1L9TA

Crystal structure of the i257v variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLVGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA02
2UXGA 4A2EA 1W6LA 2ZWNA 3FPXA 3H4HA 4YVNA 4DP2X 2YAQA 1PLAA 2YAHA 4HHWA 4M3HA 4X4KA 4CSPA 4E9SA 4PCYA 1OF0A 2VM4A 1ZIBA 1JZIA 1L9TA 1V55B 2LLNA 4BWUA 1X9RA 1BQKA 2OV0A 1L9QA 2HX9A 4FA7B 4YSEA 1MG2C 2IWFA 4PAZA 4E9QA 2GC7C 3OMAB 5B1BB 1MG3C 1JXDA 3JT2A 2YAFA 4BWWA 9PCYA 3AG3B 3X1NA 1AR1B 4HCFA 1BXUA 2HX8A 3EHBB 4GXFA 2FTAA 3ZX1A 3AG1B 1CYXA 1B3IA 1FWXA 1E5ZA 3NP4A 3V9EA 3S8FB 3G5WA 2BWIA 1AAJA 3QPKA 4YSAA 1IBYA 3FYEB 2XYBA 7PCYA 4NB7A 1AZCA 1OE3A 2BW4A 1KCWA 4Q8BA 1AG0A 1L9SA 4A66A 1ET5A 3FT0A 1PZAA 2GBAA 2JKWA 3H56A 3NJJA 3CDZA 1A8ZA 1NIEA 3JTBA 1HFUA 3PXLA 2XV3A 1KDJA 1OOWA 2I7SA 5I6PA 2DY2A 1NDTA 4YSOA 1A4AA 1SDDA 1GR7A 2PPCA 4BXSV 3DTUB 4M4RB 8PAZA 2CCWA 4UAHA 1PLCA 1BYOA 3H4FA 1AS8A 1FFTB 2AFNA 1CC3A 2FQGA 4JHVA 1CYWA 3ABGA 2YAEA 4A2GA 1RKRA 2Q9OA 2IH8A 3ASNB 2VW4A 2VMJA 1GY1A 2MRYA 2YAMA 4GP4B 1NZRA 3CDZB 2CALA 4GP5B 3CG8A 1JXGA 5EHFA 1MDAA 3WNJA 2GB2A 4BDVA 3AZUA 4P5SA 5D4HA 4DP8X 5TK4A 3S3DB 4QLWA 4BWTA 5A7EA 1SFDA 2UXTA 4G7QB 1SDDB 4N4YB 2GSMB 2FQDA 3PCYA 1J5DA 3ERXA 1SHWA 4KNSA 3BVDB 3X1BA 6PAZA 2BP8A 3NYKA 4Q89A 3IEAA 1HAUA 1DYZA 5AZUA 4A2DA 4AKOA 3S3BB 1V10A 3IN0A 2HXAA 1NIBA 2EILB 1PMYA 2XXGA 3L45A 1PY0A 1QNIA 4KO7A 1XMEB 3DIVA 1JERA 2CJ3A 2I7OA 1JOIA 1PLBA 5I5MA 4BDVB 2QDWA 1ILSA 2FT6A 6PCYA 2XV0A 1PAZA 2XWZA 2FNWA 1NWOA 4G72B 5B1KA 2OJ1A 3UADA 3ABLB 2OCCB 1OCRB 2BP8B 4CSZA 4W1TA 1NPNA 3FS9A 1SJMA 2J5WA 1UATA 3T6WA 3AW5A 3BQVA 2PPFA 4DP4X 1WAEA 3FQ2A 1ASQA 4UF7C 2J55A 1NPJA 1QHQA 5I5JA 4DPAX 1L9PA 4HCIA 4DP7X 3EH5B 3X1EA 1L9RA 4KO9A 2IH9A 1KDIA 2VSKB 4AI7A 2QT6A 3TASA 2H5UA 2IWEA 4DP0X 3FSAA 1GS6X 3PPSA 2P80D 2Y69B 1YLBB 2TSBA 3OMNB 2UXVA 3NSCA 3WG7B 5I6MA 3GYRA 2BZ7A 4E9VA 1J9RA 4G7SB 1AACA 1ZIAA 3T71A 3OD3A 4L0PB 3NJIA 1KGYE 2IWKA 1AOZA 3AG4B 2HRHA 4G7RB 3HB3B 4W9ZA 1M56B 5I6OA 1SHXA 1GS7A 5E9NA 1PCSA 4E9YA 1XB8A 2B3IA 1A65A 5FC9A 1OE1A 2DV6A 2YQBA 4WTQA 2FT7A 3CVBA 2YARA 3IN2A 2I85A 3QJTB 3QJQB 3IE9A 4DP6X 3X1GA 1SNRA 1QLEB 2H3XC 2XVBA 5B1AB 2Y1AA 2PPDA 3NJLA 4A68A 2A3TA 3NSFA 2YAOA 3FPYA 2QDVA 1E67A 4HZ1A 2GHZA 3TBCA 1SF3A 1IUZA 1MZZA 2HX7A 1FA4A 4E9TA 1ASPA 3PAUA 4A67A 4BK5C 4YSQA 3SBRA 1URIA 1E65A 4AKQA 1VLXA 4E9RA 4A2FA 3KW8A 1GSKA 1XB6A 4F2FA 1AS6A 2AZAA 3MBWB 3NSDA 1BYPA 2WO3B 2FQFA 2JFCA 2P80A 1JZHA 5B1JC 3IBOA 1OE2A 3X1FA 2PLTA 3SQRA 5PCYA 4DPCX 3EF4A 3NP3A 3NJKA 2BZCA 1ZDSA 5LDUA 3V9CA 4P5RA 1GS8A 1BQRA 2YXVA 1JZEA 3FU7A 3PAVA 3UABA 2H47C 4FAAB 2FWLB 4HAKA 3PAZA 4DPBX 1TU2A 4KNTA 1WA1X 4G71B 2GC4C 2AANA 2HLEB 2PP9A 3FU9A 1JZGA 1KBVA 1J9QA 2YAPA 3FQ1A 4DP5X 3ABMB 1AIZA 2N0MA 3FYIB 4F7KA 1KYAA 3U25A 1KV7A 2PCYA 2DYRB 4YSUA 5F7AA 4WKXA 1OCCB 1X9UA 1MZYA 3FU8A 3CVDA 1ASOA 4MFHA 1WS8A 5D4IA 3TA4D 3UGEA 1TEGA 3FU7B 5PAZA 3T6VA 3NJHA 1KCBA 2XUWA 5I6LA 2XV2A 4JHUA 5B7FA 1A4CA 2UX7A 1E5YA 2J57A 5I6KA 5I26A 4ENZA 1BXAA 7PAZA 2BW5A 4HHGA 2E86A 2VN3A 4AKPA 1JXFA 1V54B 3UAAA 1J5CA 3FSZA 2WSDA 4A2HA 2BHFA 2IDSA 1NIAA 1AG6A 4UANA 3NJNA 5B1JA 2GI0A 4G70B 4K9JA 1NIDA 2QPEB 4N8UA 2BO0A 5F7BA 3S3CB 3TU6A 2FQEA 1RCYA 1IKOP 1N70A 5AFAA 3GXUB 1PNCA 1RZPA 2XXFA 3HEIB 1BEXA 3T6XA 3FSWA 3CVCA 3KW7A 3OQRA 2NRDA 1J9SA 1E30A 4BXVA 3N2JA 5ANHA 3X2QB 1SFHA 4ZK8A 2VSMB 4KO5A 4DP1X 2IDTA 1ZV2A 4YSSA 2XX0A 4GY4A 1NINA 3WNIA 2QPDB 2TSAA 2DWSA 2MTAA 2ZOOA 2CAKA 3D12B 3EH4B 3NJMA 1PF3A 4KOBA 4YSDA 2FT8A 1CURA 1ILUA 1ADWA 2EIJB 3WKPA 2VM3A 4GP8B 2X88A 2UX6A 5D4JA 1N68A 2J56A 1NICA 1GYCA 1T5KA 2YXWA 1ET8A 4AZUA 2BWDA 1CUOA 4QKTA 2CBPA 2VW6A 3DKHA 4KNUA 3GDCA 1BQ5A 1WS7A 2BP0A 2PP7A 4AX3A 1ETJA 1BXVA 1R1CA 3N55A 2B08A 1TKWA 5I28A 1J9TA 1AZBA 2Q5BA 3AY2A 3SBQA 1GY2A 4RH4A 1JVLA 1PZCA 2AVFA 1A3ZA 3OM3B 1ID2A 4YSTA 2R7EA 2FJSA 3CZUB 3NJFA 1TEFA 1SF5A 3S8GB 1WA2X 1AZNA 2XU9A 4NERA 1AQ8A 5I5IA 3ABKB 1OCZB 2XX1A 3RYMA 2VW7A 5B7EA 1L9OA 3ZDWA 3OMIB 1JZJA 1EHKB 2PCFA 2RACA 2PPEA 1BAWA 3C75A 3T9WA 3T6ZA 2IDUA 2BP0B 3WKQA 1IBZA 2IAAC 5B7MA 1W6WA 4HIPA 2HZHA 4F2EA 4JKNA 1ET7A 2PP8A 1PZBA 3SBPA 4E9XA 1WA0X 4YL4A 4YSPA 4E9WA 1I53A 4GYBA 3FSVA 1HAWA 2JXMA 1AS7A 1NTDA 2R7EB 1NIFA 4YVUA 3ZIYA 1AZUA 4NAJA 3NJGA 1M9WA 1AZRA 1EZLA 3UAEA 3ZBMA 1W8EA 2EINB 1IC0A 1A4BA 5IY5B 1F56A 4KO6A 5TK2A 2HRGA 3PLYA 1RZQA 3QJSB 1GW0A 1XB3A 2UXFA 1AANA 4TXVB 3UACA 2WO2B 3WI9A 2CUAA 5I6NA 3QJUB 1ZPUA 5AKRA 1OCOB 3MX0B 1ZDQA 2XLLA 3FQYA 4EF3A 4KOCA 4YSCA 1JVOA 2DWTA 3QJRB 3QJVB 2AZUA 5B3SB 2EIMB 3NSYA 2IDQA 3QQXA 3WIAA 2ZONA 1NWPA 4YSRA 1KBWA 2W88A 1OV8A 4HALA 2ZXWB 2X87A 3NT0A 1JZFA 2DYSB 1M57B 2IDFA 3ASOB 3EH3B 1DZ0A 1PNDA 2GIMA 2W8CA 2EIKB 3AG2B 4DP9X 3TBBA 4HCGA 2PPAA
chains in the Genus database with same CATH superfamily
