3W56A

Structure of a c2 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
108
Chain Sequence
HMQLRLYNLRVRGLPSGITDGYVKVFCGSANLGETSVNHNNANPWWTEEFSHFKAQENDILRLEVHDEDTFFDDLLGVCQRQIKVGTHEHDCYLKEGGTLHYMYTLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining the interaction of perforin with calcium and the phospholipid membrane.
pubmed doi rcsb
source organism Scophthalmus maximus
molecule tags Lipid binding protein
molecule keywords C2 domain protein
total genus 27
structure length 108
sequence length 111
ec nomenclature
pdb deposition date 2013-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3w56A00
5H4ZA 3FDWA 1DSYA 4L1LA 4HVBA 2QZQA 2R83A 3F00A 2RD0A 2EP6A 3KWUA 3RDJA 4PS7A 1DQVA 1DJZA 2K4AA 4FHJA 1W15A 2CJTA 2Q0ZX 5T8IA 3IM1A 4FJZA 1E8ZA 4QJ4B 3R7RA 3QR0A 1V27A 3L08A 2CHXA 4WWNA 3N5AA 5KJ7E 1HE8A 3JZYA 2YRBA 3DPDA 4Y1TA 3L13A 3RPBA 3SD5A 3FBKA 3ZW3A 3PYCA 4ANUA 2WXIA 4DK5A 1UOWA 1E8YA 4F93B 4EZLA 3TJPA 5JHBA 4AJWA 4NP9A 3HHMA 1GMIA 3QJZA 4QJ3B 3L9BA 4KITB 1RLWA 2CM5A 2WXQA 2WXMA 2DMGA 2ENJA 2WXFA 3ML8A 4GB9A 4WWOA 5CCJA 4URKA 4J6IA 5G55A 2CHZA 2QZ5A 3APFA 3CSTA 2A4ZA 1BCIA 2WXJA 3OHMB 4NS0A 2ENQA 5JHAA 4WAFA 4HLEA 4G11A 1DJIA 4ANVA 4JPSA 5EDSA 3PS6A 4ANWA 3B7YA 3P2BA 5H4YA 1BYNA 1WFMA 2ENPA 2B3RA 1RH8A 4V11A 2WXKA 3KWTA 4XE0A 1DJWA 2K3HA 3QARA 2D8KA 2LHAA 2Q3XA 2CM6A 3T8MA 4FADA 2BWQA 2WXPA 4WEEA 4BFRA 4L23A 4TUUA 1TJXA 1E7UA 2N1TE 4GNKB 3R7QA 3W57A 3APDA 1WFJA 2JQZA 3NZUA 2ISDA 4KZ0A 4WWPA 4DNLA 1UGKA 4F91B 4FHKA 2A5UA 4Y1SA 4XZ4A 1E8XA 3NSJA 4XX5A 2UZPA 4BGDA 1DJXA 3TWYA 4AOFA 3ZIMA 3IBEA 3W56A 3L4CA 3HIZA 3NZSA 4F92B 2KI6A 3ZVVA 2WXLA 4LT7A 3F05A 2CJSA 4A55A 4EZKA 1QATA 1YRKA 3CSFA 3GPEA 3S2AA 3MJWA 4LCVA 1A25A 2WXHA 5CCHE 4QJ5B 3PRZA 1K5WA 3L54A 4F1SA 2WXGA 4FA6A 5CCGE 3F04A 3ENEA 4ANXA 4FULA 4ICXA 1QASA 3F01A 2WXNA 4PS3A 2X38A 3APCA 4IQHA 3QK0A 1DJHA 1E90A 4OVVA 3QAQA 4IHBA 1RSYA 1TJMA 4FLHA 5G2NA 2K8MA 1CJYA 3L16A 3M7FB 2DMHA 3ML9A 4LDCA 1W16A 2YOAA 2Y3AA 2WXRA 2Z0UA 3PREA 4TV3A 2FJUB 1E8WA 4EZJA 4FJYA 4NPKA 2FK9A 1DJYA 3PFQA 2NQ3A 4PS8A 4L2YA 2K45A 2ZKMX 1E7VA 4NPJA 4MJJA 3TL5A 2WXOA 3QR1A 4TS6A 4ICWA 4OVUA 4QAMB 3LJ3A 2CHWA 3OAWA 2V4LA 1DJGA 2CHDA 1BDYA 1UOVA 3DBSA 4L1BA 4KZCA 3L17A 2NSQA 2NCEA 3HN8A
chains in the Genus database with same CATH superfamily
1KGXA 4M48L 3EYOB 3WY3A 1IBDA 2AXJA 4MJ6A 1E40A 3LZFL 4FL4C 2EVHA 1RULH 2DIEA 2WUCH 3TBTA 2VDNB 3CFQA 5F21B 2PP7A 4L4VB 2G75B 3V5KA 3CCHB 5DRXB 3L9YA 3JQOB 3W37A 2P8PB 2R56L 3LAFA 4A6YA 2IDFA 4WFGE 5A7EA 2D7OA 2MOQA 3LNFA 1AYOA 2YARA 3W2DL 2EEXA 4W9EC 2YHGA 5FOBA 5TE6L 4N68A 3RDTA 4BK5A 2OFQA 1IC5H 2VSCA 3BAIA 3HUJB 3B6SB 4KK6C 4KVCH 5GJSL 5KWYC 4OF5A 1J88A 4RMSA 1JGEA 1JWUB 1UXWB 2PUQT 1C5BL 4YHKH 1QNIA 2EDOA 4QHUA 1EDYA 4CVXB 1DO5A 3IWUA 3KJ6H 1N8ZA 3DX9A 5FKAA 3N44B 1UJ3B 5IMKB 3QG7L 3EBAA 3DHJA 4N4YB 4OCXH 3EDJA 3F62A 1HHIA 4NQVB 5CBEA 3QNXA 4U1HB 1CYWA 4WEBH 5HYFA 4DVBB 2Q8AH 2VXUH 3S96B 3CDFA 3FT0A 1YMHA 5BZDB 3ZDYF 4PQXA 5I66A 4HP5A 2D31A 2X2UA 3JYBA 3OPZH 1LO4H 3QHTC 4JPKH 4OFDA 5JTWA 2BW5A 1T3FA 2NXYB 5D7JA 3NSXA 3EKCA 4F91B 4BZ2H 2Q8BL 3DROA 2XI9A 1CWVA 3AS1A 3L3IA 1BOGA 2ERJC 1BEYL 2FD6L 3WLWD 5LBSH 2Z4QB 1NUNB 3O6MH 1K2DA 1Z3GH 2VDNL 1OAYL 2Y7OA 3TWYA 2F5BL 3MOAH 4KOBA 4NUPA 3KWXA 3BLKA 3F85A 1XGYL 2JJWA 4LGSB 3HC2A 2C1PB 1CPUA 4MA1B 3S2AA 4AQEA 2R15A 2CDGB 1CIUA 4QOKA 4FMKA 4ZXBA 5IQ7L 4Q9QL 1L4IA 2OMVA 1SEQL 3BVXA 5EO9B 4HIHA 1T83C 4XOAA 4EI0A 2M2DA 3IFPA 1S7RA 1E3ZA 1KCVL 4AUUA 4FABH 2ED7A 4Q8BA 3BO8B 1X7QB 2WZ0A 5DHYA 5ID0A 4X5QA 2F7OA 1I1RA 4LDCA 4UIKH 5D2LB 1GGBH 4PGJA 2V9TA 4HWBL 4PV9A 3W1ZA 3FH8A 4LEOB 3CFJB 3LZRA 2J3SA 1E8WA 4WHTA 2WTPA 4N0FB 4WUKL 5D70L 1JPGB 2BIQA 1CXLA 4GS7C 3IDMA 1AI1H 1EEQA 2FNBA 3UTQB 4NUGL 4GAGL 3IAPA 3HBGA 4FZ8L 3U36B 5F96H 3LPWA 2IGFH 2NCEA 4NENB 2VDQL 1QZ1A 3TC9A 3RWCB 4X6CF 2VDLL 5GJTH 2V8MA 2EP6A 4XNYH 4Q7DA 3A22A 4LSTL 1EFQA 3DJZA 3LOWA 2LLLA 4EXPX 5CJ5A 4DCQA 2NX5A 1JP5A 1QA9B 1MJJA 3B8YA 4N2HA 7FABH 2AABH 3O8XB 4CADA 1XF3B 2JCCB 4RDBA 4XBEH 2H3NA 4YX2H 3ZT6A 2E6JA 2GT9B 4BFGA 2OR9H 4YUEL 4X4YA 3UPRB 3L3KB 4JO2H 4X6DB 1IC4L 2XJKA 2GIXA 3DECA 3UXFA 2B5IB 3PXJA 1K8DB 5TTRA 3QUYD 3DPBA 2O5ZH 3LIZH 1QHPA 4N2FA 3B7SA 4P2QD 3VNYA 5ANME 3DYOA 3PL6D 2EE6A 2XN0A 4I0PA 4ANWA 3SCMC 3P2BA 2VC2H 2P52A 1QI5A 2ZSVB 1MHPH 2COVD 2E27L 2ZOKA 2AK1L 2OSWA 4ZMPA 1LO5A 3KH4A 1YYML 4PBWD 5B1CA 4IHOA 4AMWA 2I25N 1LDPL 4LLMB 3NZHH 2VITB 3MYZA 2XOTA 4OSUL 5C97A 4LL1A 3ULUC 5IG7A 4ODBD 3AREB 4F3FB 4K3EL 2ADFH 3NH7H 2X2IA 4FMVA 4KDVA 4TUJB 3WLBB 4R2GC 2W92A 5DDHA 5FYJD 5C07E 5ICYA 2E8YA 2X6BA 4BSWA 2YD9A 2ADGA 2BPBA 5TJWK 1J8HE 1HXYA 1WCQA 3ZTJG 4ETYA 1OB1A 2VN6A 2XKUA 5FYKL 4BE6A 1U0QA 3PHOB 3ZKQD 2UX6A 1IEBB 2Z9TA 4QRRA 1G7PB 4FXKB 2GSMB 4F27A 1JWUA 4X9HA 1NPJA 2DWTA 5ACZA 1XAUA 2CD0A 1B0GB 1DN0A 1LP9F 1UD3A 1FCGA 3GWJA 4KXDA 4YHPA 5GRJH 4ALAC 1EAPB 5FM4A 5ESQB 1RZ8A 5JIMA 3HR5A 3LRGA 1EXUA 2AEQL 2IANB 3BWUC 3U2SB 3H0TA 3MNDA 4QTIH 3FN0L 5F3HB 3CSGA 4F37K 3GEFA 3S7GA 2GI0A 4AT6A 2XG4A 3PQYB 1CGSL 4J8RA 3L7FB 2D2CC 5AVZB 1RZPA 2RD0A 5C08D 4Z7QB 