2HRGA

Crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
496
structure length
496
Chain Sequence
b'AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Crystal structure of the blue multicopper oxidase from the white-rot fungus Trametes trogii complexed with p-toluate
doi rcsb
molecule tags Oxidoreductase
total genus 143
structure length 496
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA03
2PPDA 4KO5A 4YSOA 2B08A 4JHVA 3X1GA 4G71B 2TSAA 1KDIA 1MZZA 1JERA 4PAZA 3ZBMA 3WG7B 1GSKA 2A3TA 2IDFA 4FAAB 5I5JA 3WI9A 2HX7A 1JXFA 7PAZA 3DIVA 4QLWA 5FC9A 4A68A 1QHQA 1NINA 1PZAA 1MZYA 3V9CA 5B1KA 1X9UA 5F7BA 1NZRA 1R1CA 3UACA 1AZBA 2J5WA 4KNUA 2CAKA 2EIJB 2W88A 1J9QA 2GHZA 4DP8X 2W8CA 3NJJA 1BYPA 5E9NA 2HX9A 1L9RA 3ERXA 4KO6A 4BWUA 1F56A 1WS7A 2WO3B 2IAAC 2X88A 6PCYA 4YSQA 2VW6A 3U25A 1AG6A 4F2EA 4DPBX 4WTQA 1AANA 1W6WA 3TASA 4BXSV 4MFHA 4E9QA 1SJMA 1CYWA 4JKNA 3DKHA 5TK4A 3FQ2A 1AR1B 2WO2B 2YAHA 9PCYA 1DZ0A 4PCYA 1GY2A 4HALA 1XMEB 3PAZA 2BW4A 4DPAX 2Q9OA 3QJSB 1ILUA 3ABKB 3AG1B 5IY5B 3FPXA 4YVUA 2PP7A 4W1TA 3EHBB 5AZUA 2HZHA 4KNSA 4E9VA 1AQ8A 4YSRA 2FQFA 1OCOB 3JT2A 4GP5B 2CBPA 4KOCA 4X4KA 4M3HA 2IWKA 1KV7A 1BXVA 1M57B 3QQXA 4YSTA 2EIMB 3NP3A 2EILB 3IE9A 4YVNA 3NJMA 4BWWA 3PLYA 2YAQA 1ZDSA 2OV0A 2Y1AA 1N70A 3GXUB 2BW5A 3MBWB 3NJLA 3T6WA 1PNCA 2IH8A 3QJRB 4CSZA 1JZIA 4A2GA 2WSDA 4A2EA 1JOIA 4AZUA 1L9OA 1HFUA 1JXDA 1FFTB 5I28A 2JKWA 3OQRA 1PLCA 2PP8A 3UGEA 3FU9A 1JVOA 1VLXA 4BDVB 4KOBA 4E9SA 3QJUB 2XV0A 3T9WA 2GC4C 2XU9A 3IN2A 2VSMB 1NIBA 1NIEA 2VM4A 4JHUA 2FQDA 1YLBB 1SDDA 2AANA 3NYKA 3X1FA 4HHWA 3NJFA 2J57A 3T6ZA 3CZUB 4GP4B 1PZCA 4ZK8A 2RACA 2YARA 1AIZA 3GDCA 3KW7A 2BO0A 1SNRA 3FSAA 3ASNB 1IBYA 4E9XA 2BWDA 2YXVA 5I6KA 5I6OA 3FYEB 1IC0A 1QNIA 3AG3B 4YSDA 2FJSA 3ABLB 1ZIBA 5F7AA 4BWTA 4AKPA 4DP1X 1J9RA 4HAKA 3UABA 5I6MA 1OF0A 4BK5C 1AZRA 2R7EB 1EHKB 2PCYA 2GIMA 1SF3A 1ET8A 1B3IA 4W9ZA 5AFAA 2B3IA 3CDZB 2Y69B 5AKRA 1BAWA 2QDVA 3NSCA 4G7QB 3S8FB 3N55A 4E9WA 4A2FA 3X1EA 2DWSA 3T71A 1XB6A 2UXGA 1DYZA 2HX8A 2VW4A 5I5IA 4WKXA 3AW5A 1M9WA 4A2DA 1JZJA 1PAZA 4GYBA 3FU7B 2H47C 1IBZA 1BXAA 3OMIB 2OJ1A 3S8GB 2P80A 2JXMA 1OV8A 2PPEA 2ZWNA 1NDTA 3FQ1A 1ILSA 1A65A 2XX1A 2LLNA 2BZ7A 1W8EA 1ASPA 1PLBA 1ZDQA 4UANA 5I26A 3V9EA 3WNIA 2PP9A 4Q8BA 2XUWA 2XX0A 4QKTA 1EZLA 1XB8A 1E5ZA 2FQGA 3AG2B 1ASQA 1IKOP 1JZGA 1RZQA 2MTAA 2IDTA 3JTBA 4GXFA 3ZIYA 1WA1X 1WAEA 4UF7C 2DYRB 1UATA 3C75A 2CJ3A 4KO9A 1NPNA 2BHFA 2BZCA 1OE1A 2IWEA 3X1BA 1QLEB 1NIFA 1T5KA 5B1BB 2JFCA 2GBAA 3G5WA 1JZEA 5B1JA 2UXFA 2VSKB 3QJTB 1JVLA 4A67A 3DTUB 1NWOA 1JXGA 1SHWA 1BEXA 2CALA 2UXTA 1GS8A 1ETJA 5D4IA 3S3CB 3UAAA 1JZFA 4EF3A 1J9TA 2BP0B 3H4HA 1A3ZA 4HCFA 1GY1A 3H56A 2XXGA 4N8UA 4P5SA 1URIA 2Q5BA 5B7FA 1RCYA 5I6NA 3EH4B 2HRHA 1L9TA 1NTDA 3CG8A 3FPYA 5PCYA 3TBBA 2CUAA 1BXUA 2VMJA 4FA7B 1WA0X 2YXWA 1CC3A 3WKQA 1V55B 3NJHA 4E9RA 3NSFA 3UADA 2UXVA 3BVDB 3PAVA 3OMNB 1L9PA 1OE3A 1GS7A 5I5MA 3SBRA 2GB2A 1NIDA 1SFDA 3EF4A 2N0MA 1J5CA 2ZOOA 4AI7A 2IWFA 1AACA 2VM3A 5D4JA 1N68A 4AKOA 4DPCX 3TA4D 2DY2A 2PPFA 3X2QB 3QPKA 2AZUA 3SBQA 2J56A 1HAUA 2I7OA 3D12B 4YSAA 4HCGA 2QDWA 4TXVB 1SHXA 2FT8A 2CCWA 3L45A 1E67A 3NJNA 1AS8A 2QT6A 3ZDWA 2NRDA 1SDDB 3S3BB 1FWXA 2AZAA 1ZPUA 1M56B 4YSCA 2AVFA 1BQ5A 1MG3C 2IDUA 1NICA 3CVDA 3AY2A 4G70B 3PPSA 1ZV2A 3CDZA 1L9QA 1PNDA 3H4FA 4UAHA 2PLTA 4YSPA 1PY0A 1NPJA 1NWPA 2BP8B 2DYSB 2YAOA 1I53A 1L9SA 1RKRA 1HAWA 1WS8A 2FNWA 4HHGA 4NB7A 4DP6X 2YAMA 3SBPA 5B1JC 4E9YA 1FA4A 5LDUA 5ANHA 3FYIB 3QJQB 1OOWA 3FSVA 1PCSA 3TU6A 2UX6A 3S3DB 5TK2A 1SFHA 1ADWA 2FWLB 3PCYA 4G7SB 4RH4A 5B1AB 1X9RA 1AG0A 1MG2C 4BXVA 1JZHA 1KDJA 1MDAA 2YAPA 4DP0X 1OE2A 4HCIA 2H3XC 5I6LA 2FTAA 3PAUA 3FSZA 2HRGA 1ASOA 1A8ZA 1PF3A 1KCBA 1OCRB 8PAZA 3HB3B 5D4HA 3AG4B 1TEGA 5B7MA 1W6LA 2I7SA 4HIPA 5A7EA 2PCFA 5I6PA 1NIAA 2PPCA 3TBCA 4DP7X 1CURA 4KNTA 3FSWA 3AZUA 3FT0A 3SQRA 2FT6A 4GY4A 4N4YB 3NJKA 2VW7A 4A66A 2DV6A 2HLEB 4HZ1A 3HEIB 4CSPA 4DP2X 4NERA 3FU8A 3GYRA 1AZNA 2UX7A 4KO7A 2IH9A 1PZBA 1CUOA 4AKQA 3WKPA 1KBVA 3OD3A 1WA2X 2YAEA 1XB3A 2BP0A 5PAZA 3NSDA 1BYOA 2TSBA 1AZCA 4NAJA 4YSSA 1A4CA 3CVBA 3UAEA 1E5YA 1ET7A 3IBOA 1TKWA 3WIAA 2XV2A 2PPAA 2FQEA 2IDQA 4M4RB 3ZX1A 1ET5A 1V54B 2XV3A 4G72B 1TEFA 1PLAA 4K9JA 1BQRA 1CYXA 2IDSA 1KCWA 2OCCB 3NP4A 2ZXWB 3MX0B 3NSYA 3QJVB 4YSUA 2AFNA 2VN3A 3RYMA 5EHFA 4DP9X 3EH5B 4E9TA 1AZUA 4BDVA 3ABMB 1TU2A 1AS7A 3ABGA 3T6VA 3X1NA 2P80D 5B3SB 2XLLA 1RZPA 3OMAB 4P5RA 1BQKA 3NJIA 1PMYA 3T6XA 3ASOB 3OM3B 3N2JA 1A4BA 1OCCB 1E65A 2GSMB 6PAZA 3KW8A 3NT0A 2MRYA 3FS9A 2XYBA 1KBWA 4Q89A 1A4AA 2H5UA 2I85A 3CVCA 3EH3B 1J5DA 3WNJA 3NJGA 4DP5X 1ZIAA 1AAJA 2ZONA 2DWTA 1GYCA 1AS6A 1E30A 3BQVA 1IUZA 2XWZA 2E86A 2XXFA 2X87A 1OCZB 2R7EA 4YL4A 1V10A 5B7EA 1GW0A 2EIKB 1KYAA 1SF5A 2FT7A 2YQBA 4A2HA 4F2FA 4F7KA 2QPEB 2YAFA 1KGYE 2GC7C 4YSEA 1AOZA 2J55A 7PCYA 3IEAA 4GP8B 4AX3A 3PXLA 2BP8A 2BWIA 1J9SA 4G7RB 1ID2A 2QPDB 2GI0A 4L0PB 1GR7A 2EINB 3FU7A 4DP4X 4ENZA 2HXAA 3IN0A 1GS6X 2XVBA 3FQYA
chains in the Genus database with same CATH superfamily
