2HRGA

Crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
496
structure length
496
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the blue multicopper oxidase from the white-rot fungus Trametes trogii complexed with p-toluate
doi rcsb
molecule tags Oxidoreductase
molecule keywords Laccase
total genus 143
structure length 496
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA03
4G72B 3OMNB 3WKPA 4AKPA 4KO7A 2BO0A 2XWZA 3GDCA 1AS8A 1AOZA 3ABLB 3X1FA 3JT2A 1TU2A 1E5ZA 4CSPA 1MG2C 2DV6A 3NJFA 2CCWA 4DP0X 1IBZA 1PZBA 2MRYA 4KOCA 3NJNA 2UXVA 4Q8BA 1AAJA 1V10A 1ET5A 1MG3C 1OF0A 4JKNA 1SF5A 2VW4A 1AS7A 4DP6X 1ILUA 1CURA 1JOIA 1BQKA 3UADA 3ZDWA 1WS8A 1BQRA 3UGEA 2CBPA 1KDJA 1BYPA 3FPXA 4E9YA 1XMEB 3T71A 1I53A 3NJMA 1W8EA 2GIMA 2A3TA 5I6KA 5TK4A 4KO6A 1NIAA 4DPCX 4YSRA 2GHZA 3CZUB 4YSOA 3WIAA 2PCFA 4M3HA 1MZYA 4YSDA 4N4YB 2MTAA 1ZDQA 1KV7A 3ABGA 3T6XA 4QKTA 5D4IA 3CVDA 3L45A 2YQBA 1JXFA 2H5UA 1BXUA 2OJ1A 2UXFA 1T5KA 1PAZA 4DP7X 4E9VA 5B1JC 3QJSB 3WNIA 2IWFA 4HCIA 4Q89A 1PLBA 4WTQA 1KYAA 5ANHA 5I5JA 5EHFA 3EH5B 1ADWA 2FNWA 4BK5C 2IWKA 1KBVA 1WA2X 2FJSA 2XX0A 3FQ2A 3UAEA 1NPJA 4HIPA 3UAAA 1J9TA 5B7MA 2FT8A 7PCYA 3PLYA 1BYOA 4BWWA 1ILSA 3WG7B 3WNJA 1AZUA 2XUWA 1F56A 1CC3A 1JZIA 1NPNA 3EF4A 1OE2A 1AIZA 4BWTA 2P80A 1OOWA 4M4RB 3ZBMA 5B1AB 1RZPA 3X2QB 1CUOA 3FSZA 3OMAB 3NJIA 2DWTA 4HAKA 4UAHA 3PAUA 3QJUB 3ERXA 5I6NA 1A4BA 2XV2A 2VW6A 3N55A 1AZRA 4DP9X 3X1BA 2EIKB 1SDDA 4HALA 3X1NA 2YAEA 3AG3B 4ZK8A 4YSPA 1PCSA 3PCYA 1CYXA 2PCYA 2BP8B 9PCYA 2H47C 1A65A 1J9SA 3NSDA 3T6WA 1N70A 2BP8A 2IWEA 1B3IA 3QQXA 4G7SB 3T6VA 4AI7A 1CYWA 2W88A 5B1KA 4DPBX 3SBQA 1AZNA 5I5MA 4A68A 2N0MA 3FU7A 2P80D 1HFUA 3ABMB 1GW0A 2YXWA 4E9WA 3HEIB 1OCCB 1PMYA 2EILB 3WI9A 5I5IA 1HAUA 1TKWA 2IDUA 3CVCA 4YSUA 2GSMB 4GP5B 3JTBA 2FQFA 2XYBA 5B1BB 4DP8X 2CUAA 1OV8A 4DP5X 2QDWA 4X4KA 4W9ZA 4UF7C 2QPDB 3D12B 1SHWA 3FSVA 2NRDA 4HHWA 4YL4A 8PAZA 1SFDA 1IKOP 1YLBB 3TBBA 4AZUA 1SDDB 3ASOB 4YSAA 1BQ5A 3OM3B 1VLXA 1N68A 2YAOA 1PNCA 2YAPA 2PP8A 2B08A 5A7EA 2Y1AA 3PAVA 1PY0A 2H3XC 4E9XA 2VW7A 1AZCA 3V9CA 1IC0A 2PPEA 5I6MA 1J9QA 2GI0A 2J56A 2E86A 4NAJA 4WKXA 5B1JA 1J5DA 1JERA 3QJVB 1FWXA 2UXGA 4PCYA 2I7OA 1AS6A 2IDSA 1GY2A 1KGYE 3PAZA 2XXGA 5I26A 4YSSA 3C75A 2AANA 4A2FA 3NJLA 5IY5B 1BXVA 1GS8A 1W6LA 1E65A 4HHGA 5F7AA 5PCYA 1J5CA 4KOBA 2HX9A 4MFHA 1JVLA 4K9JA 3H4FA 1M9WA 2IH9A 2JFCA 3NJGA 5FC9A 1PZCA 1NZRA 1JVOA 1XB3A 1KBWA 1X9UA 4YSQA 2AZAA 1ET8A 1A3ZA 2CALA 7PAZA 2XV0A 3NJKA 3T6ZA 2IDQA 2XV3A 3OD3A 3H56A 2FWLB 5PAZA 2JKWA 1DZ0A 1ZPUA 4BWUA 2EIJB 1OE3A 4F2FA 3CDZA 4KNTA 3OQRA 2YXVA 2XLLA 1AG6A 1ZIBA 1A4AA 2BW4A 1URIA 3TU6A 4E9SA 3FU7B 1ASPA 4GP4B 4KO5A 1W6WA 1QNIA 2BZCA 3TBCA 4A2HA 1WA1X 1AACA 3AY2A 5F7BA 4AX3A 2DY2A 2OCCB 1WAEA 3NJJA 1SHXA 1TEFA 3U25A 3CDZB 1JZFA 2BWDA 2PPDA 3EH3B 2AZUA 2IDFA 1SF3A 4UANA 4JHVA 1GR7A 5AFAA 2GC7C 3FQ1A 3NT0A 4EF3A 1JZGA 2PPCA 3IEAA 5I6OA 2BZ7A 2IAAC 3ABKB 1IUZA 1V55B 3X1EA 2PP9A 3AW5A 3EH4B 2FQGA 4A2EA 4DPAX 1AANA 1A8ZA 4YVUA 1V54B 5E9NA 2VN3A 4GXFA 2QDVA 3KW7A 1JZJA 1BEXA 2WO2B 5D4HA 3SBRA 3IE9A 1M56B 2UXTA 4HZ1A 2BWIA 2BW5A 2Q5BA 1EHKB 4NB7A 1PF3A 3GXUB 4YSCA 3CVBA 2CAKA 1ID2A 3UABA 2IH8A 4DP2X 3CG8A 5B3SB 1JXGA 4E9RA 2DWSA 3QPKA 1DYZA 3ZIYA 1L9OA 2AVFA 3FSWA 2B3IA 4F2EA 3IN0A 1ZIAA 2WO3B 4HCFA 1MZZA 1NIFA 5B7EA 3SBPA 1E67A 5B7FA 2VM3A 1J9RA 4A2GA 1PLAA 1EZLA 1NWPA 3S3BB 3FYEB 2ZOOA 4KNSA 1TEGA 2I85A 1GYCA 2PP7A 1ASOA 4A67A 2J57A 3KW8A 3NJHA 4GY4A 1XB6A 1E30A 4KNUA 1RKRA 1NIDA 3RYMA 1L9SA 1NIBA 3ASNB 2VSKB 1SJMA 2ZONA 1FA4A 2HRHA 3NSYA 3QJQB 4CSZA 1UATA 3FU9A 2RACA 2QPEB 1NICA 3MBWB 1WS7A 4GYBA 1BXAA 3X1GA 1OCRB 3IN2A 3BQVA 1A4CA 1JXDA 1KCBA 4ENZA 3NSCA 1ZDSA 3H4HA 3UACA 4YSTA 2XVBA 1BAWA 1ZV2A 2EIMB 2YAHA 2HZHA 2Q9OA 2HXAA 2VM4A 1AG0A 2CJ3A 2FT7A 2R7EA 2FQEA 4G70B 4BXVA 1FFTB 1GS6X 6PAZA 2DYRB 2FTAA 2YAFA 4GP8B 5D4JA 1XB8A 3MX0B 5AKRA 3ZX1A 4A2DA 2AFNA 2YAQA 1KCWA 4HCGA 3TA4D 2XU9A 1RZQA 2BHFA 1NWOA 2BP0B 2VMJA 3AZUA 4BDVA 1PZAA 2OV0A 1HAWA 1L9TA 3BVDB 3HB3B 3S8FB 3PXLA 2HX7A 3S3CB 4E9QA 4BXSV 1ASQA 2HX8A 2JXMA 5AZUA 4YSEA 1WA0X 3FT0A 1OCOB 1X9RA 3WKQA 1AZBA 2J55A 3PPSA 4AKQA 2FT6A 3FYIB 2YAMA 3G5WA 1QLEB 3TASA 1JZEA 2UX6A 3NP4A 1R1CA 1JZHA 2GC4C 3N2JA 2PLTA 2I7SA 4TXVB 2XXFA 4W1TA 2X88A 1PLCA 2ZXWB 2UX7A 3OMIB 4F7KA 2W8CA 3GYRA 3FS9A 1ET7A 3IBOA 6PCYA 1NIEA 1NTDA 4G7RB 4FA7B 2XX1A 2R7EB 3S8GB 4A66A 3SQRA 2GB2A 5LDUA 1AQ8A 2LLNA 2HLEB 1MDAA 1GY1A 4RH4A 4BDVB 4PAZA 1L9RA 3AG2B 3V9EA 4DP4X 4QLWA 4L0PB 3QJRB 3QJTB 1L9QA 2GBAA 1SNRA 3AG4B 1KDIA 2WSDA 1IBYA 4AKOA 4P5RA 1RCYA 4E9TA 2DYSB 3NSFA 3FPYA 1NDTA 1AR1B 2FQDA 3FSAA 4P5SA 2J5WA 3FU8A 2X87A 4DP1X 1GSKA 2TSAA 4JHUA 5TK2A 5I6LA 5I28A 3DIVA 2HRGA 5I6PA 1M57B 1OE1A 1SFHA 3DKHA 3AG1B 1ETJA 2Y69B 1QHQA 4G7QB 4N8UA 2EINB 2ZWNA 4YVNA 2TSBA 4NERA 1GS7A 4G71B 2VSMB 2IDTA 3T9WA 2PPFA 2YARA 3EHBB 1OCZB 1PNDA 3DTUB 1E5YA 2QT6A 4KO9A 4FAAB 1L9PA 2BP0A 3FQYA 2PPAA 3NP3A 1NINA 3S3DB 3NYKA
chains in the Genus database with same CATH superfamily