4OZHB 2DWSA 4PGDB 1W15A 1M71B 1R34A 4YE4L 3IM1A 3A67L 2ZUWA 1VFMA 3QJXA 3RWIA 1CFMA 1EJ6A 1KTKE 3AM8C 4NIYE 4Q58C 2P26A 2WM0A 4ZW8A 4E36A 3EO9L 4QHLB 2F58L 2NY0B 3GBEA 2VISA 3VMOA 3U46A 3GMQB 4OT1L 3QUMB 1L3NA 2PTTB 3LQAH 5DMKB 5JW4M 1UA7A 1FVDB 5DQ9A 2GTQA 5GGSY 2AQ1A 1IC7L 1ACYL 3NDZE 3V4PH 3IDIB 4NQCA 3WV0A 1FFRA 1ICTA 5IP4A 1JBJA 3RLSA 1BIHA 2WQVA 2BH0A 4PJXF 1MFCL 3GMNB 3NCJH 1E43A 5DZJA 5FM5M 2QSQA 4G6KL 1J9RA 5EOTA 2DQIL 2MQ3A 4RMQA 1SYSB 5DJDB 5FKPB 1EAQA 1QRNA 5D2LA 4JPIB 3SN6N 2Q86A 4WUKH 1IC0A 4HIIA 3WE6B 1JYVA 2BNQB 1PLAA 1I1FB 2QSCL 1MVUB 1FN4B 4NHCH 1S3RA 2YN3A 2W65B 3GSVB 3KH3A 3T3MF 5F1NB 4YHYB 3ELQA 5BOJA 3GDBA 1YNKH 5BJTA 3B9KD 3FUJA 4JRXB 4Z8FH 2V0AA 3I50H 1FC2D 1QAWA 4X8GA 3M1BA 1JGDA 2VDLH 2ZX7A 2EDMA 4U1IA 4RESB 4K73A 5F89B 4P23C 3VXSE 2ZTBA 3PDGA 1T22A 4X5RA 1XF4A 3KGRA 4I0PC 4PLKD 1HINH 2WVVB 3N1FC 4WQOA 3HZMB 4V2BA 5EN2A 3B8SA 4GIOA 1OP5K 1OGPA 3IB4A 5BRZA 4Z7QE 2WJ5A 1F5WA 2QPSA 2WO2B 3D25B 3N1GC 4BD4A 3O3AB 3UOAB 4LHUG 5KYWA 2HFFB 1WAPA 3KXFB 1BAWA 1MRDH 3WXWL 1G9MC 2XV0A 3AWFA 2BRRL 1SVCP 4Y7OC 5CJOL 4KWUA 3WKPA 5AKSA 1EXHA 2FQDA 5KVGL 5FA3B 2CLVB 2Z7WA 2DQEL 5I8EB 3CC1A 1MI5B 2JJTC 2YWZA 1KY7A 3AXLB 2JKJA 3BOVA 4QPEA 5D7LE 4NNXA 3WG7B 1UKTA 2BHZA 5T1LD 4AIZB 3L4TA 2F54A 4WNSA 4NC1E 1QHOA 4FQQB 4BQCA 4A6YB 4XVUC 3WU1A 3BISA 4AYSA 2NXZD 4F7MB 4NQXA 5T33H 5LUMA 2YD6A 3CXDL 1RJLB 4PJDA 4JDZA 4LSUH 1N64L 4G83A 1A1OA 3ZE0F 2B4CL 4OUUA 43CAA 5I75C 1YEWA 2XKNA 4ODXA 3EYOA 3BDYL 5DVPA 2P5WE 4MAYD 5IHWA 2X87A 1GZHA 4ZMWA 1D9KC 2GJ6E 2XQ0A 2NUPA 1CZ8H 3KLQA 2IFFL 1QSED 2AC0A 2A74C 1HVXA 4U4IA 3CV5A 4OZFB 1KGWA 2LU7A 2VMFA 2X4QA 4YMPA 3MUGB 3BWZA 4FKKA 2DQGL 1D6EB 3VI3F 4DK5A 2EDJA 3QAZB 1PYWA 4HJUA 3PHQB 3FQUA 3QUMH 4HIXH 4X80L 1AZVA 1T0OA 1OPOA 4ZX5A 5KSAB 2X4TA 1WF5A 2FIKA 3OLGA 3OJVC 3V4PB 1QYGH 4IBVA 2ITDA 1ZVSA 4PRPD 4M6NL 3LEVH 4NNYA 3UP6A 1YSOA 1QLEH 2F8OA 5I5JA 5D72H 3DMMA 3NEEA 4JHZA 1LE9A 2H0PA 2QR0B 2Z31B 4PG2C 1YO4A 3L9RA 3QWOB 4TKWA 1S3KH 4YXKL 5ACZB 1NCJA 3BYYA 4I18A 4I0KA 4MHHG 3ZX1A 4YSCA 4YDMA 5LGJB 3RVUD 2V2XA 3KJ6L 2BNQE 4LMQI 5EZJB 4RGNE 2W81C 4YQXL 3J8F7 2VDRB 4X4KA 4HCRL 2HMID 1XO8A 4B27A 1XF5A 1QD0A 3T0WA 3X2QB 3I75A 3NJLA 4MX7A 2QADD 4OM0H 1E8XA 1T3FB 2FQFA 1Q1JH 2YMXL 3C2AL 3KDMA 3O8XD 4H44C 5DMGC 4DVRH 4ZMQA 4EI5A 4NOBA 2XPYA 3P3YA 4G8GB 4PP1C 5HGHA 4ADJA 5JXAH 5A2FA 5K93A 3W56A 3VB9A 2UY7B 4LT7A 4RRPA 3NFPB 1RK1B 4N9GA 1GAFL 1M6UA 2FJFA 5FW6A 3L3GA 5AB9A 4R7DA 2CCLA 3A4AA 5F71A 3B2PA 1KBGH 3F6JA 4NJAL 5SWSD 1T1WA 2HTLD 5AW0B 4IBYA 4Q4IA 3HI1A 4JGJA 3ULVF 1XZ0A 4MLIA 3V4PL 4K94L 2XXCB 2J8UA 4LSRH 2D03H 2KH2B 3ZTNH 2OX5B 2XSKA 2DQMA 3S5LB 1UXSB 4PGCB 4NFDA 3VFMA 1UA6L 3ZTJH 3NSFA 3MRRA 3WNJA 4G59C 1NGXA 2ZWNA 2BINA 3KYKH 5D7IE 2V3EA 4IBQA 5D8JL 4B7LA 1EAJA 4KTEL 3BP5B 3NJFA 4ZQKB 1XX9C 4AENA 3I50L 3FDWA 4DSYA 2APSA 2W9EL 3OZ9L 1S9XA 4O2EB 3EJPA 2H7WA 1AH1A 1HILA 1PCSA 4GFTB 1TLMA 1NANI 5FDWA 3QUZC 1J86A 2ZJSH 2FX8H 1P9MA 5MHSE 1A4AA 3QCVH 3BLPX 3RP1A 2AK4B 1KCRL 3H55A 4P59L 2GK0B 3CAFA 3FB7A 2YXFA 3ES6B 4PBDA 1UB5A 1XF4B 1QMUA 5BXFB 1ZLUK 2E9JA 1A7RL 1TENA 3MBWB 3Q8CA 2HVBA 3D4GA 5CZVH 5KAQG 1SJEB 1A1MB 4PWKA 3WJJA 2A4ZA 3SO5A 4PRPE 2P5EB 2BFGA 1J0ZA 4XPGL 1AQHA 4NQCE 4AL8L 4X6CA 1OSEA 3THML 1S5IH 4ZYKA 1CD9B 1Q94B 1YEDB 4NM8H 4NUQA 1QBBA 2WQAA 3CSBA 4DTGH 5CNHA 3DVGB 4K3JL 4HUKB 5DK0B 1AZNA 1UH4A 1EUTA 4OF3A 1ADWA 4MDRA 3HS0A 1RHHA 4FNUA 1KJ2B 4L3EA 5T3XD 1EHXA 3LPFA 1J1PH 2DM7A 4F7MA 1I31A 3HUJE 4Y5YB 4HBCH 2DL2A 2IO5A 4PJAE 4P48A 5E0QA 3DETD 4UZUA 1E6OH 3HI6L 2AK1H 1B9KA 2WO4A 5JXED 3BFQG 4X50A 5FUZH 4WNQB 2C1PA 4OI8A 4XPFH 4C83B 2VXVL 4B9FA 2IWGA 1XGRA 3ECWA 3UJTH 3ARFC 4P2RB 4YBQC 3RWDB 4U49A 3QORC 2QGCA 2XWXA 4M02A 2CCVA 3QIWD 3TTYA 4EXKA 3DSFL 4FA6A 3L3HA 1NWPA 4LFHG 2GEQA 1QYGL 2CR0A 1GGCH 1UM6H 2WBJD 1U4FA 2B14A 2DQTL 4N22A 1HHGA 3T0ED 4R2GD 5IB2B 3CFIC 2GBUA 3ORJA 4YLQT 1CE1L 3GSNL 4D0CA 1XGPB 1UWEL 3UBGA 3MV9D 5KSBE 1C5DB 5IVXA 1KB5A 4NP4H 2D7MA 1J8HA 7PAZA 1LQSR 2QVTA 2WXOA 4PRHE 2VMEA 3CLWA 3MDJA 3P9WB 5LB1A 1ZOXA 3VXNB 3K80A 2R29L 4FP8L 5D1QA 5DUML 4XB3A 4Y9CA 4PG9B 4HVBA 3AT0A 3K5RA 4AV5A 5DQ9B 1T1XB 5IJVA 4MRCA 2XT1B 4XCYB 4EKJA 8FABA 1FZKA 4B9IA 1HHHA 2WGXA 5E5UB 3NVQA 3UC2A 2F54E 1T5WB 4FJZA 1JXGA 4WI7A 1CL7I 5C3TA 5IHUH 3ASOB 3VVWA 3LEXA 4UMGA 4XN5A 3ZW3A 2VR4A 4S1QL 2WZPD 2OJZH 3S5YA 2AHIA 1QSFB 2OQJB 4PRPA 3S98A 5CZXD 3EUDA 4OD1L 1KJ3H 2B59A 4L8DB 1AZZC 1UVQB 3ARBA 1XH3B 5ILTL 3D18A 4HUNB 4Y5XA 5HDOA 5EU6E 1N9PA 4MXWH 4PTTB 4DO6A 1TU2A 3FB5B 2JK5A 3QIBD 1Q9LA 1SJHB 1BVNT 4FG6D 4KUZL 4MXQD 4Y1AB 1KLUB 4NQCD 3SGDI 3VJ6A 3U79A 3VXMA 4OZIF 4DZBA 1X3DA 2FZ3A 2IDTA 3ARFA 4D0BA 4WO4A 2CRZA 4HAGA 1ZANL 5B39G 1GJIA 2OLDA 4LIQE 5I1CH 2G5RA 1SLXA 3SGKC 2DL9A 2EQDA 2XBTA 1HHJB 5CGTA 1TTFA 2C7FA 2R1XA 4QNPE 2D3JA 4OZGE 1TFPA 4HOWA 3JSSA 5KYWB 4PRID 2KS0A 1UZ6E 1GJWA 1BIIA 2V5SA 3KPSB 3D4ZA 5D1ZB 1FZOB 5F8RC 5HVFB 3NIGB 4GQPH 4PJXA 4BSWB 1X7SA 3QQXA 3W5NA 3AAZB 2DWYA 1C9SA 3G08B 2VUYA 1EHAA 2IBZX 2IOOA 5D96C 2YD4A 1CBVL 3GI8L 1COBA 2FR4B 4KNSA 3ZDWA 3ARZA 3QQ9C 5BRZE 5HVHB 3OR6A 5JYMA 4PWIA 1DJHA 