3H4HA

Met94thr/phe312cys variant of nitrite reductase from alcaligenes faecalis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
334
Chain Sequence
b'TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLTHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Directed evolution of copper nitrite reductase to a chromogenic reductant.
pubmed doi rcsb
total genus 92
structure length 334
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4hA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4hA02
4YSEA 1L9OA 3EF4A 2UXGA 4G7RB 4UF7C 1ADWA 3S3DB 2FQEA 4G71B 4FA7B 4E9TA 2XV3A 1ASOA 1AZBA 2W8CA 1RZPA 1DZ0A 4BWTA 1SHWA 1FFTB 3L45A 2BP0A 3OMNB 1CC3A 5EHFA 3PXLA 4YSPA 5I5JA 1JERA 1AS6A 4BXVA 2ZWNA 4DP7X 4HALA 4P5RA 1ASPA 1OOWA 1KCBA 3KW8A 3H4FA 1EZLA 3PAZA 3S3BB 4E9SA 3BVDB 5B1JC 3GXUB 5B3SB 1IC0A 1ET5A 4PAZA 1PMYA 2OCCB 3MBWB 2BHFA 5PAZA 4TXVB 1ET8A 4HHWA 3OM3B 5B1JA 5AFAA 2BW4A 4G7QB 1W8EA 1MG3C 1JZJA 1B3IA 2BO0A 3X1FA 1ZV2A 4AZUA 4BDVA 4G70B 4QLWA 3AY2A 3CDZA 1QLEB 2QPDB 3SBRA 4DP6X 1NIBA 2AANA 1J9SA 1JXGA 3T71A 1A3ZA 2XXFA 3FQ1A 2IDUA 4YSRA 3ZBMA 1UATA 3BQVA 3X1NA 5B7FA 2IH9A 1AS8A 2HRHA 4GP4B 2YAEA 1OCRB 4E9VA 1E67A 2N0MA 4AKOA 1CYXA 1JVLA 1PNCA 4HCGA 2XV0A 3V9EA 1IBZA 1BXVA 2PPDA 5FC9A 2PPEA 2VSMB 3GDCA 4AI7A 2XX0A 3QJRB 4ENZA 2XYBA 1ILUA 1V55B 4KOCA 2PPCA 3X1BA 5LDUA 1MG2C 4M4RB 1XB3A 3DTUB 3GYRA 5D4JA 1EHKB 3ABMB 1WA2X 1E5YA 4RH4A 4GP5B 4A2EA 3TASA 1ETJA 1URIA 4KO7A 4KNSA 5B7EA 1BYOA 2AFNA 3NP4A 1NPJA 2CAKA 4E9RA 2UXVA 2VM3A 5AKRA 2FT6A 3OMIB 3EH4B 1ZDSA 3DKHA 3AG3B 4HZ1A 4BK5C 4Q8BA 2X87A 3NJMA 1CUOA 4GP8B 4YSTA 2DWTA 1A4AA 2TSAA 5B1AB 3UAEA 1FA4A 5PCYA 1YLBB 1BAWA 2VM4A 2TSBA 3CVCA 1AS7A 4DP0X 2HZHA 2YXVA 3WI9A 4HIPA 3AG2B 2W88A 1PCSA 1KCWA 3NJJA 3FQ2A 1NWPA 3ERXA 3NP3A 1RZQA 4YL4A 1A65A 1NDTA 1AANA 1RCYA 4E9QA 4F2FA 6PCYA 1PZBA 1KBWA 3RYMA 4PCYA 4N8UA 3MX0B 8PAZA 2YAMA 2R7EA 1V54B 1HAUA 4L0PB 2PP7A 3NJFA 4NB7A 1JVOA 2BW5A 4KOBA 4X4KA 3QJQB 5A7EA 2FWLB 1KV7A 4KO9A 2CALA 3NSFA 3ZIYA 2X88A 1NICA 2VN3A 1PZCA 1AZRA 2BWDA 5D4IA 2FNWA 1OCCB 4A2FA 3IEAA 1TKWA 2HRGA 4DP8X 4UAHA 1PAZA 1SF3A 2EIJB 4GYBA 3TBCA 2PPAA 1GS6X 1PF3A 1MDAA 1X9RA 4DP1X 3UACA 1AR1B 1SFDA 2GC7C 1WS8A 2XUWA 2E86A 1PZAA 2B08A 4A2DA 1L9SA 2XXGA 1W6WA 3UAAA 2EILB 2FT8A 1T5KA 2Y1AA 3ZX1A 3FSWA 2NRDA 2DWSA 4G72B 5D4HA 4YSAA 2QDVA 3FSVA 5B1BB 1QNIA 3PPSA 3ABGA 1GS8A 1JOIA 1PLAA 4KO6A 3FU7A 2YAPA 3OD3A 3S3CB 1NINA 2BP8B 1J9QA 2GC4C 1JZGA 1L9PA 3NJHA 4DPBX 5TK4A 4E9XA 2YAHA 3T6VA 3H56A 3NSDA 2AZAA 3ASOB 1GS7A 3KW7A 4UANA 1OE1A 3IE9A 4F7KA 1BQRA 1OF0A 4W9ZA 4E9YA 5I6OA 3S8GB 1AZNA 2A3TA 2DYRB 4A66A 1WA0X 1AACA 1XB6A 4EF3A 5I6MA 3TU6A 2RACA 1A4BA 2FJSA 2EINB 1M57B 3SBQA 3WG7B 1ZIAA 2J56A 1GY2A 2YARA 3PAUA 4BXSV 1AG0A 3WKQA 1NWOA 2VW4A 3AW5A 1PNDA 2BP0B 3V9CA 1NTDA 1OE2A 1E5ZA 2LLNA 2ZONA 1L9TA 3WIAA 1SDDA 3SQRA 9PCYA 2H5UA 5I5MA 1KGYE 5I26A 1GSKA 4BWUA 2PP9A 4AKPA 1TEGA 3CZUB 3NJGA 1J9TA 5I6PA 2IAAC 1W6LA 3WNIA 4YSQA 1IBYA 2P80D 1GY1A 2H3XC 4P5SA 3FPXA 1M9WA 2QT6A 3T6WA 5I5IA 4MFHA 3CVDA 1CYWA 3FSAA 3NYKA 4JHVA 4YSOA 3X1GA 2CUAA 2IH8A 2IWEA 2FQGA 1WAEA 2DYSB 3TBBA 3NJKA 3T6ZA 3NT0A 4DPCX 2CCWA 2IDFA 4YSUA 2MTAA 4G7SB 1XB8A 1E65A 2FQDA 2Y69B 2Q9OA 3N55A 4KNTA 1J9RA 1GYCA 1NZRA 2ZXWB 1ASQA 7PCYA 3FS9A 2FT7A 2PLTA 4BDVB 1AOZA 2YAOA 4A67A 6PAZA 4YSCA 1OV8A 1J5DA 1JZEA 1L9RA 1L9QA 1AG6A 5E9NA 2JXMA 3H4HA 4M3HA 4A68A 5I28A 2J5WA 1I53A 2GHZA 1ET7A 3NJLA 2QDWA 2BP8A 4GXFA 2CBPA 1ZDQA 2VW6A 2FQFA 3UABA 1DYZA 3DIVA 1E30A 1JZIA 4QKTA 3AG4B 3G5WA 4ZK8A 1NIEA 2JKWA 2FTAA 2AZUA 1IKOP 3QJTB 1NIFA 2HX9A 2UX7A 2H47C 1ILSA 3JTBA 5F7AA 3U25A 1QHQA 1BYPA 4N4YB 2HLEB 2QPEB 2WSDA 3QJVB 7PAZA 3C75A 3QPKA 1SHXA 3JT2A 2HXAA 3UADA 1BXUA 1JZFA 4BWWA 2ZOOA 3IN0A 1HAWA 2AVFA 3OMAB 5B7MA 3TA4D 2VSKB 2HX7A 3NSCA 1ZIBA 1NIDA 2BWIA 2PP8A 3EHBB 2YAFA 1BQKA 3D12B 3NJIA 3FPYA 4HAKA 1GW0A 1MZZA 4K9JA 1HFUA 3FQYA 4HCIA 2IWKA 2XU9A 1TU2A 2MRYA 3QJUB 3NSYA 5I6LA 1FWXA 4KO5A 1KBVA 3FU9A 1ID2A 2UXTA 1A8ZA 1OCZB 1M56B 4DP9X 5I6KA 1A4CA 4KNUA 1N70A 3AG1B 2XX1A 1NIAA 2GB2A 3IN2A 3T9WA 5IY5B 2EIKB 2HX8A 2UXFA 4A2GA 1TEFA 2OV0A 4W1TA 1AAJA 1JXDA 2VW7A 2I7SA 2I85A 1X9UA 2WO2B 3ASNB 1AQ8A 4F2EA 1BXAA 1JZHA 2JFCA 2XV2A 1R1CA 3X1EA 5ANHA 1OE3A 1GR7A 2PCYA 3T6XA 4E9WA 3FU7B 3ABLB 2I7OA 1VLXA 1OCOB 3PLYA 4YSSA 2GI0A 1RKRA 2XWZA 1WS7A 3UGEA 1J5CA 1CURA 2Q5BA 2GIMA 2IDQA 4A2HA 3AZUA 4JKNA 1AIZA 4WTQA 2BZCA 2GBAA 1F56A 3HB3B 1XMEB 2OJ1A 1WA1X 3ZDWA 4HCFA 3NJNA 3CVBA 2J57A 2YXWA 4CSPA 4AKQA 1MZYA 4JHUA 4WKXA 1JXFA 2BZ7A 3FYIB 3S8FB 3FSZA 3X2QB 4Q89A 2YAQA 1KYAA 1SJMA 1PLBA 1SDDB 4HHGA 1KDJA 2YQBA 3EH3B 4AX3A 2CJ3A 3WNJA 4CSZA 3FU8A 2XVBA 3PAVA 1AZUA 3SBPA 2EIMB 4NAJA 1BEXA 2B3IA 1IUZA 1V10A 2VMJA 2IWFA 4NERA 2XLLA 2J55A 2R7EB 2IDSA 1SFHA 4DP5X 4GY4A 4YSDA 3ABKB 4YVUA 1BQ5A 2DY2A 5I6NA 3FT0A 3PCYA 2WO3B 1ZPUA 1PY0A 3QQXA 4DP2X 2DV6A 5F7BA 1PLCA 1N68A 3CDZB 2IDTA 2GSMB 2UX6A 3FYEB 1NPNA 1SNRA 5AZUA 4DPAX 2PCFA 1SF5A 2PPFA 1KDIA 2P80A 3IBOA 4FAAB 3HEIB 3CG8A 3QJSB 3OQRA 1AZCA 3N2JA 3EH5B 4YVNA 5TK2A 4DP4X 5B1KA 3WKPA
