKA 4QHNA 2Y2WA 4RMSA 3TN0A 3L4ZA 4NM4L 2AXFA 1J87A 2WSDA 4WNQB 3GSQB 5IBTL 4JFOB 3U4EA 1N0XH 3FTZA 4N6QA 4N8VA 3PXHA 3SDCD 4JFQA 1KIRA 1KJMB 2ADGB 2C5DC 5DZAA 1GGIL 5GZOD 4KZCA 4LASL 1U3JA 4XPGL 3P0VH 1M1XB 4Z7UF 1HL4A 3P1VA 4RAUA 1P0SE 1Q72H 1OSYA 2VL5A 4NKIH 3IVKB 3X1NA 2ZOLA 2J8HA 2F7PA 1AVAA 2JCWA 2V6HA 1WZ1H 2O6EA 4LF3B 1GTFA 2XFXB 1PTZA 1TPXB 1FG2A 2E59A 2ZQKA 3D85D 4BWUA 1RZ8B 2D7TL 4U2YA 4EKJA 4IGBC 5EBMB 1KLFA 1CG9B 2VM3A 3GJFH 1QNZL 5DLML 1AIFA 5CIPA 5GS2H 5EB9A 4WU7A 3FC8A 1PX4A 1BJMA 4OV5A 1V3MA 2W91A 2AK1L 5J3HD 2OK0L 2H3NA 1YEJL 3CZEA 1HIML 2YMTA 4P2RA 1YZZA 2GAZB 3N1MC 1OQXA 1URLA 1M71A 2E4FA 3BC9A 1AG0A 2AAAA 3FYIB 3O3DA 5C08D 3ZTJG 4Z0BH 3U1PA 4XNXH 5M94B 2OMXA 2AEQL 4Z3FA 1I7TB 1UKSA 2JSFA 1MIML 5AYUL 1TU2B 1ND0A 1QD0A 1E5YA 3BP5A 3WNKA 3HVDA 2G0KA 3HMXL 3APMA 3GSNA 1BD2A 1XBRA 3SDAD 4GRLA 4ONFL 3VXPB 1OXYA 2D7MA 3Q48A 1CFVL 1WK0A 3LIUA 3F6LA 4KKNA 3ARPA 1OPGH 2ZG3A 3E0GA 3N1GC 1RJYB 1X6NA 1Z9SA 3C5ZA 3EDFA 4GFTB 4YDZA 4AEIH 4WLCA 3D52A 4LGRB 2GTWB 1CDIA 3X3FL 3F7KA 1KPVB 5AKRA 3FONA 1C12A 1MQKL 4OAWA 1OF2A 3G08A 1D5MA 2KPNA 2NYYD 3BLKA 2I07B 4JVWA 5GRJL 4E41E 3MZTA 4MFHA 5BUAA 1N7ML 3PQYB 4WKZB 1AZVA 1JL8A 3GI9L 5MP6L 1Z5LB 4U3SB 3NEEA 3HTLX 1P7KB 3LDBB 2A5UA 2WNKA 3DX0A 2DKSA 3VXOA 2ZP9A 2W81C 3TTSA 3ZPDA 1XO8A 3BH9A 1FO0H 3NCXA 1GGBL 4FQXA 1COBA 3BISA 4ISVB 4ZMNA 2Y7NA 4P4KD 4OQ1A 1RERA 1XFPA 4FLRA 4Y8AA 2Q9OA 2ZWLT 4QRFA 1E4WL 3RWGB 1QMUA 4CSSA 3VFMB 1AGEA 15C8L 1BOYA 2J1ZA 3GK8L 4OLVL 3V6OC 2ZUVA 3IDXL 4HS3B 1I1AA 5ECGA 2LT9A 3M7OA 3FQRA 3S4SB 4WTZA 4QRRA 4NQCA 5TDOA 4NZRH 4OIBA 3SBRA 3RJQB 5EN2B 2D8KA 2BNQB 4FHBD 4HZLA 3V4PB 4BXVA 4NUMA 4XNBA 1X5XA 4P5SA 1DQLH 5I5MA 5IK3A 3BSZL 4X8XA 2GYSA 1BQSA 3PIQA 1IKNA 2CJSA 3PFQA 3ARZA 1ZS8A 4PVMA 4NP9A 2R0WH 4R7LA 4XWGL 1JG9A 2Z8WC 4NZ8A 4XN9A 1XGQB 3I02B 4O5LH 4UTBL 3RX5A 1OGPA 3D1MC 4AGMA 4B53A 2C3HA 1ZANL 2AXGA 3D39B 3TBTA 5JR1H 4N68A 4LP8A 2VJXA 3DURB 2V2WB 3EJYC 1WAEA 4N0FB 5FW6A 1AAJA 3IGAB 2ICEC 4W9LC 2ODIA 3BLBA 3L9BA 1TKWB 3KCPB 3GSOA 2R1XB 4EDWH 4DP6X 3DHPA 2WBWB 1TTUA 4JQIL 32C2B 3RVXD 3GLAA 4JL2A 4RCAA 1YEDA 2BSSA 2CLRB 3GMPA 3L7FB 4UQ9A 4XNUL 1DVFB 4ECNA 4M6OH 4XAWL 3ZDXB 1BQ5A 1UOLA 3FPXA 1JZ2A 2VB5A 4ES8A 1EAPB 5G5DB 1W72A 3MGTB 1RK1A 4P2OA 5SWZA 3IMWA 2GI0A 2VWEC 1M2OA 3SOBH 5KAQF 1NCGA 3KPSD 3TC9A 4YBQC 4PFEA 4DP5X 5I73B 4U2ZA 4BM7A 5I1DA 4PRPB 4S1SL 1NINA 4U1KA 4ELMA 4RGND 3OPUA 4QHUB 4XCEB 4Q2ZA 4MQ7A 2MHAB 3BO8B 4RLDA 3RIAF 2VSKB 1UZ6F 2Y23A 3GJFK 5AW5B 3LRKA 1ZV5A 2WQ8A 3IPEA 3DMMC 4JMXA 3WLBA 1M3JA 1PVHA 1VDGA 1Q1PA 5EC2B 1EXGA 1SNRA 3D48R 4QRTA 5FV1L 1JV5A 3RY6C 1F8TH 1R3LB 1EUUA 5IJVA 1QPPA 1PW3A 2FX9L 2PO6A 5DZLA 2XKSA 3II1A 1A9BA 4K7PX 1T2XA 5E2UH 2YS4A 3BFOA 4PJ8A 1V3JA 1IGYA 2VR4A 1JHKH 4PWFA 4XPFL 5EU6E 5E4IA 4EUPG 1JNLL 2P5EE 2DB8A 3Q8BA 4FQJL 5F7HA 1NUNB 1CE1H 3DJTA 1URZA 4P46A 2H1LM 4MS6A 4PWHA 1HHKB 3FT2B 5LGYA 2FIRT 1JZIA 2CJTA 4W6WB 4PLKD 2CCWA 2I9LB 5JPNA 4F2EA 4HLZH 3C5JB 3DGGA 1IIKA 2VXTL 1KULA 1RZQA 4F8OA 3V52L 