3RQ3A

Structure of t-cell immunoreceptor with immunoglobulin and itim domains (tigit) in hexagonal crystal form
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
MTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell immunoreceptor with Ig and ITIM domains
publication title Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT) in hexagonal crystal form
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rq3A00
4A2MA 5F1NB 2R1XA 1JE6A 4R0LB 4WUKH 3BSZH 3D0VA 3Q3GA 5SX4H 5DR5H 3HC4H 1E28A 1M05A 3VCLA 2ITCA 2NYYD 5CJQL 4JPKH 4AT6A 4OZHE 4EUPH 1OL0A 1U8PB 2NX5D 1UB6A 3I02B 3MRLB 4YDKH 2IQAA 1FFQA 5IJVB 4M8VA 3BRGC 1RZKL 2QQKL 1U93A 3TV3H 3TYFA 1BZ9A 3HCVA 3JV0A 5EOTA 1FZKB 43CAB 1T1XB 4Z0BH 2DQGH 4LSVL 3VXRE 3ARBC 4LSQH 4YHZH 3KPPB 4D0BA 2OX5A 2VE6B 1KOAA 2A9NH 4DVBB 2ZSVB 3NCMA 1UKQA 2FH8A 3CX2A 3CVHA 1XGUA 3TVMA 1Z5LA 4GLRH 1GC1H 4EUPB 3O41B 1JPFA 1T3FA 4KY1H 2PW1B 3OX8B 3GO1L 2ED9A 3O0RL 5E4EC 4D0CB 1KIRA 5DJAA 3BHBA 1G7JB 3KVQA 1QFWI 2CKNA 2JJTA 3LEVL 3W82A 3RAJH 5C0RL 5TPWH 2AKRB 2LFGA 4U6XB 5DJXB 1HHGB 2CDEB 5E6ID 4MNQB 4XRCA 2NY1D 4U0RB 1N5YL 4JKKA 3MRIB 1FH5H 3P11L 4PG9B 3QEHB 4P2QE 1ROWA 1ZSDA 1FL6A 1R3KA 4HD9A 1RUQH 1M7DA 3HUJE 5IWLC 2DBLL 1L7TL 3CMOL 2RR3A 3O6KH 3L3KB 3IJHA 5J56B 2YN5A 5DMKA 3O2VL 2O5ZH 4NWUH 1AD9B 3SO3B 1YEHL 4WU7B 4PTUB 2NZ9C 4I8DA 4QRRA 2PCPA 1A3QA 1RMFL 4KFZC 1W0WB 3QUKB 2R4RL 3C09C 2FO4B 1KELL 4JHAL 3REVA 1VEMA 3VMNA 3M8OL 4EDXB 3LN5A 4XWGL 4N68A 2NX5A 1FRGL 4S2SB 5AWNL 1TCMA 4JO1L 2YD3A 4WFFE 1OGAE 4IS6A 3PGDA 5INDA 4MQSB 3ARFB 1TJHL 3TBVA 2Z8WC 4UDUA 5ADOL 4S0TD 5LBSH 3PL6B 4OM1H 3LEYH 2EDXA 5DFTA 1E6OH 4L29A 1OARL 1Q0XL 3BD5A 4KU1A 2QEJA 3EO9H 3QIUC 5CEYA 5B3JE 3IKKA 2ATKB 2ICWB 4YPGA 1IEAB 4Y5VC 1ZWIB 3MZTA 1HZHH 2UZXB 4M61B 1EAJA 3I6KB 3ROLB 1WBYB 4PRPE 3ECBB 2GJ6B 1PG7W 1XF1A 2I60H 1A47A 5I15H 2OL3A 3VW3L 2DQIH 1LK2B 5C2UB 1NSNL 2HJFB 4CU8A 3U1SH 4YXHL 5JORA 5TDOA 3LKQA 4X6CB 2OQJA 32C2B 3GMQA 4JDTH 1G1CA 3ZLQC 1TQCB 4JREB 5E1AB 1H15A 35C8L 5D2NE 3O3BB 5EU7C 1K2DB 4GQPH 3VG0L 3ARRA 5IT2L 3OF6A 1II4E 3H9SA 4J1UB 2PXYC 3HLAA 4KQ4H 3VA2C 4LRNL 2Q86B 2L0DA 1YJDH 3WS6C 5C86A 5KS9B 1AHWC 1OGTB 3OKNB 4NNPH 4RMTA 2P5WE 3KDMB 4DZBA 1T2XA 3BD4A 4JCLA 4L4VA 4JQIL 5HDQL 2YZ1A 4MAYA 2R2CA 3FB7B 1KGCE 4GW4B 3C8KA 3VGDA 3VI3E 5FM8A 4PJIB 1CTNA 1FFOA 1ZAGA 3EUUA 1TVBA 1H0DB 4RAVA 3UAJD 2Q6WB 1QO3A 3KPOA 4I0PB 4P4RB 4CUCA 3JSSA 3R8BB 4WI5A 4C56B 1U8MA 5L2JB 3OXSA 3NACH 3OAYH 2ADIB 3LZFH 1V3MA 3I3DA 2GSGA 3FB6B 3MJ8B 4HGMA 3S37L 4JCMA 2VXSL 4X6BB 3VFOB 3CLEH 3DUUB 3LN4A 4LARL 2BOBA 4QY8A 2ZOLB 5E6YA 1IAOA 1A7QH 1RUPL 3P0YL 4KTEL 1PY4A 4Z7UF 4ZFZB 3ILPA 1OWRM 3WCYA 3H0TA 4EZMA 3QUXD 3WKNA 3T3PF 4P3CH 4ZFGH 2WM0A 1C7TA 3LCYA 3P0VH 3QHFH 2GIYA 4YPJA 1INEL 3KAAA 3NPZB 4P3DB 3PWPD 1F11B 3U30B 1FZMB 5B8CA 1B2WL 2R2HB 4YNYA 1INDH 3AS0A 5F8QC 2XPGB 4P5TC 3MLRH 1D6VL 1IBGL 4YHLH 1QBML 4HG4J 3QWRD 1K4DA 3TBWA 3ZE1F 4ALAH 2EKSB 1S7QB 3FT3B 4KKCC 4OF5A 4WDIA 3GK8L 1YZZA 3WMSA 4QRQA 4NNYA 4F3FB 5I76A 3LD8C 5KVDH 5DVLA 2R0WL 1F2QA 1B4JH 5J1TC 2CXGA 1MPAL 4U1IA 1BWWA 4GW5A 4Y4HB 4QLRA 1UACH 2DRUA 1MFBL 4X6EA 3L7EB 1IMHC 2DQHL 2C3VB 4J23A 5ETUB 2LAGB 5AAMA 5IMMB 1RK1A 1XGRA 3DARA 1MF2L 1G6RL 3KLAA 1DDHB 4NRZA 3D39E 3HA0A 5I30H 1AGFB 1T1ZB 1H5BA 5DMIH 5E2WL 3FO1B 1BQHA 1G6VK 4XVTH 1KSRA 4QGYA 3LN9A 3A6BL 4F37F 1HDMB 4Z0XA 2DTMH 3MROA 5IMKA 1NFKA 5HYQA 3V52L 5D96C 1S7UB 3TA3C 1L0XA 5T3XH 2FIKB 4RIRA 5IJKC 5DJ2A 2MOVA 1N5AA 43C9A 3NOIA 3HRZB 3QUXA 1BWMA 4IRZL 2A74A 3ULSA 3W2DH 5GRUL 5C08D 4U1LA 3DMMC 2YZ8A 1LO0H 1DUZA 2R29L 3PWPA 2BDNH 3KNBA 1GAFL 5FUOL 2VABA 1EHLH 1KCUH 3C5JA 4F58H 5EDXA 3V5KB 5C8JA 5GGQH 4Z7VE 5D6CB 2I25N 5HGHA 1SEBB 5IQ9B 4KDTC 2HVKA 3ARDB 3QWRA 1UJTA 4EOWH 3FCTB 1A3RH 5C0CD 3BRFA 2Z31B 3MJ9A 3ETBF 5GISH 1JYVA 3BIBX 1ZVSA 5ICZB 3LKNA 1XGTA 4Y5YB 3SKNB 2YN3A 3HE6B 1K6QH 1FZOB 5FO8B 3ZTNL 1OLLA 4K9EC 2Z91B 1UWXK 4KRPD 4OGZA 3WDHA 1HWGB 4CADB 3ILQC 2X5PA 1JPTL 5C0DB 1EEZB 2EEBA 4FG6D 4P2RD 2VDRL 2LU3A 3GI9H 1VFAA 3Q5YA 1IC4H 1D5ZA 2CIKB 4ONOA 3V4VH 4JZNA 5JIIA 1HSBB 5EC1A 4X7FC 2CLZA 3MACH 4Q74A 1MJ8L 4JPWH 4WY7H 4OD3H 3VD9A 5HYJB 3MODH 4RMRA 3U7WL 2BZDA 4W6WB 3VRLF 4GH7B 3HG1D 3A6OA 1MVUB 2VLKD 5FO9A 3TP4A 4M6MH 5DQ9B 3CX5K 1L7IL 4HWEH 3U2SB 5DEFB 5HYSB 1G0XA 5DD6A 4XBEL 5JXAH 2RFXB 1YEFL 2NY3B 2BP3A 1CGTA 4YWGH 3QUMA 2VYRE 2N7AA 3IDMB 2H6PB 4WO4B 4MWFB 1CGSH 2F53E 1Z3GH 4YFDB 1Q9KB 4PJFB 5C08A 3VD5A 5CZXC 5DTFB 4RFOH 4QOKD 3C9NA 4Y5XA 3BW9A 5DI8B 1KXVC 1U3JA 4U3HA 5F7DB 3RVVC 5D7JA 1CCZA 4XVSL 3MUY1 5I1AA 4QRPE 5DRZA 2ESVE 4APQB 1BF2A 4YHML 3BPOB 3NPSB 3AUVA 3V0VA 4JPVL 4NKMA 3TT1H 4LQFH 5CGYD 3ZDXE 3L5XL 3AU1B 2FB4L 5C0CA 4XMKL 1XCQA 3P4NB 3PDOB 1XF4B 3KPSD 4JFFA 1AGBB 1Q94A 5CWSB 3MLWL 5IFJA 1HXYA 4ODVL 4XXCA 4PJ9A 3HRPA 2JK5B 1GZQB 3BIKA 2H26B 2VERN 1YY8A 3EO0B 4HV8B 5F3HB 3FOLA 1TETL 1G1YA 4G7VL 1S9VB 5J6GA 4P2RA 3OKMB 4ZPTB 1WIOA 3TWCL 2ILLA 4LU5L 1CLYL 3K81A 4S10A 5F7KC 1L9NA 5IBTL 2D31A 5J9PB 1FL3B 3DX8A 5GGSA 5KVFH 3ULVE 1QUNA 5DA0B 3H3PH 1YDPA 3MC0A 3HG1A 3SN6N 1WCBB 1I1AB 