chains in the Genus database with same CATH superfamily
2C3VA 4J2QA 1RJCA 3UG5A 4FQPA 4HKZA 4UF7C 2NXZB 5GIRA 3SHSA 3TPUB 1EJOH 4PW9A 4A1RA 4UTAL 5LGYA 3TJHD 4NN7C 1G9MC 2X3BA 4N85A 1BZQK 5AOJA 5EUKB 3ZO9A 1UTDA 2FUQA 1Q9OA 1FFTB 1ZVHA 2OA9A 3VTTA 3DUUB 2XBZA 2X2IA 1LP9F 1IGJB 2QQNL 2VR6A 3QCUL 1M7IB 1CVSC 3VG0L 4HALA 3QUGA 5GS0H 1HJCA 4O4YL 1NGQH 1JS4A 2H1PH 5EULV 5D1XC 5DEJA 4DEPB 3O6LL 3MN8A 4XTRD 3LNFA 3ARFC 3QEHA 1Y6MR 5PAZA 2SODB 4IJTA 4G9FA 4ZAKB 5B1JA 2KQMA 5FO8B 3DYMA 1UXWB 4PJCF 2F19L 5SWSB 1T1YA 2G2PA 1KJ3L 4GSDH 2X4SB 4PBWD 1CI5A 1G7IB 2OYKA 3VFMB 2Q7AA 4MD0B 5FAAA 4ZW6A 1IM9B 3QYMA 1MAMH 2W0FB 5FKPB 2AANA 4OD3H 1MFVA 1ZA6B 2IDUA 3SGDH 3FH7A 1T83A 3WDHA 4UIMA 3MDJA 5G4MA 2PCPA 1CXHA 5HDBE 2BNUA 4G8IA 1TUPA 1ZTXL 3RL2B 2VT0A 3RI5K 3UBXI 2CRIA 1NAMA 2XV0A 3D2UA 2F1EA 5DZ9A 5IFJB 3ZSTA 4OFDA 4YIQA 2PPEA 4AK1A 4JKPL 4NCC1 3FRUA 5L8JB 4QRPD 2I26N 2QSCL 4P04A 3CFIC 1XSKA 3H7LA 1CJYA 2B20A 1PZ5A 2CK2A 4WO4D 1ERNA 2HJLA 3LXBA 3P30H 5D6CA 2ZX7A 3ZIMA 1IFHH 4FQLH 1T03L 4G9DB 3TFBA 3UZVA 1L0PA 3CDCA 3QG7H 2DLEA 1J12A 1TJGL 4KO7A 4AGMA 5E2VL 4F3FB 3IDUA 3NZ8B 5AW4B 4IRJD 2GJ6A 5EF3A 4UQDA 3WFBL 3X13A 5KBNC 1NPJA 2VOTA 3D30A 4WFGD 2F7PA 1B4TA 3LQAC 4KKAD 4N24A 1Z2KA 4WEEA 2P5WE 5I8OH 2DD8H 2CHXA 2ED8A 1DSWA 4HZAA 2DDQL 4L3CB 4G11A 4WO4C 3WJLA 4PPTA 5DK0B 3IVKB 4HZ1A 4WI6A 4MNHA 4JE4B 1T6WA 5FHBH 3E80A 1MI5A 2MTPA 1FC1A 1EZVX 4F7MA 4CGTA 3K0YA 1P4BH 5AB1A 4P57B 4K8RC 5F0MB 3MLVH 1BQHA 4J1UB 3MBXH 1QBML 1S7VB 2D2OA 3IK2A 1E7VA 4NUJA 2ICWA 1B2WH 2AJZB 4ZFOA 5I73C 2GTZB 5IFJA 2LU3A 3NJJA 3V4UH 3STLA 4WW1A 3NP3A 1DL7L 3HHMA 2E9IA 4OFKA 1M3IA 4KI5C 1QNZL 1E3FA 1RCYA 4PRHB 4D9LL 2IXQA 4Q9RH 3L3JA 4N8UA 3MX0B 3PL6B 3VFOA 43CAA 3B7RL 2B5IC 4XT1C 3TA3A 5HYSA 3H85A 5EUOB 1OTUC 2DQUH 1Q94B 5CZVH 5KS9B 3HC0A 5EZOH 3PGDB 3RTQA 1HS6A 5MEOB 3HZKA 1AYRA 4K5PA 1U3ZA 3Q8EA 3UIZA 4OGYL 3QSKB 3GZKA 1S9XA 5HPMB 4HK0A 4MTMA 4QHMA 3CIQA 1K9TA 4NUMA 3UJTH 4BK8A 5CIPB 1I3RB 3S5LA 1HX0A 5EFIB 1VCBC 1MDAA 4OZIA 4PJDE 3F2LA 2GEQA 1P7HL 1I7RB 1WS8A 2G3MA 3BN3B 1IC5H 2D3LA 4WU5A 5CIPH 3S36X 2AK4A 3IJEB 4ODTH 1B2WL 2CO6B 2XXGA 3UAFA 5F96H 3PHSA 4DKAA 3UYOD 3LZLA 1T2JA 4MB3A 3C2AH 1VKXB 2P9RA 3RWCB 2BS8A 4PRIB 4C4BA 5HD8C 4M1GH 4G72B 3L3GB 1CQYA 5IHLB 1KXTB 2HKHH 4NWUH 5FM4A 2BVTA 4CNIB 1INDH 3GINA 3MV11 1D5ZA 3R19A 4NUQA 2OBGA 4P2QA 1H6TA 2YAPA 3IJ9A 5GS1C 3SEPA 3AC0A 3VXRE 3C6LD 3MA7A 4Q6IB 1PKQA 4K3JL 3SKJH 4GSXA 1XL4A 3KBFA 3KGSA 4MB5A 2QR0B 3CFMA 3FT3B 2BHYA 5IBUB 3QNFA 4PJXE 1EGJA 2Z4QB 2AV1B 1IAKB 3B5HA 4RMSA 3MMEB 2N4IA 3VFUA 1GMEA 2WZAA 3TH3T 2Y7QB 1CG9A 3WJMB 1MCLA 1LDSA 4R2GD 4KK9D 1XGRB 2VDOL 3G7TA 4ZS7L 3ZL2A 4IBVA 1XSIA 1M57B 3O0RH 3V5DA 1AKJD 5AZ2L 3ZDYB 2AXHA 1DE4B 3VFSB 2NY1C 2WLNA 2K1MA 3OKOA 3NZUA 5L0QB 4UT6H 4LFHG 1UYWH 1NTDA 1L9TA 1MVFA 2NCMA 2ARJA 4XMVA 4BSWB 2PXYC 1TTRA 2EEXA 3KPOB 2YMTA 3GJFH 1NMBH 1ZEAL 2PYEA 1MWAB 5D6DC 3SPGA 3H9ZA 4M5TA 1WZAA 5A6LA 1A25A 2FHCA 3VFPA 1Q1JL 1SYVB 3FH8A 4AITA 2QJDA 1A1NB 3I9GL 2X4UA 3JVGA 3DSFH 3FPXA 3T0XA 3COOA 4J3WA 4KV5E 3HZYB 1QZNA 5LGJB 1BREA 3VYNA 3TBBA 2CGZA 3LX9A 1AZZC 4MWFB 1KTDA 1PCXA 3K91A 3SE4A 1U8NA 4XPBH 3SDYL 1OD7A 2WWKO 4I88A 3DOSB 3IDMA 1KF9B 2FJFA 1SJHA 4BHUA 2X1QA 3L17A 3RGVD 7PCYA 5EEYA 3LD8B 2FT7A 1G7IA 3US0A 1U8JB 4KRPC 3S34H 4HLEA 1FYTE 1PQZB 4IU2B 5E9AA 5TPWL 5FFGA 2NY4B 4XZ4A 1A9EB 5DDHA 3QG6A 1U91A 4LMQI 5AZEH 3L2NA 1P4IL 3MV7D 4X5LA 2HVJA 4MQ7A 2ZCLH 4TULH 1FVEA 4XNMB 3HE6A 1KBGH 2Y22A 4ZK8A 5E2JA 3V4PL 4MJID 2GG1A 4AE1A 4XGZB 5CLZA 1IKOP 1BLNA 5JQ6L 4L5FL 4ZRGA 2F1BA 3BJLA 3FFCD 3FTXA 3B1TA 2WSKA 2I25N 2W0FA 5IV2B 2DIJA 4P46D 1ETB1 2HLEB 4OFYA 4X99B 2X4SA 1SHXA 1CMOA 4EUPB 1U41A 4M43H 3VXSE 1KGIA 4HSAC 5H37G 2G4GA 5T5NG 1UACH 2YMXL 4FABL 1TTUA 1KCVH 3KYKL 5K1VA 2VSKB 4JVPA 1DVSA 1ZIBA 1WTLA 4LPYA 1BQKA 2M1KA 4OF7A 35C8H 2ATKA 2F5BL 3AS0A 4L8CA 1HFUA 5TQ2H 4FQJH 4DTGL 3B2UD 2IVFC 4WIQA 4PBVC 1GYAA 5E8OA 1U8IB 5AOMA 4N2AA 4RGNC 4LEXH 1HKLH 3K71B 2DB8A 3FU9A 5DUJA 4RX4D 4PV9B 3ZHDA 2VR3A 5EUKA 5HYJE 3WSQL 5CEXA 1ZLUH 3H3KA 5C6TL 4D7BA 2A4CA 4PI2A 4QXGL 4XP4H 3AG1B 2YD9A 3K72A 4JZNB 2D0FA 4Q0XH 5TF0A 2AQ2A 3HMWL 4NXKA 5JHLL 3VXUD 1RURL 3G6JB 4QRUA 1BCIA 5TQ0L 5ISZA 4OLXH 1IQDA 3HG5A 1QLFA 4ZUVB 4PRAA 5C6WH 3U83A 1F8TL 5K9KB 1CE1H 1CXKA 4JHWL 2FSEA 3P0YH 4KHXH 5F7WC 1T0PB 5KZCD 3F64A 1JWMA 2JTDA 3HAEG 5IVXB 5EC2A 3FTUA 4IMKA 3QDMD 4P9ML 3RWGB 1H5BA 5FV1L 3I9PA 1LXMA 5GGRY 1AVAA 3KCPA 4CADA 1CURA 2BVQB 2KLSA 1J8SA 5F1NB 5A3ID 1BM3H 5GGSY 1UB6A 4GXVH 5E9DE 3VWJA 1X5HA 2ZYRA 1UKTA 3S3PA 1IIKA 3TT3H 1JTOA 5I1JH 4TTGA 1JYNA 4H40A 3FONA 1N26A 4N2DA 5D71L 1NOFA 1CIDA 2DF3A 4NHCL 4OIIL 3Q6FB 1A0QL 1CICA 4WO4B 4N86A 3D4CA 4NQSB 4S1RH 2VDOB 5C3TA 4HISA 2Z64C 3I02B 1TSHA 3HUJF 5KWYC 2MIZA 2NPLX 4DGYH 1GZQA 3FU0A 5JW4R 4LNRA 5LCVA 4MRCA 3VI4E 3GMNB 1SY6A 3OC8A 2IPUG 1QO3B 1OZUA 1K4DA 3BGMB 1G7QB 1V10A 1J8HE 3O4OB 4N5ED 4CW1A 3HC4H 1C8PA 1EAOA 2NY0D 2A6JA 2H26B 4YDJA 2FCBA 1JPFB 3WYRA 1D6VL 1ZHNB 3CXHK 1HWHB 1MWAL 4ALAH 3S88L 4G8GE 4Y2OA 4CVWA 4DP2X 4Y5YA 4LRIA 5SWZE 2CLVB 3BVNB 3PE9A 