1ZIBA 4NAMA 4GKSB 1QBML 3CSGA 4AYSA 1KJVA 1O6SA 4J1UA 2QQNH 2Q5BA 1JAEA 2H32B 4LDLB 4APQD 4HUVA 4IBWA 2VITB 3DRQB 2C4XA 5J6HA 4NAJA 1CTMA 3BCFA 5L2JA 8FABA 3ZGIA 2YARA 3GBNH 1H6TA 2XICA 2OPCA 1SYVA 3G5YB 3QQDA 3VRIA 1MCWM 1FNFA 1ODUA 5IVNA 5HHPA 1HINH 2QHRH 4ANUA 3AG3B 4PGEB 2VOTA 2P8LB 5DD6B 5HGDB 5AOMA 1VIWA 1G7QB 3D33A 5LCVH 1FVCB 1QSEB 1ZTXE 3P73B 4G6AC 3CC1A 2EDTA 2GSGA 4WI9A 4LIQL 4UB0H 5I30H 4HXBH 3QXVA 4A2FA 1OSZB 3EOAA 1UURA 2I9TA 4BDVA 1SXNA 2HT2C 2UY7B 2HPOA 4MD5B 3VCLA 3E8UL 4IDJL 4U1MA 3TBVB 2DWXA 3PWJA 2K4WA 1CLZL 3OR6B 1WP6A 4XMZA 1UB6B 3VFNB 2ZICA 4V33A 3WS6A 3MOAH 1EJ6A 2OMZA 4HHAB 2D3JA 1KB5A 4QRAA 1N70A 4XR8C 4NKOB 1EO8H 3GLEA 1RZJC 2LVCA 1LL1A 1RK0A 2R23A 3K6NA 2ZCHL 3L16A 3MLTB 4PV9B 3K2MC 3AQZA 4AGPA 3D0LA 4GRWF 5AENA 5C07B 1GVIA 4G8IB 2VLKE 1ETZB 2J5LB 2A73B 4OJDH 3EYVA 2P49B 4N2GA 4ADGA 5EC1B 2NY4C 3O45A 5EOCH 1AGCB 2ZXGA 2A6DB 2X4UB 3QR0A 4WI4A 1KGYE 4W81A 2GBTA 3OF6D 2CG9X 1NGQL 4QTFA 2O5YL 4R5TA 3MLZH 1G1KA 5IEHB 1R5VA 4H8QA 2VR3A 4QXVA 1CT8B 1P9MA 2JKTM 1I8UA 4RNRA 4RRPG 4F2MA 1QTPA 3BHBB 2BFVH 2DLTA 3O6ML 2HTLC 4LCCB 2R83A 2IF7A 2Q2EB 2H1PL 1D6EA 3IU4L 1TQSA 4C55A 3FUIA 4NT6B 3DVNA 4POZD 3MLYL 4Y16A 5FCSH 3TIEA 2BSCA 5IMLA 5KUKA 5MENE 1NIDA 2HJFA 4ZPVB 5IOPB 3O3BA 3T9WA 1S2EA 4HHGA 3QIUD 5GQBA 4AEHL 4Z6AT 3JWNH 2WUCH 1U3HC 3T0EE 4PQXA 3PLYA 2J7LA 4JM2C 4ELDA 1MCLA 4G3YL 1IE4A 1QFWI 4YDNA 5C9JA 4E9SA 2A9ML 1XDTT 4ZAKB 5IESH 3QJRB 4B7LA 2BVTA 2E6PA 2CO3A 3MCYA 4GP8B 3UBXB 1JYVA 2EYTB 2P8PB 3G6AB 2OX5A 2ZX7A 3ZBMA 1HOEA 2B9BA 1CYWA 1P7QA 2EXYC 4DUVA 4FULA 4N2OA 3C8KA 5E9DA 4OVVA 5JHDA 3QDME 2XNAA 1NIFA 4NUGL 1BIHA 1U8QB 2HT4C 1T80A 4RFOH 4XP4L 1AXIB 4X5RA 4TNEA 1U95A 4IRZL 2DI7A 5EZOL 3NCWA 2ZWZA 2CKBB 4I3GA 1H6UA 1KV7A 3GXMA 2QJDA 1WHPA 1TZGH 3H3PH 4H4NA 4YEEA 3WO4C 3VWKB 3VD2A 2P8MA 1XGRB 2HKAA 3ALWA 1R3HA 2FGWH 3ECWA 5FDYA 1D9KC 1BFVL 1E27B 4YDKL 2CJUH 3NVQA 3OZLA 5IR1B 5EWIL 1N2RA 2CUMA 3OKDB 3DGCR 4FTVA 3T0WA 1C9SA 4PJDB 1D5ZB 3IGKA 2PWHA 5CEXA 2OSYA 4OD2B 3X1EA 4RMBA 5DUPL 4WWPA 1Y18A 2ZSWA 4KK5D 4A7UA 5E5RB 4Y1AE 5IB3B 3HAEB 3MUZ1 1ZA3A 2CIKA 4A6YA 4POYA 4CVZA 5GS1A 5E8EA 1CD1B 5EUOA 2A4ZA 4Y19A 1BEYL 2DWEA 1BF5A 3UO1H 1FFRA 3HW7A 3V0JA 2ZP8A 3PJNA 2FJFA 3SYPA 1F18A 4HYTB 2YIHA 5EU6D 3TCTA 1TUPA 4G5AA 2ZYHA 4HIXL 4XRCA 2YD8A 4QGYA 1EGJA 4OT1L 3VXRB 3CZFB 1BOGB 4WJ5A 4IRSD 3ZUNC 3TONA 4E36A 4AIOA 1FQ9C 2I7OA 1G7PB 4URKA 1J48A 3V9CA 2VMEA 1ZHBB 4GIPD 2FEDD 5MEPA 3OGCB 4RFNB 1E0OB 4NXKA 2R0KH 5FOJA 2CNYA 4XNZB 3UZVA 3QC5X 4KNTA 4NS0A 1HDMB 5JORB 1KXQE 3B2XA 4GW4B 4GP4B 3SBPA 4TUKH 4K3EH 2WWMC 5KS9A 1T1ZA 2EDXA 4YR6A 2WXHA 1A7BA 2GSIA 2DWDB 3F01A 3H4FA 3JVGA 5CINL 4PV1C 5EZLB 3UACA 1U58A 3NRPA 5E4OA 4I0PD 5L8JB 1MFNA 3JWDL 4HJ0C 1CXEA 2HG0A 4NGHH 5SWSA 3TOPA 2MCMA 1J1OH 1JZEA 2YJQA 1BFOA 5A2AA 3U7YL 1ZA6A 4MRCA 4HFWA 4EN2A 4X98A 4FX5A 3HHSA 4PWKA 2YOCA 3D2UD 2OJZL 4LEXH 4BWWA 2WPGA 5FW7A 4PG9B 2CLZA 4KPHH 2XN9E 3VI3B 2LLNA 3ZYOA 5CZXD 3BUQA 4AYFB 5HVWA 5C0IA 4JZOB 5F1SA 4YHML 2YPVA 4P57B 