1L9TA

Crystal structure of the i257v variant of the copper-containing nitrite reductase from alcaligenes faecalis s-6
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLVGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directing the mode of nitrite binding to a copper-containing nitrite reductase from Alcaligenes faecalis S-6: Characterization of an active site isoleucine
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1l9tA02
3T6ZA 3FSAA 4HALA 1MZZA 1AG6A 1SJMA 1BXVA 1TEFA 1KCWA 4HZ1A 1NIBA 3AY2A 2X87A 4MFHA 3QPKA 1L9OA 3ZX1A 1PNDA 2XX0A 1TKWA 1RKRA 3ABMB 2FT6A 1ZDSA 4YSPA 2AANA 4QLWA 3KW7A 1OOWA 1B3IA 6PCYA 1R1CA 1OE3A 4DP2X 5F7AA 2DWSA 3WNJA 4AZUA 2JFCA 1OCCB 2FT7A 2J5WA 3X2QB 1JZFA 3EH3B 3T6VA 3H4HA 1RCYA 3NSYA 3RYMA 5B1JC 1SF5A 1GY2A 3OM3B 3OMNB 1FFTB 4NERA 3UGEA 2YARA 3EF4A 4E9RA 3GDCA 7PCYA 4HHWA 2VW7A 1QHQA 2JKWA 1JVOA 2FT8A 5PCYA 3CG8A 2CALA 4E9SA 2B08A 2YXWA 2XWZA 1E5YA 4YVNA 4NAJA 1A4AA 1OE2A 1ID2A 3UADA 3HB3B 3PAUA 4FA7B 1WA1X 3NJNA 1W6LA 1MDAA 2E86A 1NTDA 1NPJA 4KNTA 1JXDA 3OMAB 2XX1A 1SHWA 2Y1AA 1AQ8A 2DYRB 1PLAA 3FU7A 2VW6A 4YSTA 1IKOP 2UXGA 3WIAA 3UACA 3PAZA 3FU8A 4UANA 2PPDA 2FJSA 1F56A 1EZLA 1ILUA 1MZYA 1OCZB 3ASOB 3DTUB 1PZBA 2IWEA 1GSKA 4DP6X 4E9WA 3FYEB 4DPAX 1JXGA 2GC7C 3SBPA 4EF3A 2GC4C 2IWKA 4BDVB 1NWPA 1XB3A 1A4CA 3C75A 4TXVB 1FA4A 1T5KA 3T6WA 1L9QA 3BQVA 3CDZB 1URIA 4BXSV 2BO0A 2BP0B 1AZBA 3AW5A 3QJTB 1AR1B 4W9ZA 4E9VA 2CUAA 4ENZA 5I6NA 3WG7B 2BP8B 2XV0A 3S3CB 2PCFA 2PLTA 2IDQA 4GP8B 2EILB 1TEGA 1GW0A 4YVUA 1AOZA 2QPEB 2Q5BA 1M57B 5I28A 5I6OA 5AKRA 3PCYA 1HAUA 4BWWA 3CVCA 1YLBB 4E9YA 1UATA 4NB7A 2BHFA 3NJGA 2ZXWB 1KGYE 1JZHA 3FYIB 4DP1X 3H4FA 1KBWA 4G7RB 3NP3A 1MG3C 4DP0X 2GBAA 2R7EA 1L9PA 1BQ5A 3MBWB 4AX3A 1SDDB 3MX0B 2XV2A 1DZ0A 1EHKB 1IUZA 5A7EA 1XMEB 2PP8A 1E65A 3ABKB 4DPBX 3NJFA 1NINA 3NP4A 3SBQA 1M56B 1BXUA 2BWDA 2GI0A 4HCFA 4A67A 2OCCB 1HFUA 2YAFA 1A65A 1JOIA 2BW5A 3FQ2A 3NSCA 3X1FA 3HEIB 1V55B 3AZUA 5I6LA 1A4BA 1CUOA 2QDVA 1BQRA 1CURA 2YAQA 5D4IA 2DWTA 1OCOB 3NSFA 2CCWA 2WO3B 2OJ1A 3IBOA 5TK4A 4AI7A 1AZCA 1JZGA 4X4KA 1IBYA 2QPDB 2N0MA 2XLLA 3NSDA 2GHZA 1SF3A 2XUWA 1ASPA 1NZRA 2YAPA 1NIAA 1ASOA 3IN2A 5I5IA 1JZJA 3FU9A 3FPXA 3SQRA 4HIPA 4E9XA 2I85A 2UX6A 3CVDA 4BK5C 5IY5B 1AS7A 2PCYA 4F2FA 4DP9X 2YQBA 3GYRA 4KNUA 2YAMA 1AG0A 1BQKA 3QJUB 5B1JA 4PCYA 3AG4B 4HCGA 1HAWA 5TK2A 2IDFA 4CSZA 4A2HA 3PAVA 3CZUB 2BZ7A 2FQDA 4WKXA 1RZQA 4FAAB 3FSVA 2BP0A 2XXFA 2IDUA 5ANHA 5B7MA 1JZIA 5I5MA 4E9QA 1AS8A 1DYZA 2XYBA 4HCIA 2LLNA 3FSWA 5B1KA 4F2EA 3EH4B 3G5WA 3GXUB 3H56A 4YSCA 2FQEA 1KDIA 2PPEA 3JT2A 2TSAA 3OQRA 3U25A 1ET5A 3SBRA 2VMJA 1PCSA 4YSUA 4GXFA 2EIKB 3UAEA 3NYKA 1X9UA 4HAKA 3AG1B 1ZIAA 3FS9A 1NIFA 1KBVA 2TSBA 8PAZA 9PCYA 4N8UA 1J9SA 1AS6A 1SDDA 1M9WA 2HXAA 2I7SA 2EINB 1V10A 2DV6A 3TBCA 2H5UA 2P80A 2PPFA 4BWTA 7PAZA 1AZRA 4G71B 1J5CA 1J9RA 1GS8A 2IH8A 2VM4A 4KO7A 2HRGA 1CYWA 4A68A 2QDWA 3NJJA 5F7BA 4ZK8A 3ZIYA 1PY0A 1PZAA 1SFDA 5LDUA 1OE1A 5B7FA 3D12B 2XV3A 4RH4A 2Y69B 4YSDA 2XU9A 3T9WA 2IAAC 3KW8A 2HX7A 5I6MA 2CAKA 2CJ3A 4YSAA 1E67A 4JHUA 2VW4A 2AVFA 2P80D 2FNWA 1WA2X 2A3TA 2HZHA 4JHVA 3UABA 4A66A 5I26A 2FQFA 3WKPA 2QT6A 1PNCA 1J5DA 1L9RA 2BW4A 1VLXA 2BP8A 3N2JA 2DYSB 3TU6A 2AZAA 3NJKA 1JERA 3FQ1A 1AIZA 3NJIA 4YSSA 1FWXA 5B7EA 2FWLB 4G72B 2IWFA 1NIDA 2NRDA 2IDSA 2I7OA 4M4RB 1XB6A 5I5JA 1KDJA 1L9SA 4W1TA 5D4JA 1PZCA 2OV0A 2WSDA 2UXVA 1OCRB 4PAZA 3QJSB 2ZONA 3NJLA 5I6PA 3NT0A 4AKQA 2J55A 4KO9A 1QNIA 2H47C 5FC9A 2IH9A 1GS7A 2WO2B 4Q89A 2PP7A 3ASNB 3DIVA 2J56A 3UAAA 1OF0A 2ZWNA 3AG2B 2VSMB 1AAJA 4JKNA 1CC3A 2J57A 5D4HA 4GP4B 2HX8A 3IE9A 4YL4A 3TASA 5B1BB 4G7QB 2ZOOA 2VSKB 2MRYA 2RACA 1PLCA 4WTQA 2FQGA 1AZNA 2FTAA 5E9NA 1AZUA 5EHFA 3NJMA 1PMYA 2UXFA 3T6XA 3OMIB 4GY4A 4A2GA 1TU2A 4A2FA 4DP5X 3S8GB 3ERXA 2GB2A 2Q9OA 3FQYA 2B3IA 3TA4D 1ZIBA 4A2EA 4BXVA 4KO6A 3BVDB 1IC0A 2IDTA 3ZBMA 3X1EA 1NWOA 3JTBA 1WS7A 3S8FB 3PXLA 4AKPA 1OV8A 3NJHA 3X1GA 1ILSA 2XVBA 4DPCX 2YAEA 3ZDWA 1XB8A 3QQXA 2MTAA 2GSMB 1SFHA 1PF3A 3N55A 4GYBA 1GYCA 1N70A 4P5RA 1PLBA 1ZV2A 1JVLA 2HLEB 1BXAA 2CBPA 1IBZA 4M3HA 5B1AB 1ETJA 3WNIA 1W8EA 1J9TA 2VN3A 5I6KA 3WI9A 1KCBA 3ABLB 6PAZA 4BWUA 1ZPUA 4A2DA 3EHBB 2H3XC 1X9RA 3FPYA 4UF7C 1JXFA 3AG3B 1L9TA 4KOBA 1ET7A 4YSOA 2PPAA 4G70B 4QKTA 2YAHA 1A3ZA 1KV7A 1PAZA 2HX9A 4AKOA 4YSEA 3FU7B 4DP8X 4P5SA 4HHGA 1ZDQA 1E30A 2UXTA 2UX7A 4YSQA 4YSRA 4G7SB 4KNSA 1BAWA 3WKQA 4DP7X 3IEAA 2W8CA 3IN0A 1AACA 5AZUA 3DKHA 1W6WA 1QLEB 2AZUA 5PAZA 3FT0A 2AFNA 4E9TA 2XXGA 3CVBA 3EH5B 4L0PB 5AFAA 5B3SB 3L45A 2EIJB 2YAOA 1NICA 4N4YB 3S3DB 3QJVB 4GP5B 2PPCA 2YXVA 1WAEA 3TBBA 4K9JA 3S3BB 4Q8BA 4UAHA 3X1NA 1SNRA 3PLYA 1AANA 1I53A 2W88A 4KO5A 1ASQA 4BDVA 3PPSA 3T71A 1NDTA 1CYXA 2BWIA 2HRHA 3QJQB 2PP9A 1GY1A 3ABGA 3FSZA 4F7KA 2GIMA 4KOCA 1MG2C 1RZPA 2DY2A 1V54B 2VM3A 1GR7A 1ET8A 1E5ZA 1SHXA 1BYPA 4DP4X 1N68A 1NIEA 1WA0X 1JZEA 1WS8A 2X88A 3OD3A 1NPNA 2BZCA 1BEXA 1A8ZA 1GS6X 1ADWA 3V9EA 1BYOA 2JXMA 3X1BA 1KYAA 3V9CA 1J9QA 4CSPA 3CDZA 2EIMB 3QJRB 2R7EB
chains in the Genus database with same CATH superfamily