3OR6A 5FOBB 1N68A 4OZGB 2DS4A 1BVNP 3W39B 4KI5D 2BNQA 1BF5A 5EOCJ 3DRQB 4JFOA 1SNRA 3QXAA 4ZUUA 3HE7B 2VGLM 4FLSA 5GJTH 4WI9A 1BYNA 3QJOA 4PN6A 2G5BA 1A64A 2OCJA 3A6BH 1QBBA 3T0WA 4Y19D 2CE6A 3MV7A 4DP4X 4MNQD 4ACPA 3HIZA 2UWEE 3BXNA 3G08B 4PJCB 4FQXB 3F65A 4OZ4A 2VWEC 1G87A 5E9DA 5FYJE 2CO2A 4YMPA 1YO4A 5TGBB 4IIQB 1FHNA 1BZ9A 2ZP8A 3EYVB 4OFPA 4MCNA 3V0VB 4Y9FA 2W8CA 5BOPA 1QO3A 1GIGH 4N0CC 4PU2A 3GXDA 1SLUA 1IT9H 1LO2L 4PVLA 1GKEA 4IEFA 4PJXF 4BXVA 1FZJB 4XB3A 4PW3A 3UBXB 3GSNL 1LWHA 2CR6A 5IW1A 2ZSVA 1FZKB 5DFAA 1ET5A 3GNML 2L8AA 1ZLWH 1PMYA 4X6CE 3GZPA 2EEFA 2DBJA 1M7DB 5F7EH 2FSEB 1CLOH 1JG9A 2XY1A 3BJ91 1W8EA 4JANA 4ODHH 2P5WB 2ADIB 1ADQA 3VB9A 1J11A 3EGSA 4Z7UE 1A66A 3ULVC 1AGEA 3SBRA 3KGUA 4HWNA 2B0SL 1NIBA 3IAGC 2GJ6D 1KT2A 2WD0A 2CM6A 2BSEA 4TUKH 1RQ5A 1OAXH 3DUSB 3WOVA 1SBSL 2ERJB 2VL4A 2IFFH 4Z95L 1DFBH 1QBAA 1CK0H 4HKXA 1OCRB 4MQTB 5EA0H 1PNCA 4MAYD 3TCLA 5KVDL 1R5VB 1S7TB 5DRXB 4JRXE 3IMRA 2RALA 1H0DA 2PO6D 3C5ZA 2HJKA 3ZMRA 3T77B 5AENA 5BJTA 2P44B 4A7GF 1HJBC 1ILUA 1QSEE 1KJVB 4NWTH 4PJ5D 5GZNA 5CZKA 3HFMH 1QI5A 1A9BB 4JRWA 4P9HC 5E2UH 3DTUB 4S1QL 5D4JA 2ZXBA 2OMZB 5DUPL 1FCCA 1LE9B 1BFOB 2F0CA 5AL8A 5G5DA 4JG0L 3BP4B 2VDQH 4K7PY 3D51A 2H0EA 4UZUA 4KJWD 5JXEC 3RVVC 4LQ1A 4HJGB 1ACCA 4NQDA 2APBA 2OMTA 3PNWA 2CUIA 2BOBB 1LP9A 5FHAH 1RVFL 3N40P 4LKCA 5ICXA 3WL9B 1VERA 5GHWL 2QV2A 1I1AD 4D3CL 2NY3B 3GRWA 3SY6A 1E6JL 4KJQC 1L7TH 2KH2B 1SJHB 3M88A 5DD0L 4XPFH 1DBKH 2LU5A 5I1LB 4NIKB 2G3ZA 2TSAA 2WLHA 4FNTA 4XGZA 2R0WL 3WJJA 2VM4A 1I8KA 5HHNB 3G6DL 4PJHB 3AM8A 4HSCX 4EQ2A 5KOVC 3L95B 4F9PA 1GGYA 3TCXA 5LXGH 4JFFB 1NGXB 3BLPX 5TJWK 5C0NC 4Y2DA 1RZQA 2CNZA 3QQDA 4AENB 3NPSB 1U3HC 5AAMA 4B9ZA 1MCWM 1GCFA 3KPMA 2DKSA 5FOJA 2DL2A 2EKSB 1DLFH 2I60H 3MUY1 1ONQB 3ZRFC 4BSVA 2YA1A 3LPOA 4RRPG 2FLRT 3SPIA 3MREB 2IH3A 4IBLT 3TBYB 2E8YA 3UDWC 4HUCA 2BW5A 1DJWA 1WD8A 3DOSA 3IDMB 3N91A 4HS3A 2FH8A 2JE8A 3FZUD 1FDLH 1JV5B 4O2EA 4EQ3A 3EXJA 5FYJU 2FWLB 5IFAH 4YQXL 1HH9B 4P3DB 2DQFB 4N1CA 1UCBH 3SGJA 1E2ZA 3J8F7 4A7TA 4GS7B 1E4HA 1MVYA 4G1MA 5BS0B 3BZ4A 2VDRB 2FNWA 3ECBA 3Q1SH 1X4XA 4Y8DC 2DLFH 3IJ8A 3X3FL 4U3HA 4D0BA 5HI5C 5GQBA 4LDCA 5GXBB 1CXLA 5AVWB 2XZCL 5BXFA 4K9EH 5GSVA 1B6UA 1LWRA 4IOFC 5DWUH 4OLXL 1JRHH 2Y1AA 4XWOD 5HHOE 2WP3O 1NC4A 2EXTA 2R8SH 3HNVH 5IMLA 4FA6A 4ZQKA 2YPVL 4QXGH 4XP4L 4V11A 5CGMA 1F4WH 4Y16D 4KXBA 4DZ8A 3C09B 5I1EL 1W72A 3AAZA 4ZJ9A 1FORL 2ZF9A 1RSYA 4NQED 1BWMA 3QQDB 4EE2A 1R3IL 4M5YL 1G7LB 2Z9TA 4K8RD 1U8KB 2VXUH 5IKCA 4AOFA 3L95A 4KK8D 3VXUB 35C8L 4R8WH 1KJ2B 1KTRL 1UZGA 2CRMA 3IGAA 1OF0A 2JCWA 4O58H 4M61A 3ATAA 1C1EH 4ZOAA 2E7CA 3RURA 2QR0A 3FT3A 1WA0X 1AACA 5E5UB 5EFIA 2AJXL 1OD9A 2YPLB 4FQQA 4U3XA 4G6FD 3TIEB 4LVHB 2RACA 4N0CD 1RPUA 1EA9C 1UJ3A 3ZTNH 2YJQA 3EOTL 4Y2LA 4GKLA 2YARA 4AQ8C 3BSZA 4UIKL 4U4BA 2XWJA 3QCTL 4NSKA 1H6FA 3M7FB 4X9GA 1MEXL 1DHKA 4YGVB 3WELA 4KKCC 5DC2A 9PCYA 2UYLA 4ONHA 4HV8B 5BQDA 4A7VA 1Q9WA 3J7HA 5IVZA 5ENWB 3IBEA 2H8PA 3D4YA 2FB4L 1VACB 5F3HA 2R9HC 4XRCA 2WXIA 2R1YB 3N40F 5FW7A 4EEEA 1J9TA 3EJPA 3VO0A 1KPRA 1KIQB 2AJUL 5DD5L 3HLKA 4XNYH 2GUOA 4P5SA 2QT6A 5EU7C 3KPRD 1NEUA 2BMKA 5I2IA 3TN0C 4E42A 4IMLA 4ES8A 1YEHL 2GABA 3FUEA 4OFYD 3CLFL 2Q10A 1J05B 4PJ7E 4EDWL 5KBLA 2EP6A 4AL8C 2E75C 3AWFA 2Y69B 3CH8A 1OLLA 2JK5A 5FYLD 5HGGS 2B14A 2YA0A 1F3RB 1MCOL 3QIWB 1DFXA 4HS6A 4X7DC 1NZRA 2FZ3A 5GGUB 3SE4C 3I9GH 3T4AC 3IMWA 2M83A 3KYOA 3UTTA 3C6LC 1AG6A 3H4HA 3B9VA 4FXGC 5HDOA 2J1ZA 1I9RH 3UZEA 4XNBA 2FBJH 1T0NB 1Q1PA 3P9MA 3STLB 4OB5H 1S6NA 1MAKA 2HFGL 2WXOA 4ONFH 4LEEA 1Z3GH 2EH8L 4WUUA 4LIQH 2XG4A 4RGOL 4TL4A 5J8OA 2BSSB 3H9SB 4MMYB 1ZSDA 3OJ2C 3Q13A 2R9HD 3BX7C 4R26H 1CD1B 2R0LH 2A74C 3ZGHA 2LQRA 4LBAA 4FTVD 4B5EA 2VIRA 2WSDA 4NO3A 3OAWA 4AEHL 5L6YH 2EDFA 3P3RA 4MWFA 1JZFA 4KKLD 4N2OA 2J5LB 1FZJA 3ILQC 5F70A 3RUGA 4BWWA 2A6KA 4WNQB 3MRGA 3O6FB 4OCWH 4S10A 3TP4A 5DXWA 4QTHB 1CD8A 1F3DJ 2WGXA 4BK4A 1IM9D 4JW3A 4BRVA 4B53A 3OLDA 4MAYC 1E8WA 3PF2A 4IQHA 4ZX3A 3UH8A 3C9NA 4NO5A 3VGDA 4UM9B 4HIXH 2A83B 2B1OA 3ARGA 4HUMB 3VFRB 2HVJB 4MQ7B 4ZSOA 2RBLA 1PDKA 1GZPA 2WLYA 3G5YB 4LGRB 1YC8A 4MGXA 4WEBH 1JK8A 5I6KA 3WLWD 3CMOH 4P2RD 2XBTA 1FUNA 1LO4L 4QY8B 1W0YT 4LLUB 5FDYA 4HOZA 2GB2A 5LGHL 5F3FA 4PGCB 1DE4A 4B3VA 1NANH 1EZVY 1RIUH 2VRAA 5GRVK 1BDYA 2VXQL 4MNQA 1PIGA 1MQKH 4R5VA 3IXTA 3EFOB 5EBMB 3U0WL 5IHUH 1BXAA 3CWGA 2QGBA 5I9QC 4A2LA 4JFTA 4WWKC 3GBDA 1NCAH 2MQCA 1C7TA 3D18A 5KSAD 1S78C 2FWSA 5HHPB 5KJ4A 1WS7A 2Z0BA 3UZQA 4B7LA 3PABA 2ZKMX 4BQ8A 3F7PC 3PRZA 5D1ZI 3TWCH 4XMXA 5L9DH 3ISRA 3VXOB 4AYBA 1XX9C 3T5WA 3ATDA 5L4IA 1RK0A 1CGXA 3O81A 1OK8A 4PWHA 2IADA 2YXWA 3BZEA 1F4XH 1D5BB 3QQ3A 1WZMA 4JHUA 5B39G 2VLLA 4JUTA 2BZ7A 3QCVH 1KJ2L 5I2IB 3VUAA 4GUPA 3LXUX 2AABH 1BBJA 1YDPA 4YHNA 2IC2A 5HGAB 1OHQA 1VADB 2C7FA 1HHJB 4RDBA 1Q0EA 1SJMA 2OMNA 2JNZA 3VMNA 1CQKA 3BAEH 5D1ZB 1HWGB 3BH9B 3I75A 3N41F 3PFUA 3NIGF 3POCA 1KB5L 2DJUA 5MENA 3FO9B 2ATPA 3MRHB 4I3GA 1DBAH 3JV4B 1FP5A 4X7FC 1IGJA 2BHUA 5FYKE 3L3OA 5ILTL 3DV4A 1QHPA 4FE9A 3ZUCA 3E2HC 1Q9OB 4Y1AA 5IBLC 5B3JF 1OAZL 2WKOA 2EDDA 4LARL 