2Z31D 2WLNA 1KJMB 4XBPA 1M05A 4UUJB 3K80A 1UA6H 1XTMA 4ZS7H 5IQ7L 2HVJB 4H0LC 1CG9A 3MV7E 4JFYB 4LCWD 3LEXB 4NRZA 3V4UH 3OSKA 1F13A 3WXWL 3WKYA 4AZ8A 3AREA 1PLAA 4ZX3A 2ED6A 1I3GL 5CCGE 1A6AB 1JUFA 4P3DB 5C1MB 2AKRA 2HFEA 3BSHA 3VFNA 3KPMB 1ICTA 4KROC 4NWTH 1ZT4A 1P5UA 3BGMA 3RPIB 1N6VA 2LLNA 3FUDA 1MFBH 5AVQB 4P4KB 4J3BA 1DVQA 1TMCB 4I9XA 4MLIA 2X40A 4PY8J 1R19A 2B4CC 2O26U 4HJEA 2P24A 5DK0B 1HWWA 1F3DJ 1KBGL 1MY7A 5HYIA 1UM4L 4JE4B 4Y2OB 3AGWA 1JCVA 2AK4B 4O9HL 3Q2WA 1CB4A 4TVSa 4XOAA 2Y07L 5EZJA 1BXUA 2ESVA 4WI7A 15C8L 3BKYL 3PJSB 5J8OA 1CYXA 1DQIA 1U3HA 5GRXG 1P84K 5EU6A 3X3FL 3QORB 3MV8A 4NLAA 3SKOB 3RDTD 3WXWH 1UASA 2XACC 3F00A 3HNSL 1OE3A 1I3GH 8FABA 1OLZA 1XCXA 4ZUUA 1QVOB 1SLXA 2Z91A 4M93C 5JA9A 2EC9U 4ZMPA 5JOFB 1UB6B 1OM3L 4HLZH 5EPMA 1G1OA 4EQ3A 2H6PB 4DO6A 3BUPA 5F3HB 2XTJC 4BFIB 4P4KD 4YSOA 3NZHL 5LGKA 1R5WB 2QHRL 3MRJA 3QQ3A 5KVFE 1KBGH 1UM4H 1YEWA 4MAUL 4B41A 1PQZB 3AB0B 4O9HH 5KS9A 2AK4D 3D1MC 5D1XC 4ALAL 3NIDE 15C8H 3BKYH 5MEPA 2D3VA 1Y18A 3QWRD 4TLSA 5GHWL 3ASNB 4DTGH 4YZFE 4P3CH 4X9FA 4LPCA 5KSBA 5DZPA 3QORD 2XOTA 2FNBA 4XPFL 4X4ZA 5IFAL 4L8DB 1YO4A 3CG8A 3HNSH 3KEHA 4LB8A 3RWGA 1MDAA 1BG1A 3PHOB 1AXIB 4L8SA 1PBYA 3OR6B 1I7ZA 5D7SL 3HS0C 2N1TE 5EC1A 1OGSA 3Q2VA 4IBUA 2B77A 4IJ3C 2I32A 4XN1A 3LPFA 2EDJA 4KNSA 4PBDA 3BVDB 1OM3H 4MZ3A 4K7FB 4YHPB 2W60B 4LQFL 4AKOA 5AZUA 3NZHH 1GZQB 3WYRA 1AQDA 4D0BA 4WK0B 2QHRH 5CHNB 2H0FA 3PRZA 4MAUH 4I48B 4UTBA 1IJ9A 4MWFB 3AXHA 3INUL 5E95B 5LUMA 2BMKA 3MRNA 5E7FA 4ALAH 2QKSA 5I9QB 4ELMF 3CZNA 1T0NA 1ORSA 2VISA 2WZPD 5BO0D 5GHWH 4APQD 3BESR 1WAAE 3BDXA 4BJLA 1A9BB 2XTJE 4U3SA 4PJ7B 3RI5K 1B3JA 4WWID 2X70B 5IFAH 4FOMA 4FQXB 2FR4A 2E4FA 1OP4A 4ECNA 3SYQA 2PR9A 5D7SH 4PHZA 5D1XE 3UH8A 4X0KA 3DXAB 1LO5B 3IJEB 4R84A 2CR3A 4IOIA 4K2UL 1SJMA 2JNZA 3QQ4B 1PL3A 4WJG3 4HK3J 4QOKE 4NHCL 3SZKC 4ATTA 1C7SA 2PPFA 4OFKA 2ICWI 4IOSD 4LQFH 2NCMA 4M56A 3UTSE 5IKCA 3MNMA 4PU2A 2ENYA 2GIXA 3FT3A 4PGCB 4PWIA 3QDHA 5ITFB 2IF7A 4PJAE 2E6JA 2VSKB 3INUH 4N0FA 3CCHB 4AI7A 5KS9F 1GXEA 3TASA 4N2AA 5D4QA 1Y07A 1YAZA 4RDQG 5AYUL 1ZTMA 4EN3D 5DZOA 3IDIB 5DJZA 3TZVD 3EO1B 5IB5A 3ZDYB 1IFRA 4J5VA 2UXVA 4UQ2A 2XVKA 3ARYA 3MI6A 4PP1D 4WENB 5KSBF 2YLKA 1UOVA 3QBTB 4YBLB 1ZLUH 1ZIAA 1XF4A 5L2KB 5I73B 4YEEA 2IWKA 4FQXD 4PJ8D 1AGBA 4Q74A 2F0CA 4TTDD 2HRHA 3HB3B 3U30B 2CLVB 5IJKA 5I8EA 2XY1A 4K2UH 1PCSA 5EO1B 1LE9B 2DQTL 1OE1A 2DV6A 4TNWK 4NHCH 1WWCA 3ULVL 4MMXC 2G5RA 12E8L 4KQ0A 1CVRA 5CGYC 4NC0B 1TCMA 3WNOA 4YXLL 4ZFFB 1QI3A 1LEIA 2F54E 4GLRH 1JZ8A 2UWEA 1I8AA 2VXQA 4HT1L 4I0PB 3C5ZB 1UZ6F 3D25A 3JWNE 4PJBE 2A3TA 4Z18A 5AYUH 3B56A 5B8CA 4HJSA 5E24E 5D9SA 4IMKC 4JHBA 2BCMA 3HG3A 1RH8A 4GQ9L 3BO8B 3TM6A 3GM0A 4TQEL 1FYHB 2CBMA 1HWGB 4IU2B 5GRVL 3ZTNL 4XNDA 3ULUD 5DGQA 4RNRB 3HW7A 4LL9A 4P5TD 1N6UA 3HB3D 5CILL 2AV7A 4FFZA 3RY5A 4OLEA 1GYWA 1YMMA 2BS71 2DQTH 4NZ8A 3S8WA 1D9KD 3K8LA 4HCRL 3ULVH 3S5LB 2BVYA 3NCXA 4UDUA 1JZHA 4OZIB 3IBOA 12E8H 1JGEB 1NBYB 1YN6B 4R7NB 4MYPA 2E59A 3GMRB 4YXLH 3TBVB 3D0LB 4OVVA 2W95A 5GS0L 5I0WA 1BQRA 4HT1H 4X4YA 1XO8A 1CBVL 4PRHD 2EO7A 5C8JB 1ETA1 3C5ZD 1LO4L 2RD0A 5HPOA 4BSVA 1IGML 1XIWC 3RX9A 5J57B 5LXGL 4ZRGA 1FFPA 3O6FA 1JF5A 5IW6A 1JD9A 4D8PB 1HOCB 1JZ7A 1EEQA 3PQYB 4GQ9H 4CAGA 2WBKA 4FKEA 3C60B 4NENA 3ZTNH 3ATDA 5FB8A 2CO7A 2A73A 4ODTL 1JPGA 3F8UB 5C07A 2YKKA 3NAAL 5KYNA 1ASOA 5CILH 3NCYP 3HRZA 5D1QC 3DO7B 2OMUB 4HCRH 4R97B 4U7MA 2XWJB 1UCTA 3BD3A 5ABDE 4Q14A 4XI5C 4HP5A 4LSRH 3VH8B 3L3HB 1NGYB 1H3VA 2AXJA 3QUHA 4IK6A 4TS6A 5GS0H 1JGVL 2J57A 2UWEF 1G7MA 3FQWA 4GAAA 1OQOA 1L0PA 3ZE1B 4HH9A 1VFOA 2JK5B 2A0LD 2Z92A 1LO4H 5DFTA 3BAXA 1V54B 3IRCA 1IGMH 5LXGH 2YEZA 3TF4A 3L4WA 3SDAC 2PTVA 2IDSA 4PRAA 3QZWA 4MXQC 1BXXA 4K9JA 3PQYD 3K71B 2J6WA 3RL2B 4R7XA 5F9JA 3WNMA 4H20L 4K3HA 4HIEA 4HJ0D 1XHHA 4EDXA 3NAAH 4ZFOL 3OLDA 3RGVA 2IVFC 2ZWLT 1U33A 2OXHB 1WBZB 5DO2C 2J44A 3BP7B 4CMMA 1J9SA 4ZK8A 3MRHA 4GBXD 4NPYB 4FYTA 2OMYA 3QUKB 4U7SA 4BK8A 4ZG1A 4TQIA 2ZPKL 1F3RB 3PL6A 1I7UB 3DHJA 1O5DT 5D7HA 3L5JA 1M2VA 5CGBA 4KOBA 2H8PB 5BS0E 3BYTA 5DD6A 4JJ5A 3KNBA 1CD8A 1U8NA 1NUFA 1WC7B 1HHGB 3OHXB 5HHNA 1EANA 3MV9B 3BZFA 1E5BA 1PJ9A 5E2UL 2R4SL 5AVVB 4CADA 3RDJA 4Z7VA 3JYBA 2XWBB 3DX7B 1UEYA 4YDMA 3DK0A 2C1OB 1U92A 4N8VG 3VD1A 3C09C 5SWZE 4GW4B 4H20H 1KYOJ 4OZFH 4MZ2A 2EE2A 5IBUB 1UKTA 2Y7QA 4GKOA 3MJ8A 1MJJA 2QQQA 2OCFD 3RURA 1MAML 2GJ6B 3MRLA 3BWUC 3IE4A 5E1QA 3TCTA 1UEMA 1H3PL 2FO4A 3CZKA 4CU6A 1S7WB 1T83A 4B7LA 3LIZL 2ZPKH 3I75A 1CPUA 2CR0A 2Y7OA 1TEFA 5MHSE 1ND0A 2VLKE 4UB0L 2P48B 4NKQB 4K94L 2ZZUT 3ABKB 2H3KA 4DGWC 3NUKA 1SXAA 3DX0A 1IKNC 2MHAB 2R4SH 5E2UH 1UUSA 4QRBA 3X13B 4IRSB 1S46A 2VR9A 1GAFH 3MUHL 4P49A 3UIYA 1FV1B 4PJIE 4QRAA 3CFBA 4JCLA 5F7LB 1MEXL 2IDUA 4IKNA 2ZYRA 5T8IA 2HT4C 4NI6A 3L4YA 3QUMA 1K3IA 3BUQA 3QXDB 5DSCA 1PZBA 2VAAA 4LRIC 4URKA 1I53A 1MI5E 4Q4EA 1R47A 4ISVA 3BRFA 4YZWA 4P2QA 4C8XA 3ILQD 4L4VE 3VFTA 1CE6B 1SUHA 2G4GA 3S34L 4E9LA 3B5HA 2GSIA 1H3PH 3W0WE 2VN6A 1XTLA 3AXIA 1KLUB 4FQQA 5F7MC 1A4BA 3KBPA 5IGXL 5FXCH 4UB0H 1U8CB 5EN3A 2DL9A 4K94H 1CXKA 2HPTA 4X50A 3CFUA 1BJMA 3BC9A 3BW9A 5HBBA 4RIRA 2LU4A 1QSFE 1XZ0A 5T5FL 2XG4B 2ZXQA 2F9BT 4O4YL 3WS3A 4Z7VF 3GLZA 5HHQB 3D48R 3DX8B 4IRSD 4YBQD 4LOVA 2HTLD 4UCFA 1MEXH 2UYLA 4C83B 2E8ZA 1DUZB 2ZONA 4U1GB 3WFHA 4UM8B 4MD5B 