3H4HA

Met94thr/phe312cys variant of nitrite reductase from alcaligenes faecalis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
334
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLTHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title Directed evolution of copper nitrite reductase to a chromogenic reductant.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 92
structure length 334
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4hA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4hA02
1X9RA 1BXAA 1ILSA 2YQBA 3ZIYA 4YSOA 1WA1X 1E5ZA 3N2JA 4E9RA 1AZCA 2XX0A 2PPAA 2OV0A 1V54B 2QDWA 3S3CB 4KNTA 1MG2C 4FA7B 4DP2X 3EH5B 1JVLA 1J5DA 1NIEA 5I5IA 4G7QB 1JXDA 1NINA 2BP8B 1IBZA 2A3TA 2ZXWB 1CC3A 2PPCA 2I7OA 2DV6A 1ET7A 3N55A 1RKRA 1BYOA 3CZUB 3SBRA 1JXFA 1ET8A 2AZAA 1AS7A 2WO3B 3QPKA 4P5RA 2BP8A 2XX1A 4DP4X 3FPXA 1L9PA 1AZRA 4E9VA 2DYSB 2J5WA 5I26A 1PF3A 1XB6A 3FQYA 4JKNA 2AFNA 1J9QA 1ZPUA 2WO2B 3AG1B 4YVUA 2XU9A 2AZUA 3IE9A 1TEFA 5B7MA 4A68A 8PAZA 1KCWA 3FS9A 1MZYA 1PZBA 3DIVA 2FQEA 1ASQA 2IDTA 2WSDA 1L9SA 3NJFA 5IY5B 3PAZA 4BDVB 1E5YA 2XVBA 1NPNA 1QLEB 2ZWNA 2RACA 4P5SA 1BXVA 3FU9A 1NICA 2PP9A 2GBAA 2IWFA 2YAFA 3NJKA 5PCYA 4KOBA 1CURA 2J55A 1XB8A 4BDVA 4GY4A 2PPFA 1NTDA 4DP1X 3ASNB 2OCCB 3IN2A 5I5MA 2FTAA 2DY2A 2YXVA 5PAZA 1J9TA 1NIAA 1UATA 2TSBA 3QJVB 2R7EB 2HLEB 1R1CA 5FC9A 1J5CA 2GB2A 2VSMB 4N4YB 1JZIA 1NIDA 1AR1B 3FU7B 3UABA 4YVNA 4A2DA 2BW5A 3NSDA 2UX6A 2XYBA 3NJIA 4A66A 2R7EA 1IUZA 4NERA 4DPAX 4F2EA 3PCYA 1ZIBA 2E86A 1CYWA 3ERXA 5I6MA 1WAEA 2IWKA 4HIPA 1GY1A 3FU7A 3S8GB 4YSPA 4G7SB 4DP8X 4G7RB 2GIMA 4L0PB 4A2GA 1DYZA 2IH8A 1GS6X 3RYMA 1NIFA 4UF7C 1MDAA 2XV0A 3X1BA 5F7BA 2VW6A 3TASA 2GI0A 1X9UA 2GHZA 2VW4A 3NJNA 3GXUB 3TBBA 2JFCA 3SBPA 4JHUA 4YSCA 1BEXA 7PAZA 3C75A 3EH3B 2PLTA 1AQ8A 1BQRA 1EHKB 3SQRA 2QPEB 2VW7A 1AZNA 2MRYA 2IDUA 1KV7A 3WI9A 2FT6A 4BWTA 1OF0A 2JKWA 1GS7A 3PLYA 2FQFA 3X2QB 1IKOP 5AFAA 1A4BA 3OMIB 4F2FA 1OOWA 4HCGA 1AZUA 1SNRA 1GW0A 4NAJA 3DKHA 1NWPA 3FQ1A 3PPSA 4BXSV 1VLXA 3H4FA 3FYIB 4HCIA 1B3IA 1DZ0A 7PCYA 1WS8A 2CUAA 1NZRA 4E9SA 3FSWA 3WNJA 2EILB 4A2FA 1NIBA 2PP7A 2GC4C 3WKPA 1JZHA 1F56A 1JERA 2VMJA 4PCYA 4KO6A 1ID2A 3PAVA 4A2HA 2XXGA 2IH9A 5TK2A 3T71A 2B08A 3NP4A 4YSSA 3X1GA 3NSYA 3QJRB 4ZK8A 1AZBA 2Q9OA 2VSKB 1MZZA 3QJQB 3AG2B 1RCYA 1N68A 2CCWA 1J9RA 1OCZB 4W9ZA 1BYPA 1MG3C 3KW7A 5B1BB 4A2EA 4CSPA 3NT0A 4DP0X 3TBCA 1ZDQA 1KDIA 3FSAA 1SFHA 2I7SA 3NP3A 1KBVA 1FFTB 1SF3A 2DYRB 3CVBA 2IWEA 1AANA 4WTQA 4Q89A 2J56A 2H47C 5B1JC 2B3IA 3PXLA 1AAJA 2FQDA 4EF3A 1OCRB 4DPBX 2N0MA 4FAAB 1BAWA 1YLBB 3EHBB 3V9CA 2HX9A 2DWTA 1A3ZA 1PLCA 3QJSB 1ILUA 3FU8A 2UX7A 5I6OA 1M56B 3WKQA 1E65A 2DWSA 4F7KA 4AKPA 3OMAB 1NDTA 3X1NA 2EIMB 2AANA 2IDQA 2YARA 1OE1A 1QNIA 2BZ7A 3ZDWA 5I6KA 3ABMB 3ZX1A 1L9OA 1AS8A 1JVOA 3NJJA 5B1KA 2HRGA 1KGYE 2J57A 2VM4A 3HB3B 4BWUA 1GYCA 3NJHA 2YAPA 4QKTA 4GP5B 1PZAA 3UAAA 2FT8A 4HHGA 2XV3A 4HALA 3AW5A 1EZLA 4YSRA 4BWWA 4Q8BA 4HHWA 2XLLA 2FQGA 5EHFA 1PLAA 1QHQA 1L9TA 3QJTB 2Y69B 1PCSA 2Y1AA 2UXVA 2FT7A 1L9QA 1ZIAA 4JHVA 4YSDA 3WNIA 4CSZA 9PCYA 5D4HA 1SDDA 4M3HA 5B3SB 3OQRA 2LLNA 1AIZA 2H3XC 4QLWA 4A67A 4BXVA 6PCYA 4HCFA 3OM3B 4UANA 1ASPA 2BWIA 4AX3A 1GSKA 1ZDSA 2YAEA 6PAZA 3H56A 2YAMA 3FPYA 4AI7A 1ASOA 1OE2A 2CBPA 2EIJB 3X1FA 1IBYA 3D12B 1WA2X 5B7FA 1PAZA 1PNCA 1AG0A 2I85A 3NSFA 5I6PA 1L9RA 3X1EA 4AZUA 1PMYA 4KO5A 3FT0A 3DTUB 2NRDA 3GYRA 5TK4A 3S3BB 1ADWA 1CUOA 1IC0A 1TU2A 2CJ3A 2QT6A 2PCYA 1A65A 2ZOOA 5I5JA 2Q5BA 4YSEA 4DP7X 1BQKA 1SJMA 2YAOA 4KNUA 2HRHA 1SFDA 1WA0X 1KCBA 1A4AA 1PY0A 4KOCA 4TXVB 3JTBA 5AZUA 3T9WA 2YAQA 2XV2A 5B1AB 1W6LA 2X87A 1HFUA 3OD3A 3QQXA 2HZHA 5I28A 5B7EA 2GC7C 1E30A 1SHXA 2P80A 2OJ1A 4W1TA 3S3DB 2BWDA 4PAZA 5F7AA 3WG7B 1BXUA 5D4JA 4X4KA 3UADA 3U25A 2HXAA 4DPCX 3BQVA 1JXGA 1SF5A 4WKXA 1BQ5A 3NJGA 4E9XA 4E9WA 4RH4A 1V10A 3MX0B 3BVDB 3CDZB 5E9NA 3T6ZA 1HAWA 1GS8A 1V55B 2PP8A 2UXGA 4YL4A 1TEGA 3ABGA 4KNSA 1PLBA 2FWLB 5D4IA 2PCFA 2YXWA 1A8ZA 1N70A 4AKQA 3CDZA 3T6WA 2FJSA 1J9SA 2BHFA 2UXTA 1ZV2A 3CG8A 3GDCA 3G5WA 2IAAC 3H4HA 4UAHA 4MFHA 4G70B 4N8UA 2UXFA 3AY2A 3JT2A 4GXFA 4YSUA 3NJLA 2PPDA 3CVDA 4KO7A 1CYXA 3ASOB 2QPDB 3UGEA 2VN3A 2BW4A 2CAKA 3ABLB 2EIKB 3SBQA 4GYBA 1OCOB 3NSCA 2IDFA 4KO9A 2VM3A 4M4RB 2BP0B 3CVCA 1HAUA 1AG6A 2AVFA 4YSQA 2GSMB 1XMEB 4ENZA 1W8EA 3FSZA 2TSAA 4K9JA 1JZEA 4HAKA 4YSAA 2JXMA 3AZUA 3TA4D 4E9QA 2BP0A 2MTAA 1JOIA 1KDJA 2XXFA 2YAHA 1FWXA 3FSVA 1A4CA 1NWOA 5AKRA 5B1JA 3FQ2A 3ABKB 4YSTA 5A7EA 1E67A 3IEAA 3FYEB 1SDDB 3IN0A 2BZCA 1AACA 2P80D 2XUWA 4G71B 1OE3A 2XWZA 4E9YA 5ANHA 1NPJA 1AS6A 4GP8B 3ZBMA 2EINB 3UACA 2BO0A 1RZQA 3AG3B 2H5UA 4G72B 1JZGA 1PZCA 1OCCB 3WIAA 3IBOA 4NB7A 3T6VA 2IDSA 4DP9X 2ZONA 3QJUB 1WS7A 3KW8A 3PAUA 4DP5X 3EF4A 1KYAA 3UAEA 1M9WA 3V9EA 2FNWA 1GY2A 5I6NA 3TU6A 4HZ1A 1I53A 2X88A 5LDUA 1TKWA 1XB3A 3HEIB 4BK5C 2HX8A 2W88A 4E9TA 1W6WA 4AKOA 3OMNB 1OV8A 1RZPA 1URIA 1ET5A 1M57B 3NYKA 1KBWA 1JZJA 3AG4B 3T6XA 2PPEA 1FA4A 1SHWA 1T5KA 1GR7A 3NJMA 1ETJA 1PNDA 3EH4B 2HX7A 4GP4B 2QDVA 4DP6X 3S8FB 2W8CA 2CALA 1AOZA 3MBWB 5I6LA 3L45A 1JZFA
