3W56A

Structure of a c2 domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
111
structure length
108
Chain Sequence
HMQLRLYNLRVRGLPSGITDGYVKVFCGSANLGETSVNHNNANPWWTEEFSHFKAQENDILRLEVHDEDTFFDDLLGVCQRQIKVGTHEHDCYLKEGGTLHYMYTLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C2 domain protein
publication title Defining the interaction of perforin with calcium and the phospholipid membrane.
pubmed doi rcsb
source organism Scophthalmus maximus
molecule tags Lipid binding protein
total genus 27
structure length 108
sequence length 111
ec nomenclature
pdb deposition date 2013-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3w56A00
3PREA 4F91B 1DJIA 2CHDA 3CSFA 4OVVA 2WXKA 4BFRA 2NSQA 4QAMB 4ANVA 2WXIA 3B7YA 5KJ7E 2YOAA 3MJWA 2WXJA 3TWYA 3GPEA 2WXLA 2X38A 1RH8A 2CM5A 2ZKMX 4URKA 4A55A 2CM6A 2WXOA 3APCA 3F04A 3PRZA 2UZPA 3R7RA 4L2YA 3FBKA 4OVUA 1E8XA 3QARA 3SD5A 3QAQA 2FK9A 1W16A 3ENEA 4EZKA 3KWUA 1RLWA 4IQHA 3TJPA 3ZVVA 3NSJA 2V4LA 3T8MA 1YRKA 4L1LA 1WFJA 4XE0A 3F05A 3M7FB 3ML8A 5JHAA 4WWPA 3IM1A 3L13A 4AOFA 4PS8A 3RDJA 4DK5A 2DMGA 3PS6A 4Y1TA 2YRBA 2D8KA 4XZ4A 4DNLA 1BDYA 4KZ0A 1UOVA 1HE8A 2NCEA 2JQZA 3QR0A 1CJYA 1V27A 2K45A 3W57A 2WXMA 3S2AA 2WXPA 4QJ5B 2WXQA 1TJXA 3FDWA 1UGKA 1DJYA 3LJ3A 3OAWA 2K8MA 4FJYA 5H4YA 4FHKA 2K3HA 4MJJA 1QASA 4FLHA 3APDA 4PS3A 3NZUA 3HHMA 1E90A 4NPJA 4WWOA 4NPKA 4EZJA 5CCGE 1BCIA 4BGDA 3N5AA 5G2NA 4WAFA 4FA6A 4JPSA 2ISDA 3HN8A 4F1SA 4EZLA 3JZYA 1GMIA 2A5UA 2CJSA 3APFA 4L23A 4WEEA 1E7VA 2DMHA 4FHJA 3PYCA 4HLEA 3L9BA 5T8IA 4TS6A 2CHZA 4FADA 4QJ4B 4IHBA 2CHWA 2B3RA 2WXNA 2A4ZA 1K5WA 3L17A 2ENPA 2Y3AA 3HIZA 2KI6A 1E8WA 4LT7A 2QZ5A 3QK0A 2NQ3A 3QR1A 4V11A 3NZSA 1BYNA 3F00A 2N1TE 4PS7A 1DSYA 2BWQA 2WXRA 2Z0UA 3RPBA 5G55A 3KWTA 1E8YA 3IBEA 4F93B 3W56A 3DBSA 4TV3A 4ICXA 4QJ3B 2EP6A 4XX5A 4ANWA 3ZIMA 4HVBA 4AJWA 4ANUA 4FULA 3R7QA 3L54A 4KITB 1DJZA 2RD0A 1DJWA 4J6IA 4F92B 1DJGA 2WXFA 3QJZA 5CCHE 1QATA 1RSYA 2QZQA 4GNKB 3L4CA 3ZW3A 2FJUB 3CSTA 3TL5A 4Y1SA 1UOWA 4L1BA 4ICWA 1E7UA 4G11A 1TJMA 2Q0ZX 4LDCA 4ANXA 4FJZA 5CCJA 5JHBA 2WXGA 4GB9A 2CJTA 3PFQA 4KZCA 2ENQA 4TUUA 3L16A 4LCVA 3DPDA 5H4ZA 3L08A 2Q3XA 2K4AA 1E8ZA 2R83A 5EDSA 4WWNA 3OHMB 4NP9A 2WXHA 1A25A 1DJHA 2LHAA 1DJXA 1WFMA 2ENJA 3P2BA 3F01A 2CHXA 1DQVA 4NS0A 3ML9A 1W15A
chains in the Genus database with same CATH superfamily
5ERWB 2VCOA 2PTTA 3MV7B 1F90L 4OVVA 1NPJA 4E41D 2DYPD 4NI3A 4OCRL 5IHHA 2XV0A 4JJ5B 5B3SB 1D7BA 1FO0A 1WIOA 5HVHC 4MJIE 1PCSA 1MCOH 2OFQA 3GS4A 3ZKMD 2ADFH 1AQMA 2WVVA 5HHQB 4TQIA 2B39A 4KY1L 2F1BA 3JTTB 3NSJA 3O3BB 4I3GA 2OMUA 3KPMA 1T0MB 1G7IA 2OYKA 3JWNE 1ZV9A 3D51A 2VLLB 2BINA 4PIBA 1CZ8H 2JLLA 1UOKA 1WFOA 1H3WM 4AV0A 3AU0A 1GC1C 2Y1YA 1AO7A 4XBPA 1Y6NR 1FNSL 2Z92A 1SLVA 2NY5H 3RZWA 1H0DB 4F5CA 2R7EA 1C8PA 4CSTA 1A14L 1K3IA 1KJ2A 3IPEA 4MZRA 2GAZB 4KKLD 1C7TA 5EG6C 4RFEA 3DIFA 3QZOA 1NGPL 2E9WA 4PRHB 5H4YA 1HT6A 4QGYA 1UWXH 5LGYA 1E6OH 2NY1C 3S3CB 1ZPLA 1J05A 2CKBA 1T5WB 3O6FC 3STZB 5IB5B 1M56B 1CE6B 5AFAA 1KLUA 3ZYJA 1YEIH 1KGCD 2DRUA 2XC8A 3FB8B 2ZUYA 4I1PA 1QLRB 1XGZA 2XWXA 3CSYB 3GHBH 5AD0A 4X83A 2WTPA 5C0CB 1HNYA 2FX7H 1MAMH 5ECJE 3U1SL 3KBFA 4TS6A 4HZLB 1GPOL 1JZIA 2HH0L 1N12A 1UWEH 5JIHA 1AO7D 1HDMB 1J88A 5L4FA 1A3RH 3CFTA 1A6ZA 5C0EB 5FEBA 1OAJA 4NC0B 4O5LL 5C0JB 1BAFH 3VXPB 4KTDH 3E80A 1BFVH 5D5ME 2G75B 4GMSH 1F2XK 5FGRA 1PZSA 3L3DA 4FHBD 3MACH 3LZQA 5IF0A 3KBPA 3IETB 1SYVB 3L54A 1YEFH 2VABB 1PJWA 3SKOA 2X6CA 4FQJL 5EC1A 2VRKA 3MRHA 3IDXL 3OKLB 2X4SB 3KEHA 2EE9A 3ULSA 4UIMA 5D7SL 2MNJB 3U6RA 1U91A 1LMIA 4B3VA 4HWZB 4ODTH 1A9EB 4IOSA 2YUVA 3B8YA 3ZT7A 1XIWA 5K9OA 5FB8A 3LKRA 2MQ3A 1BIHA 5ILTH 5B22A 1HZHL 2OJZL 4BH8A 1ZXKA 5LAXA 3V6ZB 3RG1C 4OLVH 3SZKC 1VLXA 1MJ8L 3BRDA 1SJHB 1CLCA 4XB8A 1E3FA 3M46A 4X6DE 4GS7C 1AS6A 3F84A 3U2SB 3PDOA 5DK0A 3D87B 3VSQA 4M7LH 2UZXB 2NY4D 5BV7B 3GBNL 25C8L 4DGVH 1XR9B 5DK2A 1AKJB 1DUYA 1INEH 5IREA 4FLSA 1VFAB 1ZRUA 4IOSD 2LABA 3A4FA 1NJ9A 5IW1A 3COOA 3NCYP 1XO8A 3PIQA 4LLVA 2JTDA 1I8MA 4QXWA 3F5WA 4P59L 1V7MH 3PP4L 2OL3L 3SJVB 2ADIA 1H3PL 5B7EA 5IB2B 1MJJB 5GJSL 2EKJA 2WLLB 5J89A 4G6KL 4N9OB 4PJHB 4JFEB 1G6RA 2VDLB 4HETA 3VW3H 4AQEB 5GHWL 1OV8A 3D9AH 3QDGE 5KSBB 2FBJH 3QXAA 4P2AA 3C5ZC 4ZW5A 4XVJL 3MRPB 1NFAA 2NLJA 3O4LE 3NPZB 1F4XH 3O41B 2YPLB 3CZSA 1XCTB 1OM3H 1RZGB 4QOKA 4Y8DC 5L6YH 3N41B 2ISDA 1MFBH 3LNIA 4QRRA 2AKRA 2NY6C 4GW1A 2R2EA 3LEYL 1F2QA 3HN5A 1UZ8A 4K5MA 2X10A 3ZK0A 1F6FB 3OR6A 1WK0A 1E9QA 5JMOC 1GZQB 3FPXA 1FN4A 1MF2L 1LO3H 2VUYA 5FK9A 5CU9A 1BFTA 2NY5C 2NY0C 2UXVA 3AQDA 3MUZ1 4UAOB 4UT9A 5D71H 2JCCA 3DJZA 1EAPA 3PQYE 2BRRL 4LLUA 1FGNL 5C07D 4HS6A 3B9KC 4HQQL 4JVWA 1OAKL 2QELA 3M17B 4LEOB 3QUKA 3SYOA 4KK6C 2MKWA 2IQ9L 4CKQA 2VKXA 1ZA3B 3VWJA 1RK7A 2GPZA 2VXVH 2BOBB 5ENWB 4QOKD 4FXTA 4CW1A 1CT8A 2VQUA 2KZWA 3LYRA 3MRKA 4NLAA 4P23C 1ED3A 5SWSE 3AY4A 5BW7A 3NCFB 4ZFOL 5ECGA 2IGFH 3QCVL 3A4AA 4KU1A 3FSVA 3MRMA 3KJ4C 3EFDH 2VLRD 5KW9L 3DRTB 4LO9A 4XAKE 3DXAA 4LAQL 4D9QD 2ESVE 1VRSA 2DWDA 3Q1EA 3U9UA 1JERA 5CIPH 1KIQB 1AHMA 4AXWA 2OYMA 4AGPA 1DBML 3IJHB 2BS71 2QSTA 1N26A 2ZSVA 1ZXQA 3VWJD 3FSOA 