4QNPF 2EC9T 3RBGA 2A4CA 4G8FA 3TPUA 3U0WL 4HJ0D 1E40A 4N90D 1A7PH 5FM8A 1AS8A 2E74C 3QH3A 2YRZA 4PBDA 3VJ6A 4ORZC 3SYQA 3EYFB 1BBJB 2ZP8A 2DV6A 2DEXX 4FXGA 2ZSWB 1CICA 3DA0A 4ETQB 4HEPA 3HI1B 5TDNA 2P44B 4FTVD 2P52A 3MOQA 4KJWD 1C16B 3TZVD 4GW1B 4G8GE 4A7QA 1DFBL 2LAGB 4MZ3A 3WN5B 4KTEL 1RUMH 1X5ZA 3ILPA 4Z7UA 5BCAA 5BVJA 4JFSA 3QFJD 1DVUA 1RK0A 2CHXA 4U3SB 1OT2A 1KPRA 5IB5A 3NIGE 2CBPA 1YC8A 4HC1H 2X5PA 4QRRB 4LXFA 3PIQA 3D4CA 1XMWA 1MCWW 1AFVL 1CDIA 1OL0A 4R3SA 3RA7H 4ZODA 2XKSA 2HKHH 3TEZA 1D5ZB 5IMMA 5J5EA 2N59A 2EC9U 1A5FL 3EDFA 4Z7OB 3HS0B 2AQ1A 1RULL 2H5UA 4A1RA 4LHQB 2XWXA 5EBLB 1U36A 2YD1A 1X5GA 2CHDA 1DLFL 3COOA 5B3NA 1Q9KA 3P40A 3CK0H 2XFXB 3V6OC 2EIZA 5L4JA 3QI9D 1FZKA 2FNWA 3SDCA 4XB8A 2CIIB 5T5NF 1ZLWK 4AYGA 1JGVL 2B59B 1L6XA 2I27N 2X1XR 1KCRH 5ANME 1EMTL 3CXDH 4G9DA 3T8XA 1R47A 5L2KA 3UAAA 1KTDB 4MKMA 2WLMA 4NYLA 4E41E 3PLYA 4BWWA 5EV7A 2APXA 5EPMB 3GF8A 5E00A 2J73A 3GTNA 1FFPB 2B16A 5JTWA 1DFBH 1K8IB 4OU3A 1NAKL 1OOWA 4M4RB 1UC6A 3B6SA 4KRPB 3VXMB 2QLYA 4DGUA 2ATPB 2VLRE 4K4KA 3LKOB 2R39A 2Z3FA 3OMAB 4KV5F 1RPKA 4PJ7E 1R3KB 3FCSA 3EGXA 1ZEAH 5DSCB 5LNGA 2Q3XA 1F4AA 4HP5A 1B9KA 4YQXL 1TQUA 1F2XK 3LJ3A 4WZ9A 1Z2KA 2EDLA 2P8MA 4KROC 1GJUA 2F53D 2M8XA 2R1YB 3Q8AA 2VR3A 1UWEL 3X11A 1GGIH 3E8UL 3HB3C 3O6MH 3DO7A 5BV7L 4XVOA 5HYJD 3D25B 3I02B 3NFSL 5IVXF 2P45B 2VABA 4FHKA 1UADC 3OKOA 5F1OB 4UOW0 4EBQH 3T6WA 1TO4A 1PFOA 3QA3B 2BP8A 5HDWA 3V0DA 2BVUA 3F6LA 5FA3B 5C8JA 4MB3A 5ADPL 2QQQA 1MJUH 1A3LL 3L9BA 3PREA 3W0WE 2IANA 2W88A 5B1KA 5K59E 3GHBL 5T5NG 1AJ7H 4XMKL 4NO0A 1P6AB 1Q0YH 1AQDB 3GTTA 3OAUH 2Q8BL 1PMYA 5I5IA 3EGDB 2V4LA 2W91A 1TYEB 3LEYH 4TQEH 3IF1A 1WT5C 3GKWL 2ESVD 1RUKH 2C4FU 1PJWA 3U0TB 2QDWA 3MV9A 3MRNB 4HETA 4B9JA 1SRDA 3CHPA 5LUMA 1DUZB 5IK3A 5EZLB 4KKCD 2V7NA 5TTRA 3UG4A 5KG9B 1VGKA 3LQMA 1UOLA 3B9EA 1UFGA 1FSKC 2VXUH 4FMKA 1D7BA 2B39A 1VENA 1BV8A 1OT1A 3D4ZA 2H2PD 1CDHA 4RIRA 4DK3A 1IC0A 3CDCA 4NAJA 1AKPA 2J56A 3BDYL 4ZUUB 3PQYA 5C0JA 4GLRI 2JKRM 2OXGB 4KFMA 4NRXA 4QHMB 3PFUA 4FYRA 4PCYA 4ATTA 5IY5B 2XXGA 3LZOA 5DS2A 3VB9A 4A2FA 1QFUL 5LAXB 2DQGL 1CB4A 1Z7JA 1Q0YL 4HWBL 1VKXB 1W8NA 1R3IL 1HSBA 1AQKH 3NJGA 1X7QA 3WUWA 1DUYA 4AYMC 3GHBH 1YDPB 2QVIA 1A3ZA 3V7AG 5E5UB 5AW9B 2BWQA 4N68A 1IQDB 1U8QB 2DS4A 3A6CL 1XZWA 4M43H 1UOWA 3OAZH 2FEEL 2JKWA 3WV0A 1A5FH 1IFRA 2ZAIA 4PLOB 1EAQA 1C12A 1OE3A 3DX0A 4F2FA 3SKOB 4KNTA 4GIPD 4QY8B 5J11C 1UVQB 4ZUTB 4Q56A 2NPLX 4KTDL 3RL2B 1P4LB 1BVNP 2B1AL 3SDAA 2P7TA 2CK0L 4FN0A 1E2WA 1G0XA 1PZ5B 5H35A 1BHGA 1U3HD 5BJTA 2KYIA 3B2UC 4JM2D 4MJ2A 1F4WL 3MLUH 5E9DB 1QI3A 1XH3A 2R29A 4PGJA 4DGVH 1JXKA 4OCRL 3GK8L 4R5TA 3MHZA 4NKIL 3L3DB 4F3FA 1N67A 3TL5A 5I23A 2W5PA 1DQVA 1JWSA 4MNHA 3RX8A 1DQMH 1OAYH 3DUUA 4ODXB 2DMBA 5KSVB 1QYGL 4MMXB 2FRGP 1NCNA 2VH5L 4KKBC 5AB0A 2WXKA 3IDYB 3O2VL 3A6OA 5F0PB 3PHQA 2GK0A 2DMGA 5AFAA 3VFWB 3WJLA 2OL3L 4KAQL 3MV01 2EDYA 4DZ8B 2C9QA 2V2TB 2PPCA 4YHZH 4PUBL 5DMKB 2X42A 4AL8C 2Z1KA 4XOBA 4ELME 5IESL 1AO7D 2P5ED 3GGWB 4X50A 4GXFA 3O6FB 4UU9A 1JHTA 3GMRA 5F7UA 3MN8A 5DJCA 3GSOA 3CVIH 1F6AB 5TE7H 1ML0A 3AROA 2XKNB 2XNAB 1I75A 3TIEA 4KKZA 4JQVA 3O2WH 5DQ9A 5EEUA 3CGTA 5C0JB 3FQRA 2YUXA 3HC4L 2HJKB 2JJUA 3TA3A 1CVSC 1U8CB 1DLFH 4E9LA 1A2YB 1XFPA 2P8MB 3MREB 4WWID 1OQXA 1Z9NA 5CJQH 5C09D 4YAQB 3L9EA 1AFVH 1S2EA 1R17A 2FB4H 4AUUA 2HFFA 3J07A 2GJZB 1NIFA 1DSFH 2XXMB 4U1SA 5DRNB 5GS1C 2EUXA 3DK0A 2VQ1A 1YEIL 2HLFD 1FFOA 1J48A 2YUZA 5CGTA 5CGYD 3QG6B 3HTLX 5CEXB 2ZYIA 5IQ9B 5M95B 3HKFA 4FKKA 5JZ7D 4FXLA 3K2MC 4FQCH 4OFVA 3IFPA 2I85A 2O30A 2F58H 4XP9H 4QY8A 1C5DB 1Z5LA 1RKRA 3LDBB 4GAYA 5CILH 1IB5A 1NIDA 1DEEB 4NQUA 1KGUA 1MCKA 3GSQB 1RP9A 3EKCA 5F9JA 3PDGA 1OTUD 2CO6B 2IPUG 3ECBA 4XVTH 4X4YB 5JUEL 1V05A 3TZVC 3UJIH 3UMNA 3TEWA 5I66B 1XIWD 1A6PA 4OV6F 3EYSL 3T1FB 3ZZQA 2VDPH 4N0YH 3ROLB 2NXZB 5HY9A 2NZIA 4UQEA 1MWOA 4OV5A 5D7IE 4CRPA 2NY4B 4LPWA 2LU5A 4IRJB 2YAHA 1J88A 4IHBA 1ZLSL 2O6CA 4WUUA 1AXTH 3FN3A 5JOPE 4ANKA 4M5ZH 2XKUA 3KHOA 3BPNB 3F2LA 4EKJA 4MJ6A 2J6WA 5L7XH 5DJXA 4W6WB 3HRZC 1WBYB 2HPTA 2JIXB 4WK0B 1S9YA 1QPKA 5JXEC 4LPYA 4LOEA 4PP1D 5BRZE 1QSFB 2FX8L 1HN1A 2DLGA 1OAZH 4MS8D 3KPSB 2EAEA 1FBIH 1NWOA 3NBNA 1GGCH 5DJYA 3DX6B 5IROC 1B88A 2YD6A 3GZOA 5SV3A 3ELQA 3J8F7 4NCC2 1HWWA 4YN3A 4TULL 4ONGL 3EXLA 5EU5B 1L7TL 3PL6C 1E7VA 2WLIB 3IXAB 4YDVA 4L4TD 3ULVE 2BVEA 2GSGA 3KPMB 2ALAA 1RJLB 1DJHA 4UYQA 3MV7D 5LN4A 3T0EB 3WKQA 2FT6A 3VFMA 4P3WA 1R0AH 2WHVA 4XXCC 2MKLC 4OZIF 4RAUA 1ZS8B 3NFNB 4P2QD 1NC2A 1YRKA 4ZUWA 4H1LB 3INUL 1MCRA 2ZXWB 2UX7A 3QI9B 2O93L 1KTJA 4G6JL 4NRZB 3RY6A 3FS9A 3KJ6H 1KEGL 3OG6B 2BY0A 2IQAA 3KPLA 2YC1A 3MNZB 1A6WH 2IADA 5DD3H 5IJKC 4G6KL 1B0GB 2FR4B 1S6NA 4ZW8A 3D25A 4P4KC 1KGCE 4ONGH 2XG5B 4HIEA 2E46A 3KL5A 3PV6A 4YZFF 4XOCA 2BIHA 2DOCA 2WSPA 1S9WB 2Q3ZA 3WFEL 2YGNA 5AG8A 1HEJC 3AG4B 1OAZL 2WSDA 4H8UA 2ZZUT 1IGTB 1BZ8A 4AYID 3H0TA 4JFHE 4QT5A 4TS6A 2Q6WB 3WYRA 2FQDA 5CU9A 2Y1VA 5SV4A 4DP1X 2TSAA 3OR7B 4J3OH 1RUQL 4FQJL 5FX3A 5I6LA 3DBXA 3KWTA 3DKHA 3AB0B 3H3KA 1TZGL 3BPCB 4JN2A 3JWNH 4B3EA 1UKSA 3GDBA 3L3HB 4LLWA 3CSTA 3BE1H 5SWZB 1WAAA 1JGDA 4H8QA 4YBLC 3T0WA 4MMYA 2GY7B 