2CMRH 2UZYB 3EFFB 3PL6B 1SOQA 3VXRD 3QZNA 3JT0A 2M2DA 3RJQB 4DOHE 1MCDA 1IJNA 2O5YL 3PPEA 3UZQA 3VFRA 3NCCB 1MZZA 1X4XA 4X7FC 4QJ3B 4OJFL 1E50A 4YDVB 2A73B 1E4WL 4WZ9A 1P4IH 5KWYC 4TRPH 1CVSC 4NBXB 1UA6L 4AYDC 2UZIH 3D4CA 4FAAB 1P7KB 4C8XA 4YHOH 5DURB 5D7LE 2B1HH 4A68A 3ZE2E 1X7QB 3NA4A 1JBJA 2PYFB 5K9KA 3IWUA 4M6OH 2K70A 2XACC 4LCUA 2C9AA 4AQOA 4BQ8A 3UJIH 4YXLL 2CO4A 3DROA 4HWBL 5C0AD 3ORJA 4K7PH 1T0OA 4I18C 5JPMC 3OKLB 4LOFA 3RJDA 4IOSD 4GIAA 3UTPD 3MPCA 4XVSH 5CD5C 3SZ6A 2WGXA 3B7RL 3NJJA 3ISYA 4OLZL 4UDTA 2E7HA 5AYUL 2F19L 2FEEL 1J8HE 4KO6A 3TA3A 1T7XA 4A6YB 2NNRA 5K5YA 3MR9B 5SWZA 2C3HA 4RMBA 5ITBL 6PCYA 4PJBE 5C9KA 1S9YB 2E3VA 4OV6F 4BZ1H 3B37A 3TASA 3V7AG 2DOCA 3CFUA 1V3KA 3QUGA 4N0YL 3S37X 5B3JE 4QRUA 3QXWA 4K7FB 2WQ8A 5HYFA 3JTTB 4KJYA 5ID1B 4D9RD 2ZKYA 2DQFB 3ARXA 3LYRA 5JIMA 1OHZA 5DC9B 4IIQC 4Y4HC 5AOMA 2B15A 4MXQD 1DUYB 4MCYB 4LBEB 4X7SH 4R3SA 3K1KC 5C0FB 1TYJA 3SO3C 2MOVA 2W1NA 5IUSA 4NKOB 3BUYB 1A7OH 4S1DD 3WIHA 4Z7WB 3SGEI 3ML8A 3RA7H 3TVMC 2ICWA 2F61A 5T1KB 5J12B 1ZXKA 3DHUA 3V6ZB 4ONHB 2O5YH 4AQ8A 5HYJE 3KLAB 1P4BL 3RURA 1MAKA 4FFZA 4L4TE 4P0DA 2IWKA 1U30A 3VXNA 1E4WH 4U49A 4FG6D 3N1PC 5AVRB 1UA6H 3HC4L 4HZAA 1OTUC 4X6DF 1IGML 2L8AA 5FFLA 4QOKE 2GBVA 3EYVB 2DZEA 1JCKA 2VXSH 4IU2A 2AXHA 3GMMA 1L4IA 3A22A 3DI2B 4PGEB 3H6JA 4JFYA 3B7SA 4IJTA 1XX9C 4NPKA 1K8DB 1YYCA 1U9KA 4ADIA 4K23L 5EOTA 4BFIA 3HI5L 5AZ2L 4ANKA 3OKOA 4FTDA 4OLZH 3GF8A 1GGTA 2HTLD 3V6OC 1CDYA 1NAMB 2IXQA 4AM0B 4Q6IC 4PRHB 5ITBH 1U8MB 1FC2D 2X3AA 5FAAA 4QRRA 3CPLA 4UV7H 3FT9A 3I9IA 2A99A 1OARH 4AUJA 2BSEA 4IOFD 4N0YH 2CDGB 3GDCA 4TUKH 4UI2A 4J6RH 3ASNB 5FYJU 2NSXA 3SYQA 4G8FB 5IF0B 4G83A 1MFBL 3GMOA 4XE5B 1ZLUH 3A0OA 1SVZA 1ESOA 2CO2A 3Q2VA 3P73A 5DZOA 2R69L 3HBZA 4BV1A 4XP1L 3R06B 1EGJA 4NO2A 4HAKA 3BRDA 2VXVL 2VLKB 5TDOB 1EHKB 1E27A 3SDAD 4F7EB 3WTTA 3QUYB 2ZD0A 3EFFA 1HL5A 3N42F 3EO9L 4FFWC 3TBSA 3NPSC 4ZX3A 5JHLH 2N56A 1CK0H 2YQ2A 3ROOA 3C5SB 4NKDB 4DNLA 1P4BH 1FLRH 3TO4D 1T83A 1PIGA 1BBJB 4X6EB 2HJKB 1A2YB 2JJSA 4YDVA 4KK6C 4LDLB 4TSCL 3PFUA 4G9FE 3FU7B 2KERA 3UAFA 1XFPA 3EH2A 3LPWA 5ADOL 1RAMA 4NDMB 1W0WB 2E74C 3PDOA 3T1WA 1KELL 4K23H 1UM5L 2WN3A 4LSPH 3W0WB 1YN7A 3QUML 2X1WL 3HI5H 2EXWD 3LZNA 1WJ3A 3KVPA 3OKLA 2JNZA 4XOBA 5DRWA 1JYXA 1HESA 5DVOA 1NBCA 4XP5H 4LCWA 2OLDA 4L1HA 4ZUUA 2W9EL 4JHAL 1BD2B 4NI6A 2BSBA 4WI0B 1Y0LA 3UTTD 4BKSC 4FXLA 4X5PA 1HQRB 3K6NA 4GRWF 1WA1X 1LK2B 4F93B 1SXSA 2AK4B 3C75A 4JREC 4BFEA 3ASWA 2OMZA 4XWOC 1S9YA 2GYSA 4Z7VF 1CD0A 3ELAT 4NCC1 1NOAA 3WYRA 1M1XA 3Q5YA 3JTTA 1ACXA 2APBA 4Y0GA 2Q20A 4N2GA 3QQ3A 2DQFA 4AH2B 3QXDA 4KKCC 1J8KA 3TEXA 5JUEL 2W9LA 4LBEA 2E5EA 1FL3A 2PW1A 2R69H 3Q8FA 4GG8A 3QXUA 4I88A 4M4RA 4P4KB 4XC1L 5IHZB 4BYHA 2VXVH 4MVBD 4NKOA 2ZOKB 4DWHA 2VKWA 4HCFA 4Z7WA 1A9EB 4AYGA 2M83A 4WK4B 3OJDA 1WZ1H 3EO9H 1CVRA 2Q5BA 1A7RL 5E24E 4X8JB 4Y5VB 3ATDA 4QTIL 5CN3A 1NEUA 2MQGA 2VLRB 1MJ8L 2GTWB 3UBXI 3A3YB 2BIQA 3CC5B 5ELIA 3FT4B 1VFMA 3O9WA 1MCSA 4QKXB 4V1DA 2MHAA 1J05A 4TSCH 4B9FA 4X6BB 4AV5A 5IR1B 5L88H 5FUOH 5ADOH 5F9WB 2QADC 4P05A 4NZ8A 4CW1B 5GGRA 1D5MB 1KELH 1KB3A 1ZLEA 1UM5H 1OIOA 2R0ZH 3LKRB 4FYTA 3QUMH 5G5DB 4OUUB 1Z0MA 2EAEA 3DOHA 4JHBA 5F9AC 3QHFL 3VGFA 2I9TA 1PAMA 4XNZB 3DETC 1EVTC 1AZVA 2W9EH 4JHAH 4LU5L 4PJ8C 4AQEB 5SWSD 1MAMH 1WUZA 4NN6C 3GHPA 2FJGA 1J87A 2Q2LA 5KN5B 2BSSB 2EUVA 4FNTA 3UCQA 2DBLL 4Y5YA 1DDHA 1WQVT 5GGUA 1NMCC 1OALA 2FH6A 3D12B 1INQB 2CDGA 3SY0A 3F05A 4YSAA 1NCWH 2OMWA 2GKIA 5J9PA 2B4CC 2Z6FA 4LL1A 4G8FA 4ZSOE 5IF0A 3VD9A 3MCLL 3C5ZA 1NM9A 1J9CT 1H5BA 3GT6A 3E2HB 4P06A 3IRZA 3U2SB 3LEXB 5EOCJ 3ALWA 2HT2D 4GG6B 2Q0ZX 1T22B 4ODSL 5TDOA 1W8OA 3PP3K 5BQDA 3BQUC 3MLWL 3ZMRA 1BWMA 4XPTL 4TVPE 4RESB 1A7RH 4ZO6A 4M8UA 1IC1A 1AO7B 3CFDB 4NKDA 4XWGH 1MJ8H 1QI5A 4AL8L 1YECL 2BNRB 2F7IA 3ZKND 1BBJA 4X6EA 3TF7C 3MJ8A 4FTVB 1KY6A 2IAMD 2DTSA 4PY7B 1USZA 2L04A 2O5ZH 2ZICA 4I7ZC 5D1XD 4NB7A 3LN4B 4FULA 3ARFA 2RHEA 1UJ3A 1W0WA 2ZXDA 2WBKA 3BD4A 1CZ8L 5E94B 3UERA 4BXVA 4JPKL 1KJVA 2WNGA 1BG9A 4QR7A 5K69A 5IIEB 2AQ3A 3PAUA 4LU5H 2MCG1 4X7CC 8PAZA 1IM9A 1BD2A 4YNYA 5CWSA 3VWKA 2ZSVB 1JAEA 2I7SA 3D39B 4KKQA 1LK2A 1BJMA 2BOLA 3VFWB 1UZ6F 4MXVF 4CJ0A 1H6EA 2A83B 3G08A 1E4HA 3MNZB 5JHDB 2JK5B 5F88B 4B53A 3ZL1A 2FB4L 4N4YB 3NJKA 4AH2A 4HZ1A 4X4YA 3Q9QA 4A7GA 3R4RA 1JPGA 3TESA 1E9QB 5IHZA 2P5WD 3HE7C 3SGJA 3EOAB 1V5JA 3ES6B 3NQKA 3PHQB 2XIIA 4W9DC 3MLWH 4H13C 4XPTH 4Q14A 5HGAB 1CR9L 4NAJA 3GSUB 1I7RB 3JV4A 4NUQA 4X8JA 2NR6A 2XVLA 2AGJL 3VVWA 3DARA 1YECH 3AUVA 1BFVL 2GTWA 2X4OB 3IBOA 2OYMA 2Y2TA 3CC5A 4LCYB 4QRBA 4LRNH 2VE6B 3FT4A 4X6BA 3WEXB 2IG2L 3BDBA 4K9JA 5DA0B 4XBPA 4MQXC 2OCCB 1EMTH 3R1GL 2ZXWB 1YNKH 3IETB 4ADGA 4BFGA 3CVIL 3BYTA 2NQDA 3IGFA 1V05A 3LKRA 5C0DA 3EYUL 3QUXA 3WTUA 1J18A 3QJHB 4L8CA 2C9UA 5AW6B 3HC0A 4YFDB 1M6OB 5EZLA 4WFFE 2FWUA 4BA0A 3ZE0E 1KC5L 2FWOB 1F2XK 5KBLA 3B6SB 1RPUA 1AH1A 1Y6NR 4AQEA 2N59A 3L4XA 3HC3L 4RRPM 1N67A 3KAAA 5KN5A 3N2JA 4GUCA 2BSSA 1JCVA 1I3RB 1HINH 1DVFD 4JMXA 4WK2B 1KYUA 3TWCL 4F27A 1A25A 5C08B 3FRPB 3NJGA 1NGQL 4WDIA 4N2LA 1YDPB 2ZCLL 1MCWW 4BQBA 5KSAB 3U2SA 1FAKT 4ZMQA 2X87A 5HHPA 