chains in the Genus database with same CATH superfamily
3G04B 1I1CA 5A2IH 2FGZA 3VFRA 2UYLB 2X9XA 2DLFL 3L3KB 3ZIYA 5I2IB 3D9AH 3QEHA 3PHQA 3PYCA 5LJYH 1NKOA 4IBQA 3TOPA 2H6PB 4U1MB 2AQSA 2GHWB 1TLKA 3DUSB 2WBJB 4U0RC 5KTEL 1W72B 2HKFH 2DS4A 3M7FB 3OAYK 4HV8B 3K1KC 4L3EB 5E8PB 2KPNA 4G6JH 2ZXWB 4JM2C 3CQQA 1A6ZB 3EAKA 5I66A 1ADQL 3QIWD 3ZRFC 4OZGB 4KBPA 4LL9A 4LEOB 5F7YC 3DX3A 3QEGL 4B9JA 2ZXGA 2COQA 1BBDL 4P23A 1KCLA 1DE4B 2ZCHH 1T1YA 1F0LA 1WAPA 5I26A 5JW4N 2LU3A 3V0AC 1F3RB 2BSRB 5CINH 2B1OA 4NCC2 5DD1L 4YN3A 1U95A 1GIGL 4NGHL 3R19A 3F7PC 3BE1L 4NHCL 5C07E 3OWEA 1QBML 2WWMC 2X44D 4HCRA 1EUUA 3E8UH 4X7SL 4CDGC 4KK5C 4ZQKB 1PZBA 3AAZB 5BO0D 4JFQB 1CK0H 3IJ9A 4RMWA 1B4JL 3WCYA 1JGDB 4ZTOH 1HXMB 3HN3A 3BP5B 5ACZA 1IL1A 3O2WL 3ARUA 3SDDA 5L9DL 4J3OF 1QLEB 4W81A 3MDJA 3BAJA 2VDQL 1ZSDB 5C0CD 4XHQA 3GS4A 3IDJA 3VXMB 5BVPL 3BN9C 1BVNP 1IAIH 2AEQH 1P7KA 3H85A 1WHPA 5IMLA 4FFYH 1KFAL 2W0FA 1J9TA 1FAIH 5D2LA 1PQZB 1IEBA 2V0AA 1TJGH 4OZHF 3DO4A 4FFVC 3TH2T 1EEYA 4M4PA 3DUUA 2XN9E 2ZWLT 1Q9OB 1XGTB 1MWAL 2X9WA 3FMGL 2J8UF 1OAXL 5FYLL 4FNSA 5JIIA 3MRHA 3DURA 3PREA 1JDAA 2ZX8A 2JJSC 4WTXA 5C09A 3T1WA 5FO9A 4FLQA 4KKBD 2WVVA 3HLAB 1CYWA 1YO4A 5DD5L 5IBLD 4YK4B 1H0DB 5B4MC 1D3CA 3U46B 4U6YB 5F7DA 2GIMA 2EDLA 4YDJA 1NGXB 1PZ5A 1RIUH 4UI2A 4NAQA 43C9B 2NUTB 2O26U 1BZ9B 1UH2A 3DX7A 4S1QH 1UB6A 4TSCH 5FFLA 4PJBF 3QUYC 3PFUA 3REVA 2PCPA 3X17A 1B2WH 2LABA 2VW4A 3NJNA 4QY8A 1XF2A 3TBBA 3QEUA 3LKPB 4WV1C 4H5SB 1UUNA 1KCVH 2VLKA 3LY6A 2HRPH 3LZQA 1T89C 4BRJA 1A4JA 4A1RA 1T7VA 3HFMH 1F00I 2QPEB 3U36B 5DJYA 2CGZA 1NSNL 2J1WA 5KANI 3NSXA 3WI9A 3SHSA 5D7JA 1BD2B 3C60C 2EYRA 1U8KA 3FCSB 4NQXB 4Z23A 3CV5A 4OGAC 4WCYL 4X7TB 1IKOP 3L8QA 4DN4H 4YHYC 5H94A 5EEXA 2ORBL 1Q38A 4PRIB 1AMYA 1IE4A 2PXYD 5CJXA 3U0PA 4OKVB 3L5XH 5CD3A 3OKMA 4ODSH 4TPRL 3GPSA 3MRGA 3TYFB 2PABA 25C8L 1PD0A 2PO6D 3WTTA 1KCKA 1C5BH 2X4SB 3I9IA 4BH7B 2EUZA 1NLBH 1YEFL 3AQDA 1A4KA 3OGCB 3NJVA 2DQTL 5HDOA 1T4KB 3MNVA 5ID0A 4MNGE 1ZGLM 2EC9U 4DGYH 3V7AE 4XT1C 4F8NA 3LRHA 4XCEA 4PCYA 3B9AA 3KPLA 4F5CE 2D7OA 1MCOH 1NDMB 4LPTA 1CLZH 2DWYA 3JVGC 4JDVB 5LGHH 2CO4A 2NY6B 4RWYL 3H53A 4ZFFA 2X6BA 4YDLB 1ZGLA 4E5XG 4Q9QH 1AZBA 1LO0L 2P7TB 3QIUB 4TYUA 2RTTA 4GKOA 4K07A 3TBYB 3W2DH 4QNPF 2Z1PA 3DJRA 3O0RH 2OMZB 3AGWA 4FZ8L 4OF3A 5F6HJ 4ZBJA 4Y1AA 1JTTA 4Z1PA 4L23A 5KJRH 3PQYE 2YGVA 5HHOB 4I2XB 5HDLA 4DT2A 1HI6A 1OP4A 3CVHL 5SX5K 4G59C 1TTBA 3MUY1 4MXQD 5AAMA 1S3RA 4JFDE 4UNTA 5FDYA 1OWWA 2OR8A 2DLGA 4ZMQA 5F7UA 4C83A 3EIFA 1DBKH 4LSUH 4RGMB 4YL9A 1J05B 1EGJA 1NKRA 2FHFA 5FKPA 3RI5F 3PXLA 3K81A 1M1SA 1J8HE 4GXVL 1GJWA 1YY9C 3O3EA 5D1QC 1PZ2A 1JNLH 2OMVA 2YO3A 3TVMC 2FEDC 3VG0H 1U8JA 2V5RA 1U3YA 3FU8A 1VA9A 1QVOA 4TLTA 4KMTH 4E5XB 3CFKA 4TQPA 5DRNB 1TQVA 1XGUA 4G2AA 1J8SA 2J1YA 3APCA 2PKDA 5D9SA 1TJXA 3FBKA 4I85A 3BVTA 1FO0B 1QWHA 1GTFA 5JHDA 1CLYL 3D39E 4LLUB 3L54A 3V0VB 5I6KA 2APTA 3BKJH 3T4YB 2OK0H 1UH3A 1EO8L 5FA3A 2Y1ZA 3ME0A 4MAYA 2P5EE 1U6AH 3BUBA 4M56A 3L5HA 3UZVB 1DQMH 2VERN 3PP3K 4GXUN 3WJMA 3VJ6A 4JO1H 2VLME 2RJMA 3HZ3A 4PY7A 3T0EA 1NCJA 3PDGA 2JE8A 2XN9D 1RV6X 2OMTB 1INEH 1UWYA 3V6OA 2W0KA 4HIJB 3EYQD 1RFDL 4NO0A 2WIMA 4WNJA 2I9LA 4FYSA 1UD4A 5E6RB 3CU7A 3GGWB 2JKTM 2DOCA 4K23L 2O61B 3UYRL 3FC8A 4FQHA 4QLRA 4YHLH 1X5LA 4HX1A 3LDBC 2UXVA 2FSDA 1CLOH 1ZOXA 2GVYA 4HK3N 1OT1A 2O5XH 4NIKB 5EC1B 1UZGA 2WXLA 4ZW6A 5EO1B 3WS3B 3OQRA 3FUKA 1WSST 2R1WA 3SE4C 1U58A 2NNAA 4Y5VA 4XPHL 3KYKH 3KPMA 3HRPA 2OJZH 4YE0A 3H56A 2Z91A 3MLSH 3ARVA 3T3MB 2XZQH 3VE0B 4R2GC 1HK6A 2UWEA 4KC3B 1AE6L 2VLJA 3ESNA 1Y6MR 5TGBB 2J6EL 3RDTC 1OAUH 4X9FA 1PKQA 2JQZA 4M8QA 2XVGA 1Q94A 3FBQA 1NAML 5GQBA 3WTVA 3PWJB 3CZFB 1OHQA 3GSQB 3JUZA 4MQXD 2F54A 4ZS7L 3L1OL 1FL3A 3L5WA 3LXAA 3VRLF 2ICES 1JNJA 1IC0A 3BRFA 3I6GB 5I1LB 2M2DA 5D7SL 1A1NB 4Z77B 2WTOA 4I77L 2W94A 4WHYG 1HDMA 5CBAA 3IF1B 2UVEA 4ADGA 1HHHA 3L3IB 1BPLB 1CIDA 2Z4TA 4KNUA 3QUZD 3EJPA 5D96B 4M02A 4MA3B 1RPKA 1F02I 1BYNA 2K6ZA 2ZWKA 1JWUA 2JI1A 4Y5XC 3SE9L 4ODHL 3JTSB 5HI3C 4TUKL 2CMRL 1X4XA 2VRKA 4PWHA 1NOAA 5I28A 2EEAA 4OD2A 4HJ0C 3ZMEA 1WHOA 4IKLA 4L1LA 4L9LA 3TO2B 3GMRA 1U3JA 2ZPKH 2YZ1A 2ZKYA 2CR6A 2AXFB 3U25A 3OAYH 3ZHDA 5FUZH 4Y2OA 3P3RA 2CBQA 3QFGA 5DJ8B 3MYZA 1DSFH 5CCGE 4I18C 4Q14A 5AVVB 5ICUA 3WN5A 3OF6A 4X5QA 3NTCL 3RAJL 3OX8A 5TD4A 2KYIA 2Q76B 5FB8A 3PQYD 1M9SA 1WITA 2WKOF 5TQ0H 3RJOA 4URKA 4NP9A 1P5UB 2E0PA 4WRLA 2VLLA 5HHMD 4JG1H 2XNAB 4D9LH 2LE9A 2E3VA 3W39B 4JFDD 3FRUA 4JRWA 4YPGA 3CDZA 1RZGB 4NFDA 4JN1L 1IC1A 2DLTA 4ZMXA 2HMIC 2VH5H 2QQKH 3NQKA 4HFUH 1E9OA 4LLVB 4XVUD 5DMIH 2AI0L 3OXRA 1J8HD 1TNNA 2BS71 3DXAB 1ZT7A 4GLRH 4FQ1H 2ZAIA 3UPCA 4HIIB 5DHMC 1TPXB 1S78C 4GRLC 1A7BA 1RURL 3INOA 5DMGD 4UOQA 3NSCA 2H3NA 3BPLC 4CU7A 2W0PA 3QQ9C 1A7PL 4M93C 1HSAB 3N3EA 2GSMB 4WHYH 1VKXA 2G5UA 5K9OA 1QEWB 3CD4A 5F8RC 3K6SA 3MLUL 3D52A 1HYRC 2FR4B 4IS6B 3IJYA 4PM1A 3O41B 2X9YA 5SX4I 5JLZB 4LCWE 2CXGA 1U8HA 5L8LB 5IROD 4L5FL 5AKRA 5B1JA 2V2WA 4WNQA 3D07A 4YSTA 5A7EA 3ZMNA 1NEPA 3UJTH 3SDXA 4DK6A 2VLMD 3BUQA 3BVWA 1AIFB 3O6LH 2HG5B 2C9QA 2QSQA 4XMKL 