1XMWA 5GGQL 2NY7H 4JK0D 1NEUA 2D03L 3CXDL 1F86A 4Y7OC 1B0RA 1H9VA 1ILSA 1HHJA 1O6TA 3V9FA 1J5HA 1SDDA 1AACA 3MRJB 4LLVA 2FE0A 4OLXL 4GG6B 4AGLA 1XH0A 2XIIA 3EYSL 4LHUA 4M43L 4M62H 2OXGA 5JDSA 3ZR5A 1DZ0A 2FEEI 1MH5B 2JTYA 3VTTA 5A2BA 3QIWA 2MRYA 2X1WL 1AHWB 4PGBB 1LE9B 1A6AA 1G7LB 5KS9F 1DSWA 3REWB 3ORJA 5D7JB 5IWLC 3HHMA 4RETB 3TWCH 1QA9B 2GKIA 1YEFL 4L4VB 1HHIB 2APVA 4XB7A 3RWIB 4MVBD 2IC2A 1LGVA 1ZWIB 5J11B 1J18A 5DHDA 4QPEA 4F93B 4JFPA 1IKFH 1NMAH 2AJVH 2IDFA 5DEZA 2CO2A 4WFHE 5DRWA 1F4YL 4DGIH 4OLZL 3NIFB 1BECA 5KTEH 5MEND 3BZ4A 4LBEA 1KLGB 1LEKA 3FW6A 3P0YH 4OZ4A 3OKLA 3AITA 4MXVF 4P5TC 1GY2A 3VFVA 4NXSA 1GGYA 4TNVK 2PPAA 4FMVA 4PM1A 2WW8A 3T0ED 4LCYB 3VXUE 1Q72L 4NKIL 2I24N 4Y5VA 4ZFFB 1E2WA 4DO5A 5FWQA 1WZ1L 3JBG7 1X5HA 4B50A 1YAZA 1MRCH 3HE7C 4NJ9H 2YZ8A 4F7EB 1UB5B 5I82A 2IOMA 3HPLA 3DOIA 3EJJX 1FGVH 2H0PA 1BPVA 3KPLA 2VDRL 3PGCB 3LPOA 2CKBH 1A4JA 4NQQA 2CUHA 3NUKA 2JK5A 2HFFA 2XKUA 4X5PA 3I9GL 1FNLA 1SVZA 3D51A 2VXVH 3MLWL 2WBJC 1N6QL 5C0JA 2JELH 2WLLB 3NEOA 4ODUA 1XGTB 1ZT7A 3BP6A 4N9GB 3EUDA 4R97C 4UQ2B 1IO4C 3LZFH 4LQFH 4QI3A 5DRNB 3BQUC 4QTHA 5I6LA 2NR6C 5DUBB 1NBCA 4L5FH 5FK9A 5DD3H 1S7RA 3FO0H 3H6JA 3WKMH 4QLRA 4WO0A 1ZGLA 3HAEH 4Y4FA 5IKCB 1MZZA 5AL0A 1JPEA 1AFVL 4KXZI 3HUJB 3KZ8A 4PVNA 2X4TA 4PY8I 2YFNA 2WZ6A 4U4IA 4AV0A 1EX0A 1IBFA 4MNQE 1GAFH 5K9OA 4AKPA 5FUCE 3STLA 2E75C 5B1AB 4A37A 4NN7C 1OPGL 5I1KH 1TFHA 2GI7A 2YD0A 4XVTH 3RUGA 4FXKB 4PJIE 4WI5A 4DF9A 4GW1B 1ID5I 4HOXA 3HN5A 3SGJA 3CPUA 1A7OH 2W0FA 1MJUH 3TA3B 3GXIA 4EN3A 4AEIL 1O9ZA 1OM3L 4YSEA 3QO0B 1FFPA 1FI8C 2G5RA 3LB6D 1TMCB 1YSOA 5E6IA 2WKOA 2E7LC 4I48A 1IAKB 3BAXA 3LHPH 1IE5A 3NFSL 2JIXA 4M5YH 2LW3A 2PR4H 4D9QD 3G6JB 4R84A 2CE6A 2GK2A 5C0ND 3KVQA 1OTSC 1OB1A 4LRIA 4KKBD 1J0IA 4XCYB 3T4AC 3BE1H 4LKCA 2IPUG 5JQHC 4LOUC 2HTKD 4WO4C 1SHWA 2BSTA 1FO0L 2YWZA 3D18A 4EOWH 4MNHA 3OB8A 2A6KA 4JG1H 3L3IA 5H37H 2WWOA 2EIBA 1UCBH 4C4BA 4M7ZB 1A47A 4DPCX 2H9GB 1QVOB 2YD9A 4QF1B 4PWIA 1KXVA 1AXSB 2D0HA 4HMCA 5TQ2H 1O7DC 3TO4D 3GSVA 1L9TA 5EEXA 3V9EA 2R8SH 1L0XA 5HHME 3EYQC 2R4RH 1YNKH 4F1ZA 2X1XR 4JFVA 4ENED 3RUGF 4KI5F 3HNTH 4MQXC 3QXAB 1DQLL 3I6LE 3DOSA 1JTTA 2ORBH 3GJEB 4S10A 5IFJA 3LEVH 2Q76A 4NWUH 2ICWB 1IBHA 2HX8A 1XWVA 1I1YA 2Z6FA 5J6SA 2KUTA 3O11A 4U31A 4B27A 3L3GB 4X6DB 4CSZA 4HDIB 4R7DA 4OKDA 4X6BB 4F1SA 1VB9A 1AR1D 4G8GB 2F61A 2WKOF 5E94B 2R0WL 1P5VA 4ILDA 3IS1X 5EIIG 3KPRB 4O5LL 2XN9D 2Q87A 4RISH 3IDJA 1BCIA 2K6YA 4WF7A 5KYUA 2OI9B 1GYCA 4M7JL 2IFGA 4QHMA 3T4YB 2Y2YA 1GZQB 3ARSA 4Z7VB 5JPMC 2BOCB 2JFCA 1UOKA 2UYLA 3KPOA 4FI6A 3QK0A 4WV1A 3DTUB 3N43B 2IH3A 2XTJD 4K7FA 4TQEH 2V0AA 2Q7NA 4HIQA 1QSFE 5CGTA 2PCXA 2WXQA 4N2KA 1FLTX 5HPMA 4CVXB 4NC1E 4Q14A 1K4CB 2QHLA 1U8JA 1M6UA 3WIAA 2QTVA 3WTUA 4DW2L 1LDPH 2VN3A 1U8CA 2ZKWA 3HMXA 1JVKA 2OXHB 4KXCA 4ATWA 1G1OA 4NSKB 1JRHI 7PCYA 1AS8A 1HQ4B 2E5EA 3ZL1A 3F58H 2HVBA 5INCA 4P2QB 3SO5A 4JO2H 5IZ7A 2F53B 5CLTA 2AZAA 3P9LA 3ZDWA 4P05A 3H3BC 4UIKH 4B9CA 1M9SA 3ZDZE 4D8PB 1LLAA 1XGUB 2DWSA 3MRFB 