2HRGA

Crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
496
structure length
496
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase
publication title Crystal structure of the blue multicopper oxidase from the white-rot fungus Trametes trogii complexed with p-toluate
doi rcsb
total genus 143
structure length 496
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA03
1J9SA 1WAEA 4HIPA 5I5IA 3FU7B 4KOCA 4Q8BA 3PAVA 1E5YA 3ZIYA 4BWWA 2J5WA 2IWKA 3QPKA 2HRHA 2XLLA 2PPEA 2VN3A 4TXVB 5I5MA 1M56B 2CJ3A 2TSBA 2AZUA 2XV2A 4HHWA 3WG7B 4KO6A 3EHBB 3QJRB 7PAZA 2EIJB 2AANA 2X88A 3H4FA 2XWZA 1A4BA 1ZIAA 3H56A 1JXFA 3QQXA 5E9NA 1J5CA 1JZJA 4GP4B 1AQ8A 3JT2A 1KDJA 2N0MA 2WO3B 2HX9A 1PZAA 1L9QA 4AX3A 4E9YA 2XV3A 1ASOA 3IBOA 3V9EA 1BQRA 1PY0A 3UGEA 2IDTA 3EH5B 3NP3A 3CZUB 2I7SA 2DWTA 4JHUA 1JZEA 2UX7A 2BW5A 2YAMA 2B3IA 3HB3B 3PLYA 3H4HA 3ASOB 2GC4C 4BWUA 2FTAA 1DZ0A 5TK2A 1KGYE 1AS6A 2VM4A 5AFAA 1WA0X 1B3IA 1PAZA 1VLXA 2QDWA 2I7OA 5FC9A 3S3CB 2FWLB 4A2FA 5B7FA 3NP4A 3FSWA 1MZZA 4DP7X 4GXFA 5B1AB 3T6ZA 3X2QB 3S3DB 5I5JA 3CG8A 1PCSA 3S8GB 2UXGA 4BXSV 1OE1A 1ZDSA 1ET7A 3FQ1A 1PZCA 4GY4A 2BHFA 2FNWA 2J55A 1AR1B 1AZUA 4UANA 2YXWA 3G5WA 1AS8A 3ASNB 1L9OA 4HCGA 3ZDWA 2BP0A 2J56A 4YSQA 5AKRA 5B3SB 1BAWA 1GS7A 5I26A 2XXGA 1NICA 2XUWA 3EF4A 2BW4A 4G71B 3X1BA 2IH8A 1UATA 4YVNA 3EH3B 2AVFA 3D12B 1PZBA 4FAAB 2DWSA 4AKOA 1AS7A 1BQ5A 2BO0A 1BXVA 5PAZA 2FJSA 1KBWA 4E9WA 2VW7A 3NSDA 4A2DA 2H47C 3NSFA 2PPCA 4G7SB 4A2HA 1YLBB 2HZHA 4YSDA 1FWXA 3UADA 4HHGA 1AG6A 1HAWA 3ZX1A 1KYAA 1A65A 2CBPA 3NJIA 3UACA 1BXAA 2QPDB 3AG1B 2B08A 3CDZA 3QJVB 1GSKA 4WKXA 1MZYA 5AZUA 1BXUA 3CVBA 3IE9A 3FPXA 1MG3C 1BQKA 3NJNA 1MG2C 2PP7A 1JXDA 1ASQA 4YSTA 2PPFA 1X9UA 5EHFA 1SHXA 1AZCA 1L9TA 4DPAX 4W1TA 1SF3A 1OOWA 4YSPA 4BXVA 1XB3A 4RH4A 1E30A 1TEGA 3PAZA 2IDFA 2VSMB 4UAHA 2VMJA 4N4YB 2UXFA 3DTUB 3OMAB 2XX0A 3N55A 1QNIA 1E67A 4WTQA 1XB6A 2PP8A 5F7AA 4P5SA 1SHWA 4E9VA 1PF3A 5IY5B 2TSAA 1RZQA 4BK5C 3OM3B 1OV8A 2VM3A 1IKOP 2Q9OA 3T6VA 3U25A 3AY2A 5I6NA 3N2JA 2GHZA 2IDUA 3S8FB 2X87A 1HAUA 2WO2B 4G7RB 1FFTB 1L9PA 4KOBA 4YSSA 1ILUA 1QLEB 1E65A 5ANHA 3NJMA 2CAKA 1WA1X 4AKQA 4NAJA 2CCWA 2IDQA 3CDZB 3MBWB 1CYWA 3QJUB 4A2GA 4JHVA 4F2EA 1OF0A 3OMIB 3TA4D 1L9RA 1JERA 1RCYA 3FQ2A 4A68A 2IDSA 2Y1AA 2YAFA 5B1KA 4DPCX 2ZXWB 4AZUA 4YVUA 2XVBA 2ZWNA 1BYPA 2EILB 4E9XA 3PPSA 1CYXA 4E9TA 4NERA 2BWDA 1W6WA 3S3BB 1N68A 1OE2A 4YSCA 1NIFA 2FT6A 1WS7A 2GC7C 2GBAA 2YAEA 3MX0B 4YSOA 4GP8B 1A8ZA 1KDIA 1M9WA 1JZGA 4BDVA 2BP8A 3NJFA 1WA2X 1GY2A 3IN2A 8PAZA 4A2EA 1NIEA 1URIA 1AACA 2VW4A 4N8UA 1ID2A 3AG4B 1OCZB 2IWEA 4G7QB 1PLBA 2OCCB 3WI9A 2XXFA 2H3XC 3NJGA 2PCYA 4GYBA 1J5DA 3TBCA 3NJJA 1FA4A 2RACA 2H5UA 4DP8X 1GS8A 1NDTA 2OV0A 3FSAA 4DP9X 1PLAA 1JOIA 3T71A 3X1GA 2Y69B 3L45A 2PLTA 1AG0A 2J57A 1BEXA 2XYBA 3QJSB 3CVCA 4E9QA 5B1JA 2P80D 5A7EA 3OMNB 5TK4A 2MTAA 2GB2A 1GY1A 1HFUA 4CSZA 2CUAA 1NIBA 3PAUA 4YSEA 4E9SA 3IN0A 3C75A 2ZONA 1KV7A 1JZIA 2HRGA 3GYRA 4G70B 3NSYA 4KNUA 3NSCA 4K9JA 4BWTA 1AANA 3HEIB 5I6KA 1ASPA 1V10A 2XX1A 1GW0A 1TU2A 4F2FA 1AIZA 3ERXA 2FT8A 1F56A 1MDAA 1XMEB 2MRYA 3ABLB 4ENZA 2FT7A 1ET8A 3NJHA 5B1BB 2JFCA 4KO9A 4BDVB 2BP8B 2PCFA 2YAQA 3NJKA 4EF3A 4G72B 1ZIBA 3NYKA 5D4HA 2A3TA 5PCYA 1NIDA 1SFDA 5LDUA 3OD3A 1T5KA 1NPJA 1KBVA 2YAOA 3FS9A 2NRDA 2DYRB 1J9QA 2I85A 4A66A 1X9RA 3FU8A 5D4JA 5I6MA 4M4RB 2FQGA 1CURA 1IUZA 1N70A 3TBBA 2FQEA 4HCFA 4PCYA 3FQYA 3WKQA 7PCYA 3ABKB 3SBRA 3FSZA 4E9RA 2DYSB 1A4CA 4A67A 1NIAA 5I6PA 4ZK8A 2HX8A 3DIVA 4YSUA 2YAHA 4YL4A 1JVOA 3OQRA 3CVDA 5D4IA 2W88A 1CC3A 2GI0A 3PXLA 4DPBX 2W8CA 1OCRB 1ZPUA 3WNJA 1OCOB 3FYIB 4KO7A 1PNDA 2Q5BA 1I53A 4FA7B 2EIKB 5I6OA 4HCIA 4KO5A 3SBPA 3WKPA 3AG3B 2BZCA 1PMYA 4JKNA 2IH9A 3FPYA 1TKWA 1CUOA 2DV6A 2QPEB 1L9SA 2JKWA 3FSVA 5I6LA 2UX6A 4W9ZA 5I28A 1JZFA 3QJQB 1W8EA 4CSPA 4QLWA 1ET5A 2AFNA 1TEFA 4M3HA 4QKTA 2EINB 1OE3A 1ZV2A 4GP5B 2QDVA 1AZBA 2VSKB 2R7EA 3NJLA 2HX7A 2VW6A 1ZDQA 4AI7A 4AKPA 4DP1X 3FU9A 1KCWA 2DY2A 4HALA 2BWIA 1WS8A 2XV0A 3GXUB 4NB7A 4DP0X 3KW7A 1PNCA 3KW8A 3NT0A 3T9WA 2UXVA 4DP2X 3X1FA 3IEAA 1DYZA 3JTBA 1NWOA 1E5ZA 1ILSA 1W6LA 2PPAA 3AG2B 1BYOA 1JXGA 1JZHA 1XB8A 1NWPA 1KCBA 4HZ1A 1IC0A 2UXTA 1SF5A 1QHQA 1NZRA 5B7EA 1J9TA 2HLEB 9PCYA 2WSDA 1EHKB 3EH4B 4YSRA 3TU6A 2AZAA 2E86A 4KNTA 2IWFA 3BQVA 1SJMA 2GSMB 2HXAA 3QJTB 3AW5A 3T6WA 1SDDA 3SQRA 3V9CA 3T6XA 3UABA 3UAEA 3FU7A 4UF7C 3TASA 1JVLA 1M57B 2LLNA 3PCYA 3ABGA 4DP5X 4P5RA 2QT6A 3FYEB 3BVDB 2P80A 1SFHA 1AZNA 4PAZA 1SNRA 1EZLA 1GS6X 2YQBA 1A4AA 4KNSA 3WIAA 2PPDA 1NINA 3WNIA 3FT0A 1V55B 5B1JC 1AOZA 3UAAA 6PCYA 2YAPA 4MFHA 2R7EB 4L0PB 4Q89A 2GIMA 1RZPA 2PP9A 3X1EA 1NTDA 1ADWA 1J9RA 2YARA 1RKRA 2FQFA 4HAKA 4DP6X 1IBYA 1V54B 1IBZA 1NPNA 2CALA 2EIMB 2FQDA 6PAZA 3GDCA 2XU9A 1OCCB 1A3ZA 5B7MA 3ZBMA 3ABMB 1PLCA 1R1CA 1AZRA 1ETJA 1GR7A 2BZ7A 2OJ1A 2YXVA 3AZUA 2BP0B 2JXMA 2ZOOA 4X4KA 4DP4X 4F7KA 5F7BA 4YSAA 1GYCA 3DKHA 1AAJA 3SBQA 2IAAC 1SDDB 3X1NA 3RYMA
chains in the Genus database with same CATH superfamily