3Q3GA 1GH7A 3F7RA 4ZZFA 2XA8L 3MAWA 3CFDA 2WO3B 3SKUD 4PY7B 4ERSL 5GGSA 5E2WL 2OSLA 5T3XH 1PKQA 2R2HB 2Z8WC 4HK0B 2HWZL 2Y7MA 4AG4L 4Z7WB 3IMTA 2D4FA 4OM1L 1NWOA 3GEWB 5C7XL 5DURD 1RP9A 5MP6H 4M5TA 4K23L 2K78A 1KTDA 5DJZA 1MF2H 1J1PL 3FTWA 5E6RB 4Z7VA 1HYRC 4PJFE 1T66D 3TASA 2NQCA 2NR6C 1IVTA 4O58H 2ESVE 1TO5A 3JWDC 4Z7WE 1ETJA 4WTWA 3LD8B 4KKLC 5H35B 3ZGHA 3GB7B 3WDHA 2CKNA 2B20A 3LH2L 4C8XA 2EVGA 3H2PA 5DD6B 4W9LC 5KJ7E 1FRGH 4CDGC 4N2LA 5EZLB 3AS0A 4MS6A 4UAOB 5LGHH 3SD5A 2X1WL 2ZG1A 3LB6D 4LCUB 1X5AA 2GI7A 3ZO0A 2ID5A 4OLEA 5D1ZI 4DGIL 1F02I 3DLQR 3VFOA 2HFEA 2BM3A 5INCA 2DI7A 4GI6A 2X89D 2MOVA 2WIIB 4K3DL 2VZVA 5BQ7B 4IK6A 2ZKHL 2CM5A 2IALB 4URKA 1MJUH 4FTVA 3Q48A 3QI9A 3EW3B 4N0RA 1PSKL 1SN5A 1TZHA 4XWGL 1IC5L 1IFGA 1MCPH 4MLSA 1OSZB 3TPUB 1YAZA 2ZICA 4RMBA 4FLSA 4BWWA 1B2WH 4DP0X 3ARGB 3BI9X 3OWRA 3L48A 1VZIA 2ENPA 3VYNA 1TQCB 3L95B 3RAJL 3U1SH 1J9SA 4N24A 3KJ4B 4K7PL 1RZGB 1QOKA 1C5DA 2WWOA 5E00A 3T8MA 3WD5L 2FE0A 1JGIA 4L23A 1JTTA 3CSYA 4MCNA 1ZA3A 1NAMB 4PJ5E 3QG7H 4OCXL 2BSED 1E27B 4PVLA 4O4YL 1Q0YL 5I6NA 3II2A 1DBML 3CDGB 1OAXL 2MKLC 4O51B 4AM0B 5TK2A 5LBVA 3L45A 5EEZA 4BZ2A 1SLVA 3BH4A 4LNRA 2FGWH 1AY1L 3FT3A 1P4BL 2ZCZA 4FQXB 2GABA 4NUMA 4G8GA 5F9WB 3NEXA 2OX5A 2G9HA 3U4BL 5JMRA 1NA8A 1NAKH 4PRHD 4XCEB 2FD6H 4IEFB 6PCYA 5E8DL 5TF1H 1CUOA 2ZOLA 4ZFZA 5IV2A 4YDJA 1K8IA 1I8LC 3LZLA 3NIFE 1H9VA 3VD5A 4WI3A 5D1XD 2O5NA 4LVOC 1YNTB 4LXFA 5DURB 3CUPB 4E9TA 1KELL 3D18B 3FPYA 2G5BB 3N85L 3EJYD 2CXKA 1SGKA 2ZYSA 4GAJH 4TUKL 5DHVB 5I1EL 4XMPH 1FNGA 3FCBA 4YFLI 4YC2B 4P3DA 4UUJB 3SY6A 2ESVA 3II1A 5FYLE 3D48R 1BWMA 1BX2A 4APXB 1G6RA 3TVMC 3GKWL 5AVQB 2AK4A 2E76C 2EEAA 4MDJA 4WW2F 1NMAH 2VAJA 1YQ2A 2W38A 1HE7A 2WGNB 2VC2B 4KGJA 4L1LA 1UH2A 2R4RL 2XFGB 3H9SE 2HA1A 2VWEE 4P9MH 4HDIB 1VIWA 2X4PA 3ARVA 1RUPL 1O7DC 2CJTA 4LPYA 1WO2A 5JHLL 4ZOAA 5AZ2H 3P3RA 5KG9A 3FN3A 4XAWL 1TZGL 3NA4A 1D6EA 5DZ9A 5JR1H 3V5KB 4B0MM 2VZOA 1MFNA 3K2MC 4HT1L 3BPLC 4E9XA 4NRXB 2ZX5A 2KPWA 3IVKB 4GKNB 5DI8A 1ID5I 1O7VA 5F3BA 5IMMA 5HDQL 4WWOA 3HI5L 2AEIT 3VFPA 3ABKB 2FR4A 4OV5A 2FT6A 2GHWB 3FYEB 1A6WH 4I3GA 1P6FA 2XKSA 3T1WA 4RH4A 1JRHI 4WDIB 3RUGA 2PO6D 1JI2A 3C5ZD 4ZO7A 1NCIA 2PWEA 3I2CL 4L5FH 3VA6A 3I6KA 3D05A 5TPWL 2VABA 2Y06L 4NKOB 5CN1A 2F15A 4L4TB 3U9PL 3X3GL 5MP6L 4N20A 3QRGL 3WXVH 2HLAB 4G3YH 2M8XA 4MTMA 2EXWC 2FJGA 1IM3D 1DVFD 3P0YL 5BNXD 2C7UB 1T6BX 4OGYH 1B0RB 2AJ3A 1JK8A 3EHBD 1H5BC 2OI9C 3VGHA 4GW5B 4JM4H 5ICZA 5DRWB 4QUOA 4YGAB 3OKMB 3B6SA 1AIFA 3NZSA 4Z3IA 1AGFA 3NAAH 1CGWA 1BMZA 4G42B 1Q9KB 1G0YR 4K2UH 3Q9PA 3QCUL 2FO4B 3P73B 2OZNA 3P2TA 3J7HA 5DEFA 3EF7A 5I1IH 1BFTA 3MCLL 4XPFL 3KD4A 3JWDH 3V7AE 3C5ZC 2K9UA 3ZDYE 3V9FA 4XWGH 5LAPA 1DFBL 3WUWG 2LU5A 3ARPA 5GRVL 4ZMNA 1OF2B 3W0WD 4WO4D 3TWCL 1BECA 2ZXQA 1W9XA 2WKOA 3OKLA 3KPRD 3LXUX 3GLZA 5FYLD 1M7UA 5KSUB 3WOVA 1W6LA 5JPMA 4HWZB 1U3HC 4Z5RB 1HWHB 3MV9A 4I89A 4QGYA 5L0QB 5I1LA 4DFHA 4LCCA 1ZLSH 4PJHA 2FEJA 4MD4B 1QACA 2MTAA 4HV8A 2Y72A 4PRIA 4XI5C 3LRKA 4ZSOA 4I3SL 4YHZH 5AEAA 3RGBA 3BD5A 3D85A 1WRFA 3FRUA 5LCVL 4K55A 3VGBA 4DEPC 3R18A 1MHEA 2PTTA 3OAYH 1M4KA 4RNRA 2KBGA 4YK4C 3VFUB 5CJXC 1W72L 3O2DH 4NUJB 1SPDA 2I07B 5A16B 1UACH 1NAKL 4P4KB 1CGSH 1CG9B 1CVSC 2B4CC 2FH6A 3LQZA 3V0DA 4UIMA 1YEFL 2YAMA 3OHXC 4FTVD 3LKRB 4XPAL 4N3UA 4AH2A 4XP9H 4G7YL 5B8CC 1NBQA 5I0VA 5B21A 3V6FB 3B3IB 3V0HA 2WB7A 3IYLW 5I1DB 5GISL 3N9GL 1XB6A 3IXAA 5JUEH 4OU3A 5L8LB 4PJAB 2O61B 2R0KH 2CRIA 4HISA 4HJSA 2XN9B 3PWUB 5DF0A 2VH5H 3EO9H 2W91A 4YDJB 5HGGS 1BFVH 1TFHA 2B9BA 1KELH 1J7VR 4JE0A 4NQSB 1ORQA 3GMOB 1G84A 4PGEA 1CICB 2PP9A 4HIEA 4DWHA 2HT4C 4F80A 5L2JB 2CO6A 4MXWL 1WPCA 1EGJA 3WFEH 3H3BC 4NM4H 3BCFA 3LS5L 2Q3ZA 3MRHB 3WAKA 3D0AA 1ZGLM 3MOBL 1WC7A 4NDMB 4AQ8C 1PX3A 2FEDC 1KN2L 1R3KB 4S0TD 4WWKC 4B9JA 3C12A 2WQXA 1OHZA 2O6DA 2R1XB 1OO2A 3DTDA 4H5SB 5I1CL 3LDBC 5DFAA 5TDPB 4TTDD 3ZQWA 4ELMF 1RZ7H 2A77L 2QPDB 4GSXA 2YKKA 1P9MC 3Q5YA 5BPPA 4NFCA 2E46A 3BGMA 3WFDL 3DMMC 4F8PA 3U48A 4TN9A 1R17A 1MVYA 1W72B 1SF5A 1J1OH 2EIEA 1A5FH 1D2PA 4ZNEE 3ULVD 3ARRA 1W2KT 4E5XG 1OAUL 1F8TL 3N43F 3BE1H 2VXUL 1DUZB 1BVKB 2R0ZL 2XIIA 1JNHB 3Q6FB 4TXVB 1HXYB 3FB8B 1KGCE 4JVWA 2NDFA 5DEJA 1EHLL 4FI8A 3T3PB 2WSDA 1BBJB 1J5OH 4F57L 4IDJH 1HESA 5TD4A 3W0WE 5K59F 3ZL4H 5HHOD 4FJYA 3DMMD 1AD0A 2PCXA 3OHXA 1FL5A 4MD0B 1KIQB 1NFDF 4OZGB 1BM7A 4HKZA 4XMLH 1G4RA 1EZVX 2NUPB 3RKDD 3TYGH 2QV2A 3QRGH 1BQUA 2FJSA 3RB5A 3TBBA 2PCPA 3QZBA 2APWA 4HLZH 4JANA 4DK3A 4QRUA 3ECUA 2BK8A 4PRDB 5CFHA 4OZ4B 3ZR5A 4PJBB 4G8GD 2LVCA 3AROA 1JDCA 3QUHA 3LEXB 5KBPA 1A2YA 2NY7H 1MOEA 1UZGA 4IRJB 3SPJA 1E5YA 3GLAA 1P5VB 1GGBL 1P4LB 1CMOA 3P69A 4GW4B 3FYIB 4P57A 2UXTA 3HHMA 4JB9L 4I8DA 2ZKWA 2DMKA 4GH7B 3ZHKA 2VLME 2EXYC 1OD7A 3MNWB 1RAMA 2WNXA 3EOAA 5J5EA 3A6BL 2OMVB 3UACA 3ZTCC 1U8HA 3CZJA 1P7QD 5EO9A 1CLZH 1EXUB 1RPKA 4Y2NA 3ALPA 4Z7QF 4OZHF 2ENYA 3RVVD 2VZTA 1OK8A 1H6EA 4V11A 4FQJL 5D93B 5AKTA 4N2CA 5JPMC 2FIRT 4RBPK 3IFLL 5C6TL 1KN4L 1L7TL 2HZHA 2M26A 1KJVB 4HEPG 3KW8A 5FYJL 4EI5B 3UP1A 3M1CA 2APFA 4GRLC 4LSSL 4LCWE 4Q74A 4WW2C 4AKOA 1F6AA 3R8BB 2J8UE 4HZ1A 4RWYH 5DMIL 1ZA3B 