3VD4A 5L8LB 4AM0B 3V0FA 1YECL 5T1KB 3KJ4B 3ZHFA 4W9FC 3HNSH 4OJCA 1F8TL 5IQMA 4L8DA 1MHPL 5F9WB 5EEWA 5E2UL 4K55A 1U8NA 2J8UE 2Q3AA 5EPMA 4ZTPH 5IMKA 2FZ3B 2DDQH 1MNNA 4KXDA 1LDSA 1JHKL 1V7MH 5IHZB 5K9JH 1ET7A 3FJTA 3QR1A 4ODBD 5HHOE 3T6QC 1CE1L 1DJWA 1JOIA 1NGWA 4K5NA 3UH8A 4KUCF 3KYNB 1QR1B 2DQDH 3FB6A 4UAOC 4BK4A 4RAHA 4UAHA 3CVHB 4AI7A 4AQAA 1M3IA 3IMSA 4FEIA 1TLMA 4GYBA 4GUQA 3V5DA 3VXMA 2ZXQA 3TCXA 4ALAC 1FL6A 1ZGLM 2NLJA 1IBBA 1B90A 3UL4A 1BQLH 4RX4D 1HSBB 3RVTD 2IAMB 1N0LA 3LRSB 4Y2OB 2CPCA 2L3BA 4EJ1C 1MLCB 5BVJA 5KBPA 2QQNL 3ZKXB 3MRHA 4RESB 1KYDA 2OCJA 4HLJA 1Y1UA 2G9HB 3ARDC 3GBMH 5FO2A 3BSZA 3W9DB 1TF4A 3GBNL 4BKTC 1TSRA 5F96L 5C0AA 1HINL 1H8SA 2QHRL 4D0CA 4P2RD 2R9HC 2X89D 3PXLA 2XG5A 1BM3H 4GXUM 4MNQD 3WHXB 5BOJA 2D2OA 2Y7QB 2IFFH 2YRLA 4UTBA 4ACTA 5DI8A 1KBVA 3SOTA 4NO0B 4N85A 5I30L 3D69A 4HXBL 4KJPC 2OQJB 5ACZA 1BD2D 3HZYA 1BM7A 5KANG 5IIEB 3JQOB 4MDJB 1JDCA 4GRLD 5F0MB 1M7DA 3CSYB 1B0GB 5IVZB 4NCDA 3H0TB 3WE6A 4RSYA 3ZOAA 4RMVA 2V3EA 1VADB 4EUPB 5GGRA 3K2IA 5DCCA 4AGQA 4J4PA 3MOAL 2E47A 3GUFA 4NQXB 3EDDA 1CD8A 3ETBJ 3LKQB 3FU7A 1RZIA 1RLWA 2X87A 1J8HA 1CR9H 4JQIA 2COVD 3JV4B 5K1NA 1EK3A 2PYFA 2F7RA 3RA7H 2MOVA 4LVOB 3WMSA 2VDMB 3ZTJH 1GC1C 1T66C 2WV3A 5I16A 5IUCA 4B9PA 4QOKA 1HXYB 5B4MC 3AY4C 5DK3A 3UPRB 4X5XB 3SBQA 1MJ7H 4ODVH 2DQCH 4YHYC 3WN5A 3HBQA 3FTXA 5L9DH 4Z7WB 2OULB 5KVGH 1U8HA 5AB2A 1SFDA 5F7AA 4FJ6A 2P43B 3HIZA 2L04A 1FH5H 1JZ6A 1FFOB 2WWNA 4QNPE 4HUXB 2K9UA 1ITBB 4NQDE 1NCCL 3CMGA 3H9SA 5IVXE 5GISH 3RIFK 2CDEB 4G6KH 5HHMD 4OGXH 4HWZB 1OGAB 1N4XL 3L3HA 3HZVA 3U2IA 4ZXBA 4WZ9A 1LP9A 1WSST 3GKZA 3W56A 4QHLA 3KLDA 2BFVL 4N25A 1YJDL 3BVUA 1C1EH 4PJEB 1OTUC 3FSZA 3SYCA 5ICZB 1FZKB 1LHZA 1Y1DA 3VFOA 1NM9A 3W9EB 4WNSA 3ZE2B 4QTIL 4MWFA 5D2NA 1HH6A 1KBKA 3U6RA 4JJ5A 1ZEAH 2I5YL 2WUCL 1KTLB 3SKMA 3NIGE 1N5YH 1NBYB 2XTSA 3V4PH 5GZOC 2EICA 4HKZB 4Y8DC 2ZSVB 4JZJA 1KTBA 5HHNA 2ITEA 5E6YA 5TJWK 4FNTA 5IESL 2DY2A 4NDMB 3OWEA 4FNRA 4Z77A 1I7UA 5EG6C 1S7VA 5JO5A 5CILH 1X5AA 1QSFD 4MJ4A 5A7EA 1TJIH 2VC2B 5IW1B 3MMEA 1P53A 3GM8A 3PUCA 3UXFA 3L4TA 5IBUG 3VB8A 2YMXL 4DWHA 1QUPA 4PJAB 3WXWH 4X5WB 1ZLUH 1PNDA 5LGJB 4OFVA 4PGDA 1U8KA 5F1IA 1WT5A 3ROLA 4IU3B 5IBLD 1RAMA 1U21A 3AC0A 4LK4A 2F1EA 3VI4E 5C3TA 1LP9F 1XIWD 5D71H 4KITB 5J3HC 2P9RA 3GUTA 1WWWX 4LCWE 4Y88A 4L48A 4M7LH 5CJXA 1A2YA 4ZX6A 3U0PB 4AQEA 1E7VA 3IKKA 1PJWA 1TJHH 3J2PA 4JDTH 4WI3A 3HBGA 2OSWA 2OSLB 4DN4H 2B8OT 3DTXB 3MXVH 1CYGA 4ZQKA 5BQDA 4K3JH 5G55A 4P04A 2ED9A 1DFXA 1HYRC 1WEJH 1UXWB 1TCMA 2D4DA 2YO3A 3FU5A 3NSYA 4PJCE 5B1JA 1QI3A 3SDAC 3QCUH 2X7LB 1F4XH 5I74C 3APCA 2EDDA 2H45A 4WHCA 1EO5A 4PRHE 1EHLH 3UO1L 1W0WA 4YAQA 4FZ8H 1CFBA 1TVDA 3EBAA 4IJ3C 3T04D 2YPLB 3KEDA 3GMQB 5E00A 4KJWD 3NN8B 5FHBH 3T8XA 1K8IA 1DFBH 4LLUA 2JQMA 4XX5A 2EDRA 4C56A 1BSIA 5I24A 2VW6A 3CVHH 1JNHA 2UZPA 5TE7L 4FTDA 4PP1D 5HHOD 1FC1A 3V0VB 5IEKB 3DIFB 4HKBB 3DX6A 4NQVA 3TJEH 2VDKB 4BFKA 4PJHB 5J12C 2BW4A 4PJGE 3DECA 4DKTA 4I85A 3CDFA 1B9ZA 9PCYA 1RJLB 1SHMA 3KH3A 2X28A 