1L9TA

Crystal structure of the i257v variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLVGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA02
3T6XA 1FWXA 1EHKB 2W88A 4A68A 2IDUA 1JVLA 2J5WA 4KO6A 2ZWNA 1A4AA 4WTQA 1HFUA 4YSQA 4ZK8A 2Y1AA 4TXVB 4DP2X 4BK5C 3U25A 4GP4B 2HXAA 4M3HA 1J5CA 3NJGA 4X4KA 1IC0A 2H5UA 2QT6A 3QJRB 3N55A 3CVBA 1WS8A 3WKQA 2FT7A 4DP5X 2VM4A 1PLAA 1KYAA 1MZZA 4QLWA 1PLBA 2EIJB 2VSMB 1SF3A 3NJMA 4DP6X 2FNWA 3PCYA 1JZHA 1BQKA 1GYCA 3H4FA 3IEAA 1CURA 1W8EA 4DP9X 4E9WA 1V54B 3UABA 3JT2A 1GS7A 1JZGA 2IDFA 2HLEB 3FPXA 1W6LA 1PY0A 2GB2A 2GIMA 2VW4A 4QKTA 4HIPA 2PPDA 4KOCA 3UADA 5B3SB 1PZBA 5I5MA 3N2JA 2FJSA 1ETJA 1X9RA 3DKHA 2WSDA 8PAZA 1ET8A 1J9QA 1VLXA 5B7EA 3PXLA 4G7RB 4AI7A 2YAHA 1AZRA 2J55A 4BWTA 2IWEA 3X2QB 3ASNB 1ZDQA 1CYWA 1W6WA 1ASOA 1L9PA 3ABKB 1OV8A 1SNRA 4KNUA 2BZ7A 1SF5A 1PZCA 2GC4C 1ET7A 3SQRA 3NJIA 3UAEA 3QJQB 3T9WA 2PCFA 1L9OA 4DPCX 1KGYE 3GXUB 3SBQA 2JXMA 4RH4A 3PLYA 3CDZA 4ENZA 3FQ1A 5I5IA 1IBYA 2IAAC 2R7EB 4DP0X 2FQGA 1MG2C 2CJ3A 5AFAA 3NT0A 5E9NA 4A2EA 1SJMA 3ABLB 2TSAA 2DWSA 4YSRA 2BP8B 2FQEA 2ZXWB 1NWPA 4N4YB 3NSDA 3WNJA 1NPNA 4M4RB 1J9RA 2HX8A 2IH8A 3CZUB 3PAVA 1TKWA 3V9CA 1FA4A 1JXDA 3BQVA 3FSZA 2BWDA 3ZDWA 1ID2A 1PLCA 5TK2A 1BXAA 2PP8A 1M56B 2A3TA 3ZIYA 1AZCA 4GXFA 4W1TA 1JZEA 1XB8A 2EIMB 4GP5B 3QQXA 1ET5A 4JHVA 1AS6A 3CVDA 2N0MA 3OMIB 1GY1A 4KOBA 4DP7X 2BP0A 2GHZA 2VM3A 4YSDA 1L9QA 2CALA 2CAKA 2YARA 1ZV2A 4YVNA 6PCYA 3BVDB 1DYZA 3H56A 4BDVB 3NSYA 3TBCA 3TA4D 4BXSV 3QJSB 1CUOA 1L9TA 3SBRA 1RCYA 2AFNA 4E9YA 1KDJA 2DWTA 1B3IA 2YAQA 1CC3A 3T71A 4FAAB 2CCWA 3FSAA 3FU7A 4GP8B 1ILUA 1NIDA 1YLBB 4DP8X 1IBZA 2XX1A 1BQRA 4A2GA 2BZCA 4HHGA 3X1BA 2BW4A 3X1GA 1NPJA 2I7OA 2IDQA 3TU6A 3NJLA 1PMYA 4YSPA 3EHBB 3SBPA 1RKRA 3NP3A 2YXWA 4WKXA 2PPAA 4GY4A 1ZIAA 4YVUA 3GDCA 3X1NA 1BXUA 4P5RA 2FWLB 2UXVA 1GR7A 5PAZA 3IN2A 4HALA 1AIZA 2VW7A 3T6ZA 1CYXA 2OJ1A 1OCRB 3UAAA 3PAUA 3KW7A 1E5ZA 4HCFA 1ILSA 3IN0A 2PPCA 2AVFA 3T6WA 1I53A 3CVCA 1JXFA 1RZPA 3X1FA 1AG6A 1WS7A 3JTBA 4G70B 2EILB 4YSEA 1PCSA 3AG2B 1XB6A 4KO7A 3FS9A 2B3IA 3ZBMA 3ABMB 1PF3A 5A7EA 2YAMA 2PPFA 2P80A 4E9VA 3C75A 3UGEA 2FT8A 4YSCA 2ZOOA 2QDWA 4K9JA 1NICA 1NTDA 3NYKA 1WA2X 3FPYA 1JOIA 4HAKA 1MDAA 1MZYA 1ZDSA 2I85A 1AAJA 3KW8A 5B1AB 2QDVA 4CSZA 1A8ZA 1JZFA 1IKOP 5I6LA 3FSVA 4HCIA 4YL4A 4A2HA 4E9QA 1KCBA 4YSSA 5I6NA 3D12B 3TASA 2XVBA 4F2EA 5D4HA 3WKPA 3WI9A 2VN3A 4YSOA 1BYPA 4PCYA 2CBPA 3NJHA 1RZQA 4BWWA 3EF4A 3CG8A 2J56A 3RYMA 1M57B 1R1CA 2WO2B 3S3CB 2QPEB 1NZRA 4UF7C 1KDIA 3AG4B 2PLTA 3CDZB 1XB3A 2QPDB 4KO5A 1FFTB 2GI0A 2GSMB 5EHFA 3NJFA 2VSKB 3GYRA 3ABGA 4GYBA 5LDUA 1GY2A 3FSWA 3OMNB 1OCCB 3FQ2A 3WIAA 2DV6A 1AS8A 2BHFA 2AZUA 1SFDA 3NJKA 1ASQA 4AKOA 2AANA 4BXVA 4E9TA 4UAHA 2IDTA 4BWUA 1AR1B 2YAOA 5I6PA 7PAZA 1M9WA 1AZUA 2BWIA 2EINB 2XV3A 2CUAA 3TBBA 9PCYA 2UXTA 2HRGA 2XV0A 1KV7A 5PCYA 1SDDA 1PZAA 3PAZA 3QJVB 1E65A 3PPSA 1NDTA 1BYOA 3AW5A 2IWKA 2BP8A 3ASOB 2XXGA 2DYRB 3FYIB 3QPKA 3FU8A 1E5YA 2H3XC 2BP0B 2Y69B 5B1BB 3S8GB 1AZNA 5D4JA 1AG0A 4DP1X 1GS6X 1NIFA 4E9RA 3HB3B 4G7QB 3OD3A 3NSFA 2PPEA 1T5KA 4JHUA 1AZBA 3WG7B 1OE3A 1PNCA 1X9UA 3OMAB 1SHWA 4A2DA 5I26A 1A65A 5AZUA 4F7KA 4MFHA 5F7AA 1TEFA 2H47C 3OM3B 1HAUA 3FQYA 1F56A 1OOWA 4DPBX 1OF0A 1PNDA 5AKRA 5D4IA 3QJTB 1UATA 3AG1B 1GW0A 4HZ1A 1SHXA 3EH5B 1WA0X 1ASPA 2P80D 3NJNA 1DZ0A 2B08A 4G72B 2X87A 4DP4X 2TSBA 1JERA 1A4BA 1NIAA 1JZIA 1ZIBA 2XLLA 1N70A 1KBVA 1V10A 3AY2A 1AQ8A 3H4HA 2J57A 4CSPA 2YQBA 2IWFA 2UX7A 2XU9A 4L0PB 5ANHA 2MRYA 1JZJA 2XWZA 1L9RA 1J5DA 1WA1X 1JXGA 2UXGA 4G71B 2YAPA 2JKWA 1OCZB 1HAWA 4UANA 4AKPA 2DYSB 4E9XA 5B1JC 2IH9A 4KNTA 1URIA 3DIVA 2UXFA 1SFHA 1KBWA 2FTAA 4KNSA 2RACA 4Q89A 2PP7A 5TK4A 7PCYA 2ZONA 2BW5A 4EF3A 1AANA 3QJUB 3AZUA 1PAZA 2I7SA 6PAZA 2GBAA 2FT6A 4E9SA 1AOZA 2VMJA 2XX0A 4G7SB 1KCWA 1QLEB 3FYEB 4A2FA 5B1KA 1GS8A 4N8UA 2EIKB 3EH4B 5B7FA 4AZUA 1A3ZA 4YSAA 3L45A 4JKNA 2PCYA 2YAFA 2BO0A 2IDSA 3T6VA 3G5WA 2OCCB 2OV0A 3IBOA 2HX7A 4AX3A 5F7BA 2PP9A 3WNIA 3DTUB 1BXVA 1OE1A 2YXVA 1WAEA 4Q8BA 5FC9A 2XUWA 3EH3B 5I6MA 5I6OA 1J9SA 2XYBA 4NERA 4YSTA 4YSUA 3UACA 1AS7A 3NSCA 3AG3B 2Q5BA 2W8CA 1QHQA 4P5SA 4A66A 4F2FA 1A4CA 1NINA 1EZLA 3V9EA 5I5JA 1OCOB 3HEIB 4W9ZA 5I6KA 1BAWA 2DY2A 2R7EA 5B1JA 1IUZA 2Q9OA 2FQDA 4HHWA 3NJJA 2LLNA 5IY5B 3S3DB 2XXFA 1SDDB 3MBWB 2HRHA 1AACA 1NIEA 5I28A 4HCGA 1E67A 1JVOA 3FT0A 4DPAX 1XMEB 2YAEA 2FQFA 1V55B 1OE2A 1E30A 2X88A 3ERXA 1GSKA 1L9SA 3X1EA 2AZAA 3NP4A 1NIBA 1BQ5A 1NWOA 1ZPUA 4A67A 3FU9A 2WO3B 2UX6A 1TEGA 2HX9A 2GC7C 1BEXA 2NRDA 3IE9A 1ADWA 2JFCA 2VW6A 4FA7B 4PAZA 3S8FB 1TU2A 1MG3C 3FU7B 4NB7A 4KO9A 3ZX1A 1J9TA 2E86A 3OQRA 4AKQA 1QNIA 3S3BB 2MTAA 4BDVA 3MX0B 4NAJA 1N68A 2XV2A 5B7MA 2HZHA
chains in the Genus database with same CATH superfamily