3UG3A 3T0DA 3EGSA 4ZDHA 4D94A 3DHPA 2K45A 4EZMA 4QRUA 2O5XL 3UPAA 1NIBA 3V4PL 4H0LC 1PS3A 1EJOH 3HPLA 5K9QG 1AO7D 3V6FA 3MGOB 3LOWA 2AV1A 4L0ZA 1PNDA 4F7EA 4QHUB 3HKFA 4GXUN 4BSWB 1BJ1H 1B90A 1EJ8A 3O9WD 4YR6A 3BEVA 2C8NA 2NNFA 3LH2L 4GW1A 1R1CA 5ECJE 1I7RA 5I1DA 3BDYH 4XNZC 3C5XA 3V5DA 5EORL 3O4LA 1GC1H 1JZFA 4ZFOL 3AY4C 4LEXL 5CP7A 4URKA 1NCWL 1HHGA 3J7HA 2C3XA 5MEQA 1EAJA 3OM3B 5HHXL 3AXLA 5I1IL 4JG1L 3ZTDC 4G5ZH 1BBJA 3O0RL 3ECBB 4YLBA 5IHHA 5AOJA 2VDNH 2RIKA 5I17B 3OJ2C 3PP4H 3W9EA 4P2RA 1LO3H 2EYSA 1WYJA 1MCPH 4N2BA 3IJ7A 4GRWH 1JVOA 4L3EA 5PCYA 3D39B 4F2ME 1SOSA 2NDFA 3CFBB 3REVB 1YEGL 3ZTNL 5EN2A 2XNAB 2XOTA 4MAZA 3QIBD 1MCSA 1BVZA 2NT1A 4MJ6B 4F7TA 4QTHB 3U9UB 4LL4A 4MJID 1KMGA 3UPCA 4FA7B 1I9EA 1EA9C 4WVRA 2Q7YA 2P5ED 4GMSL 4PY7B 4K07A 3T1FB 1JNLL 15C8H 4NHUA 1M6OB 4XOCA 4AYBA 3AXIA 4KTEL 5E4EB 4H8UA 5C9JA 4NRXA 4UT9H 3O3EA 1AQ8A 2Q2LA 5GGVY 1DFBH 3FU3A 2UYLB 4M5YL 4XC3H 5E1AA 5AQ0A 4OCNC 3TZVA 2YS4A 4HJ0D 4Z1PA 4PJEB 5DWUL 4JPVH 4N8VG 4V2BA 5I2IB 1MFDL 3LRSA 2XSKA 3KS0H 5DQDL 1RZKC 5D2LB 3SBPA 2B5IB 3LVTA 4IRSB 1YYCA 4KKBC 1NWPA 3QUYC 2VZOA 4IU2B 1DEEA 2EIEA 4O58H 1J7VR 1UB5B 4KROD 3P9LA 3NA9H 4O4YL 4PS4L 4B5EA 1L9QA 3ARFB 2J7LA 1PZ5A 2YO3A 4NYLB 4M3JA 4F7PA 3U0WL 1ZHLA 1BEYH 1M05A 2DKUA 4CMHC 5KVGL 1RXLA 1X5KA 4W9IC 5I8OL 1FVEB 3LKOA 1TEGA 4NOBA 3ZRFC 3O2DH 3HAEB 4CBZA 4XPAL 3X3FH 4Z23A 4UWQB 2VDML 4KVNH 5E08H 3IFNH 3BI9X 1WFMA 2EDOA 2QZ5A 2YQ3A 1QVOA 4KPHL 4KV5F 2X4OB 3GTTA 3CC5A 1FN4A 4TLSA 4UT6L 5J4MA 3GMLA 3OKMA 1CD0A 2BHFA 2KZBA 2JK5B 3NJGA 5IR1B 1K8IB 2XICA 3X3GH 3RILA 2MH4A 2K0RA 1DJGA 1UA6L 2Z8VC 3MX0A 4G7RB 4HCRH 5CIPA 3S3PA 1RUQL 5SWQA 3T0XA 5JYMA 4CMMA 5D7JA 4DP0X 3AREB 5HVHC 1YYMH 3LMJH 3N42B 5B3JE 2OSXA 3LKRB 3RKPA 3V6OA 4Q74A 2WZPD 4OCSL 4Y5YA 3GSRB 1CDBA 3PL6D 1HKLL 1XTMA 3KYKH 4CAGA 1UA7A 1UD8A 2H3KA 2XZAL 3AQZA 4POZC 3TGXA 3QUMA 3BVXA 4J4PC 2OP4L 5IEKA 3CH8A 5JQ6H 3GBML 4Y2NA 1UM6H 1N67A 2GI0A 5CP7B 5IHUH 5DJXB 4YZWA 5JDSA 2B4CL 2R9HD 4JFYB 1JOIA 3VGGA 3UTTD 3WN5B 3PABA 1HZKA 4U1LA 3TYGH 4JFDE 5T3XL 5JDJA 2DN7A 3FUEA 1YYML 3LMJL 2VDQL 3WIIL 2ZCKL 3EOTH 1BQRA 3QQ4B 4ZX3A 2ZQKA 5T1DH 5C09A 4UDUB 2JIXD 4Y19E 4RZKA 1NKRA 3OKOB 5HI3D 2OJ1A 4FFWC 1NMBH 1SYVA 3RGVD 3F01A 5TF1L 3QIUD 3V4PA 2MCAA 4F15B 2VMFA 3Q48A 3CX2A 5H37G 2NTFB 1YRKA 3MOAL 3O6LL 3OXSA 4NQCA 2Q2EB 2OMYA 2VDQH 4XNDA 3CFUA 4KVCH 1U8QB 2OMTB 3FO2A 2GK0A 4KHTL 5FYJH 4ERSH 2HFEA 3ZLQC 4WW2B 1HESA 4QLRA 4UM8A 2UX6A 1NC2B 4HFWB 1PY9A 4F7CA 3OKKB 2Z35B 1NAMH 4PUBH 2DQJL 4U6YA 4LP8A 4GSXA 32C2B 1MPAH 2A74A 1IGIL 3CFNA 4X4XA 2CD0A 1BFVH 4PCYA 4P5TD 5C9JB 3N1GC 1IQDA 2YPLB 4OQ1A 3FQ4A 4F3FB 5BUGA 3B9KB 1HAWA 1T5XA 3QWNA 5AAMA 4BFFA 1GAFH 1J5OH 2R4SL 2GSIA 2Y3AA 1FZOA 3FTYA 1JNNL 5LWYH 1NCCH 2X4TB 3CCHA 5ANHA 5DJ6A 3DMMD 1CE1L 1G0DA 4LASL 4YHYC 2VR9A 5IK3A 3V0HA 1E42A 1W2KT 1JN6A 1N18A 2P9RA 4NEHB 4M93C 4WGVB 1TJGH 5ALCL 1R19A 4XBGB 3MRLB 3WHXA 3MREA 4ZOCA 3ECQA 3W9EB 1W91A 3ZDXB 3GXUB 3H56A 4ABWA 4P2OC 4YSCA 5K9JH 1MXGA 1C7SA 4Y9CA 1P7QA 5CMAB 4WI0B 5C3TA 3S3JA 2DMCA 2DQFA 2R4SH 5D8JL 2X40A 3RLSA 1PCSA 3QXAB 4Z7UF 5ICYB 3HBPA 4UTAA 1KFGA 1BAFL 3BKML 3KJ4B 4DQAA 3ES6A 1R5WB 3FW6A 1OSPL 2DBLH 3P11L 5C7XL 3HMXH 1I4FA 3E6FB 5AVZB 1HCVA 1MAKA 4F7EB 3BFWA 1YUHB 1S4IA 3I9AA 3UP1A 3RUGF 1MVFA 2XFXA 1FVCA 3QDGE 3L3DB 2WWMC 1R0AH 4BFNA 1CYWA 1G9EA 1UKSA 2XTJE 4KKNA 3F7YA 3QAQA 2BDNL 3KPQA 2ZF9A 2WQXA 3PL6B 5DJZA 4F1SA 2HYMA 1D6EA 5KYUA 4LLAA 2NY4D 1U30A 3ZU8A 25C8H 2W94A 1UADC 2G75A 1FAKT 4G9FD 3WFCH 1BWWA 1QO3A 5IB4A 1GYVA 2C3GA 3DUHA 4JFFD 5DZLA 3WEAA 3ZKXB 3FB5B 4UQ2B 5C0IA 2EIZB 2P5WE 4JFZL 1WHPA 3PWLA 4S0TD 5DUJA 1WCQA 4PQXA 3B5HA 3IDJB 3WJLC 5HVHB 5J13C 3WTVA 2QKIC 2G3NA 2IBBA 4I7ZC 1AIFB 3GMMA 4RGOH 4HGKC 4AT6A 2EUWA 2VQTA 3UZVA 1NCHA 1UT9A 1HL9A 3MRMB 2KZWA 1T4KB 3KR3L 4QRPE 3P0YL 1ZY9A 1WBYA 2QR0B 2EEXA 2ZPKL 4QGYA 4HUXA 4YXHH 1ZA6A 2I7OA 3ZZQA 1GZHC 4EPSA 2UWEF 4MXVF 4Z6AT 1NUGA 4XHJD 4Y2DC 2R39A 1IO4C 3TJEH 1PX8A 5IF0A 1KCVH 3RQ3A 1DFBL 2DMBA 1KEGL 1G5AA 1IQDB 2W60A 2WBJA 3NH7L 4V1DD 4F20A 3QISA 4F7CB 4POUB 5LBSL 5FC9A 1L4IA 5CSBA 3RRQA 5IEKB 3GK8L 3MV8B 3P9WB 1MVYA 2P8MA 2P49B 4HPYL 3AMLA 3R1GH 1U6AL 5HGBB 4ZX4A 3BAIA 1A66A 5D4HA 4F8NA 3RA7H 3IE9A 3TASA 1CI3M 2CXGA 3ZL1A 4OJEH 1NC4B 1ZV5A 5EBLA 3UFIA 2CNZA 4XXDB 3S36L 2EVJA 4P0DA 1AZNA 4BFRA 3VX1A 3QIBB 4GQ9L 1Z3GL 2NMSA 2WYHA 4IIQB 4PJDF 3T1WA 2IVFC 3WY2A 1M42A 1B88A 1VEMA 2QPFA 3S8GB 3EO0A 1EDYA 2NXZC 1FHGA 1G7HA 3X13A 3TEYA 1LXMA 3HG3A 4JO2H 5FGBC 1QBBA 4CDGC 1U91A 5DEJA 2ZAHA 3S35L 2XVBA 1YN6B 2AEWA 2RB8A 1CTNA 4Q14A 1H3GA 2NY2C 1LWRA 1DQDH 1JZ5A 3RY4A 2AKRA 1PF3A 4GPVA 3O6ML 3QNXB 5IMOB 3DX7B 4JMNA 1M1XA 1V3KA 3E0GA 1BXXA 1ZV2A 5GGSA 2NX5A 2ORBL 1MJ8L 5KVFE 2QSTA 1BXAA 1X4YA 2C4FU 3UBXG 4F91B 1QR1B 4LPWA 4M3HA 4C58B 5KWYC 5DA0B 4IRSA 3QHZH 1CMOA 1S9WA 3IMRA 1NGPL 1FNFA 1KCBA 4A6YA 2XA8H 4GAJH 1I9JL 5CWSA 4PJ7F 4F15C 3BP5B 3FPYA 4IIQC 3ZKSD 3O4OC 1QI5A 2AEQH 2EUXA 3NACH 1MCPL 4P2OB 4P04A 1MI5E 2PPAA 5LQBL 3ZR5A 3CVHB 3VFNA 1KCLA 5FF6B 4QKTA 1JPST 4IYKA 5AWNL 3D50A 1PGRB 