3RLSA 2J5LC 3U4EB 4U1MA 1HHHA 3E6HB 1RZIA 1UUSA 1AO7B 4XXDB 1DZBA 1PDKA 4BV1A 5HYSA 3HB3D 2YPKA 1OK0A 4JREC 5B3JE 3ZYZA 2ENJA 3IVKB 2OTWA 1BFOB 5A2KH 3AUWB 4XVTL 2OYPA 3GZPA 2V2WA 2BNQE 2QQKL 4NPJA 4UOJA 1T0NB 3IDMB 4OCYL 1G5AA 2RGSA 2YPLA 3MRJB 4FQQA 3VRLE 4Y16A 2NR6C 1JWUA 1CICD 1F3DH 2R56H 2EE0A 3O3EB 3DNKA 4Q74A 4UINL 1U58B 1A1OA 2OR9L 5DA4A 1NEUA 5IQ9A 1GZHC 2WUCL 2R83A 4RFOH 3NJNA 4PRNB 3BKYH 4X4XA 4BK5A 3EDKA 2QHLA 1NDGB 1S5HB 2DDQL 3O11B 5A3IC 2CO4A 4UTAA 3RAJL 3OVUB 4P2CG 1MIML 4NNXB 4PJ5E 4HIIB 1ILUA 4RA0C 3CVHA 3MLXH 4NN7B 4LDOB 1PSKH 2CIKB 1AXIB 1WLHA 5ES4B 5D6DC 1MY5A 2IV9A 4L5FH 5C08D 3PNRB 1IQDA 3QI9C 2O72A 2J1KA 4HX1B 3NJMA 5EC1A 4MZ2A 4LARL 3U79A 3MLRH 3QQDA 4R83A 5BPPA 4QRUB 2AK1H 2VXQH 2NY2C 2HJFB 4OBRA 1EIBA 2QTVA 4WSJA 4ZAKD 1PIGA 5CLZA 4QUOA 1RVFH 4OJFL 3UTTA 4AVKA 4ESKA 1T03L 3KPRA 3V8OA 3VQ2C 3WHXB 1KIQA 3DSFH 5D4IA 4UM9A 4N25A 2X38A 4XHJC 2UXFA 4G8FB 3ZL2A 3DOIA 4OD2A 4K9EH 4XN4A 1GGBH 3FTSA 1MCHA 32C2B 1ANUA 4X9HA 5KYYB 4E42A 2VSDA 4G82A 5BQDA 1I7UA 2Y23A 5GHWL 1PEZA 3PJSA 1ZV9A 2XX0A 4YE4H 3WMQA 4HQQL 4N0CD 2VXSH 5DC9B 4KZEL 1WZMA 4GFTB 5D8JL 3TBTB 5BS0B 5KVEE 3LRSB 1AQ8A 2A1WL 2K45A 3OKLA 4NJAL 1DQML 1ILSA 4HPOL 4V33A 4X6DF 4EZMA 4XO8A 1I7RB 1PBYA 2LLLA 2F19L 4XC3H 3VFRB 4RFNC 1YA5A 4R96A 1AKJD 4JDZB 1XH0A 4PTUA 5IQ7H 2P8LA 3WJMB 3UTTE 3BZ4A 3QFJA 3PIQB 4PUBH 2FJFB 2GUOA 5I73B 3VXRE 2FHBA 4E5XG 3VGFA 2ZKMX 3VW3L 2E7CA 3EJPA 2IAMA 3BAXA 1BGXL 3QJUB 2EYSA 1T7VA 1Y18B 2IGFH 2P48B 3HPLA 2AXGA 3QNYA 3V6FA 5IROA 4K3JL 5EO0B 5EU6D 1CL7H 4GJTB 4LSSH 3CFMA 3P2BA 2NZ9C 2H47C 4U6YA 4U6HB 3TFKD 3CFIC 3TV8A 5FYKE 1UWXK 1G84A 1YYML 3L3KA 3RX7A 4LSPH 5LAXA 3MBEA 1LXMA 3PNWA 2NY3C 5F9WC 4GO8A 3EJYD 2KL6A 3QRBA 4PJAF 2AERT 4G7VH 4I0PA 4HUCA 1WH0A 3O2WL 1PLGL 4BFFA 4ISVB 1P2CA 1VADA 3L1OH 3NFSH 2R4RH 3CQFA 5CXPA 2WXFA 2YXWA 1FIEA 2WXRA 4NI3A 1IE4A 4R84A 4YE0A 5F71A 4L3EE 5JNYB 2A0LD 4JL1A 3ZDYE 1KCVH 4UNVA 5L88H 2EXYD 4PGDA 2DQHH 4DTGH 1A3QA 3DVFA 2B77A 3V0WL 5KVDE 2YK1H 4YQXH 4HWBH 4L5FE 4J2XA 4DP5X 4PJIA 1FFNA 4GG6B 4PJDF 4Q9QL 3QQ3B 1JZ6A 5EWIL 2EEAA 5HYEA 1YHPA 1ZXQA 3FBQA 4YL4A 1XF2A 2YEZA 4Y19E 4L0ZA 3QDME 2YEVB 3VG0L 4OIIH 3VSVA 5F9AC 1H8NA 3RWIA 3V10A 3X11B 2MCPL 5A2BA 4WNQB 4PJGF 4QEGA 5GSVA 2YAPA 4GKNB 2EICA 1UJ3C 3FFCD 3TNMB 3L4XA 3MRCA 4E9XA 4O2EA 3BZFB 1M53A 4K3EH 1OAYL 1XIWB 1F1GA 1F4WH 1TIUA 4FCAA 2M83A 4GINA 4KK6D 4MNGA 3T2NL 3NZ8B 2ZWSA 2O6EA 1IJ9A 3B56A 5LO7A 4OQTA 1KGYE 2X4SB 2AAAA 4HCRA 3GSRB 3EIFA 5C0IA 3TYGH 1QO3A 2ICEB 4ANUA 2DMKA 1KYOK 2DI7A 2O61B 4NDMA 4KWUA 4P5TC 4Z7VE 4QAWA 1N9PA 3EGDA 5EUOA 1DE4B 4HUKB 2YMXL 3JWNC 1MVUA 5FYKH 3RDTA 3VFSA 3LSOB 3C60D 3LZFL 4MQTB 1FNEB 5ESAA 4K7PX 3W11C 4D9LH 1AR2A 3FRUA 4XC1H 3LQZA 3AJ7A 2FWLB 2OMVB 5C0CB 3T77A 3QCUH 3CFTA 4LZKA 1LDPH 2EIJB 1HL8A 2F5AL 2DQGH 1BSIA 1CF8H 1RJLA 2XLLA 4J6IA 1AG6A 1QLRA 1MNUH 3CH1B 2BW4A 4Z18A 1URIA 3BQUA 4Y4KB 4JFEA 2BNRE 3VACA 4ZW3A 1KCLA 2DQFA 1PCXA 2ZNXA 3TBCA 4ABVA 1Z9SA 5I71C 2XXCB 4N2FA 5GZOD 3V4PH 4WRLA 5BZZA 5I8OL 4CNIB 4K3DL 2Y5QA 2XVKA 1XO8A 3QJZA 2I9LB 1WAEA 4MA7H 5FGBC 1CDYA 4G8GA 1I82A 2J6EH 2J72A 4JL2A 3GS4A 1RZ8B 5DVNA 4F5CA 4Y4FD 5AVXB 3CZFB 4XMPH 1RK0B 3FXIC 3AMKA 1MPAH 4AENB 5I1IH 1NANI 4NS0A 1NC4D 1A1MB 5M7QA 3WE1A 4JHVA 1HXYB 4F1SA 1WEJH 3L5XL 4PJHF 3AC0A 2Y07L 1N19A 1E5UI 1RHHA 5F9JB 1REIA 1YDPA 2VXQA 3C6LC 3KDPB 1YEKL 5D2NB 2OP4L 3GI8H 1VGEL 4ZD3H 1IC5H 4O2CA 4G7VL 2HJLB 4RGNB 4KZDL 2NZ1A 4XAKD 2A9BA 4NNPL 5CUSL 2G60L 1FYTE 5E8OB 1NC2D 4QO1A 4PJAA 2WO2B 1MNUL 2NTSP 4UIMB 5JQHC 3DBXB 5ACMA 2EYRA 5ACZA 3OAUL 4ZMXA 4BUHA 4LQFL 5FFGA 2XY1A 4GSXA 2CBMA 4M93B 4XMKH 3GXUB 1DQQA 4IOIA 4RGNE 3LKSA 1FNSH 3C2AL 3PABB 4HC1L 5C2BL 4N1EA 5GPRA 4HBQA 3SOBL 3VNYA 1TJXA 3D39D 4PI0A 2G60H 2B3IA 3QPXH 2ZICA 1X5IA 1U0QA 2E5EA 5FM5O 1E6OH 1MZZA 3P0YL 4LPTA 5BQ7B 2L7JA 3MNWB 1BFSA 3KYMB 5CGMA 1EZLA 4FQ2L 4FZEH 5KW9L 1QVOA 3OMZA 5BZWB 3HNVL 5ISZA 2IALB 1PTZA 3RGVA 4DGYH 3UEZA 2IJ0C 2IAMC 4JB9L 2KI6A 3T2NH 1JWUB 4P48A 4XCEB 2J57A 3FN0L 1XB6A 1KLGB 1E30A 1ZS2A 4ICWA 3FQUA 4KVCL 4M3JA 1L0XA 2BMKA 4Y5YB 4AYBA 3MCYA 3IDJB 4X5LA 1NCCH 3VI3B 5C3TA 1JGEA 1GMEA 1PY4A 3AXHA 4ODTL 1W72H 3RZCA 3N91A 3TBWA 4RFEB 1U91B 5KVGL 5HVWA 1IKFH 2VRKA 5AUMA 3P11L 4K0OA 5C0RL 3QB7C 5CEZD 2LAAA 3LEVL 4AYSA 4PJEB 2BM3A 3HW7A 3ATAA 4JM4L 4NLHA 2Z93B 2VB5A 3K8KA 3UACA 2K9FB 4YSTA 3BP5A 2IAMD 1DVYA 4WUUD 4Z95H 5C92A 4RDQG 2AF2A 1ZRUA 5D71H 4XP6L 1NFDE 1RZFH 3V52H 1KT2A 2J4WL 3P4OB 4U6VL 4U1HA 1RHHB 3VFNB 2RTTA 4GW5A 4JFQB 3GRWH 4KC3B 3NOIA 4L2LA 5HVGB 5AKRA 4A2DA 4JHAL 2G3MA 4XWOD 3C87A 2P5WB 4FXGC 1MCOH 4LDCA 2XU9A 3G3LA 2Z8SA 5D1QE 2VLLA 4GI8A 2O26U 1AYOA 4WENB 3ZKSD 2R0WH 4G6FD 1NLDL 4JFVA 4NGHL 3BVDB 3IXTB 3U9WA 2WKOF 1C9SA 3PXLA 4FXTA 1J9CT 2QVMA 1BVKB 3S3CB 1KGIA 4HCRL 1COBA 4NDMB 1TLMA 4MA3A 3PDOA 1NKOA 4KK6C 3AQZA 5SWQB 3NFPA 3QR2A 2PWDA 3EO9H 1IAIL 4OZFG 5HHOB 1YYLL 3TBYB 3VD7A 3BKJH 2BINA 3FU6A 3QC6X 3JVGA 1JZEA 1OSZB 4GOSA 4OQTL 3SYCA 2VXTL 4FNUA 2DWXA 3T77B 1O6VA 5DLMH 2ZOLA 4LCYA 5GGTL 3VXRA 3L16A 2IAMB 4WEMB 4AH2A 4UV4H 1WICA 