3BCDA 4HBCL 5DRNB 1T22A 5ALCL 3AS3A 3X3GL 2AGJH 4NUJB 4KRNA 2GC7C 3CFDA 5ABDE 2AVGA 1BFVH 3HZVB 4AX3A 3G5XB 3QA3A 1IIIA 1U8IA 3WFHB 3SCMC 2OBGA 1ZT7A 2Q8AL 2NYYC 3EJZD 4LL4A 4MD0B 1QHOA 2OJZH 3O4LB 1N8ZB 2D2CC 3LN4A 2YD0A 1TFPA 3R1GH 4HKBB 4N0CD 4XHJD 5L2KA 4WAFA 2ENYA 3CVIH 3VB9A 4FNSA 1U8LB 5D96C 3RI5K 1NJ9A 1U41A 4P2YA 1BLIA 3L3KB 3EYUH 4L3CB 3NESA 5C0GB 3WY2A 3VXQB 5JO5B 3KM2A 1D7BA 3OXSB 4KTDH 4LPVA 4PAZA 1UWYA 3U1SH 5KJ4A 1B0RB 5CSZB 1GSKA 1T6WA 1DQVA 1NGZB 4ODVH 1UWXK 5E2JA 3SQOH 4L37B 3HC3H 5EFIB 2ZSVA 2W9DH 4QRPA 4AEHH 3D39A 1QHQA 3P0YL 1EXGA 3WIFA 1AD0A 1YMME 2VR3A 3VFWA 1OKEA 2A83A 2IVFC 4EBQH 1SUJA 2W88A 2D9QB 3QNXB 2QQLL 2JK5A 1EEZB 4YDLC 2P5EE 5C0IB 1NGQH 5TDPB 3VI3F 5E9NA 3TPUA 5EIIG 1MCNA 4AXWA 2ZCLH 4NENB 4Z7UE 3GRWA 1MCLA 5F7DA 1FNLA 4MMXB 1YNTB 2PWEA 1E9QA 3H54A 3QRLA 3Q05A 1A64A 4HBCH 3OAYH 2GJ6D 3PHQA 5H37H 1KG0A 1XH0A 4PG2C 5ALCH 5LAPA 3A67L 3WKYA 3X3GH 5HVGB 4NFBA 4UTAH 1LHZA 1B2YA 1RJCA 1I75A 4HOXA 1KPRB 2DYPA 2WN2A 2YD2A 2X4OA 4XH2B 5I71B 4KQ4L 5IFJB 4YDJB 4KI1A 5A6LA 4L18A 1U0QA 2VE6A 4ECNA 3VMPA 4LP4A 3WEXA 1UURA 2OMYB 4O5LL 1IVTA 5T5FL 1HNYA 1KXQE 3BJLA 4NUGH 2CLVB 5GHWH 4M62L 3HMWH 5FYJL 3GM8A 3Q48A 3RY5A 3W9EB 5ECJE 5AENA 4A55A 4MXQC 3QJHA 3QQXA 1M6OA 2YPKB 1PG7W 2K78A 3L16A 5C8JA 1FVCB 1QUPA 3B6SA 3LEYL 4A6YL 1L7IL 3HR5B 4S1DC 2OCJA 2W65B 3R0MA 3P0YH 4GQZA 3BVNA 1I3RA 3VSVA 4A2GA 5ABAA 2JCCE 1EHNA 4NO3B 1A47A 3VH8G 5I28A 4PJEB 4M5YL 4U1IB 4ILDA 4JGMA 1OF2B 1VLXA 1IGCL 2IPKB 3F58L 3BPCB 3IN2A 3S5LB 4FG6C 5LQBL 3WEMA 5B38G 2AEWA 1ZXQA 2XWTB 4OLWL 5IW1B 3UBHA 5D71L 5I1GH 4MJHA 3AABA 4MB3A 4OJCA 3QCTL 1P0SE 1UUNA 2J57A 4GP4B 2ZNXA 5DRNA 1XTMA 2D7NA 2MOGA 3BVTA 3DK2A 4ZDHB 3BP4B 4XXCC 3MQIA 2H8PB 4NUJA 4JPVL 2X40A 3M6DA 5JOFB 1JTTA 2HTLC 3HZVA 4KQ4H 4GAFB 5HDRA 3FO9B 4GW1B 2GUOB 2L7JA 3QXVA 2W91A 3HUJE 4TULH 3RIAK 5IJVA 3VD1A 2X89D 3BN9D 3O4LA 5DJ0B 2R7EB 4O5LH 5F6HI 4HKBA 5T5FH 3TCLA 2DMHA 2PCYA 5I8EA 1JF5A 1M7XA 1XGTB 4IOFC 2GIMA 4MJ6A 5IB5B 3HI1B 1GHFL 5FYJH 4FX5A 4Z7AA 5DD3H 5C0GA 3L3KA 1AQKH 3I75B 3OXSA 5LCVA 5CF3A 3I2CH 1GH7A 4E5XA 3T71A 3MRDB 4NQDE 1XB6A 3HAEB 3T8VA 1EEYB 2VITB 3IJSA 5T3ZE 1NAML 4GI8A 1NGZA 4PWGA 4EE2A 4A2DA 3LEYH 2WWNA 1L7IH 4JMNA 3BUDA 2J12B 3GBLA 3I6GB 5IMKB 3Q2CA 5FW7A 2OJ1A 3SDAC 4C56D 3QFJE 3O6FD 5D1ZC 2JXMA 1IT9L 3UIZA 5TGBA 1XH1A 2Q3ZA 3TO4C 1DN2A 1E3XA 1UOLA 2VZSA 4NQCD 5KVFE 4I1RA 4NO0B 3F58H 1L3WA 4GG6F 1O7DC 2H3NA 3WNIA 1SOXA 5JW4Q 3HG3A 4A04A 2XX0A 3IDGA 4OLWH 4F2ME 5D71H 2ED6A 4W70A 1DQLH 3RVUD 1YNTA 1DLFL 3GI8L 1E8WA 1G4RA 3MUGB 3KG5A 3NQIA 3QCTH 5DZAA 43C9B 4Z3IA 1TZ8A 1Z5LA 5C1MB 2CJ3A 1SVCP 2CBTA 5DGQA 3QI9B 2N7BA 3B9VA 1ECYA 3FT2B 5A16A 4JPVH 4W68A 3PNWA 3BH8B 2FECI 1KEGL 4DVRL 1G9MC 1OGAA 4J6IA 4XH2A 2A9AA 4YDJA 4MAZA 1WZMA 1KYFA 3HG5A 3P3RA 1RZ8A 4XNUL 5KSUB 3UAAA 1WD8A 5HYSG 4J3WA 2OMYA 1RJYB 2E9IA 5ICXA 1T1YA 4JO3L 1GHFH 3ARBD 5F8RC 1IAIH 2HVBA 2VUKA 1VKXB 4NHUB 4U1GC 1JZ8A 2E27L 1AFVL 5I6NA 4FLOA 3B4NA 1QKZL 2CJTA 3RAJL 4APQA 4DKTA 5D1ZI 3FCBA 3C5XA 2JIXD 3SDCB 1NAMH 2YPKA 4HC1L 1VGEL 3RDTD 1FVCA 4MVBC 2YXWA 3N0AA 3EGSA 2CM6A 4CMMB 3M7FB 5DZJA 1C9SA 5FGRA 1ACZA 5HJBA 5EV7A 4HPYL 4KK5C 2O30A 4NO3A 4PJ7E 1ZGLP 5IB1B 2FJFB 2Q6WA 2IPKA 5GZOD 3TBWB 1IBFA 1RERA 3T0ED 5K9OA 3U36A 2WYIA 4PRDB 2NDFA 5HGDB 3NABL 1DLFH 4KK9D 1UZGA 5E2WL 1TQCC 4X9YA 1Z6JT 1K3ZA 2DY2A 5T5NG 2DW5A 2GJJA 3D18A 4X6CE 4UB0L 2FX9L 3SBQA 4JKPH 3WFCH 2VYRE 3V4PB 4D0CB 3ARDD 2MSPA 2CCLA 1OW0C 1RP8A 2H8PA 2JJVA 2D03L 1A4JA 2Z92B 3AVEA 4JDEB 5AEAA 1PYWA 1KEGH 5EG6C 1LMKA 2DF3A 4MQTB 3BP5B 5CMAB 5SX4I 2UWEB 2X7LB 3CLEL 1HHIB 4WEBH 1YEEL 3O3BB 4R26H 3S3BB 2DKMA 1GA2A 2NY5C 3B7YA 2ZNWA 1JV5B 4X7TB 3ARWA 5DHXB 4N2OA 1MG3C 4FQLL 4OLVL 5DJ0A 2BOBA 3O3EB 1UXSB 3PWVA 4PWEA 1MREL 1OM3L 3HI1A 5IB5A 1K85A 2E27H 1AFVH 1FO0B 4E41A 3RAJH 1M9SA 4M56A 1JRHL 1HYRC 4JLRB 1PX4A 3CFCL 1MCBA 4P23D 5ETUA 3HG2A 4J3BA 1ZE3H 4IGBD 4HC1H 1L9SA 1JHTB 1EEYA 2VITA 5E6ZA 5LB1A 4ZTPH 4Y5XC 4JM2A 2PWDA 3CSFA 4RRPA 3L3HB 4JANB 2CRYA 3S34L 1OOWA 1KJ2H 3VA2C 2B1OA 3E6HB 4HPYH 1IKFL 4MMZC 1SFHA 3EFOB 2IALB 3LPFA 2VTFA 4MJJA 4N24A 1X9RA 3ZKNC 1KDJA 1FZKB 4DP0X 2RH0A 4NO0A 3D4GA 2IAMC 2J6WA 5I0WA 3OKNA 4DGYL 4UTBL 5KJRL 5GQBA 2VDKL 3U79A 5D1XC 3NABH 3UH8A 3VTTA 4M7KL 1XGYH 2O1AA 3PREA 1JGUL 43C9A 1XH2A 2PO6C 3I50L 4UB0H 35C8L 3QI9A 2CM5A 1T66D 2LTQB 3MDJA 5IMOB 2D03H 3KPTA 2G3ZA 3FTGA 4UOQA 3BH8A 3LQZB 2F08A 1RUKH 2XN9E 3D0LB 4PB0H 3BOVA 3LXCA 1XIWA 4P3CL 5L0QB 3T3MF 2MKWA 3MACL 4AKQA 3S96A 2C1PB 3HCVB 5JPNC 4FQLH 4OLVH 2FJUB 1FBIH 4UQDA 1MREH 4PJAB 1OM3H 1NEZB 1EV2E 4NHUA 3PV6A 3B2PA 3L95B 4RGMB 1JRHH 1JPTL 4O02A 3GUTB 4AE0A 1J10A 3MOBL 3MRRB 5LBSA 2FBRA 5MERB 3FTUA 2EECA 1WWCA 2X2JA 1D3CA 2IPTL 4NX0A 3PL6D 4XOAA 4IJ3B 2DBJA 3EAKA 4CVZB 2CRMA 1AP2B 5FEBA 4DGIH 3S34H 1B2WL 1O5DT 3GINA 3B8YA 3MX0B 1IKFH 3NSYA 4UNIA 43CAA 5IQNA 4CVUA 1G1KA 1S7TA 3F84A 2JJWA 2OR9H 4NFDA 5IB1A 2FJFA 3QIWA 4Z0BL 5IV2A 4DGYH 4UTBH 1RD6A 5KJRH 5KUKA 3GZOA 3TBWA 1WE5A 3POHA 2VDKH 3MC0A 3GRWL 1HU8A 2XLLA 4LARL 4RGNB 4XXWA 1KPVB 4P5RA 4XB8A 2ADJA 