4ZPVB 1OSEA 1CS6A 1SHSA 2W9DL 1SXCA 3WIIH 2UX7A 3O3BA 3WLBA 2Z93B 4AZ8B 3VB8A 2H1PH 2DM4A 1ZKAA 4OGXH 1UEMA 2V9RA 2WLMA 5AVSB 1AACA 3PWPE 1QTPA 2A77H 4O9HL 4H8VA 4WFFE 2VDRL 3SDXB 2AZUA 1I1YB 1W8OA 4IRZH 1RVFL 2HFFA 1ZV9A 4D8OA 4P59H 3GMQB 4DGVH 1KULA 1F11B 2MSPA 4EZJA 2J25A 4OVVA 1Q94A 1R3IH 2HWZL 3QJVB 1MHPH 4PTTB 1LO4H 2VR7A 4FQ1L 1IM9B 3W82A 5JOEA 2H41A 3GSRA 4HEME 3VGHA 3PWJB 2Z4QA 3KPNA 2L7JA 3TBBA 4YHNA 1HIMH 1JZDC 2BHUA 2VRQA 3Q8EA 4JFTA 2WTRB 4GMTH 1SNRA 1RK1B 2OK0H 2HB0A 4ZS7H 2J6EA 4M5YH 4XC3L 4GT7A 4PU2A 2LVCA 3HR5A 4HG4K 2OYKA 3GRWL 3ABGA 4RMVA 2AP2A 5C0GB 3QEGL 3VGDA 2J8UA 1K4DA 1NGZA 2XZCH 4K3EH 1QQDB 3WTWA 3QK0A 2X88A 4KZDL 3QCTH 5H8DA 5A2JH 5K9QI 2ZXDA 2GTWA 3OKYA 4L5FE 5IJCC 3X1BA 1NCCL 5SX5K 5E08L 3CMOH 4W6YB 5IQNA 3TBTB 5F7EL 3B5TA 1JPEA 1OGPA 1JXKA 3D39A 3V7AE 4AC2A 1FE8H 1N12A 1AG6A 3QPXL 1BXVA 4HQQL 5IOPA 2A9ML 4LMQI 2RJMA 5EN2B 5GRUL 3VFMA 4PJCB 5EBLB 2A6IB 5ITFA 2D2CC 4KRMB 4UT9A 5BZDB 5DWPA 5D1XD 1RAMA 4G6MH 4DAGH 2V2TA 4JL1A 1NAMA 1D5ZA 4G1EB 1MXDA 4B5ZA 1FH5L 3MLXH 4R7VA 2Y6SD 4FCHA 4HD9A 4IKKA 1WC7B 1ZVSB 4AM0A 3IDNA 3T6VA 3QQ9C 5DK2B 2WBKA 3NSYA 5TE7H 2NY0C 4Q0XH 1EHNA 3HMXL 5G5DA 5KSBE 4C56A 2DWDB 4MQXD 1T22A 1TU2B 2QADB 1ETZB 4ONGH 4TLTA 4E9RA 4JKPH 4AENA 4U6TA 4I88A 7PCYA 3B1UA 4BSWA 4OZIE 2VW7A 4FHBD 4MBRA 4WWNA 2FNBA 1M71B 3RDTD 3W39A 5DJ2B 1PSKH 4G8IB 3S8WA 3V4UL 2D7NA 5EUKB 2G2NA 4YHYB 2D31A 5I30L 3D7PA 1MFAH 3MODH 1JGLL 2EKSB 4Y4FB 4OCXL 2K3TA 4HEPG 3Q6GL 3WUWG 3ZYJA 5DD0L 4I2XA 1EVUA 4R2GD 3CSTA 4HKJB 4E5XG 2ICWJ 3L81A 3TC9A 5MP6L 3OZKA 2X05A 2UXGA 1F3JA 3AUVA 3KPLA 2CG9X 2W59A 1N0LA 4NJAL 4PWEA 4PREA 3ZHNA 1BG9A 1IGIH 1XL6A 4HW6A 5J6SA 5EO0B 3U7WH 1FZJB 4WW2C 4OCRH 3JWDC 2YA1A 3T04D 3G5VB 2JH2A 3WS3B 5KN5B 3TCLA 3TVMA 4HIIA 3NEOA 2ROXA 3QCVL 1IC7H 1JS4A 4LLUA 1EJOL 1VENA 4GW4B 2XKNB 2ZT9C 4ZT1A 1H19A 3VRIA 1KPRB 2Q0ZX 1KB9K 4FFVD 4XVSL 1KWKA 1T7XA 2AQNA 3HJEA 2XV0A 4IRZA 3CZJA 3R8BB 1PY4A 5ICUA 4EAEA 2R56H 3FQXA 1U8CB 1KWGA 5AKRA 2WLJA 2VDKL 3TV3H 4PW9A 5MEOB 4JHAH 5HGGS 1KELL 2Z91B 3EFFB 5D70L 4LXFA 4NB7A 1JIBA 4RSYA 4UQ9A 5CBAB 2ZXWB 1ZLWH 4ENED 3SSGA 4N0YH 4Y4HA 4H8WL 2DOCA 5DMKB 4RWHA 4Y16A 2WWOA 4UDTB 3TT1L 4L8BA 3PJLA 2BOCB 1YZZA 2XV2A 2P5WD 4MYPA 4DT2A 4RDQG 3F64A 4XO3A 2MJWA 5LBSA 5BW7A 3DUSA 3ROLA 5ESQA 3S35H 12E8H 1HFUA 5DU7A 4UNTA 3GUTA 5IVXF 5G5DB 2EE9A 4V1DB 3HI1B 3QAZB 4ODTH 3WEOA 4HWZB 4AXWB 2ZUWA 4TLKA 2NYYC 3MV8D 1FFOB 4Z3FA 3H0TA 1KTRL 4U33A 2MOGA 2QDVA 1HKFA 3MNVA 3U1QA 2XBTA 2O6DA 4NZFA 4ZXBA 5KS9E 3Q5OA 1AXSA 1HJCA 2JV6A 1K2DA 3VI4A 2XETA 1NC4D 3LKSB 3LSOB 5FYJE 2G5BA 4JPQA 4PJDE 4AI7A 3NCYP 1V7ML 2FWOB 5EU4A 3NABL 5LGJA 1HCFX 3TBWA 3U7YL 3INUL 3R7RA 3IAQA 4I0PB 4IJTA 1A7OH 3KWTA 3CN2A 2HRPL 1ASOA 5DJ2A 3BRDA 1AC6A 3IN2A 2O72A 3FB8A 4PBWD 2IG2L 3V95A 1GGTA 5JW3L 3QQ4A 3EBGA 2FVNA 2APVA 2ZOWA 3BT2L 4I48B 1LEGA 1YNKH 2QADD 4KK8C 4MJHA 3QUXB 4Q2ZB 5INDA 2DMKA 4FNLL 2UV3A 1PW3A 2BPBA 4PJFA 2CHDA 5A2IH 1WFNA 4NZ8A 3EZ8A 2IDFA 2EZ0D 3P0YH 5INCB 3ZUNC 1A02N 1J8HA 2ZWLT 1WC7A 1EIBA 4K5MA 1G0YR 1LL1A 2BP0A 5LGJB 2C4FT 3IJEB 1JZIA 5F6IB 3TJEL 1ULVA 1NDGA 4EN3C 5BUAA 2AK4D 4FZEL 2BC4A 4JFFB 4PLKC 3WNKA 1IBHA 1LDSA 1L7IL 3HA0A 2BVTA 3AU0A 2VUKA 2KYIA 3WDJA 4OIBA 5L9DL 2MHAB 4BSVA 1KXVC 3KXFD 1WZ1L 2AQTA 4YHOL 5TQ2L 1QSFA 2JK5A 1BVNT 3S36X 1LEGB 3UJJL 2IQAA 5ISZE 3U4EA 3NPSB 1HU8A 3N6YA 3OLIA 5HDQH 5C0DB 1XGYH 1FVDB 1BAGA 3UERA 5CD3A 4DTGH 3S36H 2ZP0T 2B1HL 2EXWD 1WBYB 3AS2A 5I8EB 4XXWC 4QCIB 5E2UL 4N24A 5KBPA 5KVEE 2R2EB 1COBA 2IMNA 3SO5A 4GQRA 1PD6A 1G6RH 3O45B 1N10A 2E76C 4Z7VB 4FZ8H 1QFPA 1YY9C 3SPVA 3HB3D 1YEIH 3ZKNC 5D2LE 5BMFH 1NDGB 3KLHD 4LO9A 4A68A 4OF0A 4YWGL 3QB7C 5LDUA 4OGQC 3RVWC 2JQAA 4Z7NE 1A14H 1SOQA 1E4HA 4LASH 5D1ZD 5DRXB 4YSDA 2Y69B 5SWSD 1A22B 5SX5H 1PLGH 2JQMA 4G9DA 5AZEL 3TZVB 1A9VA 3QHFL 2NQDA 4Z7WA 1FYTE 3BWAA 1VFAA 3I02B 5IQLA 1S7TB 1VADB 2PTUA 3EO9H 1KYOK 3O3BB 4P99A 1Q9KA 1X44A 5KJ4A 3CLEL 5ILTH 4AIZA 2C4XA 4PB0H 1SY6H 1JYXA 4OLZH 3GF8A 3BZ4A 4AYDC 5CLZA 2F5AH 3MV8E 3EDKA 5EC2B 3SD5A 3DJTA 1WHOA 1NCDH 2EXSA 2X1QA 2ZWSA 5L88H 3D18B 4DCQA 4G72B 4OJDH 4AW7A 2JCCF 2NRDA 1WVZA 3QHFH 5I73B 4M02A 3K6IA 4V2CB 5AENA 2X4QB 5ANME 5EU3A 1QABA 2Y7LA 4JDEB 1URLA 3MJWA 4UTAH 1KJVA 1X5HA 4LNVA 4KKRA 1NDMB 1U93B 3KL5A 3LQAC 4S1RL 5INCA 3OB0K 5IB4B 1WO2A 3DGDA 4QRPB 3MLYL 1UXWA 4RESB 2CKBL 3BEVB 2FR4B 5GRYA 1H8OA 4F1ZA 5ESVB 4XE5B 3KWWA 3IDGA 2X0VA 5IG7A 4N2CA 3EDEA 2X2UA 2FJGB 2DIBA 3CK0L 2X0WA 1SJEB 1T66C 2FQGA 3RFZB 3CMOL 5E9NA 1AZUA 3KWXA 2WXQA 1IM9D 2OXHA 4MNGB 3AS1A 3ZZSA 3QR2A 3KPPB 2AK4B 2GB2A 4PWKA 4WO4B 2B3IA 4TQEH 3RBGA 3UTTB 3WO4B 1IE4A 4P8QA 1PD1A 3KEHA 4R8WL 1F2QA 2EYSB 1EGJL 2ZOTA 3MRPA 4PRAB 3KG5A 1AQKH 3QDAA 1IC5L 4HKJA 2OR7A 1KJVB 1CF8H 2APWA 3FUHA 5DMJB 3MLXL 5AOZA 3U6XS 2G0LA 2RA1A 3QDGB 5GIRA 3Q6FB 3VI3A 1LGVA 4QHNA 4PJAE 3ULVF 4JDTL 4XO8A 2UWEE 3OSVA 4IHOB 4M1GH 4BCYA 3NCCB 1XGRB 4PJ8A 2DDQH 5CGMA 3MO1B 3QUZD 1CCZA 5AAPA 1YMHB 4U1HB 4FLRA 5EORH 1DVFA 1E2WA 1I1RA 4U1NB 1OARL 3TVMB 1TQSA 4Z8FH 4LLUB 1GJIA 4ZTOL 2ZOLB 4F8OA 3OKLA 4F3FA 