3GMLB 4YWGH 2XZCH 4XRCA 1B0WA 1GOHA 3CN0A 2NSMA 3RKDC 3S35X 3PAVA 1A6ZB 1UJTA 3CSPA 3UYPA 5C92A 5DD1L 2YHGA 3FL7A 4OGZA 5EG6C 2FO4A 4HKZB 1D5IH 1WWBX 3AT9A 2AZUA 1Z9NA 4HHWA 5DC9B 5DTFA 5L8KB 1F4AA 1CFNB 1TENA 1N9PA 5C08E 1EXUA 2ADGB 3FZUC 4JFZH 3BPCA 1D5ZB 4LHQB 3RWEB 1NFAA 5E8NB 3U4EA 4N20A 3PWPB 1W91A 4GS7C 3M17A 1MN4A 4NUMA 5IZ7A 4V33A 4YHYC 4EVNA 2VM9A 5CCHE 4LEBA 4X7TA 1F1DA 4X6BA 4PJXE 4WWKC 1CN4A 2XNAA 4LAQH 2JNZA 4N0YL 4RVBA 3GO1L 3ARRA 4P9ML 5FO2A 2EDRA 1U58A 4XOBA 1GPOL 4P2QD 2E6PA 2A5UA 2P46B 3ZQWA 3O3DB 4JCWA 2B3IA 3ARFD 3PLYA 3BT0A 3W11D 5CEXB 1KUMA 4IBWA 3FO1A 4P05A 2EH8L 2Z1KA 4XNXL 4ANVA 4F5CA 3UC0H 4C4UA 1U8IA 4G11A 4N22A 3JVGC 2CGRH 5GS0H 1VADB 3C6SB 2J88L 4OUOA 4DP7X 1HZLA 1JHKL 4FKEA 2CBTA 5I8CA 1QFWL 1PCSA 1QPPA 2X1XR 1OE1A 2JKXA 1LXMA 1CLZL 5A16B 1ZDSA 1WVZA 1MAMH 1EX0A 2EDLA 3FT2B 1I1FB 3F7RA 4XO8A 4IU2A 5TF0A 1NCAL 3V4PH 4ELMB 1UA3A 3O9WA 2P8MA 2O5YL 4FLOA 5EUKA 4LPXA 4H26A 1DUZB 5T3ZL 3WTVA 2R0ZL 1QSFB 1VACA 5HHXL 2NTSP 3SDDD 4F9PC 1T1ZA 4ABUA 2HT2C 3L08A 1DBKL 3APDA 4FTVB 4XBGB 2IGFH 3RZCA 3C8DA 4LEOB 2R0KL 2YQ3A 1QSEE 1JXJA 2Z64C 3CSGA 1HHGA 3KNBB 1F42A 2BVTA 3OHXA 3U7WL 5CHNB 2BO0A 5C0RL 1KB9K 4Q0XL 1M7XA 3AXLB 1DUYA 5CR8A 3IDXL 2EDKA 5E1GA 3RVXC 1UGNA 3HE6C 3O6ML 2XQBH 5DJZA 5LWYH 2RHEA 4HUCA 5EMYA 4OSUH 1T04B 4H8QA 4RISH 4PW3A 3HOGA 1RP9A 1WBXB 1GGYA 4I3SL 4GAJL 4NAQA 1LTXA 1SYSA 3H7BA 1B0GB 4FFVD 3EH2A 4NI6A 3QUZB 4MA1C 3QUHA 4HX1B 5D2NE 1HSBA 4KI5F 3CC1A 3IMUA 1OP4A 3GJEB 5INCA 3WO4C 3FT4A 1JAEA 2PWGA 3B2VH 5FOJA 3WS3A 2AXGA 1WBYA 4S2SB 5DSCB 4PYGA 4WI7A 1SF3A 3MQIA 3A6BH 3PRZA 1JV2A 4JY5H 4Q56A 4OLYL 5HYJE 2ICEB 3WSQH 2UZIL 4GIPD 3DTUB 2X4NB 4FNLH 1T20B 2X6MA 3AQYA 2VLLA 2XKUA 3S36H 5MENB 2DS4A 3MX0A 1NDMB 1ONQA 4JPKH 3VGEA 1C5CH 1JWMB 3HKFA 4Q6YA 1F02I 4RWHA 1UXWB 3Q44A 1CO1A 2X4SA 4TKWA 1L7IH 3VFRA 1A7NL 3TBTA 4BK5C 3DX0A 4NQTA 5ICXB 3QWOB 3FTYA 2E7CA 3WLBA 3U25A 1BFOA 3CFTA 3TZVA 4GI6A 2XBDA 5EFIB 1CGSH 2WQVA 1JGVH 3LOWA 1Q1JL 1BEYH 5IQLA 4U0RC 2CK2A 3S8FB 5D93B 4UV7H 5IBTH 1BM3L 4YEFA 4GUPA 1FL5A 2R4RH 4G59C 4WWKA 2OQJB 4HH8A 1LHZA 4TNGA 4FP8H 4KUZH 5K1VA 4NKDA 3L4WA 1AC0A 4NP9A 1KPUA 4XVUD 4RAUA 3DK2A 4PY7B 1QQDB 1UXLA 5E5UB 3DOSA 4JKKA 3ZSSA 1OT1A 4DO4A 3G04B 1XGYL 3GSWB 4UMGA 4HMCA 4C4KO 2D03H 3BWAB 4X7CC 2UYLA 1WH0A 2FK9A 1FVCA 3KJ4C 3D2TA 2QVFB 3MLYL 1O6VA 2ED6A 3O6FC 1N68A 4GLRI 3AFLA 4NPYA 4OLXH 5DMIL 1SMDA 1NCUA 1WFUA 4KRPD 2ZOWA 1NIFA 3IFPB 5AVXB 1D6EA 4N1EA 1LDPL 4D8PB 4YJZL 2D3NA 3ZSTA 2BS9A 1GGCH 5MEPA 1A6WL 4WV1B 5EC2B 4UZUA 1OARH 1ZJBA 2KH2B 3F7PC 1M9WA 4P57B 3RPIA 2HFEA 4YOKA 3ZKNC 4EZMA 1C08B 3P9LA 3FCTA 1MSPA 3ARBD 4F33B 1URIA 3LMJL 4OLWH 3I9GL 1UXSA 2HTLD 2WGXA 3MJ8A 4OI9A 1XF3B 2ZYRA 1YO4A 1F4YH 3BZDA 4Y4KD 3UYRH 1T0NA 3NACH 5LGHH 3VDAA 4E2OA 5E9DB 5TE6L 2BMKB 1BECA 2BVPB 4XB8A 3KLAA 5F7EH 1P5UA 4XOCA 5E6ID 4BFEA 1G94A 4ZPVB 5FYJD 3G6AB 3F7LA 3X1GA 5A7BA 4R8WL 3L45A 4EUPG 3A67H 4MDIA 4AYID 2Q3XA 2YKKA 3F5WB 2W95A 3QAQA 4L3EE 4UTAL 3HZYA 2WXHA 3QJSB 2MSPA 4U6XA 1J1PL 1Z3GL 1E5AA 3ZLQC 2WTRA 1YY8A 5JIDA 5EOTB 4OZIE 2ID5A 3OAYK 3PAUA 4PHZA 4LBAA 4O9HH 2VXQA 1CF8L 3AUVA 4LKXB 3VXOB 4G7VH 5C0DA 5C0AB 2ZUVA 1L0QA 4IMKC 2OJZL 3TBVA 1ZHNA 4W9LC 5JW4N 3VX1A 4EO5A 1YEFH 1MWAB 2PCPB 2VLKB 5GS0C 2VISB 1MKFA 2XX1A 4UOW1 3FTGA 5FUZL 5LXGL 2VQUA 3M07A 4A2LA 2CLZB 3O6KL 1KB5L 3PJNA 4YHKH 4PW4A 5I8EB 4EPSA 3RUGB 1GIGH 5ICYA 1BWWA 1D3CA 3TV8A 2YXFA 4XMPH 3BH4A 4FA8A 3X12A 1QBLH 2WYIA 2Z3FA 4TUJA 1R3LB 4LSVL 4ZSOE 1E90A 5EWIL 1QUPA 5BV7L 2Y07H 5E4AA 4DKAA 1F97A 1ZSHA 2F61A 3HZVA 3SOBH 1FYTD 1QUNA 5C0EA 3A21A 1NPJA 4PGBB 2LU7A 1VEPA 1E9PA 1FRGL 2VC2H 1V05A 4KPHH 1RURL 2DYRB 1QAWA 2LU5A 4HZLA 3QEQA 3ILDA 2LFEA 1S7VB 1VDGA 3U0TB 1JF5A 2J20A 5I16A 2CK0H 2ADIA 2DM3A 3VI3A 3Q8EA 3UTSB 1P7KA 3WKQA 5JW3L 4DKFH 7PCYA 3RWDA 1HI6B 1IC4H 4A67A 2OSLA 4AL8L 2ZG2A 2R23B 3HCVB 4QRUA 2KC0A 4IYKA 1T1WB 3ESVF 1Q9OB 4N1CA 1XVSA 4M1CC 4XN8A 4EN3C 1GTFA 1F3RB 1GYVA 3RTQB 3ZKQD 2ARWA 5KBKA 3ULUH 3D3VD 1AGDA 3MRGB 4OLUH 4QF1A 5AW0B 3ZDZE 3GC3A 5HDBE 4B9IA 4QNPE 4JHAL 4R9HA 4LLVB 1T1YB 1G1KA 1KLFB 5I15L 2JJTA 4PGEA 4MSWA 3O8XB 2R83A 1S5HA 4GQPH 1B88A 1ZLSL 1TU2B 4UAOC 4L4JA 3RX8A 4DERA 5I6OA 3VI3F 2WB1A 3D06A 3JYBA 3KYOA 4XXDA 4JRYB 3DI2B 5I2IB 2VN7A 3O6FA 5EOQH 2PO6C 3UO8B 2KPNA 4EIUA 5ID1B 2EUXA 1CDJA 3DROA 1ED3B 3BAEH 1KNOB 3HNSL 1P4IL 2VDLL 3CZEA 5D72H 2AQ2A 2FJHB 4UQCA 2EXYD 3Q3GA 4LT7A 4PJ7E 3MRHA 2ZXGA 1WISA 4XAWL 1UB6A 4XH2B 3S2CA 3TVMB 3ULVD 3MNMA 1BLNB 1I82A 2F54D 4FCHA 1TEFA 1TTAA 3KHOA 2VDQB 4H13C 1IBBA 1K5NA 1A1MA 3RIAK 2E7LA 4AK2A 2HX7A 4XMTA 4U3CA 3OC5A 4K3GA 4DOHE 3BRFA 2DY2A 3VJ6A 3U9UB 3DO4A 4FERA 5AOIA 5JHMA 3L95B 1R3KB 2IF7A 3B9AA 5D71L 3T9WA 3KW8A 3GBLA 2EO1A 1MF2H 5DDHA 5IWLC 2OMUB 2XY2A 1W6LA 1ITCA 3FUIA 4PJ5E 4GS7B 5BZXA 4I1NB 3IDMA 1ZVYA 3ARBA 2KKQA 5LHDA 2YPVA 4MNQB 3FUFA 5DZ9A 3QEUB 4UNVA 5KSUB 5LLIC 4LB8A 1OTSC 4PRIE 3WUZA 3MREA 1UQSB 5JO5B 3ATAA 2W65A 4MNGA 5D7JC 3VXRB 4XNMB 1KTKE 1NGQH 4C56E 3Q6GL 3MV9A 2GSMB 4E5XG 1DBML 4FFYL 2N7BA 4IMKA 2VDNB 3FH5A 4FZ8L 5TFSH 1TZIA 1PW3A 5IOPB 1M7DB 3FU7A 3HPLB 1ZLUH 2O93L 1N18A 4FG4A 1H9DA 