3HRZA 4N3UA 3QHTC 3N50A 3KGTA 1KLFB 1L4IA 3WNLA 1EZUA 1YPZF 4U4BA 1U9KA 1HOCB 4JZNA 4YXHH 3QO0A 1UUNA 3ZK0A 4V1DA 1A7PL 1U8OA 3OKMB 1MHHB 5E8PB 1ONQA 1ZK9A 2I9LA 3QEUA 4GBXB 4PGCB 3K3QA 3CUPB 4TQHA 4TN9A 1MCPL 1E6JL 1R5VB 3AITA 4MDIB 3RZCB 2KUTA 4BDVB 4DZBA 1OW0C 3NABL 5E2VH 5KS9E 5DRWB 3WEXB 1S9VB 3OR6A 3ZMNA 4QLWA 1S78C 3BUYA 1L7IH 2B4CC 3QJTB 3WTUA 4DSYA 4I2XA 3FTGB 3SCMD 4XGZA 5ESQB 3QBTB 4M93C 4WHTA 5J3HC 1QSFD 1UENA 2YPLD 3CE1A 1PAMA 4JHUA 5K9QI 2AJUH 2ZPKL 1AHWA 3C12A 4LFHD 3VFTB 2NZ9D 1H5BC 1BBJA 3MXVH 2CLZA 3HA0A 5EFIA 4UNUA 2B1HH 3CAFA 4HOZA 3VCLB 1NUGA 3ARBC 2QKSA 1MHCB 3O2DA 3HMWH 3EAKA 2FLMA 1WYJA 4X9IA 4Z3GA 1R4XA 3T1WA 3UBFA 4FMFA 5KVMC 3RNQA 1TENA 1YNKL 2VDRB 5CBEB 1ZK5A 1ZTMA 4CMMA 5LWYL 4NO0D 1RZ7H 1G9NL 4BGDA 4P4KA 4NUMA 5KSAA 1LK3L 4IGBB 1PZDA 2WLYA 3NP3A 3MYZA 3AADB 1J8SA 2C3VB 1MCBA 2JTDA 3NRQA 3IGAB 4X83A 4Z7NF 4Y2DA 1I1CA 4QJ4B 2BOBB 3LN5A 1HDMA 3X1FA 4WV1A 3U2JA 1YNKH 4OZ4B 5HGAB 1T1XA 3IMRA 1E5ZA 5K33A 5B38A 1U3NA 4XBPA 3RGVB 1RIUL 1N2RA 1T3FA 3D39B 1PZBA 3VFUA 4R7LA 1FNAA 3W81A 1A4KA 3KJ4C 4QLRA 2ZOTA 3LIUA 4N2HA 5ICXB 5JW4Q 3L6FA 3APCA 3QG7H 5FXCH 2YD2A 2NY7L 3BOVA 2ZPKH 2Q87A 4HMEA 2M2DA 1WCBB 4LBEB 4AQ8A 1BD2D 2WVVA 1N0LA 1CQKA 1JRHI 2X1QA 4HS6A 5MEQB 2WWMD 2OA9A 1IM9D 2VDNL 2B59A 1S5IH 2X4NB 4Y2OA 5HI5D 4WJKB 5C0BE 1FNEA 3FPXA 3TEXA 2N4IA 3LNDA 3LV3B 4PGCA 3STLB 2C3GA 3G5VB 1RZIB 1IEHA 4KO6A 4Q0XH 1HZLA 3Q5YA 2AXHA 1U92A 3BP6B 5EA0L 4XVSL 5T3XL 3X3GH 3ZMEA 3K6OA 2A5UA 3VU1A 3ABGA 5CNHA 1HWGB 1U93A 5CN1A 1Q72H 2YQBA 3QIWD 1PSKL 4U6HA 1OTSC 2I60H 1S3KL 3S96B 5C0CD 5C0BA 5H37G 5B1JC 3FO2A 3B83A 3UO8B 2X4OA 1CK0H 4XH2B 3ECBB 4Q6IB 1T83A 2D31B 1P1ZA 3NEXA 5ANHA 5C0AA 4XPAH 3ABZA 3BKYL 3ZDXE 2DYPB 3L7FB 3L9RB 1H9DA 1WA2X 4K5PA 5IFAH 4TV3A 5E1AA 3AWEA 2EEBA 2W07B 5DRXB 1NPJA 1HYRC 1W15A 3F5WA 2V3EA 3IMTA 3EOAB 3N1FC 1AGEB 1A6WL 4LK4A 5MEND 4L18A 3IMWA 1UA6L 1I9JH 3H9ZA 4IW4C 4WI7A 4KX8A 4PJBF 4AM0A 4HKZB 4NNYB 4FLQA 3QYNA 4G6ML 1CWVA 5BJTB 2XZCL 3INUH 3SY6A 2XBZA 1A3RL 3SE4A 4EN3A 5B1AB 1UZ8B 3HNTL 3T0EC 3ZKXC 3TXAA 5SWZE 5F21B 1EO5A 4I7ZC 1XBRA 3AS3A 4OZFH 3CCHA 5DQJB 1NQBA 3P4MB 4M1GL 2FJGA 4PBVC 4N0CC 3ARDA 2FYYA 3O6KL 5GJTH 5I75B 1YZZA 3FONA 1F0LA 1QFOA 1W9XA 3KPPA 2B5IB 3U83A 4PV8B 1I3GL 3QUYB 1XIWA 1SDDA 3QEGL 3L9YA 2UZYB 2J8HA 1LILA 1CGTA 1TYJA 5B38G 3WNPA 1P1VA 4PJ8B 2APSA 1PGRB 1XF5A 5HGHA 3MGTA 3C5ZD 2GJ6E 2ZSVA 1MVFA 4TYUA 5JMOC 4YPGB 4L8CA 1LK2B 3LN4A 2NSMA 3JVGC 4F8PA 1QEXA 3MYJA 3AREB 3K91A 1G4MA 3NQKA 4PJFE 1LWHA 4XMLL 5SX5K 4ZFGH 1ZS8A 3DDGA 1D9KC 1E90A 4L0YA 3FU7A 3L4ZA 3E80A 5HGDA 2PYEB 3GSWA 4WHTB 4ZFFA 5D7EA 2CCVA 4KQ4L 3FCBA 4HUUA 1MI5A 6FABH 1MJJB 1NAMA 3K6SA 1Q1JL 3B43A 2DIEA 2IEPA 1W0WA 4B9GA 3FU0A 2XYBA 5B1BB 4G43B 4K94H 5AYUL 3AWGA 4TSCH 5C7ZA 4NBYB 1CPUA 1MFNA 5F9OH 1TZOA 3RI5F 4KKLD 1OB1A 3GFUA 3NCYS 4KXDA 8PAZA 3TBBA 1X7QB 5IB4B 1ORSA 2NW3B 1T6WA 1Z9SB 2NLJB 5D1ZD 4YBQC 3JWOH 4L1SA 4KV5E 3V6FB 4U1LA 4QXWA 1VSCA 1R0AL 2FECL 2I9TB 1QHPA 2YQGA 5K39B 2IPUK 2LOEA 4JM0A 2V2XA 4PN6A 3TC9A 1N5AB 1LNUA 3BRFA 2WVTA 2J8OA 3V9CA 2JWYA 4UTBA 2R2HB 4Y1TA 5E6ZA 5DS8B 3VFNA 4LASH 2XPGA 3LIZH 1D5XB 1H5BA 2XICA 1AP2B 3BDXA 4HGWB 1UCBH 5IVXE 3NJLA 2NUTB 1MLCA 2N0KA 1XF3A 5HY9B 3L3GA 4X6CF 4MDRA 5ADPH 2IH9A 3J27A 3S36H 5I1GH 3CSGA 3L3IA 1PZCA 3MRDB 4LAQH 1Y6NR 5TGBB 4YSQA 2Y5EA 3CHOA 2YOAA 4WUKL 2NY5L 4PV8A 1IM9A 4NN6B 1CL7I 2X9ZA 5D7IB 4A55A 3H9SE 1MQ8A 4D0CA 4GS7B 1XR9B 3QP3A 1SXZA 3ARED 4TOYH 4HWEL 5G4OA 1AI1L 4BSWB 3BP4B 1WSST 4ZOEA 2WQAA 4PBXA 1L6ZA 3ARUA 1BG1A 1J0HA 4MNQD 2QQLH 4YPGA 4PJBA 5AZEH 3UXFA 2F15A 1W16A 3LRGA 5DS1A 2YD9A 2A4ZA 4GKLA 2CWRA 2VISA 5C0EA 1JL8A 5DJ0A 4HLZH 1EJ6A 4AX3A 3UYPB 1ES0A 1U93B 3VU2A 2XQYK 1SHXA 4G7YL 5C0FB 3KYNA 5HD8C 3CPLB 8FABB 1NFKA 3GBNL 4K8RC 3M8OH 3QUXC 3QO0B 2CG9X 3GXNA 3MJWA 4QRPA 1ZSHA 2CIKA 4X8XA 3RILA 1A4JA 1X5HA 2EH7L 1HI6A 3EBAA 3EG9B 4XP9L 1N6UA 3S34H 3TA3B 4A39A 1IM3A 3UYRH 5EC1B 3QDGE 3HBQA 4JPVH 2A7BA 5KJ7E 5MENA 3NT0A 2OTUB 4O5LH 3BVTA 3QCUL 2P5WE 5EUOB 3X1EA 5EEXA 2KQNA 3P0VH 1RP8A 3WFBL 2CM5A 2MQ3A 1AHMA 2C34A 4J2QA 4DPAX 2BC4B 1KIQB 4M48L 3WN5A 2XWJB 2OMWA 3E1F1 4PRPE 4U7KA 3QAQA 4W9JC 3WFDH 5MEPA 5BOPA 3VXUB 1YY9C 1YPZB 2YBRB 3A6CH 3MLWL 2GSIB 4NB7A 1Z9MA 3DLQR 3CFCL 1IL1B 1FL3A 1OXYA 1JPGA 1Q0EA 3DI3B 3FT2B 5FUZH 2CAKA 3QFJE 1N26A 2IH8A 2QELA 1NBZB 4PJXB 4U0QB 3TBSA 3DJZA 1DYZA 1E8YA 3SGJC 2H26A 3FSWA 5IJKA 3MUY1 4R2GC 1SJEA 1OHQA 5HI3C 3S36X 3T2OA 1VCBC 1YMMB 1H8SA 2VM3A 4HWNA 4A2GA 3J7HA 2WYZA 4WK4B 3RWDA 4EXKA 5L6YH 2PWHA 4HG4K 4CC4C 1DQTA 2VERN 2E6JA 4RGOL 1R46A 4KQ0A 2PCPB 5SX4I 5DHVH 3S9DB 1WG3A 4KH9A 4IRJA 4N2OA 3JV4A 4MBRA 3LN5B 5SWZA 4L4TB 2LLGA 1FRGH 1KXQE 3OWRA 1XCTA 4HKXB 4D9RE 3O8XB 1WFJA 4FP8L 1DBBH 1HE7A 4GT7A 4HEPG 3SE9H 4PVMA 1OOAA 2ZXQA 1FSKB 3OLEA 1SJMA 5LGYA 1BQHB 3T8VA 3MBWA 2Y7OA 4CSZA 4WY7L 1OTUC 2XZQL 3CFBA 4ADGA 4HUVB 3BPOB 5L8LB 2UUDK 4NQQA 5EIIA 2VDQH 3D34A 3WIHH 2NY1B 2WVVB 3ECUA 1KMGA 1S7RA 5I74C 3IN2A 3D0VB 4MAYB 4X6CA 2YO3A 2NY5H 3LXAA 2OJZH 4Y2DC 3QGVA 1NCJA 1OKEA 3ZIMA 4KKAD 5KTEH 3BGFC 2EIMB 