4PJDA 1SYVB 4PRDA 5FYJD 2OS7A 3U7AA 1JGUH 4KRLB 1CBVL 1EXHA 3I50H 1E65A 2GSMB 35C8H 4PYGA 3W5MA 1OB1A 1SXNA 4PRPB 1JE6A 3BN3B 4ABWA 2D3VA 2I85A 1ZHKB 4DETA 3PWNB 2KH2B 4JDEA 1G7LB 4HDIA 4PEEA 1L9NA 1RQ5A 2GSGA 1CICB 2L0DA 2UZXB 3BP5A 5C3IA 2COVD 2UWEA 2EVJA 4P3CH 2X6UA 2X7LA 3MACH 1WH0A 3FN0H 3O3BA 1LEKB 1IE5A 1MCPL 1WFTA 2ZWZA 4ZOAA 3MLZL 2WXQA 4MJ5B 2Z4QA 4X7TA 2ICES 5D1QA 4LASL 5B7EA 2OMXB 3O3EA 1UXSA 1G1CA 1GW0A 1DVFC 4HJTA 2Y6SD 5AD0B 2YQBA 3B56A 4R7NB 3OPZL 2QPEB 4M7JH 5IZ7A 1JPTH 4B9IA 4PJ5B 1MEXL 2WM0A 4EZJA 1FRGL 3FOLB 5EWIL 3QUKB 2FEEI 3VE0B 1OD9A 4PY8J 2KDYA 5T1KD 3QWRD 4MQ7B 4G7RB 4BQ6A 5MEOA 2DLTA 4PJEF 1YQVL 1VFBB 1B2WH 3NFPA 3L3HA 4PBWD 1MI5B 3ESNA 4LPCA 5J11B 4MDJA 1QATA 1OP5K 3E6HA 3AB0B 5MHSE 1FE8H 2KI6A 4Z77A 1TJMA 5DMGD 5TDNB 3HS0C 4Z0BH 2XY1A 5F7NC 1QWUA 3Q1SH 3JWNE 3B9EA 3GXFA 4TLSA 1UM4L 1WC7B 3LN5A 3EJZC 5DJAA 3TH4T 3ULSB 4EJ1C 2PWHA 2H9GA 2WC7A 3EYOA 4N0CC 4XHJC 5TE4H 4ALAH 1CBVH 1YEKL 4F5CE 2VMFA 2GEEA 3CPUA 2IMMA 1EBPA 3CHRA 4XPAH 2WQWA 5D7JA 3M1CA 3V6FB 4B27A 1UZ8B 1J5OL 4PRHD 2YIHA 3TIDB 3SZKC 1CD8A 4BZ2L 5GS0C 4RFEB 3T0VA 3H9YA 5D5MA 3VI4E 1ZS8B 1G5GA 1MCPH 5KS9A 5AWNL 1WS7A 2G4GA 4LCWE 4NNXA 1HJBC 3MLZH 4KJWD 5EU3B 2AJYL 1MVFA 1RK0A 3O6LL 1AG6A 4BFBD 4ZZFA 5KG9A 4E9QA 3AXIA 3OXRA 2JF1A 3OPZH 1E7UA 3WENA 4L3AA 4AEFA 4LHUB 3L95A 3UJTL 1DZ0A 1MEXH 3GUTA 2CGYA 1FRGH 5EWIH 2VLKD 3MRRA 4FEIA 1KULA 2ZX6A 5H35B 4BKLB 3QUYD 4CU7A 4DPAX 3QJSB 1YQVH 5SV4A 5ID0B 4CVZA 4GINA 4PJXB 5HPMB 1QA9B 4WNQA 1AP2A 4YVUA 4UZGA 1XXFC 3VXUE 3MUJA 2K4AA 5E8NA 4HEMA 4KNSA 2ESVB 5IT2L 4IBQA 1EXUB 3S35X 3JT2A 1KGWA 5EU6A 2WV3A 1ZT1B 2E47A 3H9ZA 3BRFA 4FQQA 2KS0A 1AMYA 4OUOA 3PGDB 1UM4H 1IBGL 3IGUA 1LP9B 4NZTL 4YSTA 1I9RH 4YBLC 3GSNA 4Y19E 1G6RA 2W5PA 1SYVA 4MA3B 1N9PA 3W0WD 2Y1AA 4V1DE 1YEKH 5ANMA 3DVGB 1EX0A 3IDMB 4G3YL 4C47A 1SVBA 4JFDE 4PRPA 4AZ8B 2NYKA 2F8XC 2PKDA 1F41A 1VPOH 1BD2D 3JWNG 1J5OH 1ZHKA 2Y7MA 1FZMA 3ZOAA 4BZ2H 5A1AA 1JNJA 1G7LA 1QLRB 2AK4D 4JO5A 1CICA 4L9DA 2NX5E 3LHAA 4LRIA 4GW4A 5IMMA 2CK0H 5EIVA 2LGNA 2G3XA 2VM4A 3MV8E 3DRQA 4HLZH 4X4MA 4PD4K 1SDDA 5IB4A 2ADGA 1HXKA 1S7VA 2AJYH 3O6LH 5INCB 4MJ5A 1MW1A 2YXMA 2OMXA 1JI1A 4ZPTB 4P4KD 3D3VB 4EUPB 4R7NA 4UQ2B 4KMQA 4PJ5A 3SE8L 3QUKA 1X7TA 3DYMA 4PP1D 5EZOH 4JQXC 3VE0A 3AG3B 3ZKQD 1WITA 1NCCL 4UBDC 1UJTA 5D9SB 5GGSA 3VRJA 4FMVA 4AYSA 4CMHB 1K8IA 4M6NL 4IRJA 1VFBA 3VD3A 1NC2A 1G7JB 2VLRD 1R5IB 2XTSA 3L5JA 3FONA 3VFVA 5F96L 5IT2H 3BAJA 4KPHL 4AIOA 4H2AA 4B0MM 4G7QB 3BVUA 4Z95L 4ZXBB 2ZCZA 3TFKD 4N5UA 2YJQA 1MFDL 3LRHA 4POZD 4JQVC 1INDL 1KIUB 1OAYL 3UBXG 2CZNA 4DN4L 1IBGH 4NZTH 2FIRT 2OI9B 5C0ND 2CIKB 2Y1ZA 3G6JF 3LJ3A 2D3NA 4XNQB 1JGLH 3JBG7 1F6LL 1SXCA 3I6LD 1R3KB 4WWPA 4WGWB 1NBVL 4MYPA 1OV8A 1IAIM 3QRGH 3VQ1C 3KCWA 4Z3JA 1Z9OA 1F86A 1KGXA 3RBSA 5DHVB 4DESA 3LY6A 4TF4A 3TONA 3V6FA 1UZ8A 2NUTB 32C2B 1HKLL 3BSGA 1PLBA 4MLIA 1BJ8A 3TIDA 4FJZA 1H9DA 4JZJA 1UQSA 2EYTB 2I60L 5GRWA 4BJLA 1BZ7A 1G7HB 1TEYA 2VDRH 1HEHC 2DEWX 4DFHA 3IAPA 2F53B 5IB2A 2I9LA 2R2HB 1ZS8A 2VRAA 1YNLL 2WZ5A 3GBEA 3FQUB 4GXFA 5GGTH 2XRAL 4D0BA 4AL8C 4JFEA 1OAXL 4Z76B 5E8EA 1MW2A 2BHFA 2W95A 2PCFB 1IRAY 3T4AB 1MCRA 4IBTA 2CR0A 3LS5L 3FFOA 3LRGA 3WLWD 4AYID 3LRSA 3Q13A 5DC4B 4GEJA 2EH8L 4ZMYA 4E0RB 1RZKH 1TQSA 4LHUA 4JDZB 3ETBJ 5C3LD 4ETQA 4ANVA 3ZZ1A 1BSIA 3NOIA 5J06A 4BKLA 1NCCH 4QRTB 3TN0C 3DTUB 4ZJ9A 3RVUC 1OHQA 1AO7D 1ETJA 3DX6A 4PJXA 2IQ9L 5ACZB 4EF3A 1RK1B 1CD1B 3L4TA 2BNRD 5F96H 1QQDB 2FWSA 4FTVD 2K9FB 3WMPA 4DT2A 2JKNA 1T4WA 4JS7A 2HT3C 4Z95H 1LEGA 1R0AL 1SN0A 2ERJB 1XAUA 3DO3A 2ZJSL 1INDH 2XQ0A 3U4BH 1B4LA 4DN4H 1JWMA 1MUJA 2WXLA 3QEGL 4FMFA 3PGDA 2CUAA 2CNYA 1LP9A 1YY8B 4P2OB 1OAKH 4HA1A 1U92B 4MA3A 3GUFA 1NBVH 3DVGA 3ARBC 2GITB 3IDMA 1J1PH 5DJCB 3IU4H 5D2LA 4CDGC 4AZ8A 1HKLH 1KV3A 4RA0C 1N4XL 2CJUL 1UXWB 1NIDA 1GW6A 4U0RB 2DLFL 1CDIA 2OX5B 4TLUA 3FN9A 1JZ6A 5IEKA 4PJAF 4IBWA 5LGHL 1DFBH 3RDTC 1LJMA 2HUHA 1NUFA 4BE5A 2XRAH 4HMCA 4Q9CA 5LHDA 4OCXH 4BGDA 5IB3B 5JHDD 5HP5A 1OAXH 1P9MC 2B0SH 4YAQB 5F8QC 3TA4D 4PTTB 1ZLSL 2J8UB 1K4CB 3TBTB 3CDCA 4JFZH 5DVNA 1XF2A 3LS5H 1KYOK 3QQ4A 2J88L 4AYFB 5F9DC 3D3VA 3DV4B 1MHPL 2GT9B 3RBGA 4AQZA 3ZDZF 3P3TA 2VSCA 1EZSA 1IAOA 3HAEH 3T0EC 3ECVA 1OK8A 2HFTA 1JTOA 4KK9C 4PD4J 5D9SA 2AV1B 5AL0A 4OLUH 5AKVA 4DZBB 4S1SH 2MNJB 1FIGH 2IQ9H 3DGDA 4F20A 4KMLB 2WXRA 5I24A 4HLEA 1R5IA 3RX8A 3AY2A 3ZT6A 5ESVA 1RPKA 4S0HA 1R0AH 1I82A 4ZXBA 2LVEA 2ZJSH 3MLYL 4P4RB 3RP1A 3X3FL 1EAOA 3QEGH 3W11D 5LNDA 2CIKA 2WXPA 3NZHL 4H0LC 4FI8A 1BMGA 4HHGA 5IREA 3IMUA 5LKNA 1EZUA 3FUMA 5DJYA 4ZFGL 1FA4A 4XTRD 2EVGA 3K2KA 3HI6L 4P07A 3FSVA 1DQKA 2UX6A 3NRFA 2XTJB 5L2KE 3D25B 3V4PL 3CFMA 1N4XH 3LKQA 4P23C 4R8WL 2NUTA 4WCYL 2DLFH 2FTAA 3OJMB 2VZTA 1P4LB 4OZIB 2EYTA 3BAIA 2WTOA 3K6DA 1PZUB 3QDGE 5F0JB 4LSTL 2F53A 4WSGA 1JK8B 3FQUA 4LNVA 3CD4A 3GXPA 4C4KO 3LPPA 2C4FT 1ZLSH 5IW6A 5C08D 4Z76A 1OP3H 4MSWB 1EJOH 2PCFA 4MJIB 3ZDXE 5G4NA 1YEGL 3U48A 1L5GB 4OCMC 2BHZA 3EOYG 1MHPH 3RI5F 1JFQL 1FO0L 1VESA 4QY8B 3KXFE 4OZGF 4TN9A 5KSAD 3V4LA 4LP8A 2K1MA 3C8KB 4GBXA 4KO7A 4L9LC 5FOJA 4YHZL 