1IKOP 3GMPB 5J0BA 3BUQA 4HD5A 5F1NA 2OMZB 5EULV 3ESOA 5KSBB 1T4WA 1OCRB 4JPWH 4JMNA 2BVQB 1HZHL 1D3CA 1KT2A 3F64A 1M9SA 3HIZA 4FLRA 2LLNA 4LNRB 2XWEA 4QWWD 5ICXB 5J3HC 1VZGA 7TAAA 4ZUSB 4OW6A 3G6DL 1KTJA 1XZ0B 1JVLA 3ESMA 2YMXH 2O30A 3DK0A 1ESOA 1TPXB 1IEBA 3L54A 3ZE2B 5AW4B 3F04A 1HZKA 4R4FH 4JJ5A 2Q7YB 3NIDE 4KPHL 5KZCD 4N6RA 4PJ9C 4YO0A 3N0PB 5EF0A 4PRHA 2ZP0T 5AAPA 2MPAL 1M7DB 2F0CA 2ICWI 5GISH 5JUEL 1I8KA 3WNPA 2XBZA 1T20A 5HYSG 4F7CA 4WJKB 4GKSA 1JN6A 2YEZA 1R9FA 3A24A 2JI1A 3E6HA 4B50A 5TGBA 3HG1E 2VL5A 4ODVH 2FWOB 1V8HA 1I1AA 1PLGL 5F7NC 2G75A 3V0WH 1G7JB 4KVNL 2VXTH 1DN2A 4X8JA 1CQYA 1KFAH 3QORA 2ZXAA 1KYUA 4AQ8A 1OWWA 2CK2A 4L3ED 3QYMA 2GSIB 1T0NA 3II3A 5MENE 2ZOKB 1ANUA 3KPOB 4FI6A 4X6CE 5DI8B 3LNGA 2F74B 4BHUI 3RVXD 2H9GB 5E6IC 3ULVH 3MI6A 5FGCB 4PTUA 3MV7B 4PJBE 4CGUB 5I1JH 2X88A 1FVCB 1UWXH 5L9DL 5IVZB 1E9OB 3S8WA 3WGVB 3MLTA 4ZX6A 1WS7A 1M05A 5CSZB 2ZQKA 5CINL 2DYPD 4H25B 5GRJL 4PWJA 1YJDL 2YGQA 3CN3A 3VXSB 5JOPD 3DRQB 1TZGH 2WQRA 3QUYB 3K6SA 2VZ1A 1CBJA 1RU9H 2CBMA 3O4OB 4P2OB 5TDNB 2XLLA 2W60B 1ADQL 3BAWA 2V37A 3GXMA 4HOMA 2F54B 2XZAH 1KIPA 1M6OB 5EA0L 3HRZB 2CLZB 5KEZA 4WJ5B 5JHMA 1BBJA 3N1MC 3ZL4L 2X42A 4X5XB 3IGKA 3RUGE 3VWKA 2YO3A 3ESNA 4JJHA 4JO8A 4LHUA 4ZFOL 5EDXA 4P5TB 4WWKD 4U33A 5AAWA 1WISA 5F9AC 5IIEA 3ZSTA 1F3DH 3CU7A 4IJ3B 3PABA 1AGEB 2IMNA 4L9LA 1SEBB 3EFFA 4P3CH 3PHQA 2F19L 4NN5C 3QVAA 3AY2A 4HS3B 4JL2A 4RMTA 4I77H 1TCRB 4K7FA 3FSAA 4IOIA 1P2CB 1A1NA 2QMJA 1OTTD 3LZQA 2VLLA 4B9KC 1TNMA 3DOSA 3LMJL 1FYHB 2Q20A 4LGPB 3WN5B 1CGTA 2DY2A 2QHRL 3K4AA 4Z7UF 1AHWB 4YSUA 1JGEB 3UJIH 5HGAB 2BDNH 2NW3B 4P57B 3RKDC 4QHUB 2WTRB 1TT6A 4P8QA 2BP8B 1VFBA 4I0CC 5T1KB 3PE9A 3QDMD 4JFDD 2D0HA 2AQNA 3A6BH 3ML9A 4ISVB 5J6HB 3G5ZB 3ZDXE 4ZW6A 3V0JA 2KHAA 1YNKL 3KEDA 4G8GE 4PJ7F 3PJSA 4FNLL 4EKXA 5D4HA 1JDAA 2HRLA 3D51A 2EDLA 3LN4B 3B56A 4NN7C 4RNRB 3UYRL 5IFHH 1DTUA 1PX4A 1XCQA 1XBDA 3ZQXA 5DK3A 4XCYA 4XXDB 8FABB 3NUKA 1XBRA 4AX3A 2XKNB 1HHHB 2ZAIA 3VH8G 3OAZK 1YAIA 1XGQB 4XX1E 2XNAB 5DZLA 4ZX3A 1OTSD 3MODL 1KJVA 4NEHB 4AJYV 1I1FA 1E6JL 4PRIB 2VR9A 3OB0K 3L81A 1YQVL 3O81A 4PJCF 2Q0ZX 5DJAA 4G7QB 4M61B 5IREA 3GJFH 2BIOA 2QLYA 5D7IF 1K9TA 1OWRM 4GMSL 2JF1A 3KPLB 4BK8A 3MV11 2DQEH 1KWKA 3KE0A 4UI2A 4PJGE 3WKYA 4LLWB 1MW0A 2NY1B 5AAWC 2DEXX 2BS71 4DKEH 4J1UB 3PGDA 4HHGA 3PP3K 5L7XL 2BRQA 3RNQB 3IN2A 4Y2OA 3E2HC 3NTCH 3ISYA 3GSQA 3L6FB 1N4XH 3CZKA 5DJ8B 1S7RB 3OKKA 5EC2B 1BCIA 4QLRA 2NYKA 2NY4B 2F7IA 3IJYB 4JGMA 5E7FA 5KYYB 2OXGA 1YEFH 2QHLA 4NO2B 2Q2LA 3VXUB 4ODVL 4ELKA 3JUYA 3SQBB 2AVGA 1KUMA 3KL5A 4PJGF 1FG2B 5KBLA 1JZ2A 4F9LC 2L7UA 2YEZB 4PWFA 3X3FL 3TEUA 2P7TB 2APVA 4YWGL 4PGEB 1T5XB 1LM8V 1NCNA 2MWCA 5B7EA 3AREA 2NR6A 2BY0A 3G6JA 4FYTA 4NB7A 1WFJA 1EO8H 5K9JH 4P5MB 1IQWL 4JHUA 4WWPA 4D7BA 1I3VA 4HXBH 4NHUB 5EN3A 5IJKC 2JKWA 3O9WC 3AGWA 1HU8A 3APMA 4JFOA 3P77B 1GSMA 4PRAB 3IMVA 2HPTA 2H1LM 1D9KA 1DVUA 5IKCB 2CGRH 5HJDA 4BEIA 25C8H 1KTCA 2DQFA 5HI4C 1KIUB 4M5ZH 2RQEA 3C6LB 5L4JA 4L8SC 4AY0A 4AGLA 1R0AH 1MCCA 1FNEA 4KKBC 3MJWA 3MO1A 1YJDH 3SOTA 3B9AA 1H8SA 2PWGA 5GRUH 3QDMB 3DTXA 4KX7A 1FFQA 2IBGA 3MRNB 3ROOA 3NCXA 4HJ0D 1N8ZB 2FEEL 3FOMB 2WP3O 1U8CA 1A47A 5A6MA 1XSIA 4ONOA 3QO0B 2ORBH 4LPTA 1JZDC 2CMRL 3RFRA 3PQYA 3QZWA 5TE4L 1VEOA 5D9SB 4Q6IC 3QFDA 2JELL 3HUJA 4NQDE 3C6SB 1KYOJ 1E7VA 5E4OA 5DA4A 3QJTB 2W0KA 4NLHA 3OJ2C 3ZT7A 2RQ8A 2GY7B 5T3ZH 3WFHA 3E8VA 2A6DB 4I1PA 4TVUA 2VUKA 1U8IA 3A3YB 3UTZB 4ZBJA 1QWHA 1IGCH 2HPOA 3EO1B 1NCCL 3FU6A 4U6XB 3VQ2C 1G9MH 1BQHG 2IOMA 5EC1B 4Z7UA 2YAOA 4LLUA 3UC0L 5I9QC 4D9LL 3BKYL 1FVEA 3TVMD 4MD5B 3SZ6A 3B9DA 1PNDA 2I7OA 4I77L 1JSYA 4MAYC 5CIPA 2DV6A 1NBVL 5AW7B 1TYEB 4UNUA 3TYGL 5IMOB 5J6GB 3CMGA 2F19H 4KK5C 2D03L 1OW0A 1U8JA 2JI3A 4JDTL 5IR1A 1JZHA 3A0OA 3CFTA 4D8PA 1J9TA 3B9VA 1URZA 3ZSSA 2VSKB 3B3IA 3UMNA 5B1JC 2OW7A 1HL4A 4W9JC 1S7WB 5F9OH 1MZZA 4PRPB 2EEFA 3AC0A 1B4JL 2X9YA 3OQ3B 4NUGH 4QRRB 4E0RB 3EH2A 4KDTA 1SYVA 4WGWB 4UNVA 2P43B 3GMRB 4XOBA 5F0MB 2NY2B 4FNLH 1RUKH 2A4EA 1KTRL 1ZMYA 4XB7A 1HL5A 1PY0A 1WFMA 1NMBH 4ISVA 2NY6D 4U1NB 3SDAD 3UTSB 4OZHE 2FNWA 1MFAL 3HVDA 2VOTA 5CD5C 1YVLA 4EMZA 4AMXA 5KVFE 4GSDH 3OLDA 4TUUA 2W0FA 2XFXB 4EUPG 1OOAA 2AXFB 4Y5YA 4F37F 1TYJA 3BEVA 5J3HD 4A7QA 3DX7B 3ILQD 1E4KA 3BZ5A 1AQ8A 4JK0D 1CFBA 3V7AG 1P4UA 4IHOB 2ZSWA 4EIBA 2KKQA 5KSVA 4FXGB 3CHRA 2R2EB 1VB9A 3DTUB 3FO0H 1A7RH 2Y0SA 1E6JH 1I3RB 3KVQA 4FLQA 1DDTA 1U8MB 4ZS7L 3SY0A 5CJQH 1S6NA 4JQIL 3UZVA 2H3NB 5KSBA 4OLUL 2R0WH 3IWVA 3QDGE 4WY7H 4JFPA 1ZLUH 5FB8A 2BOBB 2GG1A 2VDPH 1BIIB 4OCNC 1LO0L 4Q6IB 4LCVA 5JW5B 2DQHL 4NO0D 3HB3B 4YSQA 3S3SA 4FEMA 2J56A 3TEXA 5FOJA 1KB5L 4PS4L 3KWWA 5IQMA 2BX5A 4L3CA 3BPOB 5IGXH 3PCYA 4L29A 4G8IA 3MGOA 2Y4SA 1P4IH 1A4BA 3SE4A 4DTGL 3K4ZA 3S8GB 4H26A 4OIAA 3KW7A 3STZB 4C57C 1JZJA 2DPKA 5E5RB 4HUUB 4Q14A 4QXGH 5BXFA 5HI5C 1ACXA 1CE6B 1WCBB 1J87A 2VLRD 1NFDE 3T5WA 3ARFD 1G9NL 1ILSA 4KRPC 3IDXH 4J3TA 5DC4B 4YE0A 1LDPH 5I6MA 1EPFA 2CQVA 3LKNB 4PJIA 3C6LC 2X05A 4AL8C 2D4DA 3W5MA 2OXGB 5DLLA 2WANA 2YA1A 3NIGF 4QRRE 4Y1AE 3CZLA 5CSGA 1AJ7L 4PMEA 2X4PB 3X3FH 1G1YA 4BCYA 3LPOA 4QTHB 