4FF9A 3AQZA 5B21A 3RY6C 3VWKA 4IKKA 2MFNA 2NX5E 2WZ0A 4ZFZA 1X3DA 4ZO7A 3RHWF 4EI6B 5TDOA 1M57B 4LCIL 5MEQB 3S34H 3P3TA 4H8QA 3HAEG 4U1LB 5GRUL 5FYKU 4PV8A 1CFBA 2JCCB 5H37A 3TJHC 5F9AC 3V9FA 4FCHA 5IGXH 3Q3GA 1WTLA 1UA3A 4XXCA 4ZFGL 3O2VL 4AGQA 2ICWB 1YNTA 4F37K 2VLJB 2EYTB 2HKFL 4X4KA 1ZHBB 3BUTA 3QHFH 2Z0BA 4NFBA 5T5FH 3HR6A 4O4YH 5K9KA 1YY9D 4M3KB 5JDSA 1J05A 4IMLA 3X14B 5T1MB 3CZEA 3ULAB 2VABB 5J6HB 3O3DA 2KT6A 3TEWA 1ZXKA 5JMRA 3BFQG 5DMGD 3U0TB 4CC4C 1HE7A 1V27A 1MF2L 3G5YB 5E8OB 3QEQB 2J88L 3AS2A 5H35A 4R4NC 1XMWA 9PCYA 4LCIH 5AAMA 1AR1B 4S1QL 1Z5YD 5GRUH 2IGTA 3A24A 2EE3A 3FCTA 3FT4A 3G5XA 4IM8A 1CLOL 1U42A 1HYRC 4ANVA 3EBHA 4UQ3B 2D8KA 4WTZG 4R3SB 3DECA 3H3BC 4ZFGH 3O2VH 1LDPL 3TFKC 2BH0A 2HLFC 2HKFH 3C8KB 3AS3A 4WO4C 5HDOA 3S4SB 3WTYA 1DTUA 2NLJB 3RB7A 3FT0A 1XXFC 2IBZY 3NSJA 4L37A 1VZIA 5B38G 3ETBF 5D1QB 3QYMA 4JQIA 3WJLC 2FAUA 4PGEB 2BSDA 1ZVHA 3SDYL 1KXTB 3CNKA 4KI5D 5F6HI 3AACA 2PWGA 1MF2H 1W72L 1Z0NA 2J88H 4ONGL 3QEQD 5B3NA 2AFNA 3FUIA 3MJ7B 2R59A 4Z5RB 2MMXA 3VFVB 3D3VB 4PJXA 4S1QH 4XP5L 4OLWL 2OX5B 4TNVK 1AR1D 3ABGA 3G04A 4GSDL 4HUVB 2XQYG 4LO9A 4LHUA 5I18L 2GSGA 3IGAA 5A2IH 1CLOH 2Y3NA 3MCLL 5BRZE 3BIAX 3SDAB 3SDXB 3QUXD 3DX6B 2PCPB 1LDPH 1X6LA 3BISA 4WUUB 4WF7A 2GAZB 1VACA 4JFDE 5EUOB 4KFZC 2WVUA 4KZ0A 4AVHA 3VUAA 2ZXGA 4X8JA 1Q94B 1J18A 3L7EB 4N4YB 2IWGA 3V4PA 2QELA 3KLQA 3O8XC 1EAOA 3SDYH 3EGSA 2R69L 2IH3A 1U3ZA 2L0DA 2HB0A 1W72H 1ZLDA 4HEMA 5D2NC 1ZPLA 2LW3A 3ZRFC 4CNIA 3D07A 1G9HA 4XP5H 4OLWH 4GSDH 1CL7I 4EZMA 3Q6GH 1IKFL 5I18H 5JIDA 1AHMA 1KYDA 5CSBA 3SE9L 3VNYA 3MCLH 3GF8A 3APDA 1UWEL 1KPVA 2CO4A 1PIFA 5FYJU 3VU2A 3F5WA 3KPLA 2XV0A 2XWZA 2E9BA 2ENPA 3BFWA 3ESMA 4Y1AB 1DBML 1SRDA 1ZVNA 4HF5L 1R33A 4N90D 4V1DE 4YK4C 4XP6L 3EDKA 2B8OT 4PRBA 2ZJSL 1I8LC 4F8PA 1ETB1 3X12A 5CKAA 1R75A 5SWQB 5CJXC 2IAMB 2EEXA 2HT3C 2NOYA 2LTQB 3EOTL 4DP4X 1Q9OB 3H7BB 4UF7C 5ICZB 1O6SA 3OL2A 1WGOA 2Q2LA 2R69H 4HIIA 2X2UA 5B39A 1LDSA 2XQYK 3EH5B 3IMWA 3BXNA 5BUPA 1A4KB 3UCRA 3BE1L 2ADIB 2X4TB 3GZPA 4PJXF 2H5UA 5EB9A 3SE4A 5IVXA 2CJSA 3FSAA 4Y9EA 4R90L 3QNXB 4I3GA 1IKFH 4LFHD 4IGBA 2NR6C 2YSSA 5DUBA 3SE9H 1H0DB 3O9WC 3NDYE 1E42A 3GRWL 4N87A 3SYCA 3V0VB 6CGTA 3QISA 1DBMH 1BOYA 4JL1A 5T3XD 4HF5H 3BP5B 1D5MB 3ZTJG 2XWXA 4Y19B 4XP6H 4DPRA 3ARFC 2ZJSH 3QJFA 2D2OA 1E5AA 1S4IA 3HNVL 4DJMA 1HHHB 3RTLA 3ZKNC 1D6EA 3VB8A 2C3HA 1Q9KB 2FT7A 3EOTH 3ZO0A 4NKOB 3U6XS 5J12B 4JGMA 4DK6A 1RJZB 4G6AD 3HZMB 1HTYA 3DOHA 4MB3A 1H19A 1DJZA 1UACL 4PY8I 4XP1L 3WFDL 5CFHA 4KXCA 5B1AB 2ZSVA 4AE1A 1MLCB 4XNUL 4EMZA 4WHDA 3BKML 4FA8A 5IT2L 3BE1H 1EJFA 2YAOA 1ZGLM 4R90H 1WK0A 2QLVB 5DJYB 2F8XC 3S2CA 4Z3IA 4KX9A 1R3JB 2IV8A 4OGYL 1MZZA 4JO4L 3RUGE 3ZZLA 3ZR5A 3RKDD 3GRWH 1BQHA 3ZQXA 1CBJA 1ZLSL 5BW7C 4NQSA 4PRIE 5DD0L 1CZ8L 2HT2C 4A2FA 1JZDC 3KW8A 3RIAK 1L3NA 4JRXE 3FZUC 2LLGA 3VFOA 2R2BA 3DYOA 1NBCA 4U6HB 3NZ8A 4Y19D 1U58A 4B3EA 3HNVH 2G2PA 4GIAA 5BUGA 2JB5L 1PJWA 5G5DB 4ERSL 5HI5D 3OKNA 4Z7AA 1NEZG 4PIRF 1I1AB 1YEKL 5DF0A 3WTSA 2P9RA 2DM7A 2LU7A 2C34A 2XBTA 4QRPA 4DPCX 2BZCA 2ZWSA 3WFDH 1X5GA 1UACH 3II2A 1TLKA 3AM8C 2YXVA 3WGUB 1B9KA 4XNUH 5DZVA 3GSXB 2Q7YA 4MD0B 3BKMH 2LOEA 5BOJA 5JHMA 2OAAA 5IT2H 2Z4QA 1BAFL 4FHJA 1AO7D 4LLVA 5JXED 4G71B 4UAOB 3TN0C 3N9GL 3AREC 3MRDA 1QRNA 4OGYH 3B9KD 4JO4H 2ODHA 1QSZA 2N0MA 4P48A 1P5UC 2BIOA 4QTHA 1ZLSH 5DD0H 3VXRE 4UU9B 1CZ8H 1Q9WB 2F18A 3KJ4C 4HIHA 1T2JA 2X9XA 5ICUA 4JQXC 1TEGA 3UYOD 4ERSH 4X6FB 2ALWA 3T77A 1YEKH 1SJHA 2V5YA 4TVPD 3W2DL 4NUQA 1I1AD 4RRPM 4GO6B 2C7UB 3B7SA 3D85A 3HC0A 5I6KA 4FFWD 3DX3A 5KVMC 1A6ZA 4HHGA 4F7MA 1BAFH 2X12A 3JV6B 3QIUB 1SEBA 3VW3L 2HUEA 1H6UA 3N9GH 4UOJA 4JFED 4Y16B 4EE2A 1T21A 4QJ5B 5K1VA 5ELIA 3NJNA 3NEXA 3QULB 3MNDA 4PRPE 5AZ2H 3WTXA 3JTTA 1T22B 3VI4A 4PGDA 4Y4FA 5C0EA 1U6AL 3QXUA 1IKOP 1N70A 3S36X 4KRPC 4BM7A 3EF7A 3EAKA 1LP9F 3GGWB 2E7LC 1NMAL 2UZIL 4MJ5A 1R9FA 4QF1A 3G6JA 1EDQA 3WS6A 2G0KA 2CR6A 2NRDA 4F80A 1A6VL 3DVGB 4WWKD 3I6KB 2IDTA 5GQBA 2GJZA 5ICXB 3W2DH 4HFUL 3HCVB 4M1GL 1HHJA 3NCCB 2AMUA 2IALA 3MCG1 1C12A 1BLIA 3SCMD 1T7YA 2DEYX 5AW8B 4U6TA 2O4EA 1RIVH 3GMPB 4LHQB 4TPRL 3F7VA 3LV3B 5CLYA 4JCWA 1ADWA 3VW3H 2VM3A 1JHTB 2C8NA 4XAKE 2BY1A 3QIUD 1Z9SA 4S1DD 2WNXA 4L8SC 1M7DB 3TT3L 3UYRL 3VD9A 4NJAL 3GZKA 4Y16D 3BH9B 1TZHB 5CIPH 4ELME 4NRYA 4G80B 5KSUA 4AYFB 2X4QA 1NCDL 4OQTA 3CLWA 5LCVL 4AM0Q 3EYVA 3HJEA 5EU5A 4UTAH 3WTUA 2ZXDA 1Y0LB 3IFPB 3FCGA 2PW1A 5DMIL 3TT1L 1DO6A 2WXGA 5TDNA 5GZOA 2WAHA 2UZIH 1NMAH 1CK0L 2HH0L 3HBZA 5A2AA 5AEAA 3MFGB 1JRHI 4G8IB 4U1MB 3TX4A 5DRXB 1A6VH 3DJRA 4PJ9B 5HXMA 3SJVE 3EO0A 1AY1L 1NJ9A 3KXFE 2Q5BA 2KLRA 3CFQA 1SN0A 2NNAA 1WSST 4X6EB 4HFUH 4M1GH 3QR2A 1ZLVK 1JVLA 4PJGA 4YSTA 2R7EA 1A2YB 1FFNB 4HMDA 4NT6B 4OAWB 4URTB 2Y7MA 1MHHA 1AZNA 1T7XA 2H32B 4TPRH 3U46B 4NLHA 2FATL 1OCZB 3R7QA 1TO4A 3V79C 3HZKB 4NKMA 5EOCL 5D2LA 3UZQB 2R39A 3TT3H 4OGAC 3UYRH 1JZJA 3VRLF 4E0RB 4NJAH 5I17A 4RMVA 1OSZA 4U1KB 4XWGL 4JFQB 4R9HA 2BP0B 3ML9A 1BPVA 3HMXL 3W39B 3HG5A 4I3RL 5DT1L 1OL0A 5LCVH 4E42B 4PYHA 5HGAB 5GGSA 2OSLA 