4GUOA 2Z0UA 1KMGA 3UMTA 2ADFL 1Q9OB 1TQBB 3R8BB 1XB3A 1RK1A 5PAZA 1QQDA 3IJ9A 1MWAA 4MASA 1T66C 4QNPF 4UTAA 4B0MB 1T4KB 2WXNA 2KHAA 5IKCB 1HOCA 3X3FH 4WIQA 3LN9A 5TQ0L 5HGBA 2H45A 3O4LD 2DM7A 4ZFOL 1S7SA 2YGVA 1U2YA 5KEZA 1KBPA 3RPBA 3FFCB 2X3CA 3IJYB 2TRHA 2WLLB 2XWBB 4ACTA 1ET5A 4P2OA 2ZOTA 2XV3A 3HTLX 1AIFB 1D5IH 1U92A 4ZFGH 3FZUD 3EJTA 4N2CA 5CLWA 3HI6H 2GITA 4WWNA 1MF2L 2RFXB 5AQ0A 3V4PH 3EXJA 5E4IA 2ZUQC 4FN0A 3SODB 2LU7A 2IADB 3U83A 4KI5C 2VOTA 2NQCA 1HCFX 1UXWA 2X6MA 3IJ8A 2XN0A 5DLML 1XZ0A 2KZWA 3PL6C 4YO0A 1A1NB 4TQEH 3APMA 4LSTH 4X8GA 3VRLF 1EDYA 4K0OA 4EVNB 5BZWA 3M07A 5IB3A 5C0AE 1IBHA 1DVQA 1QRND 1CFNA 1H6TA 4PTTA 3G6AB 4RDQG 4YAQA 3C08L 5TJWK 2J8UA 1K4CA 4L8BB 3TBTA 2BH0A 1PZ3A 4YUEH 1GCFA 4UQEA 1MY7A 1FO0H 4HBQA 4O58L 3KGTA 2GT9A 3ISWA 4GS7B 4J1UA 3RWDB 2PXYD 3NH7L 4PWHA 3F2LA 5JQHC 1GJIA 3CTTA 4R2GB 1TVHB 5GISH 3MOAH 3VGEA 4YHZH 5I1AA 2DJUA 1AS6A 4DZBA 2R2BB 3VMNA 4FMKA 3OPUA 5EUOB 1OCZB 5CM1A 5LNGA 5IHLB 1NLDL 1KYAA 4YHNB 3QC6X 1KYOJ 1BAFH 4BCXA 1YO4A 2EEFA 3RHWK 3CFBB 2YAFA 1JYVA 5C0EB 7PCYA 5TQ0H 4OCNC 2ZCKL 4P4RA 2AJVL 2Y4SA 4H7VA 4OU3A 3QRBA 3DX8B 1J9SA 2V7HB 4QHMA 5LAXB 1PD6A 5IESL 3LVTA 3HN8A 1PKQB 1Q1JL 1OT4A 2GTZB 5EDXA 4HUWB 5MENA 5GGVL 3EJUA 4MMYB 3RVXD 1Q4NX 1MF2H 3ZSTA 1KFAL 1VRSA 2C7FA 2GAZB 1BAGA 1FFRA 5HBBA 3D25A 1OANA 2FX8L 2QPFA 2VAAA 3ZPDA 2DEYX 4L8SA 1GYVA 1IZKA 2KQNA 3T4YB 4JN1L 5DLMH 1DANT 4Q6YA 2JCWA 3IE4A 1FFPB 1AE6L 1P4LA 2YA0A 5J12C 4OZIA 1U8NA 4LF3B 3WTWA 5DEGA 3WTXA 2DDQL 3MV01 5J13B 3FUKA 1WHPA 1JDDA 3WI9A 5FYLL 3B9KA 4QLWA 1JK8A 2K8QA 1SBSL 3IGAB 3LPGA 3RIAF 3A4FA 3C08H 2OP4L 5T3XH 3AC0A 4F8NA 3L5XH 3QR1A 4MSWA 4ELME 3H8NA 4MJIA 1AZBA 4Z7OE 2VDMH 1L5GA 2X09A 4O58H 2HTKC 5DMGC 2VO8A 2KQMA 1XF1A 3NH7H 3ARYA 1BDYA 3C6LA 4Q52A 4YC2B 3RUGA 4OQ1A 2DB8A 3HNTL 2BHYA 3VFUA 4R0LB 4Z7NF 1THAA 3C8KA 3K6SA 3ZKXB 2VQUA 4KTYA 1RZGA 2VR9A 3LB6D 2A4ZA 4PJGB 1Q9OA 3I3DA 3AREB 4N6QA 1Z66A 1NLDH 3KJ6L 1I1AB 4JKNA 2N0KA 3FQ2A 1T4KA 5IKCA 1MVYA 3AADB 7CGTA 2X2IA 1OAJA 1UWGL 2AJVH 5HJDA 2OSXA 1JPFA 1SDAB 1LO5B 5IESH 3DTXB 3WJMA 4OGYH 3FFCA 4D9QE 4ZUWA 1OGAE 3WHE1 5LN8A 4HW6A 2XWBA 4XVOA 4UOW1 3LVEA 1ILUA 4KJWC 1TCRB 5IY5B 3GBMH 2PP7A 5GGVH 3VXSA 3UC0L 2Q3AA 4ZT1A 1H5BC 3OSKA 1KFAH 4W6WB 5F9JB 4YSRA 5J1SC 1ROWA 1CN4A 2K9UA 3ARVA 3C60D 1AGCB 2FX8H 2CBPA 2D7OA 3QB7C 4OCRL 2IADA 3NK4A 1MJ7L 1FFNB 3QUYC 3P9LA 4WI8A 2EILB 2DDQH 1QBLL 5HDWA 4FA8A 3VD4A 1QSFB 3CFNA 4P9HL 3X13A 2E76C 2F74B 4EVNA 1SBSH 2BSTA 1UKSA 4U4IA 3QSKB 4NO0D 3FB8B 4ORGB 5EU7E 3G6AA 1WAPA 4JFPA 4L8BA 3PABB 2VABB 2ISDA 3TBVB 3ISRA 3FUJA 3L5WA 4WV1B 4F9PA 2EABA 3FCSB 3T0AA 3AMLA 3BCFA 3UTTE 5IEHB 1UJ3C 3MRMA 1N59B 2E6QA 1CU4H 4RA3A 1U3ZA 2EDQA 3MJ9L 3QI9D 5GGRY 2YOCA 1YLBB 1NCBL 1SLUA 2OXHB 3MRJB 3AQXA 2R2BA 3UZVB 1JNHA 2OCFD 2YK1L 1ZE3C 2X4QA 2RACA 1M71A 3QJXA 4ZO9A 2A6DB 3IAGC 2UV3A 1UWGH 3U6RA 3KPMA 3SN6N 2YXVA 3BAEL 1QFWM 2E4TA 1Q94A 3DX8A 3V0VB 1OOAA 3WIIL 2YZ8A 3MGAA 1F58H 1OM9A 4V2BA 4JJ5B 2FLMA 4V11A 2FYYA 2N7SA 3GBNL 1AZRA 5KJ7E 4HUWA 1FZOA 5ACMA 2AEPL 3BUPA 4MMYA 4L1DA 1QZ1A 4W9ZA 4P4KC 3SDCD 3UG3A 3VYPA 5AFAA 1BAWA 1DJXA 1XV8A 4QHKJ 1I3GL 4OCRH 4OD3H 3DYPA 2XWCA 3FQTB 4FF9A 4NPYB 1MJ7H 1U8JB 2R29A 4TUUA 2E46A 1GOGA 4RAVB 4YDNA 4PP1C 2AXGA 4ODWA 1FFPA 5GSRB 1UTDA 4P9HH 1JZJA 2YC1B 2CJSA 4Y5VC 2EZ0C 4ABQA 2WLZA 4KXAA 5F3FA 4PJIB 4HU2A 1JDCA 3F62A 3IGAA 3CN3A 3SHSA 1Z3GL 1MIEL 4U7KA 1F97A 1RUPL 3MGOB 1A65A 15C8L 3B2MA 3KPRB 4WRLA 3V5KA 4PLNC 4U3HA 2VNCA 4POZC 2V7NA 3QS2A 1ASPA 1MRDL 4B6ZA 5F9WC 1PZSA 5C0NC 1BF2A 1N0XL 1O7VA 3HZYA 4Q8BA 3MJ9H 1XD1A 4R0LA 1EZLA 5E1AA 4QXTB 1TTBA 4OCWL 2AW2A 2MTAA 1YC7A 3QUXC 3ZY7A 2JV6A 2V5TA 1O5PA 1WAEA 5CZVH 4UF7C 5JZ7D 3VTMA 2KT6A 4XNZC 3AREA 1I1AA 1Q8MA 2YD6A 2MCMA 2SODB 3SD2A 3O8XB 1N7ML 2AXFB 3QORB 4CVXB 2F54A 3D2UB 4YX2L 3PE9A 1KLUA 3DX7A 1IGIL 3PDDA 4KROC 3STLA 3WIIH 2ZXBA 1LO5A 4JY6B 1M6UA 2ADYA 1GC1H 2OTWB 1U2CA 1GL4B 2CLZB 4HJ1A 3GBNH 4KC3B 4R4FL 1FN4B 2Z9TA 2BC4B 1G7QB 4JRFA 5DZ9A 3Q8CA 4ZOEA 2AEPH 3KPSB 1O7SA 3MUUA 1GY1A 2EEAA 2G75B 3E2HC 3HNVH 5F9JA 5MEQB 1I3GH 5L2JA 2ZAIA 3ELQA 3BEWB 4XHQA 1Z5HA 5E6IB 5T1LA 1FFNA 2OR7A 2CA3A 2VB5A 4JAMA 3C5JA 3MA7A 2DQDL 4HD5A 2YSTA 4F7PB 3D2TA 3V0JA 5KYNA 2G60L 1T04B 5CGMA 4FQHB 1W72L 5K9JL 1HL8A 1MIEH 3HG1A 1LTXA 2VAJA 15C8H 2VABA 3OHMB 4EUPH 2CCVA 5AW5B 2LLLA 3GXIA 4ZNEE 1F4AA 4X9IA 4WV1A 3U9UB 5FR3A 4NQQA 3Q5OA 4B97A 1IMHC 1N0XH 1J5CA 3K81A 4QGTA 4OW6A 4M02A 5TF1L 4OJDH 3C9NB 5J6HB 4X5WB 3BP6A 3HJEA 4ZMVA 3MRJA 3QH3B 1HNFA 4YH6A 3UZVA 1HOEA 5E8OB 4PJDE 4XVJL 5BNXD 1NCJA 3WO4C 2AZUA 1KNOB 1OSYA 1HAUA 4HZLB 2QL1A 5F7HA 1T7WA 1T7VA 3IYLW 5FKPA 3VFPB 2VJXA 3MO1B 1WAAA 4YX2H 2CCWA 4RDBA 2G5RA 3VXTB 4NKMB 1WZKA 4Y16A 2WTRA 2P5WE 2FSDA 5DTFA 3D5OF 3VFTA 2V9RA 4F33B 3V2AR 3V0VA 4UQIM 1D7CA 1QOKA 4JJ5A 4R4FH 5HDOA 1AKJA 3OJVC 2XJKA 5DWPA 3MREA 1E0OB 3CFQA 1BHGA 3VM5A 2Q86B 5I19L 3GMPB 5DHVH 2FO4A 3CXHK 3JTSA 1OK0A 4Y2OB 3T04D 4LKXB 1NMAL 4QXUL 2AQPA 3FQTA 4NPYA 4QXVA 1U8JA 3VAEA 2YAOA 3FTWA 2WQAA 4M8RA 2CO7B 5FW8A 5GSRA 2DQDH 2YC1A 1MFVA 2JKSA 2HAZA 