4FXLA 2NT0A 5JNYB 1EJOH 4YSOA 3FF7A 3C08L 1O5DT 5D7LB 1IKNC 1S9VB 1NMBH 2BFVH 3RZCB 3U9WA 1CLVA 4A55A 2O61B 2O5ZH 3ZL4H 1JV2A 3O45B 2P7TA 2VJ0A 4MMZA 1OARL 3L2NA 1IQDA 3TO4C 2HAZA 5AB0A 3ZHFA 4XXDB 1BM7A 1F11A 1MQKL 4WK4B 3UAFA 7TAAA 1UM6L 1FVCB 5HHOA 3UO1L 4G8AC 1NDGA 3QUMH 4LSTH 3GMOB 5E2TL 4A2EA 5CCKH 1TJGL 3DXAD 4U1JA 5C0IA 1PGRB 2H41A 3QJFB 2FHCA 5IEHA 4UILL 1IEBA 2Q8BL 1IILE 2JV6A 1C5CH 4M7JH 3TO2B 3MXWL 5EBWB 4FFWD 4WSJA 3KPLA 5GGTA 3ETBF 4F7MA 1UJTA 1Y18A 2Y7LA 3K3QA 3LRGA 3FOMB 5HJDA 3P3UA 5CZXC 4PJ9A 4GMTH 3TZVC 1ZIAA 4OM1H 8FABA 3UO8B 2F74B 1I8LA 3FQWB 3L3OA 4GBXA 5L9DH 5D1XB 4XMUA 1BAGA 3QIWC 4Z7WE 3CN0A 2DBLL 2N59A 5E8EA 4ZPTA 3HHSB 1I9JH 5HHOD 4AYID 5FW6A 3LQAH 4HV8A 3IDMB 3QXTA 2ERJB 3RGVC 4Y19E 1HHJA 2JB5L 3DMMB 3BVNB 3EUUA 4DP9X 2Q87A 1LD9A 4GO8A 2OZ4L 3V4VL 4CGUB 1F6AA 2A83B 1PKQB 2BS8A 3VVWA 4XMTA 4O4YH 2HFEA 3QDME 5LCVA 1MCJA 3QUYA 5IKCB 4S1QH 3GKZA 5TQ0H 4IRZA 4HUUA 5I0VA 3BESR 4KFMA 1CD9B 1LP9A 4F7KA 1GYWA 5KVFE 5ADPL 1HH6B 5I66A 4QY8B 3W81A 1MWOA 3DI3B 4PJ5E 1PG7X 4IRSB 4XX5A 5JHDE 2JKTM 3SDCC 4F8TA 5I8EA 4PYHA 3V52L 1ET7A 2Z31C 4BBWA 4BH7B 2A6IA 2H4EA 1FL5B 5ACZA 2VXUL 1S7VA 2BHFA 4P2YA 5HDQL 4WKZA 3N43B 5IY5B 3T2PA 4Z7UA 4XVTH 1YEKL 3CZFA 3UZEA 1QA9A 1PBYA 2R4SH 2Q0ZX 3NIFE 4NQCE 3P9MA 3MCKA 4RMWA 5EBMA 4AIZA 4CN6A 4GXVH 1VA9A 1T5XA 2YAOA 4YGAB 1A7PH 4MNGB 3MCG1 4JHBA 3TX4A 2K4AA 5K1VA 4LGPB 1KUMA 3QUYD 5D5MF 2H8PA 4B9ZA 1L6PA 3AGWA 2DQFA 3B5GA 3LZPA 2IH3A 1W15A 4KNUA 1MIMH 4ADJA 1ZS2A 2WXKA 2PLTA 2GBVA 3CX5J 2AQTA 3LD8B 3O4OC 5AW8B 4E9YA 1IVTA 3AACA 4A2MA 3M86A 1HHKB 5KSAA 1S78D 2YPVH 4KTEL 1CK0L 3NESA 3TA3D 4GAYB 4HUXB 5FO8B 3IGAA 5EEYA 1QABA 1LO2L 3IMUA 1ITBB 1RUQL 1FNHA 1SDYA 1F58H 2IDCA 4FX5A 4LLQA 2W0PA 2FWLB 1MNNA 2AXFB 2WBJA 2EEDA 2C3WA 3GZKA 3UJTL 3PJSB 4R97C 3UTPD 4QF1A 1UWYA 2IGTA 1YMME 3BP4A 4Q2ZB 3GBEA 5JHAA 2HZHA 3I9IA 3T0AA 5H35A 1VKXA 5CSBA 4XP4H 4PEEA 3S88L 3H3PH 4C4KT 1EVTC 3H3KA 1PQZA 4MD4B 3MROB 4X6DF 3MLUL 1M9SA 3IWUA 2BNRB 1WP6A 5EN2B 4PY7B 4NQXB 2WXQA 3D0VB 5AVRB 3NRPA 4OUUA 3E8VA 4NJAH 4P5TA 4Y5VA 3ZYIA 1J18A 5EU3A 5KYWA 3FTYA 1BZ7A 2BSSB 3AMKA 1M7XA 3T3ME 4F7PA 2ALAA 4LFHG 2DLEA 2PPCA 3J27A 3F7YA 4MSWA 1UZGA 2WBJD 2FZ3B 5GRUL 3QW9A 5CBEA 4Y9BA 4QTIH 1WBZB 5C0RH 3KPNA 3HAEA 2NW3B 3SO5A 1XF4A 3QHFH 1QX1A 2VC2B 4Z0XB 5A7BA 3P9LA 4WNSA 4FNTA 3P69A 2F8VA 2AXJA 4OQTA 1ZHKB 4IKIA 2RCSL 5JPMB 3VD1A 1ODUA 2VIRB 2YGQA 3BIKB 3BH4A 5AVQB 4L8CB 4B5EA 3NQIA 1JN6A 3EOTL 3KPRE 3BZ5A 4P5TD 5C09E 2IV9A 1HI6A 4Y4KA 1JXDA 2DL9A 3VU1A 3UG5A 2CPCA 2XI9A 5GRXG 3A0OA 3E2HB 4E9TA 4XHQA 2FGWL 1BZEA 2HWZL 1BD2A 2CUAA 1PIGA 4LIQE 1X44A 3BZ4B 3VD9A 1USQA 1EJFA 1AHWC 3FQ4A 3HNVH 4Q9QL 3O3UN 4LP5A 3MFFB 3KLQA 4YDMA 2AK4A 2GHWB 1WFIA 1T0NB 3QNZA 1E0OB 2CBPA 2JF1A 3QXWA 4KXZI 4KKZA 3RL1B 1MHCB 3HFMH 1BSIA 3ROOB 3EOAA 5DJDA 1O7DE 1VDGA 1WWAX 2NSQA 3EW3B 4Y4KD 1WUZA 1QWUA 1XGQB 4G5ZL 3QPXL 2FNBA 3REVA 3TEUA 3QQNA 4PJ6A 3GUTA 1JPSH 1PZAA 3B9DA 4PP2A 2GJ6A 5FDYA 4AH2A 4PRAB 1RU9H 1S7RB 1T0PB 2G2RA 1VGKA 4NGHL 5JDJA 2H2PC 3TCTA 2Q9OA 3BP5B 5KTEL 1P69B 1XSKA 3IPBA 2P5WD 4KAQH 5HGGS 5IMMA 1H6FA 2L7EA 3WIIH 2A9ML 3HZYA 4JHWL 4G8GE 5AVXB 3MLTA 2AK4D 5DMIL 2OW6A 3NACH 4KXAA 1ZDQA 1I8IA 3GJEB 1EZVY 4GAFB 4R83A 1D9KC 4GO6B 1GCYA 4QHPA 4JO4L 4MJIB 1HEJC 3MNDA 4U1NB 5EZJA 1Q0YL 5J06A 2YMXL 4F58H 2XKSA 3VRJB 4U49A 2O93L 1A1NB 4R7DA 4OF0A 1KGUA 3HR5B 2WLKA 1B2WL 4J8RA 3OAWA 3RWCA 4GH7B 5IWLA 5ANHA 1NPNA 4NAMA 1T6BX 2VDMH 4M3JA 2GJ6D 4JPKL 3HHMA 4NI6A 4J4PC 4AE1A 4RFOH 1PMYA 4ZW3A 2PUQT 4TLSA 5T5FH 3QI9B 4ZTPH 5JA9A 3OV6A 1S7UB 3G6JA 3AG4B 4FHJA 3PYCA 2J71A 4FQIH 1UT1A 4PV9A 2KBGA 1KGIA 3T0ED 4P99A 4HC1A 4I1RA 2A4ZA 2W60B 4NZRL 3I2CL 4LRNH 2J4WL 1DQDL 5D7KD 3G04B 1YNKL 4QHUB 5LBSA 4EO5A 5I1AA 5LXGL 2C3GA 4F7CB 1U9KA 5F7DB 2H3NA 4IHOB 2FB4H 3A5VA 3CBRA 1D6EA 3PPEA 3GI8H 4Z7WF 4RRPA 5EU4A 3G5XA 3D2TA 4GP4B 5EEWA 5BUPA 3C6LA 3PGFL 1C12B 1KCRH 2P44B 4Y4FA 1QBBA 2J2ZA 1BXXA 4OKDA 1NAMH 4GT0A 5EORL 4PJEE 4WTWA 4RAUB 2H3KA 1UYWH 1O75A 2CSPA 3MBXL 3AM8C 4MJ6A 1F3JA 3DUUA 1NCIA 4YHZH 1BEYL 1NGYB 4DWHA 5JHBA 4KK8D 5F97E 1SJXA 2FT8A 4YHOL 3SPVB 1F3DH 4DGIH 1RD6A 1U6AH 2F7IA 4NSKA 2WXHA 3QRLA 1JF1A 5J1AA 5JMRA 4OZGE 1SF3A 1U4EA 2AJ3A 3BW9A 3ARYA 4AUJA 1CXFA 1F4HA 3OMAB 3WS3A 5CKAA 2EIKB 4HXBH 4UZSA 1GR7A 2P5EE 1QFHA 1MCWM 3HE6C 3VWKC 4JKNA 4UMGA 4N8VB 3GMLB 3TBTA 4M48H 4I48B 1ZT7A 5EZIL 5HYSG 5AZ2H 4PGJA 3C6LD 1WVZA 4MQTB 5ICZB 3RUGA 2CDGB 4Y4FD 3INOA 5E1IA 5GZNA 3RVTD 3NIFF 2ZYHA 5F96L 4P49A 4HPYH 1QACA 2PW1A 3LNDA 2BWDA 2VDPH 4JKMA 3CZJA 1RZKL 2DQCL 1ZTXL 1YEEL 1QTYT 2IPUG 4A7GA 5DC2A 1TYJA 5FYKD 3MA7B 4X6DB 3GSWB 3V0DA 2V7HB 1UACL 3B56A 4HIQA 3VH8G 2DLHA 3X1GA 1MHEB 5HHXH 2VQ4A 1RZFH 4F9PA 2FUTA 2PO6C 3TBCA 4EE2A 4B3EA 5DHVA 4CMMB 4J5VA 3EUDA 4BM7A 4Q56A 3W57A 3O2DL 4K7FA 1K4CA 4XP5L 5CJXC 1JZ2A 4XVSL 4M43H 1FFNB 1NZRA 3CAFA 3TFBA 3DX0A 3NJGA 4LF3A 4UT6L 4XPBL 2W59A 1J0HA 5T1JA 3ALPA 3G5ZA 4FYTA 5E6ID 3U7WH 4OR1A 1NCTA 2A5UA 4JZJA 1UEMA 4ZAKA 3T6VA 3WJMA 4U1GC 3SSGA 4JGUA 3IFLH 3X17A 1OGPA 2DMKA 4KI5E 3FB5A 4W9FC 3QDGB 4OCYL 4WUUA 1FVDA 3RHWK 2GY5A 3O4LB 3L17A 