4L1DA 1QYGL 3T65A 4OBRA 4FQQB 3RWEB 3QDHA 3UTTE 5KSAB 3SE8H 4OV5A 3G5YB 4WNQA 5LGJA 4TOYL 1HH6A 3KYMA 4U6TA 5D2LB 5E8EA 3TBYA 2BJML 1AIFB 1A0QH 4W68A 3WO4B 2PO6A 2YR3A 1QFWL 3VRJA 1TTGA 1MNUL 3HC0A 4J12A 4OSUH 1GGBH 1DQML 4ZAKC 1MCHA 4QOKA 2QQNL 2X4UB 1HQRA 3LQZA 5DJYB 1KPVB 3Q6FA 2R15A 5EIVA 3OB0H 1MUJB 2AJZA 5D2NC 4HS6A 4JO2H 5C71A 3WKMH 4HGKC 3FFCD 3VCLB 3CVHH 1FYHB 5CLTA 4AT6B 1OM3H 5C2BL 4OZGF 1UB6B 3KPSA 1N3NB 3S35L 5T3ZD 1GL4B 3P4MB 4OGXL 1J1XH 3ZZ1A 2SEBB 1NAKH 1T04A 3PWLA 4TPRL 5H2BB 3TYFB 3X17A 4OCSH 2XQYK 1U3HD 4PS4L 1JZ5A 4PJAE 4D0BB 1OF2B 4GG6B 1UT9A 2OTUB 3B2VL 1Z5LB 1UM5L 4TSCH 1R0AL 2Y5EA 3WHXB 1JPFB 1T3FB 3IDIA 4GKZA 3UJTL 2NW3A 4UILH 2CMRH 4JVWA 4LCYA 1E6JL 4WGWB 3WIHL 1H9VA 1QFPA 4UQ3A 3GNMH 2GTWA 3H7LA 1HHKA 3INUH 2Q87A 4XPGL 3MXVL 1E4KA 5D5MF 2AABH 4XRCB 1MI5D 4JM4L 1IQDA 4XH2A 3EOYG 1K8IA 1J1PL 3PJSA 4PJCF 4HJJL 1G7HA 5DGRA 4GJTB 4HEME 3F5WA 1FL6B 4YX2H 3HR5A 5DD3L 5IR1A 5D6DA 4JGMA 2OJZL 3BXNB 1D5MA 4WWKC 1MH5B 2VDOL 2F74B 5E9DE 5HHOD 3RQ3A 2YRLA 2V6HA 5EU4B 2ADFH 1ONQB 4D9LH 2WBJA 3QFJD 4NKDB 1EMTH 4OUUB 1JV5A 2WUBL 4PGBB 5F72S 1NMAL 2HN7A 4QYOA 3MR9A 5LCVL 1BFOA 3SDXE 3BN9D 1OSPL 1Q1JH 3OKEB 4PGDA 4LLYA 5HHXL 5I2IB 5ESAB 5FGCB 4ZTPH 5F7LB 4H0GA 3ALWA 1ACZA 1FHGA 2VR4A 3NVQA 1C5CH 4M7JL 5HI5D 2J8UE 4JFZL 4RWYL 4KRNA 2PW2A 1JYWA 4PJ5D 1CICC 4Q9CA 4U3XA 3RL1B 1N4XH 2EC9U 1CFTB 4L29B 4JQVA 1ITCA 4H88L 2LVCA 1ZGLB 1T6VN 2P8PB 4WJ5A 3WNMA 3KPMB 3MRJA 3MV9D 4X6DB 3ET9F 4YPGB 1AKJB 4IOFC 5ID0B 1ZHLA 5H35A 3MYJA 3PNWB 4ZTOL 1JTTA 5C7XL 1P7QD 5HGAB 3VFUB 2F15A 5CJOH 1GGYA 3K8MA 1S9XB 4OF8A 5JORB 4G5ZL 3SY0A 5TDOB 1MI5A 3S5LA 1MRFH 3CU1A 1TQBB 2OQJB 2BC4A 3GZKA 3T0EB 1H15B 4DAGL 2CQVA 4JO3H 5IFHL 4E0RB 3WN5A 1MJ7L 3H9SB 4FQJL 4DGVL 3VFRA 4JAMA 2DLTA 4OT1H 2XY2A 3PQYD 1ZLUK 1RUMH 4PJ7F 3JWOL 2HT2D 1NCAH 1MJUL 1EEYB 5BXFB 3LHPH 4U1HB 1J87A 3QFJA 5EUKA 5DT1L 2Y6SD 4AM0A 4DZBB 3BPCA 4L4VB 1SMAA 5HVHB 2FLRT 4MAYB 4M1DL 4ELME 3SKUD 4FXLA 2YUXA 4KVNH 5IB5B 2FX7L 5B21A 1C7SA 2DQFB 4RAVB 4EXKA 3VFSA 5LGHL 4KUCD 1URLA 3TZVC 2NR6D 3FQNA 5MENE 4LPCA 1FG9C 3O3EA 4PJ5A 5B38A 3RA7L 2J7LA 1YEKL 2BNQB 5GJTH 25C8L 5EU6A 2GSGB 2Y5TA 3QFDB 4M6NL 3BZEB 3F6IA 1DANT 5ACZB 4XCEA 1OP3K 2NY5H 4ZODA 3SBWC 5I8EA 4MQXD 2UWEE 2QKIA 2MCG1 1JZ8A 3O6FC 2VLLB 2LTQB 4LFHD 5CHNB 3SKJH 1EFXD 4HCRL 5IVOA 3X12B 4XVUC 1SJHB 2GQHA 4CVZB 4TRPH 4G6FB 2EDKA 4ONGH 5IVXB 4PGEB 3LB6D 3WBDA 4WI6A 5EO9A 2HFFA 3HI6L 4YNYB 1XT5A 4XPHL 3P77B 4POYA 3OXRA 1J05A 2RHEA 3U0WL 3TBWB 4BFBD 5C09D 3KXFE 1WFUA 3BYYA 1KG0A 3LPGA 4X5XB 3VRIA 4OCRH 2NY4D 5D1ZB 3O4LB 4UNUA 2CR6A 3NABL 1WT5C 4L3EB 2EXYC 1MFNA 3HNVH 4AJ0A 4YDVA 3ARBD 2DQUL 2W59A 1T5XB 1SM3H 3NCEB 3ARDD 4X6EB 4NO2A 4Y4FC 4WW2A 2NXYC 2X9XA 5SX4I 1XCTB 2XQBH 5I1DA 5F96L 2WUCH 5DRXA 1XGRB 5FECA 4QHKI 4M7LT 4NRZB 2ZUYA 1SYSA 5F6IB 1PKOA 2VJXA 1C16A 1U2CA 4RA0C 3MROB 5IMKB 1TMCB 2G60H 2FX8H 5HYQB 3SCMC 1DBJL 4RGOH 2P24A 3T2NL 4KVCL 1JGLH 3ZDYF 2VC2L 5C0BA 5JUEL 1U58B 4GLRI 4LHUD 4U49A 2HRLA 3EO1B 2V5YA 3O8XC 3V8OA 1U91A 5C0EA 2X6MA 2W0FA 4BK4A 5T5NF 2NY2B 43C9B 3ULVC 3T0WA 4U1SA 4L8DA 1CZ8H 1BVLA 2A74B 3MJ9H 4R97C 5AD0B 3NH7L 1EFXA 2D03H 1Z2KA 1F4XL 5DRNA 4U1LB 4D3CH 1I7ZA 4YGVB 2NZ9D 2VABB 1EEQA 4JKLA 5F1IA 2YD5A 3C5JB 4XC1L 5ANME 3VWJB 5JTWA 1X5JA 4KXZH 5A2FA 4WWID 2BMKA 4Q9RL 1FV1B 3CSPA 5GRWA 4R8WL 2HVKB 5I75B 4OZIE 4Z77A 4U33A 5BZDB 1I9IL 3EYSL 2QV2A 4Y19E 3RVXC 3QEQB 3RVWC 1N6QL 1CLZL 4LAQH 1CE1H 3D9AL 1NFDE 3LKNB 3V6ZA 5TDNB 4M5YH 2ZWLT 4U31A 3ARBA 4XPAL 4KZDL 1NH6A 4JB9L 4X4XB 1R3HB 3CFJB 2B2XH 4NO5A 2DQCL 4UIKL 5JMRA 3QNZA 3MMEB 4PTTA 1L0YA 1JNHA 5EOQL 1AXTL 5JR1L 1IT9H 3CVIL 3QUMH 5EC1B 3RU8L 2VRAA 3AB0B 3OJDA 1QSEB 2VLME 3C6LD 4U2YA 2W9EL 1WV7T 2PYEE 4R4FH 3OKKA 5KSVB 4Y2DB 5DEGB 4EQ2A 2VXQH 5BRZE 2OR9L 5HHPA 3QUMB 2VUOA 1J7VR 4HIIA 2HJKB 5I1CH 5JW5B 5AZ2H 1A21A 2PXYD 5IWLA 4X4MA 4JFHD 5IHUL 3O9WC 2FATH 4OCXH 4F15C 2CO7B 1N26A 2AEIT 3CFBB 4J6RH 1RPQA 4K7PX 1Q8MA 2F19H 4MHHG 5CP7A 5EBMB 4E9LA 4OD1H 4WI3A 5D7JB 3ZO0A 2MJWA 3VH8A 3MJ6A 1T83C 2ORBH 2QQLH 4ODHL 4WHCA 5DRZB 3MUGA 1A7RL 4NZUH 4M6AA 2YUWA 1BOYA 4GW1A 4NN7C 4NKMB 1XCQB 3H9ZA 3QDGB 4YLQT 4JFFB 5E8PA 1CU4H 1Q94B 2K3TA 3P9WB 1ADQL 3L3DA 1P4LA 3LS4L 3OZ9H 1HXYB 2RB8A 4PJ9B 1MAKA 2P7TA 3SDCD 3UTSE 4LVEA 3FO2B 5I71C 4Y4KC 5I1KL 1XGYL 3FRPG 4HKXB 2MKWA 4PBWD 2FWOB 3SGDH 1HCFX 3QIUA 4Z8FL 4LBEA 3HI1A 1ZXQA 4GG8B 2IAND 4LKCB 1EIBA 3LDBB 4PJXA 4Y5VA 3AM8C 2O26U 1OCWL 3PHOA 3OPZH 1XGPA 4ZXBB 2D3VA 1P7HL 2IC2A 3DX8B 2MPAH 4ZYKA 3OBAA 4WEUD 5HDBE 1N0XL 1YY9D 4D94A 1Z6JT 1WEJH 2QSCL 5CEXB 3STZA 5GS0H 3T65B 3V2AR 5DFVC 3REWB 2LV4A 4ZFFA 4WI8A 2M1KA 2VN4A 4OV5B 3QIWC 3U7YL 5AUMA 4P5TD 1IGFH 2DDQL 2VZUA 2L4OA 1OQXA 4BFGA 1YN7A 3ARYA 4O2CB 5FHAL 1RULL 3RUGF 5ADPL 1VPOH 3CLFL 5C0AE 3MRMA 3DTXA 3I50H 5D7LD 4KKCD 5JIHA 2PXYA 2YD2A 2PO6B 3VRJB 5T1KA 3HC0B 2UVEA 1QBLH 3PV6B 3BH8A 3LEXB 1DLHB 1QOKA 3FN9A 4NBZB 2IQ9H 3KPRE 1AHWA 1YEJH 4OQ1A 3IDGB 3WS6A 1KJMA 1RV6X 1GHFH 5DK0A 2JELH 1QQDA 2AJZB 4FFWD 2CUIA 5LWYL 5KTEH 5CCKH 2CDGA 2ENSA 3MOBH 3H9HA 4HAGA 4OM0H 