2IPKB 3EGSA 1MQKL 1RIHH 1JGVH 1MCWW 2C5DC 5C08E 4KI5C 4EI6A 2IDUA 4HPHA 4LOVA 1DQVA 4N2EA 4TOYH 4HH9B 1BMWA 1UEMA 4EDXA 4GG6E 4JGUA 4PGZA 2ZWLT 3KL3A 2RCSL 2FX9H 4OJEH 2WLLB 3DX6B 4DN3H 2CR3A 2UXFA 5MEOB 1BPLB 2HRPL 5F3FA 1H0DA 1IKNC 4Y19A 3MJ7A 1HHKB 1JF1A 5ANMB 1AYRA 3CFEB 4HPOL 4NGHH 4AYFB 1OANA 4EUPA 4UTBA 2Y2YA 3KGSA 4HX1B 1L0YA 3BXNA 3UYPA 5LVEA 4MSWB 4FQHA 2JCCE 2YPVL 2R59A 3GPSA 3KYOA 3NDYE 3VFNB 4J12A 2NY1C 5KBNC 4WI5A 4A2LA 1BFOB 2QV4A 3GYRA 4E41A 3QEHA 1BQRA 1HQRB 1I53A 3BP7B 1M7IB 4NNXB 1TQBB 3MKKA 3FTVA 3GTTA 1UASA 4R4ND 1IFRA 1WT5A 1JV2A 5JIPA 3G7TA 2J1WA 4F33B 1NH6A 2BP3A 1FV1A 2N1TE 1Y1UA 4X7CC 1NZRA 2VE6B 3QUGA 2Q8BH 2JCCF 3ZKSD 4Z7AA 2ZCLH 3ZYIA 4JFVA 1RJLA 2J6EA 4PJDB 4ONFL 2F6AA 2W65A 2YQBA 3GSVA 3JV0A 4J39A 1NCCH 3S4SB 3BVNA 1G1CA 1NAMA 3FUMA 4DHLA 2DBLH 4WU7B 1HDMA 1A14L 1MY7A 2PYFA 1KT2B 3RRQA 4D9LH 2HFEB 4A04A 1C8PA 1QBAA 1U8OB 5EEVA 1NCAH 5C0RL 2BNUA 4DQOH 3BWSA 4P2RD 5ACMA 1UCBL 2F5AH 4FQXA 2HJFB 4XR8C 1J0KA 3VW3H 5L4IA 4FTVB 3QI9B 1QUNB 1CGUA 5F1IB 2HFFA 1YEKL 4P3CL 3ARBC 5DGQA 1AHWC 3VG9C 4PPTA 3V4PA 1Q8MA 5BZZA 3UZQB 2BNRA 1YDPA 4PJEF 3KXFE 2WD0A 3JWNH 3RGHA 3VXUE 5F88A 2VISB 4J3BA 3TGXA 3RFZA 4JFFE 1DJYA 4YSOA 4NN5B 4LLVA 4PS8A 4RWHA 5B1BB 3X11B 4MQSB 4GAGH 2AJUH 5I1HH 2V2TA 4AIZA 2GTZA 35C8L 1NGWB 1K4CB 3NCBB 4ONHA 4AQOA 5BJTB 2DIAA 1WFTA 4ZFOA 4ORGB 2FHFA 1OPGL 2N56A 2EIZA 3TN0A 1AXTL 1F2QA 5AZEH 4OUUB 4XZUB 43CAB 1JCKA 5JW4Q 6TAAA 4YN3A 3MCG1 3LQZB 4ZFGH 3LV3A 2K4WA 3SGDH 4CGTA 2ZF8A 1IGMH 4XCEA 1G1OA 4N90E 3SE8L 1WT5C 1HN1A 4OZFA 5C0FA 1AO7E 2ZWYA 2F53D 5ERWB 4YVUA 1BLNA 3VXQB 2WP3T 3ECVA 1UWGH 1Z66A 3SJVB 3RI5K 2MKWA 3QEGL 4NKDA 4JHAL 2R7EA 3ILDA 4P2OC 4QJ3B 3RWEB 3MX0B 2EDHA 2OP4H 4LSQL 4MAUL 1CDGA 1OB1B 4KHXH 5AL0A 3SYPA 3VB8A 3BYTA 4MKTA 5D5MB 5ISZD 1OQOA 3IDXL 2ENQA 5IM7A 1BX2B 4QXGL 4APXA 1NDMB 3D9AH 4G9FA 3DC0A 5FF6A 1MHPL 1FNFA 3BMWA 4FQQA 4F1ZA 4YJZL 1BREA 1Q90A 2A9CA 3QEQB 5AW5B 3ARXA 3W9EA 5DO2D 5HHOA 5CGYC 4ZMZA 3LN9A 3B5HA 1G7IB 4CL7A 4XX1G 1YYMH 3K2IA 2IV9A 1AGDB 2VH5L 1B9ZA 3K6NA 2VKWA 2DQCH 4R7NB 3VH8B 3SPHA 2L3BA 5EO0B 1IAII 1PVHA 4CA4A 2N4IA 4C58B 2XDHA 1NGQL 4OLZL 3FCTB 3QQDA 4YGVA 3S2CA 1VKXB 3DWTA 3DIDA 4OZIA 2OCCB 3F7PC 3LKPB 4AEIL 3NIDB 1A6TA 1I1AC 2DH2A 5IKCA 1RZKH 5L88L 1IB5A 2FBJL 5DTFA 1KN2H 4LLAA 4QRRD 3FB8A 2DWEB 3I3BA 4BQ6A 4OFPA 3KLDA 1UB6B 3BQUC 4K5OA 3SGJA 4B96A 4FGMA 5HYJA 3O45A 3ZYZA 3RAJH 3U1SL 2ED8A 2YN5A 4DW2H 4M5ZL 3GFUA 4OVVA 1U6AH 3FUHA 1BSIA 3IDIA 2NZ9C 4OLVL 3SOBH 2QQKL 5CKGA 3QWOA 2ED6A 2Z8SA 4XWOC 5IROC 4PG2A 4P2YA 1LL1A 3QDJE 3U83A 4BK5C 3T4AA 3NOIA 3NQIA 4H2AA 3LN4A 2VR7A 4MD5A 5DYOB 4HFUL 3RWGA 4JLRA 4A2GA 4GAAA 1G5AA 5BV7C 3DK2A 4LCIL 1K3IA 1QFUH 1TKWB 2DN7A 4HUVA 4IOFC 1ZDQA 2VWEC 4OZ4A 5EWIH 4MDIA 4AYBA 4J3SA 5E1HB 3VFTB 1NBZA 5HD8C 5AFAA 4YPGB 3UTZA 1GOFA 1JWSB 2ZG3A 3F12B 4LCCB 5DS1A 4EI5C 1IARB 4MCMA 1KZQA 1UWFA 4JFDE 1BZ8A 1YC7A 3TL5A 1YPZE 5EUKB 4QKTA 3IMWA 4XBPB 4K5NA 4DQOL 1VADA 4N2BA 1ZHBB 2KZWA 3KPLA 4NO0A 1IGCL 5E2JA 5C09D 4NSKA 1QUPA 3S48A 4GAJL 4YH6A 3VGFA 2GJ6B 2H47C 1ZT7A 1S9WA 4XMPL 2NX5D 3SPVB 4A7SA 4M6OL 3UBXA 4FNSA 2HT4D 3VW3L 3IFPB 4HEME 5C2BL 3ROLA 3RHWF 1Q1PA 3ZY7A 1W0YT 3UTTE 4QGTA 4TLTA 1WJ3A 1BFSA 1QRND 3MRLB 3QE5A 1MN4A 4N0FA 4IRJC 4HWZA 1IAMA 1N19A 3CDYA 2FJFB 4OIFA 4HSQA 4M6MH 3B5GA 5FYJE 1MRCH 3MXVH 1YEDA 2PPFA 3AQDA 2E9BA 4CNIB 3FBQA 3SPIA 1G7QB 3W82A 5EBWA 4J3OH 4WSGA 4MZRA 4Q89A 1FZOA 1MY5A 4ZTOL 1N7MH 1CLZL 2YQ3A 4OQTA 3UG5A 5TH2B 4ONHB 1CTMA 3FT9A 3NSJA 2V3FA 3E7JA 1AQDB 2YPVA 1WZ1H 3AITA 2QTVA 2X7LB 3RYMA 4NZUH 2O6EA 4AVIA 3FQYA 4FQXD 3BZEB 5I1GH 1N0LB 4HCFA 4MCZB 4TULH 3GXUB 4JFFD 2NY0D 4UQ3B 5HDBB 5TDPA 4IU2B 3BPNB 1CL7H 3UBXG 2B2XH 4QJ5B 4M8QA 3GHBH 1NCHA 4C4UA 3VCLA 5FKAB 2A83A 5CJOH 2WXNA 3BEWB 1IBBA 4KXAA 1TTAA 3CVHA 2N01B 2GUYA 1Y07A 4JFEE 3T6QC 3IJHA 4PTTA 1AXSA 1TJMA 4KXBA 1FPTH 5LHDA 3MFFB 3PREA 2YOAA 5HGBA 4H0HB 2ZSVA 4UANA 4PBVC 4AYDC 3T08A 5CBAA 3DMMB 2XZZA 2RGSA 2FSEA 3QZMA 1NDMA 5BUGA 3WEMA 2MHAB 1BVOA 5BRQA 4ESKA 2MCAA 1NC2D 3L5XH 1S9YA 3LDBB 3N91A 3KPOA 1V54B 3ULUD 1A1MA 1MCBA 1YYCA 1JFHA 2EH7H 3L4ZA 4BH7B 5GGUA 2AV7B 2P5EA 3BAJA 4OF8A 1KNOA 2WUCL 3MREA 4WWKA 2DQCL 1AGDA 4LLUB 4N1EA 4M48H 4FE9A 4E9QA 2N1KA 3IE4A 3EGSB 5JDSA 3VFOB 3BPOC 3WMQA 2AS5M 3N43B 4MA8H 1PLGH 5HTSA 5T1DL 4ZPTB 3ILPB 1I85C 5E6YA 1OALA 2EXWD 2P8MA 3KLAB 3GJFA 3QCTL 3T3PF 2HFGL 5FYJU 1BFOA 4ATWA 3LX9A 3O3BA 1WBZA 2AQPA 3O0RL 4QY8B 4RETB 5EIQA 5GSRA 5HYJE 4LLQA 4ECNA 5BS0B 2WUBL 2BHFA 2WWMD 1JF6A 4UU9A 4HHAB 3SO3C 4YDIH 2AKRB 4M6NH 2OKMA 5I1JL 5FHBL 2OCJA 4J6IA 4KTYA 3CSTA 3TBSB 5B8CB 4W70A 4QF1B 5GS0L 4BELD 5FEBA 1KENH 2QQNL 3OHXB 3BIBX 1HXKA 1AGBB 1RZ8B 2Q8AL 1U93A 4P4KC 3D69A 5T1LB 2P80A 2XX1A 2WLIB 1O9VA 3T3PE 1ASQA 1Z5YD 2JIXD 2NY2C 1OARH 3BO8A 5KVDL 4ETQB 5MEQA 2IQAA 3NCFB 3W81A 4QO1A 3U82B 3VQMA 2D73A 4GBXB 1AGEA 1KLGA 2IAMA 3APDA 4M43H 2FECL 4ODWB 5AOLA 4MQ7A 4EEEA 2SEBA 1K6QL 3A21A 2VLKE 1KTLB 3BP5A 4GP4B 2I9TB 1RQ5A 2OW6A 1H15A 4S2SA 4ALAH 1L9QA 1PKQE 4FQ1H 5F1IA 3BT0A 5D7JB 2VQUA 2ZXCA 4G7YH 4JO1L 4ZUWA 1A1NB 2KPNA 5CS7A 4QRPE 4X5WB 