4TNFA 3S5LG 1LVEA 2HJLA 3SBPA 3VI4F 1PY4A 5GS1A 5DMIH 1KYFA 1CK0H 2ARJQ 1TQUA 2HH0H 3FTGB 2BS8A 1UCBL 3IU3A 4OLZL 4M61B 3VXUE 3S9DB 1W9XA 3G6JF 4LNRB 2E5EA 2DEXX 1UT2A 1KNOB 2VXSL 4GXVL 1IE4A 1OAZL 2VDKL 1AY1H 2CO2A 3CZFB 4PJ9D 2DMBA 5CGTA 1KULA 2BY0A 3OB0K 4JUSA 5ETUB 3VG0L 2FHBA 4FTVB 4B9CA 3LKRA 3SODB 1P2CB 4WNQA 1E9OB 4FXTA 1MRCL 1RZQA 2VJ0A 3DHPA 3LNDA 1IEHA 2FATH 3L4VA 4L3FA 1WCQA 5C0DB 1UD6A 3QAQA 4EZLA 1WD9A 4NHUB 3D2UD 5EOCH 2UY7A 2BLFA 3E2HB 3J2PA 2XLLA 5HYJE 3RTQC 3P3UA 4X7TA 3TTYA 4XWGH 2K8MA 4CU7A 4YSCA 1FNGA 3ILEA 2PYEA 1P1ZB 3HMXH 2AS5M 4I3RH 4QCIB 5DT1H 5DRZB 2Q3AA 2UZXA 3T1FA 1UZ8A 1ZE3C 2OMVA 1PCXA 4KXAA 1H5BC 4QUOA 2X9WA 2CKBA 4OLZH 2DRUA 2X2HA 3VH8G 2AMGA 5DEZA 4EI5B 2GY5A 2VXSH 4GXVH 3HPLB 1OAZH 3WJMB 2VDKH 2MCAA 5EEXA 4OBSA 1EXHA 3AG2B 5D55A 4ETQA 2PXYB 3I84A 4HK0A 5E8DL 5EO0B 2I9TB 1NC2A 3LY6A 1P6FA 5B8CC 4PJGF 3NCWA 1DQKA 3VG0H 2XKNA 4QRUB 2V7HB 4K7PL 1PD1A 4FYSA 4RBPK 1MRCH 3FL7A 3GKWL 2WQSA 2G3MA 2X4RA 4IRZL 3R06B 3LXCA 4MXVE 5D2LF 4PV9A 1G7HB 3UEQA 4AIZB 3G6DL 3MBEA 4PQXA 2CMRL 1U8QA 3UTZA 3L9BA 2QVKA 1TG8A 1JGLL 4OTXL 2Z0UA 4UMSA 3SPHA 3L2NA 1AE6L 3EYOB 2BCKB 4G8FB 4KC3B 3KCPB 3P02A 1HEZA 5JW5A 1Z5HA 1M05B 4OJEH 3ET9F 4EI5D 3BOVA 1MCJA 4GG6F 1CG9B 4N9GA 4AZ8B 2XICA 5E8DH 5KYWA 1I7RA 3N43F 4YFLF 2YRLA 1B3IA 5C3LD 4HFWA 2NNFA 3L4UA 3ZDZB 3O6FC 3RDTC 2AKRB 2EP6A 2HFEB 3BIKA 2MOVA 3G5WA 4H1LH 4K7PH 1U3JA 4P4RA 5F6IC 2BOCA 3IMBA 1ZT4B 2WXPA 1P5UB 3BGMB 3QFDB 1ADQL 2NY3D 4IRZH 2VN4A 1L4IA 3V4VB 1P4UA 1GJUA 4PY7B 3PWVA 5ECGA 1DN2A 3G6DH 5FYLL 2CMRH 1F6AB 3P4NA 4PM1A 5IBUG 3D4YA 5GRJL 1JGLH 4OTXH 5EZJB 1AE6H 4LCWE 2ESVB 2VIRB 3TVMB 1DO5A 3MXWL 1B2YA 3MJ9A 3PF2A 1U3HB 3T0DA 5EU6B 4S10A 5L2JA 3MV8B 2FQGA 2QGEA 4NBXB 3V6ZA 2Y0SA 1ZRUA 4DCQB 3BAKA 1S7VA 1E4XL 4R2GC 3O45A 8FABB 2VMJA 4KKBD 3TV8A 2DBLL 4FJYA 4XMTA 4HUUB 1AP2A 3NIGF 4XAWL 4UOZA 2CALA 4KKAC 1P1VA 3O11A 4X7EC 2M8XA 5EPMB 2AJYL 4HVBA 4LOFA 4P5SA 1WF5A 2LABA 5CJOL 1BWMA 4FS0A 3LZNA 5A7EA 4JZJC 4YEFA 3IGUA 2Q10A 4Z7QF 5FYLH 3RGVC 3MRJB 4LESA 3X11B 5JPMA 4L9DA 1SHWA 4TM9A 3B2XA 6PAZA 1J11A 1UWFA 1JTPA 1KB5L 3NYKA 5KS9B 1EDYA 2V33A 4A2DA 2P4AB 4H0HB 2D7NA 1W15A 2VERN 4R6UA 5JR1L 3P73A 2HXAA 4PWKA 5MEPB 3WTTA 3MXWH 3PL6C 1Y18B 3QI9D 3TVMD 2P46B 2DF3A 3D4CA 2ZWKA 3E6FA 5C6PB 3NMEA 3PHQA 5EOQL 1O7SA 1U3HD 1HQ4A 3EYFA 1KFGA 5TH2A 4PI0A 2EDTA 1WZAA 3I02A 4I2XA 3STZA 2DZEA 1C8QA 4APQC 1L3WA 1U8MA 3RWGB 3ECBA 1E4XH 4QR7A 4YHIA 2EE9A 2DBLH 1D5BB 4CDHA 4FQ2L 4XAWH 2FNWA 4QAMB 5B1KA 2VRKA 4NDMA 2ZUVA 2AJYH 2CQVA 2KZKA 1WFNA 1YC7A 5CJOH 2OK0L 2AK4E 1CIUA 3VE0A 3MKKA 4OF5A 4HG4J 4LLYA 3T65A 1XGPA 1AQDB 4B0MM 4D0BB 5EU4A 2YJQA 1QUPA 1YQ2A 4NNXA 1T2QL 3RIKA 5ADPL 3GMOB 2BMKB 3MRNB 2FSEA 4P05A 2VXUH 5JR1H 1T83C 1FNEA 5E99L 2APBA 1ORSB 4DP7X 2YBRA 1O0VA 1Q0YL 1A9VA 4ZZKA 5E5LA 5EOQH 4ABVA 3OWEA 3CSPA 5DUPH 2CUIA 3B34A 4UNUA 2EXTA 1TQCC 3DBXA 4XB7A 1BBJA 4EN3C 1QFWI 4CGTA 3TZVC 4NN5B 3PWPB 2FR4B 2OTPA 1L0XA 4DQAA 4JX0A 3SQBB 1J9RA 2GUOA 4HJUA 5EOTB 3T0ED 5AG8A 4FQ2H 4FXLA 2OK0H 1N3NA 2J8HA 2ZF9A 3K46A 2FEEL 3VXSB 1ZLVH 2AF2A 4X6DE 4J2QA 4NZTL 1BIIA 3FT3B 2VT0A 5FC9A 3SDCD 4NQVA 4QLRA 2IPKA 4YWGL 1T2QH 2CPUA 2H7WA 2IPTL 3N85L 3QJTB 4PSPA 5ADPH 3EJCA 2YEQA 32C2A 2V9UA 4AMWA 1QLEB 1PEZA 4K5LA 5E99H 4Z7UA 1Q0YH 4NCDA 1OVZA 5DJZB 4JFSA 4MNGA 1E6OH 4MJ6A 3D52A 3PWNA 5C9JA 1CICB 2ZSWA 3T2QA 2C4FT 4L2YA 5F72S 3ZTCC 1HINL 3QDGA 3MA7A 3D4ZA 3PWPD 5FYKD 4YHZL 4JGUA 3S4SG 4NIKB 3B7RL 5I8EB 3MREB 3B9DA 2VZSA 3LVTA 3LHPL 3PGDA 3U2IA 1AGFB 4P23B 4LT7A 3WN5C 3DV6A 1E65A 3ZMEA 4NOBA 4V2CB 4I87A 4KZEL 3LTVA 3TA3A 4P5TC 1OW0A 1SYVA 3OB0H 4HJ1A 3CMGA 1NCBL 3VXSD 1H9VA 2NY4B 1S7QA 3S6CA 1D9KC 4NZTH 4YWGH 5EH1A 2IPTH 3N85H 2F2HA 3EF4A 4UILL 3QO0A 4G1EA 4P5RA 5D9SB 5KTEL 1JZEA 3NVQA 1E2WA 2BVEA 4JFFD 4JZNA 1R5VB 4YPJA 1LWJA 3KWWA 4XXCC 4LGRB 2BINA 5C86A 2GC4C 3UJTH 1T04A 4ONOA 1G7PA 1CICD 1HINH 4HPOL 3A4FA 4YHZH 5HD8C 1D5IL 4TVUA 2V5RA 1H6FA 4LXFA 3LHPH 1P4LA 3U25A 1KV7A 1TOXA 1Y7VA 1C5BL 1E8XA 1XXDC 4P23D 4KZEH 1OCCB 4HDIB 1NLBL 3FHEA 3ISYA 1F97A 2ZUSA 3CU1A 1NCBH 3F2LA 4X6BA 4MNHA 2NY4D 5GIRA 3DV4B 2WN2A 4I89A 3VRJA 4RBPH 2B4CL 4AJYV 4BFJA 4X4YB 2IGLA 4PJ5B 5AAMC 5DMKA 2COVD 3LAFA 4KDWA 4GRLA 4UILH 1DVSA 5KUKA 4ZW3A 1DL7L 5E2VL 4BSVB 3ULUE 5KTEH 4WRLA 2AHIA 1WVZA 1FFPB 1QYGH 4ENZA 1GL4B 3QJZA 3S5YA 5IW6B 2UV3A 1AOHA 2V9TA 4LASL 4KKQA 3IF1A 4N28A 4TULL 5LGHH 4WHTA 4NENB 5FB8B 4HPOH 2CO7B 4GIPD 4BELD 1JPGB 5C07B 1D5IH 4XO9A 4L8BA 1U8IA 2O5XL 1YA5A 3OKDA 3HRZB 1R34A 1HHIA 5DUML 1C5BH 1O75A 3O41A 4QRRD 2BIIA 4PRHE 4WV1C 3S3CB 3T4YA 3W82A 1RZFL 3ZTEA 1IT9L 1NLBH 4HJ0C 2VDMB 4W9KC 1NDMA 4MS8C 3KDMB 2DM2A 4NQQA 5FEBA 3BDYL 4CUCA 1DSYA 1RZ8A 3KW7A 4M9PA 3SGDI 4D3CH 4BXVA 3RWFA 2B4CH 4MNQD 3PV6A 4KO5A 1MCPL 4JLRB 4O58L 2R56L 4FNPA 3ISWA 4PJ5D 3EDEA 4HH9B 4XCEA 4AC4A 1O9ZA 3G5ZA 3LXUX 1DL7H 2WBXA 2Z92B 1EHAA 3IMUA 3I3DA 2R23A 2VDLB 4G8EA 3W37A 2APTA 2DWSA 2YEZB 4BSWB 3OLGA 2E7MA 4Y2DD 3SGKC 4UZUA 4PRAB 4LASH 4TULH 2EIJB 3DROB 4XHJD 5F9JB 4RX4A 1AQMA 