4UV7L 1DEEA 4U6VH 1U8OB 5CP3A 4NBXB 5GXBB 1UG9A 3B4NA 4EUPG 2IH1B 3TIEA 5CAYB 1CQKA 1PSKL 4X7CC 3QQ4B 3NIFF 4KTYA 3WIFA 5FDYA 1CDGA 1X4XA 1UXWA 4M3JA 5F7NC 2A6KB 1J0YA 2BRRH 4Q6YA 3DX9A 3S3SA 1PLGH 2FBJH 3P9LB 4G80A 5EUOB 2F9BT 2IANA 3OMZA 1AGEA 5ECJE 2GY5A 3IDIB 4GKZB 5AZEL 3RJDA 1UM4L 2D7MA 2EDNA 1MWAL 3UBXA 2HRPL 2IGFH 5IF0A 5I8KL 3M17A 2OYPA 4XC3H 4HK3N 5LXGL 3EOBA 3RHWK 1IFHH 3DMMD 3CGTA 4JM2C 1AD0B 2P46B 4RGNB 1IQDB 2R1YA 2NLJA 3RX8A 2QADC 4L5FL 1V8HA 1YMMA 4P5TA 1IL1B 5DGQA 5IBLC 1FBIL 5GS1B 5E03A 2Y06H 1NGPH 2HJLB 5J3HD 4N90E 5IR1B 1DEDA 5D7LA 4ORGA 3M07A 4G7YL 2NW2A 4XNYH 2J88L 5TGBB 1MQKH 1HCVA 4NYLA 5T3ZH 3UC0H 2BVTA 2K1MA 2J4WL 5CJXC 1WBXB 4JO4H 2P42B 2Q3AA 2WBJB 4KJPC 3OGCB 4RZCA 4ZUWB 2DD8H 2ZSWA 3STBA 2HN7B 4A2LA 4QYOB 3N50A 2Q8AL 4MA8L 1IQWH 2VXUL 1QFUH 3PIQB 1JVKA 4OTXH 3ILQD 3UYOD 4IIQA 2OP4L 4BH7B 3TCLB 3JTTB 1OY3B 3DRQA 4PGDB 1QA9A 2AK1L 3FAWA 4LLYB 5E5UB 4YJZL 1LK3H 3VU2A 4QHLA 1A5FH 1UGNA 3GBNL 3WNPA 2HH0H 3SQOH 3VFMA 4JVUA 4NIKB 4QXGH 3C6SA 2PW2B 4N5EC 3S98A 1F3DH 3FN0L 3EFDH 2Z4QB 2CR3A 2F8VA 4PJBB 2CJUH 2JB6A 4M93C 1SQ2N 3IFNL 5D1XC 4PJHA 3TA3A 5HYEA 3O11A 3QA3A 3NCYS 4XP5L 3VG9C 2YSSA 4DTGL 5IJKA 4Z95L 2OXHA 1KLGB 1Z0MA 1ZT1A 5T1DL 3QEGH 4IMLA 3LKSA 2IFFL 2R8SH 4X6CF 1WAAE 3DMMA 4TNWF 3T1FB 3VFPA 1NCCL 2D7OA 3HFML 3S34H 2RBLA 2QHRL 4NQCD 5DMJB 2VQUA 3MRQA 4I18C 4P2QD 3RVVD 3S5LB 4WU5B 3V7MA 4HKBA 4MJIB 4ONFL 2AJUH 4N0UA 1IGTA 4NQEE 4HUVB 4YDLC 4FFVD 2HVJB 3L5WA 4KDTA 4XPFL 4HQQL 3OAUL 5KS9F 3EYUH 5T1MB 3VFRB 3IDNA 4QXWA 2YC1B 4ZO8A 4LCWD 3RWJA 1JFQH 1MCCA 4U1JB 1MFAL 3QSKB 2VWEE 3ULUL 1RZJL 3BMVA 3IFOB 4FQIL 1JHKH 4PJIF 4AM0B 4CN6A 5FUZL 4FFYL 3C60B 2MHAA 4N0YH 4ZUSA 4Z7UE 2DL9A 4OZHA 2R56H 3IDXL 1NGWA 5HD8C 3T3PE 1OGAD 2D9CA 3GB7A 5D1ZD 3VFSB 4FFZL 4O00A 2X44D 3VXRA 3BE1L 1MHEA 4NOFA 3ARZA 3O3EB 4KKLD 5B38B 3EYFA 5MEQB 3GSUB 5EU6B 3OR6A 3DV4A 3GHEL 5IV2B 5K9JH 4DUVA 4WUKL 3BSZL 3ZE1E 5DR5L 3RWFB 3BD3A 3HC4L 4I3SH 1U95B 4JPKL 5ICXB 5I8EB 3DUHA 4YDKL 2HMIC 4U3CA 4G8EB 5CINH 3QUYC 4JFDE 1C5DA 3ELAT 2VKXA 2VL5B 3VWKC 5EU5B 5HVWA 4ZAKD 4Z0BL 2DQGL 1OAQH 4O9HH 3I6GB 4JHWH 4LSQL 4D0DA 4YHZL 2JIXD 3UJIH 4O02L 2A9NL 4P2QA 5HHNA 1L4IA 1GOGA 1JWMB 3MRFA 3WFBH 1GC1L 2QTEA 3HUJA 1J05B 4GSDH 4KY1L 3CC5A 1UWGH 1RAMA 3B6SA 5GSVA 3UYPA 1KG0B 4PJGB 4FXGA 3X14A 4PV9A 3RAJL 4D8PA 5TPWL 3J8F7 1MLCA 5I18H 4K3JL 5HHME 4NT6A 2B4CH 4YDVB 1FH5L 4NO2B 3BGFC 3EDEA 4JFYA 4NQSA 1WF5A 3IFPA 1RUQL 2V5TA 3DVNA 1OGAA 3MLZH 5FECB 4ZSOE 4LKXA 3VXUE 1V7MH 3HAEB 3O6KL 3N1MC 3ZYIA 4OFPA 1NDGB 2O5ZL 4NWUL 3UX9B 3RWGB 4Q9BA 2X9WA 3BWUC 3GIVA 5F71A 3BIAX 1ZLVH 1NBZA 4Z76A 3B9EA 2OI9C 5JW4N 3L3GA 2ID5A 4KROC 1U91B 4PRPA 2W0FB 1BGXH 3EHBC 1NAMA 3AGVA 4K3HA 5GS2D 3PABB 3QRGH 4U1SB 1C5BH 2AJXH 1BVLB 3DURA 4WEBH 4GOSA 4BKLB 5FDWB 1FNGB 1I3VA 1I7ZB 1X5LA 4ZAKA 3QO1A 4BZ1H 4ZG1A 5LBSL 5F8RC 4ODWA 4OM1L 3LEYL 1HNFA 1CGYA 2JIXA 5EU3A 1E6OL 4MJ6B 1RK0A 1BVKB 5D2NA 1WISA 3EO9L 4U1MB 1Q72H 2EDTA 4L8SC 3R0MA 1H3VA 4K7PH 1YNLH 5KG9A 3P9MB 4Z77B 3BKYH 1EO8H 2X7LA 3VDCA 1HZHL 4J3TA 4BSVB 5IB4B 4M5ZH 5C07E 3VRLE 3BUTA 4UV4H 1TJGH 3V6ZB 4GXVH 4MX7A 2FEDC 1MCOL 1N6VA 2I60L 2P5WA 4ETQB 5I15L 4TTGA 4D9RD 2DQIL 1F3JB 3DV6B 1CICD 3QIBC 3U1SL 1KEMH 2B5IB 5L8LB 4JDTL 2V9RA 4JG0H 3MA7A 1U3ZA 5FYJD 1BFVH 3G04A 4JANA 1BBDH 3QNZB 5HYSG 4PTTB 1MY7A 3QZWB 1W8NA 3OR7A 4MXVE 4EXPX 5E4EB 1BP3B 3GMNA 1HIMH 4KQ4L 5L2KE 2ZKHH 5D7IB 3OJDB 1NFIA 4OCWH 3CSYB 1KCVH 1U8HA 1YJDL 5B4MC 4FA8A 1PBYA 3MBEC 4NNPL 3RWDB 3R0NA 3MRDA 1UC6A 1F6LL 5GRVK 2I5YH 4HG4K 3KHOA 5AYUH 1JPSH 4DVRH 1FN4B 2X89A 4PJFF 4K94H 1NBQA 1QSVA 4GBXC 5HHPB 3RY6C 4LLDA 1T2JA 3QXAA 5D8JH 4WTWA 5HGBA 5BCAA 3EJZC 1QR1B 4WWKA 2MQCA 3T77A 1ZA6B 3G5XB 4UIMB 4I9WD 3NACL 5DD5H 1CLOL 1U0QA 5CP7B 3GGWB 1ITBB 2P5EE 3T0BA 3DI3B 1RZKH 1V3JA 3CLEL 3Q1SL 4Y16C 4JRXB 1A7QL 1NLDH 3ARXA 1I7RA 4GW1B 2YUVA 2BX5A 3HE7C 4DGYL 4M00A 3KYKH 4XP6H 1BQLH 4ZFGL 4P3CL 5CD5C 3TZVD 3GMRB 4HK0B 3CAFA 3P0VL 3QHFL 1NCBH 5KANI 1X6LA 1AH1A 4L9DA 2F8XC 4HWNA 1CICA 5L8JB 5J0BA 1X44A 2GYSA 1CD9B 3LEVH 3EYVB 4NJAH 1FAKT 3WL9A 1WVZA 2R2BA 3QIUB 3MLRL 1MFDH 2D0GA 2GY7B 4YHLL 2IBZY 3QQ3A 4N8CH 3RDTD 2MQ0A 3BN3B 3D39A 3B5GA 4ALAL 4Y5VB 4X6FA 1J0HA 3P11H 3U7AA 3S36X 1XGPB 4G9FD 5JPMA 2FBOJ 3O6FD 4UU9A 2XWJB 2X41A 1T0NB 5A1AA 5KVDL 4XVUD 3NCJH 5D2LF 1B4JL 1AE6H 4JFEE 3GSXB 4JDVA 2XN9E 1HHJB 4HBCH 4JFOB 2VTFA 1JCKA 4ZFFB 4F8TA 4JN1H 3WO3B 1UACL 1MCBA 1DUYB 1YEHH 1AGCA 4OZGE 5B3NA 2BY0A 4ODUA 2PTVA 4JZJB 5FV1L 2F53D 3QHZH 4O2FB 2O61A 1CGWA 3LKRB 4ODXA 1CL7H 1TENA 5I30L 3RWCA 3OJVC 5DMIL 3L6FA 5CP3H 1WC7B 5T1KB 4P9MH 5IIEA 3RIAF 4XVTL 4V2BA 3UZVB 3WUWA 3P4OA 3HS0B 3ESVF 1N6UA 1BECA 2C3XA 1DN2A 2DTML 2EXYD 3MO1A 1FRGH 1KJMB 4E41D 5KOVC 4K7FB 1P2CB 1SJEB 3CIQA 3PP3K 1FCGA 3HZMB 3D3VB 3H8NA 2ESVD 4LCCB 5DURB 2FX9H 5EO1B 4GAGH 3QR2A 1TJHH 5T3XL 4TSBH 2NXYD 2J1KA 1NL0L 3UXFA 4J3WA 2NQCA 2WIIB 4ONHB 4Z7NF 3WD5H 4G42B 5BQ7A 2G5BA 2R69H 2VWEC 3TZVA 4GG6F 1U42A 3W2DL 3LQAC 5E08H 4WFGD 1WWBX 5D5ME 1KCKA 1LO0L 3T0AA 2BDNL 1ORSA 3WE6A 1EHLL 4GKNB 1UXWB 4PJCE 