4UMSA 4HC1A 2XTSA 4PJFF 1L5GB 4PJ8D 4BJLA 2BFVH 2ZOLB 2BIQA 2NNAA 3RP1A 2YBGA 4WQOA 1GGUA 2NTSP 4JHBA 2ZWNA 3II3A 3WS6A 2VDKL 2DLIA 5FOBA 1IQWH 2FJUB 3ATEA 4IEFA 3U25A 4M3HA 2XOTA 4DEPC 5AVSB 3ZK0A 4W6WB 1I3RB 4WWKC 4QO1A 2A83B 3I74A 3TBTA 1F3RB 3BUPA 2GCYA 5DJ8B 1C7SA 3N55A 1Y6KR 1IGMH 1RHHA 4OJFL 2OK0L 1PLBA 2AV1A 5EU6E 3A5VA 1SF3A 3PCYA 5TQ2L 5DT1H 4K94L 1NUFA 4EN2A 1GYCA 4D8PB 1JGVH 1M05B 1BD2D 1IEHA 3TYGL 2NY2C 1ZS8B 1EUTA 5D1QE 1GKEA 4GRLA 2YRZA 1G84A 5DS2A 2OCFD 3RFZC 4QRTA 3HZ3A 3QUZA 2Q7NA 1RU9L 1OAYL 2Y22A 4H0LC 3GI8L 5C07D 1KJ2H 3D30A 3DVGB 3V0DA 3L4CA 4Z7IA 1RJYB 5EG6C 4DGYH 2I9TB 2H0PA 2FECL 1DEDA 3VRJA 5E2UH 3D50A 3MVSA 1YYLH 1ZHNA 2CCLA 2NQ3A 4MMXA 4CMHB 3SDXF 3TYFB 4L9DA 1WD9A 4LASH 2IPKA 2CD0A 1PS3A 1NGYA 1S7UA 3D3VA 1YN6B 4PJGF 1O7DE 3DKHA 4IKNA 4Y1SA 5AOZA 2L7EA 2WSDA 5FO7B 4Z7NB 1EBAA 2ADYA 2ZKHL 5E6IC 1UURA 2AQTA 3V4VL 4NN6C 5CIPH 1U8OB 1YZZA 3WIFA 3QHFH 4PD4K 5I1DA 3SDAA 3X2QB 2AJYL 3RJQB 2DQJH 1VDGA 4P4KD 1BOYA 4LLWB 2A6KB 4LQFH 3AM8A 2B0SL 2C3XA 3GNMH 2XA3A 3A6BH 4QGTA 4PP1D 2W91A 4NBZB 1WIUA 1OGTA 5I1CH 1QG3A 1PY4A 2GC4C 4R0LB 3UAEA 1KG0A 4HWNA 5JHDB 4G6MH 1QSFB 3GXUB 4JFOA 5DD0L 3SBQA 3T3PE 1LDSA 4EOWL 1IIKA 4XGZA 2C9SA 2YFNA 1PAMA 5BRZE 1INQB 4H4NA 1EA9C 4TSCL 3IETA 2O5YH 3IJ9A 3V4PL 4PGDA 4P3CH 1E4WH 1U2HA 4ELDA 2UY6B 1FFNA 3OJ2C 1A6WH 4BFEA 3WEAA 2X05A 3B56A 4QXVA 1N10A 1NUGA 4YXHL 1NPNA 3O6ML 2AEPH 3Q43A 1E7UA 1J9RA 1GGCL 1VFOA 3UTTB 4X98B 1LILA 3WMSA 1Y6MR 1MFNA 5LAPA 2NY6B 2R2HA 1QFPA 1GA2A 3H2WA 5KN5A 3VRLE 3SKMA 1GYAA 1J12A 1FC1A 3E6HA 1NLDH 2G4GA 3MJ8B 5J7CC 4F7MB 1WBYA 3SN6N 3NIDB 4QRUA 2WNGA 2EYSB 3BI9X 3I9GH 4G7YL 4U05A 2NXZC 3V0FA 4FMKA 4FFZA 5K1JA 5IQOA 3EJCA 4TVPD 4F8NA 3NEEA 2B15A 4NP4L 4V1DB 1LE9A 1W16A 3KHQA 1I4FA 1BVLA 4NRZB 3K74B 1MCQA 3NSYA 5GGUB 3PWPD 4ALAC 5GZND 3KLAA 1EXUB 4DGWC 1KBBA 3WIIH 4PGEA 5FIEA 2CCWA 3V4UH 3FU7A 3QG6B 4N8VG 3ZT5A 5C2BL 1FAIH 1BQRA 2APBA 4MNHA 1DN2A 2ITDB 1S3KH 4X99B 4KKZA 5ANMB 3ZE2E 1XEDA 4FNTA 3TN0C 4JRWA 2HSIA 3GKWL 4ZMPA 3QAZC 4AV5A 1JP5A 4G9FB 2ZSVB 1QHOA 3ZDZF 4FRWA 4KX7A 5DMGC 2I5YL 5T1LA 1AH1A 2EADA 4OFVA 1GL4B 3S35X 2IV9A 3IFLL 4YVUA 3GDCA 3IDYC 3IFNL 5KTEL 2R69A 5EDXA 5SWSE 1CFQB 1KGJA 2H2PD 1XGQA 2Q2EB 3UBXA 3EBGA 1LO4H 1VZIA 1MDTA 3VCLB 4AQ1C 4YDLB 4J1UA 4FG6D 2XWRA 1RJLB 1O9ZA 1WITA 2FO4B 1MHCB 3PL6B 2RFXA 3CVCA 4MD0A 1ZTXE 1BDYA 5F6HJ 4BK4A 4GRMB 4PYGA 4G70B 4LNRB 2WP3T 2NY0D 2GUYA 2J8UE 3GXMA 3L5IA 3V5HB 3TIEA 2WV3A 3MI6A 3WJLA 1C08A 4BE6A 4B41A 1L6XA 4WRLA 3ML9A 3CK0H 4Z1PA 3FPYA 2ZWSA 5AAWC 4K07A 2D4FA 3PS6A 4Z7VE 1X5IA 1FNHA 4WUUD 3U46A 4HYTB 1X3DA 3IJ8A 4WKZB 3C5ZB 2NLJB 4Y9BA 3BPNB 4YDVA 2IPUG 4LKCB 1RPKA 4MAYB 1W8NA 3BZ5A 1MJ7H 2OMXA 3D12B 1BBDH 4C57C 3MNVA 1H0DA 1MAMH 1SBSH 5D4HA 4B50A 4RGOL 1S8DA 4XNMA 4MMZB 1UYWL 4Q4EA 4NFCA 3QULB 1OHZA 2QELA 1WWCA 4UQAA 1H8NA 4MJIA 4MQ7B 2X7LA 1DBBL 4MCYB 4LHUD 4IBSA 3SDDC 5D6CB 4GBXD 1TQTA 3FQUA 4R7DA 5JXEA 1UD2A 2LTQC 4G5ZL 5DD5H 2BSED 5FYKL 3G5YB 3H3PH 1SFDA 1JXJA 1ORSA 5AZ2H 2XWXA 1MJJB 3TFKC 3ARGB 2FRGP 4FABH 3SCMC 2NX5A 1Q9LA 1YEJH 4NOBA 1DE4B 3HBGA 4RSYA 1MFAH 5C0BB 7PAZA 5K59E 4E0RA 1AZUA 3B2XA 1AKJB 2BS71 3O0RH 3TBBA 1Z32X 1DCEA 2GFBA 2QGCA 3HG3A 2R0ZL 3DJTA 5H37H 4PS4L 5EA0L 3UTSD 1DQVA 3D06A 1PZAA 3FUDA 2WIMA 4YDJB 3QJVB 1ETA1 5J9PB 3TS8A 3R7RA 3R1GH 5KSBF 3MV11 3V6FB 3KLQA 3LPFA 4Z3EA 3JYBA 3W9DA 3U4AA 3ARBA 3Q5TA 2O1AA 2BVOB 3WFCL 3P3TA 4WFEE 1S5HB 3TBYB 3QWOB 1U8PB 3FBKA 1YMME 4GXUN 4F7CB 3VFPB 3GIVB 4Y16D 2W9LA 1KCUH 1HC1A 3CFDB 4TLUA 1AZZC 5E8DL 2F53D 2X9XA 3L5XH 4H20L 1ZEAH 2H32H 4X8JB 3FTXA 3S35L 1WEJL 1NOFA 4WV1B 1KMGA 3ZTEA 1UWEL 5AD0B 3IGAA 4IU3A 1MHPH 1SYVB 3FQYA 3EGSB 5AKRA 1U41A 4KI5F 4LSRL 3CBKB 3RWEA 4CVUA 3QEHA 2KQMA 4E5XG 4Q9QL 4RCAA 1ITCA 5A3ID 4XP6L 3TNNA 3BKMH 3EJYC 1SJHB 1SXBA 2ADIB 2TSBA 4JB9H 1O75A 5F72S 4FLRA 3KLSA 4W9KC 4N2BA 3FFDA 4UU9A 5BMFH 4RRPA 3BGMA 3UGUA 1KBVA 1BVOA 3KBFA 3TZVB 3U1SL 4G8GE 5TFSL 1BG9A 1DN0B 5JA9A 4NGHL 4Y4HC 5EU6D 3OX8B 1AGBB 3T2NL 3U2SA 2BNQE 2P3YA 4N68A 3MRDB 1FORH 2R29H 5AW6B 1ZTXL 5HHMB 1QI5A 4MYPA 4XNQB 3CZKA 3P73B 4X2UA 3EYSL 4LVNB 4WFFE 2ENQA 2UY7A 5CBAB 5IJBC 1XWVA 3E1ZA 3NPSC 2Q76B 1J48A 3V5DA 5D1QD 5IEHB 3F6IA 5DHVA 2QGBA 1ZY9A 3SOBL 5HXMA 3HAEB 1OAJA 2WXHA 3H9SB 3BRDA 4YHIA 4CC4A 1NBYA 3ZTCC 2W81C 4WFGD 5ECGA 4IRZL 3A4FA 3TH3T 4M8QB 1YJDH 1IE4A 4AL8C 1MAKA 2OFQA 4AUJA 4DKTA 4M02A 5LNDA 4IMKA 3OKKA 5I24A 4MSWA 4S0HA 4A2FA 2F1BA 4P49A 5INDB 4DZ8B 3AY4C 4QRRE 4ADGA 3UZEC 4XX5A 3RG1C 4V2BA 5IVXA 3L48A 3IKCA 2VDOH 3N44B 4IHBA 4OM1L 3FU3A 5HI5C 1G4MA 3US1A 2NYYC 4R83A 2PP9A 3CSYB 1OE1A 3BPLC 4LRNH 1WCBB 2B20A 3HB3C 4PHZA 1HJBC 3B1UA 5D7JB 4ELME 3HLAB 1NBVL 2GTQA 4B9GA 4EI5A 3SD2A 2YZ1A 2FAUA 4YSUA 5AUMA 3KPSB 1YA5A 2YRPA 3PGFH 1M7XA 5ABAA 3BP6B 4UQCA 2EEBA 1KC5L 1WWWX 1C5BH 2NUTB 3WS6C 1QHQA 5J6GA 1CFBA 4YHLH 5F1KC 3RTQD 5EO0A 3QCTL 1EZLA 3QIWA 1HHJB 1RJZA 1A21A 3DSNA 5AVVB 1KPUA 1OTTC 3MOAH 2NR6A 3P3UA 1T89A 2QVFB 5F7DB 2JI1A 3CTTA 1YUHA 2DLFH 2FIKA 1E4KA 1T3FB 3V0WL 4LSVH 3U9WA 3AT8A 7CGTA 2X4QB 5EUOB 2XETA 1YYMH 4WVRA 5FYKD 2O5ZL 3RA7L 1BZ7A 5IY5B 5FM4A 1SDDB 2KKQA 1LTXA 4YUEH 2ZCLL 4MJ2A 3HUJA 3L4VA 1H15A 3SE3C 1T2QL 1PZSA 4GRLC 2FQFA 5EB9A 4DO5A 3BP7A 4JFZL 1GSKA 2YOCA 3FQTB 4GIOA 1JI1A 5EEVA 4PJXB 1F2XK 3RB7A 1D6VH 