1IM3B 1ZVSA 2NYYC 1DJZA 1A7NH 4M29A 5KBKA 3RZWA 1UQSA 5HGGS 3KAAA 4JREB 5ETUA 2VLRA 3IFOA 3V5HA 2UX7A 3TVMD 1FHGA 5FS5A 4FD0A 1JHTA 2BINA 4TUKL 4K3EL 4NM8H 1G84A 3ZMNA 5D5MB 3RWCB 3QG7H 1KTDB 1SXZA 4U1LB 5JIMA 4XB8A 1RKRA 1PIFA 4P4KC 4KOBA 5TD4A 4AT6B 2PYEB 2YXMA 1BZ9B 2P48B 4Y1AA 1VRSA 4P5MA 3BAIA 3IBOA 3EJSA 5JW4N 5KW9L 4AWJC 3K2KA 4GSRA 5T1JA 4LLMA 1AO7B 2YGNA 1UOWA 3OKKB 3EGXA 4NGHL 5IB4A 4W6XB 4LKXA 1KBBA 1J1OL 4OGYH 5I8OH 1K4DA 1PG7W 3OHMB 3U7WH 5K5YA 3AROA 1KMGA 3F5WA 2ZUTA 3BVNA 3TBWB 5ITFA 1KIUA 4J3WA 4TS6A 1MFAH 1RMFH 4KJYA 3SDYH 4KK6C 4LEXL 2P1YA 5DJ0B 2R2BB 5IB1A 5IFAH 5F7YC 1BP3B 2GJJA 4HOMA 5D4QA 3ETSA 2VDMH 3ILQD 3QNYA 2BC4A 2NY3D 3KYOA 3PWNA 1O0VA 4F3FA 3U9UA 3F00A 2XFGB 4QCIA 2QKSA 3KXFE 4OUOA 4FA7B 1N9PA 4X8JB 4X2UA 4KJQD 5BV7B 1EAJA 1Z9NA 1MVFA 1TVHA 1UWGH 2R0ZH 2NY7L 2B5IC 4IRZA 1OD7A 1I7ZB 2SEBB 2WO2B 2WNXA 2FUTA 4LLYA 4PEEA 4W68A 4YLBA 3L3OA 2DBJA 5MERA 3ULVD 3TT1H 5CHNB 3S88L 2D3NA 2MTPA 4M62L 4F37F 1PG7H 1KNOB 4ZFOL 1A6ZB 1O6VA 2NY0D 3GO1H 1YYCA 4GAGL 1U92B 3VFUB 2LGNA 1XCXA 1G4MA 2DN7A 2MMXA 4XMLL 3L3JB 1E6JH 1QR4A 2BMKA 4PJFA 5SV4A 1J9CT 1QUNB 2LR4A 2UVFA 1JGUH 3C8HA 2DICA 4S1RL 4NQDD 3TWCL 3BD5A 3WNPA 3BPCA 4F15B 1UGKA 2AVFA 2I25N 1XB8A 1FVEB 5KAQG 3RI5F 3W82A 4Y7MA 4B9FA 1KY7A 2C3VA 3Q3GA 1NMAL 4IGBB 3LKOA 2AJVL 1UWXH 2WMPB 1Q0EA 1DP0A 3CFEB 1NFKA 5KSAB 3R06B 1Y6MR 3AS0A 4M4PA 2VLLB 5L0QC 2OA9A 5E2VH 2FL5A 3T2OA 5AG9A 5JMOC 5TDNB 4RGNC 4ZOEA 1UYWL 2WCSA 2OMWB 1AP2A 3QWNA 1HEHC 1CXFA 3GSXA 4NHUA 1ZLUK 3ZYJA 3ZE0B 1NEZG 5C0BE 2XACC 5DEFA 2VC2H 5IB5B 2CALA 3VDBA 3DSFH 4NJ9L 4P99A 2BM3A 4WUKH 3U2SA 2Y1ZA 2D31A 1TZIA 2NUTB 1FGVL 4N90E 4H8WL 4XODA 4UZUA 5FF6A 1AY1L 1DJSA 4BFFA 3WFBH 2CKBL 3JT0A 1WS7A 3FO9B 4AC2A 3K46A 3QDGE 4HP5A 3DX9A 5KVFE 4X6FB 3RRQA 2AV1A 3KS0H 4UQ3A 3FO1A 3QIBA 1UHVA 1KPRB 4PJ7E 1OE3A 4PJFF 1K85A 2YZ1A 1FZJA 2JELL 4OZGB 2VR5A 2Q20A 4KVNH 4PLKC 5D1QA 5DDHA 5DQ9B 4L23A 3LZFL 5C09E 5AB1A 3SKJH 5AW6B 1OZTG 2O72A 2QQLH 3MRCB 2LU5A 1IGJA 2GIXA 1F4HA 2VR8A 4L5FL 4N2BA 1EHAA 4LCWD 5ISZE 4X0KB 5DS8B 4OLWL 2GJ6E 3W1ZA 2VNCA 3DO4A 1CVSC 2CUAA 3AWFA 3X1FA 4PN6A 3NK3A 1UT1A 3K6SB 3SE4C 7PAZA 1D2OA 3CFBA 2ICES 4TF4A 2HYMA 2YBRA 3DUUA 1GZPA 1XL6A 4N87A 3CSBA 3VXUA 2HVJA 2YEZB 3SGDH 5T3ZD 3JVFC 4KKCD 2NXZD 1MFUA 3CUPA 1OE2A 1X6LA 4XVTL 3UTSB 2GJPA 2DAVA 3S2CA 3WIIH 1VF5C 3GDBA 2AVGA 3QULA 5E0FA 4MHHI 1HEZB 5EF0A 1A7OL 3WAKA 1MJUL 1MCCA 1S5IH 1ZSHA 1NSNH 2HT3D 4B7IA 2VDKH 3CPLB 3OVUB 4FTVD 3SGEI 2J44A 1GKEA 1REIA 5DJ2B 3A4FA 1ZHNB 1ZJBA 5F9OH 4TVUA 3LHPL 2B39A 4X4XA 4WHTB 3ZQXA 1M6OA 5BPPA 4DKEH 4JHZA 4ZUVB 3WL9B 2AMGA 1YUHB 4Z8FH 3OKYA 2W07B 2BNRA 4PRDA 2O5ZL 3QWOB 4PIBA 4LSTH 4PJBE 4JHUA 4EOWL 5JDJA 5BMFH 5D1ZB 3SB3A 3PS6A 1VLXA 4UM9A 1NCDH 2I27N 1U3NA 1CGWA 1UCBL 3RTQA 4S2SB 3I6GA 4X80H 1K5WA 1A6TA 1XR8B 2QV2A 2ZKXA 5AW8B 5KSVB 4JRYB 1XF5B 5TQ2L 1E6OH 5I1LA 1L6XA 4UDTA 2NX5D 1VSCA 2R8SL 3DXAB 1P69B 1OAZL 2B4CL 1UC6A 3QPKA 4MX7B 4UUJA 1S46A 2QZQA 4EZKA 5D6DC 4ZMYA 2J2ZB 2WXRA 4QXUH 2VIRB 