4H1LB 4WI8A 5HY9B 3FCSA 2RMNA 3N40F 1TZHA 5DRNB 3V2AR 5EOCL 1WFIA 3BKJL 3TF4A 4JVUA 4BFKA 2CLVA 3D87B 3JWNG 2IANE 5I1GH 4O02A 4R5XA 1NFDB 3LXUX 4LGPB 1JI1A 3D4YA 2G60L 3L7EB 3U1SL 2QTEA 2A99A 4L1DA 1I9IL 3A23A 6PCYA 1QVOA 3BLKA 3FU3A 4J3VA 4QRBA 3PP3K 2R1WA 4QRQB 4FADA 1U8QA 2R2EB 4Z7UA 5DJAA 5ISZE 2CO7B 2VJ0A 3DTDA 3W5MA 1WZ1L 2FQFA 3CVHB 4IW4C 4QGYA 4PJAB 3LQZB 4KRLB 4K8RC 3DJ9A 3DRTA 4QXTA 1KXTB 2ZKMX 1XGUA 2FQDA 3ECWA 6PAZA 1AI1L 3GMOA 3M86A 2C9RA 5CJ8A 3Q1SH 3OXRA 3T1FA 1T7WA 2GUOA 3MRIA 1NCJA 1R3HB 3MXWL 3HE6B 3HE7C 4XPHL 4GT0A 2VXUH 1PKQE 4DPRA 2W94A 1J88A 1O7VA 4WHTA 5DHMC 1UEYA 2DQUL 3FT1A 2XWBB 4YLQT 4OLVL 5IEHB 4MB3A 2WINB 3MRDA 4MDJB 1SN0A 2NDFA 4Y2NA 4Z7UF 4XN5A 1E8YA 4AUJA 4ZXBC 3CTTA 4OIIH 2PYFA 2CNZA 3NPSC 4KOCA 2JLLA 1PBYA 3GGWA 4MA1B 1MJJB 3BHBA 4PRDA 1XCWA 43CAB 3VRIA 2DLIA 2HN7A 4J23A 5CINH 4MXVF 3WO4B 3WTYA 4KZCA 3I2CL 2QQQA 4KTEH 4LLAA 2EIJB 2EZ0C 3OKKB 4A2MA 4WTWA 4X0NA 1FAIH 3G5ZB 2W9LA 3CJJA 1J1OL 2ZX7A 4LGSB 3VFUB 1K4CB 1MFCH 4GRWB 3SO3B 4GP4B 1HJCA 2VDOL 3PWJB 2ORBL 4M1DL 5IW6B 4D3CL 2R0WL 3QFJB 4JKLA 2C9QA 4K5NA 2C9SA 1MFAH 4N2LA 4YDLC 3U0PB 1MHPL 2WXJA 1KJ3H 3ES6B 5E8PA 5F9WC 7FABH 1IAOA 2X05A 3UMNA 5JW4R 2FE0A 4YHIA 2BIIA 3F6IA 3CBRA 1L0XA 3MJGX 1PY0A 5ADPL 3NP3A 4KKBD 2DIEA 5KYWA 5ITFA 2AJYH 5CJXA 1NJ9A 3HAEB 1MY7A 2CBOA 3LEVH 3QDGB 1HKLL 2GITB 1G9NH 4FQQB 1KGYE 3CFEB 5I8OL 2V17H 3IRCA 4G6KH 2ZCKL 1B3IA 3GBMH 4U0RB 5FC9A 2FWLB 3IFLH 5GIRA 4ZW6A 5B7FA 2NDGA 4WW2A 1KZQA 1N64L 2DQIH 2VJ8A 4P3WA 5H8DA 2IMMA 4S1DD 3ULUC 3O2DH 1X4ZA 3SKOB 4MXQD 4JZJB 1ZANH 1NLBL 4YPJA 5CILH 4MWFA 1KJ2A 1IQDA 1Z9LA 1NGPL 2ZKHL 3A0OA 2F74B 3QISA 4H88L 1BXXA 4M48H 4M8VA 3N06B 4JQIL 1NCIA 2EDOA 2AJVH 4NWTL 3UJTH 5EORL 3WNNA 4TPRL 5F7DA 2FCBA 4ABQA 5JXED 4F57L 4C83A 4IK6A 4WHCA 3BIKB 4NO2A 4DN4H 4IOSA 3NQIA 3ULVF 2PR4L 3B34A 2K4AA 4E0RA 1FZKB 3VFTA 1NGZA 1IILE 2CO4A 3QXWA 5KS9B 4JDVB 4WW2F 2IEPA 3N42B 1RFDH 2QADD 4C59B 1X7TA 3U6RA 1DEDA 2WN2A 3NSFA 4BFRA 5K1JA 4FJYA 3TH2T 3L7FA 2E7BA 1B9ZA 1VRSA 5DURB 2ATKA 2O5XL 4LSRH 5CCKL 4HK3N 2NY5L 1T2XA 4N5EC 4JGMA 2Z0BA 4QJ3B 5C3LD 3HRZA 4OD1H 3GLZA 2XSKA 2AK1L 4Y5XC 5HD8D 5FLUA 2FEEI 4RFEA 5JIMA 5J7CC 4N0CC 1DFBH 4WLCA 2F5AL 1BGXL 1MG2C 2OAAA 3S5LB 4OGYH 3FMGH 5F44A 5C0BE 2NXYD 3EOAA 2OPCA 4HF5L 4WQOA 1X9UA 1PG7H 1A22B 2VR9A 4PJ6A 1AZCA 2XA8L 3VXUD 4GW1B 3FU0A 1HZHL 3BN9C 4ZOAA 2R1YB 5L9DH 3GSVB 4RH4A 5KYNA 3CZLA 4LQFH 4UAHA 3MCG1 2VAJA 5HHME 2ZWKA 3L3DA 4ZXBA 4K9EC 5AENA 2YPLB 3BP4B 2CDGA 1NMBH 3ZDYF 3G5YB 3BEWA 2NUPB 3QWQB 2YMXH 1N10A 5JHDB 1X7QB 2TSAA 2V5MA 3H2PA 5FUOL 5CFHA 4LESA 1MVUB 4NN5B 3DHJA 1MRDH 1U4EA 1UD6A 2IQAB 4PJGE 5E5RB 3F7VA 3OZLA 3HB3C 1YQVL 3VB9A 2Y5EA 1IM3A 1SXBA 2ZUQC 4IRSC 3RDTD 1HKFA 4JY6A 1AD0A 3TJEL 3V4PB 5D1XC 4UB0L 1L9PA 2SODB 3NCWA 1QEWA 1CFQA 4U1KA 5IROC 3GMRA 4JLRA 2QKSA 4OFPA 1DP0A 3UZEA 3WFDH 2ITCA 3MV8D 5C9JB 4D7PA 1Z2KA 4BZYA 1IL1B 4JHVA 4J3OD 2IH3B 3KBEA 3ZMEA 2WQWA 2RB8A 1RCYA 3FQ2A 4A68A 1U6AL 5DC4B 3ZHKA 1Z6JT 1JGEB 5I0VA 1B6DA 4KQ4H 2NNAA 3G9AB 4PCKA 1RULH 4PRBA 3VYPA 2EDXA 5DJ0B 1EXHA 4BH8A 1CYXA 1SLXA 4OLZH 4M7LH 2BSBA 3QQDA 4FA6A 1P5VB 2E9BA 4K55A 1JDAA 3MGAA 4ZS6D 3B9VA 2JCWA 3CXDH 4RGOH 5FOBA 3I3DA 3K6OA 5ALBL 5F3BB 2XFXB 5C0NC 5C2BL 1A0QH 4CDGC 4Q9QL 5FDYA 4Q6IC 1DHKA 1QO3A 4WO0A 2EVJA 4FFWD 2R8SH 5CKAA 4U7KA 1MNUL 1GY2A 3UDWC 5JIPA 4QOKE 1CI3M 1XCTB 3KYMB 4ENEC 4UAOB 4XB3A 5L2KD 3FO0L 4TF4A 3MKKA 4MQXD 2Z7WA 4JR9L 1KCRH 1OW0A 5AW9B 2ADJB 3DXAB 2VAAB 1M2VA 3ET9F 1FNSL 3NJGA 2PO6B 4YH6A 5IB5B 5IB2B 3EGSB 1THCA 3RX7A 3LQMA 4M4RA 1P4BH 5E95B 1XF2B 4LOUC 2KBGA 3H2QA 1I9EA 4OCWH 1QKZH 3WGVB 5K9KB 3HUJA 4G8GE 4HISA 1EDHA 1OGTA 5I30H 2RFXB 2MOGA 1Q0EA 1BEXA 4N2IA 2M2DA 1TQWA 3WFZA 1MREH 1QFPA 4E9QA 3MZGB 3NA9L 3QRGH 3DUSA 4GSXA 4ADIA 1KN2L 1YPZA 1M1XA 4Z7NB 2E5EA 2ZWYA 2G3NA 1NIBA 1OIOA 2A4ZA 2HLFC 3CSYA 4MA3A 4OQ1A 2HVJB 3GS4A 3MTXA 1TO4A 5TF1L 2Q10A 3Q01A 3VXPA 1F11B 2ZONA 1U8LB 2LAGB 4G43A 4DZ8A 1G9NC 3MYJB 4YXHL 2OL3A 2WAHA 1A6PA 1NAMH 5HHNA 4K9JA 3OGOE 4UDUB 4C8XA 3MKGA 1V10A 1WCBA 4F2FA 2EDMA 2NPLX 1M7IB 2FZ3B 3DV4A 2VXTL 4Q7DA 2YD8A 2VITB 3G5XB 1RHHA 4LKCB 2IAMC 2FT7A 2JKJA 3QUKB 3FXIC 4QYOB 5H37G 4OCXH 4YR6B 3DO7A 2BP5M 2BSRA 2CR0A 2WY3B 4JFEE 1R5VB 4NNPL 5KVDE 3DVNB 4MRCA 1UT1A 2XKNB 2F7IA 4HUXB 1N2RB 2FRGP 5D7JB 5D4HA 5EZOH 5IBLC 4U1JB 1YPZF 5JW5B 4K7FB 4MDRA 4X50A 4X6FB 5IR1B 4JKMA 4FI6A 4FQ2H 4LP5A 3VFSB 5HYSG 1QATA 4M5ZL 5D6DC 5D4QA 5CSGA 1CFVH 4UYPA 4WI6A 2X28A 3MGOA 3VXUA 5C97A 5I6MA 4U1IB 3EDEA 4MS6A 3UBGA 4HKJA 3SQOL 4HCFA 3ALWA 4PCYA 2IV9A 4TLUA 2ZG1A 5KYXB 4CRPA 2P5WD 3E1F1 3JZYA 4HS8L 1RERA 4P8QA 4YDIH 2Z35B 1EVUA 3QZLA 1J8SA 5DO2C 5EDSA 5LNDA 4Z8FL 3WUWG 3SDYH 4JO1L 2Z6FA 2WTOA 4L3CA 4Z7OB 1CLCA 1YEWA 3BQUC 3PXLA 1QSZA 4IS6B 4X7EC 4YFDB 1IBGH 2EEDA 1R19A 1ZPUA 4U1SB 4K3DL 1LNUB 2WW8A 3LZQA 4QAMB 3EDFA 4R7DB 3HHSB 1IBDA 3RWJA 1U8PB 5AAWA 4Y9CA 3WKPA 2AABL 3HE7B 1R24B 1G7HB 3MOAL 1DJSA 2JKWA 3MV8A 4ZMTA 5KUMA 2YGNA 1WE5A 1FZJB 1CGWA 1FAKT 3ZE1F 4W9FC 4WCYL 4LSUH 1JCVA 3GKWH 3UTTA 2QSVA 4MNHA 3QUXD 3NRPA 3UDWA 1G7QB 