3TF4A 2YPVL 4N2KA 5F7YC 2FQEA 3L2MA 4M43L 2DQUL 4G70B 5TE6H 2FX9H 4M5TA 1FFTB 1LNUB 2VZTA 4DFHA 1KXTA 4XP1H 3SPVA 3CVHB 1R5WB 2J1ZA 2KERA 1TCMA 4UQ3A 4OLVL 1CZ8H 1WK0A 3QXAB 1VF5C 1QRNB 4GXVL 1VJSA 1HAWA 3DTDA 4PRID 2YEZB 2Y1ZA 4RA3A 4NXSA 3UC0L 4LF3B 2HX7A 4X80H 3PWJB 2VZVA 4XB7A 3ZTEA 5F3BB 2XZQH 3UL4A 3F5WB 1KBPA 4MHHG 4X6DE 1LP9F 5FHAL 2CO2A 5I1CL 2I5YH 3L95A 4AXWB 1WA0X 5AUMB 2QHRL 3GJFH 5HHVH 3W0WD 4QF1B 1QLFB 4LSVH 3C2SA 1XSKA 2YWZA 4GQQA 4UTAH 3H9YA 2G2PA 2X2JA 3GB7B 3NA4A 4GIOA 3CMOL 1ZHLA 5DC2A 3VD4A 4K8RD 2VXVL 1J1XH 2DW5A 2WLHA 2YD7A 4JREB 4XVJH 1USZA 2Z4QB 5K1NA 1G0YR 4R7NA 1IGCH 3IKKA 1D6VL 3I50L 4G8EA 4KGLA 2GTZA 3DURB 2WO4A 4LL4A 1JGVH 5LNDA 3OXSB 3SQRA 5BZXA 5GS1B 3W0WB 1PG7W 4I9WE 1ES0B 3SE8H 4M8VA 3LMJH 5EOTB 3I2CL 2DI9A 3LHPL 1GY1A 3I6SA 3CFCH 4EUPH 1B4RA 1L5GB 2PF6A 3O0LA 3C5ZB 3IRPX 2FSEA 3O41B 5BUAA 3K74B 3LHAA 4AG4H 2IGLA 4HOWA 4X98A 1IBGL 3C9NA 1M42A 3CH1A 4K55A 1JHKL 1T22A 4TNFA 2VERA 3DRQA 1E3ZA 3QUML 1BEYL 4MJ6B 4IRZH 5FUOH 4P5SA 4ZX6A 4QI3A 3POHA 1DVFA 1IBFA 3ZRCC 3SKNA 4BZ1H 5E8EB 4FYSA 3BWUF 3DO4A 1YSOA 4Z7IA 3MRLA 4JO5A 4Y8AA 5IW6A 2Y69B 4NUGH 5CIPH 1A1OB 3MPCA 4GLRH 4LAJH 4PB0L 4R26H 5IM7B 2W0PA 1X7SA 4PJ7B 4QRRD 4J8RB 5EEYA 1RZKH 1Y07A 4JFZH 1QACA 2CUMA 2GTWA 4DT2A 3UC2A 3GS7A 4K7PH 5IKCA 1QG3A 2AEPH 5IR1A 1PKQA 4XRCA 5KOMC 4DKEL 2HFEB 3F01A 3MR9A 2JB5L 3FB5A 2EO9A 2JCCF 4PRHB 3Q2WA 4NHCH 5LBSH 1NINA 1OPGL 3ETSA 1QHOA 4HBCH 1BMZA 3TT1L 5E99L 1F90H 1ACYH 5GRYA 3QDJB 4MJJA 3SJVB 3U2IA 4YBQD 5HPMA 2FATH 4LSRL 3L3DA 1ZT4A 1EEQA 2AXWA 3L95B 1X44A 3MLVL 5CGBA 4UNTA 3ZTNH 1I8UA 4I5BB 3PWVB 1KTLA 3RPKA 5JHDA 3QZWB 1RPQA 4F57L 4ACTA 3TF7C 5C70A 2ITEA 2MRYA 3KPOA 3WFHA 1OF2A 4M1DL 4Q8BA 2JJWA 4BHUI 2QR0B 5AOJA 1LGVA 3T65A 3PJNA 1F4XH 3GIZL 2LTQC 5FKAA 3MRFA 2RB8A 2VW4A 4LCWA 4WFHE 4P46C 1EHLH 2WWKT 2WMPB 4YDIL 3KPSD 5IT2H 4X7TB 3SE3A 3UADA 3ZDWA 1ETZA 4IOFD 3MCKA 3CFBB 4HIEB 2JNZA 4PMFA 1LO5A 5CZXD 5D7IA 3DDFA 5AZ2L 1I53A 1HEZA 2EIZB 3D1MC 3QARA 4RNRB 1V3KA 4EOWH 2ZUTA 1XTMA 2FYVA 1LO2L 1WFMA 1Q94A 4YSRA 5HJ3A 2PCFA 2VRAA 1AR1C 2BPBA 4HF5H 2FH6A 5IW1B 4XCEA 3EXJA 4NXKA 4J1UB 1ZDQA 3BWUC 3DJTA 4YHIB 5DFTA 3ZE2E 4TLSA 4H8WC 4PJBB 1KFGA 2OJ1A 4N28A 1Q1PA 4S1RH 4KHXL 4UZUA 2IBGA 5JPNA 5H37A 2XQYG 1C7TA 2KZ1B 2MPVA 3MNMA 1ZTXL 4AYDC 2OBGA 5IF0B 2VRQA 3MV9D 5KYXB 5E6ID 3MRHA 3D7PA 2J43A 3S88L 1UOKA 2EVHA 4H13C 5KBPA 1EERB 2JJTC 1QABA 5D7KD 4G9FA 1J9TA 4PWFA 3LTVA 5CLXA 5HHMB 1T21B 4EDWH 3MBXH 3QS3A 2W94A 2Z8WC 3WG7B 4LF3A 5JOEA 3MODL 3US1A 4Y1AD 2RFXA 3MNDA 1DUYB 5FM4A 4H88H 1SY6H 1BD2A 1XGZA 5C09B 2DQCH 4S1QL 2EUWA 4Y5VA 2XN9B 2X4PA 4GQRA 1QBMH 1IAMA 3NJIA 4ZI8A 1XCWA 2BNUB 6CGTA 2HSIA 5I1LB 1R33A 2FEEI 5CZVL 1WISA 3CFDB 4Q97A 4JANA 3N55A 1O6SA 1UXSA 3QIBC 5GRXG 4BE6A 1QSVA 4DP9X 4XXWC 3S4SG 1YPZE 1KBBA 1B0RB 3R4RA 4I77H 4UNIA 1CDUA 1OAUH 1PCSA 2QR0A 2ZJSL 3LS5L 3BAWA 1IAKA 4TVPD 4DO5A 3H7LA 4NKQB 2FUTA 4XHQA 1AZZC 3B9KB 3R8BB 3AAZB 3ULUC 1TZHB 4QDGA 2LQRA 4EN3D 1RU9L 1A8JH 3CSPA 1ZLSH 2VT0A 5IZ7A 1B4TA 1MLCB 4OF3A 2UWEE 4ILDA 4GSDL 4XPGH 5CCKH 2CKBA 4L4JA 1VRSA 4G7SB 3T6VA 2L7EA 2JCCA 3C8KA 3DC0A 3IKCA 1HSAA 4NQCD 2OL3A 3N41B 3Q6GL 1FG2A 3EOBA 4ANVA 1RIVL 5FF6A 4DPBX 5DHYB 2DQEL 3UMTA 3REWB 5CEZH 2P80D 1EZSA 4KZ0A 2V2TA 1EJ8A 5AW8B 2WV3A 4XN8A 3CXFA 1OCCB 2ADGB 3QPQD 1CFVL 4MAZA 1UZ6E 1DL7L 5EC2A 3WTSA 3CVCA 3VYNA 1NCTA 2VMCA 3IXAA 4JGUA 4YSUA 4LLQB 4YWGH 1JPST 1JTOA 3P3RA 4DP8X 1QO3B 1B2YA 2ICEA 4PJFA 1BAFH 3K5RA 5D1XB 3S35H 4BQ8A 1SHWA 1J5IA 2P3YA 1IKOP 3DPDA 2H8PB 3D5OF 2W1NA 4WGWB 5GZOA 5L9DL 2GEQA 4ABWA 2ESVA 3LD8B 5IBUG 1ZSDB 2DWEB 2G4GA 3LS4H 1U8CA 1I7ZB 4OGYL 4XN1A 4H20L 3VX0A 2V5TA 3U36B 2VDLB 2Y5TB 2PPEA 4KJYB 4WKXA 2JMRA 3D4YA 1B6DA 3HZ3A 2CBQA 1TG8A 4TVSa 5C97A 5JIPA 1CFNB 3RB7A 4JY6A 2XG5A 3CD4A 2FLRT 5DEGA 3EOYG 5FYJH 5DZVA 4NQCB 5CWSB 1J5OL 4MFHA 4TLUA 2AW2A 4P3CH 1X5LA 3S4SA 5T1DH 1RUAH 1SGKA 1T20A 2CKNA 2OMXA 5IVXB 4GAAA 2EDKA 4OF6A 5AOZA 5J9PB 1XB3A 1MI5B 4RDQF 2J88L 2X1OA 2ZE0A 5D5MF 1P4BL 2CALA 2EEXA 4MQXC 4TRPL 3T6ZA 2VDML 4D0DA 3H54A 4E5XA 3BSGA 2EUVA 1IIKA 3CZSA 4Y5YC 1XV8A 1S8DA 5TH2B 1KCSL 2DQTH 3DUUB 5BRPA 3HG5A 2VLMD 5JHDD 3VMNA 1MFCH 1EXUB 1UWFA 1XVSA 3OKEA 4UOW1 5DCCA 2RCSL 1P2CB 1VADB 2AABL 4HXAH 5DD5L 2CJSA 4Z6AT 4J3SA 4BFBD 4QWWC 4EVNB 3CV5A 3KGSA 3TEUA 4P05A 3O6LH 4M61A 2A83B 2ZX7A 3BPLB 2WBJD 3MGOB 4R4BB 4QHUA 3KXFB 3O3DB 3A23A 3ORJA 2EZ0C 5E8OA 1OO2A 2F8VA 4JFWA 5DGQA 3R0MA 2YGPA 4ECNA 2F08A 4JUSA 1HNYA 3DSNA 4JFFA 4DHLA 2GFBB 2WLLA 3G6AB 4O02B 4ZTPH 3IMUA 3O4LD 2X10A 4ODSH 1E6OL 1NCOA 1FHGA 5GS2D 3GJFA 1UQSA 1JV2A 1YJDL 3PABA 1AH1A 1HX0A 1WC7B 3I9GH 5G2NA 1OPOA 2GC7C 1IUZA 1D9KD 2FCBA 3BW9A 3KEDA 3NESA 1NCIA 3KXFD 4YLBA 2CH8A 4PPTA 4GRLA 1A7QH 1AANA 4HJGA 4JRYE 3ALWA 1H3GA 2ICWB 4JHBA 5L8JB 1DBMH 3H85A 3KW7A 4HD5A 1I8KB 5SX5H 3MRGA 4R7DB 2VQ1B 1KB9K 3STZB 1MRCH 2CUIA 5J7CC 4M6OH 5JXAL 4NYLB 2XWEA 2JSFA 3CVBA 3KL3A 1U4FA 5DR5L 4ONFL 4B5EA 1YN6A 2VQTA 1U8IB 2BIOA 1M1XA 4JFOB 3DX7B 3HC3L 3T0AA 3MNVB 1QOKA 8FABA 4YDKL 5JLZB 3BVXA 2P8PA 1XAKA 4EQ3A 4L3CB 4R97C 