3QUMB 3HNTL 4I2XA 1ONQB 3QFJE 2ICEB 1MJJB 3EDJA 5C0DB 3S3BB 3PP3H 3LEVL 1G9MH 4NWUL 2JB6A 2AANA 2C9AA 3G6DH 3NCYS 1Q94B 5ACLA 1ICTA 3BAJA 1YPZA 2G3MA 5GZNA 1YNLL 2X4NA 4MCYB 3VSTA 3ZKND 5JHAA 5EUKA 1I8LC 5IROD 1AH1A 1D5XB 4TPRH 3I9AA 1MHHB 1TZAA 4IW4C 4KO5A 5BV7H 4QJ5B 3FF7A 3FU0A 3S7GA 3FULA 3GJFA 4RISL 5SWSD 1YY9D 4YBHA 3QIUC 2EE9A 1NGYA 3QUXA 4CMHC 3KXFD 2A83B 2YQGA 1SJHA 1JUFB 4TQHA 4FHKA 2C9VA 3PV6B 1MVUB 4D0BA 3SE9H 4TQEL 1F11B 1KPUB 4L8SC 1UWXK 4L1LA 5I8KL 1EA9C 3P02A 5H4ZA 1IILE 1ZE3C 5FUZL 2WOBA 4UILH 3VX1A 5DEJA 4N0UA 4GUPB 3UROR 4XVSH 5DJ6B 1OTTD 3B5GA 3FSVA 5JA8B 3G9AB 3N9GH 1E2ZA 3ZO9A 5E7FA 1LDPL 3O6FA 1INEH 1S7XB 2GBAA 3QT2A 3FOLA 1ML0A 2MOQA 4KMTH 4APXB 2TRYA 1XXDC 3MNZA 2ZP0T 1J1XH 1ORSA 1DJXA 3QUZD 5L88L 4PW4A 4JFEE 2RHEA 3F58L 4AQ1C 1XEDA 1IC4L 1BLIA 1KDIA 3FCSA 3OXRA 1SXSA 2N56A 4HK3J 4LEEA 3B7RL 1FNGB 4A7SA 2JJTA 1PCSA 1KACB 3UTZA 2WTRB 1JK8B 4N5UA 1BBDH 3HG4A 4HJIA 3B9KA 4UIKL 1YUKB 3U4AA 5MEQB 1I85C 5IMOA 3MV9A 3BWAB 2YGOA 3E3QE 3RDTC 3SD2A 4K3DH 3RNQB 5HYJB 5IHBA 1NJ9B 3OAYH 1XTMA 2YKLH 3A6BL 5I8CB 1U0QA 4PD4J 3AAZA 3QJVB 4XAKE 3TYFA 3EBHA 3FT9A 2OTPA 4DN3H 3SDDA 4HEPA 4MAYA 4KK5C 1L9RA 3KYMA 5EIIB 3ZZLA 1CFNB 3KBFA 2JF1A 1G7JA 5EFIA 4ZTPL 2CO6B 4ORGB 1H3XA 2DDQL 1S7UB 5IF0A 1S3KL 2E8YA 2Q8BH 3B5HA 2FO1A 3CSTA 1TTRA 1U4EA 1FO0A 2EYRB 5DK2A 5T3XD 4N90D 4M7KL 1VFOA 1K8DB 3N42F 5J6GA 2AI0H 5K93A 1UZ8A 3AB0C 1BBJB 1UENA 3T2NH 3ZHLA 3BZEA 3ISWA 1GYWA 1R3IH 5EOCJ 1KJ2L 3HJEA 2DQDL 4AJVA 4E42B 3WJMB 1ASOA 3OHXC 3O8XC 4KH2A 3KPPA 3W11D 5EBLA 5HGBA 1KYAA 1P5UA 4DSYA 4OF6A 1LJMA 1Y6KR 4ZNEE 1BQLL 3DUHA 3CC5B 3GS7A 5F89B 1GSKA 5C6PB 3GMRB 1HVXA 3FUFA 3MYJA 1E40A 3R0MA 2FEDC 5BQ7A 1TEYA 1JV2A 2FSEA 2RCSH 4EMZA 1CL7H 1A5FH 1I1FB 2GJ6D 3KNBB 3NSCA 2PCYA 2AK4B 3DTDA 3RGVB 4PRBA 3T1WA 4DUXA 3N41B 4CBPA 1HXMB 3ZW3A 4MB4A 4LSSH 2QGEA 3C9NB 4BQCA 2IFFL 3MRLA 1BVLA 1L7IH 1DUZA 1MUJA 1C16B 1QHOA 2BJMH 4NENA 5DVLA 3S98A 5CXPA 3PWVB 1IAIL 3QCVH 3HRZC 3TX4A 1JWSA 2H0EA 5GGVH 5JXEC 2Q7AA 4UIMA 4LNRB 4Y4FD 2VLJB 1HYSC 2HMID 2IADB 2NY4B 3N55A 1BYOA 4OKVA 3OGOE 3QPXH 2XBDA 2DH2A 1QFUH 5H2BA 5BCAA 1G0XA 2X4OA 4NUJA 3K4ZA 1NCBH 3NCFB 3RWHB 4MAUH 3W0WA 3VXSE 3LZLA 2CRZA 5E6ZA 1C7TA 2ITCB 3Q6FB 3IFPB 1Z1WA 4RVBA 2V17L 2FBJL 1JSYA 3QNFA 1NOAA 4UF7C 5DA4A 1UGNA 1XSJA 1QRNB 4WNQA 3RA7L 3GSQA 3CN4A 4PVBA 2LABA 1E9PB 1NGXB 2HZHA 4JFOA 2D4FA 5CZXC 2ADGA 1KJMA 3PP3K 1T21B 3DV4B 5I75C 4U6YB 4ODVL 4GQRA 1HH9B 1BZOA 1CXIA 3EZJB 3GC3A 3L13A 4L3FA 3U4KA 3WOVA 5CD3B 1WC7B 2YC1A 5HDBB 1U3HB 4F2FA 4R2GB 3QUMH 2J1XA 4JM2B 3MJ9H 3RWDB 4ZSOB 4GLRH 1PCXA 3IVKA 3MLSL 1N5AB 2F68X 4G6KL 3N44B 4HJTA 1QWUA 4LF3A 4OGXL 5IQOA 5LWYH 2Z7YA 4UOZA 1T83A 1A0QH 2QMKA 1HL5A 1HOCB 2ZYIA 3I2CH 1X9QA 2ESVE 2WZAA 1UM6H 1SF5A 3ZTNH 5D2LE 1H15B 1C1EL 3MRDB 1RZ8A 4XBEH 5CN2A 5JW3H 5EBMA 2KMWA 5AKTA 5JTWA 1CG9A 4MVBC 1JPST 1KB9K 1J1PL 3BAKA 5C70A 3PAUA 4GSDH 1Y0LB 1TTGA 1ZEAL 2Z34A 4JCMA 1GOFA 4I9WD 1OOAA 1N5YL 3V4PL 2GAZA 4M6NL 1NIBA 2OL3B 1RHHA 1XR9B 1L3NA 