4P3DA 2EINB 1OE3A 5SWZB 2GAZA 2HTKD 3MJ6A 3PV6B 3U30C 1X5HA 3ZOAA 2WBJD 1AZBA 1D9KA 4EE2A 2DD8H 5KBPA 1I4FB 2YWZA 2ZOKB 4G9DA 1AXTH 3K6SB 1HCFX 4LMQI 3OX8B 4PUBL 1AQHA 5J9PA 3WTWA 1S3KH 1BPLB 1EJFA 3QBTB 1BAGA 3CFMA 5E1IA 1NFIB 3OJVC 1MDTA 4J6RL 3UYOD 4DP2X 5B8CB 3SSGA 1CDCA 2DWDA 4NDMA 1KGCD 5G55A 3T0EA 1BYOA 4I77H 2JCCB 1G7MA 2D0FA 3TA3D 2WYHA 3BZFA 2UXTA 4J3OF 3JWOH 4BK8A 5B7EA 4XMXA 5JPMC 5L2KA 2VC2B 3EG9B 3D25A 5G5DA 2H6PB 2YN3A 5F9WB 1U92A 1FZOA 4JPVL 4IBTA 3CH1A 2VQ1A 2JELL 4L9DA 1A47A 3K1DA 1ZGLP 4HXBL 4KKAC 1OAXH 3CDGB 1HVXA 3V9CA 5GISL 3ISYA 1U3HB 2UY7B 4JFWA 3HI1B 4F20A 3ELQA 2CUIA 3MRKB 3PWPD 2UZPA 4N8VG 3B3IB 4ZI8A 4ETQA 4PN6A 4KKLC 5IG7B 1ZTXH 1LE5A 4F7TA 3KPRB 3J8F7 2W0PA 1KIQB 3O2WH 3SD5A 5D7HA 1QBAA 1RUMH 2OTUA 4IK7A 3UTZB 1YEDA 3THML 1B0RA 3U82B 1CR9L 4FQIL 1CFBA 3AS3A 3WGUB 1LEIB 5IJVA 4MHHI 3P69A 1ZVHA 5T1LB 1R75A 3E0GA 5D6DA 3T5WA 4AE0A 3UIZA 4GG6B 4KFMA 3UO1H 2Y23A 1IEAA 3QHFL 1E40A 5IJDC 2C5DC 4PWGA 5DVLA 4FQHA 1JGUH 2VZOA 2DYPD 2WWMD 3RL1B 2EIMB 3E38A 3LIZL 3MO1A 4I88A 3AU1B 4NC1E 4HOXA 3KYNA 2ZWZA 3TIEA 3L3KB 4Z7IA 2B59B 1RUPH 4MCZA 4LO9A 2AEPH 3IM1A 3D39E 1BIHA 1BD2B 3EGXB 4N2DA 4P04A 4X99A 4Y1AE 1N6UA 3IK2A 3C8KB 4ONFL 4ANKA 4XPGH 5JYMA 5I8KH 1E4JA 3LDBB 4JG1L 1QSFD 4XP1L 4M5TA 3SBQA 3BZEB 2UVFA 3HMXL 1SDDB 3QJHA 3T8MA 2UY6A 3X1NA 4FTVD 3P11L 2BERA 1OWWA 2P5WA 4Y5XB 4Z7QB 3ARGC 2ED9A 5ACLA 4JJ5A 2Q76A 4MJJA 3T4YB 2J5WA 1JDCA 4FZEH 3SKJL 2E7DA 3DX4A 3QH3B 4AQ8C 5H94A 35C8H 4OZHA 4J8QA 4PGDA 3H4FA 2H1XA 1PLGH 1KFAL 2B9BA 1MIML 3AS2A 4JRXE 4BSWA 3V95A 2HRLA 2Q87A 2FLBT 2FB4H 4R26L 1OTUC 1SY6L 4LCWD 4GXUN 1MHEA 3EJYC 4I8DA 3QUZD 1G7PA 3TYGL 4LRIA 1I3RB 4MMXC 3S3JA 4RWYH 3H54A 1YAIA 1MCFA 3BD5A 1UZ8B 3BSGA 5DWUL 5GRVL 1DVYA 2ZNWA 4APXA 4GRLB 2MPAH 3AABA 4DF9A 3HB3B 4TVPL 5FEBA 4WI5A 1GYUA 1QFWI 5EU4B 3GI8H 4OZHF 1JZ8A 2ZUQB 1JZ6A 4QHMA 4UT7L 4IRSB 2IG2L 2XWDA 3DSNA 3FC8A 3TONA 3H3PH 3QUXA 3TURA 3QPXL 4MA8L 2PW1A 5D1XB 3ZVVA 4YXLL 4A2FA 4IOIA 3VH8G 3WXWL 4JX0A 5E8DL 3HMWH 1N5AA 1AE6L 2AEWA 5JPMA 3EJZC 1FFOB 2JLPA 3L1OH 5HGAB 3SCMD 2ZOUA 4W4OA 4Y1TA 3LY6A 1PD0A 3AS1A 4GXVH 3WEXA 5E8EB 3QAZB 4I9XA 4XPTL 3HHRB 4HT1H 4EXPX 3LN5A 2P1YA 1BZ7A 2MQ0A 3A4DA 5AW7B 3KWTA 4HCGA 3AQDA 4M03A 5IFAH 2BVOA 1N8ZB 3N0AA 1UD8A 4QRTA 3GSXA 4HPHA 4NRXB 2GTWA 3T2NH 3TA3A 1G7IB 3FO2A 1O5PA 2D2OA 4MJIB 4BJLA 1YNTB 5F7LB 5TH2B 4AKOA 5T8IA 3SGDI 4R4BA 5IMOA 2MHAB 5IMLA 5J56B 3P4MA 4G6JL 4DGIH 2DQMA 3WE6B 2ITDB 2NXZC 3ZYOA 1YLBB 3N04A 1B3JA 4Q6IB 4PLNC 3RWEA 3QFGA 5JZ7C 2DJUA 2GTZB 4S0SD 5DQDH 1ZPLA 5DFVC 5TE4L 1GC1H 3DJTA 5B21A 3VG9C 1N5YL 1S78C 3NCXA 5CUSH 3NZ8A 3QWRD 4JREC 2OJEA 2E9JA 3GNML 2H0JA 3RFZC 1HU8A 3GSUA 3UBXG 4CUCA 2DQCL 4ZNEA 2X53A 1F3DJ 3B43A 2XXCB 5BZDB 4ICWA 1WIOA 3UH8A 4N9GB 1JG9A 4QO1B 4YSTA 3JWOC 4GG8A 1GMIA 2K7QA 1IFRA 4ODWA 1IEBA 1I85A 3EJPA 1EDYA 1EWHA 1OTTC 5CEXA 1F4HA 1DQTA 3QNFA 2HYMA 4BXVA 1CIDA 4YBLC 1R5IB 3DV6B 2WQUA 3R19A 3VFVB 4P4RB 2DYPA 1MQKL 3VFGH 5D5MA 4CMHC 1A9BA 4KWUA 1ZSDB 4CVXB 3ROOB 3ARGA 3TN0B 3APCA 3LHPH 1X6LA 1EZVX 1I1FA 2W0LA 3ATDA 3KPLA 5DRXA 1YQ2A 5LAXA 1YEIH 2IAMB 2CJUH 3IPFA 3ZTDC 3HIZA 1KG0A 1NMAH 1WBZB 2R51A 4FTVA 5HPMA 1DQIA 5DU7A 4F8NA 3KNBA 3DVGB 4BA0A 4HG4J 5ANHA 3NJMA 3QCTH 4NCDA 3S96A 4NAJA 5C0AD 1SVZA 1RK0A 5D5MF 5D7LB 1GGBH 4MMXA 4YUEL 2J25A 2RCSL 2XG5B 1COBA 5J13B 2VLKD 3KYAA 4LLWB 5GGUA 3TIDB 3ILEA 3ME0B 1G6RB 4NT6B 2X9WA 2ZICA 1RUAL 3FFOA 4JQXA 4OAWA 2E8YA 2XVBA 2E47A 3VTTA 3FBQA 4FQ1H 4XN2A 4LCWA 5FWRA 3NUKA 4NYLA 1Y7VA 1SN2A 4M93B 2FVNA 2D9CA 4B95C 5GHWL 3SDAB 2MCPH 3GJEA 3HNTL 2J12B 2HP4A 3DX3A 4MX7B 1KCUL 1QYGL 2AQQA 3BQUB 4HIIA 1RIVL 3WHE0 5FR3A 3FCBA 4ZMWA 1HN1A 1MFEL 1UVQB 2C4FT 3ILPB 2V3DA 2ZP0T 3MV11 3NJFA 4NJ9H 1CCZA 1C16A 1P0SE 1J8HE 2ICEA 2UZXA 2K1MA 3EO1A 3IBEA 1NBVH 5DZJA 3A6CH 3UTSD 2GW5A 4F7EA 4JY4A 3FO9A 3OKOA 4Q58C 1L3WA 4YO0B 3F7KA 1NBZA 4ELME 3PHQA 1NDMA 1JRHL 2OCCB 3PWLA 3SCMA 2Y5TA 1DBAL 2M26A 1U21A 3WJLC 1F3DH 1CU4H 1K3IA 5FO9A 2H5UA 4PJDE 3RTQD 5IJKA 1UWEL 3Q2VA 4WK2B 4OM0H 4CNIB 3OZKA 2G5BB 1KIUA 3MHZA 5E94A 1FQ9C 5I73B 5F9JA 3ARDC 2R4SL 5CP3H 1AR2A 4H0IA 4MD0B 4RDQG 4CSZA 4B60A 1V27A 3RFZA 4JRYD 4WUUA 1T6WA 3SIKA 1P4LB 4WNJA 5HHOA 3ZO9A 1RMFL 1E3FA 2J1KA 2PWDA 4G70B 4BSVA 1QQDA 2EIZB 3FCUB 1IZKA 1GXEA 2I9LA 2KUTA 3IXTB 1SPDA 5D7KD 3ERXA 3TVMD 1NL0L 3GSWA 1L0YA 3JUZA 1A02N 3ATBA 4Z0XB 1SDYA 4NS0A 1WEJL 4WI0A 3FQTA 2Y4SA 3GO1H 4P9MH 1E2WA 4K94L 3B9KB 4AYFA 4OVVA 3NZSA 1DVTA 2A3TA 3EYUL 1EGJL 2J1XA 3FZUD 1TO5A 3SE9L 5KAQF 5JORA 1UB5B 2EH8H 3ZTJG 3VQ1C 1PZ5B 4XVOA 2BOCA 4DGUA 4K3JH 4N87A 1NCWL 4M43L 1OO2A 1DN2A 2H0PA 3EYOA 4PCSA 5MENE 4X5XB 1N70A 1JHKH 4MNQD 4G9FE 1D5RA 3ZJAA 4X7DC 4N2OA 1T80A 3BH8B 5EUOE 4X5WA 1TQSA 2A9MH 1XF3A 3EJRA 1FFNB 4LEXL 3FW6A 4Y19B 4AEIL 1NIAA 4KJWD 3VXRD 3WIIL 1WFJA 1E50A 4ZQKB 2HX8A 4YSUA 3MUZ1 1FNEA 2W9DH 1LVEA 1GC1C 3PP4L 4NZ8A 3TBSB 2PNDA 3L3GB 3D4GA 43C9B 2FX8L 3K80A 5T3ZH 4O2EB 1Z32X 5C0IA 4Z77A 5HHXH 1MCIA 4MCYA 1OCRB 3T3PB 32C2B 3WNJA 3V6OE 2O5ZH 3QYNA 1KXQA 4KO7A 3U7WH 5C0RH 4Q0XH 2AV7A 2A77L 2NYYC 