4NNPH 1NGYA 4H8VA 3UAJC 4DCQB 1PPIA 3KWVA 3ZRSA 2J8HA 4ABUA 3UDWA 2IVFC 2XY1A 3WJJA 3NIGE 4KROC 1TSHA 1RD6A 1Q0EA 4BA8A 4FI6A 5EF3A 1AXSA 5J57B 5DS1A 4ZO8A 3WKML 2BHUA 5LGJA 1K72A 3LIZL 3DX0A 4OLYL 3SO5A 5A2BA 3INUH 1MHHA 1RZ8A 2R15A 1C9SA 3EF4A 2WYTA 5F1SA 3UAEA 2IQAA 2P47B 5I19H 5IMMB 1MRCH 2IV8A 3ECBA 1LE9B 3AXIA 1ZVNA 4PGZA 3QZWB 3ZYJA 2ZKXA 1KTLB 2DWEB 4CL7A 4PD4J 1MJ8L 1FFQA 3F00A 3LKSB 3AB0B 3RVTC 4XVOA 5GGQH 1IM9D 2HJFA 3X12B 4EDXB 5A2CA 3UC0L 4FP8H 3H6JA 2XHNA 3T6XA 2PPEA 3MUGB 2WOYA 4HKBB 3QDME 1SHWA 4MWFA 4RETB 3BAWA 4GO6B 1PZUB 4IIZA 3ZN6A 2X2YA 1MELA 4KQ3H 1AOZA 5D8JH 4RIRA 3LRSB 4P2OB 3RUGA 2XN2A 4MCMA 1DEEA 3TNNA 2BVQB 2DYPB 1OVZA 3IDNA 4GQRA 4MJIE 2YQBA 1GTNA 3D30A 4WUUE 5IHLB 5L6YH 1Q9LB 1AZZC 4ONOA 4AEHH 1NCDH 4HSQA 1CG9A 1V27A 2A9NH 1YEDB 3BVNA 3UCQA 2EKSA 3W0WB 4A7GF 5E2WH 4YR6B 3SDYH 3HI1B 4Q6KA 1YZZA 3IDIA 1VFMA 4BQ6A 1PEZA 2ICEA 4KJYA 4AIZA 1KLGA 4JFPB 2BP8B 2FO1A 5HI4C 5C0RL 3LPOA 1VFAA 4NUGL 3VRJA 1E6OL 3STLA 4FGMA 3Q6GH 4BE5A 4PVLA 4IOFD 1YMHB 4YLQT 4GG6B 1WBXA 3MV7E 4DP4X 3FHEA 3OTTA 3MRMB 1CLVA 5HYJA 4E0RB 5EC2B 2GAZB 4KZDH 3G6JB 4GSDL 5T5FA 5A6IA 2A9ML 1K6QL 4HWZA 1KUMA 1EBAA 4JKNA 1WV7T 5CJQL 3ALPA 5IUCA 5D2NE 4LBEB 4XMXA 3EJQA 3T3PE 2XKNA 5I1AB 2Y7QA 3WFEH 4F8TA 3QBTB 5IJVB 2V8LA 4F2ME 2YJLA 4Q6IB 5KVEH 1N59A 2NW2B 2AF2A 1KLFB 1WZLA 3ARYA 5DJZA 3NJFA 1XIWB 5LXVA 2J12B 3KWWB 1NPNA 3DSFL 3RGVD 1JZ7A 2P24A 3IE4A 4H4NA 3UG5A 1HXYA 4P5TC 1UA6H 1TIUA 1F5WA 2IH1B 4RISL 2XOTA 4AY0A 2VXUL 4YBQC 1TNMA 4O5LL 2GT9A 4WI9A 4JUTA 3ZHNA 3UTZB 3MFFA 5KAQF 1F3DH 2E9GA 1YUKB 1V8HA 2LFGA 4MD4B 3RTQC 1XR9A 3MTRA 3AS3A 3B1TA 3G9AB 4Y2DA 3MVSA 3DX2A 3BEVA 4S2SB 5KN5B 3QAZB 2R7EB 1J5CA 4ZJ9A 3GSOA 5IKCB 4OLVL 5I16B 3P30H 4WI4A 1H8OA 3N43B 5HBBA 4KHTH 5K69A 5IESH 1YHPA 1JPSH 2UX6A 2XTJB 2Z1KA 2V4LA 5I8EB 4NERA 3NRFA 5I23A 1KPUA 3NCXA 2FRGP 4LCWD 5B39G 1KGIA 1ZIBA 5JIQA 4U1GB 3DX8A 1GY1A 3OJMB 1NCOA 3L9EA 1AHWB 2Y2WA 3I6KA 2MQ3A 5H4YA 5BQ7B 5JQ6L 4X5WA 2E4FA 3D09A 3PP3H 3IAGC 2YLKA 2CJUL 1XCTB 2XZAH 1ZAGA 2WQ8A 2QKIC 4MMYB 4I88A 2O72A 4WWNA 5GISL 3THMH 4Q9RH 4N24A 2WIIA 4ZD3L 2G60L 1MCHA 2BDNH 1E4KC 3MV8B 1VFBA 1QQDB 5HDBE 1Y0LB 4NO3A 4Y16D 4JMXA 3VQMA 5BO1H 1IGTB 2Y7MA 2E9WA 5E2VL 1DVFB 1K5NA 4JO3L 3C75A 2Y23A 4KFMA 2PLTA 3VXTB 1ZT4A 2FZ3B 3TBSB 1KN4H 2R56L 4AJVA 1RJYA 1DFBL 5C07B 4KTEL 3CZSA 1F11B 2HVJB 5G55A 2ZSWA 2A74B 3S6CA 3WJLA 2HWZH 4PRHB 4KQ0A 3QDJA 2NSQA 3Q6FA 5K33A 2VISB 4FQXD 2N1TE 1GS7A 2OZ4H 3HOGA 4IKKA 4QO1B 1V05A 5B39B 5G5DA 3U0WH 2JJSA 3KYNA 4N68A 2DF3A 3EO1A 2X4PA 4HCGA 5T3XL 4MNHB 1I8MB 2IH3B 3DKHA 4AQ1B 5AVWB 3GBNH 4ENEC 4BXSV 1BWWA 1UM4H 1FN4A 2G5BB 2OR7A 3AY4A 1B3IA 1FLTX 4GAGL 4QTFA 7PCYA 4QRSA 2HFFB 3GMQB 3LIUA 1OXYA 2VUOA 4KQ4L 5I66B 4XMUA 3NAAH 1VGEL 5LNEA 4CAGA 2WW8A 3LQAL 2R69H 4ODXA 3FCTB 2X2IA 3FT4A 3BEWA 2Q0ZX 3DK2A 3QUYA 3OR6B 2GSIA 4WUUD 1PSKH 4DETA 2ZT9C 3SKJL 2Y06H 2ADIB 5E23A 2Y7LA 4PYGA 1T1YB 2VDPL 5TK2A 4IJ3C 2B08A 4IM8A 4BK5A 4J3OC 3EG9B 3T4AA 3FUIA 5E00A 3B6SA 1I3RA 3EOYG 4ZMVA 2CA3A 3VDBA 4HVBA 4ETQB 3C60A 4JLRA 4K0OA 4I0PB 4X6DA 3CC1A 4J12A 3WHE0 2CCWA 5F89A 4YEEA 2X6AA 1S7UB 3SDDB 4NQCB 3MV7D 4ORGB 4WK0B 5E4EB 1JK8B 5ICYB 4J3XA 4N0UB 3BP6A 4DSYA 4LASL 1M71A 1KBVA 1WGVA 4DGWC 1C12B 4UNVA 3CVBA 3VFPB 1OY3B 3TF7C 4L0YA 4XB7A 4M43L 3PY9A 2Q8BL 4XHJC 1YNTF 4DPBX 4G6MH 3EFOA 3W11C 2MCPL 1CICC 4PUBH 1YLBB 1T0MB 1H15A 1MJ7H 5D2LB 5D7LE 5FCUL 3V9CA 1BG9A 5C9JB 4PGCA 3UTQA 3WUZA 2CR3A 3WXWH 3JVGA 4WI2A 3EJTA 4LT7A 5EO0A 1J18A 3SGEH 3TA3B 3FFCA 4OUUB 3D0AA 1KIUA 1WZKA 2HUEA 3R06A 1Z9NA 4Z76A 4FULA 1TENA 4E9LA 3I2CL 4QCIB 1LWJA 3KBFA 3AVEA 1YY8A 5DYOA 2DQGH 3ABMB 1I1YA 3ZE2F 5GZNC 2ZCZA 4YFLI 2BOCA 4NAMA 3PWPB 1QACA 5F7DB 3LNHA 2QMJA 3CVIH 1PZ5B 1TQBC 3GHEH 4QXUL 2R2EB 1AGFB 2YAPA 4C59B 3DX7B 3ZQWA 2A1WL 4FC3E 3QXWA 4L4TE 5F88B 3X13A 2P45B 5I30H 1DLFH 1JPGA 2B0SL 4PWGA 1MRFL 3IGAA 3AQXA 4QY8B 4JNXA 4G3YL 2R8SH 2W1NA 2GJ6A 2VLKB 4NOBA 5K1VA 4IBVA 5EHFA 1ORQA 4TL5A 5D1QA 1QHQA 2ATKB 3MXWH 5IT2H 3DPBB 1BFVL 5DJYB 3BSHA 4ZG1A 3FQNA 5EWIH 2AK4E 1UUSA 3VI4A 3BQUA 4DFHA 4KX8A 2WXQA 3SKMA 4JO4L 4ONHB 4OZGE 4DGVL 3P4OA 5D7JB 3AQZA 1N12A 4UZGA 4ECNA 4UTAH 3IWUA 1M7IB 4H0GA 1BAFL 1BQUA 3B83A 5I1GH 4K94H 5H94B 5LCVL 4K71C 3K4DA 5JQHC 3P0VH 5AOMA 3FULA 4IMKA 3V52L 1BBJA 2BMKA 2BHZA 2DI9A 3L1GA 3MJWA 3QIBA 3QO1A 4IGBC 2CR0A 1ZDSA 3U0PB 3OKMB 4EQ3A 4RMSA 1RZFH 2FJFA 5ECGA 4WFHE 5AYUH 4P46D 4L2LA 2WQWA 3CDGA 5JDSA 3LZOA 4XP9H 2FX7H 2Q2LA 3COOA 1L7IH 4MCZB 3ZHFA 3GD1C 2EIJB 4FXKB 5DZ9A 5FGRA 2ZAHA 4FLSA 3B8YA 4IEFA 3RFZC 4K8RL 3Q2VA 5AEAA 3SGKA 3KPLB 3WOVA 4PJEE 3P4NA 3HG4A 5HVWA 3C5ZA 5KSAC 3MGOA 3ILPA 3MV9A 4W4NA 1TU2A 2CU9A 2DLEA 1Z9LA 1RIHL 1MCWM 4ZFFB 4GEJA 1UCBL 3TONA 2W38A 1OKEA 4A2MA 4N0RA 1AQDA 1SJMA 2ZX9A 4AITA 3QQ4A 2PW1B 1LLAA 3LHPH 3T8XA 3ATFA 3SZ6A 2ROXA 3CFDA 3N0AA 4NPYB 4XNBA 5F6IC 4NKIH 1I8LC 2MQCA 1T7WA 4UOW1 2L7EA 5IVNA 2ARJA 2EXYD 3ISWA 2MHAA 5BOZG 2Z7WA 2QVFB 3RWEB 3BW9A 1U41A 2FHCA 1HI6B 4FFWD 4YAQA 4RRPG 3QJHA 4G6AD 2FX9H 3KYOA 2G4EA 4Z7UA 3VRIA 3E80A 1MFVA 3O2DL 2WQAA 4YHKL 