3QEQB 3F3HA 1D9KB 3FU3A 4C8XA 3X1BA 1DL7H 5EEYA 3NTCH 4J3OF 1I7TA 4D8OA 3T0EC 4JG5A 3OQ3B 3F8UB 1FVDB 4O2FB 1T0OA 5BZZA 4R3SB 2A9DA 1TU2A 4NPKA 2PPEA 3HB3D 2G5BB 5M7QA 5H94B 5I6XC 3PU7A 3P3SA 2ZKYA 1TJIL 5EBWB 3VXPA 2FO8A 1XGPB 4PBVC 1IAOB 3S36X 4GIOA 3NIDE 3A67H 4U1IB 1YA5A 3OAYK 1RJYA 1TOXA 3LXAA 3WXWL 1XZ0A 1J7VR 2LHAA 3TT3H 3ILEA 5CWSB 1KTKE 4KTEH 3D6GA 5I26A 5FYJH 2GTWA 3GM0A 4JFED 5D71L 5LCVA 1KPVA 4MB3A 1ACXA 1Z5YD 5DHVA 3S8WA 1TJHL 4JFFE 2F54B 1CBJA 2O4EA 4JDTL 4DN4L 2I07A 3B6SB 3M7FB 3PQYA 4FKHA 3J8F7 4WKZA 4K3JL 5FFGA 3U0WH 1Z5LA 4U3SA 5JIHA 5F97E 1IAII 1H0DB 3MRMB 1KIQB 1OD9A 1WEJL 5DJ8B 4F7CA 5JZ7C 1E4XH 2P5WB 3QCUL 3L3KA 1F4XL 3QJUB 2WSPA 3IAPA 3FFCB 1BGXH 5CEZL 2F6AA 4FZ8L 4ISVA 1BG9A 4K8RL 2CDGB 4FQ2H 4PJ9B 3UTPD 5FHBL 5DTFB 1NDGB 2O61B 1KSRA 4IIZA 3VFMA 3B2PA 5LUMA 3CVHL 4PYGA 2IG2H 3HNVH 4BFBD 4XP1H 2VQ1B 4Q74A 1MCIA 4XPBH 3LB6C 3S4SA 3VAEA 1KN2H 4CC1A 4Y5YC 3QORC 4M61B 5CJOL 4D0DB 4O4YH 5F88B 4QNPF 5EN2A 2BNQA 1PZSA 4U33A 4IKKA 4DQAA 3ZHKA 3DX7A 2UWEE 4EIBA 5JOFB 3B7TA 1A7NL 1X7SA 3MI6A 4JN1L 5IBUB 2DQMA 3FMGH 1BPLB 2N7BA 4XB3A 2ZUQC 3G5XB 4KKBC 5LXGH 1OVZA 2TRHA 4H13C 1Z0NA 4QHNB 3TN0B 5J89A 5DS2A 1E30A 1VENA 2ICCA 4HUNB 1RZJH 4NM8L 3NK4A 3SKNB 1B2YA 3OJMB 1V8HA 3QG7L 1XGQA 3I02A 4PBWD 2MQ3A 4G43B 4YJZL 5GS0C 4XBMA 3KHOA 3UTQB 1QFOA 2WOYA 2FECL 2HKFH 1LNUA 3TM6A 3BIBX 3D39A 3D7PA 3FQTB 3TO4C 2CBTA 3DURA 1ZV9A 5B38G 1AE6H 3MLXH 5KYYA 4OGYL 1NCJA 2VL5B 3BWUC 5I8OL 4XXDB 1E5ZA 3VXNB 2GC4C 4X4MA 4UZGA 5E1IA 3WNLA 1BVNT 2HKHH 1TKWA 4ENEC 1HN1A 1IB5A 1K6QL 1J9RA 1MFAL 2R1XA 3SDYL 1NUDA 2Y72A 5IQLA 5IFAL 4W9GC 1NC2D 3H1ZA 1Z0MA 5I1CH 2CLRA 2BPBA 2FX8H 2CMRH 4TLKA 3VXSD 1KLFB 4AMKH 4RGOL 4MA3B 2NZ9C 5FGSA 4TYUA 3WS3B 1EAPA 1AMXA 5G5DA 2BIOA 3MGTA 3LD8B 4R0LA 1MCRA 3EO1B 3AS2A 5FA3A 1A1OB 4E9QA 2R0ZL 4DPBX 4G1EB 4B6ZA 3NJNA 2F15A 4PRPA 1X4XA 4ZUSB 4DIXA 1FSKB 2BP0B 3MRKB 1M71B 4PG2A 4QHUA 4XCEA 3TT1L 2DQGH 3BO8A 3VG0H 1PPIA 5I66B 1WUZA 4P5TB 3UZEA 1WRFA 4Q6IA 1QBBA 2XTJC 2C9XA 4HKXB 4J4PD 3GO1L 5D4JA 1OAQH 2DLEA 4G5ZL 2KH2B 2ILLA 3FN9A 1TTFA 1ND0B 3BP5B 5C0GB 3RJDA 3QHFL 1R3LA 4MJHA 4PJCF 5LBSH 1JGUL 2ZJSL 3I6KB 1DQQB 3QQ4B 3HE7B 4HWBL 5I18H 1X5KA 2IPUK 4WGWB 1UADC 4ZDHA 4N1CA 5G4OA 2PR9A 2FBRA 2LFGA 4QJ4B 3D0VB 3Q6GH 3VGDA 4ES9A 4BZ2H 4FYTA 1HHKA 2XPGB 3FT2A 3VSUA 2YSTA 1KZYA 3QHZL 2RQEA 3GXUB 4HALA 2OL3H 3BKYH 4GO9A 1A7PL 2I9LA 1LILA 3UO8B 3H9SD 5E2VL 1WF5A 3UYPB 2WBJB 3TFBA 1SOKA 3EUUA 3MODL 4PJGF 2DM4A 4Y2DD 4R97B 2ARJB 3T3MB 3H9ZA 4Z18A 1C12B 2V9UA 3HMWH 2ADFH 3BQUB 3FSAA 4GKSA 3GPSA 1IJ9A 3TNMB 1WCBA 2VC2L 2H32A 2Z4TA 2NTFA 2VITA 3DSFL 4WEEA 4WUKL 3M6DA 4KHXH 3LRMA 4KO9A 1JS4A 2EIZB 2AJYH 3DARA 4YUEH 4TNWF 3G5YA 3CN0A 1YQ2A 1WDAA 5BRZE 1OF0A 3KD4A 5FKAA 2ISDA 4N2CA 3DX4A 4PGEA 2X6CA 3ECVA 3ZGHA 2P8LA 3FSWA 2VUYA 5DD6A 5HGDA 3L3DB 1G7QA 2QGBA 1I1AB 1FVCA 1NA8A 3BFWA 4DVBB 1QSEA 3P73A 4G1MB 2ODHA 4KVNL 5J4MA 4NQCB 3SKJL 5TDOB 1N67A 4LL4A 1VFMA 2QQLL 1OSZA 4FA6A 5KSBB 4I89A 5D7KD 3CD4A 3BRDA 2C7UA 1FA4A 