1J1PH 1NOLA 5KUMA 3SBPA 5FLUA 4UV7L 4EQ2A 1HEHC 5I15L 2ENPA 3IJSB 1OP5K 4PWKA 1B0GA 2FR4A 1G4RA 3MUGB 4QHLA 3VFVA 1T2QH 3UP1A 3DX3A 3TT1H 1ZT4B 2YN3A 3FZUD 4Q14A 2WN2A 4S11A 2CUHA 3NJHA 5TQ0L 5BUGA 5IEKB 2F53A 3WTVA 1MWAL 4OAWA 3RYMA 4C8XA 1NIBA 2X0VA 5DUMH 3IDNA 2DL2A 4JPWL 1FVDB 2WGXA 1KXVC 3H0TB 4HCRH 4N86A 1KFAH 3KPTA 1GW6A 2AGJH 2DTML 1Z6JT 5HI4C 4Y7OC 2XWBA 1BXAA 3VI4B 5DZOA 2ZSWA 4OLYH 5C0GA 1O7VA 3VMPA 3BQVA 3L13A 4IBUA 3L3OA 4QTHB 5DVKA 4NI6A 5INDA 1ESOA 2XQBH 3HAEA 4K7FA 3MA7B 4LLWB 1IC4H 2GEEA 1YAIA 4W9LC 5TDNB 1ROWA 4AEFA 2A2QT 5D5MA 4YDZA 4PTTA 5AVZB 5IB1B 4NUJA 3H9HB 1ZPLA 4QJ3B 3ECQA 3UTTD 1AGCB 2R7EA 5ELIA 1ZV5A 3UX9B 4Q9BA 1CLVA 4PWJA 4B9CA 3FO0L 3L5HA 4B96A 5DUBA 2WXGA 4WK2B 3VWJA 4WU7A 5I0DA 2IBZX 3BI9X 1UWEH 1CT8A 1VFOA 2E9JA 4XBEH 3O41A 1FAIH 2ZOLB 1YECL 5A6LA 3AMLA 4S1DD 4HCGA 4IK7A 1NCDH 3AABA 3U2SA 3MOAH 4GUOA 4K5NA 5I1EL 1ODUA 4DVRH 3NRPA 4IS6B 4FFZA 3NCFB 3H7BA 1JP5A 3GINA 5F9DC 2FO1A 4AG4L 4YHOL 4ORGA 3S4SB 3IE4A 1NM4A 4G9FB 1T7XA 2OL3H 1HZHH 2E47A 4KAQH 1NAML 1LEKA 1NCWH 1MREH 2IPKB 3FOLA 3ESUF 1HQ4B 3QCVL 2EQDA 4FYTA 1QR1B 2MNUA 2HT3D 1AE6H 3LZRA 3E6FB 5ECGA 4Q9RL 3NP4A 1D5XA 3MUJA 1UH3A 4OCRH 3L2LA 3QXWA 3FB8B 1PJ9A 4PRHA 4L3ED 2NUPB 4TXVB 1A1NB 3BKCH 1EFQA 5CINL 1G7LA 2FGWH 2CRMA 3U7YL 2WW8A 4L37B 2A6KB 4LCUB 1KBKA 3RRQA 2PW2B 1IT9H 1HCYA 4LSVL 1JYWA 1WP6A 5E6IA 2W0KA 1FFOB 4BQCA 2BNRA 4NC1C 1I9RH 3ZHKA 4HKZA 4NNYA 5E1QA 4WW1B 1IAKB 2DLFL 3FO9B 3QDMD 4BH8A 3L5WA 3HZMA 4KZCA 1AY1L 5F96L 1Z1WA 1SY6A 3IFLL 3ARPA 1D5MA 3IBEA 5D70H 3ZTCC 5GZNC 1XSJA 1ZVSB 1S4IA 4FNSA 1XSIA 5DJAB 5A2IH 5CHNA 5F7FA 1WAAE 2B4CH 1SNRA 2BDNL 4IOSD 5DQJA 3W11D 5IP4A 5J3HD 1PX3A 2NT0A 4JPSA 3DMMD 4TSBL 3SDXB 4TSAH 1FP5A 3Q2NA 3TJHC 2J21A 5IBTL 3Q5TA 3MJ7B 4JFQA 1LO4L 4OZHA 3JWDC 3RWCB 4M7ZC 1FAKT 4QOKE 4PS7A 5IVZA 1NCHA 4OCNC 1U6AL 3VWJD 4B95C 4JN1H 5I1AB 4U2ZA 5I28A 3GXDA 4F8OA 2GUYA 1OE1A 1SFHA 1E8ZA 3B37A 3HG2A 1ETJA 4WCYL 3VFSB 5EU3B 2FK9A 1DQLH 2ZWNA 3B4NA 3IMBA 5HBBA 3TYFB 2KS0A 3ULSA 3IAGC 2YPLB 4HHAA 3ZUNC 2CRYA 3B7RL 3D2UD 1E9OA 2JKNA 5E5LA 3MRRA 5B39A 1QD0A 3EFDL 3CWGA 2ICWJ 3NZHH 4JPIB 3QDGA 3P1VA 3VXSA 4ZW5A 4M1CD 5DJXB 1XGYH 4OFYD 3HPLB 4GRLD 3F84A 4GRLC 5GRVL 2XNAA 1HXMA 4BINA 1I7TB 4LLMA 3RUGF 3PHOA 5GRWA 3RWHB 1NGQL 1L3NA 3M6DA 3JT2A 3CVHH 2EIBA 4QHLB 2H2SD 4OD1H 3MRKA 4UQ9A 3RKDD 1KPVB 2R2BB 2RALA 4JO4L 1TVBA 5GIRB 4OFIA 3S3PA 2DN7A 4DESA 1P84J 1T2JA 2W95A 5K9JH 3HS9A 1W72B 3HI5L 2GITB 3CIAA 2GT9B 15C8H 3W56A 3NCCB 3UPAA 4GG8B 1E8WA 3TEYA 1L3WA 3GKZA 3SKJH 5KZCB 2W60B 3MOAL 1AYRA 3IFPB 2Z35A 3D18A 4FXKC 3WLBA 3CHQA 4W9KC 4BH8B 1MCQA 3DMMB 4DN4H 5DYOB 5TK4A 1KJ3L 3WIAA 5T5FH 4M6NL 5CJOH 3NTCL 5BV7H 4WI6A 2ICES 4G8IA 5C8JB 3SDYL 2Z1PA 4DN3L 1K9TA 2IQAB 3KPLB 4O58H 2CLRB 1Q38A 3WDHA 2KLSA 3FTXA 3CVDA 2LU3A 2QJDA 4M5SA 4ZMLA 3VXME 3UOAB 2FWOA 4I4WA 2VN6A 2YRPA 4I13B 1EPFA 5HHPA 4L8DB 3QJSB 4KVNH 1P7QB 4LE8A 2Y2TA 4S0SD 4Q89A 4YHPA 3E8VA 3SGKC 4DETA 1FN4B 2FBRA 5K1VA 3W9EB 3FONB 5CBEA 4JFUA 2WKGA 5FO9A 1EAPB 1LWRA 1A02N 3UAEA 4PJGB 2QPUA 3FCGA 4PLKC 1KEML 3SD5A 3BUQA 4HIQA 3BEVB 3B5GA 3ZU8A 3KLAB 4X7FC 4CUCA 4FE9A 3VDAA 3VQMA 2AJZA 2ID5A 1NPUA 1JZIA 3VG9B 2VISB 3BPNC 4X5QA 2AI0L 1S3RA 2BY2A 3BT2H 4WV1B 3MRBB 3FU5A 5ID0B 2Z7UA 2WINB 5AOLA 4L2YA 1X7TA 3DXAB 3CZGA 4OLWL 2UY7B 5HVHC 1A4JB 2G4EA 2BHZA 3HC0A 3LEXA 1ZHBA 2E7MA 1OP9A 3X1BA 1IX2A 5JDJA 5TQ2H 4PRAA 3SCMB 3DVNB 3FQNB 4H8HA 4NX0A 3K71B 5BXFA 3VXNA 1MFDH 4ZO9A 1MFBH 1D6EA 5EN2B 4WJ5B 5KBKA 3GM8A 1FFRA 2W92A 5TDPA 3O3EA 1UD5A 4G8GB 5IB4A 3SJVD 4NQCA 5KVFL 4KK9D 2HN7B 1B3IA 4LMQE 3BP6A 3GMPB 1UB5B 2EKSB 3WO4B 3RX9A 3C6SA 4PP2B 1HINH 3AU1A 5I5MA 1DBML 1FJ1B 1E9QB 3EZJB 1DSWA 2Q86B 1UVQA 2CXGA 3HPJB 3HMXH 3BUIA 4Z7WE 3SDXA 5A3ID 5IVNA 4V1DE 2WZ0A 4R7VA 2YUWA 3X13B 1TETL 1G5GA 4Y5VB 4OQ1A 3UPRB 5FKPA 4Y4FC 1VFMA 3LQAC 3JTBA 4GMSL 4Z7UB 5BVJB 3PV6B 5H8DA 3UBXB 2QVKA 2Z8VC 5B8CB 1U42A 2FX7L 4UYPA 5EOTA 5GXBB 4FXKB 1MFAL 4OGQC 3T2PA 1JWMA 3PF2A 4DWHA 2VM9A 1PEWA 2VJ8A 1QFPA 3LRKA 4MAUH 5MERA 3P73A 4OF8A 3F7QA 3V6ZB 3GBMH 3KHQA 2BNQA 1EAPA 4UZGA 4U1JB 2OMBA 4OLZH 5CKAA 4Q6IC 5HDBE 3FO1A 1IGML 1T89C 3NACH 3VH8B 3L7EB 3ZKQD 4QRPD 4BSWA 4GRMA 4JO1H 2GI0A 1OIOA 1FGNL 2AABH 4Z7WB 3OX8B 3RGHA 4YIQB 3WS6A 5GS0C 4YSSA 1WD8A 2OL3B 4FX5A 4LSTH 5F6IC 3CZKA 1NL0H 4LIQE 1J5CA 1J0JA 4NZTL 2CMRL 4PGEB 3MO1A 3NJVA 4J3OD 1AR1D 5EO1A 2OZ4H 1WFNA 4UT7L 5EU6A 3ZR5A 4RISH 4KGJA 4PLJC 3VFRA 4BFGA 2YEQA 3OZ9L 2NNAA 1TJMA 5AW2B 2FH8A 5EU7C 3KWUA 3MRIB 1UASA 4IOFC 2V17L 1PS3A 3H56A 3IFNH 4HK0A 1WFUA 2V5RA 3HR5B 4YUEL 2O6PA 1J0YA 4LMQI 3T09A 2WAQA 2WJ7A 1KXTB 1BBDL 4PJDE 4I3RH 3MAWA 1S7WA 4OT1H 4PW3A 1E3XA 1S5HA 4FFZH 3FU7B 4CSSA 4P4KD 5JMRA 4NO5A 5IBUB 3WXWH 4FHBD 3ZE2F 2DL9A 2E9IA 5EU5A 3WFHB 5L2KD 2G5BA 5I1KL 1QTYT 4AZ8B 1ZHKA 4JY5H 3U7AA 2A4EA 4FFYA 1AACA 5F7BA 2ZCKL 1FNHA 1ZLVK 4GG6F 1WZ1L 1IZKA 5KOVC 4EN2A 4LCUA 2BRQA 4N24A 4J23A 3IGAA 3T5WA 4PG9A 3VGGA 3PPEA 4UM8B 3LZNA 2R2EB 4X4YA 3FRPB 1GHFL 5BNXD 4KITB 1FN4A 1HEZB 1MWAH 4C57C 3OKYA 1JZGA 4JMXA 1DBAH 3QXTA 4DK6A 2ZUUA 1TJGH 