5E94B 3W9EA 1SDYA 1ZS2A 1R24A 1QTYT 5KYWB 4XMLH 5CU9A 5TD4A 3DBXA 2J55A 2P5EA 2UZXB 2X41A 1NL0L 4FMVA 1TPXB 2IDSA 1H6UA 5D7LD 5DQJB 3TT1H 1LO3L 3FO1B 3AMKA 1I1YA 4UT6A 5EU6B 5EU5B 1GC1H 4ANKA 4EI5B 3CFJA 4L4VA 3QXTA 4JQIA 2NX5B 4MA7H 1IGIH 3L4CA 4DZBB 2OZ4H 2BSBA 2G60H 3MA7B 4Q6IA 3HPLA 3PWPB 5FF6A 2NTFB 1ACZA 4TPRL 3FRPG 2B59A 2YK1L 3O8XD 4NN6C 1UKQA 1KB5B 4HH9B 5D9SA 3US1A 5AZUA 3W3BA 2A7BA 1SF5A 2R1WB 3MXWL 3NA9L 1AKJA 5CCKL 5E1QA 4GLRH 5GRUL 1ZHBB 5IVXF 5HHQB 3INUL 4XC1L 1MFEL 2YRZA 4JGNA 2K0RA 2YGNA 4WTWA 4AIZA 3DX6A 4YSEA 4LSUH 1S7VA 4UQIM 1OW0A 1GVIA 5E8OB 2FQEA 3QZWB 1G1KA 3BHBA 4HOWA 3PV6B 3LEVL 4E9TA 1HHHB 1AZBA 3I75B 2VLRB 4HG4K 4TUOB 3V0EA 1TYJA 2J3SA 3I85A 1AH1A 2R23B 2HPOA 2XWJB 4MBOA 5C09B 3FB8A 3K74B 1ZHKA 1D6EA 3MRKB 1NLBH 3MFFB 3IF1A 4LQFL 4NQQA 3RPBA 3PU7A 5MEQA 4D8OA 3I3BA 5T1KD 1KCBA 2PR4L 2IQAB 2BSRA 2VLJA 1RUKH 4CL7A 2A0LC 4R83A 1DVYA 3MV01 1MREL 3THMH 2Q8BH 2BC4B 5J06A 4QXVA 1G84A 1BWWA 1BLNB 2XZAH 2NX5E 1UCTA 3DSNA 4X9YA 3UIYA 3ZHKA 2BRRH 5JORB 2BO0A 4MXWH 4ZMOA 5AUMA 5HP5A 5IGXL 2E9JA 5E2WH 4G1EA 3QPXL 2FIRT 1KTKE 1JHTA 4K3GA 4JO3H 2COVD 5EIIG 5CUSH 4XCNB 3VQ1C 1IVTA 5DZJA 2P8MA 1UZ6F 1U8PB 4QRPA 3ROLA 3ZE0B 4AT6B 1OL0A 1AS8A 4HETA 5EB9A 3INOA 4L1BA 3RU8H 5AAWC 4Y8AA 3A3YB 1LK2A 1OY3B 1Z5LA 4O9HH 4E9VA 3NFNB 5M95B 4C8XA 1QR4A 1V8HA 5CN1A 4ANUA 3ARRA 1AMXA 2VSMB 4B60A 3FUMA 3KGTA 5L4FA 1H3PL 1XF1A 3IE4A 1H15B 3KWVA 4OLVH 3BKCH 3FQ4A 3U30B 3SE9H 5LGKA 1T2QL 1DANT 1MCHA 4MCYA 5A2CA 4UAOB 5IREA 3KVPA 2F54D 3IDIA 1G7QA 4A55A 4GO9A 3ETBJ 5I17B 4X4ME 3O41B 4LU5L 3MCYA 3FFCA 4GXUM 4U1NB 3ABMB 3NACL 4PUBL 3L6FB 2A6KB 3MOAH 4XCEB 4YR6B 3QRGH 3ZKXC 4HS8L 1XT5A 2BOBA 4KX8A 2J73A 5EZJB 2R23A 4NRZA 1SDAB 2AQTA 2Y7MA 4XX1G 2VLRA 4XN2A 4L3ED 2HH0L 2UXVA 4O2FA 2OL3H 2ZWYA 1KPUB 3QXDA 5LXVA 3W0WE 3ARGD 3PP3K 4GI9A 2UWEF 5I0VA 4KROC 2JKNA 1I82A 3BUDA 3ZL4L 2EDEA 3RILA 3R18A 3IGFA 3V5DB 4GT7A 5I1GH 1S3KH 1LE5B 4AENA 5TDPA 4FZ8L 1IGCH 2IMNA 1CE6B 1NGXA 1GHFH 3MRCB 4KZEH 2Y06L 3KH3A 3IMTA 1E5AA 1IGYA 2Y6TE 2WHVA 4CDHA 1WITA 2R0KL 3V7AE 4F8TA 1S46A 1RXLA 3HJ0A 1RIHL 3CN0A 2YXVA 2EXSA 4MJIB 5F72S 2WQAA 5JMRA 1G9NH 4JPWH 1QACA 5E00A 1JK9B 5ICZB 4MXWL 1MH5B 1E5CA 2Z7UA 4AJYV 1PIFA 5CM1A 5DCCA 2NY2C 4BHUI 3K6FA 3R06A 1KLUB 5J6GA 6CGTA 2HFTA 1MREH 3OKNB 4U31A 2YRLA 4WU7A 2CJSA 3MQIA 1SY6L 1V54B 2Z31B 1KEMH 1XL6A 3DIFA 2B9BA 4FXGB 4LSRH 1OGTA 1YYMH 3VFWA 4X4YB 4I2XE 4OZHB 2IG2H 5DS2A 2BVEA 4BH8A 1HYSD 4U1HB 1J8HB 4NQTA 4U6XA 3FCUB 1XR9B 4DW2H 3SKNB 2Q8AL 1A3LH 1RZKH 2VSDA 5D7SH 5J89A 3KPNA 4YLCA 3R8BB 3EUUA 1NDMA 4X50A 2WXKA 1PFCA 1UENA 4LCWB 3N43F 3AXLA 4X2UA 5LN8A 5DD1L 1A1MA 1HHKB 1MFEH 1UZ8B 1UJ3B 4EZJA 2CO7A 1AXSB 2A4ZA 4LSTL 3UAAA 1UM5L 4AQAB 4MNQE 5MEND 4KKBD 4EO5A 3VU2A 3WJJC 3RY6A 3NEXA 3FSWA 1N6QL 5DD3H 4YSAA 3APCA 4IIQA 4AMXA 4Z3FA 1OAUL 2NQ3A 3A47A 3T65B 1BVKA 3ARFA 2A4EA 1ZT4A 3BXNB 4W4OA 3GK8L 4Y5XB 1NBQA 1FL5A 4KO6A 2AP2A 1JNLL 1IVLA 2VE6A 1NEZB 2YKLL 3SE3A 2CLRB 2JI2A 1X5AA 4UNIA 1YMMB 3ULUD 1AGEB 3NABL 3SO3C 2XKNB 4UU9B 1BZ8A 1F11A 3ALWA 3CSPA 4HGMA 4O5LH 3NIGE 3QZMA 2P5WA 4OZFH 4X6FB 2IBBA 3QXAB 1F4HA 3W1ZA 3S8GB 1U8JA 5FYJL 3GTVA 3CC1A 4HZLB 5EWIL 1DUYB 2A3TA 1YEIL 2NX5D 3BQUB 5FCUH 2J88H 3LSOA 5C0CD 3EJYD 1EEQA 3I2CL 4X0KB 3T4AB 2Y25A 3U48A 5FGRA 4J2XA 4QHPA 5C08A 5HDWA 3BUYA 4HGKC 2R4SH 3BKML 1OGAD 4TN9A 2VITA 4LL9A 2OS7A 2WQVA 1LO0H 1OAYH 2XG5B 3CNKA 1HXYB 2LLNA 3RTQD 1R4XA 5AW5B 1RD6A 1HEZB 1OPOA 3SDAA 3SQOL 1G6RL 5DLML 3KR3L 1E8XA 1IAII 1OTTD 4XPAH 3B6SA 4Q9BA 1LLAA 4WDIB 4N0UA 4UT7H 2IPUK 4ODSH 2AQ3A 4P2RE 1I85A 5JA8B 2A74B 4UILH 3VA6A 4W9GC 1FAIH 4NIYE 1CDUA 1N8ZB 4HIHB 3OR7B 3QISA 3U7WH 2NCEA 5FYKU 5ACMA 4JFUA 1GY1A 3QFJA 4H20H 3A6OA 3LMJL 4YNYB 3OJDB 3ECVA 3QHFH 1I4FA 2EKSA 2VDLH 3F01A 2ZXGA 1N8OE 2DYSB 1MQKL 2WWMD 1P84K 4GKSA 5DFWH 4DPCX 2MTAA 5J7CC 2OW6A 1DQQA 1H3VA 4DOHE 3QFGA 4HCRL 1N2RB 3SBWA 1RY7B 4LDEB 1ZHBA 5F8QC 4EMZA 3WKNA 1ZVSA 1PLGL 4FTDA 4Z5RA 2JWYA 4MRBA 2YAOA 4JRYD 1YC7A 1NGPL 1TT6A 1NEZG 2XN9D 1EFXB 4PTTA 2WLZA 5AD0A 2GK0B 4FYRA 4DF9A 5JNYB 2YSSA 3VDCA 4ILDA 4PW4A 5EORL 2I9TB 3HC3H 1WDAA 1E9OA 3P2TA 3A23A 5CO1A 3UP6A 3GIVA 2CBPA 3TNNA 2FQFA 5K93A 4GAGL 4YBLB 1WISA 5ISZB 5DJAA 2JJSA 5FIEA 1ND0A 3AXLB 3EBAA 5ES4B 1BQUA 4EIZC 4F92B 5IB2B 1BA9A 2XTSA 1R9FA 3LN9A 4R9HA 5JIPA 5L6YL 3IMBA 1OALA 5I1KL 2K9UA 1SEQL 2P49B 4AVJA 4MYPA 3HUJB 4OGQC 2VLRD 5ADPH 3MJ9L 5D93B 3QFJB 1R3KB 4OSUH 1YEDB 2K6ZA 4UWQB 2MOQA 3BD5A 2F8OA 3I84A 1OGAE 1G9MH 1QAWA 1GW0A 1G7MA 3FQYA 4HCIA 1DDTA 4I9WD 4N3TA 1DQVA 3ZLQC 4HJUA 1AOHA 1AY1H 2WO4A 4H1LA 2X9WA 3ZT6A 3WEXA 2H3NA 4ZMAT 1VDGA 2WIIB 1UXMA 3HKFA 3AGWA 5KOMC 3REWB 1GKOA 4AM0Q 1WWCA 2X4NA 3MV8B 1MXGA 2FUTA 3C6SA 3B37A 3BCFA 4H0LC 5I24A 4QIRA 3VI4F 1IM3B 5T1LB 3MV9D 4UZGA 4R4FL 4WI7A 3HE6B 3PUCA 2HN7A 5DJ6A 4QMEA 5IOPB 2OV0A 2GJJA 1RHHB 2W0PA 2B4CH 4KWUA 4U0RB 5T3ZL 3TBVA 4WW1B 4GAFB 2Q8AH 4FFYL 1TQSA 5DYFA 4QRBA 2WO2B 4NNXA 3L3HB 3NK4A 3OPZH 2DBLH 2XV2A 3HMXH 4L1HA 4LOEA 2ICWB 1EZUA 3JWOL 4QHKI 2WXHA 3FU7B 5GZNC 4JJOA 1S7WA 3RY5A 2AJUH 5DD5H 4CSTA 1J0KA 