2FECI 2UY7A 4MD5A 4WK4B 3RY4A 2CAKA 3TBVA 3Q44A 4ZMPA 3VG9C 1R0AH 2YLHA 4KDTC 3RVTC 4LEOB 2VDNL 4MNGE 3OR6A 1CQKA 4JFFD 3VFNA 1UB6A 3TZVD 2EDOA 1FZMB 3LNGA 4HHAA 3QAZC 4NB7A 3PHSA 5CZVH 5TPWH 5B3JF 4NFCA 4NKOA 5DMYA 4XPHH 3UMNA 4GSQA 1KWGA 5FLUA 4L18A 3L1FA 3MLTA 3FO2A 4PV9A 3ZT5A 3GT6A 5C07A 4A2DA 4G8IA 4DZ8B 1ETZA 1NBVH 1S5IL 2A73A 4TNFA 3IM1A 5FUCC 3TBTB 1JF5A 2VDKL 2FT8A 1P7HL 3ECBB 3MQIA 4HUWB 5EC1A 3RWJB 1NEZB 1AGCA 3LZNA 5D72H 5F9OL 4HCGA 3OD3A 1NANH 3QDGA 1BYNA 2BY3A 4LGSB 2VKXA 2A74A 4DKEL 4PJ7A 3D3VE 4ZFOA 1CT8A 1PEZA 2Q3XA 1ZK5A 5D96C 2KI6A 3WTTA 1QYGH 3P9MB 4ODHH 2X9YA 4ADIA 4LCCA 2RALA 1YEDB 2XBTA 1M42A 4LSTL 1AKJB 4NT6A 4TVPD 5BS0E 4OM1H 5HHQB 3EO9H 5CFAA 1ZLSH 1HKLH 4ZPVA 1JPFB 3LAFA 3RILA 5IOPA 4X80L 5SWZB 4MMZC 3UERA 1G94A 1JZHA 1TQVA 2FLMA 1E6OL 4YSUA 5FYKH 3GHEH 2OS7A 4FEMA 4BV1A 1CFQB 3WCYA 4F7TA 5K69A 1T22B 3BZFB 3IMRA 5JPMB 1XGZA 5FYLE 3E80A 3MV7B 2CHZA 3DO7A 3PREA 4ZAKA 5C9KA 2RQ8A 1I8IB 3QA3B 3UBXA 1SGKA 4ZMZA 1HJCA 2EYTA 2P8PA 1G9ML 4R7VA 3G6DL 1JPTL 1A9BB 3QUGA 1A9EB 1F4AA 2EIKB 4K23H 1BMZA 3LNFA 5D6CB 2JI2A 4PJ8B 1U8QA 2FATL 4XZUB 5AZUA 2XCMC 1YMHB 1KF9B 4P46B 4Y1TA 1NMBH 2CKBA 2DJSA 1S9KC 1N6UA 2XVLA 4HA1A 3VWKA 4PJ7F 4RA0C 7FABH 2VRQA 1SBSH 1XGRA 3GDCA 3QZNA 3P11H 3NCJH 4KQ4L 4CMMB 1NOLA 1RY7B 4IKIA 4FXGC 2XYCA 1G1CA 3BRFA 3WUWA 5IR1A 1HKFA 5T1DH 4Z3IA 1RFDH 3OKDA 3UTTE 1PIGA 4PJDA 3OMNB 4GRWB 1EH9A 3ARFA 4AC4A 1J9QA 5L2KB 5JNYB 1XCWA 1PDKB 4FC3E 4OD2A 4UILL 3LXCA 1KJVB 2V5MA 3RBGA 4NWTH 2QVMA 4XVSL 3MJGX 5IB3A 2V2TA 3N9GL 3HZKA 5HVFB 3HAEA 3N0AA 5J6HB 1INEL 4JFDE 5FC9A 1F2QA 1CD1A 2NQ3A 1SYVB 4KMTL 5AZEH 3GXTA 4BFRA 3QEUB 3B2UD 3F7YB 2FJHB 1J1XL 1AMYA 1MOEA 2F0CA 4KDWA 2V5RA 1HWGB 8CGTA 1C8QA 5G4NA 4PS4H 4HJ1A 1OP9A 2DMBA 3CX2A 4E9RA 1R17A 5IBLC 2GSGB 1F1GA 3VXRA 1BBDL 1XIWC 1BOGA 3CZFA 4UAOB 4DP1X 4NUPA 4X6EB 3WYRA 4KRLB 4K3DL 4FFZH 3OKMB 4WWID 2YKLL 1ZHBA 2B0SH 4QR7A 3GLDA 3QXDB 3OGCA 3P77A 1E5BA 2BHZA 4HC1H 4L3EB 1LO5B 3RWEB 4DN3L 1ETB1 3MRBB 2NY5C 1I9IH 3ABGA 2DM3A 1RZKH 1CLYH 3DETD 1HDMA 3ARDB 3K2UH 1JPGA 5JORA 3NABH 5CCHE 1YEKH 4GW4A 1BJ8A 5AAMC 1KYUA 4E5XG 4BZ1H 1XGYH 3MLVH 3PAZA 4XMPH 5D4IA 1JK9A 4PJDF 4KJWC 3WEXB 5H37A 4G6JL 3T2NL 5FAAA 2DWDA 5BRZD 3PGFH 5EZLA 2V7HB 4ONGH 1Z5HA 1Z3RA 4PP1C 3O45B 2Z3FA 3ESNA 3L1OH 3FBKA 4KK9C 2W5PA 4FLHA 3UAEA 5F3HB 1HCVA 3RL2A 4QDGA 2QDWA 5LLIC 4UMGA 1R5VB 4JDEB 4B0MM 3QS2A 5D93C 2IANA 4V1DE 5CGYD 2RCSL 4ZRGA 1CL7L 4J3OC 3DJSA 3MLRL 3GRGA 2VW4A 2A4EA 3VI3A 5LAXA 3TVMC 3HZMB 3JTTB 3QIBD 4FGMA 3DSNB 2QGCA 1AHMA 4AYFA 1TR7A 5JUEH 4LSSL 4EI0A 3ABMB 2V8MA 4JZOA 2OMYB 4P57A 4PRIB 1J0YA 2AW2A 2ZAIA 4TTGA 5J06A 1L7IL 2JJVA 2BJML 4FYRA 3LS4L 3GI8H 4G9FE 1JGIA 3IDIA 3M8OH 1TYEB 3Q5OA 1KGJA 3MRJA 4ABVA 4M1GL 1ITCA 4NRYB 4GG6A 4K71C 5ES4B 3QPXL 2C9PA 2GHZA 1QFUL 1MH5A 1UXLA 4HJJH 1AHWA 4DAGH 1AGBA 3S97C 3UX9B 4HISA 1LE9A 1NCBL 1G7LA 3AABA 2MWCA 2E9JA 5FYJU 3REWA 3ZKMD 2HJKA 5D7JA 4ANKA 2ZUYA 1QA9A 4L4VA 2NY2D 3CFKB 2N0MA 3RKDD 4E0RB 1QI4A 2V5SA 4JFXB 2VTFA