4ZAKA 1R34A 5DJ0A 4KITB 5DMKA 4MMXC 3EH2A 1LD9B 4L1TA 2QTVA 3VD3A 3C08H 5TDPA 2OZ4L 4EDWH 2BC4A 2YUWA 4F58L 2XZCL 4K3EL 4KJYA 2MTAA 4F7PA 1UOLA 4AQOA 1LE5B 3CHPA 4OCRL 4K5NA 1FVCB 5KAQG 1CDGA 2L4OA 3J27A 1OAQL 5EC1A 1A9BA 4UIMB 3E2HC 3N85H 1XX9C 2P5EE 4LEOA 3SDAC 3W81A 3WS3A 5CEZE 3L3HA 1OP3K 3HI5L 1DFBH 4MWFA 2WXPA 3LRLA 1HFUA 4C8XA 2C1OA 3M1CA 4OQ1A 4M7ZC 2J1YA 2ZKWA 5E99H 2HXAA 2B59A 4KROD 1T7WA 4HZAA 1HK6A 4NN7B 4P9ML 3F58L 3JXAA 1O7VA 5EUKB 2IADA 1SXCA 3CVBA 2E56A 4AK2A 1PD0A 3CFKA 3FW6A 3VX0A 4CN4A 1DVFB 1KYAA 3SKJL 3MUGB 2XDHA 5H37G 1V27A 5SWSD 3NJMA 1N5AB 5FCUH 3I6KB 3TT1L 3ZZQA 4UQIM 4CMMB 1N0XH 5EOCH 2CM6A 1UACH 2QADC 4JKMA 5E1AB 4ODUB 1SJEB 2VC2L 1HTYA 2WUBH 4UWQB 4K3HA 4PJEB 1V54B 3O6LL 5CZKA 3NCJH 2WW8A 1G1CA 1JZGA 1CF1A 7FABH 1XTLA 2LHAA 5KYNA 3NABH 2JSFA 5D7SH 1ZK9A 2RQ8A 1OAXL 2OMZA 4HIXH 4ZYKB 1FNGB 2NW3B 3C8KB 3MOQA 4HIIB 2V5SA 1T83A 1GZQA 3SQBB 3S4SG 4W70A 4QRSA 5E1QA 4QY8B 2VTFA 4YQXL 1FG9C 3KYOA 2GBTA 3MKKA 3BGFC 2EC8A 2J21A 5E4AA 1BWWA 4YO0A 1ET8A 1VLXA 2XFGB 5GRVK 4FXKC 4MDJB 3VXTA 1EVUA 2KL6A 4X9YA 1W72A 2J55A 2XA8L 1WCQA 4HPOL 1JPST 2AJ3A 4J3SA 3GPSA 1BD2B 5F9JA 4OJFH 2EDKA 2DWEA 3KLHC 1L9PA 2IAMA 3BH8B 4XZUB 4BCXA 2V2TA 4QJ3B 3D33A 5C0GB 4FNUA 2VDPL 4AUYA 3VXOA 5DUJA 2VUYA 5SV3A 3VXSE 4BK5A 1RZKH 4PUBH 4CKVX 2JLLA 2HCZX 3FQ4A 5C07B 1XAKA 4PREA 3ZDYE 4JKKA 4NWUL 4I9WE 4GG8B 4LCWE 4BZ2H 2JXMA 1PIGA 1FNSH 5F7WC 4LLUB 4NJ9H 5BJTA 4P59H 4ENZA 4ODBD 5JIKA 4GRWF 3VGEA 1NGWA 3QO0A 5C0EA 3K81A 3FZUD 4IBZA 2HT3C 3GI8H 4HGKC 4LCIH 4UOW0 3QCVH 5FGSA 3NZ8A 5HJ3A 1OT2A 1U8MB 2OR9H 2V3EA 3SPVA 2B8OT 1MXGA 1OZUA 1S7WA 4JLRA 1P7KB 1XCTB 2R2BB 3EYVB 3MMEA 4K0OA 4M4RB 4RGMB 3KCWA 5AAMC 3W0WA 1TKWA 4P4KB 5DR5L 2YBRA 4XN1A 3SDYL 1BXAA 2AI0L 2NZ1A 2ZKHH 3LY6A 1AR2A 1T6BX 4XOCA 4ZO6A 4ZUWA 3V4VH 2X09A 4GT7A 4Z7NF 4N87A 3ULAB 1UOWA 1W0VB 2ENPA 2Y7LA 4GP5B 4XO3A 2Z93B 3U1PA 1OAKL 4Y9GA 2ARJB 4JHVA 1XGUA 4NO2A 4LLAA 4WFED 5EOCJ 5DMIH 4ZO8A 1HN1A 1Z0NA 4JO4L 4NPKA 1BVZA 4KKNA 3GZKA 4Y9EA 5M95B 3PXJA 4MA3B 1F4XH 4NQXB 4X5RA 1IX2A 2CGYA 4PJAA 5CEZL 3PHAA 4JN1L 3UJJL 2ZUTA 2ZD0A 2OSYA 3RWHB 3V0IA 4XNUL 2V5MA 1ETZA 5DZAA 1NIDA 3N6YA 4RX4A 3QK0A 1J05A 3DX1A 1S2EA 4XAWH 1R3HA 4Y5XA 2XT1B 4KTDH 4YHOL 3RGVC 2J88L 3RY6C 3KDMA 3ARXA 4YXHH 2BW4A 4Z3GA 4NQEE 1GGCH 4MXWL 2ZXGA 4G8GD 3NA9L 1EK3A 4OGZA 1NJ9A 2JKIS 2DEWX 4ONHB 3TTYA 3RWCA 5B4MC 5JXEC 5I73C 3CSFA 4XP4L 3MBEC 1FCGA 2BNQD 4G1EB 5LQBL 4NC0B 3CSGA 2UUDH 4OZFB 3ZN6A 3PWPB 5DJ8A 1EANA 4WFFD 3W2DL 3KW7A 3UX9B 4B9JA 3NIDF 1JN6A 1PX4A 5D2NB 1I1AD 1U8QA 3GZOA 1T4WA 2X4SB 3P4NA 1I9RL 1CLYL 15C8L 3X1FA 4WW2F 1FI8C 2AXFA 2D7MA 4PFEA 5ALCH 1NC2A 3B43A 1ZGLA 3T8MA 4OF5A 4KO7A 4LF3A 4D8PA 5CXPA 4WUKH 5D2LB 1A3LL 1KGIA 4O2FA 2GBVA 2XACC 5HGAA 5CKAA 1IKFL 2HVBA 1DZBA 3ARBC 3BVUA 4R2GD 3KLDA 1JOIA 2VDKB 2A38A 3GM8A 3NFSH 5HGBB 4K8RC 4HUKB 1BMGA 4QRRD 2CO2A 3DVGA 4OCMC 2B7DT 1MCJA 3FSVA 2ZKXA 2I9TA 2SEBA 1Q9OB 1HNGA 3BDBA 3OZ9H 5TE4L 3L1EA 2KZBA 3KJ4C 3TYFA 2I5YH 3WKPA 1R3KB 3WI9A 2D31A 5AL8A 3IFLH 4YHYC 5KTEH 1ULVA 4RDQG 3SKNB 1BW8A 1E3FA 1WZ1L 3KPMA 5HYIA 4PJ7A 3X14B 5C0IB 1U8OA 3QJXA 2NY0B 4B9KC 1QFUL 4DKFH 3UIZA 3I3EA 4G42B 3RVXD 3JWDC 2AERT 5I76B 4GINA 4JHAH 5HPMB 1I8UA 2FD6L 4NKIL 5D1ZD 5BS0A 2CBQA 3NJFA 3IU3B 4BFFA 3MPCA 1T1YB 4NUJA 1TMCB 3ZW3A 4R0LA 3DUUA 3EJJX 4WUUB 1V7NH 3NSJA 3SEPA 3MJGX 1QFWI 1KWGA 1A02N 4UAHA 3ZDXF 4XB3A 2V8MA 5E24E 4OIIL 4JZJB 4G7VL 3GEFA 4QHKI 4QWWC 5KG9B 3IMTA 2BH0A 2A9NL 4HUNB 1TTGA 4ZJ9A 2RAMA 3L7EB 4MRCA 12E8L 1LXMA 3ULVE 5I8KH 2IWKA 3ZE0E 4YOKA 4YXLH 2G9HB 3PREA 1F11B 4JO3L 1F8TL 3FH7A 3IDNA 4CC4C 4I1NB 4WHCA 2G75A 4LHUB 2QGEA 4GLRH 4RGOH 3OG6B 5DHYB 1AG0A 4GBXB 3WY2A 4AM0B 1FN4B 1UYWH 3IVKB 4Z3HA 2PPEA 3WGVB 3RVWC 1MFVA 2MKWA 1VPOH 3OKDA 4EIUA 4GUPB 4F7MA 1HT6A 4TVUA 4NUMA 3EF7A 2EYSA 1D5MB 4HUCA 2ZKYA 3TA3D 3W5MA 2IFFL 1AXSB 1C7TA 2NY4C 2PXYC 3MV8D 4LIQH 3RPKA 1BFTA 3D0AA 4XTRC 5D4IA 2Z1KA 3QJTB 1NBQA 1HL8A 2Y7OA 5JOPE 2XKNA 3HR5B 1GW0A 2P5ED 3F6LA 3OKLA 3MX0A 3Q5YA 1JF6A 4NRZA 3UTSB 1ASPA 2B1HH 4BHUI 5CEZD 5IHLB 2JH2A 1EXUA 1NCAL 4YBLC 1OGAE 5L2JB 5IMOB 1AHWB 5E08H 4S0TD 3NIGB 3W9EB 3LV3B 1HE7A 3RIFK 2NW2A 4KWUA 3ZRSA 2YUVA 2EKJA 1MCRA 1EMTH 3BGAA 3O4OB 1N70A 1KEGH 5DI8B 2LT9A 5DJXB 1OP4A 1Q1JL 3QG6A 4P23D 4Y16B 4M7JL 1HINH 3LMJL 5CLTA 3BCDA 2ITDA 3B34A 4JO2L 4X99A 1OM3L 1FNEB 5F3BA 2F53B 5ANMA 2DI7A 4WI4A 4GT0A 4LSTH 1OCZB 1T89C 1AFVH 1YPZE 4E9XA 1CF8L 3IAQA 4XMPL 1RZFL 2WXOA 3FUKA 3ISYA 3SHSA 4KI5C 5MERB 5J5EA 4H20H 2IALA 4NZ8A 1RK1A 5KVEL 2ZAIA 1WEJH 2Q3ZA 3N41B 3D51A 2WANA 3VCLA 2I7SA 3CE1A 4LARL 6PAZA 5CLYA 4J3OD 2Z4QB 1AHMA 3WEOA 1IEBB 4AYGA 4LNRA 1QEXA 1LL1A 4KH2A 4U7SA 5TE7L 4ZXBC 4TKWA 5I0DA 4KPHL 2DJMA 2WXLA 5EU6B 4ZAKC 3GMRB 2GJ6E 5IWLC 2EH7L 4OKDA 3QE5A 4OM0L 5TFSH 3MRLB 4AX3A 4AYEC 1BFOA 5F7BA 4TQEL 2YXVA 2D4DA 1E28B 2WXJA 3B1TA 2EUWA 2XUWA 2IH1B 4YHKH 2HTKD 3E1F1 3QUXB 4WKZA 2NLJA 3EG9B 5D1QB 4BEIA 4P9HC 1TQBB 3LSOB 3H2PA 3PAYA 2YIHA 4MAYA 4ZFZB 4YSTA 3ECVA 3ZLQC 3VXSD 3UL4A 5E6ZA 5LCVA 1KLGB 