3T77B 1PFOA 3AG3B 5DJYB 3VXOA 3O6MH 1JZ5A 1A5FL 2VN5A 1XSOA 1DE4B 1L9SA 1XXDC 1ESOA 2FO8A 3RY5A 2PCPA 5I6LA 1PX4A 4KDTC 3UEZA 2VISA 4DGYH 5GJSL 4EUPH 5I28A 2Z7ZA 2LGNA 2RAMA 4I3SH 4GAJH 3EADA 1YNLH 2HFGH 1HILB 3ALPA 5BUPA 2CLZA 4NJAH 3I50L 3RUGA 1NAMB 1P7HL 1Z1WA 3ZW3A 3CDFA 4JM0A 3UX9B 1R3LA 1E6OH 3FU9A 2OXGA 3PG2A 4P5KA 4KC3B 3DX1A 3V6FA 4HALA 3HE6D 4XNUL 2CO2A 3UGUA 2XV0A 1G5GA 2WLLB 1K8IB 3ZK0A 3F7YB 5ILTL 3KH4A 1SZNA 4L3FA 3WTXA 4NCC1 2F08A 4DN3L 5GRUL 1CDGA 1NWOA 3JTBA 1ZEAH 3KL3A 3PXJA 4HZAA 4X9BA 4AGNA 3L3OC 4KXAA 3U0TA 2M8XA 1AO7A 3GRBA 1IFGA 5A2JH 3VQLA 2EO9A 4NO0B 4R7NB 4GSQA 3UTSA 1QFWM 5E9DE 1LD9B 4UQ9A 1HI6A 4L4TB 2KMWA 3RJDA 2WHVA 3T3ME 1ZA6B 2OBGA 4ZFFA 1GL4B 3LQAH 3C08L 2WSPA 4Z0BL 3RUGF 2HRPH 5INDB 4HH9B 1JZ2A 2AF2A 4LNVA 1A7NH 3L17A 4PJBA 2B20A 1PEZA 3RTQA 3QIUC 3SDXE 2IALB 3OB0H 3T6XA 1WZMA 1HQRB 3NMEA 4UF7C 4Y5VB 4X0KB 2GY5A 2BY3A 2WXOA 4L8SC 5EIIB 3OV6A 1T03H 2JWYA 5E2TL 4L0ZA 2PTTA 3Q2NA 3FRPG 3QFJD 5GJTL 4QHPA 1FZMA 3NIGE 4JRFA 4LVHC 4EZKA 4R96B 2YRBA 3HC0B 4RAVA 3WD5L 5G4MA 2MMXA 1TCRB 1N59B 2BVQB 3GHBL 5EU7E 4W9DC 1F3JA 3T8XA 4MFHA 3CFCH 3E3QC 5L2JA 1RZPA 5D1ZD 3MRJA 4AH2B 4PJBF 3EYFA 2LW3A 3WXVL 4BZ2A 1E8WA 4XH2A 2H26A 3LXBA 4XC1H 3D34A 1IBYA 3GIZL 3SKMA 1F45A 2E9IA 2WMPA 3JV4B 5GPRA 1CBVL 1JUFB 4OD2A 4DT2A 1R4XA 4BIKA 3AAZB 4GSUA 1QRNB 3TJPA 1A6WH 3P4NA 3K8KA 3SDCB 2JKIS 3BP5A 3L95A 4B9YA 1R3KA 3LRSB 5CEYB 4L8DA 3IS0X 5D7IA 1JPGA 5KBMA 2EDWA 2Z4TA 5J1AA 4QRPE 2V37A 4KXZI 2OJ1A 1A7RL 1JTOA 2JXMA 4N2GA 4H20L 3C60C 3H42H 3IMWA 3VG9B 2EADA 3PP3H 4JREB 5FYJU 2RIKA 4PWFA 4I87A 3BZ4A 2OYPA 3VXRA 2IXQB 5L7XL 4ZFOB 2D2CC 5I5MA 2XLLA 5AOKA 2X1PA 4PGCB 1W0VB 1CTMA 2ZKXA 4KO6A 3GSOB 2W60B 5DF0A 3VO0A 3ZKND 5L4IA 1C12B 3QEGL 2YJLA 3CZJA 3O11B 5HY9A 4H8HA 3BSZA 4XMLL 4YBLB 1LE9B 1AHWA 1OPOA 3O45B 2IADA 4NIYE 1P9MC 1U8HB 3BUPA 5CSBA 4M6OL 3RKPA 3WL9A 3DETC 4CMHB 1XZWA 4JB9L 4G7YL 1D5XB 2BS8A 4U6TA 3QG6A 5DRWA 4PJFA 3MI6A 4LSQH 3CK0L 2QPSA 4OCRL 1F2XK 4LSPL 2Q86B 1NCOA 3BGMB 3N43B 1HH9B 4MZ2A 2GC4C 1S9YB 1CICD 5KN5B 1WZAA 1UT9A 1SM3L 4PJCA 3JTSB 5BXFA 5LJYH 5EWIH 4EDWH 3LRKA 1E9OB 1P84K 1I1YB 2CRZA 2C8NA 3JWNH 3LKNB 4GXFA 4XR8C 4F15C 5BV7H 4U4BA 4BFOA 3LN4B 1WTGT 4JG0L 4WEEA 5B38B 4ANWA 2DH3A 1EHLL 4AGPA 1R3HA 2QZ5A 5HJ3B 1BF5A 1RURH 1YY9D 3ZE2B 1A1OB 4L1LA 4KH2A 1NFDF 4XMWA 5JHDD 2FNWA 5IB4B 1XCQA 4PS7A 3GZOA 4PJFF 3MNVB 5EOCJ 2VYRE 2JMRA 4N0UB 4APQC 4WFEE 5JW3H 4DH2A 4I0CC 4R6UA 1TJGL 3INOA 5DJ2A 3OKDA 4AL8H 4G71B 4PJAF 5E4EC 1BQHG 2DZEA 4PJCF 1J7VR 1ROCA 4XCEB 5KANI 4NNYB 2WKLA 1KBWA 4L5FL 3K8LA 1LEKB 2ZUTA 5E08H 4GKNB 2J8UB 4XHJD 3KXFE 1VZIA 3VCLB 4JHAH 2PW2A 4AIEA 4S1RL 1FWXA 2BNRB 4FYQA 4P5TA 1A6TA 1W72H 3QA3A 4M7LT 4MAYC 4GQZA 5LGJA 4AIOA 5TD4A 1FO0A 1A65A 5IW3A 1ZLSH 4NLHA 4X6EA 4HBQA 1Q8MA 1WAAE 1VFBB 4Z7WB 5EN2A 3VG0L 1S7TA 3A4EA 3MLXL 3DPBA 3ES6A 4GIOA 4K5OA 3IXAA 1XX9C 4NUQA 3RBSA 2NW3A 2NCMA 4A6YL 3TV3L 1NUFA 2VDLH 5FPIA 5DMKA 1OP5K 4PJ9A 4NC2B 3KPQA 3TYFB 4OH2A 5D1ZA 5GGRA 4XAWH 5IF0A 2AQ3A 4FQQA 4GKSB 2HH0H 1S7UA 3ARDB 2DQHL 1XB3A 3VFPB 5KVEE 3LQAC 4KMTH 2R9HC 3QGVA 2GFBB 2DM4A 2DL9A 2LTQC 2VSMB 2GJ6E 4XCYA 4QTIH 1CJYA 2GK0A 3OMAB 5EO9A 2H32B 1LYQA 3VXTA 3DXAD 2A9NL 3DX9A 2AEOA 4JVPA 3UG5A 4AQZA 5FHBL 3VTMA 1QNIA 4D7BA 1HYSD 4JZJA 4ELKA 1I7TB 2IDCA 4DKDC 5I0XA 3WTTA 1V7NL 4AM0B 4OZFA 1PL3A 4AZ8A 1D7FA 3KPMB 1I3GL 4QD2E 1F4WH 1LEGB 2J1WA 1FGNL 3EFDL 2C7FA 3FHQA 2J2ZA 4TTDC 1JF1B 1OV8A 5AKVA 4GJTB 4G80B 5TJWK 2Y7SA 3BIKA 1HSAA 3Q2LA 4YHZL 1A21A 4FCAA 4F2MB 5BRPA 4J39A 3L9RB 4IBSA 2IBZX 2AQ1A 5L0QB 1J86A 2P3YA 4WWPA 1G9ML 5IESL 4FFYH 4NM4H 4PRHB 1TZGL 3BEVB 4GRWE 1VCBC 4WGKA 3W38A 2F1AA 3U4BL 1DQJB 1LP9A 2E74C 2K7PA 1OF0A 4W6YB 4U6YB 4WU5A 5EOCH 3BKJH 4NQCB 3ZTEA 1BQSA 2QLVB 2FHBA 2QTVA 3QDMB 5I1DB 4DVRH 1OTSD 3ESNA 3QEQE 1CD1B 1IGJB 4WI4A 2G60H 5C07B 1I9IH 1MWOA 1KCSL 5F70A 2VABB 3QFDB 2YKLL 3QDGE 2XN2A 3X3FL 3K2IA 3HG1B 5I9QB 4KTDH 2V2TA 3WFEH 5MEQB 3HC3L 4B96A 5LGYA 3FUHA 4U1NA 3F8UB 1U93A 1WZ1H 4GP8B 4QHLA 3STBA 2ZCHL 5CD3B 3FFCB 4YDJA 1UD4A 1HHKA 1CICA 2VDPH 4YHLL 1OSZB 1BOGB 1LP9F 2LABA 3BZ5A 2V2XA 3LRMA 1ID2A 3NCJH 5G4OA 2QGCA 4P5MB 1L5GB 3WLWD 4OCSL 2MTPA 3STLB 5BS0B 1U36A 4XAKD 4A7UA 2XN9E 3BP4A 3N91A 4XPHH 3G5YA 1J5DA 4PVMA 3K2UL 3EDKA 4P2OD 2ROYA 5HYQA 2DQUH 3F12A 4HGKC 1E4KA 3TNNB 4H8PA 3HR5A 5JQ6H 2IQAA 4LPYA 1QPKA 1I8MA 2WUBL 1I7RA 5CD5C 4HFUL 1ECZA 1CLVA 3CLEH 2NW2A 3DURA 3BYYA 4ZUUB 5B1JA 5KS9E 5E2VL 1WHOA 1QABA 5TK4A 1U8MB 4NKOB 4RZCA 5D7SL 5ESAA 5HJGA 3MRCB 2CUAA 2OR9L 2B0SH 3VB8A 1ICTA 1H3WM 5DEFB 3Q05A 3HE7D 2EUWA 5E8OA 2F1EA 1FPTH 4ZTOL 1TETH 1EEUA 3GMNB 4ZMAT 3V52H 5C0JB 5F6IC 2MOVA 1JYNA 2X9YA 4XP4L 1J1OH 1CYGA 4NSKA 4NKIL 4NZUL 2WIIB 5DR5L 2IH3A 5BV7C 3JWNC 2ORBH 4M1DH 1DDHB 2R0WH 4JMNA 2O6EA 4D3CH 1RJYB 4JBSA 5K39A 2CDFA 4HPYL 5SWZD 3NJHA 2NT0A 4FRWA 4J5VA 3QIWC 4HMEA 3LZNA 3ILQC 1M05A 1J0KA 1ZIBA 1LO2L 1XIWC 3IFNL 4JFXA 4U6VH 2Z4QB 3MA7B 3QB7C 4XBPB 3HC4L 1A7BA 5GQBA 5IQNA 4AYEC 5ADPH 2Z7YA 1MFDL 3ATFA 2MCG1 2ED7A 1MCPH 4HC1L 5HHQA 1KBVA 3MUY1 4N8CH 1HKLH 2XFXA 