3ZIMA 4GRWB 4H2CA 4M9PA 3ZKNC 2X4NB 4DOHE 3SDCA 1P4LA 5C07B 3MRQA 5D1ZA 5KVMC 2DW5A 4KI5D 4KKQA 1JZGA 2PYFB 3IGUA 3X17A 1I8AA 3AMLA 3CUPA 1SEQH 4OH2A 2WLYA 4QIRA 4RAVA 5D2NC 5IQ7H 1K5WA 1B88A 3UPCA 2AQSA 1BAGA 3BSGA 4FKEA 2VDOL 1JUFB 4HUXA 5CJBA 5BQ7A 4NO5B 2XWDA 2OPCA 1E90A 3US9A 5C2BH 3UBXB 4L18A 1MKFA 3ZE1F 1B6UA 1E65A 2A3TA 4N1CA 5KSAD 3KS0J 1UYWL 1UCBH 2F5AL 2NY4D 4XNAA 4WO4B 1RUAH 2ATPA 2Z0UA 2L0DA 4OV6F 5HDRA 3RZWA 2BSTA 4HLJA 4F7TA 3SKNA 4RDQF 4KZDH 3KPRB 3SKJL 5F70A 1WTGT 5IBLD 3TP4A 1Z9LA 3GBMH 4ACPA 1XGUB 2K7PA 2Q2EB 1HKLH 3E6HB 4WTZA 1QR1B 1FA4A 2QFRA 3ZDZE 5DJAB 5EZOL 3HG1B 1EEUA 4R26H 1E4WL 4LSTH 5CR1A 2EDDA 5DFVD 4KQ4H 2FX8L 4L8BA 2G5UA 3GI8H 4NRXA 1KXQA 1IM9A 1OLZA 1OZUA 4K3HA 4YHML 1IBGL 2DZEA 4WGKA 1HXMB 4JFQB 1V27A 3I6LD 4KROB 4NWUH 4OZFH 4P59H 5EZPA 4P4KD 2WYZA 4IKLA 5SX4H 5HI3D 8CGTA 2BS8A 2BVEA 3QWRD 4AE1A 2B2XL 2V7NB 5EZLA 1H3WM 3GBLA 1UOWA 2X70B 2D7QA 3E8UH 2JVUA 1WV7T 2QQLL 1Z0NA 4WFED 3EZJB 4CC4A 3DXAA 2GQHA 3FMGH 3WHE0 2NZ1A 3L9BA 2WIIA 1F3RB 1IGML 3GUTA 1IC4H 3BSZH 3GM8A 1UD4A 3KBFA 4YDVB 3G5XA 2Y2TA 4GMSH 3BEWA 1SBSL 4TQEH 4E42B 1FPTL 3NIGE 4NM8L 1Q4NX 4F7PA 3PQYD 4B41A 2GC7C 1F3JA 2J1XA 2IGTA 4Y19E 1X7TA 3FULA 1F45A 3L95A 4TVSa 2NY4C 4HYTB 4MYWB 5CEZD 5DMYA 3W9DA 3QULB 4HBCL 4PIBA 1LD9B 1QEWA 1L9MA 5D2LF 4Q9RH 3TTSA 1CLVA 3O6FD 1IGYA 3HI6H 2NPLX 5EBLA 4K4KA 4DUWA 3TYFB 1MEXL 1AC0A 4WCYL 3S37L 5DK2B 3FXIC 1BF8A 5HHVL 3TVMA 1MJUL 1B3IA 3EAKA 4C56A 2KLSA 2V7HA 1I9JH 2N0MA 4JRYB 3EZ8A 4GW1A 3O2WL 1LMKA 4YLCA 5AVWB 2VN5A 4BH8A 3E0GA 2EIBA 5DJYB 1KMGA 1JYXA 3B1TA 5L88H 2NZIA 4D9QE 2AKRA 1F90L 4LCWA 2QDWA 3DJ9A 3T0AA 4PJHB 3ZRFC 5D6CB 3ALWA 4IRSC 4NN7B 1W91A 4OLXH 1Q0YH 1NIEA 1NCBH 4UT9H 4ZO6A 2YD7A 1XVSA 3HKZA 2P5ED 4LF3A 1IGFL 4UQBA 3L4XA 2FTAA 3T4YA 1DYZA 5E7BA 2J6EH 3WY2A 3BHBA 1FGNL 1OEZW 4KX9A 2EIZB 5FUCE 3TN0B 2PYED 3HN5A 1GYWA 1ZTMA 1NBZB 2DAVA 2R23B 4GKZB 2PPDA 4AH2B 5J7CC 4JFFA 1YMMB 2H0FA 4I2XA 2JJTA 1TQCC 2YRBA 3KPRE 3PUCA 4BWTA 2AI0L 2ILLA 4LOUD 3RWIB 4WV1A 2Q9OA 4XNQB 4XO8A 1SDYA 4TUJA 4YR6B 3WLBA 5DRNB 1FIGL 4XGZA 4XCNA 4MMXB 4A37A 5I19L 4GB9A 3S88L 4M62H 1GPOH 5C0BD 3SDDD 1G87A 3HZYB 3LNEA 2H1XA 2ZCHL 4N8VA 4XN1A 2NDGA 4OLYL 1RERA 2IQ9L 3QA3A 3MNMA 3POCA 2WBJB 3RBSA 1WLHA 3SKJH 3IAGC 4IU3B 3D39B 4RAUA 3QEQE 5LN4A 1RUAL 4QHPA 4YSEA 3KWTA 1JZEA 1XSOA 5ADPL 1Q38A 5KVFL 3CC5B 4ELKB 5FA3A 1KXTB 1PJ9A 4NBXB 2TAAA 2R1YB 4K9JA 4RSYA 1I3RA 3U7YH 1RUKL 1BXVA 3LD8C 1PPIA 1QKZL 4FHKA 2CDEB 4LASL 1WZKA 2RR3A 2ZX6A 4TL4A 3SDCD 2FJGB 2O6CA 4YSDA 5GZNA 3CH1A 2ZP8A 1JPFB 3U6XA 2Y5TA 1IU1A 4GINA 2MQCA 4LLWA 3WGUB 5DRWA 1FYTB 3TNMA 2MEJB 1WFNA 5IZ7A 4ZMAT 3OXSA 3VTMA 3RPIB 3PIQA 3FMGL 5GS2D 1NOFA 5CCHE 1ECYA 1OM9A 1PZ5A 2C9XA 3QIUB 4FG2A 4PW3A 5DJ8A 3T0VA 3TEZA 3GKZA 4A67A 3E8UL 3VFPB 2ETWA 4YPJA 1A66A 4U7KA 3MLSL 3OG4B 1D6VL 3T0XA 1EO5A 2OJ1A 3O3DB 1HS6A 3DXAB 4GJTB 3IXAB 1ETZB 2CO1A 4LP5A 1ZK5A 4I13B 1R6VA 5I73C 1H3UA 5D96B 2ZONA 3V6OE 4UOW1 43C9A 4KUCD 1ORQB 3O6LL 4K23H 4N86A 4B5ZA 3PXLA 2LVEA 4IBLT 1YEGL 1U21A 1BF2A 2K8QA 3AVEA 1GMEA 4FFYA 2CRYA 3Q05A 2R9HD 3QG6B 2OSYA 2E7LC 3KHQA 2XTJE 1N67A 1S5HA 3ZUNC 3NPSC 1FUNA 4MD4A 1T89C 1QBLL 2PN5A 3FF8A 3MRMB 1BBDL 1N64H 2Z3FA 1LYQA 3QJUB 1ZLWK 1NLDH 4AV0A 5D1ZD 4Z3FA 1F42A 1OSYA 2AITA 4HETA 3C9NA 5KYUB 4LKCA 4HKBA 1FDLL 4NUJA 5HHVH 3SBWC 3UEQA 3WO3B 4B95C 2A73A 2PTUA 2KQNA 1JGUL 3MR9A 3P9LB 5TE6H 1HEHC 5BRZD 2KLTA 5E8NA 3RGVD 2AJSH 3V0AC 4X80H 1JK8B 2EDWA 4TNFA 4ZMOA 1ILUA 4KMTL 3EO0A 3MBEA 5KS9B 2CHZA 1Y0LB 4FFZA 3APFA 3Q6FA 4Y2DB 5EOCJ 2AEWA 4ZFZB 5IV2B 5L6YL 3B4NA 3ZRCC 4MQ7B 1ZLSL 4BH8B 1T2QL 3CQQA 1IAOB 5T1MB 4MB1A 3IETB 3KYNA 4X4MA 1KV3A 4G7VH 3PF2A 3OMAB 4F33A 1GY1A 5JPMB 3GMLA 5I8EA 3T4AC 2WWKT 1HSBB 4UT9L 3D69B 5T1LA 1L6ZA 1A02N 2OK0L 1MFBH 4KOCA 4J3OC 2O5XH 3BVNB 2OA9A 3MJ9A 1Q0XH 1E7UA 1X5HA 2O4EA 4G8EB 4R8WL 4AXWA 3P77A 3LY6A 5A2BA 3O3EB 4E9WA 4MWFA 4P23D 3N40F 1AY1H 1AHKA 4FG4A 1BQHB 1LO2L 3U2JA 5CLZA 3AM8A 2DKMA 4BWUA 5EEXA 1CDBA 1A6AB 2BVPB 2P46B 4M43L 4JR9H 3SKMB 2CJSA 1QATA 4RMWA 2ZUTA 5C07A 3D52A 3AU0A 2CJ3A 4E2OA 3UABA 3CPUA 3BUBA 5J9PA 5IHLB 1IGJA 4UZGA 4LCWD 1GXEA 1QVOB 3GRWA 3UAAA 5JQHC 4W4OA 1K5NB 4Y4HA 1FIGH 2ZXBA 1EV2E 2LE9A 5HY9B 1FHNA 4U6YB 5F7LB 3HOGA 3I02A 3CXFA 2Z65C 4LRIA 5HDLA 4GAFB 3UTSA 3QORB 4XT1C 4M1GL 3T2OA 2ZCHH 3VFWA 3ARFB 1OZTG 1EFXB 3Q2NA 1R5IB 3RG1C 2E9GA 3ZDXF 4EZMA 3SYCA 5JZ7C 3H6JA 4NPJA 4UDTA 1I8MA 4KK9D 1VDGA 3EYUH 3RUGB 1F00I 1LE9B 3VFMB 2IJ0C 1JV5B 3HZVB 4LNVA 4GEJA 1UYWH 4B3VA 3PGFL 5DMJB 3IJ7A 4I5BB 2YGNA 4CC1A 1YEHL 4QWWC 2V2XB 2WCGA 4MJ6B 3K5SA 3RDJA 4K07A 2W9EH 1OAQL 1OAUH 2EE9A 5CN3A 4YSAA 1HYSC 4GP8B 2P8MB 3OAUH 5J06A 1KLFA 1PBYA 5JQ6L 3DDGA 5LGYA 2UWEE 4R90H 2IV8A 2ORBL 2IIJA 3A4FA 3ATBA 3GO1H 3GSRB 4GRLA 5J1AA 5LLIC 3VFSA 2X4RA 4JMXA 3STZA 1HJBC 4R7LA 3QYNA 4ENED 4TYUA 5AALA 1TTCA 4UM8B 1FBIH 2DMGA 1ED3A 2WXFA 3LHPL 1NEUA 1HHKA 3SYAA 4HJGB 1NDTA 1Z2KA 2W0LA 2OL3B 4PRHB 4XMLL 1A22B 1DVYA 4IIQC 1HL8A 1PZ3A 4L5FL 2UWEF 3MZGB 4TSCH 3T2NL 4XNXL 4GSUA 2BIMA 43C9B 5E9DB 5IB2A 1LXMA 1VFAA 2C4FU 1Z9PA 4V33A 2NW2B 3IFOB 2O26U 4M7LL 