3I9AA 1KTCA 3T8MA 4HIEB 4AW7A 4EDXB 4WDIA 2O5XH 3ZYZA 1Z3RA 5DUMH 4AM0A 4JRYD 3FUFA 5DS2A 4CMMB 4QGTA 3ZE0F 5AW9B 1RZFH 4JPVL 1IT9H 1MCFA 3KLKA 3Q8AA 4WGVB 1XAUA 1TIUA 3MRHB 5HJBA 2OMYB 2PP7A 1PDKB 3BDYH 5I28A 3SPIA 5EF2A 1J9TA 4ZAKC 1MCPH 4O58H 3P3SA 5JIPA 1MFVA 3PQYE 3L54A 3KNBB 4JJ5B 2CUHA 3GWJA 4IHOA 1A3ZA 1KN4L 5HHNB 1VEPA 2P8LA 4H0GA 3BZFB 3O4LD 1WA2X 2ZX5A 4NWUL 4CADB 2OMNA 3FU0A 4ELDA 5KW9L 3MACL 3FFOA 3CHQA 4PTUA 1PSKL 2OTWB 4QKXB 2V5MA 4FXGA 3ZT6A 2FSDA 3RGHA 4XPAL 3L3JA 2Y7QB 2JB6A 3MJ8B 1MJJB 2DMGA 1K8DB 4HMCA 5FO9A 5BZXA 2AQRA 4FG2A 1YDPB 3MAWA 4E9XA 1UOLA 5CLWA 2BRRL 2AVGA 1DQLL 2ARJA 2FBJL 5GGUA 1IFGA 1A1NA 1M1SA 1KGXA 2DWEB 1HYSC 1PKOA 3ATAA 1ND0B 3WY3A 1H6EA 4P46C 1BYNA 1G9MC 1MFNA 1ZMYA 3SE4C 2BIPA 4TQHA 4N1CA 3WV0A 4KUZH 4PJEA 4Q56A 4IGBC 4N85A 4CILA 5J56B 2N7AA 1EFXA 5IB4A 4JY6A 3T3PB 4J3WA 2A7BA 1I82A 4MD4A 2HRGA 5KW9H 3MACH 3QJSB 2KDYA 1NFDA 2M1KA 3CFBB 1FNHA 5FGBC 5ICYA 1PSKH 2XBZA 4J3TA 3FQXA 2ENQA 5AKRA 3MRGB 1I8KB 3QUMB 1Q72L 3QUZA 5DSCB 2VAAB 2KYIA 4G6KL 4OJDH 2BVPA 3O3AB 1FHNA 2HTLC 2XPZA 3GSWB 2DWTA 1C8PA 5BOPA 3OX8A 4N5EC 1ACXA 1E0OB 4HWUA 3VFTB 3PP4L 1OAUH 3A6CL 1QZNA 2NDGA 1SLWA 2BRRH 3KPQA 4GI6A 5E1HB 2GSIB 1SOQA 1A7PL 1DQLH 2DQGL 2G60L 4B9FA 1T66D 2JIXA 3Q7JA 4FQQB 2MKWA 2V5TA 1IAII 2ICEA 3GMQA 4MMYA 1CDIA 4FN0A 4ZXBB 3VGFA 4Z3FA 4WWPA 3TBBA 3ARDD 3V5KB 3WY4A 3BW9B 4RIRB 2BNRA 2WO4A 4CKQA 2YD2A 1QBBA 2YA0A 4OM1L 3MSPA 1FL3A 1GVIA 3WS3B 1H8NA 3E6HA 1X5XA 5F89A 3N1QC 5ADOL 2UYLB 1MAJA 1F86A 1Q72H 1MHPL 1YY9C 3WFHB 2Z7YA 4G6KH 3WUZA 4WY7L 1KTLB 3VWKB 2XTLA 1F3JA 4ZFZB 3LDBC 3PP4H 5TDOB 3A6CH 2G30A 1FJ1A 3N0PB 5DMGC 1A7PH 3H2QA 2G60H 5DJ2A 4PV8B 5DK3A 2X28A 2MKLC 2W94A 3Q48A 4DESA 3Q3GB 2NNRA 1OM9A 1NEUA 1WFIA 2EDLA 5E1IA 4PJFA 3GLEA 1X7QA 5HPMB 4ZXBD 1YNTB 2EDQA 4NNYB 1JPTL 4KKRA 3V9EA 4OM1H 1GZHA 1XCQA 2HJKA 4HCRA 2CO6A 1CXHA 2XYBA 3W11C 5K9KB 5JDSB 4NB7A 1A6UL 1RU9L 2WXQA 3QWOA 1J05B 5ADOH 1KB3A 1OANA 4NZRL 3RWIA 4EZJA 5EU7E 4B60A 2J2ZB 1L9SA 3O3DB 2DYPA 2RH0A 1MHPH 3KPNA 1N59A 5GJSL 4U2ZA 4WY7H 4J6IA 1N5AA 3DLQR 2Y7NA 2AEPL 4M7JL 1GMIA 4NM8L 2FVNA 1SQ2N 2DL2A 5GSRA 1L0YA 3LS5L 3AUWB 5HI4C 1PLCA 2K4AA 4AQZA 1KJ2A 1U8HB 2G9HA 2IANA 3FCTB 3G5XB 5IVZA 1MJ8L 3CSYA 1UFGA 4JHVA 1LP9E 3E1ZA 2OP4L 3SDDA 3MRIA 4F33A 5EBLA 1KIRA 1JPTH 1EAPA 4LDLB 4BK4A 2YMXL 1ZEAL 3QDMA 3QUXC 1UD2A 1A6UH 1PD0A 1RU9H 4GP5B 3T4AA 4L37B 4K5NA 4NZRH 4X9HA 1GZPB 4PWEA 5JMOC 1XAKA 4DP8X 1M1XA 3AT9A 1I1FA 5GJSH 1TZ8A 2Y3AA 5I71C 5D93B 1YEDB 2AEPH 4M7JH 1J5DA 2CH8A 2CCVA 4NM8H 1ZWIB 2HWZL 2FEDD 4Q89A 2WCGA 3IEAA 4FQ1L 2VITA 2N4IA 1CD1A 2X0WA 3S3BB 3LS5H 4Z76B 3G04B 1E3ZA 4DOHB 4HV8A 1HI6A 2GSGB 3IGAB 1VFBA 1MJ8H 1SVBA 1L9MA 1LWHA 2CDEA 2DQHL 1ZHLA 1MIML 2I7OA 2PWDA 2OP4H 4GMTL 4JREC 4PJFF 5JORA 3FTZA 4OZFA 4U0QB 2YUVA 1A3QA 1VACB 5MI0C 1SJEA 2WINA 4KZCA 2YMXH 1ZEAH 3A47A 4YFLI 5DURB 4EDWL 4F1ZA 4KI5E 1TENA 2NSQA 1PG7X 4X8JB 2CSPA 2BDNL 4LCCA 3PHAA 5GZNA 4XNBA 5E8NA 3QEQE 4HOWA 3Q5TA 5E51A 2BSRA 3EGSB 3NIFB 3PFUA 4IU3A 1HHKB 5GZOC 4DERA 3DURA 4AGNA 3DJ9A 1EVUA 3QCTL 2HWZH 4LEOA 1FGVL 3FN0L 4FQ1H 1HEHC 3DDGA 4JMNA 3F7YA 2H2SD 1Z66A 2ZX7A 5E5UB 1FIEA 4H26A 2DQHH 1MIMH 1Q38A 3F5WB 1A1MA 2AJ3A 3KPLB 5FO8A 3FUEA 4GMTH 3PPSA 4KVCL 3MYZA 3SPCA 1SOSA 5E4AA 3P0YL 4UIMA 4EDWH 5DURD 3FAXA 4PRBB 4N25A 4J2XA 1CLZH 3X12B 5DC0A 4P2OB 3BKJL 3LIZA 4P9HH 1RIHL 5FW8A 4R4BA 3R4DA 2YD6A 4HIIB 1WIUA 4PS3A 2YMTA 1BX2B 1KC5L 3MLPA 4MB4A 3QCTH 3VVVA 3TJEH 1ITBB 2Q8AL 1FGVH 3BXNB 3FN0H 4M7ZB 4MA8L 5IM7A 3X1GA 1FL5A 5IVXB 2YWYA 4W4NA 2C3XA 2V3FA 1CTMA 3H53A 2H3XC 3BD4A 2YSSB 3A6OA 5DUBB 2Y1AA 3CHRA 4N90E 2DM4A 2F5BL 2J25A 1PYWA 3DIDA 5K93A 4OKVB 3VD5A 3ARWA 4MQSB 4KVCH 3SOTA 3MLWL 3H9SD 3EYUL 1IAOA 3P0YH 4K71B 4AQ1B 5DU7A 4O5LL 4QJ4B 3RKDC 1ASPA 4BK5C 3WLWD 4K07A 3BEWB 5FM5M 4P2RA 1URIA 3KVDD 1OIOA 1D6EB 3BKJH 1G6RL 4P2OD 3OF6A 1RIHH 5TGBA 1F45A 3QFJA 3UZVB 3Q2NA 4ZNEA 3ALPA 4R5TA 1MHEA 3B2DC 4AH2B 1QWUA 1KC5H 3LXBA 3VXMA 4MAYA 5BQ7B 1NEPA 4FHBD 2Q8AH 2Y7LA 2K8QA 3N50A 4MA8H 1DVZA 3FQTA 3WFZA 4QY8A 4Y1TA 5T5FA 3CDGA 2ERJB 4JNXA 3RX5A 4HGWA 3SO5A 5T3XE 3GPEA 3RVUC 2F5BH 4HAKA 3PAZA 4A04A 4PBXA 3IDUA 3L3OA 1NFAA 4OW6A 1ROCA 3MLWH 2WJ7A 3EYUH 4BIKA 2HPOA 3B9KC 3VB9A 5AKTA 4U1JA 5CKGA 4BRVA 4GG6E 4MSWA 4NC2B 1KYAA 3MBEC 2R2BB 3CE1A 3VFOB 3NK3A 1FYTA 3NZ8B 1NMBL 5D5MA 4GRWB 5BPPA 1G6RH 4PH8A 1RERA 3VRIA 1UJ3A 2VQTA 3OKNB 1B2WL 2OSYA 3VGEA 4F27A 3ES6A 4HWBL 1I3RB 4QRPB 3UGEA 1E9QA 2EDRA 1IMHC 3GMMA 3D87B 2Q7YB 4MYWB 2Z4QB 5CAYB 1KLGA 3T0XA 3ARRA 4E41B 3RY4A 4LLVB 2UVEA 4RFEA 4I8DA 5KYXA 5B7FA 5F0JB 1A4CA 1QFUL 1QRNB 3DNKA 4FFWC 1YSOA 1DJIA 2EXSA 4KJPD 4Y19E 3I85A 4PRNA 4AKPA 4GKZA 4QTHB 3FQUA 1BZEA 4HIHB 4QGYA 1NIDA 5I75C 3BSZL 3WXVL 3BRDA 1NMBH 2NY1B 3E0GA 3ZT5A 4GFTB 3UBFA 1B2WH 5EZLA 2VR4A 1F90L 4HWBH 5IMKA 2HMID 3T77B 1AO7E 4FC3E 1HDMA 1VFMA 4F7TA 2UZPA 2XC8A 3QEGL 4F9PA 5D96C 4MZRA 4LVOB 3LB6D 5KZCB 3OQRA 3THML 3HC0B 3GRGA 3CBRA 5ANHA 5I1LB 1ZV2A 2D3JA 3R1GL 3HE6A 4Y7MA 5C0AB 4Z7QE 1DQML 1SEBB 4E41D 1QFUH 