1A2YA 4NFCA 4WWID 2WZPD 4AL8C 3VD5A 4L8SB 2I85A 2OR7A 3TEXA 2ZCKH 1KLUB 2XQYG 1HHIA 2R0LL 3QNZB 3LSOA 1AJ7L 2PN5A 2LOEA 3MV9E 2YPLE 3MV01 3OAZK 1AKPA 1JVKA 1CURA 3H7LA 3TBYA 1UCBL 4MJHA 4RGMB 3OAUH 5HGDA 1VGKB 3VGAC 3K5SA 1DJWA 4WWOA 5AW4B 3DXAA 3O3EB 3SPVA 2ZKHH 4XNBA 1NGPH 4KTYA 4QXGL 4H88H 4AUYA 3NBNA 4LCCC 4ZK8A 4JQIH 3RGBA 5F7FA 2DTSA 3L5HA 2JKLA 5K9KA 2Q1EA 2G9HA 1E28B 3MTRA 1U3HD 2ZX5A 2DWEA 4F57H 2WQSA 4X5LA 1ND0B 3QS3A 4XNQA 4PY8J 3QQ4B 1PNDA 3KPRD 4UM9D 1TTRA 4HIHA 1G5AA 5AW1B 4G5ZL 4ZNCD 3FQWB 1KJMA 2W0KA 4OCLC 4HGWA 4G6FB 3EYSH 1WIPA 2MIZA 2N59A 3T0WA 1TJXA 3FPYA 2DV6A 1CUOA 4Z7VE 2AXFB 4LLYA 3C2AL 2PCFB 4DQAA 4MBRA 2E59A 5GGVL 5T1LD 1PZ3A 5D1QC 5TPWL 3V8CA 2NY5H 3C60B 4UDUA 2WQ8A 4FMKA 4PG2A 5EF0A 4JKPL 4ZUSB 5ESQB 1BZDA 4Q97A 5A43C 4QJ5B 4PI2A 3D0VA 1T0OA 4QYOA 1CFMA 3TL5A 3BGAA 1ZVSB 5C0FB 4A7TA 1AVAA 2DQDL 4HUXA 1MCBA 3QUMH 3ZKMC 2F5AH 4OJCA 3BLPX 4X6FA 5B3JF 1C7SA 4HFWA 4Z7NF 2CIIB 3FN9A 2FHFA 3IJHA 1RZJL 4MHHG 3ZU8A 2VDRH 4P2RB 2G75B 4UTAA 3TTSA 1FFQA 1B6UA 2XA8H 5SV3A 2GY7B 2ITFA 3BVNA 5TE7L 3D69B 3M1BB 1HZHH 1MLBB 1QZ1A 1SGKA 3MAWA 3TBWB 1MCNA 3FOMA 1JXGA 4P2YA 2JB5L 4AUUA 1SBSL 4QY8B 4ZZKA 4LCYB 4ZUWA 1MCRA 3SBWC 2LHAA 1QRKA 3PABB 1ZA3B 2ZZUT 4UNIA 4WVRA 4X98A 5FYKD 1ZY9A 3G6JB 2O6PA 4N0CD 5IHHA 3MYZA 1ECYA 1QP1A 5I17B 5FUOH 4P2OA 1SJMA 1IAIL 1KB5A 1V3KA 2QVTA 5J6HA 1YQVH 2XTJC 2V0AA 3IWVA 4OCYH 4FABH 4IS6A 3BN9D 4B9CA 1CF1A 4U1SA 5JQHC 1MHHB 3S0PA 2PKDA 3G3LA 1HWWA 4F15B 3EJSA 4G82A 4LXFA 3QIWA 3A5VA 1A4AA 3MGTB 1HOCB 4L4VB 1TLKA 1HINL 3KLHC 1MJ8L 2CG9X 1ORQA 1V55B 4EI5A 3MN8A 2YAPA 3WTSA 4GRLD 2XVLA 4YQXL 4I18A 1U6AH 4APQB 2H45A 4Z7OF 1H5BA 2FLRT 3O3AB 1OXYA 3RVTC 1IE5A 4IRSD 3JTTB 4WWNA 4V2CB 2NR6C 1HH6A 3UPAA 2ZYHA 1G7QA 3IDJB 3RY6C 5E4EB 3RAJH 1EA9C 4MBOA 4BKLB 2SEBB 1QLEL 4EUPB 1P4UA 1YEJL 3VI4A 4UQ3A 3RILA 3OX8A 4U4IA 1XTMA 1CT8B 1ORSA 3SJVA 1IIIA 1RJZA 2CUHA 5I76B 4LCCA 2OX5B 4OD3L 5EZJA 4LHUB 1RV6X 1NFIA 4JGJA 1MNUH 1SXNA 2BP0B 4MAYB 4MMYA 2R2HA 5E4IA 2WZPA 5ID0B 4X4KA 5F1IB 2EYTA 2FEJA 1XXFC 2XWTB 3QORA 3WNOA 2LR4A 2VLJA 4YHNB 4HUVA 3FO0H 1JNHB 4JR9H 2QJDA 3RHWK 2JB6B 4MJID 4DZBB 3I6GA 4HIPA 3OGCB 1XZ0B 1FNSH 2BNUB 4N2EA 5J4MA 4KKPA 1E5YA 5AW5B 1NMCC 1PU0A 3ZIYA 4N5UA 1B0IA 3WKYA 4TXVB 4DJMA 1GA2A 2TSBA 3VI4F 2XICA 3F84A 15C8L 1Z66A 5GSRB 2UY7A 4XBMA 4Z78B 1KXVA 2ZTBA 3NA9H 3CFNA 1Q9KB 2DQTL 3OKYA 1S5IL 3PNRB 2CDEA 2K6WA 2LTQB 4IMLA 1MCKA 2CCLA 3JT2A 4GAYB 3OBAA 4XVJL 4CADA 4J27A 2VCOA 3P30L 1S9XB 3KPRA 5EEZA 4UM9A 1Z5LA 3IU4H 3WY1A 4AG4L 1U9KA 1PZAA 3FB5A 4BFFA 1URLA 3NFPB 4AX3A 4YXHH 3H1ZA 2Q6WA 4JN1H 4I5BB 2Y1ZA 1FC2D 3LNGA 4PJIB 1R5WB 3QI9D 1M6UA 2MNWA 1BQRA 5BMFL 4JHUA 3V6ZA 3E6FA 4EDXA 2A6JB 1JZEA 2FBJL 5GGTL 4Y5YB 5SWZE 4GG6A 2G2RA 3N5AA 2F8OA 3OF6A 2Q2EB 3GXDA 3R8BB 1UOLA 5EF3A 1YVLA 4NNPH 5FF6A 2VDKL 5DEGA 1QZNA 3CFJA 3PYCA 1U2HA 5EC1A 3L48A 1T83C 3BUTA 3QEHB 5DYFA 4ZG1A 5TQ0L 3Q2WA 4M5ZH 3TN0D 3D18A 2BFVH 1EO7A 2B59A 2IH1B 1GZPA 2JCCE 4R5VA 1TJHL 1R17A 3OL2A 5ESVA 1OB1A 1XD1A 2FJFB 3ZE0E 3F6LA 1BVZA 1J05A 1FVDA 4N2MA 3SQOH 4XNZC 2O5NA 4S0TD 1HNGA 2EXWC 3P0YH 4OFYA 4PJHB 3LS4H 5FB8B 3BZEA 2PTUA 2DKSA 2R59A 1KTRL 5DVMA 3EF4A 3P3UA 4GG6F 2CLRA 3K0WA 2NNRA 4R90L 4U6HB 2N0KA 2HFTA 4CAGA 1NEZA 5CZVL 5IBLD 4Z8FH 3GMQA 5GS1B 3L4VA 2NY5C 1XQ4A 3STZA 5GS3A 5F3HB 4OU3A 5D7LD 4M02A 1P7QB 2NOYA 2Q7YA 2DQEH 4ZX5A 6FABL 1FL6B 1TZ8A 4ZPTB 3BT2L 4G1EB 2X2UA 3S88L 4LFHG 2H2SC 2KERA 5D7EA 5D6CA 2R2BB 5CEZH 1EO8H 3ULUE 2XA3A 2XWJB 1HCZA 4KJQC 1EZSA 5A2FA 2J8OA 3PJSB 2B1HH 4YZFE 2YPVL 2B08A 2AABH 1X3DA 5ERWB 1MZYA 3VXNB 5DO2D 4E42B 1DVQA 3CVBA 1QLFA 5ADOH 1AKJA 1Y6MR 3I9PA 4Z7QF 1XR9B 4LASL 3SDAD 3K4AA 2A9AA 3BQUD 4N1HB 5I18L 3CZKA 4WCYH 1ASQA 1EBPA 1T7XA 4JHWL 4AQOA 3LB6C 3L16A 3IJSB 4ZTPL 4DETA 1UTDA 5FYJL 1DSYA 4U1MA 2EDDA 2OI9C 4M7KL 4LDLB 4OFDA 4TULL 4YN3A 5AZEL 4E5XB 1O5DT 4OZ4B 2UXFA 1KN4L 2G4EA 2YO3A 3HG5A 1K85A 3HUJE 4PUBH 4BGDA 1K2DA 3TP4A 4LRNH 2FSEA 2YRZA 4OGAD 1FFOA 1P1ZB 1BD2E 5F7AA 3TLRA 1ZTMA 2X4PA 4F9LC 4FEMA 1TQUA 4L1BA 5F6IB 1YPZE 4Y16D 3EO9H 1F4XH 4OB5H 1ZV9A 3KYKH 5BV7B 2I5YL 1QBMH 3DIDA 4HVBA 4DTGH 1IKOP 3SYAA 3VGHA 1D7DA 5T1JA 1CDBA 3MRLA 3U7YL 2B1OA 2QGBA 4MJIA 2UZYA 4WFHD 3WJMB 2HVKA 4X6CA 1XFPA 2Z1PA 1YNTA 1XIWB 2VLRA 2NLJB 4FYRA 2XT1B 4HSCX 4JPVH 5I1CL 2JELH 1FL3B 2HA1A 2ZCZA 3LNDA 5BVJA 1WA1X 3IJEA 1LO3L 5GISH 3V0IA 3AREA 3MRBA 5C08B 1KTLA 1I9JH 3MRNA 5SWSA 1GKEA 1E9QB 5FW7A 5DUML 3TA4D 4TYUA 2KI6A 2C34A 5CLYA 3VXSB 4U1HB 5JOPD 5GSVB 5DYOA 1LM8V 2B16A 5F1NA 4XVTL 4PJXB 4LVOC 3RG1C 3D2UB 4NERA 1W6WA 1W72B 3B9KD 1T83A 2UWEB 3NTCL 4X6CF 5FDWB 3GEWB 1BBDL 2KZ1B 1YNTF 3MVSA 1Q0XL 3QI9A 4KKAD 3RL2A 2CO1A 5TDOB 1HEZA 4N9GA 2N1KA 3RNKA 3I6KB 3BJ91 1JNLL 5C6PB 3S7GA 5D1XE 2BRQA 1GJUA 1Q4NX 3QHFH 3V8OA 1JRHI 5ANMA 2FD6L 1WA2X 3GXTA 4X5QA 1PIGA 4Y7MA 4LK4A 4DEUA 1R5IA 3QQ9D 4I48B 1A8JH 2VDLB 4LLMB 4YNYB 2JQMA 4Y2OA 1OCWL 3DTXB 4UUJA 1XF4B 4G7QB 5SV4A 5FFLA 4Y19D 4WK0B 3ZO0A 4CVXA 3ROOA 3WI9A 3VRLF 3O2VH 4IU3B 4NNXA 3TN0A 4WHYG 2J6WA 3SGEI 3QW9A 1PEWA 4NM8L 4WKZB 3RLSA 4D9LL 