2R83A 3WIHA 2K9FB 2W8CA 4I9WD 4AIZB 5CCGE 3FB5B 4N0FB 3HC0B 4R97C 3V9EA 4HWUA 1HSAA 3PGDB 3L3IA 3SOBH 5C0FB 4I3SH 2MTPA 5I1IL 4ERSL 5E5UB 2ROXA 4EKJA 2QMJA 2HKFH 4I87A 4MQTB 3U0TA 5BNXD 4H8UA 2Y2WA 1QQDB 3FT9A 3RDTA 5FA4A 2AK4E 3WSQL 3ZXAC 4FG0A 3GBNL 3C60C 4S0SD 1A7RL 3FT0A 3MAWA 3ATFA 1JYNA 3QNXA 3KR3L 4ZW3A 3H6JA 4U1GB 2Y23A 1ZJBA 4HZLB 4ZD3L 2OCJA 5HVHC 1DE4A 1E30A 4I2XE 4UT6L 1J8RA 1L9SA 2GJZA 2VR8A 2AHIA 2VNCA 3Q9QA 4A6YH 1QPPA 5FUCC 4OLUL 1BMWA 5G4MA 3RTQB 2ITCB 4GQRA 1DVSA 5GSVB 4YDJA 3VXNB 1W9XA 1HI6B 3LD8C 4N2CA 5J9PA 3TX4A 5HI4D 3EJZD 3S2AA 1EHLL 1GIGL 2YPVH 3GSVB 3CFTA 3LEVL 4L48A 4TTDD 5TH2B 1MFEL 2CWRA 2VISA 2KC0A 4RNRB 1KGXA 1TU2A 2CLVB 4P3DA 3ZX1A 1YO4A 5KYYB 5L4FA 5BV7H 1UB5B 3CFDA 5DUPL 3HBPA 2J1ZA 1M7DA 3D52A 3NZUA 1B0GA 3KPNA 1HXKA 1K2DB 2R0KH 2AXJA 4H1LH 4X80H 3TXAA 1EHKB 1TZIA 1WUNT 3PV7A 1U36A 4NKDB 5T8IA 4K23L 3TWCH 3PJSB 1E8XA 4NQED 4BK5C 3A21A 4FL4C 4GP4B 5EUOF 2ZCLH 4K9EL 1QLEL 4I18C 3GRWH 4MHHI 3VFMB 1TZAA 4GOSA 4FQJH 1MZZA 3C6SB 4U1MB 4LU5L 3TLRA 2V7NA 1A66A 1XCQB 5CU5A 1XF5B 3WKMH 3HE6A 3O6FD 3FT2B 5E2WL 2XKSA 3F12B 5CP7B 3TZVA 3EXJA 1P53A 5IZ7A 5IJVB 4L23A 4JFFE 2CRYA 1GZHA 3OX8A 4PJXF 5FO2A 5A2AA 2RA1A 3N43B 3MRDA 4PWEA 4AM0Q 2MQCA 2HLFC 3C2AL 4AYFA 1U9KA 4FYQA 1KXHA 1Z5LB 4OTXL 2X4TA 1JZ3A 3CIAA 4NQSB 2AF2A 2X6CA 3P73A 4POZC 4JM2A 5EU3B 2V8LA 4DKAA 2XZCH 4K3EH 5CBAA 3ZE2B 1RURL 3NAAL 4OGXH 2RCSL 1THCA 2F18A 4PP2A 1P2CB 2W94A 4KROB 5B39G 4AE0A 4EEEA 3PDDA 4RZCB 3KWWA 4LDCA 1PZBA 4MDRA 4U1IB 1DANU 4MXVE 5CAYB 4UT9H 5EF1A 3DMMD 1CDCA 2ERJB 2CKBH 3BFWA 3RHWF 2Y2TA 4M8QA 5SWSB 1VCAA 2BRRH 4WTWA 1U93A 4G7RB 1I82A 4PS8A 1E90A 3FO9B 2YPLA 3CQPA 3F58H 4OAWB 2CR3A 2VDRL 4P9MH 8FABB 5ICYA 2OL3H 1VACA 1FBIH 4XVSL 3RPIA 4NPYB 4M93B 3EBIA 3HZVA 1UKQA 4FMFA 5AVQB 5AW2B 5IFHL 1W0WB 2OMBA 4M6NL 3CLFL 3NJIA 3CSYA 3HRZB 3MFFA 4Y5XC 2DQEL 1AGCA 3CHQA 3DURB 5I74C 5D7JA 4A04A 4FF9A 1R3IL 3GSNA 2NDGA 4PJEF 1ZK5A 2R7EB 3GXDA 3LNGA 1BBJB 3BP6A 4Z7VB 2NUTA 4W9LC 1OAXH 4I4WB 2ICWB 3U9UA 4OY9A 1DSYA 4OJYA 1G7LA 1CBVH 3IMUA 1MLBA 1HHJA 2ZXWB 4N4YB 1LK2B 1I7TA 4R3SA 1ECYA 3M1BB 2G3MA 3TPKA 1IJNA 1SJXA 3G5XB 1RL1A 2WGXA 3GINA 3UBXI 2A4CA 1JXDA 3VFTB 5F7DA 3QXAA 4UDUB 1ID2A 1T3FA 2EDOA 3ULVD 3RWDB 2X4QA 2N7SA 4HJGA 4P2AA 3VGFA 4FTDA 3HG2A 1QO3A 1KBKA 4C58B 4FQCH 2ITFA 4HUMB 2GVYA 1KLFA 3R4DA 4K71C 2O6FA 2Z8SA 5GGRY 1IM3D 1JPGB 1Q0XH 2VM3A 5L4IA 5C2UB 4HG4K 1D5BB 3GSUB 2B4CL 3DJSA 3B2UD 5DO2C 1KYFA 3MCG1 6PCYA 4HUWB 1U8LA 4JG1L 5JPMA 2R4SH 2J12B 4WAFA 2Q8AL 2FEDC 2IMMA 2J73A 3SBRA 1R19A 4IHOA 5DQDL 3SY0B 5K33A 5JOPD 4CMHC 4PBXA 4WF7A 1G7MB 1FGNH 1R75A 4N3UA 3SO5A 3FSAA 5H4ZA 1W91A 2W0FA 1QA9A 43CAB 3QIBA 1OGAD 4UYPA 1KULA 1HOCB 1COBA 3JWOL 3P3SA 1B4JL 4C56E 3MJ9H 4F2ME 3D0VB 3MRBB 3TTSA 4S1RL 3GJFK 1YMMB 4RVBA 4AQEA 3O3AB 2AI0H 1EEZB 5JHLA 1CGTA 2F7RA 2BS8A 3T4YB 5C9JB 4UTBA 3OAUH 1G7JB 1G6VK 2H7WA 4NZUL 4PJ9D 4TV3A 5F1IB 5HGHB 5I1HL 2LVCA 1X7SA 2H2SD 3IN2A 4L2LA 4R0LC 3K5SA 4Z7UE 3P11H 5KSUA 3ES6B 3DV4B 4G9DB 1DVFA 2HH0L 3C5JB 1LNUB 4U1NA 3WXWH 3K0YA 2BIOA 4I0PD 4XMLH 4JCWA 4PPTA 2VL5B 1KTLB 1SBBA 4QXGL 4GKSA 4CMMA 1P4LB 1CTMA 2FX9H 4F57L 5E2TL 4DW2L 3FS9A 4ODUA 3A3YB 1SJEA 1SZNA 2EC9U 5JIDA 3R8BB 4E9VA 3T0ED 4FQ1L 1DEEA 3K2KA 4J4PA 4O2EB 1R24B 2CIIB 1J1XH 4G8GB 2WB7A 4XNUH 3ARDD 1DQIA 3ZRFC 5CSZA 1PEWA 1OSEA 2OI9B 4YHOH 4IBLT 3M6DA 4MCMA 2BNQB 1FNGA 3C8KA 1KACB 1JGEB 1Z5YD 2C4FT 2OXGB 3HG1E 1XCXA 4H8PA 3NA9H 1UZ6F 1SEQH 4F2EA 4Y0GA 3LJ3A 3QHTC 1I1AB 2KQNA 4KMQA 1A5FL 4OLWH 4ZS7L 1QFHA 3TIDA 4KJPD 4LPUA 5LQBH 2IGTA 1HYSC 1ITBB 2VC2B 1R1CA 2XXMB 4JRYE 4K5OA 1N26A 1KDIA 4NNXB 2H8PB 5EEZA 5F0PB 2PW1B 1CJYA 1I9RH 2XG5B 3GYRA 3MKGA 3BH8A 4IS6B 4OJCA 4U49A 3RNQB 4XN9A 4R2GB 1GY2A 3FSWA 1RZ8A 1SHMA 3QO1B 4PGCA 2BHFA 3QS2A 5C07A 4QRRB 5IF0B 3T4AA 5JW3L 5C8JA 3CSPA 1JRHL 4WJ5B 3ML8A 3VXQA 4LLUA 5D2LF 3QQ4A 1Y7VA 2VR6A 2AK4D 3AC0A 4Y2DD 2H0EA 4G6JL 4P2OD 5CILH 3SOTA 43C9A 3P0VL 4HWBL 4KKBC 4BSVB 5FA3A 2FHFA 2VN4A 3QORD 3ZTJH 1S7XB 1U8MA 1JZ7A 3IDJB 1JWSB 3NCMA 4FLSA 3BSHA 3PABA 3WAJA 1P7KA 4WSGA 2R2BA 3CSBA 3VXRA 1WFNA 4YDLC 4P4KA 4X8GA 3IMSA 4TOYL 5D1ZB 2VDPB 1NDGB 2YD9A 4LCCB 3MLZL 1JGUL 3LH2L 5GRWA 3VB9A 4JHWH 4X42A 1WBXB 4NLAA 1DBJL 1QFUH 2APXA 1B0RB 1SMDA 1PNCA 1X9UA 4XI5C 4JG5A 3CZSA 5DGQA 3VFNB 4A2LA 1A65A 2FD6H 3PWLB 5A2CA 3ZE1E 4JO5A 4OCWH 4U0QB 3RUGF 4M6AA 4YLQT 4Z3TA 3CQQA 2P80D 5HDOA 1T22A 3C5ZC 3BPNC 1E7VA 4MAYC 1G5GA 3PRZA 1A4BA 1NH6A 3U1QA 4TNVF 5DS8B 2QQNL 5KYXB 4G7VH 4KVPA 2VGLM 1OP3H 3WJJA 1ZHLA 4CSTA 3F5WB 2APSA 1SOQA 1AQ8A 12E8H 4MMZC 4WI6A 2ATKA 2K8MA 3QZWB 4IJTA 1S7QA 4IOIB 5FM5O 3WCYA 1GJIA 4RAVA 2WVVB 4C4KO 2IANE 4CU6A 3FUJA 1U0QA 2VH5H 3QH3B 2DF3A 4KNTA 3HNTL 4PTTB 3TA3B 3O4LE 4JFFD 4ONHA 4U6YB 4ANKA 3MV8B 2MPVA 4X4MA 4OD2B 1GAFH 3DVFA 3TO2B 2P5EB 3OZLA 4PY7A 4Z7WA 1B9ZA 1RZ7L 4LAQL 5HI3D 1PEZA 4LCVA 5I1AB 3ARGC 3T2OA 4NZRL 2BVQA 2IFFH 1Q9WB 3L1FA 4E9SA 2X4SA 4FTVE 1G43A 2HLAA 3JTTA 4LPWA 1PKQE 1I7UB 4KBPA 1HQ4B 3ZYOA 5TGBB 4P23B 5DRXB 3VU1A 2DQIH 1RAMA 2PWHA 