3V0HA 1E42A 1DDHB 5DHYA 9CGTA 2J6EA 4TRPH 5J11C 1CVSC 1MCDA 5DVOA 4C83B 1KENH 1LMIA 5E1HB 1VPOL 1K3IA 5FKPB 3QR2A 1N26A 1W91A 3TWCH 4TQEL 4PJ7A 1NCCH 2OMVB 5GSVB 3D8MA 3WDIA 3F62A 4RAVB 3OV6A 4J3WA 1QVOB 4LKCB 2UXGA 1NLDL 3CFKB 1JNNL 2B1HL 4D0CA 5T1KD 3HG2A 1IAKA 4LEXL 4MVBD 1X5JA 5D9SB 2CE6A 4N0YH 5E6ID 5T33L 2A9CA 3CCHB 1ZS8A 4ZFOL 4LNRA 3D0LB 4GMTL 3RVXC 5FA3B 1TEYA 5GGUB 1S7QB 3ME0B 1A6TA 4NPKA 3DOSA 1YEKL 1AFVH 3CBKB 2VT0A 3NQIA 3QDGE 1YQVH 1BD2E 1E40A 3WJMB 1N7MH 2EIKB 1A3RH 1XZWA 4JJHA 4LAJH 5EU7E 3HVDA 5L4MA 1BF2A 1XEDA 1OTSD 3ARFC 4F7TB 4EIGB 4PRIE 5FYKE 1EDHA 4NO0B 2ITCB 3S4SA 4ENZA 2HJKA 4WGVB 1EMTH 4LMQE 3FSZA 5SV3A 1O7DC 4XXDA 2IAND 2JXMA 3SQOH 2MTAA 3GRGA 2WINB 3VU1A 4E41A 3KGTA 1XSJA 2OMNA 4HX1B 4MQSB 2MPVA 4L4VA 1MNUH 1WIUA 3T2OA 5F7KC 3FQ2A 4X4XA 2GBVA 4PLJC 4ZT1A 4XBEL 5CN2A 5CZRA 4MB1A 1XAUA 4LP8A 4NNXA 3HR5A 4P05A 3AJ7A 4XPFH 2BSDA 1QR1B 4L4TD 5EUKB 2F1EA 4L1SA 4XH2A 1U58B 4XMVA 2O30A 4CC0A 4Y5VB 4FG6D 5E6SB 4PGEA 3MI6A 4NJ9L 3OAWA 1MW3A 4MS8C 3TBVB 5CKAA 4R7VA 5EO9A 1D5IH 1U8PA 3CXHJ 4RMTA 3GLEA 3GO1H 5IQ9A 1ZV5A 3CSBA 4FFZH 2NXZB 3S5ZA 5IFAL 3R7RA 3LKQA 4GRLA 1W16A 2AK4D 1CFVL 1H3WM 7FABH 4R7LA 3AT9A 1PKQB 4N8CL 2HN7B 5C3LD 4XNXL 5HHOE 4R7DA 4I2XE 4BEIA 5KG9A 3ZPDA 2BWQA 2F54B 1J1OL 3L5WB 4FLHA 4HKJB 2BNUB 4NC1C 1XGZA 5LG1A 1OGAA 4HJJH 3HEIB 2P4AB 3OMNB 3ZE0E 1HDMB 1OANA 3AG4B 4NKMA 3TJHD 4WFHD 4L05A 5LGKA 3CHRA 3D50A 3OZLA 4S1SL 4Y5YA 2ESVA 3MJ7A 3RHWK 3O6FA 4AYMC 2MQGA 2CALA 1FNLA 3BUYB 2XV6B 4U1IA 4BZ1H 4HQQH 1NCBH 2VR9A 1I8UA 4EN3C 1BXAA 1SM3H 5CCJA 1MW2A 1EFXA 1VGKA 1G9ML 4LCVA 2MTPA 1N6QH 4Y4HD 2EVGA 3MBWA 3GMRB 5E95B 3GUTA 3CDYA 4O9HH 1WYJA 3ARDD 3BD4A 2WB1A 2H26B 4Y2OB 3DTDA 1XCWA 1ZWIA 3NMEA 3WN5B 1NIEA 2WP3O 1ZA3A 3EFDL 6FABH 1JXDA 4NZDA 3OX8B 3K2KA 3L4WA 4OAWB 1TETL 4N6RA 3GSVB 4KVCH 4NQDE 5F7EL 2AEOA 2SODB 1GC1C 1YAIA 1EH9A 2EDRA 2ZCKL 3K4ZA 3QEQB 5C0AA 2VLLB 4BQ8A 1GC1L 5ADOH 4MHHI 5L8JB 3U1SL 3LD8C 4BJLA 1NC2D 1S9WA 3MRQA 1SJHA 3BPOC 3MBEA 4XB3A 1LDSA 5E8NB 1H19A 2YPLA 1YN7B 2WO2B 1MFUA 3O8XC 1JF6A 2X3BA 5CD5C 3VXRE 4E36A 1TEFA 3CSPA 2Q87A 3VXQA 1U93B 5F3BB 5MENA 4WHTA 3BGAA 2KH2B 4G8FB 2RCSH 3ZYZA 1FJ1A 4X99B 1A5FH 3KPRD 1MKFA 2G2RA 3QXUA 3K6SB 4K7PX 1VACB 4P5SA 1IGYA 3IJYB 5GRUH 4WU5A 3RA7L 2YAFA 2YD6A 4X5RA 1XB8A 2OX5B 2N7AA 5ANMA 5JR1H 2R9HC 2ZUXA 1TVHA 1U8HB 2XPYA 3LKNA 1I31A 4MLIA 3QDGD 4WNQB 1BD2D 1AXTH 1S7TA 5SWSB 6CGTA 3HMWL 5L2JA 4HF5L 5LNDA 1IZJA 2DICA 4PRID 5FYKD 2NCMA 4ZPTA 5LBSH 1OB0A 4EKJA 1NGYB 3TURA 4Y19B 5J56B 1BGXH 4YFDB 3N50A 1EWHA 1QLRB 5E99H 3ZTCC 5DVKA 2K4WA 5I74C 2TRYA 4A38A 4D2NA 5DJDA 2FATH 3D85A 3S3SA 1AXSB 2CBMA 4YJZL 1I1AA 1LK3L 3D87B 3MRKA 2IGLA 3TN0B 2IWKA 1F1AA 5JHBA 1P4LA 5C2UB 4AEEA 5TQ2H 3OKKA 4G7SB 1IC4H 2IQAB 4QEGA 1MF2H 1B0RA 3GTVA 3PE9A 3EW3B 3Q5YA 4NZUL 4PJ8B 5DZJA 4D7BA 3KS0H 5IHWA 1G7HA 4IU2A 4CU6A 3ZL4H 2F5AL 2X6UA 3KCPA 4P5TA 1CFTA 4QOKD 2CLZB 3T6QC 3KCWA 1B9ZA 4XNMB 4DHLA 3TZVA 5C7ZA 4AYBA 2HT2D 4TLUA 5ACLA 3K4AA 1TT6A 3QIUD 1PYWA 5CLZA 2AJYL 2FGWH 2JFCA 3RKDC 4GUCA 1BEXA 2MPAH 3OHXB 5AL8A 1IVTA 1BSIA 3ZVVA 1DP0A 1KEML 2Q6WA 5CU5A 2D31B 3U6RA 4XVSL 3FUFA 4X0KB 3M1CA 3H54A 3I75A 1KV7A 1DR9A 1EK3A 3RQ3A 1DEEB 1AKJA 3NCBB 3DJZA 4GKSA 2AGJH 4QHKJ 5ILTL 3UBHA 1M3JA 1TMCB 2GJPA 3IDNB 4LPYA 4HOXA 5HPMA 5I0DA 4ZAKD 1AO7A 2WCGA 3CX5J 3NG5A 4J8QA 1CG9B 4KXAA 4WW1A 1EVUA 3BVNB 5E94B 1I9JL 3RKPA 1P9MA 4HIEA 3ULUL 4MMXC 2IADA 3IDIB 4AM0A 4LIQH 2J88L 3F7QA 3DXAE 1KTBA 4JMNA 1I75A 1DZ0A 3T0XA 1P4BL 4HC1L 3MA7B 1JI1A 2OP4L 3Q2WA 5IQNA 2YXMA 2KZBA 5F3HB 1JGLL 4MA7L 4X5XB 2GC4C 5JIMA 1JZHA 3WFCL 3BDYH 1EQWA 3CFEA 1WBXB 2DQFA 5HYJB 2O4EA 3S3PA 1ZHKA 5TF0A 4A2HA 5AWNH 2BVPA 5DZPA 1YEJL 5FA4B 5DZAA 4GRWB 4UT6H 4U7SA 5I8CA 3DROB 1UWGH 4HXAH 2PCXA 3GSUB 1UM5L 3QZPA 3QG6A 4NQDD 1BMZA 2QSCL 1RZ7H 1N59B 4XCNB 1OCZB 4RZCA 1CO1A 1BYPA 2QZQA 5DJZB 5TDOB 3MNWB 1OAKH 1S7WA 4U0RB 3UXFA 3A6OA 4DZBA 1JL8A 3NIGF 5SWZA 3FONA 2P24B 4CGUB 3RX9A 3IRCA 4UTCA 2IXQB 2MH4A 4LSPL 3REWA 3VXRD 2J56A 2NY0D 1Q8MA 3HRZC 3MFFB 4GRWH 1F2QA 1FNHA 4YHNB 1BQLH 3BDXA 1AAJA 3C09C 1QD0A 5CJ8A 2QVIA 4D94A 5I1KH 1XR9B 4Y2DB 1YMMA 1D2OA 5BQDA 3BEVB 1H8SA 4Y0GA 1VSCA 5E9DA 2X2JA 3GSOB 4O51B 3S36X 3KM2A 3QIWC 4YPJA 4ES9A 1W2KT 1WP6A 1FAKT 1H3XA 1YEGH 3I9PA 1J48A 3NCYP 1ACCA 2RD0A 2VR8A 4XNYH 4OV5B 4IDJL 1WGOA 3L6FA 3GSWB 5IMKB 3BH8B 3DV4B 5BZWA 1Y1UA 3KPOB 1UG9A 2UY7B 3DBXA 3ARZA 3Q5OA 4XOCA 5L2KB 3N6YA 2VDQB 1BBDH 1Z3GH 4M1DH 2DTMH 1K9TA 1FC1A 2DQCH 2PWDA 1WD9A 2WIIB 3LVEA 4FMVA 5EB9A 4F3FB 1L3WA 1SMDA 3B7YA 2CSPA 1VFBB 4J4PA 2R1XA 5A40E 3P4LA 3W0WE 1QBMH 4X7SH 1X9LA 1EZLA 4TVPL 4BWWA 4X7FC 1K5NB 4UQBA 2FH8A 4Q8BA 1FHNA 5I0VA 1LVEA 4X6CA 2K7PA 1T5XA 1EPFA 1MWAB 1BP3B 2WPGA 5E8EB 5IHZA 5CLTA 4CSZA 3QDJB 2XRAH 3UZEC 2CO6B 2APWA 2WXOA 4NZ8A 2NY5L 2BFVL 4PFEA 5MEOB 5G5DB 2H3XC 4QLWA 1C7SA 1FORL 4BXVA 1HZHL 1P5VA 5AB1A 3ZDZB 3OKYA 4K3DL 3G6JE 1FNSH 1UFUA 1RK7A 2AS5M 1D7DA 4N25A 4XWOD 3SPVB 3WL9B 3T3PF 1AD0B 1OD9A 2FJUB 1AXIB 3MYJA 4LZKA 5DC9B 1FN4B 5FM4A 5BS0A 3GI9H 3GKZA 3EGXA 3E2HB 5AVQB 4KKBC 4NO5A 2EAEA 