1R3HB 1WIPA 4Z7OE 1GYUA 1KN4H 2X3CA 3TJPA 1XZ0A 2QVTA 4YVUA 4YUEH 1MHEB 4OLUL 1XEUA 4WI9A 1BQLL 1I1FA 3O9WA 2GTQA 4H0LC 4PJDB 3L3OB 2ATKA 3O4LA 4P2YA 4QTHA 4ZX3A 2BVOA 3BMWA 2HT2D 3LNGA 4K07A 3KYMA 5IOPB 1KXQA 4WKZB 5C08A 1GYAA 1L0PA 2WBKA 3SDCC 1IARB 2BWIA 1SYSB 2C4FT 2JJSC 4UQ2A 3IJ7A 1UWXH 3U0PB 3SDXF 2VO5A 3O3AB 5C0NC 4I2XE 4QRTB 4P2RD 5EO9A 1F1AA 4ZXBB 3EO1A 4H2CA 4IJTA 3RPIA 4AEEA 3MREA 1F02I 1C5BL 3ALXA 2PKDA 3IPFA 4PEEA 3QRFM 4UT6A 4M7JL 4JDTL 2FEJA 2IMNA 3L3HA 3EYQC 2F54E 1J9RA 4YGVA 3HE7D 4FHJA 2OMYB 4H8PA 1ADQA 5E8PA 4HWZB 4NKIH 5IW6B 25C8H 4OLXH 3U4EA 3FYEB 2ZCHL 3QJFB 1ZANL 4AMKH 4WO4B 4Z1PA 3JZYA 3SBWA 3U46A 2BFVL 2EVJA 4J8RA 3G9VA 3Q8EA 5T3XE 2Z93A 2AK4A 4FI6A 1HHGB 3CH8A 5D93C 1JNLL 4YMPA 2ITFA 4DUWA 3AY4C 4RX4A 2VIRB 1O9WA 3Q6FB 3UIZA 5ISZD 3ENEA 4LO9A 4MA8H 2PXYA 2Q2LA 2EYTB 2Y1YA 4PJIE 5BV7B 3FU9A 4GAJL 3CHRA 1RXLA 4OF7A 3K0YA 3STZA 4RBPK 5IFHH 2BFVH 2GT9A 4R7XA 3LKQB 5DD0L 5IBTH 1WHOA 3INOA 4YHMH 3EYUL 3FMGH 5LXVA 3DROB 4OM0H 3EBIA 4G5ZH 3PWJA 3VCLA 4QRSA 4ZX4A 2A74C 4JR9L 1CFBA 1I8LC 2HZHA 4YLCA 3G5YB 4ZOAA 1AG0A 3QIWB 4X6BB 3KPPB 2BOLA 3G7TA 1ZGLB 2DICA 1KJMA 2IC2A 3Q2LA 4MASA 2ZCLH 3L5IA 3N3EA 3S5ZA 4J28A 2EJ1A 4H4NA 2BIQA 5CHNB 2AFNA 3KZ8A 1EHNA 4ENED 1XCQA 4LPUA 1S7XA 1JV5B 3N9GL 1II4E 1JPGB 1GJWA 1R3LB 1OSPL 3O4OC 4PB9H 4M9OA 3IDXL 4KKAC 1GIGL 5I5RA 5HYQB 2VDMB 3D39A 3IU4L 4LRNH 3U4AA 4ALAH 4MQ7B 5LB1A 1YYCA 3WEAA 2HG5B 4J3TA 4LOUC 4LVNC 2JXMA 5TF1H 3GMLA 3HS0C 5K69A 5C0IB 4RQQA 4DEWA 3TONA 1UG9A 1JRHL 3FC8A 4DW2L 2R0LH 1SXNA 1NBCA 4MRCA 1G9EA 1QTPA 5DJ2A 4DKDC 5A6IA 4WI5A 3EDJA 3Q0HA 5AEAA 1B2WH 1LYQA 4LPXA 4QTFA 3N40F 4MCYB 3GSUB 4RGMB 3U4BL 3ULVL 1WFOA 2IQ9L 1RERA 2OMXB 5IVXA 3B2UD 1LEIB 5A40E 2F1EA 4QHKI 4QRQB 3F7LA 4K9EC 4WI3A 3D2UA 1A6VH 1G87A 4OZFA 2Y6TE 3RUGE 2X89A 3K71A 3TVMA 1CTMA 3VFTA 1MDAA 4FTVE 3OKNB 4JGMA 3MCLH 1L9RA 2XPGB 4FG0A 5DK3A 2DMCA 2MOVA 4C54A 1U95B 4DP4X 1DVTA 2R2CA 3V4UH 1E4KC 4PSPA 4LCVA 3S3SA 2DYPA 5T5FA 2CGRH 5I1LA 2CHNA 4E9TA 3QJHB 2YRLA 3SZKC 3K1KC 4LCCA 4P23C 1YCSA 1LEKB 2J5WA 3G08B 2WYTA 4YHKL 1E9QA 4XPGL 1RZGA 5EDSA 4FFYL 4WI2A 1PG7X 3G5YA 3WENA 4X6BA 1THCA 2ITDB 4XCYB 4AM0B 4AQAA 1KC5L 3MBEB 4W68A 1I1FB 3LH8A 1FZMB 3QYCA 1H6UA 2EVIA 1FO0B 2F5BL 5F88A 2G30A 1MH5B 2MNJB 3HFML 4I77L 2K6WA 2UZIL 4QRBA 5AKSA 5E5MA 5JPMA 4RZCA 4NZRL 4XOAA 1H3PH 4AC4A 1NOAA 3DVIA 4NQXB 3ZYOA 4OD1L 4OCWH 4OB5L 1A7NL 3WY4A 2VMDA 4KPHH 3O8XD 4RGMC 4F9PA 4R9HA 1YEHH 5D4QA 4YFEA 1J10A 1P7QA 3HUJB 4WDIB 1DJYA 3NYKA 4F8NA 3P11H 4KK8C 5D7SL 5KSVA 1M2VA 3WKPA 4LNVA 1OY3B 1PYWA 2RIKA 4AKPA 1BVNT 4HOXA 3PU7A 2YD3A 3QZMA 1DVQA 4HWBA 3I6LE 3TBVB 5BOJA 4KJQC 4MLIA 4LVOC 2AXFA 1YMMD 3M46A 2P8LB 1V7MH 3MACH 5DFWH 4WNSA 3EJZD 4WW2F 4X7EC 5FYJU 4XMWA 5D72L 3MBXL 3OJDB 3QAZC 1WT5A 4DP0X 4RAHA 1NEPA 3K6NA 3FTVA 3G6DL 3KLAA 4GQZA 5D7LE 1CS6A 4OZHB 3IK2A 1ET5A 4RETB 3O6FA 4UU9B 1FF5A 2VR6A 4A7GA 1XH2A 3O4OB 3DV4A 2NNFA 2X6AA 4WEBH 4LQFH 4HGKC 5K93A 4F33A 2P28B 5LCVH 2GK2A 3QNXB 4ZFZA 5CFAA 5DUJA 3UTPD 4ZFFB 5KYXA 4ZS7L 3K4ZA 2OMTA 1AQMA 5FGSA 1I1RA 3I9AA 4NM8H 3X3FL 4BSVA 5CLYA 2OJEB 2O5ZH 2A3TA 2R27A 2R69H 3NK4A 4XBGB 5AB2A 4XCCL 1AGBA 2H1LM 4UT9H 1PPIA 1SJVA 1JJUA 3C6LA 1J7VR 2Q76A 3I6KB 2PTVA 3QWOB 1OAXL 2OK0H 3R06B 2QBWA 4HIXL 5E9AA 1FVEB 1AGEA 1F58H 3SE6A 3GMMA 1HXMB 4JAMB 3SQOL 3HLAA 4AJ0A 3K6DA 3RVVC 3GZKA 1V7NL 1XIWC 3RJQB 1WWCA 1V7ML 3MACL 3B3BA 4KJQD 4WTQA 4N8VA 1EGJH 1U8PA 1JIBA 2V6HA 2A9MH 3UIYA 5CM1A 5HJDA 3R8QA 4CJ1A 2D7MA 1UD3A 5EU7E 5IR1B 3FH7A 4AVJA 3BX7C 1HHJB 3I6GA 5AAMC 5DO2D 4FKHA 3P4MA 1FO0A 2VLJB 1U30A 3MLZH 1GTNA 2A74A 5C0DA 3ILEA 1HIMH 5ALBL 2BRRH 1AHWB 5JZ7C 3DK2A 2VZ1A 1CF8L 1F56A 1OW0A 35C8H 3MGOA 4R4BA 5ICYA 1OE2A 3OQ3B 4J3VA 3QXUA 1EHXA 3CTTA 1M6OB 3PWLB 5KSBE 5C3IA 2X4RA 3VXOB 3QZWA 5C2UB 5JDSA 2DQIL 2F61A 3F83A 4HAKA 4PVNA 3KPRD 3PY9A 4OR1A 4CU8A 1RIHL 2UWEA 4KI5D 3II3A 3QWRD 1YG9A 1L9NA 4X8JB 1M4KA 4IRSD 5AL0A 4G9FE 4YHKH 2NY1C 2ZOWA 3VH8A 3WIIH 3X1NA 3BKML 1GRWA 1AO7A 4XXDA 3SD2A 4BZ2A 1TR7A 4R26L 5JHLH 4KY1H 4NJ9H 4PJFB 2F18A 4OZGA 4WFEE 2C7UB 3NRFA 3ZMRA 5HGAA 4NAQA 3MO1B 2E4FA 1HU8A 3D85A 2WZPD 5JIKA 4Z8FH 2Z7WA 2ADJA 4X6CE 4MZIA 4FQLL 1AZNA 5I6XC 4IHOB 3TTYA 2IFGA 1KGWA 3G6JE 1EHAA 5E2UH 1AKJA 1N8OE 5LJYH 5MENB 1GW0A 3P9WB 1NAKH 2DQMA 4IQHA 2F6AA 2X3AA 1ZTXE 2PR4H 2V2XB 4BRJA 3DGDA 2ZKXA 2GY5A 3RVVD 4CAGA 3KWVA 5C6PB 4LKXA 5E9DE 4B7LA 1ETA1 2R4SH 1LVEA 4XNAA 4X7SH 2AJ3B 1R24A 2ZTBA 4WTWA 2VLJD 4W9ZA 4E0RA 3PUCA 2YJQA 1Z9PA 4MS6A 5G4MA 5KN5A 4JJ5B 3RWJA 1U8KA 5F1IB 1SMDA 2C9SA 2WC7A 3IJHA 1OGTB 2G5BB 5EORH 1T21A 3ZLQC 1FIGL 2XQ0A 1E4KA 3L1FA 2E8ZA 4ZMTA 3OM3B 4G1EA 2J1WA 1A0QH 4PYHA 5C6TL 4K8RL 3BGAA 4JHWL 2HT4C 3MQIA 3PAVA 5CLWA 4QXTA 5GGVH 3WD5L 3FH8A 4KHTL 2ZT9C 5DFVD 1UACL 4OM1H 2O5XL 2EEDA 2ADYA 2HT2C 1SYVB 4ABUA 3D9AL 1F58L 4XN7A 1AS6A 1OANA 1G9MC 3VVVA 3BP5B 1BXVA 4HWEH 1IO4C 3GBEA 1QRND 4K15A 4Y7MA 2R4RL 4YZWA 2K8MA 2YA2A 1YEWA 2VDLH 4JO3L 4I9XA 1THAA 4P2OB 1X4XA 2O5ZL 3H6JA 3F7VA 3X13A 4K23L 4RMRA 5T1MA 3DX2A 2ZAHA 3A24A 3BPCA 2EE3A 2O6DA 2OMNA 5F0MB 