1K8DB 5CD3A 2VWEE 4ZUSA 1ZMYA 1R3LA 2IDQA 4LSRL 1AZVA 5IB1A 2QELA 4XPTL 4AH2A 1F56A 1B2YA 4P5TC 1WA1X 3WXWL 3BW9B 2F1AA 5FLVA 4G8FA 1A7OL 3L7EB 1IEBB 2HTLC 2Y23A 4UQ9A 1C7SA 2EACA 3BEVA 5T1MB 2CHZA 5TE7L 2YD7A 2PKDA 2BIHA 4PVMA 3FSZA 3MCG1 1G5GA 1EO8H 4F20A 3TEUA 2AF2A 2Z35B 4I1RA 1U8OA 3G6AA 3V6OA 2H4EA 2XWRA 3ECBB 4MAYA 2WTRB 4B27A 4NKMB 2X1WL 4AJ0A 4IKIA 2CZNA 4MJIE 5HJGA 5C0DA 4IKNA 4TTDD 4KZEL 1H15A 2ZUSA 1OPGL 3VGBA 3LKSA 3W81A 3KLHC 1BEXA 3DBSA 5I8CA 2HJLB 2OTUA 1G6RB 3ZL4H 4OY9A 4BZ1A 4Z7NE 2J2ZB 3FO0H 4DO5A 2PO6B 3BT0A 1AHMA 5JLZA 2NY2B 4KDTA 3GRWH 3QDMA 1GL4B 4Y2DC 3MACL 4POZD 1XSOA 4FYQA 2F08A 3A4DA 1FIGL 2R2BB 3QC6X 1FIGH 2YQ3A 5DK2A 2HFEA 3HAEB 3L3HA 1USQA 2DQEL 2JELH 2XKNA 4Y5XC 5H8DA 5EOCH 1N64H 4L2YA 5FEBA 4JO4H 1SXZA 4PUBH 3D0LA 3IJHB 2QGCA 5DTFA 1K2DB 2FO4A 2HRPH 1AI1L 3R4RA 4F2MA 3VFUB 3HS9A 1QUNB 1GGCH 1SLXA 1YHPA 4JRYA 5E24E 1CS6A 3KLHD 3CQQA 1FI8C 4YXLH 2Y0SA 3VXSB 3V10A 1KDIA 5HYJD 3QYNA 2R59A 3FT2B 3UTOA 4MJJA 4PJ9C 3JWNH 1AZCA 3P11H 4YVNA 3VFMA 1II4E 4GT0A 1YEKH 5DJYA 1SJEB 3LNHA 2IQAA 1MXDA 4UB0H 3K6NA 4Z9KB 3L9RB 3U2SA 3EF4A 1K8IA 1RIVH 4CNIA 3B2MA 4HJSA 4YX2L 1T1ZA 2H6OA 1YEJH 4X6DA 3TNMA 2EE9A 3DX7B 1RZPA 4HIEA 4JJ5B 2Y5TB 1MLBA 3MOQA 1WWWX 2V9QA 1F90H 1V3KA 2QLVB 4G2AA 5D72L 1KCSL 4M5ZL 1AGDB 3NJXA 2FR4B 3VX1A 5AQ0A 5JIDA 2VKXA 3L3IB 3PAZA 3BPOB 1O75A 5J3HD 4KUCF 3BPNB 4PAZA 2P42B 4GB9A 4JFDE 1A9BA 5D8JL 1OGTB 3QZLA 3D0VA 4N2MA 4MQXD 5I71B 2VTFA 3JVFC 4H13C 4YDIH 5DD6B 2JSFA 4JREB 4CADB 1IGFH 2X6BA 1TQCB 4MMZA 3OPZL 3PWLA 5ADOL 4U1MA 5IBTL 3WFHA 4Z7NF 2EVGA 1KCLA 2IV9A 2VJ0A 1XBRA 2QTEA 4FG6C 1URLA 3KYMA 4F15C 3CDZA 1PKQB 5AW9B 3H9SE 2Q6WA 3G6DH 4QXUL 2QPUA 2CIIA 2DWYA 4BYHA 1B3JA 3REVB 3FQ1A 5F6IC 5FCSH 5HGBB 4NNYA 2AMUA 1CFSB 4NPJA 4ICWA 5E7BA 1ZVSB 2Z31C 4Z5RB 2V2TA 4PJGA 2ZSWB 5FGBA 8CGTA 2V2XA 2NZ9D 4CC4C 5J4MA 1AY1L 3F7YB 5CWSA 4AXWA 4Z7VA 4FJZA 5ANMB 1W72B 2EDXA 3AAZB 4WENB 4OZIE 4X7EC 3A21A 3ZXAC 5TFSH 4ZNEE 1DVFD 4H26B 2XN9B 4HK3J 1UD5A 3GBEA 1XGUB 4PV8B 2G0KA 1XTMA 2YXMA 4IMKC 2ZOKA 3C8DA 3GFUA 1BZ7B 4WGVB 1HOCB 1XB3A 4TNGA 5JA9A 3ULVH 4O51B 3AQYA 3SY0A 3OJMB 5L88L 5KBKA 5EU4B 4MHHG 4LPUA 3O2DA 1MCIA 3UERA 1URIA 1R19A 4X98B 3UTSE 5BW7C 1IKNA 3AB0C 3O41A 4U3CA 5B39B 4B6ZA 2RQ8A 1UEMA 3IJYB 2XJKA 2EDTA 3FQWB 4NQEE 5DO2C 2BOCB 1BVLA 3NIFB 4UUJA 3I6LD 4OLEA 3SDDB 4AYFB 5E99L 1GGIH 2DICA 3HNSL 3U4EB 1A4JB 3QI9C 2AERT 5AB9A 3MRIB 4HUKB 4OV5A 3ECUA 3KWXA 1MY7A 2AEQL 4LCUA 3VE0B 1PZSA 2OK0L 5E95B 3M8OH 1YG9A 2NY5C 2PABA 1DBML 4XPGL 3ZYOA 3PQYA 4YHIA 4YHYB 1U21A 4LF3A 2DM3A 4ZS6D 5E1HB 4K7PX 1Z9SA 3BAEL 3B9EA 4U2ZA 4W9DC 1V3JA 2B5IB 4B9FA 5I16A 2DQTL 4OCXH 3CHSA 2MPVA 4M7JH 2KZBA 3OAZK 3ZRCC 1AGBB 1QFWM 3IVKA 3I3EA 2YEZA 2V6HA 1RZFL 4CDGC 1PD1A 1TJIH 4Y4KA 3BZFB 2JLLA 1S5HA 3GZQA 2NZIA 3QWRA 2Y07H 1TITA 5FGCB 3OKEA 1MW2A 1T89A 1BX2B 2NY4D 3NJFA 3OF6A 3OMZA 2NTFA 1P7QA 4JFPB 4PY7B 1RI8A 3H53A 3LRSB 1A6WH 4KO9A 2HG5B 1OTUD 4X6CB 3O11B 1MIEH 4UM9D 5JDSB 2ZXQA 3PHOB 2CCVA 1D9KC 2KKQA 4XH2B 1LEIA 3QT2A 1B88A 2EE0A 2X7LA 3H6JA 3OSKA 2DYPA 3K6OA 1PAZA 1SF3A 2B8OT 2NT0A 1BLIA 3EF7A 3T8MA 3BHBB 3SKNA 4H5SB 3EFFB 3QEQE 4PJ9B 4QRTA 4ZOCA 1LE9A 2NUPB 1QRKA 1UHVA 2Q76B 3L4ZA 3RGVA 3D06A 4M6AA 4TSCL 4R7XA 3RWHB 5AG9A 1JGIA 2ZXAA 3PWVA 1UD3A 4WU7B 4R7NA 2ISDA 5DLLA 2XETA 1YNKH 3EH2A 5H35B 4HKZB 5BCAA 2V7NB 3DHMA 4S0SD 1KCUL 2YKLH 3AABA 1T6BX 4NENB 4ZPTB 5C07B 1MUJB 3RVUC 5GS1B 1P0SE 3GK8H 2OL3A 4QOKA 1J9QA 5EEZA 1S7UA 3CFTA 4M6OL 1KIPB 1SMAA 4PY7A 3M17A 1LP9E 5E4OA 4R96B 5F7NC 5BRQA 3WGUB 4MD5B 1XF4A 4MAZA 4OVVA 2VERN 3HRPA 5FM5M 4F7KA 4ANVA 2QGEA 3L3GA 2AAAA 1IBFA 3PJLA 4Y4KB 1NFDE 4B9JA 1BQLL 1XB6A 5J9PA 4PJHE 1E43A 5IESH 1A7PL 5LBGA 3M6DA 2EINB 4GKZB 3RVVD 4EI0A 2HKFL 1A7BA 3FUDA 1P7BA 3OXRA 1C16A 4ZQTA 3ZDYE 3DUUA 3WFDL 4LLUA 1IX2A 1RZKL 3V9CA 3FO2B 4N0FB 2ZONA 1Q72H 2Q2LA 3D1MC 3TN0B 4ESKA 1JD7A 1LEGA 4X6DB 3DURA 1QZ1A 2O5XL 2A9AA 4GUCA 5F1OB 4AIEA 4HUWB 3P4LA 5D2NB 2NLJB 1T5WB 1TJMA 5KYXB 4JRXD 4N9GA 4B0MB 1RK0B 3H9HA 3VNYA 1T83C 4P9MH 5ERWB 1YEHH 4OLYL 5KVFL 1XXFC 3EKCA 4MFHA 4P2QD 2OXHB 3FQTB 3ZR5A 2XTJB 3AU1A 3G5ZA 5JXAH 2AGJL 3WD5H 2A1WL 3NJKA 4C54A 5E5MA 3T6ZA 5EH1A 3EJRA 4LP5A 1MAJA 3RBGA 3NZSA 3ZT7A 2IAMB 4F7TA 1IGTA 1RURH 3E9TA 1PGRB 1IGFL 3DI3B 1T4KB 4WTZG 5F1IB 4QDGA 3LKOA 4ZUUB 2NNXA 4DEUA 2Y2WA 1TZGL 3VRIB 4HXAH 4QY8A 5E9NA 4A68A 1MFCL 1I53A 3OL2A 1E4JA 3OZ9L 3RGBA 4KVNH 1VFBA 3GUFA 4QLRA 5I8CB 4IDJL 3GMOA 5C70A 2XIBA 2D7OA 1U8NB 5KZCB 5TH2B 1QTPA 3FT9A 4TSAH 4WK0B 5HYJB 3E6HB 3MV9A 1KLGB 4CVXB 1ZLSL 3QJTB 1YEJL 2ZUQB 2X40A 1A1NA 2VN5A 3KPPA 4P46B 5SX5H 3EADA 3QUML 4RMRA 3KE0A 2EDLA 1BYPA 5C97A 1L0XA 1NCCL 3N5AA 4J3VA 2WIIA 3WMQA 4GUQA 1N64L 2VQ4A 2BK8A 3CVHL 3MGOA 5TF1H 1J5OL 1MIML 4W93A 4E42B 2AV7A 4HLZG 4O51A 3VXMA 1TQWA 4YXLL 3DXAE 1Z3RA 5EU3A 3O2VL 1GGCL 2WKOF 4TVSa 4IBUA 4J6RL 1XGPA 3OZKA 2BNQE 1YYLL 2YPVH 4EPSA 3ATBA 1E40A 2AXGB 2DQEH 2JELL 2CKBH 4I0CC 1UWYA 1USZA 3LRHA 3LEXB 1JRHL 3S6CA 5M94B 3LIZA 5DWUL 4G6AC 1A8ZA 1CDIA 4FFVD 1FH5H 4JFYA 1OSPH 1HCFX 4HIEB 2GK2A 4JJ5A 4K3DL 