3SCMC 2CHWA 1T21B 4WW2F 3ELQA 2WANA 3NH7H 4BUQA 3VYNA 4S1DC 3JTTB 5D1ZA 1EO8L 3R19A 2DM3A 4PGDB 4Y4FB 5C0EB 1NICA 4TVPE 2YPVL 2R1XA 2AQPA 4JKPL 2WLIA 1CUOA 4MJ5B 4MRBA 3BSZH 5C0CA 3WXVH 4QF1B 2PNDA 3VGHA 3G6JB 3MR9A 1QTPA 1AKJA 3UXFA 5D5MF 1F90H 4DKFL 4ZQTA 4LDCA 1WS7A 2GJZB 3EUUA 3QEGH 5IEKA 1BG9A 3QZMA 4JFEE 2O72A 3FONA 4GIOA 1N2RA 4NC1C 5C3IA 1HHJB 3THMH 3TBSA 2BVTA 2IALB 3WE6B 1C12B 4JRFA 5KZCD 3HI1A 3HUJA 2XDHA 2FIRT 2ITEA 3AY2A 3R1GH 3PDOB 3QUYA 1DQMH 1T1ZA 3F7VB 2VKXA 2DKUA 4RH4A 1PZCA 5C0AD 3N41F 5DC9B 3IAGC 3ZPDA 3NJFA 3WLBA 1Z9SB 1QWHA 5LBSA 3GKZA 5HHOA 4ZUVA 2R51A 3PUCA 1SVCP 1F00I 4NRYB 5KSUB 2OMWA 2R69A 1HSBA 1DQJA 2HYMA 1O5PA 4R7LA 5L9DL 1TUPA 2Z65C 3NABL 3EYVB 1SVZA 3HMWL 3VA6A 2YPVH 2ZX9A 4JKPH 5D7JB 4X5LA 4UT6L 5TDNB 3T6ZA 5L0QB 4YN3A 2VR5A 5L88H 5IHWA 4X5XA 1JHKL 4HW6A 2X2YA 3UO8B 4ATWA 2OZNA 4OZGA 1XF2A 2B15A 4ADGA 2V7NA 4GMSL 3V7AG 3EO0B 1NJ9B 4R0LB 4DKFH 3CGTA 1CDBA 2XIDA 2ZE0A 1Y1DA 3Q43A 4PJGB 2XBDA 4HC1A 5EFIA 1AS7A 1Q1JL 2R7EB 1NIFA 3IMTA 4NAJA 5J13B 2JQMA 2DBJA 5CO1A 1MHHB 5TQ0L 3WFEL 5I5RA 3FH5A 1TTBA 1F6LL 3FFCD 4NKMB 3RPKA 3BGAA 4NQXA 1V3LA 2L4OA 1IZKA 5D2LB 3WDIA 4JFHD 4RCAA 1XB3A 3BUDA 5I17B 1OSZB 4XP4L 4MA1B 2W81C 4JN2A 3LKSA 1E3XA 5IHLB 4BZ2L 1ONQB 2LAAA 5L9DH 4NC1E 3FB6A 3GFUA 3NABH 5HJDA 3HMWH 2OSLB 5GGSB 5BV7C 2H32H 2HJLB 5EU3A 3UP6A 3WSQL 2WVSA 4J4PD 1WIOA 2QFPA 4KK5C 4X42A 3HLKA 4JHAL 5GS1B 4UT6H 1JVOA 1DVXA 5D7JD 3DUUA 1BF2A 2Z1KA 2EJ1A 3EYSL 3BZEA 5E4EC 4GMSH 4OCMC 1QSEB 2WD0A 3N43B 3AVEA 3TS8A 2BHYA 1Q1JH 4X6CB 1XF3B 3LKRB 5FDWA 5JYMA 3ARVA 4WNQB 4A38A 4TUJA 2J6EL 5TQ0H 1S7TA 1LK2B 4F8LA 4G6ML 4HUXA 3C8DA 3WFEH 4J1UA 2UY7B 4R4FL 4BH8A 5DCCA 5F7UA 2JLLA 4Y5YA 1DVFD 4NN7B 1AFVL 4XP4H 1KYUA 1FNGB 4BZ2H 2PYEB 4HHWA 2W80C 4M43L 2UZXB 3GSRA 2GBVA 3HFMH 3T1FB 2SODB 3WSQH 1QRKA 2OMVB 3AU0A 2FX9L 4JHAH 4L3EB 3BYYA 1HH6A 2CKBB 1KBBA 4JGNA 2KBGA 2OA9A 2VR7A 3EYSH 1IGIH 3FFDB 5C08A 4HK0B 1N8OE 1QSED 2JJWA 1QA9A 1PLGL 2GHWB 2XKNB 4YGAB 5CCKH 3JWDC 2J6EH 1DCEA 2FTAA 2G2RA 4RMSA 1F2QA 4G6MH 3B5TA 2VXTL 2B0SL 1FSKB 2VMCA 2X4RB 5E70A 4R4FH 4Z95L 5DQDL 1AAJA 4YSAA 3JSSA 4F2MA 4J8QA 3FTYA 5DJCB 7PCYA 1AFVH 3MBEB 4PLNC 3BSGA 4NO3A 2CG9X 3UTZB 1XZWA 5L4MA 1HEJC 2PYED 4M43H 4Q97A 2TRHA 2FX9H 3BMVA 2B16A 4L3ED 1DANU 4NJ9L 1TJXA 1UH4A 3FDWA 1NDTA 1ZA6A 5AOKA 5JW5B 1K5NA 1L5GB 5FGCB 4JG9A 1BMGA 4M4RB 5KG9A 4GRLC 3GSVA 4UAHA 1I7RB 1SXZA 1PLGH 5F9OL 2AC0A 2XWCA 3PREA 4A63A 2Y5EA 5GGRY 4DN4L 1AXSA 3IDGA 4P4RB 2BOCB 4DEPC 2GBTA 2DTSA 3N0AA 2VXTH 4C4KO 2J21A 2A9ML 3IGFA 2B0SH 5I82A 4Z95H 3P9LA 2UZYB 5DQDH 5DHXB 1EA9C 3PWVB 3TYFA 4Q9BA 2H1LM 5I8OL 1OT1A 4K8RD 1CI5A 2AQTA 1JXGA 2ICCA 3P4NB 3GO1L 2GT9A 3QIWB 1CQKA 3VGDA 1YN7B 2CGZA 3MV01 2R15A 5TK4A 1ERNA 5CFAA 2OR9L 3LNHA 1OAQL 4ZSOE 1BPLB 3WJJC 3EXJA 2BWQA 3U0PA 4NJ9H 5F7KC 1AC0A 3QJOA 3OBAA 5L2JB 4WNJA 1F3DH 2GFBA 2KH2B 4OUOA 3UTPD 2OYPA 3V6ZB 3QI9C 2XXGA 3ARGB 3OJDA 1S7VB 3ECQA 4IRJD 4Q6IB 3L45A 1CF1A 3LRSA 4AT6A 5KSAB 3EZ8A 4DN4H 3E8VA 1KN2L 1AP2B 1DVUA 1YEJL 5C97A 3O11B 2WJ5A 2VH5L 2LVCA 2EDNA 1BFOB 3V6OA 4MDIB 5D7LB 4W9IC 1Z2KA 4G7YL 1XEUA 2J8UE 4G72B 1X6NA 5JPMB 3GO1H 3MUUA 1NBQA 4Y5VB 5DMJB 4LSDA 3MCKB 5FGRA 3QIWD 1LM8V 1ZA3B 4IBZA 2DH2A 1P4IL 2OR9H 1S7UA 2ADJA 3P73B 3ZL1A 4F8NA 5EC2A 1YECL 3ESPA 4GLRI 1OO2A 4RMRA 3HHMA 3IPEA 1TO5A 3MRBB 2XJLA 3PHQB 2W0LA 3RZCA 1E2ZA 3EYFB 1HQ4B 1Z5LA 4HBQA 5TH2B 3WOVA 1TTUA 1M7IA 4I2XB 1T6VN 4MZIA 3STZB 3TH3T 2R0WL 1E2VA 3PY9A 2DJMA 1MRDL 3JUYA 5CN3A 3ECBB 5AW0B 3ARGD 4D8OA 5KYYA 4O2CA 4YHIB 1Q90A 2BY2A 4L2LA 1KYOK 5KSAD 1B0RA 3PIQA 3QIBD 4NUPA 3L5XL 4ZPTB 5LCVA 1KN2H 1YEJH 1XSIA 3HOGA 3UTTD 2TSBA 4NDMB 4UYQA 2VH5H 2A4EA 4Z7WA 1H8OA 3ULSB 3VE0B 3T0EC 2KKQA 2WKOA 4B3VA 4LLYB 3T65B 1EJ8A 4G7YH 4LEEA 5EU4B 5D7LD 2OYMA 1EEUA 4CBPA 3Q8EA 1KLFA 4EUPA 1SHXA 1P4IH 1CS6A 2CJTA 2XPGA 2FSEB 2QL1A 1N18A 1WUNT 1G7IB 1FNEB 2F53A 3SDCC 1YECH 1IEBB 2HVKA 1JTTA 2YBRB 5FFOA 5H37G 1AD0A 4G82A 4HWEL 5GS2H 2R0KL 2UY6A 3GJFB 5JNYA 1XR8A 2IDCA 2HN7A 5EOCJ 3FUJA 2FCBA 1BBJB 2R0WH 1MRDH 4UTBH 1G7LA 2V8MA 1UT1A 2PPDA 2NT1A 4UOQA 3VFUA 3QZBA 3L9EA 3HMXA 1KXHA 2GUOB 1X5JA 3L5XH 3OXRA 4TNGA 2EEBA 1JYVA 1P4BL 1JFHA 3QQDA 1E67A 2WXFA 3BKCH 4BD4A 2IGFL 1BLNA 4FXKA 5IQLA 1SF3A 3QUZC 1ZHKA 4ODWB 4UOW0 2FYVA 2YD5A 2Q3ZA 1BIIB 5FWRA 4JFZL 2IPKB 1LEGA 2DWYA 3BPNC 4BFBD 1MVUB 2FRGP 4AYSA 4GEIA 3KM1A 5JO5A 2WW8A 4Z7UB 4HWEH 2R0KH 2GCYA 1SLVA 2MNJB 3T0EE 4MNGB 3FQ4A 5CGMA 4D0CA 4MJ6B 4XVTL 3PWNB 3NSXA 2P45B 1WHOA 2ZSWB 4ZOAA 5IUSA 3QDGB 3MA7B 2H47C 3MCYA 3OAWA 4AJWA 2FWLB 3AY4C 1S7RA 4DPBX 4GOSA 2Q86A 2EYSB 1U4EA 3PGDB 4ODXB 1P4BH 3H85A 1J8RA 4LSQL 3DV6B 3HI5L 4HZAA 2PP9A 1PU0A 2IGFH 1ECYA 2M26A 3H9HA 3TA3B 1B88A 1KBVA 3FT2A 4N68A 1KGCD 1G87A 1EGJL 1TQBC 2WTRA 3DO4A 3RPBA 4Z7WF 1SYVB 1RK1B 3NRQA 3C5SA 3MBXL 3ZMRA 4JFZH 5F7AA 4I85A 3QAZB 5DR5L 1ZHNA 1YHPA 4DZBB 4J12A 3QZLA 2V2TA 4HIJA 1WS8A 2YD9A 3C9NA 5D6CA 4H1LA 1U8JB 1G4MA 1N8ZA 4NQEB 3QO0B 4LPTA 3B2UD 1ZE3H 4G1EB 3PWPE 5FYKE 2CPCA 4WEMB 3AFLA 4JZNB 4M29A 