1AP2A 1KCUL 4F58L 2OTPA 3DX9B 3SCMD 2VDPH 5GGQL 3I75A 2D7NA 3V95A 3NBNA 2IAMC 4GRWB 1AGEB 2D7TH 4EOWL 2NMSA 1S7VA 1A3RL 4UOW0 5JHDD 3AVEA 3UBXB 5GISL 3O6FA 4JGUA 5IF0B 1I4FB 2DBJA 3EOBB 4AK1A 1MRDH 4KK5C 4K23H 4XNQB 4R2GC 3UTTD 1K6QL 1FYTE 2QLVB 4LSUH 4X4YA 2R1YB 5DJ0A 2E7LC 4EIZC 3IAPA 5MERA 1YMMB 2AV7A 4R4ND 1IJ9A 3LV3B 3GI9L 1B0WA 1IC4L 2F53A 1RJCA 3EFFA 3TF7C 3V4VL 3MACL 5IBUB 1NKRA 3MBXH 3CPLA 4WY7L 1KIPB 3HPLB 4OD3L 3MODL 5DJCA 1WT5A 4RZCB 4M6ML 4QRPA 2F5BH 4E41A 4ENEC 2ZSWB 1BOGA 2ZUQC 3F7YA 4HWEL 2ESVA 1J18A 3FRUA 1GPOL 4FN0A 1A4KA 2YKLH 1NUGA 1YN6B 4TVPH 3MRRA 3HB3C 4Y4FA 1PY9A 4E5XA 4LLVB 4XPBL 2KL6A 3DRQB 1X5KA 3BP6A 4XNMA 3KYNA 4P5KA 2OJEA 4YWGL 1KB5L 4YR6A 5H94B 2IMMA 1F00I 1OB1A 3J7HA 3ZMRA 1X7QA 1FSKB 1CGSL 3B8SA 1Z3GL 5FYLE 4OLWH 3VFMB 1G0YR 2AS5M 4X6DF 1N8ZB 4FZEH 4RRPA 4X7TB 3CUPB 5DMGC 4FTVB 2VAAB 3HMWL 3SCMA 1ETZA 1INEH 3TA3B 4QRTA 4RBPK 2GK2A 1D9KB 3TNMA 1PX4A 2OK0H 3O8XA 3TT1L 4YFLI 5GZOD 2W9LA 3CH1A 4ACPA 1K4CA 2IWGA 4PJ7E 1ZT1B 4XBPB 2X4TB 4ZS6C 5CSZA 5IKCB 3LKSB 3VE0A 5I8CB 3VFPB 2CLRB 3UTTA 2HKHH 3EOAA 2BY1A 1BIIA 3UTZA 3U36B 3MRQB 5TDPA 3H6JA 3TN0D 3VDAA 1H8OA 4K9EH 4YZFE 1C08A 1FE8H 1P84J 3IS0X 3CFDB 5DJ6B 3FFDB 4O2EA 1IGTB 5C9JB 3QUZC 3QDME 1QRNB 1T03H 2NNAB 5CEZE 1MFBH 3IDNB 1LO5A 5FGBC 5KVFL 3U0PB 1LP9F 1T2QH 1T89C 3H3PL 5F1OB 4PY8I 5KANG 2E9IA 4RFEA 3ALXA 4ZUSB 3SE8L 2XG5A 4F7TB 1HNGA 3BUYA 1X5YA 4JE4B 5FYKU 2NY0C 4YHPA 3AY4C 3ORJA 1NGWB 1UA6H 3MV11 4H5SA 5E4IA 1FJ1A 4TUJA 4Q2ZB 4QXUH 1NEZG 4OSUL 2X4RB 1FGVH 4H8WC 4NUJB 3ESUF 3EYFB 3X13A 1JP5A 5EH1A 4U1NB 1JHTB 2ZUXA 1KJVA 5DFVD 4JO2L 3WKML 5IQ7H 2BSSA 4DCQB 4H1LA 3CVHL 1A02N 5EZLA 4NN6B 2PKDA 1OM3L 3STLA 4XP1H 3GSQA 4I2XB 5IVXF 1UJ3B 3NCBB 4K3GA 2GW5A 1IAKA 5JA8B 3O9WA 4XXDB 3JWDL 1R3JA 1J1XL 5C1MB 3IDYC 3O4OC 4OCSL 1FNFA 1G84A 5BJTB 3QRFM 4R7NA 3MNVA 5D70L 4KRMB 3TN0A 1T83A 2I9TA 4XCFH 3DIFA 1BX2A 4TSCL 2NY6C 3SPVA 2OTWA 1S7TB 1KJ2A 5E9DA 3L9RB 2BERA 5ID1A 3I3EA 1DQTA 2ITDA 2BNUA 1CG9B 3TBSA 3BQUB 4OIBA 4UILL 2AJ3B 2CMRL 5JIPA 3GIZH 4FXGB 4JY6A 4LPVA 4PV9B 3GNML 3INUL 5I8OH 4NT6B 3SDXA 3V4PH 3EDJA 3ZDYE 3MV8E 2AABL 4Y4KA 1BQHG 3IU3B 3RGVC 2V2TB 4XB7A 2QSQA 1MHHA 3U7WH 4E42A 4NQSB 4FQCH 2NXZC 3SDDC 3RKDC 1MHCA 3IFPB 3WS3B 2HLAA 5HJ3B 1L6XA 2HG5A 4YX2L 4GS7C 3AM8A 4EN3D 4LKXB 1HILA 1NAMH 3PDGA 1U8JA 2J8UA 1WITA 3DXAE 4DUXA 1FGNH 1LMKA 5C6WH 2AAVA 4LF3A 2E6QA 2ADFL 4TTDC 4D9LL 2QBWA 3VMPA 4DEPB 4TULH 1EMTL 4L3CA 1WFTA 3GIVB 4JPIB 4KMLB 1ZE3C 2E6PA 1NBZB 4OB5H 5JW3H 1TNMA 2QADD 4M7ZC 3QIWA 1Q1JL 3SE4C 1IC7H 2VLRB 2VZTA 3RPKA 4X9IA 4YHYC 4G6JH 3IDJB 4PRPB 1NAMB 2DWDA 3ARTA 5DDHB 4HWUA 4CVXB 1BFSA 1T21B 1ZT4B 3MLTA 4ZTPL 5JOPE 1GVIA 1PAMA 1DVFC 4KKBC 2APWA 4CMMB 2EDYA 1BZ7B 1T80A 1C5CL 4RCAA 1QPXA 1ES0A 4MZ3A 4LSTH 5ITFB 4R9HA 4HIHB 1XR9A 1N4XL 3BGAA 4LVOC 1KCRH 5DRWB 1T5WB 3IXAA 5CIPA 4PJ8C 4P23D 2FDBP 3BFOA 2K7PA 2JKXA 2M2DA 5C08E 3KXFD 3EBAA 2YMXL 2HP4A 2X7LB 4DFIA 3C2AL 3IYLW 1BBJA 3ZSTA 2FEEL 4XBGB 1B90A 4MX7B 5IW6A 2P5WB 4PFEA 5CJOL 2DKUA 1FO0A 4N5ED 4OI8A 5GSRB 4OAWA 4ELMA 1EZVY 5C0CE 1MRFL 3QJFA 5C6PB 5D1XD 4AIZA 1LWRA 3MA7B 4OI9A 3VFGH 3G04B 4K8RC 2OM5A 4JANB 2R0LL 2EDWA 4JO3L 5M94B 3HPJA 3ZE0F 4BSJA 5MENA 1KB9J 3AAZB 2YPLE 3MGOA 4NBYB 4OT1L 5GS2H 1NFIB 1RUML 3AMKA 4L8BA 1NCAL 1U8HB 3MV7B 1H3GA 1NUFA 3EAKA 3LHPL 4JM2A 4JY4A 2HTKD 3DVIA 1QFWH 3MRDB 1S7XA 3NN8B 3T1WA 2CKBA 2DF3A 4KVNL 1JI1A 1P7KA 2UWEA 3SEPA 2GCYA 4OCMC 3GJFK 1UWXH 4JVPA 4ZPVA 5FAAA 3HG1E 2VLKE 5E00A 5I6XB 3S6CA 1NMCB 1M4KA 5IM7B 1PZ5A 1YNKH 5C0IA 3O3AB 3CFEA 3IB4A 3CDGA 3FQRA 4KV5F 3PP4H 5CJXA 5IK3B 5GJTL 3B2UC 5J57B 3CFKA 3MTRA 2XKUA 2PUQT 3VJ6B 1H3XA 4JDZA 5E6IC 2NY5L 2VQTA 1I7RB 3KXFA 3L5IA 1RD6A 1XF5A 3ZHKA 4GKSA 1ZA3B 1UM5H 3SKJL 4PJEB 4OZFA 4YUEH 1P5UA 3DROA 4TRPL 4MD5A 4ONGL 2FR4A 2FYYA 3KWWA 1X5AA 3WL9B 1HN1A 5FA3A 5D1XA 3RUGE 4ODTH 3QQ3B 2ZP0T 3MXVH 3QYCA 1J1PH 1NGXB 5FM4A 3QUYD 4HJJH 5JW4M 4OCRL 2EYSA 1GZPB 1GOFA 4LQ1A 4FQXD 1ZHNB 1ZVYA 1P4BH 3HNVL 5I1GH 1PVHA 3KLDA 4I18A 5ENWA 4AZ8A 1SM3L 2ADJB 1FFNB 4EKXA 1MIMH 1IGYB 4EIGB 4I48B 4L9LC 2VDQH 5AG9A 2XQBL 2WUCL 2ZUTA 1HKLH 2O61B 2Y07H 3ZYOA 2R23A 3RVUD 5SWQA 3RWCB 2YEZA 5FHBH 3NIFE 1UH2A 5IIEB 2A6DA 4GRLD 3OV6A 4K3EH 3LSOA 3P4OB 3TH4T 1FG2A 3VDBA 2APBA 5ANMA 1GH7A 2KBGA 2P4AB 2I24N 1R3IH 2G60L 2FX8L 3C5ZB 1PD6A 3LS5H 2N1KA 3RZCD 2I27N 1MELA 4RGOL 1JGLL 4K71B 2XWTA 4MCZA 4OZIA 1NMBH 1S8DA 2BNRB 5IG7A 3MRCA 4G8GB 4MNQE 4PYGA 1OPGL 1NFDA 1IEBB 5EORH 3SE3C 1P1ZA 1CZ8L 2QSVA 4FHBD 3MJ9L 1YECH 1HHIB 2DYPB 2D03L 4D3CL 1X5FA 5EUOF 1HI6B 3FFCE 3QNXA 3HR6A 4O4YH 3LPWA 4JLRA 3U4AA 4OI7A 1R24A 3N1QC 2XRAH 1J8HD 1J10A 3KJ6H 3JVGC 1VDGA 4XGZB 4M8QA 3W0WB 1GSMA 1S7VB 1S7SA 3EHBD 5ITBL 4PJDE 3TGXA 4LAQL 1CE1L 3QUYA 4XAKD 15C8L 1PJ9A 3VXTA 4M5YL 3T4AA 3DHJA 2PYEA 4QWWD 5IFHH 3VWKA 3BP4A 4NRXB 4J3UA 1IRAY 1HEZB 5DA4A 5ERWA 4YDJB 3LVEA 1D9KD 4NM8H 1XH3B 2DLHA 4PLKD 5DJ0B 4PRDB 4Z7OF 1YPZB 1IC1A 3AS3A 2B2XL 3QJHA 2X1WL 3U48A 1R6VA 1IT9L 5C0GB 3QUML 5F7HA 4IRSC 1NC2A 1MI5E 3CPLB 3EIFA 3TO4C 1VEPA 5LJYH 4XAWH 4QF1B 