1MN4A 5CHNA 3FT2A 1M6UA 3K6NA 2OSXA 4RETB 2A9CA 4A39A 2PYEE 3HC3H 5GGSA 1WCBB 1K8DA 3G3LA 1N59B 5IBLC 4ZOEA 2Q76B 2ITCA 3T3MF 3BAYA 3W1ZA 2V33A 3F3HA 3LEVL 4B9GA 4JDEA 5F3HA 4ZUUB 2XIDA 3PQYB 2D7TH 3EOBA 4QT5A 3NFPB 2VOTA 3JV6A 3IPFA 2J88L 4HIPA 2VR9A 4FJZA 1OCOB 3BI9X 4FXKC 4MYWB 2VJ8A 3BT2L 3QG6A 1IAMA 4FFTA 2K6YA 3P3TA 2RB8A 1J0YA 4P2QD 4XMZA 5BQ7B 4UQBA 5TE4H 2EINB 4M9OA 4FQLH 4M3KB 2Z91B 5H37H 1YY8B 1G9HA 2VZ1A 2OMWB 1Q9LA 4G8IB 1FH5H 2BIOA 2APSA 1DL7H 1TT6A 5SWSB 1PZBA 2XTSA 3ZE0E 3IXAA 2DJUA 3WFCL 5CFHA 4JRYE 3K6OA 4K8RL 5ALCH 2BXZA 3GPSA 5KJRH 1E2WA 1OCWL 5C1MB 2ESVB 1JFQH 2NCMA 3C8KB 5HYJA 4TSAH 1XTMA 3P40A 4JO2L 4RGNE 1FFTB 2NW2B 1A6VH 2DTMH 3BO8A 4QHLA 2DQEH 4Z95H 2ZG1A 2XWJB 1XHHA 2I9LA 3LH2H 1CLZH 5K9QG 4NZ8A 3CIAA 2PPEA 3FT4B 2BVTA 3VDAA 1JRHL 4WGVB 3EHBD 3VFOA 2PCFA 5EUOA 4XN9A 4DW2L 2NYZA 3SGDI 4ZFFB 2ZXCA 4PHZA 2XTJC 1NEPA 3TU6A 4AQ8A 3H56A 3F6LA 5HI4D 3SE8H 3BC9A 5KWYC 2VMDA 3NP4A 1M05B 1ZSDB 3VXQB 3D12B 4DKDC 4HUVA 1YUHA 3C5SB 1TFHA 3MLZL 1E65A 4Y16B 2AJYL 4CBZA 3ZO0A 2H2SD 3MJ9A 5I18H 3BLBA 5F0MB 4HG4K 4AE0A 4I8DA 1KIUB 3NJKA 4H8PA 5ID1A 2HFFB 5HYQB 3P4NB 4R26H 1U8OA 3UDWA 4NQEA 3BXNB 1YNLL 3T5WA 1BX2B 2WVTA 2NTFA 4RA3A 3ULUD 4P9HH 4YUEL 4Z77A 1AQ8A 2B4CL 3H42H 4O51A 5C6TH 4ABQA 2UY6B 3MRDA 2ITDA 2AJZA 3GXDA 1J7VR 5GGTL 4BDVB 3WI9A 1S7XA 2V6HA 5L2KA 1X5HA 2YUXA 3RILA 1JK8A 5L8LB 1AR1D 4FG4A 4FQPA 4OM0H 5EO9B 1QR4A 5DVLA 3HC2A 1KDJA 4HKJB 4BZ2A 1IAII 4KJPC 1FPTL 5HHNA 1MY7A 4PJ5B 5E9NA 4ZS6C 4NQED 2G3MA 2VWEC 3NVQA 1G43A 4JDTH 1GGUA 5TF1H 3K6SB 1HEZA 1MNUH 1X7TA 1HS6A 2H1XA 2LHAA 2P52A 4CN4A 2XN9A 4Q0XH 4N2DA 1SN0A 3IFNH 3KH4A 3FONA 3ZY7A 1SUJA 5EEUA 5LCVL 1P7KB 3KJ6L 3NIFB 1KCSL 4NQCB 4Y2OB 1ZVYA 1UENA 4FZEL 5L2KD 3HE7C 4S1RL 5FGCE 4NWTH 4PJEF 4XAWL 1JGLL 1XGYH 5IEKB 1MIEL 4P57A 4N0CC 5LNDA 1FFOB 5I17B 2YO3A 4Y8AA 2YD2A 3E9UA 3N9GH 4HISA 3QNXA 5LXVA 3QQ3A 4GI6A 1D5MB 4K3EL 4OZGF 1L7IL 2OK0H 4L8BA 4KTYA 4EXKA 4MMXB 2AFNA 2XN9D 4OGAC 3DKHA 1FIGL 4FI7A 3V0HA 4NAQA 1AP2B 2P43B 4PWGA 5F3FA 2G60L 3TJHD 2TAAA 2ZKXA 4U6VL 3WO4B 3MJ7B 4ENEC 1A66A 1C08A 4J3OD 3OD3A 2BIQA 1YMMB 3QQDA 1I4FB 5D2LA 2V3EA 4U1SA 1BQHG 1CB4A 5C7ZA 4Y4HB 4GW4A 1EFXB 3NH7H 1J8HD 2N56A 3BAKA 3MA9L 3VI4E 5C92A 2JI1A 4XCFH 1EHXA 3DX7A 2F53D 3OAYH 1KBGL 3L1EA 5AZEL 4AY0A 1C16B 2BPBA 2QSVA 4NUJA 4M4RA 4P5KB 1YMHB 3DX6B 4RGOL 5GSVB 2R0ZH 1U8JB 3CVHA 2VITB 1GTFA 2NDGA 5DJAA 1SMOA 3BJLA 3MSPA 1PD1A 1BF8A 5BOPA 1QUPA 4R96A 3QGVA 4WU7B 1P5VA 2E7MA 2NQ3A 3T3MB 5FYJH 2NR6C 2R0LH 3LH9A 3WFDL 1MCWW 5SV3A 3QO0A 5TDOA 4O9HL 2QTVA 1NWOA 2RFXA 2UVFA 3BQUD 4CU6A 4A7VA 4HULB 1B0WA 1P1ZB 4LVOB 5BVPL 2AANA 3AS0A 5D1QA 4HIXH 1W0WB 4NNYA 4OW6A 2Z93B 4XI5D 4WY7L 5DGQA 5DZNA 3D18B 4OCNC 4KI5F 3WE1A 3BFQG 4FNLL 4WW2F 1V5JA 2VO5A 2YRPA 2GT9B 3TFKC 5LWYH 2ZYSA 2OTUB 3O6LH 4YGVB 3JT0A 4JFOA 1NCJA 1AXSA 3IDUA 2VDOL 3CH1A 2WZAA 3KPRB 5DS8A 5C09B 3PHQA 3T8XB 3ASWA 4BRVA 1TQVA 3QQXA 4MNHB 1UA3A 4WW1B 2YAQA 35C8H 3DWTA 4HCRH 4HPOH 2F7OA 2J8UA 1EO8H 1E5AA 4QTFA 5D1QD 2KQNA 1CDYA 3OG6B 1R75A 1TTUA 4OQTL 3SE3C 1DLHB 3KPOB 5F88A 1OTUD 4ZFGH 1CICA 2ARJA 1OW0A 2B14A 2X42A 4TSBH 4XCNB 1NCWH 2NXYB 1KXVC 4PWKA 2HXAA 2BDNH 2BY3A 3VXOB 4QYAA 4OLWH 3SBPA 4M93B 4ZUTB 3FU6A 1E9OA 4DCQA 1NL0H 2F19L 4WWKC 4X98A 3PUUA 3U83A 4B6ZA 4MHHG 4ES8A 3SCMB 3NSXA 5CJOH 3ECBA 2FUQA 2Y2WA 3FZUC 3V5DB 3ZE0F 5F2FA 2J1WA 1WC7B 2NXZD 3K4AA 5DUBB 5FDWB 2VXTH 3W39B 4YSEA 1MREH 4DTGH 4N0FA 5T33L 5CLYA 1J9QA 2HLFC 5HYIA 1N4XH 4G8GB 4HJGB 4EKJA 2WO3B 4WTZG 1FV1B 1EK3A 5AAMC 1ETZA 1TJIH 2LU7A 3AG3B 4K4KA 5ITFB 1KYOJ 4QRPA 3OX8A 3HRZA 4JFXB 1URIA 2V5SA 3GRGA 3LQMA 1XCXA 2W95A 5ADOH 4NBXB 1Q72L 4KKAD 2GEEA 1QD0A 3EO1A 4HKZB 2Q8AH 1VCAA 2BSBA 1OPOA 3NCJL 4L8SA 4LVNC 3UC2A 5MP6L 3HC4L 2Q10A 1N0XH 2E4TA 3PAZA 2JJTC 2ZWNA 1QI4A 3HPLA 4X6FB 3MMEA 1JGEA 3CXDH 3FFCA 4UYQA 5IQ9B 1Y7VA 4EUPH 3FTVA 2IPKA 3WGVB 4E9QA 4KJQD 1RV6X 1MW0A 5ICYB 2BHZA 4MA3A 2AGJL 3HNTH 3MYJB 4U1MB 1Z5YD 1MCQA 4KPHL 1DE4A 1MJ7L 2XN0A 4QRPD 4W9CC 5DQDH 2OMTA 4IMKC 3OKYA 4L4TE 5LGHL 4ZMVA 4ZUVA 1XGUB 3K81A 1Z9SB 5IB4A 2FD6H 2Y5TB 3EJZD 4NO2A 4PJBF 2A2QT 3NFNA 4KDVA 4W4OA 3OZ9H 3WIHA 4NQSA 1PCXA 4QRBA 2CMRL 1ZIBA 15C8H 4AL8H 4F8LA 4TYUA 1SY6H 1A0QH 2OSYA 4UNVA 4K71B 4TUUA 1U3YA 4U6YB 5GJTL 1OSPH 3FFCD 3FMGH 1TZHA 1OCRB 4QWWC 1SPDA 3BAEL 3BGFC 3PDDA 3QHZL 4AYFA 1KXTB 5E9DD 3DC0A 3BFWA 3QYNA 4PJEB 3MODL 3FW6A 3ZR5A 1E4WL 4NUMA 1GOGA 3BKJL 3OJMB 4IIQC 3QZPA 3JWDH 4DKEL 1BBJA 5DYOB 1I7RB 5LBSL 3RWJA 3OC8A 4EIGB 4KZEH 2GK0A 1T21B 3GSNA 3FT3B 3KM1A 1HOEA 1QRKA 5TF0A 1QOKA 4L3FA 3FUEA 3FBKA 1I3RA 3IJEA 4G6AD 1CCZA 1CR9H 2MEJB 4OZGB 2KT6A 3HMWL 3OLDA 5MEOB 4XO4A 2P5EB 5EOCH 4AJYV 2E27H 3KYMA 1PY9A 4OT1L 3IDGB 2VQ1B 4P5MA 3RX5A 2Z35A 3HS0A 3NIGE 3NP3A 5LN8A 4JANB 1PFOA 3OHXA 3OSVA 4M61A 4ELMB 5D7JD 3L13A 4YO0B 1DR9A 4JS7A 2QEJA 3ETTA 5J0BA 1QLFB 2EDTA 3B83A 4QAWA 5EZLB 2NY7H 3AWFA 1RPUA 2X2UA 5LG6A 5DLML 1AD0B 1HXYB 1QFWM 1T4KA 2AJUL 4LMQI 1NC4D 1P84K 2GSIB 1FI8C 4HJSA 3BPCA 1DQML 4WI9A 1KGCE 5CINL 3EXLA 5DRZA 4OCRH 4PB0H 4CSZA 5TK4A 3Q6FB 2XQYA 5T1MB 1NIBA 3V95A 3LS5L 5EIIG 3HKZA 