3UIZA 2ILLA 2HFGL 2YA1A 5A3ID 4O2EA 5FGCB 4B96A 5IBLC 1JXKA 1MCJA 1MWAH 3GS7A 4MJ4A 3ZU8A 4AMKH 5CSZA 4HH9A 2X89A 2W60B 3QUYB 2CCVA 2GSIB 1INDH 1TTAA 1N67A 1FE8L 4DUXA 1OL0A 4WV1B 1AC6A 4KGLA 4AZUA 3KLSA 5DD5H 2W07A 2OI9C 4R4FH 4WW2C 4OB5L 1ADWA 2FX8L 5JZ7D 5BVJA 4D0BB 3MOAL 1FBIH 3G5VA 4OJCA 4N0FA 3DXAD 4K7PL 3MBXL 4YE4H 4Z78A 3B6SB 4LLYA 5HXMA 3QSKB 4NKQB 3C60B 3UAFA 3IPFA 4FNRA 5F89B 4F8LA 1BQHG 4KOCA 2V37A 2Y36L 3JTBA 4OCWL 5M94B 3KHOA 3T9WA 5I8OH 3ZTJG 1CGWA 1KTDA 4QF1A 2JV6A 3ARGA 4XMPL 1RXLA 1SMAA 4IGBA 2WVSA 5MEPA 4MQ7A 1WIOA 2XTJE 3I9GL 1JG9A 3UADA 4JDEB 3BGMB 1CZ8L 3P9WB 1KXHA 4QHKI 5CWSA 4L48A 1R24A 1JZ6A 2GK0A 4NQQA 4WCYH 5H35B 2C7UA 2KBGA 4FCHA 1KTCA 3FOLB 3SPJA 1E9QB 3RFZA 1IBBA 2PO6C 1D5ZA 4LLWB 5J6HA 2QQQA 4PGCB 3UTQB 2F7IA 5DEGA 2VDRH 3QZNA 1RPQA 2LGNA 2GFBA 4QXGH 5HDBF 4M61A 3MV8E 5EO0B 4B9FA 5KSAA 2JIXA 2VR4A 3FFCB 1KIUB 5D5MA 1OZUA 1ORSB 3AADB 4WF7A 2VZUA 4JHWH 4NCDA 1RK1A 1BQHB 1FH2A 4XTRD 1U8CA 4MD0A 3GDCA 1YY8B 5DYOB 2V17H 1IM3D 1C1EH 1KLUB 2FYYA 1I1YB 2DWXA 2WYIA 1I8LA 3CVHB 4I1RA 2BOCB 2XETA 2ZYHA 4OLUL 4POZD 4NUJB 4XVTH 1B3JA 3BPNC 5IVXB 1FIGH 4Y1TA 4PJCA 1HU8A 1RUAL 2V3DA 5LDSA 5JIHA 5I82A 3V4UH 1V3LA 4IRSD 3N85H 3V0FA 1RVFL 4D8OA 4HUVB 5TFSH 2VZ1A 2VOTA 3FQTB 4ZZKA 4FHJA 5FCSH 2WBXA 1CE6A 1BZEA 1JPGB 1IILE 1CGSL 2A83B 3GEFA 5KYUA 4EO5A 3HUJA 4ABQA 5EH1A 2K78A 3ZHKA 4R7NA 1IKFH 5DWPA 4G6FB 2I32A 3QGVA 1ORQB 2BP0A 4LO9A 5D1QB 4A7UA 4ZFGH 5HYSA 4CU8A 4OR1A 3X3GL 5I1CL 1T3FB 3L4CA 3VA2C 4CILA 3HI5H 3TVMB 5HSFA 3A6BL 5FO7B 3FQNB 4R9HA 1PD6A 2OYMA 3ZTJH 2ZJSL 5I1JL 3CVHH 2D9CA 4H1LG 4NQED 4Y2NA 3TT3H 4JRXA 4JFZH 1A6VL 3IN0A 1SN2A 3F7KA 3FN9A 1B0GA 2EABA 5B21A 2P80D 1JV5A 2G5RA 1GSMA 1R9FA 3LH2H 1IFGA 2BMKB 3LNGA 3TPUB 1MREH 2VYRE 2X38A 4GXVH 4NLAA 3WEOA 4EOWL 5JQIB 1SY6H 3IGFA 3UPRA 4PB0L 3POHA 3UC2A 3CDGB 3PAYA 3MLRL 3DOIA 4UNUA 3SYQA 2X0UA 3QXAA 3IDXL 5FR3A 1CI3M 5IOKA 4IEFB 4F58H 4NQCE 1JZ8A 1NC4A 1F4WH 5FYJE 4P2RA 1KIRB 2GKIA 2NMSA 4UZUA 2JTDA 4N0UE 2O6CA 3C5ZB 3MGOB 3JV4B 1WD8A 1TU2B 3EYQC 1KELL 4LHUD 3S5LG 3LDBB 4FI7A 5H4ZA 4AVKA 4Y88A 4F20A 1J0YA 1AGCA 1EA9C 1T83A 5ESQA 1C16B 1I7TA 1YECL 3EH4B 5D2LE 3ABZA 4O4YH 4F9LA 4ZW5A 1MCPL 2BP5M 2ZNXA 1FL6A 5L4JA 4DPRA 1L0YA 1XIWD 2MHAB 4OU3A 1JDCA 3KJ6L 1NFIA 3BW9B 4JFOA 4XMZA 3ESMA 4CVXA 1BOGA 1HL4A 2BK8A 4K23H 5DUML 1D9KD 3KYOB 3IETA 2X4RA 4Z7UB 5TE6H 3VRIB 4ERSL 3S36L 2W9EL 5C09E 3I3EA 2EH8L 5ESAB 2Q2EB 4R2GB 4G8AC 3JWOL 1X7QA 2X7LA 5ISZB 1V54B 1NAMB 3HG5A 4ZMNA 3MCLL 3RDTB 4H1LH 1J5DA 4DW2H 3LS5L 1EZVX 4JFTA 3AS1A 2BINA 3OJ2C 4RMQA 4XPHH 4ZMAT 1CXLA 4N8VA 1JFQL 2W65A 4D0CB 2ZCLL 3WDHA 1RKRA 3DTXA 1CCZA 1DL7H 1SBSH 2Z8RA 3H9SB 3NA9H 12E8L 2G0LA 3NH7H 3P69A 5GGSB 3AS2A 3HPJA 5KVFH 5F96L 4MQXC 4ZQTA 4AGMA 4YHML 3PXHA 2VLKE 3QPQD 3W38A 3LMJH 2YPKA 1VDGA 4OZGF 2DQEH 2P5WA 1SJEA 1A6TB 2IGFL 4Y5XB 1EEZB 2UZIL 4ZS7H 1PKOA 3QUZC 4G7VH 1VCBC 4HWBH 8PAZA 3MO1A 4JPKL 5FS5A 3TT1L 4F93B 4GAYA 2N7BA 1QFPA 2CDFB 4ETYA 5HYQA 4I77H 5EOTA 1WFMA 4BDVB 1YJDC 4LEBA 1DVFD 3BSZL 5C70A 1TQSA 4XXDB 5IWLA 2QL1A 3HHMA 3UTSA 4I18B 3P54A 1YJDL 2IWFA 5IVOA 4TNFA 3H9HA 5C07D 1UJ3C 4LCYB 1UKSA 4L4VB 1ZXKA 5F0LB 3EGDB 4X4XB 3K2UL 3BHBA 5DVMA 4W93A 5AW9B 2K6WA 3OLEA 5PAZA 4JKMA 5DZOA 4NNXB 3IJHB 4PJEF 5MP6L 1AI1H 2HLEB 1ND0B 1R1CA 5IK3B 5D7KD 1XSOA 2LAGB 4PP1D 1EAPA 1EAQA 1NGZA 1XF4B 5GS0C 4BQCA 4TSBL 4P9ML 4OJDH 3QYMA 2XYBA 3O6ML 1XX9C 1N4XH 5GS0L 5DFAA 5EZLA 4M7JL 1TZHB 4HOWA 2A6DB 1SRDA 4GRLB 4XNDA 1KGJA 4H0LC 4PGBA 3S8GB 4MB3A 4Y1AE 2Y6SD 1MIEL 1R3KA 2JK5A 3BPLB 3MLWL 4XVUC 4YHPB 5EUOB 5F2FA 1NBVH 4M93B 5T8IA 3VW3L 4A2GA 4YFEA 5DMJB 3N9GL 2YMTA 3GMNA 1ACYL 4P23D 1A25A 3D4CA 1FCGA 5DMGC 1QFWH 4A7TA 4PLNC 3UZQA 4P06A 1E3ZA 1G7IA 3HNVH 3DX9A 3KR3L 2C1PB 1DJSA 1J12A 4BZ1A 3CBRA 3OMZA 2ESVB 3MJ7B 3O6FB 2EYTA 4FKEA 4U1IB 4XAWL 4G1EA 3EBGA 3HS9A 1MQKH 4KXZH 4PJXF 5IROC 3WLWD 4BKLA 4Z7NB 3SDDD 3VFMB 1AGBB 3NVQA 3MLUH 1OF0A 1EFXB 1VGKB 1CE1H 2XQBH 2VN5A 4KROB 4OCYH 2MKLC 1O6TA 1FZOB 3I6LE 3OMIB 2B5IC 4L5FH 4U1NA 4OTXL 4S10A 3FFDA 3A23A 1HWHB 5EOQL 1NEUA 5FKAB 3L9RA 2EXTA 4B41A 4IU3B 3N06B 4NX0A 4MZRA 4C57C 1ZLSL 3VMNA 1KYFA 5IJBC 3WEAA 3O11B 5GRXG 5C3TA 2EILB 3V6OE 2PP7A 4HXBL 1N5YH 3PRZA 3WFBH 4MDJA 1JERA 3L3JA 5C09D 1QPKA 3QWRA 1S9WB 3UROR 3MRQB 1IAOB 1NCUA 4M7KH 2YD3A 2QFRA 2X05A 2MNJB 5DRZB 1LYQA 3QJRB 4R6UA 4P04A 1XBDA 3ET9F 2Y1YA 5FWQA 3O4LA 4RGOL 1JRHH 3LZFH 3VXQB 4X98B 3SE3A 1HILB 4U6XA 3V8CA 5KVDE 1N10A 1BOYA 4PJ9D 2E27L 1B88A 2DMBA 1MG3C 1LO2L 5DDHB 2VZSA 3ZYIA 2G2RB 1INQB 2GTZA 5FWRA 3SGDH 3GSNH 1RSYA 1YSOA 2VLKD 3QFJA 4WU5B 1DUZA 5GGSY 4OM0L 1ZANH 2JCWA 2JB5L 3TV3L 1KZYA 1FV1A 3H55A 1J8RA 1WLHA 2VLJE 2B1AH 4UQDA 4ISVB 2IIJA 4KV5E 1I85C 1PKQE 2OA9A 1M6OA 5C86A 4ZNEA 5L2JB 1SOQA 3WMPA 4IOIB 2J21A 2OS7A 5GHWL 3EHBB 2HX9A 1L3NA 4ZPTB 1Y18A 2PR9A 2F54E 2UX7A 4UTBH 3C5JA 3ZE0F 1HH6B 3H3KA 2YGNA 3DMMA 2ZXDA 4BCXA 2WTRA 2MOVA 3ESVF 5DEZA 3OVUB 3HKZA 4JFYA 4IOFC 3ARQA 4PBWD 5LUMA 4YOKA 2Q3ZA 4JO8A 3GXMA 1HSBB 1QNIA 1TQCC 1TTGA 4PW9A 3TBTA 1PL3A 4PD4K 1M1XA 1T6WA 3ZX1A 3BT0A 3CMOH 