4KAQH 4YDVB 1MCCA 5HYIA 2V2TB 5K59E 1GAFH 1OSYA 4PV1C 4N20A 1JNHA 4FCHA 1C5DB 2G9HB 4S0TD 1SBBA 5IHHA 2R4RL 2FZ3B 1UQSA 4PGDB 2I7SA 3SKOB 5DI8B 5DZVA 1AQ8A 1Z1WA 5DEFB 2ITCA 1JZHA 2JFCA 4BZ1L 2WLKA 4YQXH 5BS0E 3DIDA 4Y5YC 4ATWA 1ZS8B 5I1DB 1N5YH 2GITA 1I1YB 1OB1A 4PJHF 4U1MB 3WBDA 5SWZB 4L3EE 1OSZA 5DZAA 2F7IA 1BAGA 1JPSL 2GUOB 4A2HA 4OCLC 2PR4H 3VTMA 5E6IB 3FOMB 1AXTH 4LHUD 3SDXE 3KPSA 4GW5A 2KI6A 1JHKL 4Y4FB 4CSPA 5E4AA 2P5PA 2Q0ZX 3HMXL 1ORQA 2CUMA 4E9LA 1V5JA 2Y7NA 1FNAA 3LDBB 2EE6A 2JKJA 1ZJBA 5HHMD 1UYWL 2B4CL 2C3XA 1T04A 2CDEB 3SJVD 2EH7L 2F7OA 1NCHA 1PLBA 1TOXA 1MJJB 2MJWA 5D7IB 1CD9B 4AX3A 2CGYA 1NGYB 4JKKA 4QNPE 3V8CA 2VB5A 4APQA 4IJ3B 3KLKA 2ZAIA 3S37H 2A73B 3IFPA 4M7LH 2OJEB 2KDYA 5IMKB 4BA8A 3CHRA 2UY6B 3EZJB 4NHUB 5I0WA 2NNCA 3BPNC 5EDXA 3O9WA 2C9PA 5KAQG 3T0EC 4ZW5A 2HT2D 3E3QC 2I9TA 2OSLA 2AEIT 4R4FH 4P4KB 1HXYA 2X9XA 2IBZX 2XN0A 4DGWC 2DY2A 1HQ4B 2VITB 3L5XH 4XNXL 2F7QA 5I76A 4AGNA 4QHUA 3QUKB 4Z3HA 1B0GA 4KJPC 4PREB 1QTSA 3QQ9C 3BW9A 1A47A 3BUTA 3TT1L 2FGWL 4YC2B 2WYHA 1PLCA 4JL1A 4NWUL 5CSZB 4MLIA 3BQUA 3JYBA 4F8NA 3HR5A 4XMLL 3PXHA 1QX1A 1PQZA 2AJVH 1CXFA 1MKFA 3EJZC 3ZTDC 3C2AL 2EXWD 4P99A 3CBKB 1YEWA 4UTCA 1RZ8B 1M6UA 1TEYA 3FTZA 3N44F 3NN8A 3P73B 3IBOA 5CJQL 4OI7A 1EJFA 3GMMA 3FF8A 3PJSB 4LEOB 3F12B 1A6ZB 2WXNA 3N2JA 3BPLC 4XN1A 2R29H 3GXTA 3ARGB 2A83A 2ZQKA 3UBXA 1S2EA 3Q0HA 2WBXA 1ACXA 1V7NH 3IAQA 2ZWZA 4LCWD 5AOKA 5LGJA 3SDXA 2VZVA 4L8SB 3CUPB 3K80A 4JS7A 3D69A 2FJGB 4F80A 4TVPL 3MNZA 4M03A 3ARZA 2YEVB 1DZ0A 1FYTD 1CB4A 1DSYA 3ARDC 4L3EA 1CXEA 4NZUL 3T2NH 2DQCL 4BWTA 1EUUA 4AZ8A 1FNGA 5AYUL 1U8MB 1NKGA 4TSCH 5KW9H 5DMJB 3ESOA 1XV8A 4PRPA 3G9VA 1CN4A 1MJ8H 1CFTB 3PNRB 3QH3B 4KRLB 3GRGA 5AALA 4AQOA 1J1XL 1NFDA 3T04D 1EK3A 4KQ4H 2J8HA 1YMMD 4TQEL 3EFDH 4XO9A 4F58L 1OB0A 3W9DB 3FCSA 5DMGD 2BW4A 4ZX5A 4BZYA 1LNUB 5EZLB 1TCRA 4FG0A 5HJ3B 1B3IA 3L5HA 2ZG1A 3X1FA 1ZV2A 2YWZA 2ED6A 5IW6A 4BH8B 4BDVA 4GKZA 4Z0BL 5EIVA 2E6PA 1MIEL 3F04A 5KSBB 3CZKA 3GXPA 1RZGA 4ZFGL 4UT7L 3KS0J 4F58H 1LO4H 3FOMA 3RFZC 1IT9L 3CC5A 3DETC 3DVFA 2DJ4A 1QR1A 5DVLA 4K8RH 4LHUG 1IM3A 1HEHC 4FKHA 5T1LA 2VAAA 4XBGB 4L1TA 2VN4A 4YO0B 1H5BC 5EF1A 3EXLA 1JFQH 1J18A 3BKMH 2PWGA 4NHUA 3SQOH 4IBZA 1L5GB 1OSEA 2EC8A 5HD8D 4CC4A 1KBPA 2V7NA 3K1DA 4L0ZA 3AWGA 1L6ZA 3FK3A 4I8DA 2IBZY 5EIIB 2LLGA 5IB3B 4WW2B 1GTFA 2PPCA 5FK9B 4KTDH 4M4RB 3GXMA 1PW3A 1F5WA 3O3BA 1RK1A 2P46B 3NEOA 2QGDA 1WHPA 4WU5B 3H2QA 4LB8A 3QWQB 4FFTA 4AVKA 3L4WA 5BVPL 5BS0D 1LK3L 2NY3C 3MLXH 1R3HB 3OKKA 3LHPL 2G2RB 4IBQA 1F6AB 3MR9B 5I1AB 4RGOH 2O6PA 3GJFB 5B3NA 1Z3GL 4QT5B 3WDIA 1OAUH 4AGQA 4MJ5A 1VEMA 1NANI 1D9KB 1K3IA 5J12C 3UGUA 3UC0L 1JNLH 2WXJA 4KI5F 5DRXA 4KV5F 1ZLVH 1CDJA 2O5NA 5IR1B 1HXKA 5L88H 4PTUB 2RJMA 4M8UA 4OZ4B 3U4AA 4L4TE 4DP0X 1E4WH 1PCSA 2X2HA 1E6OH 3SOBH 1QW9A 1QA9A 4X5PA 4YFLF 3ERXA 1JI1A 4P2OA 1A65A 4CU6A 2Y2YA 1CLVA 4DH2A 2DQJH 1LK2B 5GRJH 4YHPB 2FDBP 1IARB 2H9GB 3ARFD 2YGQA 3BP7B 4P9HL 4GXVL 1PY4A 2LU7A 4YNYA 2UZIH 1V3LA 3OHXA 1JVOA 2RB8A 5GS0L 1XF2A 1UJ3C 4UV4L 2A6DA 1EHLL 4L37A 2DI8A 5CLYA 2QQNH 4IYKA 5IFHL 2APWA 1T21B 2BVOA 2NYKA 3DDFA 2A9NL 3IETA 4OV5B 1YYML 3EYFA 3ZIYA 4QXUH 2BNRD 2K4WA 3ARVA 5BV7C 3QCTH 3KM1A 1BOYA 1T1WB 1EJOL 4UYQA 1DVTA 4HMEA 2WYIA 5FUCC 5ADOH 1HWWA 1XR8A 2WMPA 3HMWH 3NZ8A 1JYVA 3UACA 3ABZA 3BKYL 1MELA 4ZXBD 1SFDA 3EHBC 3GSWA 1G9NL 4JPWL 1NMCC 5HHMB 4Z0XA 1K5WA 1E2VA 1ZKAA 1S3KL 3L3KA 3KYNA 3MUGB 1JZ5A 2YGVA 3CN1A 3NMEA 3X17A 4PIBA 2D0GA 2NRDA 4KUZL 3VWKC 3ZE1F 2MHAA 4R8WL 1T0MB 3JWDC 5D4HA 5IMOA 3BMWA 4Q14A 1GAFL 3QUYA 4AYEC 3QJHA 3UTSD 1J1PH 3MU3A 3WEAA 3DMMD 4BFBD 3FRUB 2C7UA 1FORH 2BNQB 2ZUQC 3KLQA 1NINA 3V6FA 4IIZA 2YUWA 4A7QA 1DO6A 3CFKA 4XX1E 4KRNA 5I1EH 2J1XA 3EOBA 3VFTB 1CVRA 1MCPL 1RIVL 1IFGA 1DQDH 3V9FA 1KN4H 4M43L 3GO1L 1DQML 4UCFA 3NSDA 3KPQA 3KGRA 4FFWD 4HGWB 3EG9A 5I75C 3UPAA 4MVBD 1VPOL 1TQBC 2WOBA 4QHLA 1DZBA 1M6OB 5JQ6H 3REVA 4Z78A 1O7DC 2R15A 3C6LA 5C8JB 2XZCH 1CFNA 1AGCA 3WNOA 4A63A 1ULVA 2H1XA 3FU6A 1AI1H 1BBDH 4HKJB 5D7EA 2NLJA 1FNEA 4GAYB 1O6SA 4JO4L 2B3RA 4L4TD 5DFVC 4JDZA 2J56A 4CBPA 3B56A 2IGTA 3JVGC 2HG0A 3NQKA 4JO1L 4MJ5B 3WFHB 4BXSV 1AIFA 3WE6A 4NFCA 4LHUB 1IGYB 5F1KC 2VXVH 4DVBA 1SDDA 1BIIB 4GRWH 4Q52A 4DJMA 1S9VB 4YHKL 1FNSL 4Y1TA 1J1PL 2JQZA 1AR1D 3GT6A 5CLWA 1QABA 2WLLA 4N0RA 5IB4A 5I5MA 3AU0A 2VISB 1COBA 4BKLB 1R46A 4IDJH 2Q86B 2FLBT 2WNKA 4JM2C 1J5HA 3GSUB 4FADA 5JW3L 4PFEA 2IAND 5I6PA 3OXSA 3QDJB 4G9FD 4NKDA 3SQBA 4WO0A 5JW4M 5JPNB 2QPSA 3VI4A 1AKJB 4XAWL 5KSVB 5L2KA 1I7TB 2BSTB 1YY8B 4TM9A 2FYVA 3C5ZB 2AV1A 5B38A 1I7ZB 2MNWA 3WLBB 3DGGA 1EO8L 3RNQA 4BV1A 4C57C 1RHFA 2A1WH 3GIZH 4G7SB 2NY7L 5HY9A 1J10A 2Q9OA 4OZFB 4HVBA 2WXGA 1E4XI 1PD6A 1QLFB 1FFOB 2R0WH 3ATFA 3PHQA 3N44B 5D6DA 4H8VA 3UZEC 3TM6A 3BMVA 3DUSA 3KDPB 1KXTA 1L9RA 3WCYA 4JLRB 4XPTH 1JWSB 1XMWA 1TZAA 2DIEA 4DGVL 1ET7A 4LVNC 3MKGA 4HXBL 3VNZA 4NBXB 3RVWD 2O4EA 4G80B 4BZ2A 2QFPA 2VW6A 2OR7A 3QS3A 2AK4B 1TZHB 3GXNA 1NAML 1YAIA 3FOLA 3UCRA 3T3PB 1E90A 5JHAA 3AG4B 3QRLA 1UXSB 3QUZC 2Q3ZA 2D0HA 2FTAA 3RWFB 1AC6A 2HFFB 1I1CA 4FTVB 2FYYB 