3AS3A 2YN5A 2O6PA 1OP3H 4F5CE 4OJAA 3V6FB 5L7XH 3KDMB 2KI6A 4DUWA 4ZOCA 1MFAL 3PAYA 1CTMA 1R5WA 2X7LA 2YQBA 4G59C 4K55A 3B3IA 4I3RL 2AQRA 4BKSC 5HSFA 2F5BL 3L9EA 4HJ0D 1IM9A 3LXCA 3NOIA 4J12A 4WW2B 4ERSL 2IG2L 3QJHB 4E5XB 2GTQA 3EFFA 1B0IA 3AQXA 4GO9A 2GHZA 2F8OA 4JB9H 2YC1B 3WD5L 4WO4D 1BBDL 3WFEL 3MV11 4G2AA 2BCKB 4UOZA 5F9JB 1CFTB 4DP6X 5J11B 5BJTA 2Z8WC 2PYEB 1NKOA 5KAQF 3WIFA 2GK2A 9PCYA 3P4OB 5KBLA 1A5FL 3MGOA 5ABDE 1ZT4A 3VXRD 1FDLL 1TMQA 1XX9C 3NCCB 2OP4H 1TETL 3IJ8A 4ODXA 5DJ6A 2SEBA 4AEHL 1CF8L 4KWUA 1PS3A 4ZFZA 3BN9C 3GLDA 2Q86B 3U0PA 5L8KB 1Q8MA 4AQZA 2AJSH 1CQKA 4YHNA 1IM9D 2HT2C 4W9JC 5I9QB 2EEFA 2VDQH 4LCYA 4QHMB 4BFRA 2CDEA 5DJ8B 1I8KB 1IZJA 3AXLA 4POUB 4NC1E 4O5LH 1ZA6A 3WFBH 1M1XB 2WTRA 2ZP8A 3S5ZA 1ADQL 3OPZL 1CDUA 4N8CL 5ICXA 2C3VB 1R3KA 3RWGA 3IFOA 2D3LA 2CO6B 3QAQA 1FWXA 3RIKA 1MFUA 1OAQH 3MCLH 4U7KA 4HOZA 4JJOA 1UWGL 4AL8C 5JOFA 2I07A 5EU5A 4LHUB 1MVUB 5SX4H 3SO3B 1UH3A 3AABA 3GMQB 3ISYA 4JRYB 3KYOB 4XE5B 4JM4L 4MCYB 3K71A 4TUKH 3EOYG 4OGXH 3QEHA 4ZS7H 2AVGA 3BUPA 1UXWB 2K7PA 4RGNB 4M8QB 3L95A 2VRQA 3ZQ9A 1KENL 3AAZB 1Q94B 5D2NC 1KPRA 1BM3L 1BVNT 3GGWB 2DQIL 1PZDA 4CAGA 2ICWB 4A6YH 1UVQA 2KYIA 5AKTA 1DVSA 4FKHA 4AM0Q 5C9JA 4MQXC 4R90L 3KWXA 3EJJX 5DWUL 3NA4A 1R5VB 3I9AA 4RDQF 3KGSA 5I1EH 3ZT6A 1MRFL 1ZEAH 2EEXA 4HX1A 1CWVA 1IX2A 4HWBH 4WTQA 3TT3H 3L4XA 3TT1H 4NOFA 2NNRA 5JW3H 3K8KA 4H1LH 2R29H 3L5IA 4FEMA 4P4KC 3V6OA 3ELAT 4PU2A 1D6VH 1OB1A 1T1YA 3P11H 4XPAH 5JORA 3S96B 2ZX5A 3N6YA 4IOIB 1EGJH 4GQ9H 3FU7A 1IFRA 4GSQA 4NO5B 5CGTA 1DJSA 5L88L 1J5CA 1ZVSB 1UM5L 3PWVA 4GW5B 4PLJC 2ZSWA 3KLSA 4P9ML 5HJ3A 3E8UH 3V4PB 3EGSA 4UUJA 1E9PA 1IVLA 3L2MA 2UY7B 2ZG3A 1G9ML 4PLKC 4HK0B 3JBG7 3V2AR 5I1KL 1YO4A 4QOKE 1UKSA 2XZQH 5BMFH 3FSWA 4QRRE 5FLUA 4KRPC 5K9QI 2AERT 1HHIA 2ID5A 3KYNA 3QJSB 5GGUA 4PTUB 5DS1A 2WIIB 5KYUB 1N8ZB 3MJ9L 4G1MA 4AGLA 4Z7QF 3A47A 5A2IH 2HVJA 4W9KC 5ESVA 1JGIA 3U6XS 4D9QE 1LWHA 4NENB 3U4BL 4IBUA 1MVYA 2BH0A 3L6FA 4PRDB 4NDMA 4RMTA 2AXGA 1FUNA 4MD5B 2AJVL 1UQSB 3JUYA 2CA3A 3C5XA 1XSOA 1X4XA 3B7YA 1VCBC 1XB8A 1ZS8A 2O5XL 1RJYA 2OMXB 3I6LD 3V0VB 4I77H 1BVOA 3PRZA 5FO9A 2XA8H 3TNNB 4YDZA 3ESUF 2IQ9H 3CVDA 2LR4A 1M71A 1BVKB 5DJCB 3T8MA 5GS1B 4LLYB 4KXDA 5AALA 2GJJA 1ZGLA 4FQ1H 3QEQE 3VYOA 2YD1A 3M6DA 4BZ2L 3DXAE 4ZMLA 2E9GA 4I18A 1HILA 4Y2DC 3NAAL 5FGCB 1FORL 3BFOA 4Y9GA 2JMRA 1A9BB 1BLIA 3FN3A 3IM1A 3MLWL 1U3HD 3K91A 3QUZA 4G6JH 4WFFD 1EAJA 4XHJD 2W92A 5B38B 3BUQA 2YWZA 1NCBL 5CILL 4N28A 4O02L 5C0FB 4X80L 1IE4A 1T7VA 5AOIA 5J12B 1MFDL 1TQTA 1PDKA 3FDWA 1JWMB 3ZRFC 4JRLA 1PNDA 5GZOC 2KL6A 4YVNA 3WAKA 4RWYL 1JSYA 4Y5YA 3R06B 5F8RC 2A9NL 3SB3A 5KBKA 4ODHL 5A2FA 4P46A 3X11A 5JXAH 2J6EL 5HHOE 4F7TA 3MAWA 3NIGF 1HYSD 1P6WA 2KKQA 2YAHA 1SUHA 1T89A 4DO6A 4LQ1A 1C5DB 3GD1C 5FYKU 4R2GC 2AQ1A 4L9LB 1W2KT 2WUBH 5CNHA 5I73B 4AQ1A 3VFUB 4R4BB 3UYPA 1OARH 4ZUSA 3ME0B 4JR9H 3V8CA 2DB8A 4LP8A 4NYLA 5E00B 3KS0H 3MNVB 3LKOB 2DZEA 2CO7B 1FHNA 3A6BL 4I2XA 3VI4B 1DVFC 2BVUA 1UKTA 4XC1L 2JSFA 2APVA 3M07A 1L9NA 3CFDB 4M62H 3ZHLA 3OC5A 4UILH 5DQ9B 2QPSA 4YHKL 1J8SA 2CXKA 3LTVA 3WU1A 3GNMH 1QPXA 3H7BB 1THCA 2BMKA 1DUZA 4ZK8A 2BVOB 1JGVL 4XO9A 1CLOH 2C7UB 2WANA 3P30L 4Z3JA 1JZDC 3SE9L 1UADC 4I5BA 2P8MB 1HQ4B 3SOTA 1FZJB 3IMRA 5A3ID 1P2CB 4B95C 2QQKL 1ZHNA 3DI2B 3ILQC 3VXNB 1S7QA 5T1DL 3FT0A 1KULA 5FGBC 2BCMA 1FYHB 2NX5D 1A4JB 1LP9E 3CVHL 4EUPG 1J5DA 2DQHL 4MCZA 5BV7H 5AAWC 5CEXB 32C2B 2ATKA 3O6FA 1KTJA 2NYKA 4HA1A 4W9LC 1AQKL 2OZ4H 4NHUB 4MASA 4PV8B 5JYMA 3FO1B 1U8LB 3QVAA 1HINH 4HIHA 3WKML 4YZFE 4N2OA 1J1PH 1NIEA 1YLBB 1SXAA 3CU7A 2WMPA 4MA8H 4Q6IA 3TWCH 3F8UB 3QRGH 2R1XA 5ADPH 1OAZL 1R6VA 3V9EA 4Z7UE 5FYLH 2GABA 1J1XH 2E59A 1JUFB 2WN2A 3TPUB 1XR8B 3IAPA 1ZLVK 1TOXA 3C8HA 1CTNA 1E4HA 1T1WB 2VXUH 2VDLH 3HG2A 3UTPE 1OHQA 4H8VA 2HLEB 1RLBA 1HX0A 3L4YA 3M88A 4YHYB 3LKNB 3U82B 5DUJA 3JVGA 2HJFA 3AB0B 3O6FD 1H8NA 3VRIB 1KELH 3RB5A 1UM4H 1M7DA 4GFXA 3RDTC 5CBAA 2NCEA 1XVSA 4HUWA 3OKDA 1HXMA 3BLPX 4RMSA 1FBIH 5F0PB 1RZ8B 1WAPA 2I7OA 2K8MA 3FB7A 1A6UL 2ZUXA 2QPDB 3BHBB 1KB5L 1ORQA 2FO4A 1I7TB 5CR8A 2Y6SC 3VGDA 1RK1A 2YD7A 5AENA 2X3AA 4EBQL 3DGGB 1CK0H 3EH2A 4DKAA 4NERA 1XF2A 5E2JA 1C8QA 2A6JA 4IGBC 1ZMYA 1QBMH 2QADD 4U33A 3VYNA 3FO0L 3ZMRA 1MCEA 1IGYA 3BMVA 3E38A 3PWLA 4PVLA 1FC1A 4ZQKA 2APXA 1VGEL 4JM2C 4ADGA 3BRFA 3DHMA 5FA4A 2YD3A 4TQ8A 2K78A 4LEXH 4YQXH 4ONGL 2NY2C 3UJTH 5IUSA 1U8MB 1S3RA 4BE6A 3HG4A 4IMLB 3BD4A 2X88A 1GZHC 2EYSB 1HN1A 4X4MA 1B0RB 3TF4A 2M2DA 3RTQB 3SY6A 4ALAH 4I3SL 4K7PL 1H6UA 5C0NC 3MLUH 4MHHI 4NT6B 2IAMC 4M8UA 2JJVA 2D3JA 3BPOC 3MJ6A 1DBJL 1UT2A 4LCCB 3S48A 1ETJA 4OZFG 4F7EB 8PAZA 5DI8B 3TONA 3X12B 2Y06H 1MWAL 5B8CC 5F9AC 1I1FB 1KPVA 1VZHA 3ZKNC 3Q2VA 4L4TB 2Q20A 3LPGA 3HB3B 3O3DA 3C5ZA 3SKMA 2BHYA 4RNRA 4X6EB 1YEHH 2AXHA 1DQKA 1YC7A 1T1XA 3VSVA 1HHHB 3RU8H 2D31A 1Q9KB 4EPSA 4J2XA 3RWHB 3WAJA 3H7LA 1Z9LA 2ZXGA 3IRZA 5TDNA 3S37H 1BD2E 2QVTA 1MRDL 1DSFL 1Z9MA 2YZ8A 4OFDA 2K0RA 4H44C 5C08E 5A2LH 1CDIA 4FXGC 2COVD 2JCCF 3PJNA 3OKOB 5D8JL 3WDIA 3ZIYA 4HJIA 2Z4TA 3W9EA 1CXIA 2DYPB 3CC1A 4NP4L 3MNWB 2WWNA 4K23H 2FGWH 4NNXA 2XJLA 3FXIC 