5D93B 2FEDD 3MJ7B 4YGAB 3C8DA 3A67H 4ZFOA 4QRPB 2V7NB 4HLJA 4R4FL 3QIBD 2GJ6E 4TN9A 2VXVH 2E9JA 1A4KB 4OF0A 1R5IA 5HHOE 3MRRB 4XHJD 4Y4FB 1Q9WA 4DN3H 2ZG2A 2VXQL 4P5KB 1KN2H 5F88B 5GGVH 4YR6B 3V6FA 1CR9H 5I1CL 4X6CE 4PJBF 3MGAA 3V7AG 3ULVH 2FATL 3UTSA 4OCXL 4B7LA 5EZIL 5GIRA 4NDMB 3KS0H 2GITA 3MLYL 1B0GB 2X1PA 2G9HA 4J6RL 4XVJH 2F19L 3MBED 4OD1L 2XWBA 1LE9B 3T3MF 1F13A 2ORBL 2QQLL 3N0PB 1KF9B 1UXSB 4NZUL 1I1FA 2FCBA 1EAPB 1OWWA 3WEXA 3BT2H 2XI9A 3O8XB 3S5LG 2GKIA 2F8OA 3CH1B 1K4CB 4UTAH 2MQ3A 4ZOEA 4BH8A 3FQXB 3EJZD 4Z7WF 1CU4L 4PYHA 1EXUB 1IM9D 3OZ9L 4N1CA 3MV9E 4PRID 1H3PH 1P4IH 2YPKB 3EYOB 1BIIB 4KJYA 4PP2B 3CSGA 2YWYA 1MQ8A 1TTUA 1C08B 2WWKO 3C5SA 4Y16D 3EZJB 4O2EB 4LP5A 5C0AA 1UKTA 1KIQA 4L8SA 1KTDA 2WSKA 4ZOAA 3CK0H 4TNVF 4HS8H 4HUUA 1XAUA 1TXKA 3F8UB 2EDQA 2MPAL 1V3LA 3SDYH 2PR4H 2R4SH 1NLBH 1UEMA 3VMOA 5F96H 1SVZA 5J12C 1WEJL 3N9GH 1G7IA 4YO0B 4RDQF 4AL8H 5GS0L 4MA1C 4CU6A 3QIBA 2XIDA 2XTJD 4JG1H 5BV7C 1LDSA 5B38G 3PQYE 4NNXA 1ACYH 1IGFL 5B39G 1UCBH 3UJJH 1BJMA 1BJ8A 4J8RA 3I85A 4H1LH 4ETYA 1VPOL 1A7BA 3GI8H 4FOMA 3ZKXB 3I50L 4ZUVB 4ORZC 1FJ1B 4KGJA 1N59A 4TUJB 2VZSA 4URTB 1FCCA 1QBBA 1QBLL 3VXOA 4IDLA 4PJAB 5L7XH 1MCPH 1ZHKA 1MCNA 4X4ZA 1JZ6A 1YEJL 3VGFA 3MBEA 2DN7A 3X13B 2I9LA 1I9RH 1GHFL 4QXTA 5DD1H 1ZLUH 1KJVB 2JELL 4HX1B 5F7WC 2E7CA 3G6AA 2UZIH 3ARVA 5MEOB 1T0MA 1NBVH 3RIFF 1G9NC 4TNWK 5L9DH 1YQVH 1JK8B 2BSSB 5KTEL 2GAZA 5GRXG 3MOBL 5EZLB 1JRHI 4PD4K 2VH5L 5I16A 4GBXA 4OM0L 1E27A 3RY6A 1KJ2H 3W9EA 4U6VL 1BFTA 1MY5A 4P48A 1VEOA 4TUKH 2A83A 1R3JB 4PLJD 4IRJD 5EIIB 3LRSA 4Y1AD 4F15B 3AXLA 3S9DB 2VISB 2EDEA 2XZQH 3OGOE 3UPRB 3IAGC 2BRRL 3JV5A 1U36A 5D1QC 1A4JA 4ZOBA 4NQED 3VXMB 1XFPA 5KBNC 4Y16A 3DIFB 2W38A 4PJGF 1W72A 3OWEA 4O5LH 3SPVB 3D85D 3WFDH 5SWZD 3VXSB 3PGFH 4NN7B 4Q0XH 5E9DB 1VGKA 3HE7A 2BNUB 1CL7I 1KUMA 2IGFL 2VSDA 1OP3H 5FK9A 4XC3L 5GGRB 4AMKH 4G8FB 3RRQA 2JF1A 1Y0LA 1IFHL 2V2XB 3JTSB 3B9KB 3IGAA 2EECA 3RU8H 4CN1A 2DQTH 2OZ4H 2X09A 4Y4KB 2D9QB 5B22A 5C09E 3ZTJH 3CCHB 3MCKA 1IAMA 3F58H 4KI5F 3WIIH 1BAFH 1MHCB 2Y06L 1NGPL 3UMTA 1JZ3A 2F5AH 2KDGA 3E3QE 1W8OA 3RFZC 2BY3A 1X4YA 3GEWB 2J8UB 1VACB 4XNYL 5HTSA 5DEZA 2CLVA 5INCA 1MQKL 3UBXI 5T3ZL 3UC0L 3UTQA 5CGYC 1XIWC 4LF3B 1PG7H 4KK5D 1IILE 4HFUH 3QI9B 4R2GD 4EI6A 4CAGA 3FQWA 4LFHG 2DD8L 4MDIA 2D2OA 3F7QA 4X7SH 1IQWL 1QFUL 3ARUA 4OTXL 4RAUB 5CIPH 3QIWB 2P1YA 4R0LC 3QDJD 4HXAH 2DQEL 3NGBC 4HK3J 3FTGB 1CDUA 3MLVH 1KACB 4DQOH 1LK3L 3EDDA 1VGEH 3ZHDA 1A5FL 1WAAA 4EVNB 1FORH 2HH0L 4QKXB 3SQOL 3TFKC 4QXGL 2FHFA 4MD4A 1ES0B 3ARED 5DJ8A 2AXGB 2ZCLL 3K74B 3D0LB 3EFDL 1FO0H 4ENED 3OJMB 2CJUL 2Q7NA 5CIPB 4NQEA 2IPUG 3HB3D 5DS8B 1EERB 3PG2A 5IMLA 5CGTA 2F58H 1D5XA 2FZ3A 3QEGL 1BBJB 4GRMA 5EIQA 1QLEL 2R8SL 2VXTH 1X9QA 3DWTA 1J0JA 5EN2A 4BSWA 5LVEA 3S34L 4ELMB 4Z7UA 5A3ID 4HEPG 5DMGD 1OP9A 4PJFE 4U0RC 5D7IF 2CKBH 4AEHH 4AIZB 3EJYC 2AJUL 4X80H 4ZUUB 3VXUD 2IAMA 5KAQG 1JPGB 4HDIA 2AQ1A 5DQDH 2A0LC 3EYUL 5MENB 3D69A 4NHUA 3SE9H 4MMZC 2R0KH 1ZS8A 3LY6A 4CRPA 3TO2A 1EHXA 1J12A 4JKPH 2XFXB 3UYRH 1JFQL 4L8BB 4XB8A 2A9MH 3HTLX 4MQ7A 4KH2A 1JHKL 4JM2B 2VITB 1S7XB 2HWZH 1WWCA 2CKBB 4N0YL 2E7LA 3DGGB 2ZJSL 5E5MB 2R56L 1U3HC 1C12A 4I5BB 1DN0B 3GBMH 5DQJA 3VH8G 1YUHA 5IW1B 2VQ1A 3LMJH 5GGTA 4TYUA 4HIJB 3CDFA 3FQRB 3L7FA 4UV7H 3KLHC 5KSUA 1S7RA 4LRIC 3ARFC 4YHKH 3L3HB 3CFKB 5K9JL 2Y9RT 4EQ3A 2O93L 3W5MA 1A6TB 3DYPA 1T1YB 1PSKH 4JEGB 4K2UH 4JFHE 4PV8B 4MQTB 2ZZUT 4I3SL 2A6IB 2FJGB 3L3IA 3BKCH 3OKLB 5C07D 3D87B 4P4KB 1VFBB 5SWSB 5CINL 4GKSB 5JOEA 3QWOA 3QQNA 3SDAB 5D2LE 1EEUA 3OKOA 3X3GH 4MD5B 5F1SA 4O9HL 2FSEA 4JHWL 2F54D 2FR4B 2FYYB 2W60B 4AENA 5IEKA 3QB7C 3UJIL 4OKVA 3K4ZA 4PRHD 2E7MA 4M93B 2YA0A 5FA3B 1ZK9A 3EJJX 3TYGH 3U79A 3WFBL 3E2HC 3N85H 4NQDD 1CF8L 4ZSOA 3VXUA 1TQCC 2FL5B 4WEMB 3FT4B 1DCLA 4YHNB 4GSDL 3MREA 1UWGL 2GFBB 1A6AB 4M7KL 2DQDH 1SMOA 4HH9A 1GOHA 5I17B 1MWAB 4L4TB 1ED3B 5I18L 2B4CL 1M6OA 5HI5C 1EVUA 3ALPA 1CFSA 7FABH 1BM3H 4HS3A 4XX1E 1A7PH 5IB3B 5A2IH 3QUZA 4PRNB 4YDLB 3MLZL 4GG6E 4MA8H 2R23B 4UTBH 5SWQB 1WLHA 2FJFA 5FGBA 4I0PC 2P5ED 2YXMA 3LSOB 1T89A 3QULB 4F2MA 5ANMB 1WK0A 1FFPA 3O3DB 4OFYD 4LVNC 5D7LE 3MJGX 5F6HI 2EDFA 4MCZB 4N0FA 3RX7A 1RZGA 3S35X 5A43C 3FN0H 1S8DB 5GJSH 3AY4A 3MRCB 4Y19B 2NXZD 4QHNB 5C07A 1Z9MA 1BGXL 1V3KA 3QRGL 3O45B 2Y1VA 4HJ0C 4IJ3B 1C5BL 1P1ZB 1UVQA 2AJXL 4IDJH 1QSFD 4NRYA 4P59H 4NC1E 4WEBL 1U8KA 1OAZL 3U9UA 1QHOA 4BZ1L 4TTDD 3UBXG 4GRWF 3L3JB 4XPTL 1UZ8B 4G9DA 3VXNB 3DVGB 4NO3A 4JLRB 1BLNB 5E94A 5LKNA 2MCPH 4XNZB 4PY7A 1EJ6A 3MRHA 1Q72L 1CLCA 4UQ2A 3U4BH 4XNUH 2C1OB 4NC0B 2YD9A 3U9PH 2FH6A 2AEQH 1NCCH 4M8QB 4X7DC 2A6JA 4PB9H 2X4SA 1YNLL 4K7PL 5L2KA 3RWIA 3BKYL 1EO8L 1ORQB 2DWEB 3EZ8A 5I0ZA 1UFUA 5I66B 4J3SA 4KK6C 4JJ5A 2C1PA 4M5ZL 1DVFD 1GGCH 4UV4L 3GMOB 4KKBD 1TJGL 4GXVL 4JFED 3RNQA 1KLUA 1KNOA 4FXKB 3T4AB 3G5ZA 2PYEB 4DKFH 3P40A 3VWKB 3BP4B 1A14L 1RZIA 5DK3A 3NZ8B 2H41A 1T22A 3P2TA 1FNSH 1F97A 4FP8H 1KEML 3D18B 1LE5B 1DQLH 5BRZB 1LEKB 3P4LA 4JG0L 4NQVB 1T0PB 5BW7C 1BFVL 3QJHB 1E4XI 1BBDL 2CXKA 4WUUD 3ZKSD 1RJZA 4NCC2 1HIML 2ZKHL 