1HILB 3CFJA 1TSHA 1YNTF 1I1CA 4J5VA 2FHFA 4FQQA 5CR1A 2GSIB 4JM4H 1CK0H 1BHGA 2FGWL 3FB7B 3QXDA 4WK4B 7FABH 3BSGA 2Q20A 4U6YB 2KT6A 4WI7A 2NY7H 5C0GA 3FU7B 1EBPA 3ARWA 1I85C 1UWXK 2CIKA 3D87B 3MUJA 2UZYA 5GZNC 1B2YA 2FYYB 3WKQA 4DP7X 5KS9F 5MI0B 2CM5A 2BRRL 3HMWH 1OARH 3VTMA 2PWEA 5BJTA 5J89A 2HKAA 3MA9L 4XAKE 3B9DA 5KUKA 2A9NH 4LCIL 4WF7A 3EGDA 4BCXA 7FABL 4OZ4A 3B2DC 2AQ3A 3AM8C 4PM1A 3ZQXA 3MFFA 3NH7H 2PPCA 2WXIA 3RUGE 1DQLH 1RV6X 3FDWA 4ZFQA 4NZUL 3SE3A 3CSPA 3QCUL 5IMMB 4JFPB 1BQHA 4IOIB 4JQXC 2HTKC 2HT4D 2IFGA 2VN7A 3VSVA 4ELKB 4HK3J 5F3HA 4YK4B 4PJ7A 2NNXA 3R18A 1T1ZB 4M6NL 5BZZA 3B1TA 3TF4A 1IAIM 2WKGA 1WBXA 1UXSB 5AW3B 4ZPVA 3L4ZA 1OAYL 5C0JB 3SDCC 5E6IC 1LEIB 2R1WB 1QSZA 1BYPA 2DEYX 5DSCB 3TTYA 1KC5H 3V9EA 1BYOA 5HBBA 3Q3GA 4GO8A 3BVTA 4KK6D 3FQUA 3ZO9A 2C1OA 3WFBH 2FL5A 2VABB 4B7LA 4BH8A 4XVSH 1A1NA 3GMPB 4M93B 5D9SA 2X87A 1L3WA 1LEKA 3TEWA 4U7KA 1A6AA 4JFDB 4PBDA 2EXYD 2V7HB 3W9DA 1XXDC 5HPOA 4KRNA 5BOZG 1EQWA 3WFHA 4Z7VE 1CBVH 1ZD6A 1OLLA 1QVOB 3OPZH 4XPBH 5I8OH 4OW6A 1CGSH 1G7IA 2KBGA 3WNJA 4AZUA 1JWMB 1T80A 3GSNB 2FT7A 3BW9A 3ML9A 3TBTA 3F5WB 2VITB 3FH5A 3PQYB 4OI9A 2BS8A 4YX2H 4FQXA 1E7UA 5CO1A 2EXTA 3QRGH 2NY5L 4KKLC 1NGZB 4POZD 1VKXA 1P4IH 2X70A 3EF4A 1B2WH 4O2FA 4G7VL 1NC2D 3BE1L 1K4CB 4X99B 1ZHNB 1ZSDA 3ATFA 2ZXQA 3LS4H 4YPJA 1IBGH 4YFEA 2EC8A 4UU9B 2WIIB 4E9SA 4OUOA 4IK7A 5TPWH 4Y5YC 4HH9B 4ZMYA 1NCAL 4RISH 4ODUA 3KDMB 2OMZA 1MI5B 3O4LD 1ID2A 2HH0H 4GKLA 4CSSA 2VRAA 3NJNA 1TJHL 1HCYA 4H25A 3V0VB 1P6WA 3C5JA 4KZ0A 1K72A 4P2AA 4P46C 3RVUC 4XNXH 2EYRB 2HTLC 3BISA 5T1LD 2JJVA 1FP5A 4OQTA 1I1YA 3GRWH 5CBEB 1FVDA 2X4OA 3QUZB 4I3SL 5KSBF 3BPLB 1KXTB 5CEZE 2CHWA 1XIWC 3CLFH 1MFMA 1BM3L 1A7PL 1OSYA 3BESR 3IJ8A 5J12C 4QHLA 2IWEA 3QIBA 2UUDK 1GSKA 2BP3A 1M4KA 4MS8C 2J1XA 4N6RA 1E6OH 4Y16B 4AMXA 5HVWA 5I1LA 5DLMH 1GGBH 1QBML 4G3YL 4AGQA 3MLZL 2BX5A 3SJVB 2BSDA 3HZVB 2BVEA 5D1XB 1I82A 1W8NA 3BPLC 5BUPA 3WGUB 3K91A 3QCTL 3QUZC 4GKSB 3CZFA 2ZX6A 2BP0B 1XQ4A 2J8UE 2PCPB 3I6KB 1RUMH 3K72A 2V0AA 3FBQA 4J6RL 5F7KC 2QSQA 3S0PA 4PJDB 5K5YA 3APDA 3TVMC 3TZVD 3MLSL 1BQHG 1DQVA 4XN7A 4FEIA 4NQDE 1UC6A 3F7KA 1YYLL 2VXQH 2Q5BA 4JO4H 1TITA 1CE1H 5DR5H 1IEAB 5CGYC 5DC4B 3V0JA 1SGKA 4YE4H 1FGVL 2NY1B 3T65A 2Z65C 3CBJB 4WFHE 2L04A 3FRPB 1UATA 3LJ3A 4IBTA 4LHUG 3LZLA 3AAZA 2C7UB 4QXUH 3DXAB 4PJBA 4TUJA 2XKSA 4XN2A 1PVHA 1CLVA 3U6RA 3QDJD 3ZK0A 4BUHA 1PFCA 2TRYA 2CGRH 5C2UB 4X6FA 1X5JA 4K7PL 2AEOA 5KSAD 5LBVA 3EXLA 1MIMH 2KQNA 4OFYA 4R4ND 3HE6D 2NR6C 2X89A 3OZ9L 4NN5B 1CL7L 2JJTC 3NJFA 3P3SA 4HC1H 1SEQH 4MJ2A 2E6QA 5MEOA 2BWDA 3N85H 1CF8L 5DZJA 4XCEB 3L4UA 4D3CH 5AW2B 2WB7A 3LB6C 1AZZC 1DJHA 5A2FA 3UTZB 4KDWA 5IWLC 3JTSB 2WTOA 2NXYD 5D1QA 1XH3B 2HVJA 1U8CA 1UCBH 3EH2A 3IWVA 3SCMC 1NGQL 4KHXH 1M9SA 3T2OA 1E9PB 5E4EC 3EG9A 5IF0B 4RIRA 3HTLX 4HLJA 3NG5A 5E7FA 5TK4A 2CGZA 1MEXL 3C9NB 3IPBA 4JO3H 4X4KA 5I74C 3VFSB 3LB6D 3PL6A 1IBYA 3DECA 3E8UL 4WNQB 2D0HA 3BOVA 3RNQB 3RWDA 4HJEA 5LDSA 1N7ML 1QUNB 3MACL 4OFIA 4RNRB 2BOLA 2VDOB 2YWZA 4U1KB 2YSTA 4XO5A 3SDXF 4AQ8C 4PJ7E 3UEQA 1HWWA 4LRNH 3WUWA 4L2LA 3IDMA 3BAEH 3DI2B 3GJFK 2WCGA 8FABB 5H94A 3UO1L 3QDMD 2YGPA 3SQRA 3QR0A 5IVXA 4U1SB 3VSUA 3SQOH 5HI4C 1WISA 4X7EC 3SE4C 1YPZE 4P49A 3CZLA 4L8DB 3W38A 2LU4A 4GRMB 5CP3A 3U6XA 2AW2A 4NT6B 1SY6L 4N1EA 2F08A 4LVOC 3FFOA 3QIUA 1BQKA 5DK0B 4OF5A 5EU3B 1MCFA 3VSQA 3QC6X 1LK2A 1YN7A 3ESUF 1S3KL 4CSZA 1ND0B 3PAVA 4QRQA 1DZBA 2FQDA 3E3QE 3BN9C 3F83A 4AWJC 3VFMB 3UCRA 3LQMA 3TZVC 4CC4A 5I75C 4RAUA 2IFFH 5J6GB 2P24A 2GJ6E 4QXGH 1FZOB 1UH4A 2A9DA 5AW8B 4G7YL 2CLVA 3SYPA 5LG6A 2A99A 4CVZA 1JI2A 4P4KA 2YLKA 3TPUA 3MRBB 4QHKI 5FEBA 3QJOA 3QEQD 1SJEA 5E9DB 1MAML 4ODWB 4Z7QE 1I7UB 4M7ZB 5E6YA 3OQRA 2EDKA 1S8DA 4LQ1A 5ECGA 5F1NA 1KEGH 2GSGB 2YFOA 2AXFA 4P2YA 4UILH 5D96C 5F71A 4QXTA 7TAAA 2D03L 1ZIAA 4RRPM 1BFOB 4Y8DC 5H4YA 1G7QB 3ESMA 4FXGB 1E7VA 3QUMB 3O2WL 3ZGIA 1GYUA 1QATA 2CHZA 4L5FH 4AOFA 1IGCH 2ATAA 3VW3H 1AS6A 1YEKH 2X4QA 2KS0A 1WV7T 1QHOA 1UXMA 5CCKL 1KIUA 5ERWA 4MMXB 3UPRB 2OKMA 3RVUD 4X0NA 5EC2A 1PQZA 1AZRA 4G71B 1OHZA 1U21A 4DCQB 1AQKL 1DJIA 4UILL 2NTSP 3KGRA 4PRPE 5C0NC 2VXVH 5CJQH 1R17A 1RZIA 3POHA 3QWOB 1G7LB 3OHXA 5I19H 2X4RB 1H3PL 1PZAA 2ENPA 3GHBH 4HIHA 3CTTA 3RX9A 3RWGB 3L3DA 3A3YB 5D5MB 1FSKC 1C16B 1EFXB 1Q9WA 2G4GA 4L3CB 3FT3A 4NC2B 4LLYA 1HI6B 5MENB 1QTYT 1QKZH 3H3PL 4WV1A 2DJUA 5I6MA 3QE5A 3BCFA 1UXWB 4ZNEE 2VDMB 2FCBA 4G6AD 4GAJL 3S37L 2E8ZA 2NDGA 1J0JA 5CJXC 1ZLEA 2HZHA 4W9KC 5JIDA 3G6JE 2QT6A 3BE1H 3L2LA 4UQCA 4DK3A 5FXCH 1FSKB 3I6SA 1ECZA 2NZIA 5I1JL 3C87A 4OZGA 3ZDZE 2AZAA 3FCSB 4HAGA 4ZPTB 3ISWA 3SGDI 2ETWA 3RVTD 1OT1A 2WJ7A 3D85B 1RU9L 4Z7VA 1AFVH 5IESH 3APNA 4DZ8B 1IL1A 2JNZA 5H35A 1P0SE 1KB3A 3K2IA 3O3AA 1DQLL 3GNML 2Z92B 1MPAL 5FV1L 1BPVA 4HULB 5AVXB 4ALAL 4WI6A 1R5VA 3HZ3A 3M17A 2D9CA 3Q1SH 3L16A 1LP9E 1VERA 3OAYK 4I3RL 5I73C 2YXFA 3VFOA 4G59C 4LVHB 2OMBA 4U1JB 3WEMA 1BD2E 3FO9A 2RR3A 2PXYA 1IE5A 4JKNA 4Z7UE 3V6BR 1K5NA 2YD9A 3K4DA 1IBDA 3VD4A 4XMZA 3MI6A 4EQ2A 1XO8A 1YJDH 3UP6A 3PYCA 1LO2H 3FCSA 1S9WB 4NDMA 5CEYA 4UV4L 