4LLWB 4ONOA 1TU2A 4PJCA 1QNIA 3C5ZD 3DIVA 3EH1A 2DQ6A 3HUJA 3FQUB 1F3DJ 4LL9A 5I23A 3K46A 4TULH 4MXWH 5IB1B 2PR4H 1R3JA 5IG7B 4X8GA 4Q9QH 3MBWA 4ZMXA 5HJBA 2Q7YB 1ZHLA 5E8DL 3EDFA 2NY6D 5JIMA 2GJ6E 3FCUB 4P23A 3CSBA 3QZBA 2PXYB 2XZAH 4XCCH 1MUJA 1PAMA 3A6CL 2G3NA 2PTTB 3KW8A 2DQMA 2DJMA 3T4YB 3INUH 5DZLA 2FO1A 4U3CA 2IQAA 1WITA 3RWFA 4M6OH 1BOGB 4HJEA 2AAVA 4B97A 1T5KA 1JCVA 1FO0B 3DV4A 4RMQA 3I6SA 3G5WA 2BM3A 1IKFL 4FF9A 4KK6D 2WVVB 5DURD 5F1IB 2A9MH 5K1NA 4R7NA 5D7KE 2BJML 3ZZQA 1O6SA 4F2MA 2OMUB 2QKSA 2VM9A 3KPMB 1G7IB 3UROR 4P23D 3P0VH 4JO4H 3ABZA 4E9VA 2PWHA 1PZ3A 4XBPB 5FUZL 1E4XI 2FSEA 4OU3A 4MX7A 2Z92B 3TO4A 2R7EB 1WA1X 3N40P 3ULVE 1E6JL 3D2UA 1CYWA 1KJ2B 1B9KA 1I3GL 3G6JE 3QIBA 4JDZA 4TPRH 5HGBA 4RFEB 1WS7A 3IRCA 4D0CA 2OULB 2B0SH 3T1WA 2HT3D 4H1LG 2CKBB 1J05B 4TNVK 1LHZA 2N3JA 4XNBA 3GSVA 3CMGA 3FB6B 1ZGLP 1KLUB 1KGYE 2YAEA 4KRMB 4RSVA 1TKWA 2R8SL 3D85B 4GKSA 4B0MB 1WFMA 5B1CA 5D6DC 5AD0B 4B9PA 2ZOKB 2HRPH 2X4UA 4WWOA 3PREA 2EE6A 2HYMA 1NBQA 4GG6A 2IVFC 1MG2C 3TO4D 2JELL 3I2CH 2RH0A 5AVVB 4U0QB 1UH4A 3QIWA 4ZOAA 3D2UD 3GHPA 4BFNA 1CL7I 4LOFA 5HHMD 5CFAA 3QIBD 1DVUA 1KFAL 4YHIA 3RGVA 2D0HA 3VI3A 1WBXA 4I88A 5HTSA 5I74C 4G43A 1KB9K 3Q01A 2N7BA 3OKEB 1ERNA 5IF0B 2BNUA 4EI5D 3P4MA 3VA6A 2DQDL 3QZMA 2GSGB 3F05A 1LP9F 5FYKE 2JKXA 5EC1B 4A7SA 3MRHB 3S35H 3ULSB 1LDSA 3ARBC 4UIMB 3K2MC 3DHUA 4DK5A 4L29A 3U6RB 1U91B 1GH7A 2ADYA 2XZCL 5EN3A 2CHNA 4KTGA 2RBLA 4M1GL 1P6AB 4YZFF 1JZFA 3CDZA 4M5SA 4Y7OC 4DO4A 2Z31A 1XIWB 3M8OH 5FB8B 3RUGE 1KJ3L 3Q2WA 4Z7UF 4ZSOA 2X9WA 5FA3A 1AACA 2OYPA 3RGVD 3UZVB 4BH8B 1J0JA 4YR6A 2VC2H 5I8OL 5KYYA 3B4NA 3IXTA 1FSKB 1BVNP 1WZLA 3OG4B 4KXBA 2LOEA 5I8CA 1B3IA 2X70A 3D3VB 4W6XB 3PDOB 5DK0B 4F8OA 2RTTA 2E74C 1K5WA 2BVQB 4JFSA 5E08H 5CSZA 2CXGA 5DK2B 1DUYB 4AW4A 1MEXL 5I1JL 3DO7A 3U30C 3OKMA 1A2YA 1X6LA 1N7MH 3C09B 4XBMA 2FQFA 5IW1B 3PIQB 1FYTA 4LLVB 4FQ2L 5IMKA 1TJHL 3K5RA 1OK0A 3N55A 4PJGA 1OO2A 3F5WB 1UACH 5AW3B 1FCGA 4RFNB 4FQXD 1C5BL 3KLAB 1HHGA 3QCTH 2ADIB 2IDTA 2X4OA 3MOAL 5L0QC 3ES6A 1Y6MR 5T3ZH 3LIZH 1BQUA 3IJSA 5I30L 1ZT1B 3JT2A 3QRFM 2X2JA 1G6RB 3O9WA 1HJCA 4H7VA 1FVEA 3OPUA 1M1SA 3VH8A 1MFCL 3SDDD 3QXAB 3GC3A 3QJUB 4XVSH 2VM3A 4NJ9H 4OB5L 1SBSH 4WUUE 1IUZA 2A1WL 2NLJB 3HBQA 3TVMB 5I5MA 2WXGA 4WSGA 4UT6H 1EDQA 2PETA 2P1YA 3QZNA 2ZUQC 5DDHA 4QOKB 3VFRA 2VZVA 3HVNA 4HHAA 4QRRB 2MIZA 1Z6JT 3C9NA 4TOYL 3Q13A 1FYTD 2HMIC 1KGXA 5C0AA 4E42A 5EEVA 1F8TL 2R2EB 2DQTL 1XXDC 4XOCA 1UZ8B 3OR6B 3WUZA 3ZDZE 1FN4B 2WBWB 5FK9B 2EVFA 4S1SL 3T4AC 4IS6A 2EC9U 1BGXH 1H3TA 4OD3H 4DGYH 1EAPB 4D2NA 4LLUB 3O9WD 1ASOA 4M5YL 1I82A 5I71B 3LOWA 4KMTL 3QUKB 4PWFA 3QNYA 3VWJB 3BKMH 2YGPA 3K8LA 1QSFA 3TBWA 4K2UL 4U7MA 1CT8B 3AREA 4AQAB 2C3HA 4NWUH 2YEQA 3MRKB 5C0AD 3JWNH 1LEIB 2ZKHH 1ED3B 4HZAA 1TLKA 1EAOA 3CCHA 3DHPA 4PY8J 1I1YA 1YN6A 4KZ0A 4YBLC 1MOEA 3UJIH 1S7WA 1ID2A 1L0QA 1URZA 2X1QA 3MRMB 4H8UA 2KZKA 1XGPA 2D9CA 3QEQB 1CTOA 4OTXL 3DXAB 5FHBH 2DWDB 1BXUA 2B5IC 1ZD6A 3FTGB 5HYJE 4MCMA 4GUCA 3RX9A 2EAEA 1WIUA 4AXWB 4M02A 3AT8A 2ZSVB 1AHWA 1SHWA 4LPUA 2IBZX 4RZCA 4DP5X 4UNUA 1CGYA 2FTAA 4PWHA 3TH3T 4ZX6A 2WLZA 4A04A 3ARED 2RHEA 4TTGA 3U4EA 1JV2B 5GGRA 4MMZB 1QP1A 4GT7A 5GISL 5EUOE 1JZ6A 1TPXC 1WZ1L 3THML 1CFBA 1F11B 1VFBA 2YQ3A 3ULUE 5K5YA 1NDGB 4JPWH 3GT6A 4V33A 4F15B 1Q9WB 4Q4IA 1C1EH 2L3BA 1AJ7H 1IFHL 2DWEB 2PPAA 4HLJA 4MJ5A 4ZG1A 1KCVL 4TV3A 4XPTL 1T1ZB 2KS0A 2QVMA 1RZIA 1IEBB 2CO2A 2WK2A 3X1FA 3IWVA 5DSCA 4EI6B 4ZXBC 2R69L 3K2UH 4F7MB 3KPLB 4ZBJA 1Y18B 1LLAA 3GXMA 1YQVL 4ICWA 4DETA 2VB5A 4PJ9B 5KVDE 1D9KA 8FABB 4NQEE 2G3ZA 1NBYA 4GBXB 4LSQH 1CPUA 4G7SB 1RZKC 2R4RH 3DROA 4XODA 4XMVA 3CDYA 3CFIC 2NY4C 4WEUD 5E8EB 4ZPTB 5FUCC 5AAPA 4H0GA 2I5YH 3G7TA 4HV8B 3MV8B 4EZLA 5LVEA 1HHJB 4X8JA 4XWGL 2A0LC 4NKDA 1G94A 1CFSA 4J4PA 5EU7C 5KS9A 4IJTA 4ZO8A 4JK0D 3ULVF 1LD9B 3REWA 2Y3NA 4AMKL 3SDAD 5L2KE 1F6AB 3G6JF 4KO7A 3RWIA 3S5LG 2VAAA 2HFEB 1I9RH 2Y6TE 5BVJA 3QUYB 4HUUB 1LP9B 4GAGL 3DVFA 4XPFL 5I66B 4G1EA 3EYSH 1JCKA 3A24A 4DP1X 1JD9A 1QFWL 5BRZA 2AEPH 2XYBA 2BY0A 3HG0A 2A6IB 4GQQA 5J13C 4GKLA 3TPKA 2VZ3A 3GJFA 5ACZB 5DD5L 2XN9E 3E3QE 2DIJA 1JHLH 1IC5L 1NCGA 1NDMB 4QHKI 4WKZB 4J4PD 3CZFB 4ESKA 1QA9B 3S8FB 3F83A 3P9MB 3MCKB 1DSWA 1BVLB 3CHOA 4MMYA 3RAJH 4AIZB 4QR7A 1T5XB 2Y1ZA 1NEZG 2YFNA 3UTSD 1TVBB 4G6FD 1KBVA 2ZUWA 1N67A 4V2CB 5C9KA 3NZUA 3NSDA 4DN4H 3ZZ1A 2H8PB 3FOLA 3AM8A 4H4NA 3VFTA 5BO0D 4M1DH 2FWOA 4U6XB 1F1GA 2X6VA 5AOMA 1S9WA 2JKIS 3FU8A 3GIZH 5BRZD 1U8IA 2Y1VA 2GUOA 3CHQA 5KSAB 1HCZA 3FK3A 3TYFA 1YYML 1IGIH 2PWDA 3M1OA 4ETQA 4XNDA 4Z9KB 1TTCA 4XB3A 3O0RH 3RIAK 5L2JA 3GDCA 4R3SA 5HVWA 3RUGF 1ZV2A 1AMXA 2IWFA 4PRPA 2WBJB 1MHPL 1LYQA 4PRIB 4MLSA 5E2VL 1FRGH 4QF1B 4DEPC 1Z0MA 1NSNH 2N7SA 1NGWA 5D2LE 1CF1A 1VKXB 2VH5H 4JGJA 1I1RA 1LO0L 1Y1DA 3X3GH 2G4EA 4A7GF 2VDKL 2YK1H 3II1A 4K8RC 5FCUH 1PQZB 3SYQA 5DLLA 1REIA 2WSPA 1GOFA 1I9IH 3QZWG 2VAJA 3P73A 3LNEA 4D3CL 1NCCH 1U95A 4B9IA 4Y5VB 3HNSL 5EU3B 1BZ7B 5AKSA 2PO6A 1WT5C 2H6OA 4F7PB 5DFWH 1LNUB 5TE6H 2Y24A 1DJHA 3F7YB 4MSWB 5JW4M 2Y36H 4PRPD 5BW7C 3BH8A 3WOVA 2IADB 4G9FA 5CBEB 1ZLVH 1V3LA 3MLVH 