1NC2B 4OCWL 3KPQA 4X6DE 2P5EA 4CW1A 3BO8A 4HMDA 5E2TL 1KCVL 4LLMB 2Y7QA 5MP6H 1FL5B 4N0UE 3TC9A 2EEDA 4ZFOB 4I0KA 1RHHA 3S4SA 4P2OD 4C57C 4PLOB 3AC0A 4ZO9A 4V1DB 2I5YL 3RGVA 5HI4C 3V4UH 2HFEB 2H32B 5BS0B 1NJ9A 1JPSL 4DVRL 1Q9WB 4XZUA 5E70A 1RIUL 4OFDA 5EOCH 1K9TA 2YXFA 3LB6C 4K8RD 3SDDA 1UEYA 2EXWC 1W0VB 5D8JL 2K9UA 3ARGB 3T0EE 1U3YA 3UTSB 4F80A 4QT5A 3TIDA 5IMOA 5JOFB 1EUTA 5DD5L 1I85C 3KPNA 2VB5A 4U05A 1OAXL 3QCUH 4U6YB 2NY4C 1XR8A 3LRGA 4H25A 5FM5O 3MPCA 4HZAA 1QVOB 5EZJA 4MJ4A 3E3QC 1I1FB 1Q0YH 4YAQA 3SE4A 2OI9B 1DL7H 3EDKA 4ESKA 1I8MA 1NLDL 1XMWA 4WW1A 4KROB 3QXDA 3FOMB 4O02H 2BXZA 1AGDA 3V0AC 2EZ0D 1LP9E 2R39A 3ARDC 3KYKL 2Z9TA 4XP6L 1A8JH 1BQLL 5CD3B 1CFQB 1DVFA 2XOTA 2Z31C 4KMTH 2GTZA 1NCBL 1FYTD 4JFEA 4J3XA 2XN9A 1G7LB 1PZUB 3HKFA 2VDLH 3V0WH 3B2UD 3G6DH 4KJYB 4AQOA 3HE6C 3P3YA 4JFQB 4NJAL 4OZGA 1MJJB 3DRTA 4NQTA 4PJ8A 4MA3B 5CJ5A 2V5MA 1G9EA 1MFDL 4K3JH 1OT2A 2BNQE 1IM3A 4L8SB 4N8CL 3QAZB 5IHZA 1DP0A 3CD4A 1G7PA 4Y88A 5K9OB 4NQCE 4YBLC 4MXQC 2YBRA 4YK4C 3KPRB 5L0QC 5T1LD 3PWVB 1R3LA 4PREB 1G7IB 3NCJL 1AE6L 1OD9A 4RMQA 5K9QI 3GSVA 4HBCL 3G08A 1ZOXA 1LEGB 4P99A 3PUCA 4JN1L 5LAXA 2PYFA 2P49B 3Q5OA 4LCWE 5IVXE 2V9QA 1CFBA 4CL7A 1BD2D 3QHZL 1Q9LB 5FYLD 1S3KH 1CL7L 1YYLH 5HY9B 1KYOJ 5C0FA 1N59B 5D5MA 4X9HA 4P9ML 4YBQC 2AK4B 1FVDA 4NC2B 3VXOB 4PJCA 3UROR 4LLWA 1RFDH 5GGUB 1ZHKB 5F89A 4M03A 4M4RA 4QXTB 1Z0NA 4XNXH 2FX9L 4I3GA 4F7PA 3BZ4B 3O4LE 4GAGL 4U1KA 5EFIA 3JUZA 3F12A 1CE6A 2GAZB 4YHIA 3WXVH 4BQCA 4L3EE 4TSBL 2C4XA 2UYLA 3BX7C 5DHVH 4HHAA 4APQC 2KQMA 3BPOC 3NPSC 3WD5L 3W9EB 2DOCA 2R69L 4X7EC 3K2MC 1LD9A 1FYTA 4TUOA 5E08L 3KJ4C 1DTUA 3NFNA 3MRBA 1KPRA 2IEPA 3CFCH 2UZYB 2P8LB 3BI9X 3ARQA 2VDPL 1MCOH 2LVEA 3QDMD 3C6LC 5DHVB 4P46D 4X5LA 3S97C 5CEZD 3QQ9D 2B39A 5E6IA 4YHOH 2G75A 2D7TL 1BEYH 3ZL4H 3HE7B 1I7UA 5JW4Q 3WNNA 3MFFA 3LKPA 3B3IA 3RTQB 1D3CA 1TCRB 1UZ6E 3WJLC 3U46A 5T1LA 1MRDL 3W11C 2XYCA 3PGCA 4K23L 3W39B 3CDYA 4M7LH 2BK8A 3IGAB 2VLJD 4N9GA 4OGAC 4LSUL 4OLVH 3QG6A 3MRPB 2PTTA 3CFIC 1I1AC 1P6FA 5KZCD 3QCTH 3SOBH 5KSAC 1JNJA 3Q0HA 4IOIA 1TVHA 5F3BB 3PWUA 1NC4B 1HSAB 2WINA 5FKAA 1JGEB 1BJ1J 3MBXL 5HPMB 3DO7A 5BZWB 3OKDB 3WO4C 3UTQB 4X9GA 3TPUA 3HZVA 1CXHA 1P84K 5GGRY 2F5BL 3JV6A 3QEQE 1AR2A 4JKWA 2YKLL 3ZKMC 4TVPL 1LEIB 3SDCC 5TQ2H 3OAZK 1CLOH 3FB5A 4B53A 4BUGA 4L9LA 4PJ7A 4DZ8A 1FZJB 3MA9H 1DE4A 1U92A 3Q1SH 1A6ZB 3SKOA 4JRYD 4IRSD 1MCDA 4OLWL 1JN6B 3TO4D 1NEZA 3GSRA 2BHZA 4LLUA 2ERJB 3SJVD 1CT8B 3RP1A 4BZ2H 4DGYH 1MSPA 3LQAH 4CU7A 4FZEL 4RQQA 3AROA 1N7MH 3W9DB 2EYTA 1D5BA 4DN4H 1QSEE 3QDMA 1YY9C 1VADA 1KTLA 3ZE0E 1CYGA 1FNAA 3WFCH 3GSOB 1IGJA 5GQBA 1OD7A 5IMLB 2OK0L 5BMFH 4OD2A 4NSKA 1IARB 4BFIA 4MJ5B 3VFVA 3G6JB 2WBWB 2AV1A 1OTTC 1QLFA 3SE3A 3MQIA 1VA9A 2BVUA 2ATPA 3HC3H 2WP3T 1PKQB 3MV8D 4BSWB 4OV6F 2HKHL 4PRAB 4L8CA 5DK2A 4IOSD 4K9EL 2VO5A 1CVSC 1FE8L 3M1BB 3NIGF 3JVGA 3OB8A 2IAMB 4NC1C 4HMEA 4NO0D 1YEDA 4F7EA 3DXAD 4D9RE 1T03L 4FFWC 3NFPA 4NHUB 3F7VB 1RZ8A 2R9HC 4IIQC 4KJWD 4KV5E 3DX7A 1T2QL 1HYRC 3PV7A 5GGTH 4MQ7B 1B0RA 3BKMH 5FYJE 4R90H 5KSBE 1U8IA 3PHQA 3U6RB 5E2VH 4Z78A 5ACMA 2WQ8A 3BJ91 3F7PC 1A1MA 5ESVA 2R2EB 4EEEA 5JOPD 1UA6L 2ARJA 1FLRL 2NZIA 4JFDB 1UB5A 1F8TH 3VGAB 1YUHB 2VZVA 4QXUL 4BQ8A 4IRSA 3NAAL 4QHMB 3TO4A 1NL0H 4DKEL 1FGVL 1NBYB 3L7FB 3BP7A 2IPTL 5KSUB 2JJSC 4JZOB 4Q7DA 3L95A 4N1EA 1BPVA 1FLTX 2IALA 4UT6L 5K9QG 2BSRA 5IQ7L 2D7QA 4JFPB 2YD6A 4PJEF 4I9WE 3L3IB 5EPMA 4BK5A 2X1XR 4XP1L 1V05A 4EI5D 1G7MA 4NQXA 1KBGH 3HNTL 4UT7H 3H7BA 2DI8A 5HHMB 1J11A 4MD0A 3P73A 4OLUH 3MV8A 5J3HC 3RWHA 3L3OB 2EIZB 5D71H 5ICYA 4OQTA 1RURH 2ADGA 2BFVH 4OKVB 4ZS7H 5ISZD 4XCFL 4X83A 5HHQA 1TQBC 4J4PD 2YPLD 4LSDA 3T0EC 1NUDA 4NO0A 3DXAA 2EH7L 3UCRA 4GT7A 2WQRA 3GJFA 3QXUA 4NFBA 2Q76A 3GIZL 3KLSA 4LNRB 1FVEA 1CBVH 5I8OL 1SY6A 3V4PL 3ZHLA 4FZ8H 3S96B 4K55A 1OP5K 3WUWG 4HT1L 5D1QD 1I3GL 2JCCF 3RY5A 1EJOH 1CFSB 3DX6A 4G9FE 3KYOA 2H9GB 3R8QA 2EC8A 4FQCL 4QRSA 2FHBA 5DYOA 1T6WA 1GPOH 5J11B 3OTTA 1NAML 4M43H 4S1DD 5EUOE 4K3DH 4XPBH 1FGNL 2FJFB 3H9YA 3IJYB 4LIQE 1IGCH 4JGJA 3PWNA 1KB5H 1AO7B 1I8LC 3D1MC 4TULL 3ABZA 1MCKA 3BDXA 1X5ZA 4OB5L 5JW3L 4Y8AA 3EGSB 5GHWH 1IC7L 3K4AA 1KB9K 1RZGB 2NY0B 5D7KD 3TJHD 4RGNE 4G6JL 2Z93A 3L1OH 2W0KA 3HMWH 5FKPA 4E41E 3QNYA 1QKZH 2BVPA 3MNWA 1KB5B 1PQZA 4FFVC 4YEEA 2LTQC 3U9UB 1XIWD 1HOCA 4ZQKB 1XF3B 4MDJA 5IVZA 4LSTL 5I1LB 3ULUD 4Z7OE 2X40A 3BRDA 5BS0D 1KCRL 1TITA 9CGTA 2Z8VC 5DJDB 3MRHB 3E6HA 1JPST 4J3VA 2LU7A 1AQDA 4EBQH 2YPLA 1MLBB 4MVBC 3PP3H 4WFGE 2OS7A 5FO7A 2X4SB 3SGKC 3U0TB 5L2KB 4CDGC 1AY1H 2X70A 3JV4A 4QTHB 3X3FL 5F9JB 2FGWH 5IROC 2KZWA 3IAQA 4MS8D 4HPYH 1B3JA 2IADB 3RNQB 1YPZF 3TFKD 3GMMA 3G5ZB 4HJGA 3TNNA 1IKFH 2ZNWA 1N64H 1B9ZA 3R1GL 4OZ4A 5D1ZC 4NJ9H 1T22B 1TVDA 5D1QA 5JHDE 1PYWA 2G2RA 1FQ9C 5SX5K 3FONA 1S5HB 2VDKH 4HGWB 2Q7YA 4KKLC 2NY6B 3VFGL 2VLKA 2Y4SA 4W4NA 1SYVA 4FQ1H 4PJBE 1D6EB 2VZ3A 2XQYG 1DR9A 1I9JH 4RMUA 1FPTH 5E8NB 2X10A 5CZVH 1A22B 3BVNA 3ZDXF 2Y7QB 5F6IC 4MGXA 1JNLH 3T3ME 4HMCA 4UUJA 1FDLH 1RHHB 1VESA 1JZ2A 1WQVT 3D2UB 3RGVB 4U7MA 1JF1A 4MNQD 4OFVA 4RRPG 