3SDAA 1ESOA 5EBMB 4AE1A 5HDQL 1PMYA 1AI1L 4JEGB 5A1AA 2FUQA 2NY3D 3BZDA 1DTUA 1YNLH 1JPSL 4OFVA 1RZFH 5IJVA 3QG6B 4AMKL 5IJBC 2ZSVA 2OULB 3S8FB 1QD0A 3FTXA 5D7IB 1HSAB 2WYIA 5JXAH 5HDRA 5FYKL 1I9IL 3Q5TA 2LU5A 1RFDH 1QRNB 3H9SA 3ZDWA 3QQXA 1NCUA 4M00A 4BK5A 2FECI 2N3JA 3T0EE 1CE6B 1GRWA 4HAFA 4UTAL 3BW9B 5DA4A 2OSYA 4IBYA 4L4VD 4W93A 5C08A 2P8PA 2OA9A 4ZTEA 1JJUA 1ZK9A 3C5ZA 1LK3L 1RI8A 1TQUA 2D3VA 4LEOB 1RZIB 1J9TA 4WEBH 3EGSB 5I6KA 5J5EA 4AVIA 3M1CA 3DVNB 2EC9T 4Y19A 5FCUL 4Z0XA 1H6UA 3ZT6A 4PGCA 1P5UA 2LV4A 2OXGB 3GXPA 5A2KH 4QY8A 4P4RA 3BHBB 5KZCD 1N5AA 4BKLA 1KV7A 2EIZA 3CMGA 2VXQA 1A21A 2MQ0A 5EU6D 4X50A 1AGDB 5E6SB 2Z31A 5LHDA 1UCBL 2AF2A 2B39A 4NZRL 4YSRA 1HSBB 4P2OD 3O9WA 3BD3A 2B9BA 4FQCL 3CIAA 5FM4A 1PG7W 4ODWA 5KG9B 1JV5B 2H0FA 1RPQA 2WIMA 5BRZA 4NHCL 3QNFA 4DO5A 3FQNA 1JZ4A 3CFJB 4L0PB 4PWGA 5GS1A 3VXMD 2EIJB 4WRLA 1NICA 4GUPB 3ARBD 3NCEB 1MQKH 5CSZB 1T6WA 2V7HA 4OV5A 4IGBB 4H5SB 4Y2DA 3FULA 4ANKA 3MODL 2JIXB 5TDPB 3FT2A 4L1BA 2V3DA 3IPEA 2W88A 3UXFA 3QIUB 5F1SA 4O2CB 3QO1A 4ZO6A 5EWIH 5HD8D 3HVDA 2NPLX 4N3UA 2PTVA 4A2MA 1TZAA 4W4OA 5HGDB 1NMAH 1NBYB 3FL7A 5J1TC 3R1GL 3DPDA 3KM2A 5K1NA 4KV5E 3MV7E 3OWRA 1OTTC 4TOYL 1H0DB 3UIZA 2ZCZA 5FCSH 3RI5F 1MCCA 5EG6C 1XGZA 1EHLH 2A6DA 2Q6WA 2PYEB 3T4YA 3EJUA 4QYOA 3GEWB 3JWNC 4HALA 4ZODA 1SJMA 3RTLA 4J6RH 1I7UA 1W0YT 5DVOA 4OH2A 3TH3T 3MN8A 1RPKA 1I8IB 1RHHA 2AXJA 3G6DH 4OQTH 5BCAA 2R0LH 3O3DB 3ZX1A 3WHE0 1IKNC 2HJLA 4JO4L 4Y8AA 3ISYA 4JDTH 5J12B 3GSOB 3PU7A 5E5UB 2R8SH 2AANA 3P0GB 1OP3K 2R0WL 3QQ3B 4XH2B 5HJGA 3QJHA 1KN2L 3VD0A 2JFCA 2H6PB 3I50L 4KVCL 2ERJC 5DMIH 1KPVB 5SWZD 1GZHA 2CDGA 4NZJA 5CBAA 1N0XH 3S34L 4ZD3L 4GSDL 1TQWA 1G7JB 3IFOB 1R3HB 1YEKL 3QXAA 4GINA 4OFDA 1KN4H 3F04A 3II2A 3U1PA 3PJSA 4LDLB 3L3IB 5HI4D 1FORH 3DUUB 3WEXA 1EFQA 4MQXC 4YUEL 3ZTJH 3HUJE 4XVTH 3V5HB 3TPUB 3CUPB 1F4YL 4A6YL 3A6OA 4HXAL 3DXAA 1WA1X 1GHFL 4PJBB 2E86A 4WLCA 1A6TA 2J4WH 2KDGA 3QI9D 1D9KB 4KRPD 5AVUB 4NN7C 2XVGA 1I1AD 3IXTB 3VFTB 1PZUB 1A3LH 3AFLA 3N50A 1DBMH 2KI6A 5DDHA 3WJJC 2G3XA 3RDTA 1WLHA 4YX2L 3IU4L 1OGAA 2FEEL 4CADA 3R4DA 5F9OL 3PP4L 5LNGA 3FYEB 3DHUA 1JD7A 1OSPH 2JIXA 3CFCL 1K4CA 3P30L 4JFQB 4Y2OB 5ID1A 1GH7A 1AE6H 5FKPA 4M61B 1U8PB 5E70A 1CFTB 3RGVA 5I66B 2ICWB 1WIUA 4ZMXA 1D5IH 1TNMA 1W15A 5IR1A 1KTCA 2X6MA 4N90D 4DKAA 1GZQB 1FL5A 4Y9FA 3N40P 3I74A 1H3XA 3CVHL 3ULSA 2NZ1A 5E1GA 3S3CB 1QQDA 2G9KA 4NQCD 1MF2L 5EEVA 3JXAA 5GGRB 4FI6A 3N40F 3RWIB 4YVUA 3OKNB 3RY5A 1K9TA 3C60B 5TE4L 2JQZA 3EYOA 4NKDB 4CJ0A 1LE9B 3OQ3B 2D2OA 3RP1A 4X8CA 4LSPH 3LV3A 4AJWA 1JGEB 1VIWA 3VU2A 1T3FA 4ZUSA 1C1EL 3VXRE 1LEKB 3TVMD 1KGYE 4DP1X 2IAMB 4MX7B 2Z31B 3CIQA 4N2LA 1EO8H 5F1IB 1FL3B 3LTVA 5HHOD 4CA4A 3DGGA 4P9HL 2R7EA 3FC8A 3X14A 1IILE 3HN5A 3V6ZA 2V37A 1TTBA 1PX4A 1IUZA 2X44D 3OL2A 4UTCA 5DVNA 4PJEF 2Y2YA 4NC0B 4MCMA 5E9DD 1Q38A 3T8MA 2F5BH 1BXUA 1W72B 2VXVL 4O5LL 4FJ6A 5F89A 3GS7A 4CGUB 3OC5A 2YFNA 2LTQB 2UY6A 5INDB 2P8PB 2HFGH 3ARGD 1V55B 3VFOB 2Z0BA 2YSSB 3BMWA 1YPZB 4H13C 4J23A 5IEHB 4XVOA 3L4CA 2R27A 1ZTXE 4A1RA 4XP4H 4GLRI 4Y16D 3IETA 3MRHA 1VCBC 3QNYB 2FO1A 4JY6B 1RL1A 4Y0GA 3ZDYE 1GYAA 5DR5L 2YD3A 3SDDB 1RZ8A 2OMZB 2XLLA 3FB6A 1RUQH 3HUJF 1OIOA 4NP4L 5I15H 2ARJQ 3S2CA 2E5EA 2F19L 4MVBC 3BAKA 3BVNA 3GT6A 3KLQA 4AIEA 5SWZB 4MMZC 2FWOA 5EU4B 2X9XA 3B7SA 4J1UA 3POCA 4A6YB 4JRFA 4OZGB 2KC0A 2BNRE 1JZJA 4YO0A 1FFNB 1M1XB 1NLBL 5B39G 1RZJC 4UUJA 2UUDH 3VTTA 2PF6A 1P84J 5CZRA 5C0JA 4P07A 1MY7A 1UM6L 4OBRA 4PJ9D 4CILA 2Z6FA 4HEMA 4BKTC 5CJXA 2YXMA 2R29A 2VO5A 3E2HC 5I18H 2YQBA 5I1JH 4HZLB 3DROA 3MRGA 1YPZA 2CLRA 1UZ6F 2PWHA 4AZ8A 2NCEA 1PKQE 4B9YA 4XNAA 1BJ1J 2ZWYA 3CLEH 3MGTA 3R06B 5IESL 5E4AA 3MRKB 2MIZA 2BZ7A 1NOLA 3MZTA 2B4CH 3II1A 4IQHA 3LIZL 3ZKXC 2ICWA 3O6MH 3S35X 3GGWA 2XXFA 5IREA 3FOMB 1KIPA 3DVGA 3EJYD 1T2QL 1XGUB 5E1QA 1FNGB 4WWOA 4LLVA 3MLYH 2LLNA 1JYVA 4EI5B 1BBJB 2I69A 3TBVB 4L23A 3SGKA 1T21A 2F58H 3PDOA 4LOUC 5FHBL 2E9IA 1ZTMA 1BF2A 3N41F 3NCJH 3P2TA 3H6JA 4R5XA 1XH1A 1ZSDB 3KMDA 1OCWL 2EXYC 2Q8BH 3L7EB 4P3WA 1J8HD 4QRSB 4DW2L 3TYFA 4HAKA 4KTGA 4RMBA 1QTSA 4LEBA 3FFCD 1ZXKA 1T0OA 3UAFA 4R90H 4UYPA 4V1DA 3WS6A 3FONA 2VXTL 3VXSE 2HXAA 2A9AA 4M7LT 2NY6D 2R23B 3VXNB 5D1XE 2PPFA 7PAZA 1J1OL 4TULL 1NFDF 1FNEB 2VM4A 4JUSA 1JG9A 2WKOA 5BO0D 5IBLD 3WL9A 2H2SD 3LEVL 2G2PA 2HWZH 2UY7B 1OE1A 4A38A 1Q0YH 3UZVB 1H15A 2VXUH 2V3EA 3TBWB 2F7QA 3D05A 4Y88A 1R3HA 4QHNB 2LLLA 3UTOA 3SQBA 5E5LA 4K8RL 1DANT 3NIGB 5KYXB 1ETB1 1YUKB 1NCBH 1Q8MA 2IAMD 2NXZB 3L3HA 5CIPH 4CJ1A 5L2KD 1ORQB 4JG1H 2R0ZH 1PJWA 5D96B 4YDVB 3GBEA 1GKOA 4AQ1A 1A7QL 3B9KD 4FXGA 2B1AH 1INDH 4PJBF 3S7GA 1JPGA 2DDQL 5HSFA 4MKTA 2BW4A 1VESA 4JREC 3EW3B 5E5RB 3VH8A 4Y89A 2D4DA 2ITCB 1U8HB 3MLUH 1BW8A 1UB6B 5GZND 4WHYG 5J11C 1REIA 3T09A 3C6EA 2E74C 1ZT7A 2ZKHH 4C56B 4IRSD 3GKWL 3MA9H 2C3HA 1F90L 2GG1A 4FHKA 5BPPA 1KDJA 5HI3C 3VXPA 3BJ91 2OV0A 1JSYA 3IDYB 4FYSA 4D0DB 4L05A 5IBUG 1HVXA 4AKQA 3SDDD 5B39A 3T2NH 1CDHA 2H47C 2O6EA 5I71C 1HNFA 5HHVL 4NBYB 3ZYZA 2YPVL 1ZK5A 2WLLB 3K4ZA 2EIDA 4HJ1A 2PTTA 4M29A 1AAJA 1DBBL 2BNQE 