4KTEL 2UY7B 4F5CE 3IDNA 1IEAA 1RUPL 1X5KA 1QHQA 5DHVH 3Q7JA 5C0BB 4AUYA 4Q74A 1SQMA 4GMSH 2WBKA 5IESL 3U79A 2WP3T 4JVUA 4MB1A 2N7SA 3T0VA 3UCQA 4TUJA 2ZX6A 3SKJL 1XF3A 3VGFA 3AREA 1IAIL 4L4VE 5IB5B 4K94C 3MXVL 3I6KA 2F53A 3EHBB 2D03H 4GRWE 2JKRM 4QF1B 2EABA 1CZ8H 1YSOA 4E0RA 1Z9PA 1S8DA 2CGRH 2PYFB 2VDNB 5IK3B 3MLYL 1E3XA 3U36A 4LOFA 1XAUA 2C9XA 2O6DA 3B1UA 3UROR 5KVDH 3NSYA 4MSWA 4ODVH 3SDXB 4LARH 2HRLA 3KPTA 1FWXA 3LHPH 3NA4A 1UA6H 3PUUA 3KPRA 4WF7A 1U3HA 4NGHH 5AAMC 3P40A 2IFFL 1LO3H 2ZKYA 2C5DC 5DQDL 1OAXL 5JQHC 9CGTA 5EUOF 4XMUA 2KPWA 2R29A 1BQHB 1GC1C 4J1UA 2XFXB 1NCWH 3RE0A 3VD7A 4RCAA 3VGEA 3WV0A 4K23H 3U2IA 4R7DA 3DLQR 3FMGH 4GG8B 3GPEA 1JAEA 1ZLDA 5FYJD 4ODHL 2GIXA 3K2IA 5F7HA 4Y2OB 4F2EA 2FWOA 4ZFOL 2FD6L 1R1CA 3ARSA 4G7VH 2HT3C 2JQMA 2X6VA 4YSSA 5JORA 1AHWB 4ENED 2GJZB 3HC3L 1WF5A 2DLIA 3UGEA 3GNMH 4J23A 4GRLC 2CKBB 2DWEA 4KXZH 5DGQA 4HMCA 4WTQA 4L05A 1A1OB 1GYWA 3QUXA 5KUKA 3JSSA 5CSGA 4NQCA 3IDJA 1QFWI 5K59F 4D9LH 3GGWA 1KZQA 3NJNA 4I0PD 3TC9A 2VR4A 3H3BC 5CILH 1VF5C 4X7TB 4EIUA 4LLDB 4ZFGH 4XCCH 4KK5D 5T3XH 4H1LB 3SDCB 1HOEA 4Z0BH 3MYJA 4Q89A 1YNTF 2UZXA 4R4BB 3D85A 2XFGB 2VDKL 4HHGA 4KY2A 3PS6A 1HE8A 5I1AA 1HCZA 1PVHA 1UEYA 2Y6SC 5B1CA 4CSZA 5E6YA 4DGIL 1RZFH 2ZX9A 3FHEA 4HIQA 3U7YH 4H20L 4LRIC 3SBPA 2WIMA 4KQ4L 5AB2A 5CZXC 1IC7H 3QNXA 1JGUH 1MOEA 1FO0A 4IOFD 1MLBB 1A7NL 3ZW3A 2AK1L 2IGLA 1HHJA 4N25A 4WWKB 2R1WA 2J12B 5FYLH 5IB2A 2PXYB 6TAAA 1E9PB 2OK0H 3K6DA 1QASA 4FC3E 1NCNA 4PJGF 4NQUA 1QRND 3QQXA 1XFPA 3BAIA 5E2VH 5E99H 2NW2A 3BAJA 3KYMB 1O6VA 4L1LA 3VJ6B 2FEDC 3QUXB 1BD2B 4B9CA 3O8XB 1Q94A 4XO8A 2UX6A 4OLWH 1T80A 4QOKD 4WWID 4EI5A 4Z7QE 1EXUA 5KG9A 2PYED 3VWKB 3VFOB 4MD4A 3MRMA 4KKPA 1EEYB 4P2RA 2WBJC 3U7AA 1H3WM 1ZGLB 3EGXA 3D39A 2DLHA 1BVZA 1NMCB 4PJEB 1H9DA 4ZTOH 1KIQA 3SPJA 4ZTPL 4DWHA 4NXSA 2EAEA 4V1DE 1G1CA 1HE7A 2P43B 3BUIA 3QXWA 4ZW3A 3K6SA 2RMNA 5B1KA 1F0LA 1MLCA 4HPYH 1DVUA 2EH8H 3SDDD 3V6OE 1K72A 2G9KA 4P2AA 4PJBE 2M26A 4S1RL 1WBXA 4OZIB 4OR1A 4LF3B 3BRFA 4JG1H 1BZOA 5D71H 2B9AA 5C9JB 1URZA 3X3GL 4ZMWA 3OGOE 5F7DA 3QZOA 4L4TB 3HE7D 3LKSB 5I71C 1KTCA 4BQBA 3CDYA 3KW8A 1EZLA 4LLDA 2EYSB 2DWXA 1UH4A 3S3BB 2WZ6A 4LHJB 3QR0A 1X4ZA 3H1ZA 3V5HB 5T3XE 3DC0A 4Y19B 1JGEB 4OJYA 4AYMC 3CLFH 5L2KD 3EYSL 2XWBB 1WG3A 2F19H 1KB9J 3VYOA 3LB6C 3MNZB 3U1PA 4WEMB 3WS3A 1QPPA 2PWHA 4JHWH 4N90E 5HYJA 1FNLA 1E28A 4HWZB 1VEOA 4XVSL 3AACA 3QUMA 1NGQL 4O4YH 1UC6A 1AO7E 1H8LA 4ZG1A 5J1SC 5HI4C 1M7UA 2B15A 4PEEA 3EJYC 4GP4B 2MSPA 3ULSA 5IBLD 1NKOA 5D8JH 4ZDHB 3HVNA 1KENH 1SY6H 5I6XB 2BNRE 4UIKH 4YHLL 4LK4A 4MDRA 3K4DA 1N5YL 1S7QB 4X9HA 1JZ8A 1HINL 2FHBA 2VM9A 4X4MA 5JXEA 1MEXH 4L3AA 2OZNA 5HPOA 2OKMA 3ZDZE 4OJFH 1UADC 1S5IL 1FCGA 5FX3A 3RVXD 3WHE0 1HXMB 3N1QC 2JKLA 3E7JA 4FNLL 4Y1AD 1KJMB 2CLZA 2GJ6B 2ENPA 1TTGA 4OU3A 1DJXA 2D31A 4QRQA 3P11L 4JDEA 4OVUA 3WLBA 3LKPA 4GP5B 2W9EL 3S48A 1ETJA 3ARED 3CQPA 3BFQG 1FYHB 1JFHA 2I07B 2XWCA 3C5SB 2PUQT 3A5VA 3KL0A 3MCLL 4R0LC 4V1DA 4L5FH 5F71A 2FJHB 1C12B 1CTOA 4YDKL 2WZPD 4O58L 2LVCA 1KGJA 2YUZA 4IOSD 2XRAL 5I19L 1ZWIB 2V5SA 3KDMA 1KBGL 2CAKA 5A2BA 2IAMD 1P5VA 2CK0L 2HT4C 2ADGB 2QFRA 4FQHB 4I3SL 4HUXA 2AQQA 3Q44A 1LMIA 1C16B 1IE4A 4KHTH 5D1QB 4UBDC 5SWSD 4EN3A 4AEIH 5F9JB 4RWHA 2JJWA 3LN5B 4XVUC 2DQGH 1GYUA 1R3JA 1TLKA 1TZHA 3N3EA 4HJJH 3QARA 1DN0B 1MIMH 4MJ4A 5DHYA 3CVHH 4IKJA 4P0DA 1A4AA 4F24A 4HH8A 1P53A 3AREC 4H0HB 3FO0L 1DCEA 4PH8A 3HMXA 5DRNB 3IFLH 1FIEA 5BUPA 3C5ZD 3X12B 3RVWC 5CGYD 2W38A 1KLFB 4LU5H 4I1NB 1RJZB 3T3MB 3R06B 5J6GB 3WI9A 3ESNA 4H25B 2J1WA 2X0WA 1HHIA 3MRQB 4TTDC 5LO7A 5L8LB 1YPZA 3L81A 3SKOA 5CSBA 1OF2A 3L4TA 3KBHE 1N0XL 4PWIA 5IQOA 4HKXB 6PCYA 3NEEA 1FDLL 1V05A 4ERSH 1QSFA 1WE5A 2NR6D 1W8NA 4LBEB 2NT1A 5B38B 4TLKA 5D1XB 2PW1B 2GT9B 1FVDA 4YN3A 5HGDA 4YFEA 2Y9RT 3NG5A 1VESA 3VDBA 1MHCA 2EO1A 4YDLC 3P77A 5FM8A 3KHOA 3O9WD 1HCVA 2ADIA 2EYTA 2XWTA 5A2LH 3NSFA 1Z6JT 4JX0A 1D7FA 3DX0A 3MV9E 2K8MA 5CZXD 2AQNA 3PWNB 2EDKA 3BH8A 3RDTB 3TO4B 2IH1B 1OCCB 2HVBA 3IEAA 1F02I 1EJ8A 4PG2C 4DP8X 1QATA 4GQ9L 4C56B 1XGYL 4TNFA 4WHYH 4GYBA 2PPAA 5CBAB 1CXIA 3NGBB 1TENA 1ZY9A 1C12A 4BFRA 1N18A 3GQFA 2VZSA 3GJEB 3X14B 5DJAB 4H2AA 4Y4HD 3ZDXE 2Q8BL 3DVGB 3S0PA 5I15H 3DJTA 1I9IL 4FXKA 1YUHB 1PEWA 4M4PA 1FNGB 3AY4C 2F6AA 4NQCB 5IJBC 4BUQA 1KXVA 1ODUA 1CL7L 4UQ2B 1KZYA 4EVNA 2V5RA 4NCC2 2CKBA 4J3OG 1QNIA 4YOKA 5DD0H 3CDGA 4IW4C 1SJXA 2AXJA 3ABGA 2EUWA 3VD0A 1JOIA 3FB7A 3LXAA 5I0ZA 4P2OC 1GOFA 1JHLL 1U8HA 1HSAB 1P7QD 2HP4A 1AGFA 5I66A 1T21A 1OTSC 4ORGA 2AQSA 1L9PA 5I18H 3NSJA 5TDOA 2QSVA 5DQ9A 2GBVA 4X4ZA 1NSNH 3EYQD 3H56A 5I16B 1XCWA 3HUJE 5CP7B 1GS7A 4S1QH 2NNRA 4OSUL 5KVEH 4OD1L 1MHHB 2DMKA 4W9ZA 3ILEA 3QNZA 3FF7A 3V5KB 3GUTA 3AS3A 4F8OA 4XCNA 3C5XA 4UINL 1QKZH 3RX5A 1FJ1B 3LHAA 4KJYA 5H2BB 4NAMA 3RWEB 4KK6C 4I18A 1A7RL 2QSTA 3S3JA 1JDCA 1XZ0A 3G5VB 4H2CA 5IWLC 1M2VB 2W9DL 5LKNA 4MZ2A 4XZUB 5E6UB 2LHAA 1KOAA 5FECB 1CK0L 1BSIA 2VLKB 2X6MA 4RISL 3QEQB 4BQCA 2JJVA 5JHMA 1SBSH 4G5ZH 4X9IA 1FFNB 2LR4A 2G5RA 3P9LB 2QKIA 4PJAE 3RX8A 3DA0A 1IJ9A 2WLIA 3DOHA 3MRJA 4M62L 4QTFA 4AGPA 