4WFEE 4TNGA 1Z7JA 4PJIA 4KJPD 4LCCB 3IXTA 1W72H 3MLTB 3RY6C 5K9JH 1JXKA 4CC0A 3E6FB 4G7SB 4RGND 3ZO9A 2Y9RT 4XPBH 4WY7L 1MDAA 1TQVA 3REVA 5EUOF 3W11C 5I6LA 4HCIA 2H3XC 3BKML 3NCWA 4NOBA 5ESQB 2VN4A 3PAYA 1KIPA 5TF1H 1E2WA 3MUY1 2OJEB 4UUJB 2DWXA 3C8DA 2HWZL 4OZ4B 3M45A 4XTRC 1I3VA 2QGEA 1JK9A 3IJ7A 4OGXL 4XVJH 5IHBA 2WIIB 1CICD 1X44A 1NIAA 1F3DH 3MLSH 1JZ4A 1GZHA 5I6XB 3AZUA 1NC4A 3O8XA 3U0PA 3FT0A 3UIYA 2PABA 3CAFA 3TLRA 8CGTA 2DV6A 2ITFA 4BK5A 4CVXA 1EFQA 3GBDA 4W6YB 1TJHL 1ZAGA 3RNKB 1DJHA 3AAZA 3DA0A 3DV6B 4OGZA 3FT3A 4R4BA 3KYKH 2Q8BL 2ZXQA 1BW8A 2APSA 2OTWA 3ESPA 4FZ8L 4U1LA 1UYWL 5D6DA 2EDXA 5D5ME 4FLRA 4OCSL 1A6ZA 1G7QA 3BXNA 4OFVA 1UD4A 4PJ5D 4PJHF 5KVGL 3KLHD 1YPZB 3KPSA 3MCKB 2G75A 2AP2A 3C6SA 5MEQA 2GBTA 3CVBA 2JKTM 3F7QA 3QEUB 4G8EB 4YZFF 3WEBA 5KSAC 1BZ8A 1NMAH 3CFKA 4IOIB 4H8WH 1GRWA 4QXUH 5EO1A 1TKWA 3CK0L 3PWPE 5IVXB 1AQDA 1MI5D 3MFFB 5E6IA 3E8VA 1NPUA 4HKZB 3S48A 1JI2A 4OLXL 2QGBA 2EIBA 3MYJA 3FCUB 4A7VA 4DVBB 2D0FA 4F7PA 4PREB 4HK0A 1T04A 3WXVL 2WWOA 2YRPA 4FQHA 1HH9B 1NFDE 2QZ5A 2VN3A 4Z6AT 3X11B 1S3KL 2H3KA 4PJCF 2FX7L 5DVKA 3BKMH 3U9UA 3ZN6A 1NUDA 1S7XB 4Z7IA 1S7WA 5EU6E 3TO2B 4XXDB 2HYMA 4I3RL 3NRPA 3MZTA 1FI8C 5BXFA 4GNKB 3ILPB 3IF1A 2HWZH 3C9NA 5J6HA 3FZUC 2WCPA 4HJGA 5CEYB 5FA3B 5FM5O 3NEXA 3NT0A 3F6JA 1VEOA 2J25A 5ANME 1KBWA 3HKZA 5JHMA 3VFNA 1BREA 3ENEA 3BW9A 3OGOE 3TYFB 4FI7A 1QO3A 2J72A 1Z5YD 2YUVA 3E9UA 4H25A 3VGAB 1NGXB 4NKMA 1TJHH 5E5MB 3K3QA 4DCQB 4F33A 3D06A 2GJ6E 2OK0H 2Q8BH 1T03L 4FZ8H 4UTCA 3BQVA 5E2VL 1UYWH 2XICA 2P5PA 1R5WB 2BNUB 4OZFA 4OCSH 4LHUD 5KVGH 3UTSE 3GEFA 1V10A 3K46A 3UL4A 1A1MA 1TNNA 4IBVA 1SQMA 3FHEA 3SO3B 2BSRA 4MMXC 3VXMB 1KGYE 2MQ3A 3NIFB 1CGYA 4GMTH 1JJUA 1ZTMA 3QPXL 2H0EA 4LIQL 1QEWA 5JIHA 4YZWA 2YOAA 1QRKA 4HX1A 3P40A 1UD8A 2R27A 2CO7A 2ESVD 3TGXA 4OLXH 4N8VB 2VL5A 4KKRA 3DIFB 3ZTEA 4I9XA 4R90L 4QHLA 7TAAA 2O61B 2LHAA 1Z9SB 2BCKB 5I71C 3WXVH 2BVOA 4EO5A 4LVOB 4UNTA 4G82A 2Y5QA 3FU5A 3KMDA 3LKOB 3X1GA 3CXHJ 3E6FA 4X98A 5EEWA 5LNEA 3U46B 2QTVA 3AT9A 3CC1A 1AHWA 3DVNB 3MLRL 4CAGA 4I3RH 1M05B 2HT4D 3UCRA 2QBWA 3LMJL 4F7TA 4D7PA 1EHLL 4L48A 1VB9A 3KPLB 3BUTA 4UUJA 1J0HA 3LNIA 7PAZA 3ZYIA 1FP5A 2LFGA 5CJBA 1NINA 3RVXC 5I76B 2WIIA 3V9CA 1HDMB 1DTUA 1X9UA 4Q6IB 3SYAA 4K8RL 3ZZSA 4EDXB 2APWA 1J1XH 3DECA 4DQAA 1R47A 1FPTH 4X6DE 1UADC 2WO4A 3VG9B 1HZLA 1OSZB 1NANH 5C09B 5JXAL 4XMTA 3ATBA 4G11A 1UCBH 3DV6A 1T03H 5E2VH 3GC3A 3D3VD 4WI2A 3MRGA 4F2EA 4PRBB 2X12A 1YPZA 1XSKA 1JFHA 4L3EB 4JFEE 4LLMB 1PY4A 2Y07L 3HE6A 3U6XS 2VLJE 3QPXH 1H19A 4PCYA 4IOIA 2R29L 1A4KB 2QSTA 3S37L 3QDME 1G0YR 5IVXA 1ZT4A 4U6XB 4IMLA 1OGTB 4RGOL 3MFFA 5E1GA 5D7IB 5F89A 4Z5RA 2EXYD 4F1SA 4R90H 5JHAA 3LB6C 4RIRB 3F8UB 4ZXBD 3AG1B 3SKMA 4GSDL 3KLKA 3K0YA 3LIUA 4PRIB 5EBWB 5DQDL 1IE4A 3OZ9L 3N43F 3GKZA 4XCEA 4YHKL 3SKNA 3X11A 4Z8FL 4I48A 1QASA 2EIDA 3G9VA 1OZTG 3MLRH 2DLEA 3TO2A 3H7BB 4OD1L 1ZWIA 4P2RD 3LMJH 4FZEL 4N2BA 3GB7B 1H6UA 2QZQA 5HYQB 1AY1L 1VFAA 1KCVL 4JG0H 4LEXL 4N6RB 2BIMA 3IS0X 4M1GL 4MX7A 4L05A 3JQOB 5CEYA 3CSYB 5FA3A 3QHZL 4NQCE 4A7QA 4K8RH 5K9QG 1CE6B 1JOIA 4HIIB 5KUMA 1J0IA 3PXJA 4L4VB 5KBMA 4PLJC 2F53D 4PVMA 5FS5A 4MDIA 1SLVA 4FXGB 2H1PL 4QDGA 2O5NA 1TU2B 5A2JH 4XAKD 1NIBA 2KBGA 1EJ6A 3NFNA 3OKDB 3FRUB 3EJCA 1LDSA 5EU4A 4DCQA 1OP5H 3BPOB 3BKJL 1QG3A 1R3JA 3KWTA 4K07A 1X3DA 5E6RB 1F5WA 5CJQL 2JKIS 1SJEB 3CZUB 1LXMA 2YMTA 4HQQL 2X9WA 4LLVB 2YEVB 3ATFA 2Y07H 3B34A 1I9JH 1JD9A 1GOHA 1P84K 1SNRA 1WP6A 3VXMA 5C0CB 1XGRA 3OAZK 3WEOA 3S37H 3Q3GB 1THCA 3QI9C 4RGOH 3SDXB 4GRWE 3SJVE 1T7ZA 4PRNB 3LRMA 2VH5H 5F7YC 2QJDA 3LZQA 3VDCA 1WZLA 1OAUH 4GSDH 5I0ZA 1Z9SA 2V2XB 3ZKMD 2BCKA 4FQJL 5D2NB 4EN2A 5DQDH 1H15B 1W0YT 3ZDYE 2A6IB 3L6FB 3SKUD 3LKOA 1XZWA 2IFFL 2YLKA 2ZF9A 4P2OD 4JJOA 4YHKH 3PWJB 1JZ5A 3QP3A 1JNNL 3F7VA 4JZNB 2WUCL 3U46A 3MV9B 1HWGB 2LOEA 1D5ZB 3F12B 3DVNA 4OD1H 4FZEH 4FP8H 1M05A 4WKXA 5MEPB 2QHRL 2OQJB 1KCVH 4M1GH 4FFYL 3QHZH 4U3SB 3SDCC 3KYMB 2X9ZA 3FQRA 2Y3NA 3BZ4B 3MTRA 4ODHH 2EYSA 2BZ7A 4MS8D 3HPJB 5J6GA 3T0EE 2HFGL 4WEEA 3IDJA 1GZPB 3SKOA 1DQIA 3FQWA 5C09A 4P59L 2XQBL 3BLBA 1ASQA 3CXFA 3BKJH 5IUCA 2NPLX 1D9KA 5IBLD 5CJQH 5E9DB 3ARUA 4HQQH 2AJUH 4PRBA 3S5YA 5AYQA 2XVGA 4LLMA 1T5KA 3DO4A 3DXAB 2BERA 5CLZA 3RJOA 2HFEB 4PWFA 4DZ8B 5I0DA 1U3HB 2YEQA 2WOYA 2JTDA 4Y2DB 4UZSA 3CXDH 5EC2B 3UAJA 3BLKA 2A4CA 2UXTA 4RIRA 5CUSH 3RWCB 5JZ7C 2G2RB 1ORQB 3B9AA 2E7MA 1C5CH 4UOZA 2R8SL 3TT3H 4PRIA 2E6JA 5F7LB 5G4OA 4N28A 3RL2B 2JTYA 2IFFH 4FDWA 2VDNL 1L9TA 1JNNH 3HS9A 5FOBA 3JVGC 4R7DB 5FGBA 1QYGH 1IILE 3FB5B 2QHRH 4U2YA 2XTJD 3AU1B 2R1WB 3ZR5A 3NEOA 2EEBA 4X8CA 3UTQB 1FVDA 2IFGA 4FFYH 4DUVA 1V55B 3NJHA 4JZOA 3BVDB 1OE3A 5KVEH 1QBML 1CE6A 2ORBL 4HIIA 4U6HB 4DQOL 1OY3B 2IQAB 1MFCL 3CMOL 4OF5A 2HFGH 5K1VA 2WLNA 4FXGA 3VSUA 1IGJB 1SFDA 3VRIB 4KJQD 4P59H 1HYSD 3CHSA 3FRUA 4BA8A 2X4RA 3P30L 4MJID 2VM3A 3QO1B 1N68A 4TNVK 1QP1A 4JCMA 2LABA 4U3CA 5GRZA 3U9PL 4AIZB 3QS3A 1YYML 3WNOA 4KTEH 5CHNB 4M7ZB 2GHWB 2XDHA 1NCOA 5I8KL 1FYTA 3Q5TA 5F9OL 3VFMB 1P7HL 2WUBH 2ZWKA 4LLVA 4FQ1H 3KNBB 1DUZB 4HCGA 4WWKD 