4RSVA 3EJYD 4XZUB 4PR5A 4X8JA 3WHE0 1YEEH 2A73A 2FIRT 2OSLA 4Z7WE 3SDDB 2CSPA 2R1XB 3MNZA 4MAUH 3L5HA 4GS7B 2A0LD 4LGSB 3D0VB 4MJIE 5EZOH 3Q3GB 1KCSH 1YNKL 1E28B 1M05B 1KFAH 4S1RH 1J0KA 2ITCB 3TIDB 3FKUS 1XIWA 3PXHA 3PP4L 1R5VA 1SBSH 1A9EA 1S7WA 2IQAB 3SGJC 3RUGA 4H0IA 3ULVF 4PIRF 3JWDH 1XR8B 2X4NA 3K4DA 3PXJA 1U93B 4QO1A 5DUBA 5HYIA 1BZ9B 3HCVB 2KZ1B 4X8XA 5EOTB 3VWJC 1FVCA 4YAQB 1X5HA 4KUZH 3TT3H 4R0LA 1BZQK 3QXDB 5D70H 5H37H 2E5EA 1J88A 1AGDB 4NZTH 5I75C 1RUKH 3CVHB 1XGUB 4S1SL 3TVMB 1OVZA 3I02A 3QCVL 4YUEL 4G6KH 2XN9B 3LPFA 5IJVA 1E0OB 4LGRB 1HHHA 5FYKE 3KLHD 1U41A 1KIRB 2VR9A 1QEWA 1CWVA 3ARFD 5DJAB 3VXPA 4HFWA 3BHBB 1LO3H 1T1XA 1H3TA 1QNZH 3PL6D 4PJ8B 3KPPA 3T08A 4ODTL 1P5VA 2ZSVA 4MNHA 2X2YA 3NIDF 4K8RH 5TH2A 4FQ2H 3O41A 2AGJH 4RBPH 2PW1A 2EIDA 3OX8A 2N4IA 1ZSDB 3GKWH 3V5DA 1DQDH 1R3KB 4XMPH 1G7JA 1A64A 1I1YA 2GJ6D 1CK0H 2H2SD 1M7DB 1P4BL 1OT1A 3TCXA 2L7UA 5I1GL 5DJXA 4HLZG 2CDEA 2BRQA 3DLQR 5LGKA 3IJHB 5DMKB 2FRGP 4MNQA 1MIML 4EDWH 4DK3A 2CGRH 2VDQL 4LSPH 4Y2DC 4KC3B 4QRRB 2PCPB 4NKOA 4PG9A 3QEHA 4PJAF 1HKLL 2Y07L 5C3LD 3REVB 4H1LG 5D5MB 5FHBL 2HKFH 1VFUA 2CRIA 3FFCA 4K3EL 3LN5B 3NCCB 3VGGA 1QHPA 4LLWB 1G9MH 3Q5TA 3ZSSA 2NX5B 1DANU 1OAKH 1R3IL 4PJGE 1AD9A 3LS5L 4WU7A 3ZDZF 4F7PB 4IS6B 3PGDB 4WCYH 3P0GB 5INDB 2YD8A 3TBVB 4UDUB 1NMBL 1W0WA 3QUKA 3O3UN 1U3HA 2FO4A 4PJDA 2OL3H 4HHAB 4UAOC 1AC0A 2HA1A 2OXGA 2VDNH 4KKNA 5EORL 4IBLT 1JYXA 5CEYB 3HMXA 1CD1A 1YECL 2HT4D 2W65A 4I0PD 4S2SA 2Y36H 1KPRB 2YMXH 4C56D 3C2AH 4LRIA 3ARFA 4O4YL 4N0RA 4KI5E 5BO1H 2XRAL 2OL3B 3KJ6L 4LCIH 2ZCHH 1IVLA 4FQLH 5E6IB 2B20A 5FOJA 2G75B 2NY1B 4KKAD 3LKQB 4BUHA 4Y7MA 3ISWA 2ATKA 1UM6H 4HJ0D 1IEAA 3GMQB 5FYLH 5E99H 1EGJA 4N0CC 3B3IB 1CQYA 3U46B 2R0LH 3ROLA 4ZXBC 3E0GA 4P49A 2GJ6A 3JZ7A 2B8OT 1NDMA 4JFXA 5HHOA 3HLAB 4JQXC 2BXYA 4NM8L 2AJSL 1LK2A 1BHGA 5J89A 2HJFA 2J8UF 3L5JA 1TVHB 4X6CA 3ZTJG 32C2A 3PWUB 5MEPA 3EOTH 4NPYA 4OKDA 4NN5B 4PGCA 4KK6D 1K2DA 3DO7B 3C8KB 4KPHL 4J1UA 4XAWL 1FFOB 4JHZA 2AJYH 1TVBB 3HZVB 3A67L 1QO3B 2FJHA 3KPOB 3JV6B 5CUSH 4UB0H 4M1CC 2VXVL 5KS9A 1U8MB 3OXSB 3BOVA 5CJ8A 3KDMA 2OMNA 4DN3L 4PJ7B 4DZ8B 4Y4HD 1RIVH 2A38A 2CO6B 1KN2L 5CMAA 5B39A 5GGVL 1CR9L 3LN4B 2BOBB 4QTIH 4QY8B 4PJIA 1LNUA 4WTZG 3ULVL 1CDYA 1IAOB 2AVGA 3MV9A 3BJLA 2PNDA 1NEZB 2VDMH 4I0PA 4P4RA 3RDTC 4H26A 4LLUB 3ILPB 4XVJL 5L2JA 3H0TB 4Z7QF 2EIBA 1O7VA 5KN5A 5KVMC 4NP4H 4OUOA 1MRCH 2C3WA 1P7QA 2EYTB 5HI4D 3U83A 3FB6A 1S78C 3MJ8A 1VADB 4X6BA 3VFOA 1IGJB 3DUUA 5F44A 1DQQA 4LDOB 2ZOLA 3BT2L 4OD2B 4BFIB 5B8CB 2EXWD 4UTAL 4AH2A 1QLFB 4ELMF 4ZFZA 1RZFH 1K4DB 1H3PL 1JIBA 1P4IL 5ALCH 8CGTA 4WDIB 3DUSA 4GFTB 4Y8DC 4QRQB 4NNYB 1FNHA 4HUMB 4MYWB 4P3DA 3PQYA 5I76B 4L8CB 1F11A 5DK2B 4RGNC 2J2ZA 1FZMA 2R2HA 5T3XD 2ARWA 3K2UH 2ZPKH 2EE9A 1QRKA 3PWJA 1E4WL 4U1IB 4F7EB 2OR8A 3CK0L 5GS1C 4GW5B 3NFPB 2XKNA 4JM2F 4HS8L 1FAIL 4JRXE 3N1PC 3DX7B 1WICA 3FT3A 2Z31D 3SDYL 2PR4L 2R4SL 1NLBL 2V2WA 1RK1B 3SO5A 3N9GL 2LAAA 4AL8L 1MCLA 3KLAB 3TH2T 1U8IB 1H5BB 4Z78B 3HE6D 1BQHB 4JG1L 5F70A 1A1MB 2AJVH 3MSPA 4Z0XB 1ACYL 1L6ZA 3DHMA 2RCSH 1UCBL 5BW7A 3UJJL 1EUUA 2ARJB 2HTLD 3L7EA 3GI8L 2WP3O 1YYMH 4BZYA 1A6VH 4YXKH 5IMMA 4MXQD 4RIRB 1MAMH 5DJ2B 3TBTA 1N5AB 2HFTA 3ZYJA 1AGFA 3BP7B 5L7XL 1MCPL 1OPGH 1H8NA 5HYJD 4G43A 3L95B 4KTDH 3QUXB 1I9RL 2W91A 4P9HC 1WFOA 2J6EA 5DD1L 2AI0H 4OZFG 3ULSB 5GZND 2UZIL 4CNIA 4OQTH 1NBVL 4QNPF 4XP9H 5L9DL 1YQVL 1DUZB 3PWPB 3KNBB 1S7UA 3QG7H 2X9YA 5DWUH 1KJ2L 2A1WH 2NY3D 2FIKA 5C8JB 3K0WA 1G7MB 4R4NC 3H7BB 4M3KB 3U4EA 4TUKL 3GJFH 4YBQD 5HGHB 3HRZA 4LMQE 4WO4D 3NCYP 1I85A 5ITBH 1IGIH 2XZQL 3ZT5A 5C09A 4AEEA 2P48B 1SY6H 1ZVSB 15C8H 2XZCH 1XGTB 1UYWH 4XWOC 4O5LL 5HHQB 3WFDL 3V5KA 3PGFL 1QPPA 4Q0XL 3D3VE 4RWHA 4APQD 1GYAA 3S3JA 3GSNA 2AEPH 1ZLSL 5IEHA 1CGUA 1O5DT 5IQ9A 3ARDA 3GJFB 4M6OH 3BZFA 3FCTA 1F3RB 3MRGA 3O81A 3E8UH 2Z31A 4AMKL 2MFNA 1VFAB 5IW3A 5ICZA 1D5ZB 1KLFA 5A16A 5EO0A 4JZNB 1EO5A 2CLZB 2DQTL 2OZ4L 4Y2OA 4BQBA 3HE6A 4OJFH 4UBDC 4NUGH 2DLFH 2Z91A 1OTSC 3C60C 3GMLA 2OCFD 3F58L 4X99A 5FO9B 2FNBA 5BV7H 3WIIL 4QRSB 1BAFL 1P9MC 5JA9A 5C0DA 1EEZA 2F5AL 5DD6B 2NY7H 4LOUC 3BPLB 4G3YH 3RX5A 4LLQA 3VI4E 2CIKA 4LHUA 4GRWE 1HSBA 5GZOC 1PG7L 1PX3A 3W11D 4HFUL 4WVRA 4F57H 3GFUA 5HYJA 4OGAD 1TLKA 1W0YT 1U2HA 4OLZH 1MVUA 5EZIH 1I1AD 4X7SL 3ARPA 3FO0H 1A3LH 5D9SA 5C08B 2JJWA 5DQ9A 3MLYH 3U2SA 5KSAD 3C9NB 4Y5XB 4FNLH 3BW9B 4HXAL 3GUTA 1G9NH 4YQXH 3MLVL 1NGYA 4PGJA 2Z93B 1LDPH 3TN0C 4DQOL 2GSIA 4R4BA 4UOJA 5I1AB 3I6LD 5FKPB 3QNYB 1VGEL 1EBAA 3IDMA 1FORL 3DBXA 3V0VB 2QL1A 4MWFA 3QH3A 5C0CB 1Q9KA 4PJFA 1FO0L 2XY1A 4OIAA 1A6PA 2HLFC 3WSQH 5IFJB 3NZHH 2DI9A 3ZKMD 4YDIH 4ZD3H 3E6HB 5F7DA 5EB9A 3QPXH 1WZ1H 1AQDB 4KI1A 4BJLA 3BIKB 2F58L 4KRPB 4APQA 3JV4B 1YY8B 6CGTA 3FOLB 1IZJA 4C59B 4MA7H 4G6AC 3AU1A 1ZEAH 2X4OA 2P45B 5J6GB 4P2RB 3PDOA 1XF4A 1EDQA 2VXTL 1AGBA 1J8HE 2C3GA 3TNNB 5FA4A 4QHKJ 2D31B 4GAYA 4AEIH 5GGSB 2WV3A 5T5FH 2CKBL 3C6LA 4AEHL 1YDPB 2H26A 3CZFA 3EO0A 3HG1B 4HV8A 4X80L 4XAKE 5F3HA 2VLKB 2YPVH 2YHGA 2VN7A 3JBG7 4DOHE 1S9VA 4LPXA 2ZUUA 5DQDL 4C54A 3OKMA 4FTVE 