3RU8H 4L4VE 4OCRH 2G9KA 4FA8A 1DBBL 3P0YH 3VVVA 1YMMD 2B15A 1FE8L 1AANA 1EAOA 4JRYA 3QG6A 4L5FE 2WCSA 3LN5B 5DC9B 2A6DA 2F8IA 2DQDL 3LH9A 3HNTH 2BOBA 1I7RA 4XVOA 5DZOA 3AS2A 5IW3A 2HXAA 5B7MA 3SBWA 3GSNA 3WUWA 1W80A 4D7PA 3HNSH 1HDMB 3EDEA 2FB4L 4AGQA 3RY5A 2WXHA 1U58A 4U3SA 1G7MA 3ZHLA 3FAWA 3ELAT 4XPTH 4ZPVA 3I6GA 3EOAB 4M5YL 2IALA 2X44D 4NQED 4A2FA 4QRUB 2Q7YA 3B37A 4JJ5B 1AZCA 5DU7A 5L6YH 4BE5A 5HD8D 2TRHA 1VHPA 2H45A 3U6XS 4ZW5A 1O6VA 1P7BA 2XETA 1A0QL 1IJ9A 3FU9A 2WVSA 3MRFA 4N2NA 4K94C 4QT5A 3WDIA 2OL3L 5L0QC 3PAZA 1QSFA 2OQJA 3KG5A 1OF0A 3ATAA 3G04B 3ZU8A 4LVEA 1KY6A 1QFWH 1A4KA 2Y6TE 1GOGA 1RUML 1D5XB 3CFUA 3QXWA 3KYNB 4XRCB 4DW2L 1KG0B 5IROD 1MJ7H 1RK7A 5DD5L 3WNMA 1YY9D 4OI9A 3UG3A 4BUGA 5T5FL 3D85D 4NC1C 4JQIH 4ELDA 1TVDA 1IBZA 5GZND 5I17B 1IM3B 1DVFB 3MU3A 5DD1H 3V6ZA 1NCBL 1OIOA 2APBA 2C26A 3BPCB 3QDME 4XMWA 2ATKA 4IRZA 1DEDA 4DGVH 1XWVA 4E68A 1D7BA 4MHHI 1UACL 3IKKA 3U7WH 5LNGA 3C60D 5JHDE 4I9WD 5EWIL 2FEDD 1FGNH 1T5WA 2Z0BA 4JFFB 2MJWA 1E5BA 2XX0A 3FSVA 5H37A 2GKIA 4FCAA 1VGKA 2VDLB 3TCTA 4M7LT 3Q44A 2OI9B 4AZ8B 1H5BB 2D7PA 1RJYB 4WI0B 5J12B 4OCWL 3L5HA 3NCYS 3MHZA 3QJZA 3SIKA 1MQ8A 1NFDB 4OZGF 2BSBA 5A43C 4UQIM 1RMFH 1P7HL 1JJUA 3CIAA 2Z92B 1MCNA 4KVNH 1RI8A 2VT0A 4AMKH 1XCWA 3OHMB 4F7EB 3UTTA 2PNDA 1H3PL 4F58H 1O5DT 4G11A 4L29B 1U3JA 3MA7B 4H0LC 3V5DB 4Y8DC 1AGCA 1AO7A 5LDSA 4PU2A 1MQKH 1RIHL 4S11A 3WIHL 1BQLL 5E6UB 2RAMA 2MMXA 2GBTA 2ZOWA 1SXZA 2CPCA 3D3VE 3N1QC 4PJBF 4R7XA 3IDUA 5D2NA 3EYFB 4D0CB 3QUKA 4ZFFA 3D07A 2I85A 2IVFC 4AYEC 2FZ3B 1D9KB 2X3BA 2P8LA 4I1NB 2RH0A 1WAAF 2QSCH 3FFDA 4X4XA 3CLFL 3JVGA 4HUCA 4D9RD 4NZDA 5IWLC 3Q7JA 3IEAA 5CP3H 4A6YH 3BPLB 3VSVA 5FA4B 4HPOH 4P2AA 3VG0H 3FW6A 4F2MA 2P45B 4MJ4A 5DD0L 2V9RA 1OCZB 3L3OB 2QLVB 5IMLB 5TK4A 1IV8A 4FEIA 3QQDB 3FUFA 1SJXA 5J4MA 1JD9A 1GY2A 3F84A 4MCYB 4WNJA 2XZAL 1KLFB 3EGDA 3FZUD 4ANXA 3O11B 1YEIL 1KIRA 1U3HD 1EZVY 4KO7A 1MNNA 3OVUB 4FAAB 1RUQH 4H4NA 3RNQA 3WXWH 1V7ML 2RHEA 2WQSA 3LHPH 1XH3A 2JJUA 3W9EB 4IMLB 4N2AA 4MQTB 4DP6X 4XP4H 3EDFA 1U2CA 2XVGA 4FQIH 3ZDZB 5JDJA 3H2WA 2NQ3A 3VXMD 5FR3A 2XN9D 4WSKA 2X4OB 2FHCA 4P23B 2O5ZL 3LIZL 4X6FB 4GP5B 3DSNA 1F6FB 4AGMA 1JVKA 4FXLA 4LVOB 2GYSA 2Q76A 3M46A 5I0WA 1UXLA 4JG0H 1NL0H 3G6JB 3PGCB 3WKQA 4NOFA 3DVIA 1EUUA 3CQFA 3V0FA 4Z7OF 1DBBH 3IFOA 4LESA 4O58L 4YHYC 2XNAA 5JORA 1SZNA 2R2BA 4D9QD 4ZJ9A 2HJKA 3ZJAA 4MJIE 1GZPA 1T80A 3B7TA 2VDRH 3D39E 3SD2A 3TO2A 1PCXA 1BLNB 4TQHA 1FFPB 3SGKA 4K3GA 1A6UL 1UKSA 3CGTA 3UFIA 2P5WB 3AJ7A 5CLTA 4YZFE 3NIFB 1SQMA 1BBDH 3RY6C 4P5KB 1DFXA 3H56A 4DKFL 1E9PA 3KPPB 1ZEAL 3P4NA 4GRWH 4H40A 1P7QA 1PIGA 3I74A 4POZD 4W9CC 5LAXB 1VFBB 4K3DH 1D5BA 3I6GB 1C1EH 3FOMA 4N6RB 1L7IH 1M42A 3OSKA 5BZXA 1JPTL 4PD4K 2ITCB 4NXKA 1WTLA 1EA9C 5SWZE 2WSPA 5D7SH 1MJJB 2IANE 1KTBA 1A0QH 3FCSB 4IEFA 1TCRA 5DYOA 5AB1A 3RWGB 5FO7B 4U3HA 5D72L 5KSUA 1OGTA 5E1IA 1JN6B 3ARGC 1B2WL 1N70A 2YXMA 3Q5TA 3FQXA 2ZPKH 4M3JA 5EBMA 2OMUA 3CG8A 3OKEB 1R3LB 3FO2B 2EUVA 1KZYA 2N7BA 1G5GA 2W07A 4HW6A 4Q97A 5T5NF 4X8JB 3D2UD 1B0WA 2GTZB 1F11B 4JY4A 3O2VL 3V6OC 3VAEA 5JW3L 1V3KA 1OGSA 1HOCB 2PW2B 4PREB 4Z7WF 3U7WL 3OX8A 3D06A 3IBEA 4I87A 2AZUA 2E6PA 1NUFA 3NFNA 3QXDA 4UAOC 2FGWL 1HCFX 4PCKA 3V0VB 2VDQB 2OMXA 3H6AA 3SHSA 3N6YA 2CGYA 2R0LH 4F24A 4DAGL 4NKIL 4ODSL 1EDHA 1WHPA 2BERA 4RIRB 1NOAA 3DV6A 3RJOA 3K72A 3PAUA 3WBDA 4KKAC 4TNEA 3LRMA 1U8LA 4PJ5D 3R06B 5LQBL 2KERA 4M9OA 4P2QB 3WNNA 5GXBB 3RKPA 4TV3A 1SOQA 3MN8A 4POYA 1YY8A 1IQDB 2RMNA 3FUDA 4F9LA 3BIKB 5SX4I 1PZBA 2DLTA 1XH0A 2NTFA 5IM7B 3AREC 4EDXB 1TQVA 4L1TA 4G9FB 4IBSA 3OGCB 3NCJL 3PWJA 2YK1L 3GSQB 1C08B 1LO3H 3HE7C 4K8RL 1IM9B 2FBJH 3OF6A 1A1OB 5HVHC 4Y9GA 2JKLA 3D6GA 4Y19B 1JK9A 1U92A 4BH7A 1HWGB 1A7OH 3LQMA 5GRUL 3V9EA 2KC0A 2ICWB 4QNPF 1NTDA 2X70A 1YN6A 3HPLA 5BVJB 1SXAA 1KJ2H 3MXWL 2WLMA 3C9NB 4PLNC 3GZOA 2LU3A 4MNQB 1ROCA 3AUWB 3CLEL 5FYKE 2GUOA 4HBQA 3GNML 2AAVA 2XACC 1YEIH 3ILPA 3FO1A 2VAAA 3NCCB 3KPNA 3WIFB 3QC5X 5B4MD 2QTEA 2WMPA 2IMMA 1U9KA 3HI5H 1BVKA 5F0LB 3QQ4A 4GMTL 3MGOB 4M3KB 4OJYA 4D9RE 4MJHA 1OT1A 3TFBA 1QSFD 3L9EA 1AQKL 1SN2A 5D4IA 3MA9L 1J5IA 3SDXF 4Z95L 3UTQA 4DERA 4XN4A 1U8QB 2AEOA 5IROA 5AVXB 1MRDL 4CAGA 4IMLA 2E8ZA 1XSJA 3UJJL 1KFGA 2E3VA 4FADA 4G1MB 2YD0A 4KK6D 4TVPH 1SRDA 4OKDA 2JJSC 3ZXAC 2ZWZA 5FGSA 3ETBF 2BWIA 4QTHA 2PLTA 2OJEA 4FDWA 4LBAA 4HMDA 3GHPA 2J1ZA 4MNGA 3UZEA 2YXVA 5HHMB 1W8EA 1R5VA 3MNZA 4OGYL 3CIQA 1HNFA 1GIGL 2EKSB 5BZWA 4AI7A 5JIDA 4LLQB 3MZTA 1OGAD 1MPAL 2CBQA 4Y9EA 5K9KB 3UZVB 3PWPA 3H3PH 5LXVA 4P5RA 2PPCA 3WIAA 4XBPA 3WJMA 2P44B 4X9FA 4FS0A 5EIIB 4ELMA 3EFOB 2Y1YA 3FU0A 1NDGA 4FFZH 2X10A 4GG8B 1PAMA 2BOCA 4YHIA 3FKUS 1E9PB 3KPPA 3HAEG 1KEMH 4H20H 4PI0A 1DVTA 2DYPB 4W9HC 5DUBB 4U3XA 5EIVA 1X6NA 3DI2B 4H8WH 1RIUH 1ZTXH 4U1NA 4AJVA 1ZIAA 4JRXE 5E6SB 1S9YB 5AAMA 3MJ9L 2JIXA 2XBDA 2EYSA 2CO3A 2IPTH 3RHWK 3TA3D 5F1OB 3RILA 3QQ9D 1R3KA 1S7WA 3FCUB 4HKJB 4ZSOE 2R23A 4HXAH 3BH9A 4ILDA 1FNAA 1KACB 4TULL 3JWOC 1MCSA 1OE1A 3OKEA 4D2NA 4B9CA 2HAZA 3QUXA 1C7SA 5IK3A 2AMUA 4WV1B 2E4FA 2OAAA 3V4VB 5LCVH 2X2JA 3F7YA 3FTXA 1TMQA 1HIML 1J5HA 4DAGH 