1DEDA 4K3JL 4Z7QF 3K80A 2E7BA 1B0GB 5EF3A 2AI0H 1DQMH 1B3JA 3Q3GA 2NRDA 3SDXA 2LTQC 5E8DL 4P57B 1ITBB 1RIUL 3FULA 1JZ7A 1UZ6E 1PQZB 4GKLA 2KLSA 1BPVA 2OTUB 4HUUA 3GLDA 2F7PA 4IW4C 4FFTA 4FNUA 3ZJAA 3KYOB 3FFCD 1XD0A 3GMRA 3SYOA 3L5IA 2A6IA 3ZZLA 5L0QC 4UAHA 2VDNH 5CZKA 2IBBA 3QJFA 3PWJA 1DJGA 2FHBA 4JZNA 4LLYB 3LPOA 5IK3A 4AJVA 3GMQA 2C9PA 5K93A 5F3BB 1TZHB 5MEPA 2J4WL 4C58B 4RGMC 4OFQA 2OMVB 1CFBA 4F9LA 2Y0SA 3FYIB 1CO1A 5KSBF 1L0XA 4H40A 3DDFA 2VC2B 5IFHH 4U3SA 5H37G 3VQMA 2ORBH 3TIEA 5MENE 5DFVC 4DQOH 3CN4A 4IJ3C 3BZ4A 4R7VA 2EC9U 3CMOH 2NQ3A 2WXOA 5AVZB 3BIBX 3QYCA 1CLYH 3DGCR 1XEUA 5D7LB 3ZE2B 3SGKC 3IVKA 4X9GA 1OCRB 3LNDA 3ZKSD 3U9PH 1KJMA 4YGAB 2HB0A 4BE6A 2BVUA 3NIFF 1YYMH 3HIZA 4FQCH 4HIPA 4KJPC 1ZLUK 3WTVA 4J2XA 1PD1A 1K72A 1SGKA 2ZG1A 5A7EA 5I8KH 2YN3A 2EYRB 4R2GD 4UWQB 4ZO7A 3VX1A 4RGNC 5C71A 1CURA 4GQ9H 2VQ1B 3LXUX 4K3JH 4Y9CA 1J8HB 1MFAL 7FABL 1M7IB 1F11A 1U3HA 2FJHB 2Y2YA 3O2DA 2DIBA 4Y2DA 4Y9GA 2ZUWA 3FU8A 2VR7A 1QSEB 4PJBB 5FV1L 3QYMA 4K8RD 3RUGE 4FG0A 1HXYB 4PS4L 3U7WL 5E8DH 4B95C 1I1YB 1NBZA 1RIUH 5AAWC 4TOYL 3RWCA 2BSDA 2X0VA 2YAEA 1CICC 4FYRA 4AITA 1DSFL 1ORQA 4LRIC 4RZCA 5I30L 1C08B 1AXIB 1KIRA 4PLKD 4CADB 4K9EH 4QTHB 3SY6A 4DGUA 2P28B 3SE4A 2BS8A 4H2CA 3M17B 2EVHA 3FXIC 4IS6B 5K59E 3LAFA 4EIGB 3L1FA 3GD1C 3WFZA 2L4OA 4JFFB 3FH8A 1I7TB 1P7QB 4N2MA 3BT0A 1C12B 1RV6X 2R1WA 1TTAA 3UTQA 3KLHC 2WQVA 5HYJB 5D55A 2QV2A 4L4TB 2EDFA 4RMQA 1CI5A 4NRYA 3GJFK 5TTRA 3C12A 3DGGA 2XWRA 3D69B 2M26A 4HIJB 5BW7A 5L8JB 2X9XA 3V0WH 2XPGA 4E9TA 4QOKB 5F7KC 1IGJA 1QFWL 2QMKA 3RU8L 4IYKA 3VRIA 5J11C 2VR4A 4L8DB 2WK2A 3OL2A 5AW8B 3U4KA 4BFJA 1HQ4B 3CH1B 3AXLA 3PG2A 4AIZA 1XCXA 3J8F7 4H88L 3RWEB 5D7EA 4YBQC 3APDA 4NQSB 3VJ6B 4PRHE 1ZKAA 4JL1A 4Y9FA 3ZSSA 4QHNB 5D7IF 5ICZB 3V5HB 1BOYA 1YUKB 1LNUB 4QCIB 1XAKA 4IHOB 3KNBA 4UDUB 3AT0A 1QBBA 3B2DC 7FABH 3G6DL 1ADQL 3QYNA 1CTOA 4LOEA 1T0NA 2IC2A 2FCBA 3DBXB 3WS6A 2EIEA 3ARED 1B0GA 2ZONA 1I1AD 4PS4H 1TYRA 1UH4A 3VFOB 4ZBJA 2AJSL 4FG4A 3DJTA 3MYZA 1JS4A 5I30H 5E6YA 3EDJA 1RY7B 4WUUB 1BGXL 1P5VA 3DMMB 1KT2A 1GZQA 3MHZA 2VMDA 4YXKH 4P9HC 3VI3E 3FHAA 3VD5A 1QLFB 3EGXB 1VCBC 3LCYA 1XMWA 3UG5A 3ZT5A 3RZCA 5EOCL 1RZ7H 4NM8L 1MCKA 4FRWA 4NQEA 4WU7B 4KAQH 5ENWB 1VEMA 3GQFA 2JLPA 3CN0A 4OT1L 1C7SA 1BLNA 1GS6X 2OMVA 2F7RA 3IJEA 5I1KH 3QZPA 2K3TA 3BZFA 4AVHA 5BS0B 4G71B 4NWUL 2CU9A 1QSFD 3NN8B 1K5NA 5F7MC 1XTLA 3WSQL 1NGYA 4G9FB 1EIBA 3N0PB 4HSQA 4CA4A 3PQYB 3ECBB 5D7LA 3T0DA 2OULB 2XWJB 3GPEA 3TNMA 4HGMA 3L3IA 1JXFA 5EOQL 4X42A 5IWLA 1QMUA 4MJ2A 3ESVF 2WAQA 1RJZB 2NXZB 3UZEC 3PWUB 3WCYA 1CXLA 3UACA 2EYRA 4MYWB 1R1CA 4RNRA 4EAEA 2DQEL 2AK4E 4L5FL 1KFGA 1A0QL 3DIDA 2VQ1A 3G6DH 1ADQH 1J8HA 4CRPA 3CU7A 3IDYB 5DQ9B 2W8CA 2W92A 3U1PA 1NGPL 2FJHA 5FHBL 4PJBA 2FBJL 1IAKB 2DMCA 2ZG3A 5C0JA 3WGVB 2ADIB 4H8HA 4LSRL 3UPCA 1L7TH 1MCFA 1URZA 2EDLA 1D5BB 3SGEH 5CN2A 3S3SA 1SRDA 3JWOL 1AGDB 2UYLA 3EGDB 3NA9L 3EFDL 2WNWA 3RWIB 1ZTXE 2N01B 3IPEA 3K1DA 3O0RL 2NY0B 4WENB 2K8MA 3FUHA 3KLLA 1A02N 4RFOH 1ICTA 3IB4A 4NM8H 4HALA 3B2VL 2VDPB 2VLRE 2Q9OA 4MWFB 2WMPA 3HNSH 1XGPB 1P7QA 1WFNA 3KPNA 2YBRB 1AQMA 2GCYA 1C12A 1WDAA 3IMVA 2VZUA 4JPWL 2V37A 4DK6A 4GSXA 4L1TA 2AEQL 5HYJA 3WXWL 2UUDH 2YKLL 2FQFA 4K3EL 3NDZE 4CL7A 1SEQH 2WKGA 2WLMA 4HJIA 4G6KL 4NWUH 4KRMB 5E0FA 4CMHC 2APTA 4H1LH 1ED3A 4IDLA 4QOKA 1FH5L 3HLAB 2NW3B 5IVOA 1GKEA 1G7PB 3NP3A 2EXYC 4L8DA 3W2DL 4M1DL 1U8QB 1P6FA 4ZXBC 2P8LA 3KPRD 3UYPB 1BX2B 1H8SA 4GFXA 4A2LA 4M43L 2OI9C 4NQSA 1I7UB 3QG7L 3VJ6A 2DQEH 3N1MC 4H20L 1QTYT 4L5FH 3DVFA 5ICZA 3V5HA 3OQRA 1LNUA 2PP8A 4IHOA 4UDUA 3HG1E 3F6LA 4XZUB 2GPZA 4R5XA 4HJUA 4IEFA 5FO7B 4P9ML 4JDTH 2DLHA 2LAGB 5FHBH 2FBJH 4PLOB 4XN5A 3VFOA 2AANA 4LSRH 4OF0A 1Y18A 3O8XD 5C2BL 1S5HA 4QEGA 2V9QA 3QORD 4OZHB 3D2UD 1W0VB 1EO8L 1G1YA 1SLWA 2B59B 1FJ1B 2RMNA 1OTTD 3CVHA 3JWOH 1U58B 4KMTL 5AOKA 3DMMA 4ZSOB 3ZIMA 1IJ9A 4AGQA 2J1ZA 2XZCL 5JOPD 4GG6E 4J4PA 3UG4A 1BYNA 1IGYB 1AO7E 2YZ1A 2VXQL 3B2VH 1WAAE 1MCHA 2X4PB 3K8KA 3T4AC 3TBYA 3ALXA 4HS3B 4Y1AA 4BELD 1CF1A 2BNRE 2OZ4L 4I89A 4JPWH 4N86A 4PW3A 2QSCH 3GM0A 2AEQH 5KTEL 3MLXL 2AJ3B 3WXWH 3LXAA 2R23B 2F68X 4CU6A 4EQ3A 1KXTB 5F1NB 5E6ID 3BP7A 3EYQD 4G6KH 4LFHG 2NTFA 3H3PL 4AEEA 1T2QL 3DUSA 1IQDB 4MKMA 2CKBH 5HJ3B 3ECBA 2AJXL 1X7SA 2YUZA 4M1DH 1H3XA 2F7OA 4P48A 1CLZL 4EI0A 2ERJC 3ZKMC 5IQ7H 5IOPB 2CHNA 4M43H 5KBKA 1RJZA 1UFGA 2H6UA 3QG7H 4HSCX 4H20H 1M4KA 4P2OC 4GIPD 4W81A 2B8OT 4P5TA 3H85A 1W8EA 1X5FA 4PP2B 1I4FB 5D7KE 3HVDA 4P9MH 2G9KA 1KCRL 3V4UH 3GSXB 5I17A 5ITFA 2FQGA 1KCUH 1VGKB 3RZWA 3KPQA 1YHPA 4GUQA 3WUWG 5AOLA 4U0RC 4JFSA 1KTRL 3A6BL 1K2DB 3D4YA 4KMTH 2IWEA 3OX8B 2C3VA 5JNYA 4MS8C 1DLHB 2XZCH 2E0PA 1AGDA 2L7QA 3EGDA 4P5KB 5B1BB 4LMQI 3RWIA 2Z35B 3L4WA 2MPVA 3OKKB 4MA8L 3HBGA 2VXQH 4TUJA 4P5MB 1H8NA 1JVLA 5JOEA 1KZYA 4A67A 3PP4L 2NNAB 1SHWA 1LVEA 3F85A 1TLMA 2HRPL 4L4JA 4MWFA 1AD9A 1XGPA 2EE3A 5IBLC 5I1IH 2YBRA 2X70A 3LKPB 5KTEH 5DMJB 5TPWL 3APNA 4Q4IA 5EO9B 1A66A 3LKNA 1MJUL 4KHTL 4WW1B 1D6VL 2Y5EA 4Y5XB 3CMGA 5IVZB 1ZLVK 1TPXB 1TLKA 1QVOB 1T2QH 2X9YA 1ES0B 4XI5D 5DGRA 