1HESA 3CFCH 5E6UB 4XVTH 1X5ZA 1I8IA 5C6WH 1T04B 4KAQH 1G7PB 4ZBJA 4JPQA 3MYJA 4X5PA 1EPFA 1SHMA 2H1XA 4AYMC 3IMRA 1GZHC 2JXMB 2VN3A 3VXSE 5C71A 3EGDA 4UQBA 2DEWX 5JPNA 3UAAA 5CEZD 3EYQD 4JS7A 3HI5H 4LSQH 4YLBA 2D7TL 3ZE0B 4YFDB 4A2HA 2RTTA 3B9AA 4P57B 1EGJH 1YYCA 4NEHB 4X6BB 3MBXH 4MNHB 3FHQA 1QW9A 4JFFE 1XGYL 5DR5H 3MO1A 4AGOA 4YO0A 5DMKB 4PIBA 5FYJL 5I8CB 5EEZA 2FLMA 3LRHA 3C12A 4NQED 1ADQA 1GGYA 2JTDA 5DFAA 1W80A 4XN8A 5SX5H 3ZMNA 1BM3L 4FMFA 5J4MA 1VENA 1AH1A 8CGTA 3LN4A 3IF1B 3FOMB 4CVWA 5HI3C 3WNPA 3KYNA 4WHTB 5MENA 1J9CT 2VDOL 3OJMB 3NJMA 1Q9LA 4XCFL 4Y2DC 5ABZA 3EDJA 1MHCB 1CURA 5FOBA 2X3BA 1U8IB 2G0LA 2YD3A 3OKDB 3T4AC 3QDJA 2R2EA 4XHJC 2Z8VC 3MBWA 1EHLL 2X88A 4AQAA 5CM1A 2D7TH 3O41B 2WSPA 3K3QA 5FK9A 3VGAC 2WWKO 2XZQL 3VFMA 3TBTA 4Z9KB 5H4ZA 5B39G 1OXYA 4LF3B 5K9OA 1M7XA 3FT9A 1RZ8B 1R17A 1XGYH 1TEYA 4ANKA 3PV6B 5DDHB 3M46A 4PGZA 2SEBA 3J27A 5FYJH 2B39A 2WN3A 1L7IL 3HKFA 4XCEB 2HLAB 5DHMC 3G5ZB 5IOKA 2KZ1B 4ZS6D 1IZJA 4G8EB 4FMVA 2VDMH 1U8KA 3RFZC 1PY9A 5BMFL 1OP5K 1BM3H 3BCFA 4FLRA 4B53A 1GY2A 4QRRE 3SOBL 2FJSA 1KCSH 5AOLA 3VD7A 1SF5A 4MDJB 2VDOH 3BPCB 1W0YT 4LCUA 4XCFH 4MMZB 1CWVA 2AXFA 1HU8A 1INEL 2RFXA 3MJWA 4JY4A 4F7CA 5I5IA 1KB5A 2NW3A 3JV5A 2EXWD 1KCVL 4AM0B 1EHLH 2Z64C 4MNQE 4UIKH 3R8BB 2AEQL 1ED3A 3V0HA 4PJ5E 2XZQH 3C75A 1QI5A 2NUTA 3HC4L 1OALA 3EUDA 2TAAA 1D5XA 4YNYA 5CBEA 1U9KA 1FCGA 5CD5D 3Q06A 5ID1A 5EWIL 1UT9A 4F2EA 3AROA 1ZT7A 1WA0X 2X44D 3D6GA 2J20A 1URLA 2HKAA 4XGZB 2JKSA 4XVUC 2N3JA 3DARA 1L7IH 3EKCA 4WCYL 3FSVA 4BFGA 2P8LB 2AP2A 1U36A 5BMFH 2VUOA 4X99B 4LBAA 4Q6YA 4JRYE 3SOBH 5SV3A 1PD6A 1F1DA 1MCQA 5FUOL 4FXGB 5TK2A 2J3SA 1INEH 3I6LD 3L3JB 4BKSC 4G9DA 4AJVA 5I6NA 1KCVH 2Z3FA 5FO9B 2AJUL 1I1RA 2ZIDA 4UWQB 2C9UA 1ZDQA 2AEQH 4P5KB 2YXMA 1ZGLA 3KCWA 1AR2A 3BCDA 2MIZA 5I23A 4KOCA 3HC4H 4HUWA 2ARJB 3QJRB 5J89A 4RESB 1A1NB 2QR0B 3O4LE 5EORL 5LXVA 3Q0HA 1ETZB 2BSTA 4HKXA 4YSRA 3TH4T 1VEOA 1REIA 3V6FA 1KBWA 4M1CC 1T66C 1FNLA 2X87A 4WCYH 3NT0A 4LHJB 4PJEB 2C9QA 1GSMA 3S3PA 5KVGL 4H8WH 2G3ZA 1EFXB 5IB4B 4JY6B 2YOAA 5J06A 3V0EA 4MD4B 3ARDC 4PJHA 1H9DA 4XMXA 2BVQA 1NFDB 5ICYB 3FQXB 5DTFA 5FUOH 2EC8A 4A2EA 3RE0A 1G9NC 3OV6A 4QYOA 2BVPB 2FUQA 1EHNA 2VN5A 2YAQA 3MV7A 1G43A 3OX8B 3ZL4L 5LNEA 4KTEL 4I4WA 4CSPA 2AJUH 4TQ8A 4LCVA 1CDYA 1PG7W 3KPQB 3WO3B 1OF0A 4QHUA 1FH2A 2X4SB 4OV6F 3M6DA 1RXLA 2JIXB 1CFQB 3RA7L 5EORH 1L9QA 4MAYC 2ZX6A 3WHXA 3SEPA 4JFXA 4U6YA 1CLVA 2ICEB 3GMQB 4S1SL 3S98A 1KF9B 5KVEE 3SKUD 3KYOA 2D3LA 1JXDA 4UT9A 4BKTC 5KVGH 2BNRB 1IV8A 3WNNA 2PO6D 1OY3B 4WW2C 2NCEA 4XCCL 1EFXD 3UC2A 2OL3A 1WFUA 3E6HB 4YC2B 1B4TA 3BWZA 3CU7A 3UBGA 4YS4A 1F6FB 2GTZA 4A6YL 3GMNA 3BHBA 3NP4A 4IQHA 4D94A 4WFED 4ONFH 4RRPA 1A0QH 4PPTA 3ZL4H 2HTKC 3D18A 3D30A 4KTEH 1A7OL 3ENEA 1FJ1B 4KZDL 2GBAA 1WDAA 1PAMA 2WQXA 3CDZA 4KPHL 3U36A 4G8GD 2JCWA 5DJ2B 2LV4A 3F05A 4X98A 2XV3A 2JJVA 3RA7H 4GSXA 3MUJA 2V3DA 3T3PE 2IXQA 3O4OC 4S1SH 4GT7A 3KPPA 3G08A 1BYOA 1CFSA 3UGUA 3MFFA 3PNRB 3IS1X 1CGSL 1IBGL 4XCCH 2WUCL 2HJKB 1XCQB 2X1XR 1KT2B 2FB4L 2XA3A 1BZQK 2CO6B 2YAEA 3CH1B 4PJHF 3QWOB 3ULVD 3ZTDC 1DBAL 2HRPL 2VLRB 4A6YH 3RWIB 2YGNA 1YPZF 3BH8A 3FH8A 1MJUL 2DYPB 4KRNA 4W9LC 5H2BB 4J3OG 5I66B 1N5AB 1W0WB 3HE7B 5E0FA 4B6ZA 3WNJA 2X4PA 3BN9D 3T1WA 5EMYA 4QLWA 2YN5A 1A7OH 4KZDH 1QFHA 5GSRB 1A66A 1KTKE 1JK9A 4KPHH 4HU8A 3DPBA 3GMLA 5C0NC 1OARL 1NUDA 3PCYA 3LD8C 1HL5A 1KJ2B 1K4CB 2IANB 4W9FC 5IVZB 5C6TL 2RJMA 4WVRA 1VADA 5LNDA 3CSYB 5AB0A 2HFGH 2NY2C 2VO8A 3IKCA 4RLDA 3HE6C 3SDDB 1IM9D 3MRIB 2N0KA 4P0DA 5EBLB 4F33B 1CGSH 2O93L 4YHLH 5E5MB 1IBGH 1NC4A 1XMEB 3QDMB 1KXQE 3DIVA 2WUCH 1JERA 5AUMA 2FB4H 5CLTA 5H94B 4MHHI 5ITBL 1W2KT 5E03A 1DBAH 2HRPH 2JELL 2JJTC 2YRZA 5G4MA 5I5MA 4H0IA 1M4KA 2VLRD 5D1ZC 1WAAA 2QDWA 1MJUH 1FQ9C 1I1FB 2F74B 1ILSA 4K7PX 5EBWA 3VGAB 2VDRL 2DYPD 4DVBA 2NNCA 5GS0D 3UADA 4NQTA 1TU2B 2Y6SD 2QZ5A 3HE7D 2VC2L 2LFEA 4M03A 1CFVL 4PLJD 4MXWL 1CD1B 2EDWA 5D1XA 4NSKA 1MCIA 1OARH 3V4PL 3KH4A 5LAXB 4HV8B 2XFXA 2VZ1A 5C6TH 1WAEA 5DJ6A 1VFBB 4QOKA 1QHQA 4I1RA 1QPPA 2BHUA 2CDEB 1YEHL 2BRQA 1ZHLB 1ES0A 3QUYC 3UTSA 5JHDD 4IIQA 4OZFB 3VM5A 2BC4A 3HC2A 4ZFOB 2KLTA 1SJEB 2WINB 3SDDD 4PJAA 3QP3A 4YGVA 3QDMD 3C87A 3HS0A 4BHUI 4LCCB 1LO2L 4HAGA 1BIHA 3C6LB 4JO2L 5ITBH 2JELH 1NM9A 3ILPA 5KVDE 3FSOA 4G7SB 2WMPA 4YZFF 2CIIA 3HLAA 5G4NA 2BSRB 1SEQL 2VDRH 4DFIA 4RZCA 3DI2B 1DDHA 3DURB 3MUGA 3AMLA 4CDGC 1AOZA 2AJSL 2VC2H 2OSWA 2I69A 2L04A 3E3QC 4FNTA 1CFVH 4MXWH 1I3UA 4QHPA 3V4PH 1DJGA 4ZPVA 3QW9A 1BFSA 3F7YB 4BCYA 5ALCL 2F58L 4H26B 2P5WA 1YEHH 4KTDL 1A1MB 2AJ3B 4LK4A 4Y7OC 3EG9A 5ENWA 3ZYOA 3VQ1C 2F54A 5C70A 2EE0A 1G9ML 1UHVA 1WZLA 4FCAA 4UIMB 5I6XC 1S5HA 2QDVA 1GC1C 1S9KC 1HWHB 1LO2H 4JO2H 1COBA 4MB5A 3EZJB 3BJ91 3C6LD 5FA4A 4OD3L 5F8QC 4JDTL 2H1PL 3FCUB 1WAAF 1W8OA 5K59E 1SEQH 1G5AA 3LNFA 3TOPA 2EO9A 4LSTL 2YPLD 3E80A 1A6PA 4YHKH 4MVBD 4DOHE 1N9PA 1F4XL 2AJSH 2J73A 1NDGA 2RMNA 3HR5A 2EUVA 1XB6A 3RNQA 3LZPA 3R0NA 1FL5B 4LP8A 4WEEA 3NACL 1H8SA 4MA3A 5I2IA 5F9DC 3ZHNA 4ZYKB 3TWCL 3S0PA 3LIUA 1GGCL 