4HCRH 5C0CE 5HGDA 4FERA 4NAQA 4S1RL 5DD1L 4ZOEA 5MI0B 1R3HA 3V5HB 3C6LA 3K8KA 2CIKA 1L9RA 2DBJA 2FYYB 1Q1JL 2ZIDA 1N0LA 4RRPM 4MB3A 4NX0A 1W6WA 3BP4A 2R2EA 4QHKJ 2YZ8A 1ERNA 3MRNA 4N6QA 4G80B 4PJCA 2QZ5A 1AJ7H 5KN5A 5DEFB 1KPVB 4BQ9A 3ARUA 3ABMB 3EIFA 2RFXB 1QQDA 4HKZB 3BAKA 1JGVL 2IANA 4N90D 3U2SA 4FD0A 4OCWH 1LEGA 4IBZA 3VFVB 4H8HA 1OE3A 4F2MB 3HMXA 3Q0HA 4IRSD 2HRGA 1KXQE 5T1DH 2GY5A 5KVDE 3K2UL 4FABL 4EN2A 5HGBB 4F7PB 1VEMA 2LQRA 3CH1B 2QDVA 4G6AC 1BV8A 4IYKA 4X6BA 5DXWA 4GQZA 1E50A 1JGLL 1VPOL 4RRPG 1TVBA 4L37B 1EJ8A 4ACTA 3ZTEA 4F8OA 3PP4L 3KGTA 3FFDB 1QTPA 1KIRB 3MRHA 3QBTB 5GHWH 4PJ8C 4X4XB 1Y6NR 1WC7B 3QHFH 3B1UA 3D7PA 1RZ7L 2A77H 2X3CA 4IRJD 4S1SL 1QFPA 3WKML 3DX0A 4N8CL 2A9DA 2ICEB 3BGAA 1LK3L 2CLRA 4YVNA 3QUMA 2KI6A 2J8OA 1A4JB 2X4UB 1RZIA 1Z1WA 5L2KB 3TO4A 1DQJB 4QEGA 2Y7LA 5FHAH 3TJEL 3AT9A 4LK4A 3BKCH 5A3IC 1W0WB 1O7SA 3G5XB 5I16A 2IADA 1N12A 3D34A 4FULA 4QCIA 3HE6B 3APCA 3RQ3A 4P2OA 3MX0A 5DD0H 4K7PX 1SHMA 4WW2A 5KVDH 4A2HA 4XBGB 3VU1A 2GJPA 4CSZA 2YUWA 2Z7YA 3FU3A 4XPHH 2VSMB 4JG1H 1VEPA 3VXUD 3IS0X 4GW4A 4R9HA 4XMKH 1RZKC 4O02B 3S37X 4G7RB 5I8CB 1PEWA 2UVFA 1A6VL 3MRPA 5ABDE 5HYEA 1UD5A 4JFDA 3AU1B 5J6SA 3EOTH 4S1DD 3IGFA 3D2UB 4OM1H 5IHHA 5C7XH 2WBXA 1A7BA 3CZFB 4UT7L 3UJJH 4FQHB 4XO3A 4DZ8B 4PJAF 1SY6L 3HN8A 2VLKA 2C9VA 2HRHA 4L8BB 5C0IA 3QEUB 2V5MA 1HCZA 4N0YL 3THMH 2VC2L 1SXBA 1S7SA 3BPCA 5D1QB 2CO2A 4ORGA 5IJVB 4PJ9A 5K9OA 1WHOA 3SPVA 1AKPA 4XWOD 4Z77A 3BHBB 4WU5A 1F6LL 3RTQA 2G60H 4AC2A 4KJPC 5AENA 3G9VA 4WUUB 1ZK9A 3N40P 3VWKC 1P2CA 4H8UA 3DARA 4N0CC 1UFGA 3ISWA 2K6ZA 1TO4A 1ECZA 4ZFQA 3Q2LA 4RGOH 5GRYA 1T20B 5HGAA 2CLVA 2XVKA 3KM2A 5IHZB 3VXRA 2IDCA 4BCXA 1MCDA 2BVYA 4ELMB 2DQUH 5EIIA 4RAVB 2HUEA 3BKJH 1FDLH 2QKIB 3SDAA 2FWOA 4Z78A 3TX4A 1NJ9B 1FNLA 4XO9A 3WEBA 1KEML 5IESL 1ZE3H 1H3XA 3NJVA 3PJSB 2QL1A 4XN9A 3X11A 3DSFH 3FTYA 3SQOH 2V2TB 2QVMA 4QRSB 4N5EC 3G6JE 3MV8E 3QEQA 3G5YB 3V2AR 3WELA 4BHUA 4YHMH 4WEUD 2SODB 1SFDA 4X7SL 1KPUA 5AL8A 3UGXA 3EBGA 4CU6A 1L7TH 3SE8H 3FSWA 2W9LA 1F4WH 4AEEA 1BMGA 3AXIA 3QHZL 1XGUA 1H3GA 4ODTH 3IMBA 2W07B 1QR1A 2F7PA 4O2CA 4JKKA 4EVNB 1DBAH 1VENA 2JMRA 2OV0A 2ZNWA 1DBMH 5FFGA 4X6DA 2ZE0A 2A9AA 1OAXH 4L3AA 3QAZC 3WY1A 3CFCL 1D7FA 3DVGA 2EZ0C 2ZT9C 3K71B 4JPWL 2W9DL 3U0PB 1WGVA 2Y7QA 2A74B 5IT2L 2Z35A 1MIML 2W60A 3CQPA 1IBFA 2R4SH 4HCGA 4F1SA 1FNHA 5J11C 5MERB 1MREL 1QASA 4FKHA 3KLHD 5I75B 5K1VA 2V33A 1EEZB 2B1HL 3U4EB 2XJLA 3KWVA 1E4HA 4OGQC 2XG5B 4FLHA 3OAZH 2MPAH 3L9RB 3X12A 4GLRH 1MCQA 4XPBH 1GGUA 3D33A 3BESR 1YCSA 4P5TD 3KLKA 1N5AA 5EZIL 1UADC 4YXHH 4Q52A 4EPSA 2KL6A 1M7IA 5DC0A 1KF9B 2FDBP 4B60A 2GVYA 3O41A 5CZXC 3QUXD 2NSQA 2ZUQB 1JHTA 5D5MA 3W2DH 2NYYD 5E8EA 3EG9A 1AS8A 1FV1B 4JFED 1I3UA 2NNAB 4PJFA 4PLJD 2E6QA 1CD1B 2J1YA 4JNXA 1O6SB 5DZAA 1AOHA 4R3SB 3QQ4B 2R51A 2FX9L 1PZCA 1OGAA 1R24A 2A9NH 4PJIF 4UQEA 5DZNA 5J1AB 4QYAA 2VLLB 4HUWA 3E3QE 2GHZA 4OFKA 5EUKA 2WBKA 1U6AL 1AE6H 3MRJB 4K7PY 3ARBD 1KGJA 5CINH 4QF1A 2J55A 1I7TA 4YL4A 1GGIL 2Y07H 2BVQA 4X2UA 3ZR6A 1CDJA 3JVGC 1DN0B 3QJHA 1SEBA 5LAXA 4B7IA 3SDDC 3AACA 3QDGA 1RU9L 4M4RB 3WMPA 3OAUL 3TBCA 4EQ2A 4H25A 4UYQA 3MR9B 3P9LA 1WAAE 1MAMH 3MRCB 5ENWA 3T0EB 5MEND 2Y7SA 3P3UA 4FRWA 5AVRB 3GO1L 1WS8A 1NGXB 3ZYOA 2NLJB 1CU4L 3GI9H 4D0DA 4HJ0C 1IFHL 3CFJA 1VSCA 5DRZA 1RURH 2BP8A 2XXFA 5T1KA 3RL2A 2GCYB 4EN3B 5KVGH 2RBLA 1D5RA 3LNDA 2WOBA 3KPMA 4R6UA 4M00A 2AV7A 5JOPE 1EVUA 4JY4B 1KDJA 4Y5VC 4LQFL 5TQ0L 2YPKB 4N28A 4XNXH 4XZ4A 4P3WA 1ZSDB 1P1ZB 4TSAH 1PLCA 5MEPA 1GCFA 1I9RH 2BVOB 3QJFA 5JLZB 1CXEA 4K71C 3F7LA 4I4WB 4KH2A 5KS9F 2XC8A 2NY0C 1NCWL 4JM0A 4MJIA 5D5MF 2VXQL 3T0BA 1NGYB 1BYPA 4N8UA 1O9WA 4WFGD 2W80C 2LAGB 1LEKB 3ESUF 1PZAA 4R5VA 4MYPA 1ZT4B 3HMXL 2IBZY 4F15B 1JXDA 4FYQA 2NXZC 4G6MH 4U4BA 2YD3A 3CFKB 5D70H 2YGVA 4N26A 1IL1A 3CZGA 1H3VA 2X38A 3LH2H 3VWJD 2A83B 1PEZA 4PGBA 1BJ1J 3NK4A 4MZ2A 4NPYA 3I3EA 3BAYA 1RSYA 1RHFA 1MPAH 2FBOJ 2ENSA 1GC1H 5KW9L 1HSBA 15C8H 4K5PA 3H7BA 4M8VA 4JG9A 5C70A 1P84K 4H88L 1NJ9A 2ZKHH 4PRNA 3ARDC 1A3RL 4NZUL 2LFEA 3OKKB 3MMEA 2A6IA 3OKOB 1TTGA 4QR7A 3OBAA 3IPBA 1F4WL 1NM9A 2ZKYA 5I1KH 4LHUD 1R3JA 2E4TA 1VZHA 1NC4A 2VIRB 3VFRA 4LVNC 7FABL 1N59A 3BUTA 2CSPA 5I6KA 2WLHA 1KB9J 3CC5A 1SHSA 3GIZL 4KXZH 3CBRA 3CN4A 3ERXA 4I5BA 4EDWL 4EN3C 2VNCA 4M29A 4YFEA 2VDOB 4LVHB 4HKBB 2A2QT 3KPSD 1I9IL 2MQ0A 1IE4A 1J05B 3JWNG 4HWBA 1ZWIA 3BZ4A 3SDCC 3F7YB 1F97A 2P8PA 4HWNA 3QPQC 1Z5LB 3PU7A 3GGWB 4LSPL 4KKCC 2W9DH 4FF9A 2HB0A 3AXLA 5SWSA 3QI9D 1K85A 2YAHA 1J0HA 4TLSA 1AQDA 1B2YA 3LS4H 3TIDA 4ONGH 4HK3J 1YZZA 4J27A 2YR3A 1PZ5B 2P42B 4NJ9L 5CZRA 3VXOA 1J8HB 3C8DA 1CURA 4A2MA 4CC0A 4PYGA 5E6IA 3B7RL 3NZHL 5HPMA 3TIEA 3T8XB 3MUHL 1OP3K 5A1AA 1ID2A 4PN6A 3BUIA 3SCMB 5C8JB 1EERB 1EGJH 3SQBA 4Z7UB 1JAEA 5GSVA 4PG9A 3DX8A 3C8KA 3MREB 3SE4C 1TSHA 1R46A 3D30A 3QCTH 3ZE1E 5D7LB 1IZKA 4XCFL 2XG4B 4HUVB 4OF0A 2B5IC 1YUHA 3ABLB 2ZUQC 1D7CA 1CXFA 2HVKB 3RTQD 1QSFE 2J8UF 3GKWH 4PSRA 3X1BA 4D8PB 3O8XC 2C9PA 2R8SL 1DZ0A 2MTPA 3U0TA 5E70A 3OV6A 1C7TA 2C3WA 2LTQB 1MW3A 1B90A 1TEFA 2F53B 2CLRB 1KENL 2QQNH 4BK4A 2DQFB 1MFDL 5D4JA 4CMHB 3MUY1