3TL5A 2AJXH 4C4BA 2VDQB 2CBQA 1U8QA 5IG7A 1VACA 3MRHB 3FH5A 1J1OH 1BX2A 3NSFA 1CGWA 1F0LA 3JYCA 3J2PA 1WISA 5FUCC 4YDIL 1I7UA 4NHCL 1OZUA 2O5XL 4B9GA 5B3JF 1FG2B 5DF0A 3ZE0B 4O2CB 4XZUA 1KBGH 4CILA 1FORH 5C2UB 5LGJB 3NFSH 2Y1YA 3PIQB 3TWYA 1LMIA 1CFQB 2BY2A 4AE1A 4GSUA 2YEZB 2KC0A 3LZFH 4CSTA 3A6BH 1W0VA 5JDSB 4O51B 2B59A 1FJ1A 4ZYKB 4ZSOA 3CFIC 4HUKB 3OLDA 3WY3A 4PSRA 4MA8H 4KJQC 1HYSC 4HT1L 3HZKA 3K4AA 3PP4H 1S3RA 2H32B 1HK6A 2HRPH 4HS3A 4LAJH 3VFSA 2P8MB 3C6LC 2EIZB 3WUZA 5ALBH 3HPLA 4YSCA 4LDEB 2FUQA 2IDUA 5TPWH 1A14H 3WFEH 2AJ3A 2HJLB 4NN5B 1SN5A 3QULA 1MJUH 1D6VH 2FL5B 5F1NA 2CUIA 1QFOA 4HGWB 1WHOA 4O9HL 2IV8A 3PHAA 1SOKA 1UT2A 3H2PA 4AWJC 3P0GB 1TQBC 2WINB 3BT2L 3MNWB 3T3ME 5HJ3A 1OEZW 4ELDA 2DQGL 5E8PA 1HAWA 4N9GA 2V6HA 2EP6A 2B4CH 2EDOA 4ZS7L 4JQIA 4E9YA 3K4DA 4PMEA 4WF7A 3T6QC 5CP3H 1TSHA 2O26U 3PJSB 4YDIH 3VH8B 3PCYA 2LFEA 2O5XH 3BYYA 3VVVA 4LEOB 3KWXA 1LO3H 4M7LT 1X9LA 1I4FA 1ZGLB 5FW6A 3BWSA 4X83A 3OR6B 3LQAL 3NZ8A 1T89C 5B22A 3GSXA 1ASOA 5GRJL 5F0MB 1QRNE 3HB3B 1YMMB 4LLQB 2Y5TA 4U1HB 1QR1A 1VGKA 2X38A 3N41B 3BFOA 3II2A 1LO0H 2P5EB 1K2DA 4RWYH 3CNKA 3TBCA 1INEL 3OX8A 5AW1B 4KNTA 3WLBB 5M95B 1DLHA 4BRJA 1IFGA 1J0JA 2ZKWA 4P5KA 3SQRA 3ZZQA 4GUPA 5HGHB 1AJ7H 2GK0B 3FRPG 4HT1H 4IMKA 4NERA 5DZVA 4P5MA 1IL1B 4F92B 2NNAA 2MH4A 4HF5L 4GS7C 5EUKB 2XWDA 1Q9KB 2VXTL 3UYRL 2GBUA 1NM4A 2VC2L 1IC7L 4Y7MA 5AAPA 3ILEA 3QK0A 4O9HH 4RMSA 4WW1A 5BVPL 5EN3A 4KKBC 2QKIB 5LUMA 1JUFA 4Z9KB 3BT2H 1QVOA 4IBUA 4NLHA 5EO0B 5H4ZA 12E8H 4DEPB 1MAJA 2DQGH 2QR0B 2PR9A 4K8RC 5T1MB 4HLZG 3GJFB 5GPRA 2E75C 3M88A 3H0TB 4ORZC 1SY6L 3MRHA 2ATKB 1ZS2A 2V8LA 4PLKC 5TQ2H 4KK8D 4MB5A 4CC1A 4DP9X 4Q9RH 1FG2A 3MLVL 1S9XB 1NL0L 1REIA 1T6BX 5DD0L 5B8CB 1SLXA 2I32A 2JQZA 3QISA 5EIIA 4GSQA 3WELA 4BSVA 5LGJA 1BZEA 2P7TA 4IKLA 1CG9B 2ENPA 1GGIL 1CFQA 4PWKA 2DS4A 2JCCB 3UDWA 2WQRA 1AGEA 2YEZA 1JNLH 5ES4B 4HPOL 5I1EL 2B5IC 3MLUH 2VWEE 1INEH 4O51A 5JDSA 5C09D 3AS0A 1V3JA 3DK0A 1VZIA 5DT1H 1A4AA 3KLSA 4ESKA 4ZYKA 5J13C 1MRCL 3INOA 4EOWL 4KFMA 4X2UA 1OP9A 2PCPA 2WLIB 3L81A 1BOGB 3EBHA 4ZODA 2DWTA 1V3LA 4ZAKB 1E30A 4L3ED 3PDGA 5CKGA 1RSYA 4HF5H 1G7IA 3S36X 2XWZA 2E86A 3DSNA 2FIKA 2VXTH 4YC2C 3UYRH 2E7LC 3ESUF 2WCGA 2VC2H 1IC7H 4R0LC 1UG9A 5I66B 1SF5A 3UAJD 5BVJB 2A38A 2ICEB 2XC8A 3F83A 2BWIA 3AREC 4NKQB 1PCXA 3HUJB 4MCMA 2WZPA 1I1AC 4PRID 1T1ZA 2XQYG 2ZTBA 3IMSA 3X12B 3IDXH 2W94A 1CTNA 1SY6H 5EIQA 5I9QB 2HXAA 3IN0A 1FVEA 3WOVA 4JUTA 1JWUA 3B43A 4AGNA 1CJYA 2WKOF 1TJGL 2RD0A 3W81A 3PJSA 1FGVL 4OIAA 4NQDB 3VH8A 5F1IB 1KIQB 1KWKA 1BQHG 1H3TA 4FXKB 1TDQA 1NL0H 3Q06A 5DD0H 1E2VA 4LEOA 4OZHF 1A9BA 3F7YB 1KCSH 3ZUNC 5B38A 1J8RA 3OR6A 1A7PL 2A3TA 4TL4A 3QFJB 3HMXH 5J4MA 4J12A 2CRZA 3WDHA 3H9HB 4L4VD 4U1HA 5HPOA 4MRCA 4KKZA 1BG1A 4HPOH 4U6TA 2B16A 5I1EH 4F8LA 2AV7B 4XWOD 5F6IB 1JWSA 1Y1DA 3ETSA 4JGNA 2P5EA 1YC8A 3IKCB 2ZAGA 1E5CA 3I9AA 1MRCH 2ZT9C 4F2MB 2GHZA 3VYOA 4Z7UA 4M3JA 5AVUB 4GQPH 1M42A 3S5LG 1ERNA 2EH7L 3MXVL 4M6AA 2C1OA 3Q6GL 4WO4B 1M7DB 4X7DC 2GTQA 4IRZL 4WV1C 1NFKA 5LGKA 4YLCA 5AOJA 2XBTA 2WBJB 5C0CD 4IDJL 1QFPA 1Q9KA 3B3IB 4W4NA 2X0UA 1T7YA 1AR1B 5IJBC 1BF5A 5JQ6L 2VN5A 4NBZB 1NKRA 3AFLA 2EDWA 2Z31B 4XP6L 4FYQA 1MOEA 1EPFA 4UM8A 4XN7A 4N22A 4GAGL 2B14A 4MAYA 3MBEB 3E1ZA 2BW4A 1E6OL 3WJJC 1BZQK 3E80A 2OMUB 3GK8L 5J89A 3RGVB 2Z0BA 5I18L 3H0TA 5LG6A 4YQXL 4Y16C 3KR3L 1BA9A 1TJGH 4C4KT 3MV9D 2V5YA 1FGVH 1T5WB 1J0KA 4I5BA 5AW4B 3UROR 3OV6A 2IGLA 1F8TL 3MRBB 1E5UI 2WXFA 1S9XA 3QZBA 2WXGA 5B8CA 3US0A 1KB9K 3M8OH 5HHXL 3GSRB 4OD2B 4DGVL 3HAEG 4K71C 3KHOA 3N06B 3DOIA 3ZE1B 2R59A 3NJMA 4EIZC 2BX5A 3FJTA 3MBXL 4PTUA 4PJ7B 2XFXA 1KLFB 1KLGB 3L8QA 5E2TH 3H9SE 1CMOA 4YEFA 2LE9A 2OL3A 3GMLB 1HFUA 3E3QE 2DJMA 4AYBA 3UGEA 1JVOA 5GS3A 5I2IA 3G6JE 1EBAA 1JGEA 2FECL 2GC4C 5E9DD 1JGDA 3PV7A 5CLTA 4S1RH 1BOGA 2VDPL 3TP4A 1TZIA 3S2AA 5DEZA 1HEJC 4IRZH 4X6CB 4K4KA 3DXAD 2UY7A 3OAUH 5HYSA 2FEJA 2X05A 4IDJH 1A6AB 4QAWA 3DOSB 1U3HD 9CGTA 2Y7OA 4ZK8A 5CEZL 3S4SB 4Y2DD 3TPKA 3RWFA 4G8GB 2X0WA 5I66A 1BCIA 4JO4L 5JQ6H 2GSIA 3MI6A 1P2CB 3NSJA 4XP6H 5CIPB 3E0GA 2ICEA 1GGCH 1GIGL 1CDUA 3LH9A 1N12A 3MRCA 4BIKA 5HHQB 3FYEB 3HUJA 1E6OH 1OT2A 2J6EA 3QGVA 2NW2B 4DEWA 2OTPA 4Q74A 3GK8H 1RHHB 3O8XC 4HXAL 1J9RA 4TNVF 2PTTA 1WFMA 3QORC 4BK5C 4YQXH 2JSFA 1OTTC 1ZSDB 3S8FB 1Q9LB 3KCPA 1KIQA 5D6DC 5KOMC 1O6TA 4FXKA 3WJLA 3MAWA 3S35H 2B9BA 3L9RB 4DGVH 5F0LB 3F7YA 1DQJA 4GXUM 1XF4A 4A1RA 2B3RA 3QFJA 4RQQB 4WWOA 4GYBA 3H9HA 4FLSA 4NC1C 4AEIL 3D50A 3VNYA 4MNGE 4J28A 3BWZA 1XT5A 4HCRA 2DMBA 3NCXA 4JB9L 1F2QA 5E6IC 3EYQC 4QI3A 3UZQB 1HHHA 3VFRB 4Z3GA 1DVZA 3BAWA 3II3A 4YDZA 4F2MA 5LVEA 5I26A 5IBUB 4WVRA 2G3NA 3IM1A 1BVKB 4WO4A 1HEZB 2WVSA 5DD1L 4TVPL 4IHBA 3CDGA 2WBJA 3A6CH 3QQ9D 5CEZH 4LCUB 2Q10A 4B9PA 3DROB 4JO4H 3ZW3A 2TRYA 4X9FA 1NIFA 1C8PA 2YD3A 1K6QH 1VADA 2JFCA 2GBAA 4UT6A 5CU5A 5CU9A 5T3XE 1GIGH 4NJAH 2RGSA 2Z31A 4UDTB 2VSKB 2O6FA 5EBMA 3MBEA 3PWLA 2E9WA 3TA3B 3KPPA 4HXAH 5SWZB 2OMUA 2QQNH 3GO1L 4WI9A 1PIFA 3S3CB 2DTML 5E70A 1CT8B 4LPTA 5ISZE 4YHIA 4U7MA 3U7YH 2ZX5A 4MKTA 4QRUB 3ZDZE 4KJYB 4I2XA