3LB6C 4N68A 2EYTB 2WQAA 3WJLC 4MAYB 4S0HA 3KPNB 3HAEB 5D1QE 5B1BB 1XF4B 2PWEA 3DK0A 1S5IL 1EHLH 1JYXA 4Q89A 3T6XA 3P9LB 4MBOA 3AQZA 1JV5B 2O6DA 1IT9L 2CG9X 3HZVA 2RACA 4X5QA 2F2HA 1ECYA 4QKXB 2JKWA 5FC9A 4BQ6A 2EACA 3HVDA 2FYVA 3PL6A 4K3GA 1O9WA 4LLAA 4DKFL 1JN6B 5EO1A 1RY7B 4QRTA 1HI6B 1VAHA 4XO8A 4Y4KB 3UACA 4L1DA 3S3BB 3NSCA 3BRGC 1P4BH 1IQWL 4S2SB 1JI2A 3NZ8A 3I02A 2XBDA 2BSTB 4JHAL 4E9SA 4G9FD 2J8UE 3ZDZF 1RXLA 1BD2B 1JOIA 2X4NB 2XVBA 4UM8A 5C08B 2HTLD 2OCCB 5C6PB 3GRWA 2MHAA 4NPYA 5T5FA 3O2VH 2YOCA 4P3CH 1WBYA 4NN7B 4HBQA 3FF8A 1MCOL 3QNZB 2C1OA 4KNQA 2ADFL 2B4CC 2EDKA 3I9PA 3DTXA 3N5AA 1MCRA 4AITA 3PL6D 2Y7SA 4H20H 4L4VE 3UP6A 3WE6A 3WCYA 3DDFA 3EOAB 1GMIA 4FXKA 5DJDB 5E4EC 4NM8H 3Q9PA 4UWQB 3VCLA 5EOCJ 1TTRA 3M7OA 4DK6A 3L3OC 3IFPA 2GJ6B 4APQC 3CFEA 4AH2B 4GY4A 2UVEA 3MUJA 3DX3A 4NNPH 2G2RB 1VGKB 3H0TA 4PG2C 1G0DA 1NANI 3NCYS 5D1ZC 2QZ5A 4G3YH 3ZYOA 2XWTA 5IMMB 1ZE3H 3HZYB 2EDXA 3MLTB 3E9TA 1E6OL 1YY9D 3OAUH 1NAMA 3UEQA 3O81A 4DOHE 2VMCA 4ZUWA 1HCVA 2Y25A 4HYTB 4QRPE 4AJWA 3KXFA 1YEIL 4XN4A 1AE6H 5EZJB 3ILPA 4HFUH 2YSTA 3IF1A 2QQNH 3GHBL 3HS8A 4WQOA 4R7DB 2FX7L 1MAML 4J8RB 3MYZA 3K4DA 4ZZFA 3FUHA 2C9PA 3RWCB 4WF7A 4UAHA 4PR5A 7PCYA 1UWEL 4B7IA 1MCIA 2F7RA 4HLZG 5EUOF 1CFQB 4AVHA 1A3RL 3RLSA 1Q38A 3FFCE 3NIDE 3ULUF 2P8LA 3TA3C 1DVXA 2VMFA 1BAFL 3BISA 4C83A 4WTZA 4KTDL 8CGTA 2BNQA 5DF0A 3NTCH 1BFVL 4ODUA 3G6JB 1F1AA 4GMSL 5FO7B 1CO1A 3FYEB 3MACL 4PV9B 2AV7A 2GSMB 4CVWA 1F42A 3LEXB 3KXFD 1YEFL 4W9EC 4B9FA 1ZK9A 4LSUH 3QZLA 1WPCA 5LNEA 1DDHA 3BVUA 1LE9A 1XH1A 4TLKA 4B9CA 1M57B 3QARA 4HCFA 3UC0H 5I1AB 2Z9TA 1MJ7H 4GQRA 4ODTL 4AZUA 3I3EA 1D6EB 2QDVA 1L6ZA 2AEQH 2DWXA 2Y1AA 3G5XB 5C2BL 3V6BR 5ILTL 3C6LB 3GTTA 3QYMA 1HSBA 2LV4A 4ODSH 2BNQD 4Y4FB 4KQ3H 2J2ZB 2OCJA 2NUTA 2CMRH 4MJ6B 4OLVL 1F3JB 3DUUB 4CBPA 4X9YA 5DMJB 5E1AB 5KVEH 3EZ8A 5F7AA 4P06A 1MRCH 2I85A 5IHBA 3DYPA 1IM3D 3BAEH 1VADA 3QHZH 2O5YH 4M7LL 4N8PA 5J1AB 4R0LC 1XH0A 1JF1B 2C3XA 4DGVL 2JK5B 1I75A 3BW9B 2AJ3B 2WJ5A 1INEL 5AW0B 4Y5XA 3WS3B 3BKJH 1JK9A 2MOGA 1KWKA 1E43A 2W5PA 1NIDA 3TIDA 1BYOA 2Z0BA 3MLPA 4UTBL 4CILA 3PWPE 2WQSA 2J44A 1V7ML 1A4KB 1WF5A 3FUIA 3GZOA 3PFUA 4UZGA 5JIKA 3RUGB 4P5TC 4Z78A 4NB7A 3D25A 4OFQA 1OVZA 4JKWA 4DN3H 5IK3A 4OT1H 2PW1B 3TBVA 3H1ZA 4J3OF 3EYQC 4V11A 3VW3L 2WKLA 3HE7A 3D9AL 1EXUA 1KTDA 1SOSA 2Z0UA 5G55A 2CR0A 4JLRA 1JL8A 2G9HA 3UPAA 4OQ1A 6PAZA 1OM3L 1KYAA 3II3A 3SDYH 5L6YL 2F5AH 3ABLB 1MFBL 1GY1A 1M53A 3EJRA 4ZS6D 3WN5C 2BC4A 5DVNA 2FHFA 5DHVB 1A47A 4WFED 2XQBH 3ARSA 3GDBA 2IALB 4PTTA 4L1BA 4ZMAT 3N1MC 4H13C 5A1AA 1XH3A 3QDHA 4PH8A 1GKEA 3OQ3B 1LO3L 3QDJA 5IBTH 1FL3A 1QUNB 3MX0A 5T5NF 1IBFA 4LIQH 1TG8A 2GIMA 2P26A 2WB1A 4JFPB 3KPSA 2PCXA 4LF3B 5D71L 5EU6B 2N1KA 4ES9A 2XUWA 3G5ZB 5HXMA 3HC0A 1DP0A 4JZJB 4LEEA 4ZAKB 2ZAIA 1BPLB 3PGCB 2VMEA 4TUJA 5D2LF 3FB5B 5BUAA 3M1BB 4N2EA 4DEUA 4K5PA 2LTQC 4WUUB 2VXVL 1H3VA 1FVDB 4CVUA 5CHNB 3BZDA 5JQ6H 3FT2B 4NRZA 2F18A 4KROC 4PD4K 5FKAA 4OKVA 3U46A 3FQNA 1E8XA 1X4ZA 2R39A 2YFOA 5GGSB 2IGFL 3NJHA 1FNEB 1MQ8A 1K8DB 4ERSH 3QDJD 4H2AA 4JFDA 4HEPG 3ZDZB 5KYXA 3QUHA 3KVQA 2ITCB 1WFJA 3KPSD 4F1ZA 4EIZC 3WFEH 4NN6B 1U3JA 4I0PC 4BK4A 2NR6A 3SGKC 1FZMB 3K5SA 3EOBB 4IDLA 4QT5B 3VD4A 4NXKA 4PUBH 2X9ZA 3APNA 3JV6B 4FFZL 1A1MA 1GL4B 4FEIA 1DBAH 1EJOL 2ZUTA 2WINB 2ROXA 2BFVL 1WO2A 1NMBL 2Q1EA 4FMVA 4JO8A 3QG6B 2O5ZL 3T0EC 5BS0A 2AMGA 2DLIA 1DBKH 2Q2LA 1KLGA 1NGXA 1NFIA 4JQIH 1WQVT 2XWDA 1Q9LB 2X41A 4AGNA 2EXTA 3IXAB 3UIZA 3QUML 4LSTL 3APFA 5CCKL 3VJ6A 5D7IA 1QR1A 4N8CH 4BXVA 2J8UF 2CHZA 1DZ0A 1S8DB 4AMXA 4NKQB 4MDJA 3S8GB 3QG7H 3UX9B 1J8KA 4MD0B 5HYJB 2YMTA 3BCFA 1C5CL 3V5HA 2JFCA 3H85A 4M7JL 5JHLL 4L3CB 2JB6B 3TN0C 4K5NA 3CZLA 5HGDA 1MLBA 3BO8B 3L5WA 4QHLB 2X6BA 3SE3A 1MCFA 1QSEA 2GIYA 2LFEA 3H53A 4B53A 4HG4J 5J3HD 4E0RB 1XZ0B 2I9LB 4GMTL 4OM1L 5BS0D 5HHVH 4TVPD 3BSHA 3MRIA 3TJEH 1JF6A 1KXVA 1WTGT 5L9DL 1F18A 3R7QA 2ZYRA 1K72A 3VFOB 2O6FA 2PCFB 2XRAH 2QKIC 1ZLWK 4WWKA 2MNWA 3LQAL 3WUWA 4ZMYA 2OMNA 3CE1A 5D7EA 2Z8RA 1PW3A 2J20A 2WQWA 4MA1B 1J5HA 4R90H 4JEGB 3B5HA 3V6OE 3SPGA 2I60H 3DJRA 3ARDC 4HUVB 1MRFH 5B3NA 1YUHB 3NMEA 4L37A 1TO5A 5DT1H 4PB9H 3S2CA 4NZUH 2XG5A 4LLMB 4O4YL 3RJOA 4E9RA 2X6UA 2GJPA 5F71A 4ZD3H 1I1AA 1AXIB 4OIBA 4S1QL 5TQ0L 1AR1B 1AR2A 2JIXB 1HXKA 5AAMA 2B15A 3RIFK 4GKNB 1AGBA 3HJ0A 2VR7A 4NQEB 4IBSA 2BSCA 1KZYA 5T1LA 5I2IB 3I6LE 2YBGA 3RX8A 4YPGA 2NTFB 4N3TA 3RI5F 1VEPA 3WFHA 3F7VA 4Z7IA 1WZKA 3UCRA 4XVTL 1FNGB 1G9EA 2FR4A 3QP3A 2R4SL 4O51B 3FZUD 3TJPA 3NIDF 2JJTA 3MRDB 2ITDB 2AJZB 4GXVL 2Y2TA 3FQ2A 5L2KB 4J3UA 4XRCA 4XE0A 2YD9A 3GIVB 1I1AD 2AZUA 3ZSSA 4O58H 3GF8A 4NUQA 3NA9H 4RAVB 1H15A 1W72A 4WFFE 3ISRA 1MIML 5F0LB 5EB9A 5E6IC 3WDJA 2XNAB 2XT1B 4Q58C 4F27A 5HHNB 3RKDC 2OX5A 3IN0A 3TEWA 2YPVL 4MQSB 4YDJA 3MRQA 1HEZB 4BSJA 1OGTA 3WEOA 5J7CC 1KEMH 1R1CA 1NINA 2WGXA 1F58L 5LBVA 2X0WA 3QJTB 3SGEI 4XNMA 5DHMC 2Y5QA 1NLBH 3FONB 4OD2A 3WNOA 2ICEA 2QQLH 2F08A 1TQUA 3F6IA 3H9HB 4WRLA 5FIEA 3AVEA 1S5HA 4ODBD 4P57B 3ARGA 4XP4L 3ECUA 3H3PL 3QIUB 5F0JB 2C9SA 4JAMA 3D08A 3UADA 1MJUH 3SPJA 4IIQA 1MHHA 1EHNA 3OTTA 4KJYA 5DC0A 3UTQA 