2RB8A 2WLKA 3BAEH 2RBLA 3E9TA 1NCAH 1F4YL 2EIKB 1A3ZA 3CXDL 2P24A 4R5XA 4N6RA 3NIGF 4M1GL 3RBGA 2BHYA 1JD9A 5HGBA 4WI9A 3SE6A 1TZGH 1IFRA 3DX7B 4M7JH 4N8VB 3APDA 4QYOB 4L2YA 4JO2H 3ISRA 2XKUA 5AB0A 3V0VB 4JNXA 1IAKB 2EDBA 3K6SA 3QAQA 3SPHA 1Q9OA 3U7WL 5JUEH 2VQUA 2WXMA 4WV1C 5DUBB 3U36B 1RZFH 2DL9A 2EAEA 3WO4C 1FL3A 5TDNA 4RAUB 2UZXB 2QSQA 2BFGA 3NFNB 4A66A 4F7TB 5K9QI 3TPUA 4LK4A 3SKNA 4F27A 1EAQA 3E6FB 5EEUA 2YKLL 1TTBA 3X14A 3X11A 3OLDA 1IGTA 2WWKT 4DEUA 1X5GA 4QTHA 4UV4H 4YZFF 3GZPA 5FUZH 4XN7A 5I76A 1IUZA 1ZGLM 3QZBA 3D87B 2ED6A 1RZJC 4PM1A 3N9GH 2IWGA 4X9HA 3HE6C 2B1OA 4K7PY 3MU3A 4PWIA 2YQ3A 3VGBA 2QR0B 4LEEA 3TZVC 4WHYH 8CGTA 1FRGL 3K2IA 4FP8H 3QQNA 4KPHH 4AGNA 2HKAA 1UD5A 3ZZLA 2FEEI 4NNYB 1GZHC 1A7NH 2H6UA 2JKXA 2EH7H 2JKJA 3VXSB 3EYQC 4YC2C 4OM0H 2OJEA 5FWRA 3ZDYB 2K3HA 4M1DL 5BXFA 2J2ZB 3BHBB 1FG2A 4TULL 3NSXA 5GHWL 4LVNC 5FEBA 5KG9A 2MOQA 2OZNA 4CDHA 4QRBA 2GC7C 2ZXCA 5CD5D 1F11A 3PWUB 5HVWA 3MLWL 2Z7WA 3IRPX 1BQHA 4N22A 4LHUA 1U95A 5DHYA 4PLKC 4DVRL 4XPHH 4AM0A 1DLHB 3KHOA 2FCBA 2OMUB 5HD8D 1JHKH 3JTSA 4XVTL 4NAJA 2YEZA 2YA2A 4KKCD 3M8OL 4ERSH 4BUHA 2K4AA 2NMSA 2VL4A 2OMVA 4F9PA 3O6KH 5I1EL 3BESR 4GUPA 4PJGA 3GRGA 4KU1A 3O3DB 4IQHA 2J5LC 1D5MA 1NMBL 2XTLA 3CFUA 3PV6A 4WEEA 5E5MB 3UJIH 3CN1A 2VCOA 3UERA 4S2SB 3Q6GL 2EDQA 2DWDA 1AXSA 4C56D 2OX5A 2KS0A 2X4RA 3HFMH 5SWZA 4TSBH 6FABL 4QYAA 1KXTB 3LZOA 4AH2B 2IBZY 3B7UX 4N25A 1ID5I 3WSQH 2Y9RT 3FOLB 5E9DA 5IMLB 2A6JA 1IC0A 4N6QA 1EAPB 4WGKA 4YDKL 1A7RH 1KCVL 1QEWB 3PDOB 2X2JA 5D7JC 4D3CH 3WFEL 4WTZA 1X4YA 2J1KA 4PRPE 4XP5L 4M8RA 4EUPH 1A7OH 5I0YA 2VLJD 4DJMA 3LKNB 4XPGH 4P3WA 5DJXA 4AYBA 4FKHA 4KHXL 5ITBH 4Q9RL 1U4FA 1V3KA 5BVPH 1N67A 2R9HD 1UM4H 4GI6A 3QRGL 3VXUE 3T0DA 3J8F7 4E9WA 1GIGH 3ESMA 2E9GA 3V52L 3SGDI 3TFBA 1HH6A 4PV8B 2NY5H 1P9MA 1AE6L 2OTWB 4ZSOA 2E5EA 3S36X 4HCRH 3QUML 1X9QA 4X6CB 2VUKA 4H8HA 4POYA 1NANI 5CIPB 5MERA 4NQEB 1QZ1A 2L7QA 2V7HA 3UADA 4C47A 2AEQL 4JQVA 3P9WB 2O6PA 2ZCKH 2XN2A 2IGFL 4UILL 4K23H 2MQ0A 2A73B 3LQAH 5F9WB 1P4BL 3LNFA 3O6FB 3HG1D 1U8CB 3ARFA 1IBBA 1QLEH 5FS5A 5JPMC 3HI6H 3KPPB 5L8KB 1SOXA 4G6FB 3LQZB 2ZSWB 5DS1A 1RPUA 4LU5H 3INUL 1KIRB 3ABKB 5C0NC 4B0MB 4KJWC 3VI4E 2F58L 3BX7C 3UC0H 1PZCA 3MRLA 3VFSA 5L0QB 3IAGC 2AKRB 2CDGB 3CMOL 1CICD 2IH1A 3IJEB 4PJHE 5DRZA 2EXSA 3QUXA 4LMQE 4RH4A 5D1QA 1VZGA 4MX7A 1OARL 4KMLB 1D5XB 3R06A 4QHUB 1WIOA 2BY0A 2IIJA 4OTXH 4UM8B 2BVEA 2EJ1A 1KLGA 3DMMB 2YJQA 3IMRA 4A2EA 2CU9A 1MW0A 3NUKA 4ATWA 1MCWM 3FB5A 1QRNE 1DJSA 4JFEA 3ZKMC 4NNPH 4UDTB 3MRKB 4A7QA 3HC0A 2KLSA 1NBZB 3N1FC 5C09E 3NSDA 4NN7C 5C0FA 1JPTL 2BIMA 2IH3A 5FW6A 1GPOL 4X8CA 5GJSL 1MY7A 2VM9A 1DVFC 2YLKA 3AU1B 3MLUL 4NJAL 4K73A 2V37A 2PTUA 1QQDA 5A1AA 3CNKA 1JZEA 1UD4A 1XB8A 4ODHL 4NKOB 3RWIA 5HHNA 4JPKH 3D85A 5ID1A 1ZA3B 1K5NB 1BM3H 3WN6A 4PI2A 5F9OL 3K4DA 3ZZSA 1TNMA 1CGSH 2HPOA 4JAMB 4LLVB 1PGRB 1XIWA 4NENB 5CN2A 1UFUA 4I7ZC 2KT6A 1BOGB 4Q14A 1TJHH 2R4RL 3W38A 3OJMB 3HZKB 3QJHA 4M6NH 4ZUUB 4PHXA 3SODB 3LKQB 3SPGA 2DQEH 1EIBA 1B90A 2ARWA 4FZ8H 4ENED 4ZZFA 3NESA 1USZA 2WP3O 3BD5A 3HCVB 4I5BB 4WI3A 4YZWA 3QG7H 5BRZA 5LGKA 2BJML 1U8NA 2VDNH 4V2CB 1ZLSL 4GO8A 3DXAD 3B5TA 4RNRA 5A6MA 1ZD6A 3U4EB 1M6UA 1OP9A 5E03A 4TUOB 4DP8X 5C7XL 4ALAL 5C0CE 3ZE0B 1UB5A 1L6PA 1URZA 3RILA 4WK0B 3LEXB 5HDQL 1OSPL 1NAML 5L4JA 2DMHA 2P42B 4D8OA 2C1PB 1OB1A 4WKXA 5DC4B 1BXUA 1KPRA 2ZOKA 3VDCA 3JVGA 4P2RE 2IAND 4TM9A 1GR7A 1TENA 4DAGL 1KJ3L 3BZEA 1X5HA 3F62A 2J20A 5D1XE 3PAUA 3UTZB 3CZGA 1E5ZA 3O4LD 1CDIA 1FSKC 1WAAE 1DDTA 2GY5A 4UIKH 5CSBA 4L8DB 3UAJA 1RUQL 3ILEA 3KAAA 3C6SA 2B4CH 1CK0H 5LAXB 4BCYA 1O6SB 1XCQA 3BZ4A 1C12B 2AK1L 4AGQA 3FT2A 1D5ZA 1DVXA 5KBLA 4BA8A 3S96B 3B9KD 4IBTA 1F6LL 4PVLA 1OGAB 3DX4A 5IJVA 2EEAA 5IB5B 1X7QA 5IB1B 4FTVD 2I25N 5DQDH 4RGMC 3CZEA 3NYKA 3TEXA 5IBLC 1BQSA 4P4KC 5GRJL 4AYMC 1QWUA 1Z5LA 4JPVH 4NQSA 3OLGA 4L0ZA 2W0LA 3T2PA 1NGQH 2CBOA 4UNIA 2NY2D 3T8XA 4PJ9B 4ANVA 4XVOA 2Y7SA 5J3HC 4KFZC 2VITB 1DVYA 1J5OL 5DRWB 1YPZB 1A7QL 4RZCA 2CXKA 3EYFB 4OCNC 3VG9B 1IAII 1TQSA 1E2WA 2VE6B 4U1IA 1FAKT 1F42A 5AAPA 4G8EB 4JRXD 4NWTH 2JCCE 1OANA 4HGWA 3T65A 1IVLA 2AC0A 1RIVL 1UWFA 4I0PB 1TEYA 2W65B 1W0YT 3VD0A 4Z5RA 1H3WM 8FABA 4J28A 1PTZA 1AQKH 4X6BB 2QLVB 3GTTA 3AG4B 5DDHB 3T0EB 5C6TL 3SQOL 1RK7A 4WW1A 5CSGA 5IOKA 4CVXB 3ABGA 1HNFA 1AZVA 4XC1L 2C7FA 3NN8A 3ARDB 3WJJC 2B2XL 2J8UA 4F57H 4LPYA 4N9GA 4A7GF 4GW4A 5F44A 4FHBD 3K6OA 1FVDB 4JFTA 4QOKE 5IHHA 4JDVB 3DURA 3BMVA 3IXTB 3NCYP 5F1NA 1ZJAA 1KIQB 3OHMB 4FADA 4FQ2L 1KFAH 4ODSL 3DYOA 2EIDA 4JQIL 1Z66A 5DK2A 1AD0B 4Z7VA 2UXTA 1DQJB 5DK3A 1FNLA 1F1GA 1KYOK 3WENA 2NYZA 1QFWL 2N0KA 3G5ZB 3MBWA 4I4WA 2ICWA 5JHBA 2MHAB 3QDJE 1RK0A 2VDRB 4KZEH 4Z78A 2WO4A 4IOFD 2EDJA 1PG7L 2VLKA 3EBAA 3NTCL 2F8XC 1LK2A 3ASOB 1TQUA 4MB4A 4AQAB 4YFEA 1A7PL 2Y69B 5GZNC 4GFXA 3G5XA 3S4SB 1BVKB 5D4JA 3IMBA 1A5FH 4UDUA 3GUTA 2WXNA 1MUJB 3EJRA 2F74A 3NVQA 1DUZB 1U8IB 3U6RB 1ACXA 4X4YA 4BIKA 5I0VA 6TAAA 1BFVL 1GKOA 3TCXA 1ZCRA 4RFOH 4QRQB 4R7VA 4MFHA 1JPGA 1TEFA 5CMAB 2DBLL 2WKOA 5DWUL 