1NEUA 1QG3A 5D1QB 4UTBA 1MPAH 2VKXA 4JG1H 4U49A 3S5LG 5I1IL 4XP1H 3HMXH 2ATAA 1CQYA 2F0CA 3QIBD 3F2LA 1KCVH 3ULVL 3FF8A 2MNUA 4FMVA 3UL4A 4TSBL 1Q9LA 5DJXA 2C9XA 3C6LC 3T8VA 5EU6D 2ZF9A 2AK4A 1QSEB 2IOOA 3UTTE 5EU5B 5MP6L 1S6NA 3MJ7A 1A4JB 2EAEA 2J43A 2CIKA 4R4NC 2EYRA 1O6SA 1PCXA 3KL5A 1T1XB 1BZ8A 1ADQA 4KNUA 3MJ9A 2FL5B 2A2QT 4X4XB 5I6KA 1MIMH 2B15A 1O9VA 2KZBA 4ODXA 1AIZA 4TUOA 1G6RA 2FIRT 3VXMB 2K3TA 1XMEB 2R56L 1SY6H 2C3WA 4R26H 1IFHL 3A3YB 3L5WB 4G6AC 4HDIB 1AQDB 3ZT7A 1KTDB 4NO5A 1JFQH 1E8XA 1NBYB 4PLJD 3AGVA 1E3XA 1RVFL 4WEMB 1HIMH 4QHKI 5DWUH 3S36X 2D7NA 3SDAA 2FEDD 2GCYB 3BDYH 3OD3A 1Z9MA 4TVPH 4XI5D 2XTJB 4UOW0 3W9DA 4RA3A 1J5OH 4PMEA 3PGDB 4UT7H 3BCDA 4NQVB 3QPXH 2I26N 3P2BA 4OTXH 4YXLH 3WXWH 5E8DH 5HYJB 1U95B 2ENSA 4MJ5B 4ODTL 1AE6H 2BSTA 4MYPA 2BIPA 4L4TD 4TLKA 1UACH 4E9RA 3B37A 2VMEA 2H8PB 1TSRA 3M8OL 2HKHH 1UKQA 2VDPB 1SYVA 3D48R 3DIVA 4ZBJA 1T7ZA 4Y16A 4HWUA 1MW2A 1X5IA 4LP4A 5DS8B 3VGGA 5BPPA 2YRPA 3BWUF 3QARA 4EKXA 3HG3A 2G5BA 4R97C 5A2KH 1INQB 1VESA 3DMMC 1SUHA 3ARUA 4OZGB 1BMZA 3MCKA 3EO0B 4KK5D 1FUNA 5FXCH 3FTUA 2EIKB 2H2PD 4FQXC 3S2AA 1BA9A 3S34L 2VXSL 2WBXA 1MCQA 3ALXA 1ZXQA 4LSTL 2ZUYA 3N3EA 1P4LA 1RK1B 4JW3A 1TKWA 4HUUA 4LIQL 1Z9SA 4XVSL 2EIZA 4UTCA 2NZ9C 2PXYC 2YSSB 2UX6A 5IVZB 2X6BA 4KV5F 1U8KA 3RA7H 2K9UA 1N5YH 4OW6A 2X40A 5AYUH 3GMMB 1I9RL 5ETUA 4JFPB 1S8DB 4FNRA 3GNMH 1EXGA 4QKTA 2DQCH 2X6VA 4CC0A 1GGTA 4FYTA 1NMCB 2OMVA 4I7ZC 2QDVA 1UG9A 2QR0A 4YXKL 5HI5D 2PYEE 1QRND 5CSZA 3WEMA 3JWDL 4AI7A 5I1HL 2FR4A 3D0LB 3SDCD 3KPNB 4ZAKD 3COOA 4O2CB 4M6ML 5KOMC 5DJ8A 5BO1L 5LN4A 3CPLA 1QR4A 2Z92B 3NT0A 4HKXA 4ZYKA 3X1FA 2DBLL 1DYZA 1MI5A 1KIPA 5K33A 3IMVA 1X44A 3X14B 4P06A 4D0CB 1NWPA 3CU1A 4U3SB 2X4TB 3KWWA 1NZRA 2QSTA 3I75B 2GSIB 2IPTH 2HLEB 1DQKA 1SBBA 3EOYG 1OAQL 1V7MH 4Y19A 3C6LA 5CIPH 2E86A 2DMCA 3IDGB 4TUKL 5HGHB 2LQRA 4PG9B 5CZRA 1HDMA 1FH2A 2YEZA 5C86A 1QW9A 1KT2B 3PQYB 4HUKB 3TEZA 2W07B 3MXVL 1OY3B 1OTTD 1XF5B 5DK0B 1OPGL 3KPOB 3F7QA 4O2EA 5AUMB 1IKFL 4IKNA 1KTBA 2FECL 3QIBA 4L3EB 2BNQE 4KH9A 3MCYA 4M5YL 5IKCB 3BVXA 5EU6A 5AALA 2P8PB 3AGWA 3CC5A 4K2UL 4QRRA 4DHLA 5C71A 1YMMD 3K72B 3PIQB 4YUEH 2RCSH 5FO8B 2PPDA 3UTPE 1FFRA 1CE6B 4QRSB 1MELA 1S9WB 3IAQA 5CBEB 3GXPA 3EOTL 4G83A 4PPTA 8CGTA 2NQ3A 4XNZB 3SO5A 1IGFH 4JZOB 3CFIC 3LZFL 2FIKB 1TVHA 2ZUWA 4JPIA 2KT6A 3QUYC 4OKDA 4V1DA 2ZWSA 3R7QA 3T3PF 4D0BA 1WICA 1E6JL 1A7OL 5B7MA 4ZSOB 5GHWH 2FJGA 2LV4A 2XWRA 1QYGH 3D30A 4HUWA 1RIVH 2M1KA 4FL4C 3DGGA 4O5LH 1MFEH 3CX5J 4ZODA 3QYMA 1JL8A 2OMYA 1FC1A 1Y6NR 3BOVA 4QI3A 5J57B 2D0GA 4HWEL 5BQ7B 5I66A 3QUMB 1PY4A 4WFGD 2WXQA 2BXYA 2IBBA 2OMBA 5DZPA 1FCGA 4FXGB 4M1GH 2VDRB 4OBRA 3RYMA 3ZHLA 2ZXBA 4L4TA 4UU9B 1DBAH 1YMHB 4QWWC 1JYWA 2QGEA 1P69B 3NIFF 2GHWB 2Q2LA 4N90E 2VN6A 4P59L 4XCNA 3CIAA 5IVXA 1ZRUA 4PEEA 1H3TA 2X0UA 4DNLA 2BNRD 5IB3A 3BDBA 3LPOA 4GW5A 4Y5VA 3SGEH 3PHSA 3ZDZB 2OI9B 4JE0A 2IFGA 3P1VA 3TO4A 5CAYB 3ARSA 4ZO7A 3LZOA 3NVQA 5HYSB 4YLBA 4C58B 2N0MA 4NHUA 2GBTA 1J48A 2JK5A 4AIXA 5F0JB 2EUVA 4G8IA 1L9QA 1J1XL 2WNWA 1GHFL 1UOKA 5IHBA 3KGSA 4ADGA 1ZS8A 3IBOA 1N59A 4J1UB 3WHE1 4KK8D 4JM4L 4GUQA 2W0FA 2W38A 4YFLI 1KOAA 4PRPE 4AH2A 2UX7A 2XG4B 3LXAA 4PJ7B 1FYHB 4TN9A 3NN8B 1WEJH 1XO8A 3ROLB 1UKTA 3T4AA 3I6LD 1L6PA 2Z93B 1JUFA 1RZGB 2W92A 3QZBA 4I89A 1XR8A 4K94H 4FQJH 1DBJL 2WXFA 3VD3A 1UZ6F 3EYUH 1QRNA 4JFOB 3WEAA 5AVRB 4DOHB 2ZKYA 4GNKB 3BW9B 5FM5O 3SDCA 4ZAKA 3RQ3A 4YDVA 4P4KA 1JNNL 3SE9H 3MRFA 5TDNB 3MRQB 1KLGB 3K1KC 3ASNB 1NCWH 3LRHA 3QUGA 4H8WH 1GS7A 4WFFD 4PJ5B 4CC1A 3L4ZA 5IIEA 2Y7QB 2XXGA 1FF5A 4HIJB 3V0VB 5EEVA 4U33A 3WJJA 1I3UA 2KL6A 1PAMA 2BW4A 4LEXH 4UIKH 4LVOB 4PBVC 1BBJB 4PRIB 4MZRA 5JW4Q 1KEGH 4XPFL 2AVFA 4FAAB 1HL8A 3TT3L 3DHPA 1IAKB 3W39B 4FFTA 1NGWB 4O00A 3FB7B 3QCVH 3UP6A 4C56B 5K59E 3HI5H 4PRHD 1I8AA 5DUBB 4PGCA 1W0VA 5DWPA 1YA5A 2BOBB 2H47C 2NY2C 3AC0A 1AP2B 3WS6A 2W60A 5A3IC 5ITBH 3OKMB 5FA3B 2HZHA 1C12A 1IC5L 4HHGA 3HR6A 3LIZA 3K71B 3KLDA 3CHSA 4CU6A 5HHPB 5AWNH 4KY1H 3HC2A 4JEGB 4R0LA 3QDMD 4HJEA 5EBMB 1CMOA 3NZHL 4IEFA 1UM6L 2QPDB 1FV1B 3QUYA 5D8JH 4TRPL 1L6ZA 3CDZA 3D6GA 3DX7A 3MROA 3QXUA 5BRZD 4BRJA 2IANB 3B6SA 1UD5A 3MBWA 5FGBC 5C07D 2EICA 4X7SH 4HSAC 3IF1A 3VNZA 1YMMA 2WPGA 3TOPA 1IC7L 3P9MA 3IE9A 4PRAA 5LCVH 5A6IA 5FECA 1MG3C 4UT9H 2D0HA 4HJ0D 5GJSH 4XGZB 5KUKA 3EHBC 4NQUA 2YD7A 1NCNA 2QFPA 4OF3A 1PD1A 3I02B 3WE1A 1JWUB 2VLME 3NZUA 3CXHJ 3PFQA 3UZQB 2ZCLH 3JTSA 2HJFB 4HJGB 5KSBB 3KPSA 1TTFA 3MLTA 3NGBC 2V2WA 1T2QL 2NYYD 4K3HA 5BS0D 3CFKA 1OQOA 4LEEA 4L29B 4TNWK 4HWNA 4XNUH 1JD9A 4PGZA 1H6UA 3OKLB 2PP8A 2V33A 4HS3A 4DCQB 5C7XL 2UV3A 1X5KA 3F3HA 4N8VB 1E4XL 1Q9WB 2MKLC 5ILTH 2XFGB 3V0WL 1BFSA 1DJXA 5FGSA 1PKQB 1IGML 1K4DB 5DD6A 4DN3H 4JFDB 2IMNA 5IM7A 3QXAA 4JFYA 3L6FB 1XL4A 1BZQK 1OLZA 4WUUE 4N0UA 4Y4FD 1SMOA 3IJYA 5E70A 2Z31C 1OP5H 3N43F 3QNXB 2NUTB 4UDTB 2VQTA 4HWZB 2GHZA 1VFAA 2AQNA 1E4WH 4Z0BH 4MJ4A 4G7RB 4L8BB 4M62H 2CO6B 4YSSA 1ILUA 2VO8A 1ES0B 3PREA 1Z3RA 2Y36L 3ZL2A 4AQ1B 3JQOB 5KSAC 4CJ0A 1IVTA 2IDQA 1LK2A 2K3HA 1JFHA 4TQIA 3ZE2F 3DUUB 3B9EA 3O4LD 4AW7A 3FB6B 