4HULB 1HH9A 3MGAA 4P3DA 1MFUA 1OAZH 5C08B 1TEGA 3T0EB 5MEQB 4WFED 3TBWA 4M1DL 1QFWL 5IG7B 5MHSE 7FABH 1W6LA 5E5LA 3KLLA 4YSQA 2BS71 2P80D 4EXPX 5JW5A 2ZOUA 4GJTB 4PRID 1F6AA 3MR9A 4NX0A 5CN3A 1ED3B 1PZ5B 1O5DT 2HUEA 4ZMZA 2FQGA 1UURA 1WAPA 1MCWW 5JIMA 4I77L 4PGJA 1KTJA 3NT0A 4JQXC 1CBVH 2YD3A 3PREA 2K6YA 4ZUWA 4DCQA 3MV8D 3C12A 1KJ2H 3LY6A 4QPEA 5L4JA 2EIDA 1FVDB 1CLOL 1SXBA 1XSJA 1F1GA 2K9FB 4HA1A 1YQ2A 1U8HB 2WZ5A 4PJDF 2KZWA 3IJSA 3QP3A 4HOXA 2YRPA 3LOWA 4XO3A 1J7VR 4ZMQA 1J86A 4MD4B 5E6IC 4JZOA 3UEZA 3R0MA 5BRZA 4EOWH 4WFGE 4GQZA 1OXYA 1ZS8A 5HGBA 5I1DA 4R96A 4ODSL 3VSTA 3MLUL 1FG2A 2DD8L 3AROA 4QOKB 4XPAL 1TJIL 1G6RH 1TMQA 2DZEA 5KVFE 3CFJB 5AD0B 5IHUL 4RFNC 4W70A 3X14A 3G6JA 3KM2A 5HXMA 1DN2A 2FRGP 2HX9A 2W60A 4U3SB 3JV6A 5D7KD 4GRMB 5F9DC 4Y9BA 7PAZA 5BQ7B 1FN4B 4NKOA 1KNOB 3N42B 4WUUE 4HWBH 3ZT5A 3TURA 4HOMA 3L3IA 4AEFA 1EVUA 2J88L 3RX7A 3L7FB 5BZXA 4B41A 4TOYL 1WT5A 5GJTL 4X9FA 3NSCA 2PP8A 2P24B 3LPPA 3ZDXF 2L4OA 2JI3A 1U58B 4WTZA 4F7CA 3IT8D 3HG2A 3U6RB 4PGEB 3BEWA 4H0IA 4P49A 4ZO8A 3VCLA 2NY5L 1FG9C 5J1TC 1IBBA 2JXMB 5CBEA 5C0ND 4G6KH 4GUPB 1KLUA 3SE8L 5J11C 2DTSA 4NYLB 4QO1A 4D9RE 5LG6A 2E9BA 1X5XA 4UI2A 5F7LB 4FS0A 3J27A 4KO5A 2EDWA 4AM0B 1KBVA 4OKDA 2IGFH 4AGOA 1B0RA 3LZNA 2IPKA 4XB8A 1Z0NA 3U9UB 1JN6B 4QYOA 4R0LA 2CLZB 3HI5L 1AGCB 1IMHC 5K9KA 3D25A 4MJIA 4QCIB 5ESQA 5DD3L 3VH8A 2X44D 5BRZB 2EDQA 2VDPL 3BGFB 4RZCB 5JPMB 4GQ9H 4NQXB 1TJHH 1WUZA 4XC3H 1XGQA 4ZSOE 1R5IA 1AAJA 5TH2A 5LAXB 1SVZA 4MDJA 3EO0A 4ODXB 4LCCC 4TNWF 5EO0A 2AEPL 1OIOA 1RUAL 1XF5A 4QRRE 3HKZA 3OGCA 3MJ7B 3MV8E 2N0KA 5D7SL 3QDMB 2R1XA 3W9DA 1A3LL 4AE0A 4CN1A 2YZ1A 3DMMC 1REIA 3H2PA 3RRQA 1WLHA 2D7QA 2EEDA 4FEMA 2ZG3A 2IG2L 5E56A 5KVGE 4AKQA 2EIZA 2HMIC 2X89A 5HDQL 4ZPVB 1F1DA 4AQ1C 3A4AA 1BOGB 2YUVA 3LVEA 5AOIA 3SDDA 4AYFA 1U8MA 1F8TH 4WI0A 4EI5D 2JTYA 2CDGA 5JR1H 4E41B 2H2PD 3DHPA 2MCPH 2VNCA 5K39A 3MLWL 3FQWA 1CLZL 3C60B 3ILPB 3QORC 1UG9A 3ZL1A 1DJIA 2VN7A 3QB7C 2XVBA 1JUFB 5JHLH 1MJ7H 3HZMA 2V17H 4NO0B 4X5WB 5HGHA 3D34A 3DK2A 2E56A 5BO0D 3EOYG 3SYOA 1NUNB 1PG7W 3OAYK 4GPVA 1HHKA 1UZ8A 3FN9A 3KPLB 1QLRA 4IRSC 4MMXB 1RIHH 2FB4H 2VMJA 3LNGA 4WSGA 4XHQA 5MI0B 5E1GA 2BDNL 4YSDA 3QDGB 3WSQH 1IL1B 3T4YB 3DXAD 3VSUA 3P3SA 3OKOB 3DRQA 5CP3A 5EIQA 4NDMB 5GGTH 4PB0H 5I19H 1EBPA 2XQYG 2WO3B 3KJ6H 3W0WB 1WCBB 1N12A 2BVPB 3ALXA 2X4TA 3V52L 4JFQA 4LEXL 5CN2A 3U9PH 2F58L 2XA8H 1CO1A 3BOVA 2VZTA 2F74A 2DIAA 32C2B 3LIZL 4Z7VF 3ZUNC 2VC2L 5IT2H 2GKIA 2H7WA 4M93B 3NFSH 4Y1AE 2BH0A 2D7TH 3L5WB 4AMKH 5BV7H 5E0FA 2ID5A 3IGUA 3UAJA 2F7RA 3T6QC 3PHQB 3S36L 2VDLB 2YMXH 1QEWA 1SYVA 2JV6A 1Y18B 3HEIB 4LKXB 1OK0A 4G6JL 1VGKB 2BSDA 1YUHA 3AQXA 4LNRB 3UTZB 2UXGA 4G7RB 1DR9A 2GCYB 3CZNA 4Q6IC 4TQHA 5HHOB 2OJEA 5GS0D 2H0JA 4FA7B 3WAJA 4L4TA 3EO9H 2VC2B 2YFOA 5DD6A 3ZYJA 3DTDA 1A22B 2NNAB 4P5MA 1JGLH 3W9EB 2VLMD 3CIAA 1WFOA 3L45A 3ZKMC 4OFQA 2WCSA 1JERA 3O3DB 2XPGA 5F3HB 4KTYA 4YK4C 1HHGB 2Q86A 3DMMB 1ORQB 3L4XA 4U1IA 4YL9A 1IC0A 1HQRA 2ZIDA 4ABUA 3TVMA 3ZY7A 4K9EL 4B95C 2BHFA 1M05A 4KH9A 5F9WB 1SN2A 4XNDA 5I1IH 3S97C 3CSYB 4ZXBC 4OQTA 1WPCA 1EEZA 4HX1B 5HPMA 4RIRA 3QDGE 2JCCA 2A9MH 5C0FA 3EBIA 1Q1JH 3QPXH 1SVCP 3VFNA 2Z65C 4BGLA 5BRPA 2GW5A 4NUGH 3TESA 5JPMC 3RWIB 1J0ZA 3T71A 3WEBA 3FQRB 4L4VB 5CCHE 2FEDD 1N9PA 2FEEI 5C0JA 1UWGL 1WICA 3IGAB 4YXKH 2MFNA 4G42B 4JEGB 1EEUA 1RUKL 5L7XL 1B6DA 1JBJA 4PRIA 2N0MA 3V9EA 5AVVB 1T3FB 5C0RL 1RZJC 1KB9K 4BKTC 1NKRA 1NLBL 5FA4B 4XPHH 4D94A 1TQCC 3O2WH 2V8MA 3FT4A 2WC7A 1O9VA 2HLFC 4ZS7H 3QO1B 4ADIA 2OX5B 2F68X 2GY5A 4ZTPH 3B34A 4MA1B 3GI8H 4P5TA 5HYSG 2NZ9C 2BP3A 3GSRB 1PAMA 2AK4E 3TGXA 3ALPA 5CIPA 1XBDA 3S5LB 1A3QA 4MA3A 3BGFC 4S1DD 1O9ZA 2NSXA 1OGSA 1YY9C 4K5MA 3RJQB 4LRNL 1EDQA 1T0OA 3TASA 3P3TA 2WXPA 5ELIA 1ZE3C 4KGJA 4Y19E 1A2YA 1BYOA 3KLAA 4H1LH 3J2PA 4W4NA 3WDJA 4JJHA 3F6LA 1R33A 4PCSA 4D0DB 2ED9A 3VXRD 4TPRH 5CFAA 4JFXA 1LTXA 2ENSA 3P02A 4MJ2A 3OMIB 3EH4B 4F7EB 5C92A 4L9LB 3E6HA 5DVNA 1AHWA 3ZHLA 4F9LA 3CPLB 3M1CA 3UTPD 4BEIA 5IHWA 1IEBA 5KBPA 3F05A 4NNPL 4Q8BA 5AW2B 4ZX4A 4ZO7A 3DO3A 4OGAD 2IWGA 4YSTA 4K7FB 5I75B 3UAEA 1NL0H 3O45A 3GSVA 4Y1SA 1NC2B 5ICUA 3SGEI 3MREA 4C83B 3VRIA 4FP8L 4ELMB 2VDKH 3UJTL 5E6ZA 2HA1A 3ZDZF 1OZTG 2XG4B 5BVJA 3DX9B 5D70L 1GA2A 3B5TA 3MRRA 1ZA3B 4NPYA 5E8NB 1KTLB 1XGZA 1OANA 1SXAA 4U4IA 4N2FA 4OGYH 1XGQB 4KMTH 2JIXD 3RYMA 1P7KB 2H32B 5HJBA 1HKFA 2GTWB 3C8HA 4UIMB 5HVGB 4RRPA 5HHNA 1FO0L 4LESA 4L0PB 3FCTA 4HLJA 2GJRA 3DX4A 1DFBL 4I85A 4TLSA 3QIWA 3NTCL 1EDHA 3VMOA 2VDNH 4AV5A 1JV2A 5D1XE 2OL3B 4KMTL 2KZ1B 4F3FA 2CALA 4ZPVA 2X88A 1PTZA 2B0SH 5KANG 1PZCA 4F15B 3QR1A 3GJEA 4WCYH 2IEPA 3DYOA 4NBZB 3MRNB 4QOKE 2E7DA 2HCZX 2R2HB 3OTTA 2XN1A 4W4OC 4AQ1B 4F7CB 4FP8H 2VDLL 2ZP0T 1QNZH 2X10A 3LKRA 1X9RA 3ETSA 4E5XG 1OAKL 1T04B 2HT4D 2XUWA 3MJ7A 1N5AA 4H8HA 3FOLB 4NGHL 2EILB 2FT8A 3RL1A 3DOIA 1M3JA 1T5KA 2Z92B 1TO5A 1TTBA 4ODVL 3GC3A 4JG9A 3FUFA 1ZLVK 3LEYH 1J9CT 4RFOH 5I5RA 5EBGA 4YEFA 2Y1YA 1PLAA 3WFBH 2CMRH 4U6YA 3NIFE 1XCQB 3BZEB 3TYGL 1HSBB 2J72A 1O7DE 2KS0A 2ZNWA 2ZOLA 3PDOB 5SX5K 4DPBX 1T22A 3HC0B<