2WIIA 3FTVA 3GSUA 2AK4B 1ZAGA 4P2OB 2F1EA 5JDJA 3LHAA 4HUWA 4HJJL 5JW3H 4FYRA 4W93A 1ZT4B 3UOAB 1CLOH 1DZ0A 3QORB 2X87A 3F04A 1WBZB 4LPCA 2H2PC 4O02A 3KZ8A 5IB2A 4H88L 1EO8L 4HWBH 1H3XA 3DLQR 3HOGA 2X38A 1JJUA 3JQOB 4RMSA 3V7MA 4Z23A 4ATTA 2QVIA 3QRLA 3AWGA 4PRPD 1J5DA 4JM0A 2A9BA 2NY0C 4YAQB 1ZVNA 1RIUH 1XH0A 3AGWA 2PYEE 1FFQA 1YMMA 4ZDHA 4TOYH 1NGPH 1NFIB 3VXUD 4AYID 3LPWA 2KH2B 2VJ8A 5EU7C 4LDEB 4JPWL 3H1ZA 2D9CA 4HUXA 3IYLW 2JE8A 5KSAD 1RUML 2XN9A 1G7JA 3TN0D 1DBJH 1YEDA 4XR8C 4CNIB 1WUZA 4ZTOL 1NCBL 2O5XL 2QV4A 2BW5A 3UZQA 3MRNB 4L05A 1JGIA 4IKJA 2HJFB 5CKGA 1A6TA 5KZCD 1AQHA 3DV4A 2GBAA 4YDNA 1EDHA 1VGKA 2AXGA 4JZJC 4X6DE 5CINL 4MASA 1KCKA 1P4LA 3WDJA 3AS3A 1GS8A 2ZUXA 3QR0A 1Z3GH 3L95B 5HGDA 3S88H 3GRBA 2ED9A 4AL8L 2CIIA 4G80A 4WEBL 3RKPA 2JJSC 4GBXC 4E41E 2ADJA 3A23A 4I77H 3CQFA 1DL7H 2PTTB 4JFFB 1ZVSA 1A6UH 2NSQA 4ZX5A 1DQMH 3AROA 5CM1A 5LBSL 3W5NA 4MXQC 1SY6L 5D7IE 1SMOA 2KLTA 3KNBB 4F9PC 1CGXA 1E2VA 1JHLH 3NJXA 4X8XA 4X9IA 2SODB 4MNQE 1ESOA 2JQMA 2PCPB 1AYRA 4P5KA 2ZJSL 3HNTH 4Y4KA 5BOPA 2ATPB 1N19A 1GGTA 1OLZA 5DK0A 1GTFA 3UGXA 3ROLB 1Z9MA 1JPFA 1OCOB 4H8VA 4IMLB 3WHE0 1IL1A 5JW5B 3HKZA 4ODTH 1FJ1B 5IM7B 1F3JB 4HC1L 4G6AC 4NNXA 5FB8B 4NZRH 3MRPB 4ZFFB 2PW1A 3WFBL 5ADOL 1QRND 4OLZL 1F18A 5IB4B 1KNOB 2BDNL 1V7ML 3BAXA 2F7IA 2WQSA 5DA0B 3ATBA 3O4OC 3PU7A 3LPGA 4N0CC 4YBHA 1H8OA 2DH2A 2E6QA 3QO1A 4I13B 5HY9B 4HCGA 4QRRA 1F4YH 3SDDD 5ITFB 1YUKB 3F85A 4JKPH 5E6YA 1AP2A 4JUSA 1BLNB 1NL0L 5AVWB 5IJKC 2PABA 1P9MC 4PJCE 5D96B 2X88A 4KC3B 4U1JA 2G4EA 5GIRA 2MWCA 3DGCR 4XPFL 4WLCA 2AZAA 3TEUA 3ZL2A 1DDHB 1VENA 3DHMA 4NHUB 2QZQA 5HHVH 4Q6IB 4ELMA 3MNZA 1R6VA 5TF1H 2VUOA 2ZG1A 3SCMD 3ALWA 2DLEA 3I9PA 2FJGB 4MJ4A 2J6WA 4Z8FH 1S7XA 4UB0L 5JO5B 2DLHA 1JWSA 5F97E 1MIML 4U6VH 1KCRL 4JQVC 5A3IC 4ZQKB 1F02I 1XL6A 1QFOA 2AQPA 1JWMA 1Q94B 3AWFA 1VFMA 2PTVA 4IRJA 3SPJA 1MG3C 3MLXH 1R46A 3BT0A 3L3DB 4BGDA 1R3JB 5CGMA 3BE1L 1U3YA 1NDGA 1F00I 4ZZKA 4J3OF 1T0MA 5I1LB 4M5YL 1SEBB 3ARFC 1KB9K 1CGUA 1L7IL 1VFUA 2XZAL 3IE4A 4JVWA 4XC3L 1B0RA 4DCQA 1H6FA 3OQ3B 5GJTH 3MRQB 1FWXA 3D5OF 5DFTA 2JIXD 4KXZI 3LS4H 4UINL 3EGXA 2Q86B 4AUUA 1T21A 5C0CD 1N7MH 4TXVB 3LNIA 2AGJH 4GS7B 4DP2X 5B8CB 1B3JA 1FRGH 4HU8A 1YQVL 1TXKA 5CGYC 3EGDB 1P1VA 3QUXC 2A9DA 3GB7B 5D1QC 1TQBC 1WO2A 2VM4A 3BVVA 5ENWB 2RALA 2EIJB 4P2RD 2VSMB 4M1DH 3CFMA 2B1AH 4F37F 3D34A 3B8YA 3V5KB 4N0UA 4U3HA 1JMZA 3LRSB 4HKBB 3HPJB 3WEMA 3ZDYF 4DP9X 2EZ0D 3ABZA 5BOZG 2DQUL 4HFUL 3IJHB 2OR8A 3KYNB 2C9VA 1I8KA 3MJ7A 4OD3H 4XPBL 2WY3B 4HD5A 4HJTA 1O7DC 1P7HL 2H41A 2QKIB 2Z35B 3CZFA 1BAFL 4TUUA 2ZYHA 4PTTA 1SYSB 1ND0A 3TA3A 1PY0A 3VDBA 4C56B 1T04B 3INOA 1IJ9A 5JLZA 2D2CC 3Q2CA 1J11A 5BUAA 5CS7A 1ZE3C 4KDVA 1U33A 5AALA 5AOLA 3QXDB 1NMBH 4KVNL 2A99A 4U1GC 4BUQA 1XIWC 1LP9E 2BCKB 2NX5E 3MZGB 3DX8A 5CEXB 1AYOA 4RFEB 1BZ8A 2CE6A 4Y5VB 2VLJB 4Z7UB 4AI7A 1AZRA 5J89A 1HQ4A 2BNRE 2F1AA 3TONA 3ILDA 1EERB 3RTQC 1UA6L 2YEVB 2XPYA 3A6CL 3UBGA 5BW7A 3CLEL 4U33A 4XP5H 4FFZL 5JOFB 1E6OH 3LS5L 4H2AA 3FCUB 1T1WA 1P6FA 2DKUA 4B9PA 1ZLWK 1SNRA 1OTSD 4OZGE 3QWRA 1WHPA 4LESA 3CC5A 3FFCE 4L8SB 3AAZB 3QRGH 2V4LA 3VFGL 4NZTH 3V0VA 1IAKA 5DEGA 3FQ1A 5I5IA 5HI5D 3MJWA 4PRBB 3P9LB 2E6JA 2ZX6A 3GIZL 1HQRA 4XVJH 3U36A 3NT0A 2A6DA 3EZJB 2VZUA 5E7BA 4RAUA 2UZXA 4X6CF 4I3GA 3JVGC 3NFNA 4F7TA 3T08A 2R0LL 4Z7QE 2VXVL 3HG1B 3EUDA 2BP8B 3SB3A 1ZHKA 3CXHK 2PKDA 2V9TA 2IGFH 3V9CA 1IGIL 3ECBB 1CLCA 1GCFA 3UAJC 1EGJH 4U1SB 4Y8AA 5FYKU 3QDJD 4UMGA 3V10A 1T20A 2VZVA 2ZYSA 4I88A 3ZIYA 3MTXA 3RVTD 3ME0A 3UP6A 2R69L 1OTTD 5MEQB 2EIMB 4ZX6A 2JB5H 2Y1ZA 1XGRB 4J39A 1CDBA 4JZOB 4AQ8A 1CICB 1YNTA 2CA3A 2Z91A 3OMIB 4F8OA 3QNFA 3QEGH 3MXWL 3QJZA 4HIEA 2K45A 2F58H 3VXSA 1EEYA 5G4OA 3MROB 2N1TE 4UQDA 4ORZC 1YEGL 3BHBA 3BUYA 3BAWA 5J56B 3H56A 1X6LA 4LCWA 5DZNA 3VE0B 1Q72L 3QJSB 1ADQA 3LN4B 3MRJB 4KROC 1TMQA 2DQFB 1KDJA 3QUZD 4RBPK 5IK3A 3VG0L 2QJDA 3KPTA 2PW2B 2RTTA 2BNUB 4UM9A 3CVHH 2OMUA 3BP5B 3FUIA 3ZSTA 1NCOA 3X13A 2FBJH 4MGXA 4UQ3A 4OCXH 1MNUL 3X3GL 1F90L 1IO4C 3FAXA 4APXB 2GK2A 3NJLA 4YSPA 3P4MB 4R8WH 3R0MA 3D3VD 1RKRA 4X7EC 3BSZH 1LM8V 4MD4A 1S7TB 5IVXE 1U3HA 3HJ0A 2UXVA 4ODHH 5DGRA 1OF2A 4LPTA 1WIPA 2PYED 3DROA 4KUZL 5IMLA 3LDBB 1EAPA 2DQCH 2YD0A 3HRZC 4KXBA 4QXUL 5F9OH 4A7SA 1J10A 1QEWA 3LZPA 3ZE1B 3GC3A 3HZYB 3IN0A 2AVFA 3L7FA 1I53A 5EZIL 3ZYZA 3VH8G 1EJOH 1WS7A 3BH9A 1KJ2A 5CLXA 2KERA 1ED3A 4NRYB 4YSEA 5AYUL 3SZKC 3F84A 4OU3A 1SUJA 2GTZA 1E5AA 3ZBMA 2Y06H 3ZZ1A 4CC1A 1OPOA 4WJG3 1TLKA 5J0BA 1CBJA 1BX2B 2H1LM 3UGEA 4HLJA 5ESAB 3STLB 4AMKH 5K9KA 4PV8A 1ZLSH 4PWFA 1NICA 3PE9A 2D73A 3VFUA 3WE1A 1WFTA 3WN5B 4AIOA 5C7XH 4YHNA 5CIPA 2D3NA 2BOCB 5E00B 1A6AB 2IANB 3S36H 4O4YL 4YL4A 1NCDL 1DVZA 1KB5B 5HDQH 5CF3A 1NAMH 3GMNB 4PGBB 2WTRB 1UZ8B 2CHDA 5KBNC 4HXBL 3OKNB 1L0QA 2IG2H 4E41D 1QBLL 3O4LB 5B38A 2X1WL 4U3SB 5DRNB 5ACZB 4K8RL 2I60L 2V2XB 3MRRA 4TTGA 3QPXH 2MKLC 3TJEH 5IVZB 4X7CC 3Q9PA 5JIPA 3NIFB 1G6RB 5GXBB 3ZT7A 1N6UA 1KJ3H 3B9KB 5DTFA 2WQRA 4E5XA 1DLFH 3FT4B 4FTVB 1GGBH 5T3ZH 1PKQB 3CHOA 