7PAZA 5I17B 2CPUA 1E4WL 4BSJA 2XQBL 3UBXA 2MQCA 4N8PA 1DBJH 1AC6A 2ZF8A 4XAWH 2FGZA 5ERWB 1LO0H 1FVCA 1ZPUA 2WYIA 4OFYA 3K8MA 3O8XC 5F7NC 3G5ZA 1ITBB 4JFED 3MUUA 2UZPA 4ODVH 4M6MH 3L6FB 1VACB 5GGQH 5JXEA 3Q48A 2FVNA 4NJAH 4JQIL 5IMKA 4DAGL 4OVUA 3ZW3A 1V3JA 2Q76B 2P49B 5EZOH 4BHUA 1BGXH 1KYDA 4PJ8A 2K78A 2JF1A 2L7QA 3K5SA 1XGQA 5DRZA 5EO0A 4FQQB 1T4KB 4ABQA 2ZSVB 5FGRA 3HN8A 5LG1A 1TOXA 1INDH 3U25A 3BMVA 3HE7C 4OH2A 3LH9A 1O7DE 3QZLA 4OCLC 4XWGH 1ZHNB 2L04A 1AHKA 2OYMA 1YN7A 2ZXBA 4FI7A 2GSIA 5LLIC 4CC4A 1HXYA 3ABKB 4Y8DC 1GKOA 1Y1UA 4XXCA 3AW5A 2BK8A 4HAGA 3CN3A 4I0PB 4LSDA 2AP2A 4OZGF 1FO0H 3WKMH 4ZZFA 5DR5H 2F54B 1P6WA 3FCTB 1W0YT 4WSKA 2W59A 3VJ6B 4EXPX 4ODHL 4CVWA 1NGXB 2F8OA 4TNWK 5JW4M 1CLOL 2OW6A 3CN1A 3NIFB 1Z66A 4HZ1A 4LIQL 3DSFL 5LDSA 4AQ1B 4EZKA 3UTZA 3NPSB 3V4PA 2XZAL 3SCMC 2F8IA 3JWDH 4TTGA 4X8JA 4KRNA 5JA8B 3MRPB 3H42H 5I8KL 2GIYA 2VLRB 2H0PA 4NWTH 2CNZA 3TO2A 1DBAL 1N0XH 3NZUA 3QK0A 3DIFB 4IIQA 2YD5A 2AK4E 3UBHA 5C7XH 1VPOH 3LS4L 4YZFE 4ZDHA 2G3ZA 3IF1B 3ZSTA 3EJSA 4N2DA 3I3EA 3P0VL 1ZKAA 3OKLB 4NEHB 1ASOA 1G7HB 4GY4A 4M8QA 3ZT5A 1XGPB 1YUKB 2JJVA 1VESA 5HYSG 4F9LA 4WO4C 4UILL 4LCYB 3S35L 4ADJA 4N9OB 2FO4B 4ENEC 1A2YA 2C3VA 4M7JH 3ZQ9A 1JNJA 2B0SH 3V0GA 3CU1A 4D0CB 3MV9E 2XTLA 3E9UA 1FZKB 2J25A 5F1NA 5CJXA 5LGHL 5AWNH 5D7JA 2G75B 3GJFB 3ARRA 3CXHJ 2G9HA 2ZWLT 4IYKA 4PRHE 1KWGA 3MLTB 5I19L 4XBPB 5TDPB 4Y0GA 3DWTA 3IU4H 2VUYA 2YQ3A 3NSCA 3PDDA 4H2AA 1P6FA 2DLIA 2NQDA 4AGMA 4D9QE 1J1OL 3FT1A 4M5YH 4YHLH 4JZOA 1BAWA 4PRBB 5A6MA 5I15H 4ZUVB 4G42B 4JFDD 4RMQA 5C0EB 2OI9B 1FLRH 5DJ0B 2WQWA 3MRKB 2HXAA 5IGXL 3C8DA 1R19A 1FZJA 2DB8A 2C4XA 1QNZL 3U7WL 1W0WB 2WQXA 4Y2OB 5I19H 2QZQA 5D4JA 4DJMA 1BOGB 3Q1SL 4XO4A 1PG7H 4P2AA 4I48A 2GHWB 3APDA 3EJCA 5ILTL 1FL5B 1RZ8A 5DMIH 4QYOA 2WQSA 4XP4L 4G3YH 4AC2A 1G0DA 5D6DA 4UBDC 3V95A 1PZAA 2NXZD 3CQQA 2GBTA 4YJZL 5T33L 2HMID 4IBWA 3U1SH 2MHAA 1T0PB 2VWEE 5H94B 1H15B 3OXRA 4FMVA 4KUCF 4AIZB 5TFSL 5IOKA 2X9YA 1DJSA 1ZA6A 2CO1A 4OGXL 5DLLA 1ASQA 2A6JA 2DBLL 3A67L 5AZUA 3ZJAA 2JKLA 1T5WB 2NUTA 2AQ2A 1UM6L 2J55A 1SUHA 3ARGC 1IGJB 4G6KH 3V55A 3OSKA 4TQ8A 1YNLH 3QR0A 3C5SB 4GFXA 2DQDL 2YKLH 1BX2A 1NMAL 4MNQA 2WB7A 3VWKB 4C56A 5E08L 2WZ6A 1NGPL 2DQJH 4NO2A 2EXWC 2F53B 2Z31A 3MRCB 4W1TA 2PO6D 3S2CA 5GS0L 3BZFA 4X98B 2WQUA 4UM9B 4NWUH 3F12A 4RRPG 4GO9A 3UBXI 1NCBH 1WZAA 3RVUC 1I9EA 1FZOB 4G7RB 2XTJD 5CP3H 5D2LF 2EIDA 3TOPA 3ULSB 3D0LA 5KJRL 3ZE1E 1E50A 3UTOA 5HP5A 2EDTA 1DUZA 2LLNA 5IK3B 2ZX5A 3B2VH 5T1LA 2BOCB 4APQD 1CD1B 2OXHB 4CBPA 4HG4J 2XDHA 1ZA3B 3NEEA 2B2XL 3JYBA 4YXKH 3QUXB 3MA9H 3L4UA 4X5XA 2ZP0T 4JFDA 1KG0A 3FTGA 1RCYA 2PMZA 2H4EA 4PJBE 4DEPB 2HG5A 4Z0BL 5T3ZL 2OKMA 3LQZB 4JDZA 1A14H 5LN8A 3ESMA 3B2VL 5JQ6L 2ORBH 1CLYL 5G4NA 4KDVA 4L8CB 1YY8B 1GZPB 2ZD0A 2GJZA 2FLBT 2OCFD 2ZWYA 4LLAA 4A7TA 4F93B 3T8XB 3QUKA 3QG6A 4BFRA 5LKNA 4FL4C 1JGLH 3L7FA 4Q52A 2B0SL 1KCUL 2IOIA 3HE6C 4FAAB 3CIQA 1OWRM 3SO5A 3QO1B 3QUYC 4HISA 4ODVL 4AEIH 3WSQH 1WRFA 4MJIA 3EYSH 4LU5H 3DJ9A 1QR1A 1DQJA 4Y9FA 3MVSA 4EI6A 3V0HA 3WNOA 1LWJA 3ZL4L 2XWZA 2JKTM 5CO1A 4S2SA 4FGMA 4TTDC 1YQVH 2LVEA 1TU2A 1TJIL 3P30H 5DZPA 1UZ8A 2ERJC 1IBZA 3KVQA 4J3OC 5HHNB 5B38B 4JDEA 1XGUA 3NDZE 5EF0A 1EK3A 4FA6A 1AMYA 5E7FA 1VZIA 1SF5A 4HF5L 4MSWA 4O58L 4JZJA 4NZDA 5IB5B 3WELA 1PG7L 2EKJA 4MMXA 3EHBD 1F42A 2V2WB 4W9EC 3FH5A 4LBEA 1WS8A 4GSRA 4MDJA 3DPBA 5C3LD 1A6UL 1E4XI 2OQJA 2WBWB 4L4TA 2VITA 4ZMQA 1K4CA 2ZG2A 5IWLC 4Z5RB 4JRFA 4N6QA 3ML9A 1FDLL 4JCMA 1G9ML 1JF1A 4FQXC 5DJ8B 4AJVA 2PWFA 4JG1L 1XWVA 4RRPM 1N7MH 2VJ0A 2C3WA 1JHTB 4NM4L 5IFJB 4AH2B 2ENQA 1KBGL 3CLEH 5K9KB 3PUUA 4O4YL 4Y2NA 1QVOB 4OCXH 2X70A 1TQSA 2W0LA 2ZUVA 3ME0A 4L29A 1K4DA 1SOSA 3OBAA 4JFPA 3GSXA 3QZNA 3U36A 3MRIA 4BK5C 4UDTA 2H9GB 2DJSA 4KJPD 3UZEC 1RMFL 5BO1L 1Y1DA 1YEFL 3G6JF 3CC5A 2XJKA 3DGCR 3WTWA 1FYTA 5IIEA 1VPOL 4J27A 3D06A 1GGUA 5E8NA 2NW3A 4ZAKB 5CWSA 3LSOA 2IAND 5C0FA 3F58H 4WTZG 3VXMA 2B5IC 3B2MA 3OPZL 4CKQA 4GH7B 1NPNA 2RH0A 1R24B 3U4KA 5EH1A 2KC0A 2YC1B 3MNZA 3ZBMA 1AIFA 3P2DA 5DMGD 4P23B 5IHUL 4PJ5A 2X6BA 4FABH 2DWTA 1P4UA 1QPPA 5CJOL 2DKMA 1LE5B 3FKUS 3JWOC 1A4BA 4HGWA 4UM8A 4WWPA 3K2KA 4BZ2H 3AXLA 1RZJH 3LKPA 5I30L 3D07A 5DHYA 3DMMC 5E2TL 1ND0A 5E4EB 3HG1E 3LRHA 5LQBL 1CDGA 1KJVB 2XFGB 4PS4L 2NY3D 2CM6A 4FFVC 4JDEB 3PCYA 4PFEA 4CMMB 5FO8B 4LKCB 4TUOB 4K8RH 2D7TL 1Z32X 3L3IB 2BP8B 2K8QA 1GVIA 4AQEB 2X2IA 2EACA 3B9KC 4Q2ZA 1OCWL 1KTLB 1Q9LA 5HI4D 3ARGA 1ZLDA 3RI5K 1QTSA 3IJ8A 1T1YA 1H3TA 3ULUH 3BP4A 3CFKA 4PLKD 4KHTH 1UWGH 1Q0XH 4QTIH 4NNPH 5ECJE 1OZTG 2UUDH 1TO5A 3KG5A 2IV8A 3CFEA 2FIKB 2Z34A 1FVCB 1K6QH 1TKWA 2IDUA 2X4RB 3BSZA 3VXOA 5CMAA 2P47B 4WJG3 1SJXA 3A4AA 2FQFA 3AUVA 1CCZA 2PCPA 3HVDA 3DJSA 2V7NB 4AT6A 4PGEA 3EH1A 2XN9D 5BZDA 2R1XB 1GZPA 4HH9A 2MSPA 4JQIH 2IFFL 3KR3H 3APMA 4HHWA 4PJ7F 5D9SB 1SFDA 3KYKH 1E5CA 4ZUSA 2HTKC 4I18C 1DTUA 4FQIH 4M6ML 2PP8A 2EH8H 1G7LB 1A3LH 1S7VB 2JQZA 4QOKA 5MP6H 3BGMA 1OCWH 3DO7B 2ARWA 2P5EA 5LQBH 5FECB 1U3HA 3QEQD 4M62L 3TLRA 1ZGLM 4PJCF 1S9VA 3OR6B 5DQ9B 4KI5F 2UXGA 5F0JB 4URTB 3L5WB 3JWNG 5MEPB 3VFGH