5CZVL 5IW1B 4YXHL 3DVGB 1RZKH 4GKNB 4Y4HC 1JWSA 1IGCL 1HNYA 1TMCB 1XXFC 4G6AC 4OGAC 3WENA 1FNGA 2X4SB 4JFWA 4PR5B 5AZ2H 3ULVD 5GS2H 1XGPB 1BFSA 3NJMA 2QMKA 2UXFA 3ISRA 4PD4K 1WGVA 5DHEA 4LPTA 4XPHH 5FIEA 5TDNB 5F6IC 3SB3A 4GY4A 4JQIH 3OKLB 4PP2A 2DQMA 2YRBA 4DP5X 1DJXA 4F58L 3LEYL 4N87A 2YA0A 1NBZB 3TA3B 4H40A 4WFHD 2EH8L 4MB4A 4PRPA 3S48A 2ZUTA 1GGUA 1WGOA 3SGJC 3K1KC 4ZG1A 3WKML 2RBLA 4N2EA 5EH1A 4M03A 5E2VH 1YDPB 4LVHC 2X4PB 1TQBC 3OG6B 4NQEA 4OZHB 4QRSA 3N55A 2PABA 1F18A 1ZHBA 3FO2B 1SZNA 4O2EA 4H44C 3E38A 3G5XB 3GJFA 1W16A 4WFEE 2F2HA 3U9WA 3ZSTA 3BXNA 2APXA 4K9EL 3ABLB 1R3KB 1G7MB 3A67H 4BWUA 1I1AC 1UWGH 1ZPUA 3SDXA 1XV8A 1RU9H 3GSVA 1OL0A 5GJTH 1A3RL 3BQUD 3CFEB 3CSYA 3W56A 1FN4B 1RUKH 2X2HA 1UUSA 4FFZH 2DQUL 1H8LA 1IC7L 5CEZD 3HG4A 4DP8X 1C08A 4ZMQA 3U1SL 5KVEL 5E9DE 2DL2A 5ACMA 2PYED 2FBJH 3U4KA 3OLEA 3P54A 1VADA 2HT2C 4G8EA 3HHSB 3CN0A 5FX3A 4PJ8D 2LW3A 3BN9D 3PXHA 1MW3A 4OB5L 4DIXA 1QRNA 5F7UA 3GI9L 5DWUH 5I1AA 5KAQF 2H1XA 3DKHA 4FG6C 4BSVB 1OALA 1QLEB 3G5YB 5PAZA 3EJCA 1HXKA 3EH5B 1RUKL 4O4YH 4PS4H 2QPUA 2YK1H 4I3RH 4TTGA 4M56A 1JNLH 3N42F 3RAJH 3MLPA 3SKJH 3VFGH 2JB6A 3P73A 4R7NA 1BF8A 4RFNB 4RX4D 5KSVB 5G2NA 2R2BB 3TT1H 3PLYA 4WI5A 4PYHA 4S1RH 1ZLUK 3RL1A 3VXSA 1P9MA 4PY8I 1NDTA 2BWIA 2NQ3A 5E4IA 1GY1A 1KTJA 2F18A 2OQJB 3TM6A 1N4XH 5BXFA 3GSNH 4AL8L 1UD6A 4NNYB 4PJ7B 2AVGA 4HBCL 3U0PA 3S5ZA 5C07D 3LZNA 3H85A 1IAIL 3U83A 1A8ZA 1T0PB 5LQBH 3BQUC 4NN6C 4BFIB 3QC5X 4NKOA 2CJUH 2O26U 2FSEB 3T6ZA 4NRYB 3TIEB 3VGBA 2EXWC 5TGBA 3Q05A 4M7ZC 4DKFL 4TQEL 2JKNA 2XQYK 4PBXA 2C3VB 5J56B 4ODUB 3V9FA 4I1PA 2FL5B 4G42B 4MDIB 2L3BA 1A7NH 2X4NB 3BPNC 2WXMA 3FQWB 1WK0A 1MRFL 1TR7A 4XNYL 3MYZA 2HKFL 2CR6A 3QUMH 2XTSA 3IM1A 1KPUB 5AW6B 5EZOL 2VQ1A 1F1GA 4NN7B 1YAIA 3EH3B 4K3DH 3ATAA 4HQQH 3Q06A 1X4ZA 2P5EA 3OKEA 4R26H 3DNKA 4H0GA 1ID5I 5C0DA 4W9JC 3MNDA 4JQIA 3ASWA 3BUYA 3RVXC 2RMNA 3UTQB 3ECVA 3KLKA 5EDSA 4FXKA 1Y07A 4KK9D 2ADJA 3EYUH 4RFOL 3KPOB 5IMKA 4OJFL 4N90E 1QHQA 4G8GD 5HDLA 1JPTH 2X12A 3CFEA 4C4UA 3K74B 3O6LH 3KAAA 4HLZH 2DLTA 4FQCH 2OMWA 2FEEI 3CGTA 2UZPA 5TF0A 3A21A 2C1PA 1CICB 1ND0A 4NAJA 5C6TH 3TEXA 2BNQA 3UADA 4S1DC 4AQAB 4M48L 1ORQA 1KT2A 1TVHA 2VJXA 1MDAA 2OJEA 1MEXH 1S2EA 4JG5A 4MX7A 4IBUA 3BZ5A 4OUUB 2DQGH 4XH2A 1CFMA 1U8IB 3PWVB 5JLZB 5EEUA 3L9YA 3O4LB 4KDTC 1KPVA 1U2CA 4NI3A 1JGEA 1IKOP 1NEPA 5I8KL 4BZYA 3VRIB 4DGYH 3QIWB 1PSKL 2V5MA 2WQVA 3PAZA 4GH7B 4LOUD 5BNXD 3CDYA 1Q90A 4OLYL 4MWFB 2AXFB 2B5IC 3KS0J 3GZPA 5E8OA 3CVIL 1SHMA 3WO3B 3TOPA 2V2WB 2FX7L 4E9WA 5BOJA 4KQ0A 4C55A 1QASA 4IS6B 1TQBB 1JUFA 4XCNA 1N64H 4PGDB 1DVFC 5DZOA 1XB3A 3D2TA 1KSRA 2WOBA 1QBAA 3C5ZC 3PWNB 3BAEL 1KLFB 3WFEH 4ZW8A 4YDZA 2D9QB 5D7JD 1AR1B 4GKOA 1O6SA 4JZNB 4PJ8B 3R8QA 4E9VA 3OKDB 1NJ9A 3ULUD 1KIUB 1XBRA 1FYTA 4ENZA 3SJVD 2NY1D 5IQ7H 3RX5A 2VCOA 5JA8B 1P7HL 4R4BA 4ABVA 3GMMB 1AGFA 1IMHC 1GW0A 1D6VL 2EICA 3V52H 1EDQA 5D7KE 3N3EA 4H1LH 3QUXD 4KQ4L 2E0PA 1DFXA 2X3BA 3LN9A 1F58L 2WMPA 1JD9A 1G4MA 1RIVL 1TZHA 2Z8SA 3W81A 1IAMA 3TBSB 5DHXB 5C3IA 1M71A 3NP3A 4QAWA 1LP9B 3AWGA 4IGBC 1DBML 4U1KA 3GSXB 1NBZA 4RGNB 4L4TE 4MB5A 5D2NA 4RBPK 4ZQKA 3T77B 1DZ0A 4CGTA 4ANWA 3PWPA 2P26A 1F4XL 1TFHA 1WBZB 2ICEB 3SOBH 4P9HC 1H3VA 3PQYE 4XCCL 2E46A 3HRZA 2TAAA 4KXZI 1EEZA 3NP4A 5C07B 3ZTCC 2W65B 3BCDA 4Y5VA 4HCFA 1OGAE 1CFVH 3VVWA 5EU5B 1JWUB 4LVNC 2BW5A 4UIMB 4LF3A 4NBZB 1XZ0B 1H6TA 2E9BA 1YQ2A 1OPGL 3WIHA 1FG9C 4I0KA 3HZKA 4TVPL 4I3GA 5F7DB 5HYSA 3SQBB 1U3HC 2CO2A 5D1QE 4OM1H 3BP7A 1L6XA 5E94A 4ZW3A 3GEFA 2CCWA 1VZGA 4LARH 4IBQA 3QHZL 1AYRA 3AGWA 5CILL 1ODUA 4DGIH 1UG9A 1B9KA 1GTFA 2DQHL 3CHQA 4J4PD 4JRWA 5C7ZA 3IAGC 4K7FB 4QMEA 3CK0H 5DQJB 1IFHL 1KELH 5D70H 5D71H 2Y9RT 3CDGB 4PVMA 1JVKA 1SEBA 3FU9A 4WDIB 2CDFA 5I76A 2VIRB 3DMMA 4X98A 3IWUA 4J3OD 4E9XA 4K73A 2Q1EA 4WUUE 1CTOA 4TSCH 2XFGB 3P2BA 4ISVB 4BE5A 1T5XB 3OAWA 1VA9A 1BM3H 1INEH 1XR8B 2B59B 5E24E 1HHKB 1ADQL 3L95B 3ZE1F 3B2XA 5B22A 4N2IA 4ACPA 5IJVB 5FUZH 1UKQA 3EJZD 3MKKA 4XC1H 3HNSH 5E56A 5FW7A 5BVPH 3BN3B 1JYNA 5EUOF 2BSRA 3RGHA 1CDGA 3QDMA 1JMZA 4GAGH 2UY7A 4LLWA 1KGUA 4X6DB 3S37X 4LSRH 5DGRA 2X70B 4MXWL 4BIKA 1LE5A 5B1KA 2BK8A 2P47B 1N9PA 4F2EA 2YRLA 3N1FC 1ZE3C 4KROC 4YDJA 3G5WA 2YQ2A 3L5XL 4LEOA 4HYTB 3VA6A 4FN0A 4BUQA 5FUZL 4N2DA 1T83A 2GJ6B 1MELA 1OT4A 3I85A 5JIIA 2OZ4H 3V4LA 4CW1B 2VDLL 1QFUH 4KRPC 5CJOH 4AVJA 1TZIA 1UWEL 4ZX6A 1LLAA 4N9GA 3FH8A 3FO1B 3ULUE 2XWTA 4XP4L 4B41A 4JFFA 4BELD 5AB1A 2EEBA 1AKJD 3H9HB 2EINB 4JB9H 4PJIA 3GXNA 4FC3E 1NCGA 1J9RA 5DVLA 5GGVH 1UURA 1RUPL 5EA0L 2LFEA 3OX8A 5EO9A 4NJ9H 4UOW1 2PR9A 4HKBA 4JO5A 1TCRA 3NJVA 5DD3H 3W11D 1A9EA 1UWEH 1J8RA 1I3RB 1ICTA 3ZDZF 1S7WB 2WV3A 1P7BA 5I82A 3QSKB 2AJSH 4HWUA 3QDJB 1BD2D 4Y4FD 3RKDC 2ZWZA 5F0MB 4Q9QL 2AK4E 1T6BX 3VFRA 4PVNA 1ZT4B 2BIMA 1FC1A 3K80A 5FCUH 3TBYB 3GM0A 2QFPA 2WLYA 5K9JL 1F00I 5MENA 2VITA 2BIIA 1FL5B 5IFHH 1RUPH 4X7TB 1J5DA 3WFHB 1X3DA 2WBJD 3CU7A 4DW2H 1G7IB 4GLRH 2B1OA 3JWNE 1KC5L 3D4GA 5K33A 1NUDA 3RWFB 3UYRH 1L9NA 3LRMA 4XPTH 2XCMC 1PYWB 3RHWF 3NRPA 1UD5A 4OF6A 2FX9H 1QSEA 2H3NA 4P9MH 2IANA 