1GCFA 3CXDH 3M1OA 4N9GA 4FEMA 5LBVA 4YDVA 1KMGA 3OZKA 1AY1H 3AFLA 4P5TB 5KBNC 2Q86A 3VYNA 2H8PB 1WCQA 1FLRH 2JQAA 2VZVA 3L4ZA 3RGVC 2IOOA 1DBAH 1L4IA 2YA2A 2XWBA 3QJFA 4RAUA 4Y1AD 3U6RB 2GJZA 3GIZL 2I69A 4BA0A 2YGQA 4D7PA 3I75B 2QTVA 4KXCA 5EA0L 4AVHA 3L2LA 4WJG3 4M3HA 3J2PA 4R0LA 3PGDA 5HPMB 3V55A 1GCYA 1LO4L 4OY9A 2Z31A 5EBMB 3TXAA 4WW1B 4AQOA 4HS6B 1IGFH 3BKML 2OQJA 4L37A 4GI8A 5EEUA 1IGCL 4HIEB 4NP4L 5F7MC 4JZNB 2ZXAA 4AM0B 4HYTB 4U2ZA 1XXDC 3B3IA 1DQLL 5HJ3B 1FYTB 5CCHE 3QXDA 3C6LC 4L1HA 2I9TB 3CWGA 4IBZA 4UYPA 1IQWH 5JPNA 3MLXH 4JG0H 5T3ZE 3FRPG 4G9FA 3AREC 4JL2A 3X1FA 5BRZA 5DI8B 3DVFA 1KIQA 2BC4A 4H20H 3C2AL 3ROOA 2Z7YA 3I6LD 2P5PA 5DD6A 5I1EL 4UT6A 5JHDD 2OLDA 2E5EA 1EHAA 1OAQL 3FUNA 2CDGB 1CUOA 5C2BL 2QT6A 1Q90A 2JELL 4Y16C 4MAYD 1XL4A 2ZOOA 5CBEA 5I8CB 3ALWA 2YAOA 3T1FA 4J3OG 3FQWB 1R3IH 4AMWA 3QC6X 4QXTB 3QG6B 5SWSE 3SDXE 1L9NA 3T0ED 4ELMA 1PY0A 3QUMH 3SPGA 4RFEB 5JXAL 3HHRB 1KCRL 1CFSB 1W0VB 5IJCC 1R5IB 4NO0D 3OG4B 5CEXA 5F9DC 4QI3A 4QWWD 4DZBB 1NOLA 3UTTB 1G0DA 1JGUL 4YDIL 5DQDL 5HGGS 2GC7C 5J12C 3D6GA 4PAZA 1D6VL 4GAFB 3DA0A 2WZ5A 5D4JA 1MFBL 3QPXH 2HXAA 4UT7H 4L1TA 1NL0L 4AQEA 1CF8H 2NW3B 4Y7OC 5IR1B 3US1A 1CLCA 2BIHA 2VDPB 1UQSA 1MVYA 4LRNH 2CBOA 5T3XH 5IM7B 1HAWA 1YN6A 1MUJA 3KYAA 4YL4A 1ZMYA 2YUVA 4WW2A 2KLSA 4IJ3B 3VXOB 5E08L 2IQ9H 4AJWA 3L1EA 1OARL 2R59A 1WVZA 4IIQA 3JWDC 2EP6A 2VLJD 3NFPA 3QH3A 3WNLA 5A6MA 3MRBA 2PW2B 3ETBF 2Q7YB 1Q72L 4P57A 1L6XA 3JWDL 1F6AA 4CMMB 2J3SA 3ASOB 2CZNA 3NCWA 4G8IA 1R0AH 2BW4A 4MB4A 2F54D 1K5WA 2VDPH 1EXUA 4RGNB 4OZHB 4M9PA 4OLXH 2IDCA 1BEYH 1RHHA 4YSAA 4J3OH 4N26A 1MJUH 4TNWF 4CW1B 4OZIA 1CICB 1KDJA 4I48B 3B43A 1T5XB 2HJLA 1BG1A 1TZGH 4KKCD 3ZY7A 5IHZB 1E9PA 3U4BL 1PIGA 4OQTL 3ABKB 3U7YH 2MNUA 1GKOA 4P48A 4EDWL 4PW4A 4G71B 4JPWH 5A6LA 3EBHA 5SV4A 5HYJE 1QBAA 5DQ9B 4JPSA 3TIEB 1MJJA 4JW3A 3IXTA 1IEAA 4UV7H 2BO0A 3MYJB 4ALAC 3OF6D 5BS0B 1V7NH 1NGPH 3FO0L 4PSPA 4XNUL 1CWVA 4X8GA 4CSSA 1WCBB 1TQBB 3Q44A 4ALAL 3IPBA 2HLFD 2IDSA 3FO1B 4DP9X 2YSTA 5MHSD 4Q74A 1A7NH 4YMPA 4GW5A 5HY9A 1MH5A 1FNFA 3OPZH 4AJ0A 2AEPH 2WLLB 1HKFA 4HFWA 1KC5L 1WEJH 2WJ7A 3FB6A 1LNUB 1URIA 3M1BA 2PTUA 4N0FB 5LXGL 4HDIA 3MRNA 1LEGA 4JQIH 1F4YL 2KZWA 5DXWA 1JZ2A 1CXIA 4XRCB 4LLQA 1GZHC 5AD0B 2CKNA 4K71B 4W9HC 2VQ1A 1SXZA 3P3YA 4LCUA 4XC1H 3S35L 5ICZB 3STZB 1G7MA 1Y6NR 4IGBB 1YNKH 4TOYH 4MQ7B 3ZL1A 3ZKMD 2VQTA 4ODUA 4E9RA 2QLYA 3B56A 1KB5L 1JV2B 4LOEA 1I9RL 5FEBA 2X41A 4KK6D 3S0PA 4ESKA 2ADGB 5L2KE 2MCG1 2C7UB 1I4FA 4G7QB 3M46A 5LCVH 3RFZB 4JK0D 4P46C 2Y7OA 5J6HB 5MI0C 1WWAX 4NCC1 4JY4A 5KSAB 2ALWA 3F7VB 1EJ8A 1R46A 2DD8L 1RK0B 1JNHA 5IHBA 1LDPL 3JWNE 5TDNA 3WSQH 5JTWA 3LXUX 4Z7OB 1L9PA 1RK1B 2VMEA 1TUPA 1U8CB 2DYSB 4HS8L 4MD0B 1GYAA 1KJ2A 1SYSB 5DFVD 1F90L 4AUYA 1XB6A 4NYLA 1WZ1H 5F6IB 1ZPUA 1L9MA 5FYLE 3RIAF 3QDJE 1IMHC 2EADA 3MHZA 1KCWA 1N3NA 1E0OB 2FQEA 5EZPA 4EIBA 1URLA 2IDTA 3V4VH 2EXYC 2QV4A 3ZDZE 1RJLA 4DQOL 4DIXA 5J11B 3BYYA 1MLBA 4I4WB 1JD7A 2PR4H 3ULVC 1FGNH 3V5KA 3VQLA 1T7ZA 1G0XA 3HUJB 3TIDA 4G6AC 3UJIH 3FU9A 3GK8H 2DI7A 5IP4A 4UQ2B 5C0NC 1XD0A 4JFXB 5GRYA 5HYSB 4KOBA 3ULVL 4HG4J 1YEEH 2Y07H 3VFGH 1LE5A 4GY4A 4GRMA 4K4KA 1S7XA 4JE4B 3VM5A 1IGMH 3BUDA 5ALCL 5FGCE 1XL6A 1NBCA 4KTDL 5EZOL 4AEFA 1B0GB 1I1FA 3LAFA 3QCUH 4UDUB 5IMOA 1P2CA 4ZFOB 3X14A 3M17A 1DLHA 3CDCA 3H0TA 3MA9L 3I02A 4LGPB 1NUGA 1MFAH 1RULH 1WBZB 1NIDA 2YC1A 4FL4C 2QQNL 4NQVA 5E7FA 2GITA 5A1AA 35C8L 2H9GA 3CLEH 4MVBC 4TKWA 3PJSB 2GBUA 3ZTNL 1DDTA 1N8ZA 5E6IC 3ARWA 3FW6A 4L3CA 1CVRA 5F7NC 4X6DE 1JNNH 2Q10A 5KBDA 2MKWA 3N43F 4KDTA 3UG4A 2VXVH 3ARFB 4KAQH 2VXTH 5JORB 2O1AA 2OL3H 3DVNA 4B3EA 1NC4B 2V6HA 1N64L 5HYJD 4FQJH 3IVKA 1MDAA 1XGQA 2VE6B 1OTSC 2GI0A 3BZ4B 5CXPA 1YEKH 1D7CA 2O93L 3ETBJ 4LMQI 5GRWA 4OD3L 2QR0A 4IRZL 2HTKD 4QTHB 1MFEL 1NDGA 1ZPLA 4Z7VA 4OQ1A 4NI3A 2I07B 1FL6B 2IMNA 5CEYB 2IDUA 1NFIB 2CLRA 1JGIA 2TRHA 4OFYA 1OCWH 3QULB 1BOGB 1CL7I 3FFCE 2DL2A 5EMYA 1N19A 3U2IA 4IHBA 3IETB 1THCA 2BVTA 4L1BA 5EU6A 2CBTA 5LN4A 2ZXBA 4B6ZA 1AZVA 3QUXA 1X7QB 1TXKA 4FG6C 1SXCA 1E2VA 4LRIC 1OPGH 2BSTB 1TTUA 3MJ9L 5GS2D 1YC7A 3GSRA 3NIFB 4QIRA 4Y2DD 4YWGL 1GJUA 2EVFA 4NOFA 3WTXA 1JSYA 4PJ5B 2R2BA 4U1HA 4N8VB 4XXWC 4AIEA 2W65B 4LARH 4W4OA 5DR5L 1Z2KA 2L04A 4IYKA 4MJ5B 5C92A 2W9DH 4Y7MA 2B2XL 5KVGL 5AVRB 1MLCB 2H0FA 5DGRA 1KGWA 2GJ6E 1SZNA 3S3JA 5JXEA 4OH2A 5D1QE 4AT6A 3NSYA 1P84J 1MFDL 1SJEB 4FNUA 3WLBB 1JYNA 2IJ0C 3LH8A 3TJHC 1MZZA 3MRFB 4JANA 3U9PH 5KJ7E 3ESOA 3MLPA 1PX3A 2WWNA 4EN3B 1U2HA 1MNNA 5F1KC 32C2A 4TN9A 3RWHB 4GAYB 1EDQA 3KW7A 4MAZA 1VADA 3IJSA 2FLMA 2J71A 1EANA 1DVZA 4J39A 2PN5A 3UTSB 2BVYA 3B2VH 3BZDA 4JB9L 4Y4HC 4AC4A 4BZ2L 2ZUSA 1CQKA 2CHWA 1UOWA 2F5BH 2DQHL 1AJ7H 3ARDC 5FYLD 2OTPA 2R23B 3QDJD 4GSUA 4F33A 2GBTA 3BHBB 4MXVE 3ROLA 1MEXH 1XGYL 3BI9X 1G0YR 5GGTL 1JGEA 4Q58C 3QG7H 2OBGA 3NZ8B 5AAPA 1IC7L 3KDMA 4FX5A 3IGKA 1ILUA 1UWFA 2P28B 3LD8B 3RBSA 3WKQA 4M5YH 2EVIA 2F1AA 2E9IA 3BPOB 3MV9E 1E65A 5DRWB 1GZQA 5EDXA 3O8XB 4ZUSA 2C3VA 2B15A 4JFEB 5D2LF 1B4TA 4HK3J 1G9NC 3N1PC 2APVA 3TO4C 2P8MB 4TS6A 4WI3A 5DHXB 5AW3B 8CGTA 2GJRA 