5GSRB 1LO5A 3D07A 4AK2A 5TFSH 2F1AA 4CMHB 3NAAH 2Z7WA 4QRSB 2H0PA 4L8BB 4RMRA 4NJAL 3R1GH 3S6CA 4FULA 4XH2A 3SPIA 5ESAB 2J12B 4O02H 1BQLH 3T09A 4LCIL 3F12A 1AFVH 2FJUB 1TVDA 5DHYA 1QBLH 4QTIL 3RPBA 1BMWA 3ZTJH 5C0RL 1C08B 2H5UA 4N9GA 2LW3A 4XNQA 4O2CA 5FPIA 1RZ7H 1NMAH 3QHFL 4X0KB 3ARGD 4UNIA 4AVJA 3QQDB 1HNGA 1QG3A 5D2LB 4U1SB 3B34A 5E5UB 3PAVA 5I6XC 4GW4B 1OWWA 1L5GA 4GUPB 4I2XE 3AWGA 5E9AA 4UMSA 4YSRA 3STLA 3DX7B 5D9SA 1U3ZA 5IJVA 2WLIA 3VXSA 4G83A 5IFJA 3DPBB 4KDWA 3IEAA 3AG2B 4NUJB 4M4RB 4LARH 2BW5A 5BZWA 3HZ3A 1BW8A 3ABGA 5DJAB 2P45B 3D4GA 1CXEA 1ZK5A 3US9A 4MAUH 2AI0H 1P5VB 1UFUA 2FQDA 1UASA 3EHBC 3P0YL 3QHTC 3UYRH 2XXGA 3MUHL 1QMUA 4H26A 3T6QC 1GGYA 1J9RA 3QO0B 4EDWL 5TDOB 4F37F 4YHKH 5FFGA 3HNVL 4LRIC 4NNYB 4AKPA 2UXFA 3ESVF 2ADJB 3NJVA 4KV5E 3K7UA 1U92A 3DYMA 2H6PA 2JVUA 4TVUA 2AS5M 1RIVH 3QUGA 2DI7A 2APWA 1MZYA 3HFML 1YDPA 5FLVA 4YLQT 5HDBE 4JFOB 2H2SC 5EBGA 4YWGH 4JFFB 4JY5H 1AXSB 5FKPA 3ZTEA 2CIIA 3CH1B 4JDVA 3EBIA 3MLSH 1JXFA 2G2NA 5T1DH 3ARFD 1JPSL 4XMKH 1RU9L 4YLCA 3OXRA 5JA8B 3D39D 2XKNA 2PWGA 4XGZA 1G9MC 4A2GA 4KAQL 12E8H 4ZODA 3R19A 2J8OA 4CC4A 3WIIL 4N26A 3BSZH 2VZSA 4QXTA 2MOQA 4WEEA 1W6LA 1V55B 2WM0A 2UV3A 3NACL 4H40A 4EUPA 3IU3B 5FF6B 5I1HH 3VG9C 1OAZH 1FG9C 1CICB 2A6KA 2ARJB 3V4PH 3V9FA 1XFPA 1TQSA 4D8OA 5IOPA 2FT7A 3N06B 4F58L 4L4VB 3NEXA 4U6HA 4DCQB 4X98B 4TXVB 2HLAA 3LN9A 3PV6A 2F58H 1JD7A 4MFHA 2VDML 3KCPA 3VGBA 1HC1A 3UDWC 4KFZC 5CZVH 5E4OA 4N2FA 4RFOL 5ACMA 3KGTA 3RURA 1JNHB 1X9UA 5T5FL 4ZTPL 5F6HI 1A22B 1SY6A 4HU8A 1QQDA 2WWKO 4DP0X 3JXAA 4W6YB 1INDH 3MRGA 4JHVA 4FQIL 2A38A 2SODB 3FTZA 1HK6A 3VM5A 5CEZL 1ETZB 1OKEA 4NOBA 3F85A 2GFBA 4DOHB 4QXUH 4RRPG 1OQXA 2HT2D 4QRPB 3KPQA 4LRNL 3OX8B 1YPZE 3RP1A 2XN2A 4QEGA 5D2NA 3CXFA 1WLHA 3U0WH 1K2DA 1KCBA 1T6VN 2L7QA 3EO1B 2FB4L 3FO0H 4FI8A 4YH6A 5TGBA 4HBCH 4X4ME 3GI9H 4L8SB 5TTRA 3GI8L 5DUMH 4EVNA 1A4BA 3FRPB 4M9PA 5M94B 1NCDH 1UB6A 3FUFA 3MRBA 1FZOA 4EDXA 2X38A 2EO9A 1KCRL 3MMEB 3FFCB 3NIDB 4KKRA 1FNLA 3C2AL 3CDCA 3H4HA 1UYWL 2IPTH 4HT1H 1MAKA 2FDBP 3BVXA 3TJHC 4GXFA 3VTAA 4P4KA 4YHZL 2EUVA 4U1HA 3D69A 2QHRH 5E56A 3VB9A 4LL4A 4L5FE 3FCTA 3I3BA 2ATAA 3DX8A 1U6AL 3UBXG 3VFPB 3NK4A 3UZQA 5FECA 1CLYH 5IB4B 3BPLB 4G6MH 4HXBL 4NO2B 1JNNH 1UWXK 4NQSB 5T3XE 4FTDA 5I0WA 1LO4H 4M48L 3ZRSA 5BNXD 5A6IA 1NGQL 1UOLA 5AZ2L 4YX2H 4PJDA 1A6TB 1IBYA 3VMOA 5EF0A 4XN1A 3VGAB 2YXWA 3PABA 2Z8SA 4AYFB 6TAAA 2W0KA 1JWUB 3MXVH 5G2NA 4HPYL 3WL9B 1OSYA 3II2A 1GS6X 2VDPL 4OZHB 4M6NH 3ZL1A 5AVYB 2HVKB 5C7XH 3ET9F 1Z9NA 3P1VA 1BBJB 3RWJB 3HZMA 4DZBA 3BQUC 2GK0B 3K80A 4PLJD 1NCHA 4YBQC 5DZJA 3GSNB 1MG3C 3RIFF 3DSNA 4GSRA 4PJCE 5JDSA 1MRDH 5HHXL 5IUCA 2F9BT 3HUJE 5C3TA 3IJEB 1RZFL 1P84J 4N5EC 2F1EA 3DOHA 3KYMB 2V17H 2CZNA 2HJLA 4X5LA 4JZOB 2MOVA 3OLIA 4P5MB 2Z35B 3HS0B 3PWPB 4KRPD 4QLWA 4M43L 4W81A 1R3LA 4ICXA 4M61B 1JHTA 4G80A 5F7WC 3DX1A 4UU9A 3MBEA 5IW3A 1HVXA 3U7WL 2V2WA 1LL1A 1JDCA 4KUCD 3VD7A 1KSRA 3CFUA 4L2LA 1EEYA 3IJYA 1LXMA 2J3SA 3IFLL 4LESA 5J1SC 3CLWA 4LCWD 5GRYA 3QNFA 5D1QC 3PWJA 4UBDD 1WSST 2B59A 4DPAX 1T4KB 4XB7A 4OJDH 4YL9A 3BPCB 1OTUC 5CF3A 4WHTA 1NUGA 1I7UA 3HC3L 5D93C 3K6FA 4N24A 3GXFA 4N0UB 5GZOA 3N2JA 4N90D 3WIAA 1AIZA 3MBED 1TZOA 1N5AA 3MJWA 3SKJH 1JZ3A 1CYGA 2FL5A 3QFJD 4J27A 3SGEH 5LGKA 5HHME 1R5WB 2D7TL 2X7LB 5IR1A 2N01B 2EIMB 1U0QA 3B3IB 2NXZC 5I5JA 3D4CA 2DM7A 3ENEA 3NPSB 4RGMC 1L3WA 5FUZH 1IM9B 1XXFC 3MI6A 1B4JH 1OD9A 1BP3B 2Y22A 4YC2B 3EFFB 4R7LA 3W0WE 4ZI8A 1OW0C 1U93A 3BIBX 4HXAH 2A99A 2CR3A 1EANA 3ESOA 1DVFA 1UC6A 1W8NA 5TE4L 2DWYA 4FQLL 5BJTB 3TBYA 1K6QH 5FOJA 3RDJA 1FH5L 1WAAA 4P2OC 3ZRCC 4N4YB 1NM9A 2XWEA 4HJ1A 4IU2A 2CLRA 2X3CA 4GG6E 5EO0A 3MGOB 4HIEA 5TQ2H 1ZT4B 4KKAC 5ALCL 2H6UA 5DD6A 5DR5H 3WHE1 5KJRL 1Q0XH 1N6UA 5DJ6B 3TIEA 2SEBB 4XNUH 2OTPA 1PLGH 3I6KB 5I6OA 5GGVY 1RJZA 3VI3E 4TSAL 3T0DA 4H1LA 3FFDA 3U0PB 2ZAGA 3ZZLA 1A6VL 3IAGC 1XEDA 2DTML 3IKCA 3JV4A 3LDBC 4YHNB 2DDQH 1HWGB 3SOBH 4B9KC 1EZSA 5KZCD 4KJQC 2DQEL 4KV5F 4H8HA 4Z95L 4K3DH 5KN5A 3UEZA 3AXLB 4ZMTA 1ZA6B 4GKZB 2WTRB 1CLZL 1JPGA 5CAYB 5FGBA 3PPSA 2P80D 1M7IA 1DVFD 3ZDYE 1HCFX 5ICXB 1DQQB 4WNJA 3CVIH 1R3KB 4WDIA 5HD8D 2OL3A 3HRZC 3IFOB 5HDBF 3RWGB 5AAWA 5C71A 1JRHI 2P8PA 5J6GA 2EVGA 4AEFA 3KL5A 4GLRI 4H8WH 1OZTG 2VDRB 4ELKA 1SN5A 3EJZC 2I07B 1U8KA 2IH9A 3QWRA 5ISZD 1UFGA 3I3DA 3SE8L 4ZSOE 3OLEA 4XN8A 1RHHA 2R23A 4YEEA 3QEHB 2XG4B 3LRHA 3KHQA 2YD0A 3WTYA 3OAZK 5BXFA 4UDTB 3L95B 4UV7H 5I18L 4WGWB 1BG9A 1AC6A 1KPRB 2X4QA 3WTTA 1E7UA 1TJMA 1UVQB 5C9JB 1L0YA 5CCJA 3IGKA 1I31A 3OZKA 1R17A 1D5ZB 3MRNB 4OCXH 3RDTA 4TNGA 4P9HL 3QWRD 4G6AC 4K7PX 3OLGA 4PJGE 3MR9A 3H42L 5C6TL 4WK2B 2CHDA 3KBEA 4HSQA 2EDFA 1BZ9A 2VLLA 3MRRA 3NCBB 3T0WA 2EUZA 1MEXH 1T1YB 4H88H 4HFWA 2E8ZA 5DJZA 5JORB 3F2LA 3VXME 1KCWA 2OMVA 5D72H 1H0DA 3PWVB 4PV1C 4OM0L 2ZSWB 5D7JC 4L2YA 2P9RA 2CK2A 3LY6A 5HJ3B 3BAIA 2FATH 4IGBA 3EGSB 2UWEB 4PRHA 4UUJB 3MOAH 3KWUA 1E9PB 2MTAA 3ZTDC 5DYFA 2LT9A 4JDTL 1N19A 5TF1L 4OI8A 4JM2A 5IB5A 1AS7A 1WV7T 2IANB 1V54B 2OMZA 1MNUL 1DCEA 3VFNA 3WEBA 3MNMA 4ZYKB 5C0AE 5LDUA 1HHIB 4Q0XL 1HESA 3IFNL 1D7CA 2A1WH 2X1WL 4KKBC 1GZHA 