3D08A 2WUCL 1FWXA 3UROR 3WY4A 2FX8H 1Q9LA 1WZMA 4UU9A 4HJUA 1FL6A 4M4RB 4MSWB 4MJ4A 4X6CA 1J1OH 3MRCB 4KDVA 3ULVE 1GXEA 3H3KA 5D4JA 3MZGB 2ZCHL 4EN2A 4P2QE 4PAZA 2BXYA 4XVUC 1UTDA 4YHPA 4PJEA 1A2YB 1CGSL 3VXMB 1TVBA 2ZP9A 3B2VH 3P1VA 3PGFL 4HWZA 4AXWA 3NZHH 1MLBB 1Z0MA 1OM9A 1S8DB 3DXAE 3O2VH 3NCXA 2WNKA 3U82B 1NFKA 4EUPG 2YZ8A 1E4WL 3EJPA 4GP4B 3DX9B 5JOPD 2R1YA 5B21A 4Z7WE 5F89B 2K9UA 2CRZA 2CMRH 3RPKA 2JE8A 4MZIA 4A7GF 5DRNB 3IMBA 5JW4M 1SYSA 3ARDD 3SYQA 2MCPH 2EEAA 1AR1C 1LVEA 3ATEA 4HX1A 2Y5QA 1SVZA 3ZL2A 3DWTA 5L7XH 1S9YB 3EFOB 4MCZB 4NWTH 3PWUB 5IHWA 4M62H 3ARZA 2PTTB 1PZSA 1AOHA 5HJ3B 4EO5A 1MCHA 1YY9D 1HL4A 1AZVA 1OZUA 1CLOL 2Y7MA 2F61A 3KL3A 3KJ6H 2Z3FA 1C8PA 4XXCA 3QUML 3GKZA 3T0EC 2XWDA 5KYUB 2BY1A 4XO4A 1Z5LB 3GQFA 4JZJA 3UO8B 1KBGL 1N70A 4MA8L 1SN0A 5DMYA 1OWRM 2WQWA 5CHNA 1DQKA 3RWEA 4NSKB 5DJAB 2VC2L 4TTDC 1J05A 1QSFE 5HPMA 4ONFH 5FGSA 4PY8J 3DIDA 4O51B 5FFLA 3IGLA 1N6QL 4MAYA 3SBWC 4KY1H 2OZ4A 3VI3E 4CC4C 2F7RA 5TDNA 1UXLA 3LKNA 1OTTD 4HFUH 1CD8A 5EOCH 4B60A 4POYA 1R5WA 1M3IA 4JFVA 3PJSB 3LAFA 4JQIL 4OKDA 4Q4IA 5E2WH 3BP7B 5E94B 4AY0A 1OW0A 5C6TL 1UACH 1EEUA 1BD2B 1KFAL 2AJXH 3BP4B 3M88A 4OM1L 5E8PA 3I75A 2OJEB 3C2AL 3VTAA 1RUAH 3PHOA 4Z8FL 2PMZA 1N8ZA 3O6KL 1V3LA 1XHHA 1D6EB 4GW5B 2HSIA 4GUCA 4YHLH 4WO0A 2WC7A 4D2NA 5B3SB 2ARJA 3D3VA 1X6LA 4OM0L 3S3DB 2Z0UA 4KGJA 5KYNA 5IHBA 4G8GB 3NCBB 1AHKA 2W81C 3V0FA 3W3BA 5AL8A 3GNMH 3RNQA 3RWDB 2LT9A 5EU6A 3S3BB 1WT5C 4U6VL 3B9AA 2F7IA 4XI5D 4HXAH 2JELL 3ZJAA 4NUPA 3FAXA 4GBXA 3EG9B 3FONB 5EIQA 2A74B 3QXUA 1FBIL 3DDGA 4LSSL 3OHXC 1N59A 3HKZA 2ZUVA 4AT6B 3A5VA 3L3KA 1OSZB 2DY2A 4QXVA 2K1MA 4Y4KB 2VERN 3BC9A 4JHAL 3OR7A 1N68A 1ZLWK 1YNTB 4FFZL 1KCKA 1D7CA 4JKMA 5T3XD 3LZFH 4JM4L 3UTSE 4RGNC 3VI4E 4BZ2A 5LGHL 2JXMA 3L9BA 1F4HA 2ADGB 3D4YA 2EDJA 3DDFA 1ZOXA 4MS6A 5EBMA 3X17A 2PO6D 3SY0B 4Y2DD 3ECWA 5T1KA 3B9EA 3C08H 5J3HC 4OZIF 3MBXL 2VMCA 4LHQB 5F72S 1A6WL 4MFHA 3W0WB 4OTXL 2X4TA 3CCHB 1JBJA 2VXSL 3Q2LA 3AU1B 2GUOB 5I1CH 3KPRE 4NCDA 2O93L 4UBDC 4GXVH 2LTQC 4XP6H 3WNLA 4F5CA 3KW7A 4JHWL 4JY4B 3MTXA 3JUZA 2QJDA 2Q8AH 4TQHA 3UZEC 4PJAF 3QH3A 1OCCB 4WSKA 1J48A 1TYJA 1XGYL 4CVWA 4EMZA 1IFRA 4XWGL 1JZ2A 1CO1A 4P9HH 2J5WA 3QIWA 3OVUB 1K4DB 3ARSA 1LK3H 3DHJA 5JDSB 1YEGH 1PZ5B 2C9XA 3TNMB 4HJGA 3V8OA 3ZVVA 4GIAA 4WKZA 1ITBB 3MRNA 3BX7C 1SUHA 3GJEB 1HQRB 1P5UB 3GJFH 2DBJA 3WFBL 1ES0A 3MRFA 3MLWL 3CG8A 3ML8A 4G8FB 3IRPX 5DHMC 4PJCA 3QI9B 5DD5L 4S1QL 4WTXA 1E5YA 2VZVA 4FKEA 3RJQB 1T89C 3VI4F 3CC5B 4CMHB 5HHQA 3WD5L 4N6RB 1HCZA 1I1AB 2ESVD 1PLGL 4NM8L 5GRUH 3HE6A 1CGVA 4Z77A 2X89D 1U33A 1JXDA 1URZA 1Z9OA 4H0IA 4KNTA 4NO5A 4Z7OB 1BOGA 2K7QA 2DWEA 3RNKB 4G7VH 5A43C 5E5MB 2CKNA 4YHKH 4L3CA 4AQ8A 3AS3A 3VCLB 3PREA 2VNCA 2E6JA 1LJMA 2QQKL 4PV9B 3WIAA 4MA1B 1FV1A 3H7BA 4XPFH 1G7LA 3OHXB 5EZOH 3MNZA 4ZTPH 2VZSA 1EZLA 4M4PA 4J7RA 3ASOB 1LDPH 1HSAA 1E8YA 4FQJL 4PHZA 4N2KA 4BH8B 3GMOB 1XH2A 4N3TA 2J1KA 4FQPA 4KJPD 3SCMA 4OCMC 3DGGB 1DCEA 3Q1EA 2J5LC 2IWKA 5BZXA 3IB4A 1ES0B 1SDYA 3DXAD 2VUOA 4B96A 1GMEA 1XF3B 1A25A 3QRGL 2VLMD 5FA3A 1YNKL 3IFNL 1R5IB 3K1DA 3UG5A 5GSVA 2ODHA 3QZPA 2NY4B 3BAJA 4AUJA 1ZHBB 43C9B 4QOKB 1HEZA 2IALB 4OKVB 3VGEA 5B38A 1N19A 4FLOA 1JI1A 1TNNA 4MYWB 1EPFA 2BP8B 2P5WA 4IDJH 1QLEL 2VAAA 1WIPA 4XC1L 1R47A 5I8EA 4EQ3A 5CN3A 3EGXA 3M17B 4G6KL 1DR9A 1Y6KR 3UC0H 2A83A 4XGZA 4U3XA 4APXB 3ZO0A 3MLTA 1JPFB 4JFOB 2BOCA 1PG7H 4GG6E 2X53A 1H5BB 3L5XH 1AJ7L 3MLVH 4ZW7A 3VXUE 1I31A 3SY0A 2JSFA 3LIUA 1F86A 1NC4A 4I3SH 1WUZA 3HVNA 2W92A 4E41D 4EZKA 4XXDA 5LCVH 5BJTB 1XMEB 1WITA 3P9LB 1I7ZA 3C6SA 3P4OA 3X14B 4UV7H 4AIXA 4NZDA 2E7BA 4YQXH 1IEBB 2EIBA 5GHWH 3JT0A 4ZOAA 3H0TB 3AXLB 4FFWD 4LQFH 5EIIB 3BUPA 2ATPB 4LKXB 3W2DL 4HJGB 1BBDH 2KERA 4TKWA 2XV6B 1F41A 3MLVL 1MQ8A 1XCWA 2R1WA 1OB1B 4L4JA 4ZO7A 1EBAA 1JTPA 4ZUTB 3FN0L 4IOFD 4YIQA 1IGML 1NAKH 1YMMD 1GIGH 1QFWI 2KLRA 4XMXA 3RZCB 1QEWA 1XSOA 2WY3B 3H9SE 2D7MA 4MD5B 3KLDA 3UTSD 3V52L 1EUTA 3LKOB 4KZEL 4WGKA 3G9AB 3DO7A 3N85L 1MCLA 2GITA 1HHIB 5DMKA 4HHAA 3SE3C 3VWKA 3ZSSA 1CLYL 1RZJL 2R0ZL 3LNHA 4PJ9B 4R83A 4M6AA 4PW4A 3Q9PA 1NIAA 2XTLA 4FYQA 5AZEH 1M6UA 4BK8A 1AHWB 3ARGA 2VDLB 3KYAA 5D1QB 5KSUB 3WCYA 3TWYA 2RQEA 1Z7JA 5D7LE 1SLWA 2IGLA 4QIRA 5CGYD 5ICYA 1CXKA 4PP1C 1E28B 3RVWD 5JMOC 2PCYA 2OBGA 3AT9A 2JVUA 1ZGLP 1XF5B 1HZLA 3GYRA 1FZKB 4U1MB 2MQGA 5F3BB 1FDLH 2H1LM 5B1JA 3QXVA 3TEZA 4AH2A 1NBVH 5T1MB 4Y9BA 4YDNA 4LK4A 1GAFL 3KPQB 3WMQA 4IBVA 3A6CH 2XQYG 3BVVA 3FUDA 3PGFH 4OZFH 8CGTA 4K15A 3LZRA 5C8JA 5TFSL 3BGFC 2XXCB 3WYRA 4XVUD 2VIRA 3O6FB 3QT2A 4RGNE 4Y9EA 3WBDA 5I5MA 3IDGB 4E9QA 4LOEA 4G80A 1ANUA 4PJHE 5FECB 4FP8L 2IH1A 2Y72A 4F37K 5I1EL 2FJGA 2QEJA 2D0FA 3X12B 5HHVH 4YDKH 4KKBD 4K94H 4M3KB 5FO8A 1JV5A 3KCWA 1YECH 2AC0A 1XIWD 5T5NG 2Y7SA 4DN3L 4PVLA 3GBNL 3M8OH 2WQ8A 4G83A 2X6BA 4LHUB 4LEXH 5LAPA 4P23C 4I9WE 5DRNA 5I6XC 1K8DA 2QVFB 3ZHKA 4XMKL 3T2NL 3Q6FA 3VI3B 4ELDA 4NAMA 3MJ8A 2GBVA 2RFXA 2VOTA 3KVPA 2VDNL 2NCMA 2GJZA 3IRCA 4G6JL 3QZMA 2CSPA 1YAZA 2FWUA 4EDWL 3VNZA 4A7QA 4AQAA 1I3UA 2WXFA 4MD4B 1S7XA 3TCXA 3J2PA 3QQNA 