5EU3B 1LO3H 2VABA 3L9BA 3S34L 2R51A 2WZPA 4DVRH 3DWTA 2VM4A 4Z7UE 3HPLA 1WH0A 4L8SA 3RWDB 3KLHD 2XV3A 2VNCA 5IBUG 1HHIA 3BH9A 4IK6A 4NKDA 4N6QA 4NXSA 5M95B 2R29H 1LK2A 3C60D 3CN0A 5FW7A 4XMLH 4BFNA 4IBLT 4N2GA 3BXNA 2EYTB 2HT3D 3DX6B 4DH2A 4PJ7E 3ZJAA 3JTTA 4NDMA 3L4YA 3EDJA 4K5OA 5JW5A 3V0GA 3MODL 4Z9KB 4TUOA 1GPOL 2ZUUA 1ZT1A 1AQKL 1ZHNA 4WVRA 3DK0A 2WQRA 1S5IH 4G6KL 4RMRA 5I74B 4TQHA 1T21A 2YEZB 3LKRA 3QNZA 5IB4A 4ZO6A 4U1NB 4YHZH 4UOZA 4PJGA 2H1PH 2NZIA 4B0MM 3K8KA 2AV1A 4PRDA 2F61A 4OJEH 2V7HA 2BSEA 2FIKA 3BVUA 1G7QA 2CBPA 5DQJB 1VHPA 3GIVA 4XB8A 1I8IA 2JSFA 3ZT5A 3FFCD 2CIKA 2HVKA 2VO5A 5A2JH 4TSAL 3HC3H 3M8OL 4UIMB 3WHXA 4MDJB 3MR9A 4GG8A 1T0PB 3RPIB 3L3JB 4EZMA 1JZDC 1CL7L 4JAMB 5ENWB 3WHE1 2JJTC 2AP2A 4M6MH 5IIEA 2E9JA 4XCCH 1YUHA 3CGTA 3A67H 2HT2C 4L4VE 1KEGL 1F97A 1KJ3H 5C71A 5I5JA 5AKSA 2Q5BA 4OF0A 3OKNA 3QJXA 3S37X 5DFWH 4MCNA 1TCRB 1I3UA 2YAQA 4N1HB 1J0KA 1X44A 5BW7A 1FH5L 5IF0B 4YUEH 5GGVL 3VX0A 1I9IL 2GTZB 5KAQG 4AGLA 2GJ6D 4L8BB 3QFJB 4JHBA 3R8BB 2EH7L 1DUZB 1P7QB 3P11L 4PRPA 4ZAKC 5DMKB 1BXUA 4LK4A 2ZUVA 3C6LA 3FO2A 1MCQA 1FV1B 3SO3C 1FVCA 1M2OA 3BQVA 3BQUD 2VN4A 4KDVA 3EOBB 2EKJA 1TJIH 3PWLA 5EUOE 2FHBA 3AREA 5F0JB 1AD9B 4UTBA 3WAJA 3TFBA 5BUGA 1UXSB 1TTCA 1X5MA 4FTVB 5F71A 5SWQA 4HEME 3HN8A 4CMHC 4D9QD 3LEYL 4PB9L 1GS8A 1OGAE 3QIBD 3KPNB 5H2BB 1ED3B 2YWYA 2J73A 2KI6A 1T22A 1HINL 4HC1H 5DHDA 5CEZH 2ZXEB 1K85A 2ESVE 1HCYA 3U1QA 1M1XB 2L8AA 1DVSA 4BK8A 2Z34A 3RWCA 4Z7NE 4KO7A 1ZTMA 2QPDB 4N9GB 4RCAA 1HVXA 3C5ZD 5IB3B 4FQQB 3O81A 3MV9D 1YEJH 4X50A 1AG6A 1KBPA 1ZLDA 4YGVA 3IU4L 1II4E 3HRZB 1GGCH 3C09B 4OCNC 2Q3AA 3GM0A 5B22A 3GMPB 2EDKA 5IBTL 1JWSA 5FDWB 4M5ZH 1ZHLA 2EZ0D 5I73C 2HT4D 1H6UA 1TZOA 2GI7A 3OWRA 1NWOA 4HETA 5DC4B 4JEGB 2ADFL 1IBDA 2NY0C 3CX5K 3QIWB 2DDQH 3VD4A 4AC2A 2VL5B 5C0AE 1WO2A 5L4IA 2P8LA 5TPWL 4R0LB 1J0HA 5D71L 3WIHH 1ES0A 3MJ6A 4BUQA 1ONQB 4S1DC 4QXWA 3KLAB 4CADB 4BIKA 4J8RB 4F7CA 2JVUA 4JR9L 4NFCA 2YPLE 1OF2A 3RIKA 2HB0A 2H5UA 1OSZA 3WGUB 3FAXA 2IALA 1JN6A 5MENE 2NY4D 2GEEA 2JLLA 4TLSA 3KPPB 4KGJA 1J87A 4C4BA 3CNKA 2ZQKA 1M9WA 3ML8A 5BRZB 4R90H 4Y8DC 1NMBH 3ROOB 4GQPH 5I15H 2Y1VA 4F27A 4JFWA 4LSQL 1HHJA 4PMEA 1I53A 1QSZA 3ELQA 4ZX5A 1BVLA 2XFXA 4G42B 5C0CB 3WN6A 1W6WA 4KV5F 5ANME 1GRWA 2XQYK 4HPYH 5TH2B 1EXGA 4WO4A 1UXLA 3MREB 4AENB 4BFKA 5L7XL 4M29A 3AM8C 3NJMA 5D96C 4LCCC 5EEWA 1PNDA 2UV3A 4ELMB 1TQTA 5IQOA 3NA4A 3T09A 1QW8A 2JKLA 2NCEA 3V0WH 4GAJH 1K8IB 5AZEH 2AJ3A 3IGLA 2ZF9A 4DUVA 3DGGA 5ETUB 43CAB 1B4RA 4ZMYA 2X40A 4QHUB 4E41D 4RQQB 2NYYD 4RVBA 4L4VD 2BHYA 4XGZB 4X6EB 5I76B 1MQ8A 3HAEG 4XWOC 3U0TA 1P4IH 1S9VB 1T5WA 2AV7B 1TOXA 3FB8A 3NZUA 1CBJA 4JZOB 1X5AA 1UQSB 3L3HA 4K3DH 1NFDA 5A3IC 1YN6B 2EC9T 3QS2A 4FOMA 2HMID 2OI9B 2X5PA 3LB6D 2SEBA 4NZJA 2JKSA 2R1YB 4WW2B 1UACH 2XYCA 3NFNA 5DJ6B 3QAQA 3CZUB 4Q52A 4FCAA 5EIIA 1FZKB 3HHSA 3FRPA 3BD3A 4LOFA 5AW1B 4ELKA 3LZPA 4K3HA 4C55A 2ZKMX 4JM4L 4FABH 4IIQB 3NFPB 2J5WA 1S8DB 5JZ7C 1Z5YD 1GGIL 1GZHA 5K1NA 2VDML 2ZP8A 3AU1B 4UM9A 2WWKT 4G8IB 3SOBL 2WK2A 4R4BB 1C5DA 1PG7W 1NMCC 2AJZB 1CXEA 2FBJH 2Y0SA 5KYYA 4PRAA 1NCGA 1OGAD 5CJOL 1F18A 3HC4L 1EXUB 5C0BA 4G1MA 1AO7E 3HCVB 1NANH 2K6YA 2D03L 3HAEB 3MNZB 5IY5B 2ZUQC 4EBQH 3AXLA 3KGSA 1RHHB 4QHLA 5KS9A 2ESVD 3QJOA 3JBG7 3O6FD 1O6VA 4X83A 1HJCA 4OZIB 3NJKA 4OCWH 5DJ0B 2DQDL 2PO6B 4P46A 2HJLB 2EDNA 2BVOA 5FLVA 4MDIA 5LAXB 1E4WL 4A63A 4N2AA 1T2JA 3C08H 4UB0L 3FH8A 4YXKL 1EFXD 2YXVA 3DO7B 2CIIA 3FUEA 2VN7A 2FB4L 1EHLH 1OIOA 1I8KA 4DTGL 4AYFA 3ZW3A 1CZ8H 4NNYB 3LXBA 3PIQB 1IEAB 1NM4A 3FU7B 3HAEH 4NBXB 2D0FA 4I7ZC 4NRYA 4CJ0A 4DESA 4NC0B 5C7XL 3AWEA 3BPNB 3SDXF 2WZ6A 3VI3A 3GC3A 4XTRC 4I8DA 5E9AA 4S1RL 3ASWA 4FQLL 4KX7A 4NHUB 4ZYKA 1MPAH 4UIKH 2RFXA 4OIIH 5C0AD 2ZG3A 4JPVH 3FL7A 3VSQA 4GW5B 1FZJB 1UCTA 1FSKC 4WFGE 5SWZE 3S37L 3UTTE 4WDIA 5KZCD 2FK9A 4IRSC 4PJBA 5C97A 4G5ZL 3MBED 4JCWA 5F7BA 4I3SL 5KSVA 4WEBL 2YPLD 5F0PB 1DQVA 2CWRA 1HHKA 2OJEA 2ZG1A 3M1BB 4P5KA 1T2QL 1KCSL 1W15A 2PUQT 4R8WL 4JQXA 4HDIB 5FHAL 5EBLB 5MEND 4OGYH 4G43A 3A4DA 1YMME 4HK0B 3GLZA 4PG9B 3ZTEA 3TESA 5INCA 5E9DE 4QRUA 1AZNA 4HWEL 3VO0A 1KGXA 2VQ1B 4LCUB 1WC7B 2IFFH 3A22A 2M1KA 4UQ3A 5CIPB 3W37A 4LP5A 1OGTB 2VCOA 3OKLA 4F9PC 3TC9A 2QGBA 1QSFA 3QFDB 4MJ2A 4BGLA 1WZMA 1UWXK 4HUUB 5DJCB 5E6IA 2F74B 3ORJA 4WHCA 2R0WL 4ZO9A 4I1NB 4FYQA 3U2SB 3NSJA 5IW1A 4HP5A 1I4FB 3FYIB 2V33A 1R34A 2HH0L 3EHBD 3H6AA 5C0DA 5I24A 4XPGL 3QDAA 3L7FA 4WK4B 3VGGA 3ZRCC 2WXGA 4S0TD 2XN9B 4IRZA 2IO5A 4RGNE 5CR1A 1MHPL 1NIBA 1JNHB 1G94A 1HC1A 1F56A 1UYWL 3QHZH 2LAAA 2X4TA 4H25A 5LHDA 3D85D 3Q1SH 2F19L 5C0IA 1PDKB 2OTWA 5TDNB 3D25A 1ICTA 3JUYA 1I1AD 4HIHA 4PJHA 4UINH 1C5CH 2GTWB 3WE1A 4X6CE 3DVGA 4YDMA 2DQJH 3JV5A 2ZICA 3VD0A 5IFJA 3K6IA 4OCRL 2GYSA 3PGFH 1N3NB 4P5TD 2NSMA 4OBRA 4NZRH 3ZXAC 1JP5A 3TZVD 1XIWC 1RJLB 2B4CH 3MJ9A 4K7PY 1PX8A 2B16A 3NT0A 3TIDB 1D9KC 3V7AG 2ZXQA 1SFHA 2BIIA 5BS0E 2E75C 1DBML 1RUPH 2IWEA 1LE5B 4DF9A 3IS1X 3KJ6H 2WZAA 3V5DA 1S7XB 4GNKB 3CN2A 2B3IA 2EIZA 3JT0A 5ERWA 4IHOB 1AKJD 4WUKL 2VL4A 3OKDA 2ZYIA 3A3YB 3KVQA 1JTOA 4IK7A 4LKXB 