5E2TH 1JHLL 5AVWB 4K23L 2AJSL 4NBXB 5SWQA 4GXUM 3RFRA 1DLFH 1FIGL 1FLRL 1JPFB 1LMIA 3DX8A 3PDDA 3LS5L 3QPQC 4GKZA 5TQ2L 4F91B 2A38A 1GAFL 1S7WB 3H85A 5E1AA 2EILB 1XT5A 4X8JA 2EYSA 1UA6H 1B2YA 1ZTXE 3NIDF 4A7QA 1AFVL 3UAJA 3H2WA 4K71C 5KYYB 2FWOB 5FYLE 1EV2E 1W9XA 3LH9A 4XHQA 1L6XA 1GZQA 2F6AA 1QOKA 3WXVH 1K3ZA 2XJKA 4R97B 1QR1B 2B4CH 4OUUB 4ATWA 2J6EL 3DMMB 5AVQB 3X17A 5B39G 2BP8A 3VQ2C 3FN0L 1BAFH 3FOLA 3GIZH 4LLQB 4OQTL 4BZ1L 1Q1PA 4ZUTA 4IRJA 1CBVH 1T5WB 2JI2A 1AACA 3MLPA 4OR1A 1ZLUK 4N8UA 1GCYA 2H32A 4FQXB 4KROB 1OCZB 2ZAIA 3SE8L 1A3RL 4NAMA 1JV5A 3PHOB 2DB8A 3AXHA 3DDGA 3OLDA 4GAFB 4ODBD 3CIQA 1F13A 1LILA 4Z7WF 1A7RH 1O7DE 3QNYA 4JK0D 4WFGE 4RMQA 5DFWH 3TWCL 1G1OA 2PXYB 2AERT 1HQ4B 2IVFC 3CSTA 2OK0L 4OI7A 3Q8AA 5I1EH 1S7RB 3VRJB 2YEVB 4NXKA 2BHUA 4G80A 3CMOL 4R7XA 3CVCA 4R2GD 3W9EB 4MCMA 1KJVA 4RSVA 1BVKB 3VGDA 1TQCB 2J8UE 3QQ3B 4QTHB 2Z0UA 2FDBP 3GI9L 4NC1C 1T6BX 3C75A 5F0MB 4LDEB 3BEVA 1BDYA 3SGKA 1UADC 3M1CA 5AOLA 3GYRA 2L3BA 3D5OF 3OXSB 4LPVA 4BWTA 3C60D 4XMLH 3RGVA 3L8QA 4PS4L 4K94C 2IGLA 1YYML 4LU5L 3IFOB 1YYLH 1N7ML 3VFOB 3KCPA 3DIFB 4E41B 4MQ7A 3QDMA 3L9YA 5KVMC 1ET8A 4JB9H 2JJSA 2K8MA 4N24A 1FVEB 1OM3L 1IGJA 1YEKL 3C6EA 5BRZA 2YAQA 5JXAH 2JIXB 1IM9A 4G72B 2Z7UA 1M71A 5E03A 1AO7E 3TEWA 1XH2A 3NRQA 3PWNA 4LSPH 3V9FA 1NIDA 2L04A 4AEFA 1B4JL 4QUOA 4QJ4B 2FGZA 4P2RD 1VFOA 2ODIA 4ORGA 2YZ1A 5C0BB 1DJGA 2AXHA 2W80C 4I9WD 1D5MA 4Y9GA 4N6RB 1U8NB 1KFGA 1XAKA 2GSGB 4NUPA 5CD3A 1J9QA 4TQEL 2OMTB 4D94A 1BIIA 1BOGA 2KLRA 4QHUA 3V10A 2ZX9A 3QSKB 1YN7B 4MB4A 1NBQA 2FQEA 1N3NB 1LL1A 2AMUA 3CN1A 4ZW5A 4GOSA 1TXKA 3BIAX 4O2FA 1EHLH 1IJ9A 3OG4B 4KX7A 3O4OB 3QXDB 2HCZX 4K3EL 3UJJL 1KWKA 4NXSA 3M45A 2DM7A 3WEBA 4RDBA 4XOAA 2D3VA 3EFOB 3TNNA 4JKWA 5F9OL 1J0IA 1MRFL 5E2WH 2FBRA 1K8DA 1U8CB 3N6YA 1TJGH 3CFUA 4GW4B 4Y4FA 1A6UL 1YEEL 3T65A 3TEYA 3N0PB 3WU1A 4LZKA 5F97E 6CGTA 3UC2A 4PRHE 1WK0A 2WWKT 3BIBX 3ZGIA 3UXFA 4XB7A 1XAUA 5FS5A 2MCMA 4L5FH 1OGPA 2XPYA 4D0DA 2PR9A 4L4VD 1FFPB 3Q2CA 4N2FA 3TC9A 4S1RH 2YGVA 4NQCE 4HYTB 4G6ML 5FW6A 2J71A 3O4LA 4APQD 2WJ7A 1NC4B 2NTFB 1E2ZA 1RJYA 4KK9D 4AMKL 2R29H 5AW3B 2Z8WC 5D7IE 1SDAB 4QLWA 4ZO9A 3R7RA 4ABWA 1USQA 5IFJA 2LFGA 4ONHB 3NJLA 3HG1E 3H0TB 2R7EA 5EH1A 1OL0A 1HE7A 2VH5L 3MA7A 4R7LA 5J6GB 4IDJL 3D33A 3FFCE 2WANA 2R69H 1H3GA 1SUJA 3HZMA 2X1OA 1DBBH 1KCLA 3QO0A 4KHTL 4XBEH 1XV8A 1KPRA 5JPNC 1K6QH 2QL1A 3A6OA 3GTVA 3CN3A 1WD8A 2P8LA 4WJ5A 4IJ3C 1U91B 1EZVY 2D7OA 3P3TA 5IP4A 1FE8L 4QOKB 4TVUA 1IAII 2A9NH 4LCVA 4F8LA 1DVUA 1EUUA 5JUEL 2L8AA 5I1JL 1CS6A 3D85D 4B27A 3QDJA 1A6AA 1V7NH 5F7UA 3NABH 3NCCB 2GVYA 1TYEB 1FGNH 1WUZA 1J10A 2FYYB 3KBFA 3MBED 2Q8AH 4ZMZA 3E9UA 5I24A 5E2UH 1M57B 4G3YL 3LEXB 4LMQE 1JBJA 2R9HD 3NPZB 4DP5X 4H5SB 5H35A 1HOEA 2E6JA 4W9GC 4NOFA 1EGJA 3V55A 1G9MH 3QJFB 5IESH 4FQLL 1DTUA 4GMSH 1CG9A 1EJOL 1NBCA 1TZGH 2A6DB 1UJ3C 2B4CC 3B2MA 2AGJL 3OLGA 2G2NA 3O41B 4OF7A 3APNA 3H3BC 4UV4L 3U4BH 3E2HC 3VMNA 5GS2H 2J21A 5DEZA 4NWUL 2GIMA 4RGNE 5LAPA 4FS0A 1DJYA 1Q0YL 2EKSB 1NTDA 3EYQC 1KGIA 2YARA 4Y2DD 4Y4HC 1TVDA 3KGUA 2BIMA 3WENA 2ZF8A 1JHTA 4CC4A 4O4YL 2FH8A 3AXIA 1ZVSA 3UGXA 1RU9L 4JFEB 4P23D 2CALA 3MLRH 4B41A 1VKXB 3PWUA 2AITA 4NO3B 4K7PL 1LO0L 2N56A 2YKLH 3VWKC 3X3FH 3A24A 2A83B 1ZHBB 2HT3D 5T1KA 4XX1E 2NY2B 4P2RA 3G5VB 2MKWA 2ZCHH 1R1CA 1T0MA 4FHBD 4AGOA 2JF1A 3M1BA 1J0JA 4YHLH 3QO1B 4L1HA 4B0MM 2HT4D 4F7KA 5T3XD 5F7BA 3EBIA 4N6QA 2ILLA 2H0EA 4TSAL 1R46A 4QY8A 3N1MC 4ZFZB 1W15A 4BUQA 4NQDB 3WY4A 4MZ3A 1JGIA 4PV8B 4PLOB 1HXYB 4M61B 1TF4A 1CDYA 3K2UH 2B77A 3G6JA 1JYXA 4UINL 4WW1B 3JV5A 3P4OB 3MACH 2BINA 3V7AE 2YK1L 2OZ4L 5LBVA 3DX6B 2WUBH 1NDGB 3EHBB 3QJRB 4AQAA 4O51A 3IVKB 2OP4L 4IKLA 1UWYA 3MRPA 5M94B 4GSRA 1ZIAA 3WNKA 3MNWA 5CIPB 1UCTA 3K3QA 3MV7D 3PXHA 4AJWA 1A25A 3NGBB 2JVUA 5D7SH 3U36B 1NSNL 4FLRA 4UILL 5C6WH 4W9JC 2B1AH 1WFOA 2BOLA 4LAJH 4BSJA 3WY3A 3MGTA 5F21B 4EOWL 1WZKA 4HOMA 4XP4H 1XGPB 5CBAA 4NZUH 3G6JF 5DR5H 3UGEA 2RTTA 5T1MA 4LL1A 1E5BA 5DHVB 5BQDA 4DVBB 1ZGLM 1CFTA 1VENA 3RWCB 5CD5D 3U9WA 4YX2L 4HPYH 1DZ0A 2Z31B 4FQCL 4Z3GA 2FUQA 2PUQT 3LKPB 1ETZB 3H9HA 2WXKA 3IETB 5EIIG 5IT2L 4Q14A 2Q7AA 3MUGB 3BXNA 5E00B 1KBKA 1MZZA 3D9AL 3HC4H 3PL6D 4JZNA 5FKAA 3AM8C 4ATTA 1PIFA 2CKBA 4B9ZA 4KZEH 1QTYT 2EH7L 5IVNA 3S3PA 2DDQL 4TS6A 3P77A 2BK8A 5I76A 5LG6A 1X7SA 2WLNA 4WO4B 3US9A 2J55A 2XBZA 3MMEA 4PWKA 4UANA 2R0LH 1AJ7H 1MWAL 2BP0A 2O61B 3IMRA 4FX5A 5CZKA 4JDZA 5BZZA 2XWTA 5FWQA 1UCBH 4YHNA 3PWVB 1NICA 4QDGA 5HPOA 1JNHA 3BKCH 4PWJA 2OTPA 4ZMQA 4XPBH 5D9SA 3LV3A 3OGCA 2C4FU 5DMGD 1EFQA 3SE3C 4G8FA 1LP9E 4QKXB 2CHNA 1PZBA 3N85H 1CL7L 4X6DA 3TCTA 3VD4A 1AS7A 3D85A 1N0LB 3LZLA 4XCCH 3ZXAC 1HEJC 3ZUCA 4ELDA 1I7ZB 2WAQA 3VWJB 3NSDA 1E3ZA 3QRLA 7TAAA 2PPCA 3QCUH 5C08D 4IGBC 3ZYIA 2H3NB 3MBEA 4YSDA 3BUYA 4Z78A 2J4WL 2C3HA 1JWSB 1KYAA 1KZYA 1A4KB 4LPWA 5T3ZE 3DPDA 1T4KA 5L88L 4Y4HA 4HIXH 3ZTCC 4ICXA 2ADFL 4J3BA 4PJEB 4G5ZH 4CMMA 2XYCA 4JFFA 3QJVB 1GSKA 1ZHKA 1M7UA 5AZUA 3CSFA 1DFXA 4H0GA 3C2AH 3VWKA 1R5WA 4X6DF 3K74B 4I0PD 4AGMA 1E0OB 4LNRB 4XNYL 1D2PA 3RWIB 4JKPH 1SXZA 3TGXA