3E9TA 5DD6B 2LAAA 1D2OA 2I7SA 3SKNB 3TA3D 5DUBA 1XTLA 1F1DA 4FG4A 4JPSA 2WYTA 1MCRA 2EADA 3EYVA 3VG0H 1RQ5A 1ZE3H 4G80B 5FECA 2R23A 3AC0A 4PS3A 4QRBA 4TNVK 4DJMA 3GM8A 1EAOA 3SE9L 3ZIYA 5I16A 1E4XL 3V4VB 4JHWH 1G5GA 4GG6F 4MJJA 1E6JL 4KTEH 1SJHA 2NY7L 1F8TL 4M5ZL 5IBLC 1A2YA 4RGOL 1OD7A 2YUVA 3D9AH 3FFCA 4FXLA 3DRTA 3G5ZA 2IGFH 4OLUH 5KTEL 2AEPH 2XY2A 4YSAA 4QO1B 3QVAA 5CF3A 2Z34A 1YEFL 3A67L 1YN7B 4B27A 2ZUYA 4PI0A 3WEBA 3NGBB 4QOKA 4MS8D 4F9LA 3UABA 4A66A 5KYXA 1JHTA 5CEXB 2CKBB 2PCPA 3I6KA 3M46A 5BS0A 2FB4H 5T5FA 3CDFA 2OZ4L 5L2JB 4KROB 3K6SB 2FAUA 3H42L 3OF6A 2YBRA 5DYOB 3D18A 3S97C 5E2JA 1UHVA 3BO8A 5D7JB 2NYKA 3ARGB 5KSUA 4YSSA 5EU7E 4LSUH 5DJ8B 3RUGB 3S96A 1JPFA 3TBYA 1RSFA 5J9PB 2GIXA 4Y19D 1GA2A 5CCKH 4DEPB 1H3UA 2FBJL 1LO5A 3B9KA 3QJSB 4AYFB 2OL3A 4HUUA 2FR4A 4PI2A 4DH2A 3VDCA 4G9DB 2J55A 1P1ZB 2F1BA 4LCIH 4FE9A 4KI5F 4JZJB 4OM0H 3MV9E 3CSFA 3DBXB 5HHNA 1AKJB 1A7PH 4LPXA 4M9OA 1GC1L 2HTKD 3AG2B 4P2OA 4S1SH 4TLUA 1ONQA 3GO1H 5GZNA 4DZ8A 2BZDA 2WTPA 5DJ0B 5EIIA 5A2LH 3DURA 2MNWA 4FG0A 1KLGB 2ZOOA 3BZEB 1EX0A 2VSKB 5JOFB 2QQNL 5IKCB 4WTQA 3T3ME 2ADFH 4ZMZA 1G1KA 2EEDA 1QFUL 3JBG7 2XQYA 3HE7D 1MAJA 3D6GA 1LD9B 4XAWL 3QNYA 5I74B 3VAEA 5SWQB 1MFEH 4PJFB 1HE7A 4BXVA 1OY3B 1DDHA 3SDDA 3DJ9A 4LSTL 4AEHL 1DVFD 1AR2A 2EKJA 4FKKA 2ADJB 3O81A 4UT7L 5JZ7C 2WN2A 1J8SA 3JTBA 4BFGA 1WS7A 1QZ1A 4J3WA 5D72L 5DUMH 4JJOA 1KLUB 1OV8A 4BQ9A 2OL3B 5AYQA 3NJHA 1CFBA 3GFUA 4APXA 2EVFA 5DHYB 5EF0A 1IAIH 1XB8A 4Q7DA 2MTAA 4BFKA 3HHRB 4X4YA 3OB0H 4PCTA 3GSNA 3HC4H 4NPYA 5B8CC 1FFPB 2GCYA 3CH1B 1DDTA 4YAQB 2W0FB 2FUTA 2Z7ZA 1CFSB 2AGJL 4XX1E 5DC9B 1SM3H 2YZ1A 2O5ZH 3S4SA 4K7PH 2YEZB 1IBZA 5E2TH 4HKBB 1M1SA 3ATDA 5B3JF 4FRWA 5K59E 4HH9A 3UTTE 3QG6A 4GO6B 1J0IA 3WI9A 3FU6A 3GTVA 3QUYA 4IBZA 1XF3A 4UV4H 1MI5A 4DO4A 6PAZA 1MFBH 4MNGE 3P73B 3MUGB 4S1DD 1SEQL 1XR9B 3HC2A 4P9ML 1HT6A 3TV8A 3V4VL 4Y1AD 3INOA 1N26A 3UX9B 4IKJA 4KOBA 1UEYA 5I2IA 3D0LA 3EJSA 4MNHA 1N6VA 1PKOA 2E7MA 3JWDH 2ENQA 2I24N 4IGBD 3BUBA 2W9DH 4OV6F 5GGUA 4AKOA 1YEWA 4KK9C 4MAYC 1NFIB 5F70A 1IB5A 4WEUD 5J7CC 2PUQT 5JW4N 3ROLB 4JRXD 1SQ2N 3EJJX 5DQDH 1SPDA 4XWOC 4KNSA 5M94B 5DI8B 1VSCA 1C08B 1M7UA 4BA8A 5F9DC 1GZPB 1GGIL 2NW2B 2FLMA 2WINA 1W6WA 3LEXB 3GSQA 4FKHA 1TLKA 1Y1DA 4GMTL 5E6UB 3SODB 5L6YH 2GPZA 2CBQA 2J6EL 5DRWB 3P3TA 2FIKA 3E1ZA 4UZSA 1SXBA 4X6DA 3RUGA 2OPCA 4N0UA 3ARFA 3U4BH 1LE5B 3RVVD 3SE4A 2MPAL 2ITFA 3RE0A 3TTSA 5LKNA 4PRNB 3H8NA 3QJZA 1S7XB 4UAHA 1XGTB 2VR6A 4XRCB 3IBEA 4BBWA 3DOSA 4K8RD 4KO5A 1I53A 3I75B 4DKTA 3LN5B 5D6DA 5B8CB 4WKZB 3W0WE 2AV7B 3KH3A 4FQ2L 4WI3A 5FO7B 5CJ8A 5EOCJ 2FIRT 3ARTA 3MBEA 4QF1B 5JNYB 2FX7H 1BQSA 1TJXA 4KKAD 4RGND 5I8KH 1QO3B 1SMDA 1UJ3B 1ET8A 4P46A 2W9EH 4CN1A 4HUUB 1QLEH 2OZNA 1SJHB 3E6HA 4LNRB 3KWUA 3CHOA 5EU6B 3IF1A 3V9CA 1Q9WB 3DBSA 3AT0A 5AD0B 1WFTA 2EIMB 3D0VA 5D7SL 3F65A 4N1HB 2XG4B 3FSAA 4NO5B 2W1NA 4G82A 1G7HB 2OYMA 3US0A 4UM9D 1VCAA 4EOWH 3CFBA 3REVA 3JZYA 1T4KA 4GAFB 3HNVL 5FKPB 3ET9F 4Z9KB 4MHHI 1SBBA 1KXHA 4QRPA 4MA8H 3B2UD 1ZDSA 4DAGL 5IQ7L 3I3BA 5DYOA 5AW9B 3MV01 4PWFA 4DP2X 5FW6A 3MCKA 2NW3B 3CSBA 5CU5A 3T6QC 2MCMA 1IKFH 2FJUB 3D4ZA 3QYCA 2ZX9A 3LHPL 2XJKA 2PR4H 3H4HA 4NN5C 4UQ3B 1I9RH 5F7HA 1FLRH 4J3TA 5IB2B 1KB5B 1RIVH 2ZNWA 1MCBA 3HNVH 5EEXA 4XCCH 3HI1A 3BEWB 1CGXA 1TYEB 4FNRA 4WUKL 4HDIB 4GQQA 4GFTB 1KXVA 2V8LA 1RK7A 4FFYH 4TPRL 5FYJL 1KGIA 2DJSA 1E4KA 4A55A 1CQKA 1WP6A 5TQ0L 1BIIA 2R2HA 2O5XH 3VGAC 3VFSA 1UZ8A 1BF5A 2GAZB 5EZJB 3HHMA 2WQAA 4ZSOE 4YL9A 2QELA 1MDTA 4QHMB 1EXUA 3MUZ1 3TONA 3WU1A 4MNQE 2G3ZA 2ZP8A 3PHOB 2W07A 4RRPG 1LTXA 4J28A 1JNNH 2ZE0A 4FQHA 1T1XB 4XB8A 4YSTA 4L9LB 3PGCA 3BFOA 43CAB 1R9FA 4FS0A 2R0LL 1PCXA 3L3HB 1MHHA 1E28A 1S46A 2AABH 4KH9A 1F56A 4JQXA 2VGLM 4NCC2 4K71B 3RAJL 2DICA 3BDYL 3HZVA 1EGJA 2IXQA 3I50H 3RTQC 1TTAA 2X9WA 2H2PD 1IV8A 4LSVH 3LQZB 1JXGA 4ZS6D 1KBPA 3MROA 2LFGA 1IVLA 2GC4C 4EF3A 2GBTA 3M7FB 4NQTA 3Q44A 2FIKB 4KQ3L 1A4CA 4R7XA 4TXVB 4BFIA 1UZ8B 4D0CA 3OMZA 2CNYA 4AYSA 4A7SA 1U8MB 1CE6A 1J12A 3I6GB 2QKIB 1ETZA 4MCYB 5I6NA 4H2CA 4H8PA 4AENB 5KSAA 4OFYD 5E00B 4XX5A 3WG7B 4P46B 2PLTA 3CFKB 4GP8B 1USQA 5IHZB 4HT1H 4J3UA 2N7AA 3TL5A 2OMXB 3ZRSA 4DN3H 4PJGB 1EMTL 2HP4A 5I6OA 5JNYA 4NO3A 3N91A 2IFFL 1AE6L 4LSRL 2UZXB 1XDTT 1T4WA 3L3JA 3LRHA 2VYRE 3MJ7B 4YNYB 4ZS6C 4CU7A 1OP5H 1N5AB 3NA4A 5LBGA 1HN1A 5D1QD 1BJ8A 2ZXBA 5JXEA 1UD3A 1MFCH 1CDJA 2H0EA 3U9PH 4XPFL 1R24A 1C5CH 1SXZA 4IHBA 1JGIA 4QHKJ 3STZB 5LXGL 3SJVA 4HS6B 3MX0B 3VFWA 4YDMA 1EHKB 3PGDA 5IROA 1G7PB 4HU8A 4Z3JA 3FK3A 4JZOA 2V33A 3WHE1 1Z9LA 4RMSA 3HIZA 1BLNA 2PYFB 1WD9A 3FO9B 4LSPL 4PRIE 3VYOA 4L4VE 1MFDH 3LZOA 3OAZH 2NYZA 2AJUL 2AXGA 2OCCB 3QUXA 1F6LL 3SO3C 1MHEA 3Q2NA 5T8IA 2BY2A 5AB9A 4YHIB 4QRFA 4PIBA 1KTDA 4FNTA 3X3FL 4YPGB 5JIHA 3HRZC 3VFNB 4X4XB 4JO1L 4XBPA 3T4AB 1AXTH 5H4ZA 1X9LA 2BVYA 2UZIL 2EDRA 2RTTA 3RL1B 3T0AA 4IM8A 3CX5J 3FCTA 2DWTA 2FD6H 4XNUH 5E99H 4J6IA 5EO9B 5FM5O 1JZGA 1SXAA 4R97B 1TCRB 3EYQD 4IW4C 2VDKB 1DVTA 3A0OA 3IJEA 4E68A 4UZUA 4YE4L 2GT9A 5DFWH 3G5XA 4NXSA 2X2YA 5HI5C 1ASPA 3H2PA 4TQ8A 2HG5B