1OM3H 2KMWA 5IMOB 5KW9H 1K4CB 3M17B 1DLHB 2BRQA 2DWTA 1AO7D 1CDYA 5J9PA 2DLIA 1MFCH 5ADPL 3LKOA 3W5MA 1E8WA 1Z9SB 2KUTA 2VB5A 3TS8A 1B6DA 5DJXA 3NEOA 1M6UA 1FCCA 1U8OA 2KPWA 4HISA 5TE7L 5AENA 4ZUTB 3HS0C 3U9UB 1N8ZB 1JFQH 2OL3A 2VAJA 3QUZB 4JKPH 4POUB 1Q9WB 1EEQA 4MJ6B 4PV9A 4UM8A 4MNGB 2F58L 1JVOA 1I7UA 3G08A 2HRGA 4BZ2A 2OCFD 2OYPA 3T65A 3HB3B 3QWOA 3II3A 5CMAA 3TCLA 5B8CA 4KI1A 5CCKL 3VSVA 3MXVL 3U7WL 1F4XH 2NQDA 1ZRUA 4OCSH 5GGTA 4PS4H 2YMOA 5CHNA 4YSRA 5JW4R 4E2OA 1T6VN 2R4SH 3E6FB 3MNMA 1A0QL 2CNYA 3T8MA 4QKXB 4HHWA 1UM6H 1NDGB 1XH0A 4OT1L 5GJSL 1JYWA 4JY5L 4PWIA 1MY5A 4MAUH 4YO0B 3UYPB 3WFDL 4FEIA 1JVKA 2CLRB 1UD8A 1CDGA 4XPAH 4Q2ZA 1D5MA 3J07A 4WFGD 5SWZD 1SDDA 4MTMA 5HHMB 4MNQA 4LDOB 5E24E 3WY3A 4AE1A 5IB2A 4OM1H 3G6DL 4Z7OE 1RI8A 4HCFA 4K15A 2VDOH 4PP1C 1NC2A 4UANA 1ASPA 2YD8A 3NK3A 5HDRA 4C58B 5AAWA 4U6VH 1HE8A 3TO4A 5HYEA 2PWGA 1XH1A 1DUYB 1YMMD 1IFHH 4GBXA 2PYFB 1FGVH 2O6EA 5BZZA 5E9DD 4PJCE 1BF5A 3EOTL 4H2AA 3APDA 2R2BB 3ZDZF 1ZLEA 4XNQB 4CDHA 5DJAA 2Y6SC 3MLZL 1VEPA 2JKRM 2QPUA 2H32B 4GSQA 5DK0B 2FIRT 4DAGH 4JE0A 5JYMA 3O6MH 3M7OA 4W9GC 3UBXG 5JOEA 1RU9H 3GQFA 2YRPA 1A21A 1L9RA 4P23C 3DETD 3HUJE 5ABZA 3CPLA 3QHFL 2P43B 3CBJB 1BVKA 3QQDA 4A6YL 4H40A 4APXA 3MLWH 3OL2A 3ES6B 4O2CA 1H3UA 5CP7B 3MSPA 3QORA 4KY1L 3WS6A 4B9YA 4PTTA 1WFNA 5CN1A 5JO5A 3BZEB 4JANB 1QUPA 4JRXE 3VTMA 3EH1A 4NRZB 4PYHA 1UZ8A 4K9EL 2WQVA 3MACH 4F15C 2EEXA 3UO1H 1EEUA 1HNGA 4RGND 5AZUA 4J4PD 1SJVA 3WLWC 1J0IA 1HCVA 2B5IB 3SDDC 2PTVA 3E6HB 3OJDB 3QQXA 1E28A 3LVTA 4MASA 1FG2B 1KYDA 1QZ1A 3TYGL 4JRYA 4MZIA 5GRVL 5IGXL 3RVUD 3D7PA 4X6DF 2X10A 4Q97A 2EDXA 4QMEA 5DC0A 4X4KA 1QRKA 3BWZA 3KXFA 4ZXBA 1QLFA 3DSNA 4HD5A 4F37K 1KB9J 3CHOA 4AV4A 1BM3L 1QBLH 1XDTT 3F6IA 4E9WA 4LU5L 1F86A 2DW5A 3BVDB 4P2RE 3EO9H 4UV4L 3T6ZA 5MEQB 1O7DE 4F91B 2OR9H 4NWTH 4B9GA 3MMEA 4DKTA 2DEYX 3ZO9A 1KN2L 2PCFA 3VX1A 1A14L 5I1HH 1CXFA 1IM9B 1KPRA 5A2FA 5BS0D 1R3LB 4OVUA 2VKWA 1S5HB 3PUUA 5GS3A 1R3JB 2FJSA 3DYOA 4DZ8B 1JK9B 3US0A 1CT8A 1I7RB 3HZMB 3PWUA 3DX1A 2QSTA 1RJZB 5C6TH 5BMFL 2X89D 5HDQL 3NJLA 1S3KH 4K5NA 2ADJB 2X4OA 4WGWB 3JV0A 3FUMA 3ABLB 2KKQA 3FTWA 4NENA 4PJ9C 3HPLB 4P0DA 2XZCL 5EBWA 3FSOA 3GNML 3CLWA 3KWUA 2KQNA 3P1VA 1HHIB 5IQ7L 1NFKA 3BRDA 1I82A 3IFLL 5DEJA 2MFNA 3NIFE 1JGVH 2E27H 1SXSA 2AW2A 3JTTB 1PG7H 2VSCA 3AU0A 3QE5A 2QEJA 1A4CA 4KJWC 3FN0H 1UENA 1ETZA 5E1AA 4NC1E 1ZT1B 3ARGD 1CTNA 1IIKA 1ZHNB 1ZTXL 3HC0B 3IEAA 3WIFA 4QRRA 3EXLA 4RMVA 3RY6A 1V7MH 3DHUA 1RLWA 3UFIA 4U1SA 1H6FA 1E3XA 1BJMA 1QA9A 4UT9H 3GMMA 4IBUA 5E1QA 5IB4B 5K9KB 4MGXA 1N6UA 4K2UL 4PJIB 4JJOA 4K8RD 1W0WA 4PJGB 5CJXC 2VTFA 2XBDA 3SJVA 1XTMA 3KPQA 3GXPA 3AG3B 1NEZA 5DTFA 2VDNL 1JZGA 2ZF8A 3KGRA 1D5BB 2K8MA 2IG2L 2V7HB 3PV6B 2FIKB 2HVBA 2WZ0A 3L5JA 1G7QB 3VM7A 4CN4A 4PMFA 5KSAD 3GIVB 5AZ2L 1I8IB 2JIXD 4YXHL 2CIKB 2HVKB 3NFSL 4ODVH 4QHNA 3ZUCA 3BKYL 2WJ5A 4M1CD 2QHLA 3P0YL 3RGVB 4RX4A 1DTUA 1DHKA 1F58L 1E7VA 4G83A 4FE9A 3UTSE 5LG6A 3DHMA 4MXVF 4JN2B 1W8OA 4FG0A 1NQBA 2YGOA 4LOUD 2G3NA 1VEOA 1R19A 2V5YA 2Z93A 3OKNB 4J28A 4OBSA 2G9HA 4I9WE 2XTLA 1KG0A 2PTTB 2DKSA 4QHPA 2A73B 1X9RA 1G4MA 4IBSA 4KVNH 2BJML 2R0KH 5J4MA 2J43A 1DJIA 2CK0L 4GFXA 5CP3H 5AAMC 3OR7A 4OFIA 1UWXH 3SQBB 4TVUA 3PHSA 1CDCA 5CZVH 1OT2A 2MJWA 3C6LB 1L7TH 3QT2A 1HJBC 2ZX7A 2D4DA 3FUDA 3CQFA 3AREB 4JRXD 3W82A 5JNYB 3S97C 4Z7UF 4B60A 5E8OA 1CC3A 3OHMB 1MRDL 1PJ9A 4LE8A 2DZEA 4FQCL 1V3JA 1JXFA 1A1MA 4DKFL 1IC5H 3J7HA 3N1QC 5GJTL 3QPKA 4Y16B 5EFIB 2YS4A 5EORL 4BFBD 3CSTA 1Z3RA 5ALBL 1RZIA 4PJ7F 4JGMA 2ZOKA 4ZW8A 3ZE1E 3ETTA 4H0IA 1YYLL 2XIBA 4AXWB 2F53A 1UADC 4UQ9A 4MAYC 5AUMB 5JOPE 1MHCB 1MWOA 3TL5A 1USQA 1NC4D 3OSKA 4GI9A 4P2RD 3V5HA 5HD8D 3C8KB 3QZOA 5E8DH 5JMOC 1E5BA 3T0EC 4XVJL 2VXQH 3KM1A 4J6RL 4PIBA 2FJGA 5ITFA 5J12B 2YKLL 3RZCA 3V6OC 1OK0A 1E8ZA 2WUBL 3WD5L 4QWWC 3GI8H 5DWUL 5KBKA 2RACA 5ECJE 5KOMC 5C8JA 1JHLL 1WRFA 2YBRB 3J8F7 2J8OA 1MI5A 3MRLB 2OSXA 1CURA 3GXIA 4NM4H 5AOLA 5LVEA 2E74C 3NRQA 4U0QB 3MU3A 2OCCB 2AAVA 3MRJA 4AH2A 1OB1B 4P2YA 1CDJA 3JV6A 2NQCA 5D1XC 1OP3K 3HG1A 4WUUB 5HHVL 3OJVC 2CJSA 5GGRA 4AK2A 5LBGA 2GPZA 2BVUA 2DMGA 4Y5VC 1AVAA 1GJIA 2ALAA 4H8WH 4MD5B 4X6BA 3VG9C 2AVGA 4S0HA 1JZ4A 2NY7L 2VDKH 3F8UB 4UDTA 2NQ3A 1NBYA 5C6WH 1OSZB 4NJAL 2AXGA 3EUDA 4HIXL 3U7AA 4AG4H 3MC0A 3LN5B 4JJ5A 4UQEA 3ERXA 4G8GA 1WAEA 2BSSA 3L16A 1A47A 1QAWA 3U4AA 2R2HA 3ULUE 1XBRA 4XPTL 3VDCA 4RFNC 5CSGA 4L0PB 4K7FA 5FIEA 2E7MA 2GUYA 2I60H 5C3IA 1OARH 2DWDA 3D08A 3LS4L 3P77B 4QRPA 4Y4KA 5CU9A 2Q8AL 3RYMA 4Z6AT 2XV0A 3OC5A 1BVLB 3QFJE 4M6OH 4OZFG 3I85A 1Z32X 3NACH 4NC2B 3VXNA 5IV2A 2P5WD 2VLRA 4KY2A 1U8QB 5EUOF 2IC2A 1Z9PA 1FFNA 4Y2LA 4ZUUA 4FYRA 3T3PB 2GK2A 2X4NA 4L9DA 4IBTA 3R1GH 3FZUD 4ZNEE 2EVJA 2O5NA 5AOJA 1BQRA 1EHKB 2ZSVA 1OAYL 4NSKB 4FTVE 1E4XH 1U8LB 1R47A 1XGPB 1FNGB 4KKCC 1SOSA 2VRAA 5IB1A 1YEIH 2NT1A 1CGXA 4EI5A 2V2TA 5C0GB 3GWJA 3ILQD 4NPJA 3S98A 3UTSD 1EZUA 1H5BA 4L9LC 2EDTA 4MBOA 1AQMA 3RB5A 3H3BC 2A77H 3LEXB 4WWOA 3B7RL 3LH9A 3PL6A 4Z7NF 5CN3A 3VFNA 3HMXH 4LLDB 3FQ1A 3U0TB 1CD1A 3BO8A 3OGOE 2CGYA 3WEXB 3WN5C 1G4RA 5EG6