4ZPTA 1OTTD 3SE9L 4WNQB 2R0KL 2FLBT 5LGJB 4OF3A 1HH6B 3KYMB 1CXFA 4JKPL 3ULUF 4OLXH 5E8EB 2O5YH 3UYRL 3WJLA 3BVNB 3TBYB 2A9ML 4KI5C 4U1GB 2UV3A 4F7MA 3MXWH 3MCLH 4HWBA 2V5SA 2HWZL 1I1AA 3BPNB 5E8OA 1J1OH 4FQQA 3RWEA 4R7DA 3V79C 1TZGL 5JQHC 4QOKB 5KSAA 4PR5B 1HWHB 1HQRB 3GBML 3LQZB 3Q6FB 3MUHL 2OSLB 1KJ3H 2APFA 1T20A 1JNNH 3MNZB 4HS6B 5D2LA 4PP1C 2R9HD 3RHWF 5TJWK 3LMJL 3ZYZA 5JO5A 2W0LA 5JLZA 1QRNE 2VH5H 1H3WM 4NWTL 3GHBH 5JDSA 1RIHL 4TQEH 3I3BA 1A2YA 1MREH 3KPSB 4YHKL 1ZLWK 1Y6KR 1S7WB 3T0DA 1WBZA 2X4UA 2X4NB 5DJYA 1KPVA 1T04B 3PWLB 2B1HH 4K2UL 3SDCA 5IB2A 5C0NC 1FVCB 1MUJA 4LHQB 3B9DA 5DMYA 3BKCL 3NGBB 4HC1A 1F6FB 2X1QA 5E8DH 1K8DA 4H20H 4CMHB 4OCYH 1MCRA 1OW0C 1F4HA 5TE6H 4LP4A 1N3NA 2YRZA 2EH8H 3X3GL 4EN3C 1HHHB 3P4MA 5CKGA 2ICWJ 2SEBA 1QEWB 5H2BA 3VXPB 2NW3B 4HFWB 4LCYB 5HHVH 4RMVA 3NA9H 4BA8A 4UQ3B 5L6YH 3TYGL 2GTWB 1HHKB 3N85L 1OF2A 2B5IC 4GG6A 5C9KA 5E7FA 2OTUA 4MNHB 3MLSH 3RGHA 4PRIE 5D4QA 4Z18A 5TH2B 3WHXA 2Q1EA 4XH2B 1AKJD 1K8IB 3PJSB 1HINH 2DQDL 1G7HB 4LNVA 4N8VA 3F5WB 3V5DB 1I1YB 4I2XE 3HR5B 1D5MB 4HAFA 3IFLH 5HGDA 1J0IA 4W81A 7FABL 1BM3L 1EVTC 4GMSH 1A7PL 1JV5B 4NKOB 3T0ED 1I7TA 3MR9B 1BFOB 5GRYA 4WHTA 4P23C 4UTBL 1MFCH 1S5IH 3FFCB 3OF6D 2XTJE 3H9SD 2DQEH 1NCDH 3BXNA 5ACLA 1MH5A 3HMXH 2F74A 1CI5A 3QXWA 1ND0A 2UUDK 3O6MH 4Q6IC 2CK2A 3ZKNC 3GRWA 5EU4A 1MCSA 2E9BA 1ONQA 3QXVA 4J3OC 5DSCA 3B5HA 2BSED 4NKDA 4OUUA 4PGBA 2ZCLH 4WV1C 4L4VD 1U3HB 4ODBD 5GJSL 4MAYD 4PJDB 1B6UA 5E24E 4K94C 4OBSA 3OKEA 3Q48A 4IDJL 4P59L 4WJ5B 3GJEA 3MRJB 4OLEA 5I2IA 1CD1B 5ESAA 2W65B 2D0FA 3N1GC 1EGJH 3K8KA 1WZKA 2EE2A 2DLIA 1ZHLB 2JJSA 5H35B 3MYJB 1DFBH 1H3UA 5HI3C 1QLEH 2MCPL 5TFSH 5D7SH 2BNQD 1RZKC 1I8IA 3U4BL 1ZV5A 4XNUL 3RL1A 1GGIH 1CFTA 3U9PL 2AEQL 1ZGLA 2HTKC 2P8PA 4PB9L 4Y1AE 3KPMA 3SY0B 3H2WA 1MI5B 1ZANH 4X6DA 1U8NA 3WUZA 1AKJA 2BC4B 1WJ3A 1GGCL 1EHAA 1MFEH 2VLRE 5ID0A 4UT9H 4NQUA 4DKFL 3PNWA 4XMLH 3C08H 3WN5B 5HGAA 2IH3A 1NDMB 5SWZE 4JFXB 3VFUA 5HHOB 1MAJA 4JAMB 1FNSL 1YEIH 1Y18A 4ZFOL 4FP8L 4G6FD 1S9XA 1DQLL 3BKJH 2VL4A 3E2HB 1FIGH 1RUAH 5EUKB 3QFJB 1Y6NR 5E7BA 5MEPB 3ZE2F 4MVBD 3T0EA 4NPYB 3BPCB 1A7OH 2O5XH 4PGCB 5I74B 1QFHA 4EJ1C 3K7UA 4JZJC 2ZJSH 4QRUA 4E0RA 4WI9A 1DBKH 4IEFB 3FHQA 5MP6L 3RZWA 2FJHB 3O4LD 3S8WA 2QHLA 1EEYA 4L3ED 3FQNB 5BXFA 4U1HA 3V4UL 4LCCC 1DBAL 1WAAF 5I73B 4PJ5B 2BVQA 5EOCL 1LP9A 2RJMA 2Y5TB 2B7DT 5CMAB 5B39B 1L9MA 1A9BA 2A2QT 3MRNA 4ERSH 2BVEA 5IB5A 3IU4H 4XCEB 1LNUB 3G9VA 3U82B 3MV9B 2DQFA 4BQ6A 4H26B 3AMLA 2C7UA 3FJTA 5I9QC 1I8LA 3QDJE 2QKIB 5IFAH 4GAJH 4PLNC 4F7CA 5KN5B 3QCUL 3NIGE 3KR3H 3G6JF 1P7QB 2BNQA 5ILTH 1MCQA 4LVNB 4X0KA 3QFDA 4FQXC 4P3WA 1GJIA 1Q0YL 3BZEA 3MV7E 1DL7L 1NANI 1KYOK 1WSST 1DQQB 1P69B 5ACZA 4NQCA 4HUWA 5EO9B 2HFFB 4AH2B 2H1PH 2NY2D 1CF8H 4KMTL 5F9OH 3OXRB 2VLLA 1UWEH 5CHNA 5DO2C 2VDLL 3RVUC 3DUSB 3V0WL 5F9WB 3X12A 1F58H 3G6DL 4M7KH 3WFHA 4LDLB 1SJHA 3PQYB 4CVZA 2DJ4A 3VRIB 3H42H 4GRLC 2W9DH 4LCWA 5IVXA 4PGEA 4AIOA 5I1IH 1RVFH 3VWJD 4LHJB 2EDOA 2VR5A 4CN4A 3SGKA 3P77A 3PWJB 4GKOA 3RZCC 2XKNB 2UY6A 4NZDA 5IROA 2A77H 4WW2B 5I1EH 5JHLL 4FABH 2V2WB 3QEQD 5I1DB 5DRXB 4X5XA 2B1AL 5D1ZA 1NCTA 3O4LA 2DLGA 5EC2A 1SYSB 1F45A 3UPCA 3CNKA 4L3EA 2K7QA 4PJEE 2J6EH 4M9PA 2ICES 1C16B 3V6OE 1T5XA 4M62H 3BEWA 1WIUA 1XCTA 1S3KL 1BQSA 2P24B 1YYLL 4OCNC 5C0BB 1F90H 2D7PA 3C8HA 1FSKC 3TBTB 5C0EB 1RFDL 1E4JA 4G43B 4L8DB 4NM4L 4NCDA 1QSED 4XNXL 5DC0A 2P47B 1A1OA 1EFXB 4QWWC 1OAZH 5DRNB 3WFEH 4CNIB 1IAIH 3WXVL 3I84A 2B0SL 4OIIH 4XPTH 4TSAH 4Y2DD 1W72L 1D9KC 5F1IB 4PLKC 1U58A 3RPIA 4LSRH 3EO1A 2BMKB 1HYSC 5DVMA 4CDHA 3GSNH 3U4EB 2EYRA 3WHE1 1NGQH 5AD0A 2JCCE 3CFCL 4WFEE 5C09B 2X4PA 2YA2A 2VZOA 1VSCA 2XACC 4YGVA 3BWAA 3SGJA 2NY4B 3HNSH 2BCKA 4MNGE 1KCLA 1A14H 5D7JD 3VWJA 1F4WH 5IP4A 4YHOL 1FV1A 3ARBB 1BEYL 3ZL4L 2LU4A 3DOSA 3GSNB 4XTRD 3RBGA 1JGUH 5IEHB 4F37K 2F54E 4JY5H 4XHJC 1CIDA 5SV4A 4MB4A 3BZFB 5BZDA 4NO5B 3MRGB 3QDGD 3MUZ1 4PRHE 4JFFD 2BNRE 5K33A 4G8GE 3QEQA 1UH4A 2Q3ZA 1JNHB 4M7LL 4NQDE 5A16B 5EO0B 1FFRA 5TDNA 3M45A 4OLVL 4PJ9D 5EWIL 1OAUH 3K1DA 3QCTL 3SOBL 3WJJC 3B9AA 5E2TH 4AG4H 5FCUH 3GMLB 2XA3A 3C87A 1JZ4A 4X99B 2FD6H 3D48R 3BYTA 4X4XA 3T4YA 1R3HA 3CFJA 4RX4D 1J86A 3OKKB 3MMEA 4YBLB 2J5LC 4N0CD 4LLQB 1RIUH 4LHUB 4YK4B 3T8XA 3I2CH 3W0WE 5L0QB 4HULB 4MXWH 4XCYA 4ZXBD 2YD7A 4NOBA 2YRPA 4HIIB 4KK8D 4XCNA 1JBJA 1QSEA 3QEUA 5D9SB 2CDFA 5TQ2L 5FGSA 1EX0A 3GUTB 5KSVA 1OAXH 1CXLA 4Y2DA 5DEGA 5DHXB 1NGYB 3MA9L 4X9FA 4WI4A 2HAZA 4RGMC 2GSIB 3VH8B 1X6NA 4R4BB 3C09B 4NN6C 5A2JH 4NCC1 1YPZE 5FGRA 3MUGB 2MTPA 5CSGA 3DBXB 2HJKA 2KKQA 5LQBH 4D9QE 5EBGA 1UJ3C 5JW5A 1BVZA 1RU9H 2PO6D 4BZ2L 3QH3B 3LQAL 4MXVF 1T7XA 5E8PB 1KC5H 3VGEA 5GS0D 4M1CD 5DUMH 1N7ML 3CFBA 5EBMA 3L3DB 1DLFL 1P4LB 5GRJH 4DN4L 1KEGH 1QSFE 2P7TB 2OMBA 5DC9B 3WFCL 5IB1A 1Q9OA 5TQ0H 5BMFL 5DXWA 4POZC 2XTJC 1DBBH 4LBEB 2X4OB 3HC3L 3HI1B 3QDGA 5E0QA 5EULV 3BQUC 2AQ2A 4PJXB 1JRHH 3KJ4B 5KSBA 4W6YB 3PHOB 5FA4B 3CXHJ 1HQ4A 4GAYB 5I19L 4ZYKB 5BVPH 3FO2A 4HWBH 1S78D 3C6LB 4HKXA 2XKSA 3CZFB 3S4SG 3STZB 1HKFA 4DGIH 2NTFA 1OSZA 2FWOA 3BISA 5FEBA