2R0KH 1YAZA 1YVLA 3ZX1A 4G1MB 2X40A 3OHXC 4NWTL 4K94H 2HVJB 5ESVB 2IAMA 5AOKA 3BIAX 4WV1B 3L6FB 2W65B 3WLBB 4NDMB 1FO0H 2AXGB 2FH6A 4PRHD 3KNBA 3N9GL 2EO7A 2V9UA 5I16A 3DETD 2EDYA 5DRWA 3HI5L 5EBLB 5B8CA 5CLZA 4YMPA 4JM2D 1QSFE 2OK0L 3L5XH 4HJ0C 1RJYB 4JY6A 4PJFA 2NY2D 3NGBC 4OFIA 4LSRL 5J6SA 3HZKA 3I84A 5FO9B 1A4AA 4FAAB 2BFGA 4WO4C 5I0XA 1M71B 3LZLA 3LMJH 1K85A 1UURA 4M6AA 1A9EA 4BV1A 2BZCA 3TTSA 4FDWA 4TLTA 1ZGLB 2D3NA 3A3YB 1J12A 2IAMD 4IKNA 1HILB 2DEWX 2B9AA 2CJUL 2APBA 1T3FB 2LU5A 2V5YA 3QUZB 4W9DC 5DHDA 2CKBH 5MI0B 2ATPA 3PWNB 1FAIH 1L9SA 3NH7L 5F89B 4YDLC 4UOQA 4XCFL 5I1LB 3GB7A 1ZLUK 2F54E 2Q5BA 4OTXH 3ZKND 4PJCF 1SJHA 1PDKB 3HUJF 3RNQA 3EYFA 3IDYB 3MV9A 2R0ZL 3PFQA 3U2SA 3D05A 5CWSA 4U1KB 3Q5OA 3DO3A 2D7MA 2OAAA 3DIDA 3IKKA 4P46B 2OZ4A 4WJG3 5FYJL 3V4VA 2R0LL 5DMKA 5F7EH 3BEWB 5I1IL 1QHPA 3QFDA 2XACC 4R7XA 1IEHA 4AQ1B 3TH4T 4HIXL 3UYPB 1JPFB 4ZUSB 2DW5A 4FFYH 3VFSB 3UXFA 4NYLB 1U2CA 4BWWA 1CGXA 3WHXB 1MJJA 2WLLA 2BP8A 3ELQA 3L4TA 3NN8A 1PEWA 1PFCA 2BVPA 4I2XB 4JFEA 5CJ8A 2MCG1 3O6LL 4JQXA 4XPTH 3FCGA 3MV9D 5HVHB 3KPPA 1AYRA 3O41A 2YPLA 2YAMA 1XCTA 1J9SA 1KIRA 4P5SA 1AQDA 1SHMA 1D3CA 1DUZB 1RZGA 4JUSA 4JGMA 1HQRA 3ESPA 1NWPA 4HCRL 4JQVA 4HPOL 5CP7A 1EO8L 2QBWA 2DMGA 4QPEA 5AOLA 5KS9E 4FI6A 3BX7C 4GOSA 5FYLD 1JZ4A 4LDOB 4I4WA 2IFFH 1F41A 2Y23A 4XNZC 3SKUD 2DWSA 1OPGH 4ZFGL 1ZHNB 1S7QB 4TSBL 4JFED 3WBDA 5I75B 1NCWL 1QI3A 4JCLA 4YDKH 1K4DA 3B8SA 3L3GA 1NAKH 2BDNL 3KLHC 4OLWL 4B60A 2JE8A 4PGDB 2NY1B 3W11C 2ATKB 3O6FB 4UZUA 2AP2A 1AGDA 5HDBB 5DEJA 3V4UH 4AMKH 1NL0L 5K33A 5BRZE 4FNSA 5JW5A 2YPLD 1ZA3A 1TZAA 5CJOL 2WAHA 4IJ3C 1TO4A 2CGYA 2ZOTA 1B4LA 4GAGH 5D6DA 2R1XB 4GG6F 5I15H 2DD8H 2D03H 2VXTL 4BSVB 1N5YH 1MREL 2AEOA 2OLDA 2XFXA 4DTGL 2YEVB 5EV7A 3S5LA 5F9WC 4IKKA 1N4XL 1RSFA 1JZEA 1G6RH 3CD4A 1CXHA 3VI3F 4F93B 1RJLB 3DRTA 4PN6A 1TJIL 1GCFA 4ANWA 4EZMA 2J7LA 4KUZH 3WTXA 5DZAA 5GGVH 1KIQA 2D7OA 4OIIL 2V9TA 4YE4H 1JNLL 4EQ2A 1KV7A 5K1JA 3WDHA 1M7DB 5D70H 5CBAB 1INQB 1TMCB 5ADOL 3GO1H 4HUWB 1U36A 3BT0A 1HXMB 1G5AA 3OKDB 3WTVA 3ZDYF 2Q8AL 3CHRA 3AUVA 4MNQA 1N0XL 3PJLA 3ARBA 1KXQE 4X4XB 1MFNA 2FO4B 4YDIH 1CXLA 3CXDL 4HHGA 1OOAA 1ZAGA 4HCIA 1HCYA 2A77H 4AENB 1NEZA 1NMCC 1RK1B 3QEGL 4UT9H 1AIFB 4PRPE 2XWRA 2DM4A 4XXDA 2HTKD 2ENYA 1A4CA 1ZJBA 2HRLA 1LDPH 1CFMA 3HNTL 1XF2B 3N04A 1VEMA 2A6JB 3EYUH 4FTVA 4ONHA 2BZ7A 4A2FA 2WY3B 4A66A 1OTSC 5DQDL 2CBMA 3QJFA 4LDLB 1IARB 4ZQKB 1IGJA 4URKA 4TQPA 2GG1A 3PP3H 5FA4B 1YPZB 2WNGA 2FD6L 1U3HC 1BWMA 3OZ9L 4GS7B 5CD3B 1SJVA 1HWWA 5D7LD 5JZ7C 15C8L 1OT4A 1CI3M 3DHJA 3ARBD 1A0QL 3I74A 3G5VA 1OSPL 3DV6B 2WUCH 3LZRA 4K9EH 2QQQA 3FMGL 3ZGIA 1P7HL 4PJGF 3IRPX 3P77A 4P0DA 3FSAA 3QUXC 1PAZA 4G9FE 4JX0A 4AUUA 3ATAA 2E7DA 2X5PA 2OCFD 1RVFH 2ITFA 4OGQC 1X5YA 4PW4A 3V5KA 3VDCA 3JWDL 4EIUA 3BVNA 1A1OA 4JG0H 1B6UA 4LNRA 5E7FA 2ILLA 4I18C 4DGUA 4KZEL 3B9VA 4HP5A 1KPVB 1D2OA 2A83A 1AD9B 5FFOA 4LKXA 3QZWA 2GY7B 3FCSA 5DEFA 1CR9L 5D4HA 1G9NH 3O3DB 3C5ZB 2CKNA 3P3RA 3QB7C 4RNRB 3B43A 5EOCL 2E27L 4E41A 1T1XB 4CRPA 2R27A 3E6FB 4X7DC 5EZOH 1UWFA 2D31B 6CGTA 1OANA 2WZPA 1XCQA 3BWAB 4YDVB 7FABL 2DI9A 3CZNA 3CX2A 3OWEA 4BH7A 4DFHA 1DEDA 2NY6B 1FL5A 2GUYA 3BMWA 4Y5YC 5EH1A 2BIPA 5TDNB 3PUCA 1MKFA 1LK3H 1MCLA 1UZ6E 2KQMA 3OF6A 4LDEB 4F3FA 5DD1H 4IK7A 1M7UA 2NY7L 3ZE1E 4BFGA 3FQTB 3CXHJ 4Z23A 3W9EB 2NY0B 4BA8A 4C4KO 2CQVA 2WCGA 3AFLA 5MEQA 1EH9A 3B9KB 5IVZA 5LDSA 1TU2B 1OAUH 2YXVA 4PJCB 5A3IC 1ES0A 3HUJB 4H0IA 2DQGH 4FKKA 5EOQH 5F7YC 4AQOA 5D4JA 1R3JB 3VU2A 4PB0L 3MBWB 4AG4H 2WW8A 2WZPD 2H0JA 1ZHLB 4FQCH 3RL2A 4DVBA 1SVBA 4MJ4A 3EH4B 4ZNEA 2HMID 1T66D 3SZ6A 4P23B 1AC0A 5FO8A 4HUXA 5CZKA 1MUJB 4FQHB 4MXQD 3ATDA 1IFGA 3OF6D 3SBRA 5H4ZA 5L7XL 1RUMH 5DD0H 3L2LA 5LQBH 3KJ4B 4KC3B 4OAWB 1UT9A 3O2WL 3GTVA 1LM8V 1RMFH 2AXFA 2IQAB 4Y89A 3RWFB 4AYSA 2YHGA 2DKMA 3KXFE 3L3JA 1KGWA 2FJSA 3ILDA 3SQBA 3TWYA 2WNWA 2WXLA 1RH8A 1COBA 1LMKA 3ULAB 3EXJA 4JB9L 4M7ZC 2WXOA 4B5ZA 2NY3C 4R7NB 1BOYA 2CR6A 1RURL 3R7RA 1O6SB 3MROA 1RKRA 2BNRA 4BRJA 4NQXA 1XMWA 5A2KH 2JXMA 3MGAA 2B2XH 1WWWX 5L8JB 2J25A 2BP5M 1L9OA 2OP4L 3TO4B 2KZ1B 4MX7B 4P3DA 4Q6IC 2E3VA 2XTJE 2BSSA 2BNQE 3D2UB 2WKOA 1SBBA 4JDZB 1W8EA 4X8CA 2AJSL 1ZCRA 5CD5D 2FZ3A 2VDQL 3L81A 1DLFH 1NCAH 4LXFA 5D7HA 1KB9J 1SHSA 3BYTA 3RFRA 1X5GA 2WBKA 2DQUH 3QJOA 3WFBL 3GSVB 3G6DL 5EDXA 4ZXBA 2QADC 4C4BA 1TKWB 3D09A 3MTRA 3W0WB 1ZJAA 1YEJH 4GKSB 2V5TA 4XNXH 3WMSA 3JVGC 4PRBA 5IP4A 2BNRD 4RAHA 3VTMA 3MLRH 1OAQL 5I5IA 3MCLL 4W9ZA 2B1AH 3A21A 3JZYA 3TZVB 5HPOA 4L8CA 4GG6B 4JJHA 2D73A 1A7RH 1U58A 3QIWB 4TUKL 2WVSA 2WBXA 5FFLA 4OGXL 3K6IA 4ZS7L 1IC4L 3RGVB 3TEXA 5KS9F 5PCYA 5I19H 1WBXB 1Z7JA 1HAUA 5HGHA 3BWUC 4OLXH 5EIVA 2VNCA 3V8OA 1NA8A 4LQFH 5C2BH 1UJ3C 1ZV5A 3C75A 3LIZA 2PNDA 3RY6C 2W9EH 3P4MB 3QO1A 4A6YL 4ZXBD 1DSYA 4YK4C 5KSUA 5CJ5A 3MFFA 5GGSY 1TQBC 3E7JA 3O2DA 4NQQA 3ZU8A 3ZDYB 1T0NA 5I1EL 2BSDA 1MCBA 3F58H 3POHA 4QDGA 3CVBA 1ZEAL 2YD5A 4DAGH 2BS9A 4HWBL 3TT3L 4FJ6A 5K39A 4UT6A 3SDCB 4WFEE 2VWEE 3ROOA 3TT1L 4D9LH 1ORSA 5KG9A 3CDZB 4FG0A 4M8VA 3PWUA 5JW3L 2R29L 2Z31B 1UOWA 4AVIA 1FF5A 4JKPH 4ZSOB 1C9SA 1D6VL 1YEGH