3ECWA 3QUMB 2VXUL 4OZHB 2AK1H 2ZYRA 1XGPB 3KH4A 3ZQWA 4ECNA 3ZMEA 2YRBA 4NKQB 2H9GA 2HFFA 5IVNA 2CO6A 3EOBB 3ZL4L 3GJEA 1E8YA 1HZKA 1M9WA 1EH9A 2WQ8A 2WBJA 1Z9SB 9PCYA 4RWYH 4C4UA 3DMMA 4JRXB 5JW4N 4MKTA 1MHEB 1GJUA 3T2LA 5FR3A 1NDTA 1J5OH 5B39B 1A7QH 1SN2A 5T1JA 3BT2H 3BUQA 4DT2A 2VWEE 4BUGA 4OCSH 5F0LB 9CGTA 3AJ7A 1E5YA 4FFWD 4FJZA 2ZZUT 2VERA 5T1LD 3WLWD 1KXVA 1V05A 3DVIA 3AU1A 4JN2B 2R1XB 4B9YA 2P52A 4NN6B 1OPGL 5AB2A 2D7OA 3X3FH 4Q0XH 2CCVA 5JIHA 3I50L 4NKOA 1B4TA 1Y0LA 3BAYA 4Q6YA 4MZRA 2Y5QA 1WV7T 3CAFA 2V17L 4PN6A 3FO2B 1SHWA 2KYIA 1RULL 4Q56A 1U91B 4L8BA 3QEQA 5CZXD 1VKXA 5F7AA 1B2YA 4A7TA 2EO7A 4DPBX 2BVYA 2GABA 1MQ8A 2PNDA 2I07A 2W1NA 2WZAA 3RWFA 5I75C 5J06A 4ZUUA 2H26B 1AO7A 4NXSA 4HS6B 3GT6A 1C5CL 3LKQA 2OI9C 4NO3A 1E0OB 3BUBA 2Z7ZA 4OB5L 4ZOAA 2MCMA 5KVDE 4EBQL 4UCFA 4HKXA 4CGUB 2F7PA 3CZJA 5AEAA 3HCVA 4I5BA 5KS9E 4EZMA 1MFCH 4ZNEA 1P69B 1ZIBA 2EO1A 4L3CB 5F3HB 1EPFA 3VFVA 3FOMA 1QW9A 2YN3A 1S6NA 3QXTA 3RPBA 2YMTA 5IVOA 4XXDA 1KENH 3ECUA 1EZVX 4AVIA 1XF1A 2K7QA 4DEWA 1JXKA 2DD8L 2JKWA 4W4OC 4WK2B 2ADFH 3KWUA 2AJSL 5CU9A 3BW9A 4P57A 1F1AA 2E9WA 3OXRB 4UT7H 2MCAA 1O6TA 3HS8A 2CO4A 1G9NH 4R2GC 3KLLA 2FTAA 3FCSB 3RIKA 3F8UB 4J8RB 2UZYA 4F9LC 4DGVH 5TK4A 4MJID 7PCYA 3AVEA 2HRPL 1CVSC 4MAUL 1KCSL 2WLIA 4A55A 1HZHL 1G9MH 3JVFC 1SDAB 1C1EL 3EO1A 2FECI 4HSAC 2BVPA 2YD2A 4L8DA 4MZ2A 5B4MD 3ZHKA 5JXED 4B96A 5LAXA 2D2OA 1ZWIB 1O6SA 1FO0H 2DJSA 2EDDA 2F7OA 4ZOCA 5E1HB 5FO9B 4N2FA 1FFPA 1VEOA 3OKOA 4NQVA 1MWAB 1YC7A 3S96A 3UCRA 4PV9A 2NX5D 3I3BA 4HD9A 5T1MB 2A7BA 5A6IA 2VR7A 4PRPB 4J2QA 1KT2B 1AJ7L 4QXWA 1HL5A 3VSUA 1EFXD 1IC1A 3RVXC 2HVKB 4XE0A 1NEUA 5LXGH 2HJLB 3ZHNA 3VXUB 2AABH 3M88A 1X9LA 3LKPA 4JY4B 5KSAB 1DUYB 2X1XR 1BIHA 3QUKB 1JV2A 5GS3A 2XYBA 4CBPA 5HSFA 5G55A 2EACA 4AWJC 3T3ME 3ALXA 3ARBD 2OULB 1YPZA 5C0DA 2YPKB 1FZKB 3U4BH 4GB9A 1JNLL 1EQWA 4LLYB 5KZCB 3EJTA 1SN0A 1JNHA 3CGTA 4FNLL 1QBBA 5HHXH 4P9HL 2WVUA 2EKSB 1I8MB 2X42A 1NCBH 1UXMA 3L5HA 5BCAA 5I6KA 4OLXH 1KGUA 5DDHA 4H8QA 3HN3A 2Q9OA 1HE8A 4GMTL 3KYKL 4WO4A 1QUNB 3S5ZA 4CVXA 4G6KH 1X5XA 4XHJD 5H37A 4A7VA 5B3NA 4NCC2 5DWPA 3ARDA 1FFOA 3Q8AA 4Q58C 2Q0ZX 2O61A 1WSST 2B14A 3MRGA 3VFWB 4LKXB 2F5AH 2GJ6A 4DUVA 3IXTA 3VI4B 5C92A 2CXGA 4AL8H 4WEBH 3K1KC 3MUUA 3GZQA 5F7KC 5I23A 1AD0A 3NP4A 4NDMA 4PJHB 3TA3C 2YHGA 5JHAA 2CO7A 2D03H 3U6XS 2W07B 2GJRA 3G5ZA 1SY6H 1RD6A 3L13A 1RMFH 2H32A 2VR5A 2HX9A 3KXFA 5FV1L 4ICXA 3GGWA 1P7QD 5C70A 4QWWD 4GG6B 3BKCH 4S1QL 3AS2A 3RZWA 1QRNB 4MS8D 4LEXL 4HX1A 2P7TB 1TVBB 3LRHA 4PG2A 5GGTH 5C09B 1M42A 2CLRB 4UV7L 1DUZA 3LRMA 2XV2A 3U6RA 4HC1H 2EYTB 3K4AA 4P23C 4LLQA 3SDDB 3O2VH 4MXVF 5BW7C 1MFBL 5ADOH 4M6MH 4ZMNA 1PQZA 4YSQA 2Y1AA 3D05A 4G3YL 4S1SL 3RVWD 1A0QL 3CFCL 4XMKL 1HCVA 2AK4A 4WENB 3RQ3A 2APTA 1W72L 2XWJA 3NJGA 4G8IB 4NZFA 3DHJA 1QSEE 5GGVY 3N0AA 4EAEA 4MB1A 2GTWA 5EO9A 2VRKA 3SCMB 3DRQA 1NL0H 2NY4D 2R29A 5C3TA 1WBZA 5CUSH 4I2XA 4W9IC 4FKEA 5FXCH 2NY3D 1WPCA 4QHMA 2BSTB 4YX2L 3UG5A 4QXTA 5CD3B 5C86A 1BQKA 1CURA 1GMIA 2AJUH 4FI8A 2NOYA 4HK0B 1W8EA 4NN5B 1KOAA 3GHBL 3ARYA 4EI5D 4MBOA 4PJ7E 1KCRH 1DO5A 3UABA 4YAQA 1E8ZA 3JT2A 3EDJA 1J1PL 2JIXB 5DQJB 2HLEB 4P2CG 2E7CA 3D1MC 3FPXA 4L4VE 5C0CB 4JANA 5BS0E 2GIMA 3MNWB 1EVTC 3QIWD 1TG8A 3K0WA 2F2HA 2VDLL 4FXLA 4CNIA 2NR6D 1R5IB 4X5LA 5I17B 2Y3NA 2FGWL 2CRIA 2YXFA 5E70A 2HTKC 3MRNA 5EO1A 3N2JA 5EIQA 1X9RA 4P2RB 1I85A 3J2PA 4S11A 5F89A 3L5WB 4B9CA 2QEJA 3PXLA 2Q10A 4YWGH 5D1XB 2DRUA 2CQVA 2IXQB 4BWTA 4OLVL 4NHCL 3T8VA 4NLHA 2EQDA 4KK8D 5AYQA 4LP4A 4NO5B 4WY7L 4X4ZA 4QEGA 2CDEA 2E7BA 4ZMTA 4D9LH 2XBZA 1YDPB 3QZLA 4R4FL 3E3QE 1SF5A 1EDQA 2CNZA 1ZLVK 4ODVL 1BP3B 2PTTA 3LKOB 4O51B 1IEAA 4JFFA 3VFOA 4F80A 5GS2D 5BZDB 5CBEB 1NC4A 1L9OA 4ZAKD 3VGAB 5IESH 1BVNP 4XPBH 5L7XL 3JV4B 1LWJA 5JHMA 4BKSC 2B16A 3KNBA 1CMOA 3HBZA 5CJXC 3QR1A 2H6OA 2VXTH 4ONFH 2X6MA 3DBXA 2FVNA 3NPSB 3BDXA 1XDTT 3CHRA 2ATPA 4FD0A 1QAWA 5T1KB 5KVFL 2ZNXA 4JFYB 4UOZA 1E27A 4GSQA 1QABA 4UTCA 3ROLA 3U0WH 2LW3A 2R0WL 2E7DA 3WNJA 5JW5A 4KVNH 4XN4A 4OI9A 3HA0A 4FQIL 3BQVA 5DMYA 2JCCB 5HI4C 5JORB 1OCWL 2HFGL 2ITEA 3TBVA 4TTDC 5LWYL 4NRXA 5L88L 3PXHA 4Y8DC 5DJ2A 3OAYK 3T77B 2D0HA 1CE1H 3I85A 4OLEA 3A67H 3L6FB 1ET5A 2ALWA 5IGXL 1BF2A 5J57B 1J0YA 2EECA 5LNGA 1INDL 2O6DA 3MLYL 4AY0A 4DN3H 1MELA 4UNVA 2P8PA 3MYZA 4IU2A 1NEZG 4R26H 4QRAA 1DDHA 4JDZA 4NHUA 1GGIH 3VFGH 1JWUA 3K71A 4MQSB 3DYMA 2HTLC 4N3TA 4JE4B 1IMHC 1MREL 4OGAD 2AFNA 2H1PL 3MLVL 1RIHH 4KGLA 2NNAB 2AQQA 4BSJA 1Q94A 3EO9L 3FCBA 3L3DA 5FOBB 3QDJB 1R3JA 4IEFB 2B77A 5LGHL 1RXLA 2R0LH 1BCIA 3SBWA 2BZCA 3IWVA 1N59B 5F9WC 4QO1B 3O6FC 3X1BA 4GSUA 2GCYB 1CFTA 1JE6A 3UO1L 4IDJH 4QLRA 1RHHB 4OBSA 1ZGLP 1CU4L 2J4WL 4PJIE 3MRQA 1II4E 3OHXB 2WMPA 3NP3A 4ES8A 2Q86A 3MGTB 4GUQA 4P5RA 2FWLB 1QOKA 2OMTA 4BFBD 5L0QC 1E9PB 1T4KA 1XCWA 1UM6H 2VW7A 3QRBA 1MQKL 3MXWH 3EGDA 3OJDA 2YUXA 2D3JA 2FATH 3GB7A 2IAMD 2L7JA 5ENWA 4QRTB 3QUZB 25C8H 1E4XH 3BOVA 2WBJC 3DTDA 2WQXA 1YEGH 2CK0H 4R90L 3JTBA 2EILB 3C6LD 1OAUH 3DMMC 3V5KA 4FC3E 4KGJA 3LRSA 4HKBA 3HPJA 