4PR5A 3VSQA 5ALCH 4CVZA 1PYWB 2F58H 4AL8C 4L05A 3UROR 3EFOA 4KTDH 4MCNA 3BGFC 2I26N 2XZCL 2G5BA 1E4KA 2I5YL 1IAOB 1MW1A 1BQLL 2V2XA 1G9MH 2VRQA 5B4MC 4PJAF 5INDA 1GMEA 4Y5YC 3NIFE 1WA1X 4QHNA 3P3RA 4FL4B 1VPOH 5C0IA 2YIHA 3N44B 1WAPA 4OD3H 3QRBA 1J9QA 1S7XA 2H1PH 4JDTH 4MMXA 4WGWB 2OR7A 4MBRA 5TGBB 4I1NB 4P3WA 4PWFA 3QFJB 2OMXB 2L7UA 1FN4B 3L4XA 4B9GA 1MHEB 3US1A 1MFMA 4LSTH 3QE5A 5F0PB 4H44C 1F4XH 3VXMB 5C0GB 3WTWA 1R5IA 2DLIA 5GGSY 3MLTB 2Q87A 4NZFA 3IGKA 1I9EA 5D4IA 2Q7NA 4QY8B 3NACH 2X6UA 2QADD 3H9SE 4XE0A 5LO7A 2X0VA 4HGWB 3TWCH 5F3BA 5G55A 4YDLB 3QARA 4PG9A 4PRDA 2IQAA 4IMKA 4ANUA 2IMMA 3D39B 1GYVA 5B3JE 1E27A 4PW9A 3VAEA 5KYUA 1CXLA 1MFDH 1XH3A 4S2SB 4XPBL 3L3OB 4PEEA 5E8EA 2I5YH 3IB4A 3NFPA 1BQLH 3QXWA 4WI8A 2DWDA 2DDQL 1XSKA 5INCB 3AAZA 4ONHA 1Z9MA 4PLKD 1BREA 4PJBF 2BVOA 1FYTB 1BZ7A 2E74C 2JSFA 5AALA 2BY3A 5D5MB 4XNMB 1UJ3B 2IOMA 3ZU8A 5IVXE 4HULB 1E9QB 3L4ZA 1A1OA 1RPUA 2FGZA 3GMMB 3EADA 4JFOA 4QRTA 4RGND 4YSQA 2A5UA 4A1RA 2D2CC 1BFVL 2WWOA 1RZPA 4PP2A 3LB6C 3EOBB 3CVCA 3L4TA 4LZKA 5KYXB 2N01B 4XO4A 4HXAL 3KGTA 1XIWA 4DP1X 5L8KB 4R96B 2CK0L 4DWHA 1E4WL 4AV4A 1UKQA 4PRNB 3D39D 3F6JA 4XPBH 4Z1PA 3QSKB 4GKZB 3WNIA 1AIFA 4O2EA 1QMUA 5DD5L 4Z3EA 3EH4B 2DDQH 2J72A 5BS0A 3HNTL 5E9DD 3ROOA 1NFIA 2HAZA 4Z0BL 2QGDA 3T8XA 1Z9PA 5HHMD 1FYTD 3NTCH 5DHDA 3VSTA 2Z8RA 3KL3A 1BFTA 4BA8A 3HG2A 5EZLB 4S1RH 2VL4A 4XXDA 1HDMB 2E8YA 2WBJA 4GNKB 5ANMA 4JW3A 4CW1A 5CZKA 2BIHA 4QHMA 1GJWA 1OSEA 1FHGA 1Y6NR 1XGUB 3BP6A 2PTTA 2NY2B 1BFVH 1KELL 3K6OA 1ETJA 2ED8A 5C7XL 4GW5A 2O1AA 4NUJA 5HGHA 4HXAH 4TNEA 5L4IA 1AGEA 2CK0H 4RSVA 4ILDA 1E4WH 2GK2A 4M6NL 4F58L 1ZOXA 5DD5H 2FIKA 5AW6B 4F15C 1W72B 4GRWE 5JQHC 5DEJA 5I1IL 2VLKA 2VZTA 3EJTA 1BVZA 5CR1A 4ZMVA 5TDPB 3HNTH 3CLEH 2XX1A 1HH9A 4U1SA 4Z0BH 4MJIB 1GGBL 1NAMA 2ZUQB 3MR9B 3EBGA 1AKJB 4Z7NB 4LKCB 2PPEA 3FF7A 1J8KA 3UYPA 2K0RA 4PJIA 4E41E 5IEKB 5K9JH 2B2XL 2Y22A 1W6WA 1N2RB 2PP8A 2ATKA 3EHBD 3TBSB 3ESNA 4E9WA 3HI1B 3HUJB 3G3LA 1KELH 3QFGA 2WOYA 4N2MA 5C7XH 1KJVA 3VG9B 1HXYA 2X2JA 1WZ1L 3OJVC 4L4VA 4NPKA 2CRYA 4HG4K 2DQEL 2UUDH 3DSNA 5E4OA 4ZUVB 3W0WA 4M6NH 3QR0A 1I8UA 4F58H 1IC0A 2OMWB 1HSBB 1DQJB 5T3ZL 3P77B 3O6KL 4P2CG 4TKWA 1W0VA 1JNLL 2CZNA 5I1IH 1TZGL 1GW0A 4OFPA 5AB1A 3UAJD 1C16A 1UXSA 2WO2B 3JV0A 3WI9A 1N7ML 1BZ9A 1SGKA 4GKSA 2KC0A 4WI0B 4MJID 4B96A 1QSFA 1G0DA 4OZGB 4GAYA 4OVUA 2V7NB 4RAUB 5BZWA 1WBYA 5C0AE 3TPUB 3GXFA 2AERT 2B2XH 1L7TL 2BP3A 4ZNCD 5EFIB 2CM5A 1TVDA 2C5DC 4NQDA 5F1IA 3OXSB 4KVNL 2GABA 2AQSA 3Q1SL 2J5LC 2NX5A 1BVLA 3TNMB 1WZ1H 3CUPA 2YKLH 1WT5A 1J0IA 1KBKA 1USZA 3DYPA 4NQXB 2NW2B 4C55A 1IKNA 2CHDA 2DQEH 3UG5A 2O30A 5HGBA 3LKSB 4LOUD 5F7WC 5T3ZH 2HVBA 3E7JA 3FB6B 3O6KH 1JNLH 1DVFC 1OT4A 2LGNA 1TZGH 1ZANL 5EU3B 4C54A 4JM2B 1RULL 4OCSL 4XO8A 4CN1A 3BJLA 2C3VA 4XWOD 1KIPA 1N7MH 3DUUB 4U1NB 3IWVA 4DGIH 1OGTB 3BZEB 4PCYA 2Y6TE 4HETA 3LNEA 3PFQA 1XCWA 3HG4A 1V8HA 3FFCE 1L7TH 4PJIF 3TCLA 1PEWA 1ROWA 3O3BA 4JFHE 1MG2C 2IWFA 4PAZA 5JIQA 4KVNH 2YD0A 4PGBA 3EJJX 1WHPA 3M8OL 4JN1L 5EBGA 5T1LA 1CIDA 2DLHA 5B1BB 1MG3C 1X5MA 3Q1SH 4PS4L 4M8VA 2Z35A 4ZX4A 2YGOA 4HUXB 1MXDA 1T0MA 3C6SA 5IBLC 2BOBA 3LQZA 4J1UB 4YDKL 4BH8B 5HDBB 4LQ1A 5GXBB 4J3UA 3Q5OA 3ZYJA 1JS4A 3ZX1A 1M9SA 4N0RA 3WMSA 3AGVA 1IM3A 2Q8BL 4N8VB 5DFVD 2PR4L 2ZX8A 4O2FA 1ZKAA 3V8CA 1QTSA 3GSRB 1OPGL 3P30L 3QPKA 4OF3A 2XI9A 3FYEB 1ZANH 3VFRA 4MQ7B 5I0XA 1RULH 4OCSH 5HYQA 2ARWA 1HH6B 3RY6A 5CR8A 2PKDA 4JM2D 1KCWA 5D72L 2ZYSA 3GLAA 1A8ZA 3JTBA 3FO1B 3L6FB 5E8PA 4FULA 5C08B 5AG9A 1J87A 3MRKA 4GG8A 2OMBA 1FIGH 4UZGA 3OKLA 3M8OH 1I31A 2G2RB 3KYMA 1A22B 3QJHB 3BZ4B 4G9FD 4PS4H 1GCFA 4ZTOL 4RISL 4B9ZA 1H15A 2CGRL 4M8RA 4YDKH 1YYML 1N64L 2ZOLA 3BLKA 1LWRA 1R3KA 3DYMA 1T7VA 4F2MB 2PWEA 5KBLA 2V5SA 2Q9OA 2WK2A 2NY6D 3QS3A 4HWBA 2Q8BH 5IMLA 4HD9A 2PR4H 3UMTA 1BDYA 2AEOA 5BRZA 1EZSA 2MRYA 1OPGH 2LLLA 3P30H 3REVA 4QDGA 1RAMA 3LVEA 4K8RC 1JHLL 1FLRL 3G9VA 1UUNA 4LIQH 1G0XA 3RI5F 1SY6A 4CC4A 1QSEE 2WVVB 5D72H 5D4HA 4X6CE 1D7BA 1ZA6B 4XXWC 3K2MC 1K5NB 3KPRD 1AZVA 2IOIA 4MBOA 2Z34A 3GSVB 4N0UB 2JJUA 2YJLA 4X5WB 3APFA 2FYYB 4M6OL 4AMKL 5FLVA 3GXTA 3T3MB 2IMNA 1VGKA 1C1EL 2ZNXA 1FG2A 3ZSSA 3J8F7 1AXSB 3IN0A 1OTTC 3MJ9L 1MVFA 4IRJC 3VXPA 3VWJA 4ZTOH 4RISH 2PYEE 3OKKA 1FVEA 2CGRH 3CQQA 3QZOA 4QPEA 3GTTA 1YYMH 3BSZA 3P9LB 1N64H 4WAFA 1I1CA 5IROA 5TTRA 4ZMNA 5C7ZA 5AD0A 4C47A 4NX0A 1PLBA 4L3EE 4JFPA 1LO0L 3PG2A 1VEMA 3CFEA 4U0RC 3V0AC 3CLFH 3GS0A 3GHEL 1LYQA 1JHLH 1FLRH 1PAZA 2AEWA 1G1YA 3H9YA 3NFNA 1P69B 5F7DA 3NJVA 3EJSA 1W16A 5IUCA 1QG3A 4JVWA 4CSZA 3RVXC 2W9EH 5C09A 1CFTA 2GFBB 4DO4A 2NXZC 4FI8A 1UH3A 2F1AA 2OS7A 2NY7L 3V55A 3VMOA 4M6OH 5CIPB 5TPWL 4AMKH 3LRSB 4AT6B 4HPHA 4HH8A 4OU3A 1C1EH 1XEDA 4TNWF 4UNVA 1T7ZA 3O2DL 3MJ9H 1P9MC 2YPVA 4Z3JA 1FZKB 1MCOL 2QQLL 2AV1B 3QEUA 4YHYC 3HTLX 2QT6A 2A6JA 3WMPA 4LLQA 4WGKA 1TJHL 2FWOA 4QXWA 1OGAB 2AAVA 1IGYA 5FAAA 1K8IB 2DMHA 1LO0H 5TE6L 3HI6H 2B5IC 3HFFA 3O8XA 5DZ9A 2BZ7A 2WYZA 3UTPE 3GBNL 3WEXA 1CLYL 3MXVL 3GHEH 5F70A 3T71A 1S7UB 5D2NA 3K4DA 3L3IB 4KKCC