4YGAB 5DUML 1YNKL 3VMOA 3VRJB 1G1KA 1QR1A 2ICWI 3IJHA 4N1HB 3NDYE 1HOEA 3DVNA 3NRPA 4BFNA 1NGYB 1S7UB 1ZANL 2DI8A 1MDAA 2QKIA 1SYSA 4C56A 1BFSA 1T04A 4F2MA 4GEIA 1MCKA 2E3VA 1BZEA 5I1DB 5IIEB 1KCBA 3GQFA 2PYEB 4OCYH 5EPMA 3DO3A 5I8OH 3DPBA 4FZEL 2NNFA 5LGJA 3S7GA 2XVBA 3QXDA 2DM2A 2W5PA 4DGIL 1KYOJ 4YHML 2CZNA 2BCKA 4PBWD 4GSRA 1PKOA 1KG0B 4WZ9A 4Z7UA 3EF4A 4KVCH 4G83A 3ESPA 1IAIL 4JFOB 4BZ2A 2QPEB 4EQ3A 1I1FB 5LNEA 4DGUA 1GYVA 4I89A 4R4BA 4XGZB 4PB0H 1XSIA 3DX6A 3RUGA 3IETB 3S6CA 1WDAA 4X6DB 4PGDB 4UZSA 3QHZL 2CIKA 1FFNB 3JV5A 2FGZA 4OJAA 1DJYA 2DV6A 3HNVL 3DIFB 4PB9L 1PX8A 1UFGA 3AAZA 3ULVC 3O9WA 1LHZA 3BAJA 1HDMA 4F5CE 5F3FA 2PF6A 1NAKH 4BH8B 4FE9A 2VXQA 4PRBA 4E41B 3L2LA 2R2HB 1F6FB 2G60H 2TRHA 4I1RA 4RX4D 4D9RE 3N5AA 5A2LH 1EHXA 4R4NC 5D7IB 3SKMB 4X4XB 3E6HB 3IDUA 3PPSA 3Q8FA 4HMDA 1WBYB 4MNQB 4U2ZA 4QRUB 2BP8A 5G4NA 4HXBH 3UIYA 4PRNB 2Y4SA 5MHSE 3QPKA 3MA9H 4DZBB 1UVQB 1YEEH 3BGFB 4K8RH 4FA6A 2WBKA 3MBXH 2GI7A 4DFIA 2VDQB 3LZLA 4JRYA 4XXWA 2ZAHA 2YFOA 4JHUA 5AVRB 1XGRA 3KLAB 5A6LA 4JZOA 1MRDH 5I2IB 3NIFF 1M7UA 4A39A 4X0KA 5I26A 3LEYH 1S7RA 3J7HA 2VXUH 5T5FH 3ATDA 3STBA 1NC2D 4MJ5A 3AG1B 4MNHB 4OZHF 3LHPL 5I18L 3DNKA 3OWEA 1SHXA 1WA0X 3DK2A 4PG9B 2KBGA 3JWDH 4FJYA 3RHWK 1VHPA 3N42F 4PJ9C 1YNLH 3LN4A 1A8JH 4K2UH 4PJCB 1LO2L 2H2SC 1OD9A 2Y36H 2ZXBA 3MRJA 4H5SB 5DVLA 3SE9H 2FZ3A 1TOXA 3GMPA 4M9OA 3VG9C 5T1LB 2PW2A 5IMMA 3N0PB 3DO7B 4Z77B 3BP5A 2IEPA 3QFDB 4BD4A 4I0PC 4HQQL 4M43L 3FONB 3UBXB 5AWNL 4LEBA 5FKAA 4ZMWA 5AB1A 3VD9A 1F13A 4J1UB 3FMGL 3K91A 3P4MA 3U2IA 4CW1A 5LCVL 2RFXB 3MACH 3VAEA 3WIHL 5T3ZE 4MD0B 1Q0YL 2R56L 2XIBA 2Y1VA 1QVOA 1OPGH 3L08A 4CKQA 3C12A 4NIKB 4JFQB 2UXFA 3PFUA 2Z8WC 3ARDC 4Q89A 1NFDA 1WWAX 4XN2A 1HHGB 1M71B 1RULH 1VFAB 1C08B 3TCLA 5BS0D 1CL7I 4PRHE 2FT6A 4XMXA 2WWKO 1T2JA 1GW6A 1CLZH 3AREA 4GAJL 4M7LL 5DC0A 5DJAA 5BUPA 1LVEA 5DHDA 1IT9H 3U46B 1C5CH 1KCWA 2Y7MA 1FE8H 4DO4A 4POUB 3UH8A 4YDVB 5B1KA 2WBWB 5IROA 4KJPC 1O5DT 2MCPL 3EFFA 1LK3L 3NACH 1LLAA 2XZQL 3FT3A 1EZSA 3MNVB 5ESAA 5B21A 4YSAA 1H0DB 4J27A 4CVWA 3SE8L 2IDSA 2OCCB 2OV0A 1JCKA 1S8DB 1OTUC 5CLZA 3DHUA 1B0WA 3B9AA 2D0FA 5SX5K 5BUGA 1SM3L 3DSFH 1XSKA 4RMWA 4XMZA 1FCCA 2WPGA 3K72A 4PG2C 5E00A 3AGVA 1J9SA 5E8PB 4WHTA 3T1FB 3QGVA 4QNPE 1KB5A 1IQDA 2DD8H 2X7LB 2JI2A 3B4NA 4PGBA 2IQAB 1OSYA 1DBAL 4MDIA 5CFHA 4YHZH 3CUPA 3FQUB 4L29B 3VD1A 1J8SA 5ACZA 5DRNA 1I1YB 4ZW7A 4ONGH 1ZLWH 4TRPH 5IVZA 2ZCHL 1N2RB 1AGFB 4P2OC 3WLBA 1FLRH 5EZPA 1G6RA 3VD7A 3HEIB 3NMEA 3O3BB 3VI3E 5AVTB 2NX5B 1LP9B 1Q9LB 1WT5A 1ZT1A 2DWXA 3AQYA 3QORC 4W9DC 3VU2A 4E0RB 2ALAA 2XYCA 1XXDC 3ZKXB 4CSSA 1EFXB 2GFBB 5MEOA 2GW5A 1HYSD 2XICA 1MF2H 2H0JA 1RUPL 1O5PA 1ZLEA 3I6GB 2C9UA 3KJ6H 4OZIE 3MUZ1 2FH8A 1SLUA 1Y1UA 4YMPA 1RSFA 3IDIB 3W9DB 1WFOA 3G6JE 1RZJL 3UJTL 5A40E 2IF7A 1IC4L 4IBWA 5CLWA 2W80C 3ZTNH 1M1SA 1YJDC 4QRPE 5IFAL 1N5YH 4AEEA 5AOIA 4YDIH 1TEGA 3VB8A 5B39A 5T3XH 1PZ2A 4Y1AA 5KSVB 5FYJL 2VW6A 5FPIA 3K2UH 4YHYB 4IU3B 4NB7A 2JTYA 1U21A 4KZCA 4Z7QB 1I85C 4QHNA 2R1XA 3RWEB 1PD1A 3QEHB 4B6ZA 2A4ZA 3UYRH 3F65A 3M45A 4ZX4A 3T6XA 3IKKA 1MRFH 2VXSH 3FO2A 1HL9A 1GYUA 1U91A 4GMTH 3C5SB 3OPZH 4KO6A 2XWTB 1N12A 5GRUL 4K15A 1EO5A 4RBPH 4ZPTB 4IBVA 2Z7UA 4X4KA 2H26A 4XI5D 1LEIB 1ZVHA 4N2IA 2BK8A 1MCNA 4MZ3A 3LKSA 4TPRL 4UTAH 1KEML 2EP6A 2PWFA 3FHEA 4MAZA 4WFHE 3WHE1 4HWEH 1P7QB 4HAGA 4OIBA 4X5QA 2UY7B 4L3CA 1I9EA 4PBVC 5CCKH 1JZ8A 4H8WC 3BIKA 5IOPA 2FJFA 4KAQL 3V5DB 3NZHL 3CPLA 4HF5L 5FFOA 5DHVB 4AEHH 3UO8B 1JF1A 2XPZA 4O2CB 2WLLB 4Y4FA 3V8OA 1F41A 4YHIB 3GSNL 1NBYB 2C3GA 5GS1B 1NGZA 1BGXH 3QUGA 3KPOB 2N56A 4XCYB 3G6DL 3FO0L 3G5VA 3QQ9D 3OXRA 4GG6F 1W6LA 5DZJA 3JZYA 4N8CH 4P48A 4XNZB 4P5MA 1KTRL 3P9MB 4HIPA 3FCSA 1U3JA 3P4LA 1AXTH 4M5TA 4PJ6A 4B7IA 3R19A 5KBKA 1DP0A 1PL3A 4YDMA 3M7FB 5IVXB 2AJXH 1GC1L 2RQEA 3IKCB 2NY4B 2FJSA 5F1OB 3DUHA 4NM4H 1NMAH 3NCEB 3SO3B 2JB6A 5D96C 3RDTD 2NY3B 3CFBA 4XPTL 3CXHJ 3MRFB 4CN6A 3QIUA 3S5LA 4Q6IC 1MWAA 4WTXA 3CFNA 3DETC 1HILA 3N1GC 4EI5B 2BCMA 5KW9L 5E2JA 4L3EA 1ZDQA 3ARQA 3BP4B 2DDQL 2WXRA 3SPIA 1BIIA 1T0NA 3P69A 4GQ9L 2HVKA 2BZ7A 2A77H 3I6LE 5DHMC 5J6GB 3ULUE 1WC7B 2HJLA 2Y07H 4YNYB 5EO0B 1M7IA 2YD4A 4Q9BA 3ZYJA 1AGEB 3QIWB 1RJZB 3KS0H 5KSAA 1DUYA 3B2MA 4EIZC 2YK1H 1UA3A 1B9KA 2XQBH 5AQ0A 4PJDF 3HLKA 1YUHB 3ESUF 1W2KT 2DQGL 4M3JA 3RL2B 1NEPA 4PJBE 3EDEA 5E8EA 2VLRA 3SGDH 4GS7C 5B8CC 2Z1PA 2QPFA 1WGVA 3HUJB 2GHWB 1A14L 2ZUQB 3MLSL 1AQMA 4WNSA 1GH7A 1H15B 4D9RD 3QDAA 3G04A 2HWZH 3LIZL 5LN4A 1NANH 3BP7B 4OGQC 1NOLA 3PYCA 2VB5A 5JHLL 1QUNA 2PP8A 1DSFH 5CD5C 1EXGA 1WG3A 3GFUA 4KI1A 4ORGA 4A6YA 3L3OB 5MHSD 5IKCA 4B60A 4OLVH 3MQIA 3TP4A 1A2YB 2WYIA 4L1HA 5HD8C 4ZAKB 2YPVA 3BKJH 1XTMA 3S37L 4DP7X 5DMKB 1RFDH 4KKCC 3UFIA 2Q8BL 2E76C 1UD6A 3FTSA 3CU1A 4YSDA 3HE6D 4R4FH 3VI4A 3RZCA 2FHBA 2WN2A 5A2IH 2BC4B 4YVNA 1WFUA 2QKIC 4ODVH 3WTUA 3VGGA 1DYZA 4PJHA 5E0QA 4KJYB 4QIRA 2YD3A 3UTOA 4F7PB 1N64H 4X4ME 5DD1L 1TJGL 4OFKA 1CDYA 2EDTA 3BKYH 5D8JL 5EC1B 1A9BB 4H1LA 3QRFM 3EYQD 3H3BC 1NSNL 4XO8A 3WS3B 4L5FL 4MWFB 4JM2D