2HRGA

Crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
496
structure length
496
Chain Sequence
b'AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Crystal structure of the blue multicopper oxidase from the white-rot fungus Trametes trogii complexed with p-toluate
doi rcsb
molecule tags Oxidoreductase
total genus 143
structure length 496
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA03
1ZPUA 2AANA 2EIKB 4YSQA 1KCWA 4YSAA 3PCYA 3HEIB 3AG3B 4Q89A 1JZEA 1QLEB 3CZUB 1ET8A 2PP9A 4KO6A 2XV2A 2YQBA 3T6ZA 2PCYA 1JZGA 1OE2A 4KO5A 2CAKA 1XMEB 1FA4A 2WO3B 3V9CA 3EF4A 2MTAA 3S8FB 4FA7B 3NYKA 5I6OA 2IH8A 1AIZA 1CC3A 1AG6A 3RYMA 4ENZA 2DWSA 2DY2A 2FNWA 4JKNA 5B1KA 4BWUA 3U25A 2YAEA 2PLTA 5EHFA 1L9PA 1T5KA 2Y69B 4PAZA 2QPDB 1AR1B 2HX9A 1ID2A 3WI9A 5ANHA 6PCYA 3NJKA 2BHFA 1W6LA 1KDJA 3UGEA 1W6WA 4BDVA 1UATA 1A4AA 3ZIYA 1RZPA 1IKOP 1BQRA 1WA0X 1X9UA 3X1GA 1BXVA 3PPSA 4HALA 2YXWA 2J55A 3FSVA 1AG0A 3NJIA 2UXGA 3IN2A 4E9SA 1SF5A 2R7EA 3FQ1A 2HX8A 1TEGA 4DPCX 1VLXA 4HZ1A 3TA4D 4F2EA 4P5SA 4BXSV 1AZUA 2X87A 4YSTA 3MBWB 1E30A 4GY4A 2AZUA 2VW7A 4UAHA 4WTQA 3UAEA 1TKWA 1PLBA 4A2HA 4DPBX 2ZWNA 4E9WA 2EIMB 4BK5C 1AQ8A 3WNIA 3CDZA 1EZLA 3PLYA 4N4YB 2A3TA 4HCIA 3QJVB 3HB3B 2BWDA 6PAZA 1AOZA 4N8UA 3ZBMA 2ZXWB 2IDQA 1PNCA 1ET5A 1ZDQA 4E9VA 4A66A 3ABMB 1AZBA 3FQYA 2QDWA 2P80D 1PCSA 2XU9A 9PCYA 5I6LA 2YAPA 3DTUB 3EH4B 4YSPA 3AG2B 5I6KA 1KGYE 1X9RA 3FYEB 3N55A 4DP6X 1L9SA 1PLAA 4NB7A 1IBYA 5TK2A 1HAWA 4HAKA 3NSFA 4AKQA 1ASOA 3CVCA 4YSCA 4F7KA 4DP5X 4ZK8A 3UABA 1E65A 1MG3C 4UANA 4HHWA 3WKQA 3N2JA 5B1BB 4KOBA 3D12B 4HCGA 3FU9A 4WKXA 3PXLA 2I7SA 1MZZA 2VMJA 4KNUA 1AS8A 1N68A 1A3ZA 1SNRA 1V54B 3UACA 2BWIA 1BXAA 4G7QB 3NJFA 5F7BA 2H47C 2FQFA 2BP0A 3JT2A 1J9QA 2CBPA 5D4IA 2J5WA 1OE3A 3NP3A 3TASA 5AFAA 1GS7A 3QPKA 4YVUA 5I6MA 1AS7A 3SBQA 4A68A 2PPCA 1JZHA 4NAJA 2OJ1A 3FS9A 1OF0A 1J9SA 1KBWA 1MZYA 3IN0A 2HRGA 4G71B 1BYOA 1JXDA 1V55B 2UXTA 1AAJA 2IDUA 5I5JA 4YVNA 5I5MA 1GYCA 1OE1A 4KOCA 4BDVB 2P80A 2PPAA 4KNTA 1NIFA 4F2FA 1MDAA 4TXVB 1ADWA 1E67A 1TEFA 4KO7A 2PCFA 1JERA 2ZOOA 2UXVA 2XV3A 1SFHA 2XWZA 2YAOA 1ASQA 1GR7A 1A4BA 1KBVA 1KYAA 5AKRA 4DP7X 4YSEA 4HCFA 2GBAA 1A8ZA 2GC7C 2H5UA 2Q9OA 3OMNB 3MX0B 2TSAA 4A2DA 3QQXA 2GC4C 3ERXA 7PAZA 1EHKB 1PNDA 2DWTA 3CDZB 1NIEA 1CURA 3KW7A 4RH4A 1IC0A 1R1CA 2YAMA 2XXFA 1XB8A 4G7RB 3ABKB 1MG2C 4AKPA 5E9NA 1JXFA 3NJJA 5A7EA 3QJTB 2AZAA 3X1NA 1SHWA 1SHXA 2XX1A 2HX7A 3X1FA 2XLLA 1JVOA 2DYRB 3AZUA 2FJSA 1PZBA 1E5YA 1JVLA 3QJUB 4G7SB 2IH9A 4M3HA 4E9TA 2AFNA 3ABLB 1M57B 2VM4A 1NIAA 2GI0A 3DKHA 2YAHA 1IBZA 4A67A 1OCOB 5I6PA 1XB3A 3IBOA 3NJHA 3NJLA 2PP8A 1JZIA 4AZUA 5I26A 3BQVA 2N0MA 5F7AA 4GP4B 4JHUA 4YSRA 3S3DB 5B7FA 1ILUA 4W1TA 5I5IA 3X1BA 4HHGA 2BP0B 4GYBA 3FU7A 3SQRA 3H4HA 1A65A 2XUWA 2PPEA 3AW5A 1J9RA 2GSMB 3CVBA 3NSCA 2GB2A 1XB6A 1OCRB 5IY5B 2W8CA 2JFCA 1SFDA 1B3IA 1BQ5A 4YSUA 3X2QB 1WS7A 3WIAA 3OQRA 4DP9X 4DP1X 2J56A 5TK4A 4JHVA 1W8EA 2UXFA 3H4FA 2XX0A 4E9YA 2FWLB 2GHZA 2IWFA 1E5ZA 4DP0X 4X4KA 3WKPA 2CCWA 4DP8X 1J5DA 4QKTA 3EHBB 4FAAB 3NSYA 1F56A 2DYSB 2VN3A 4AI7A 3PAUA 4YSSA 3X1EA 5PCYA 2X88A 3OD3A 3NT0A 1SF3A 1KCBA 2IAAC 3IE9A 3FQ2A 2Q5BA 5PAZA 3S3BB 2VSKB 1FFTB 2XXGA 2GIMA 5FC9A 2Y1AA 1GS8A 1URIA 2BP8A 3FPYA 1L9OA 1PMYA 1NIBA 7PCYA 1SJMA 2NRDA 3NP4A 2AVFA 4PCYA 1DZ0A 1BQKA 2XV0A 2W88A 3S3CB 3JTBA 1AS6A 4A2GA 3UADA 1PLCA 3NJMA 1ETJA 1NTDA 4YSDA 1CUOA 4YSOA 3FSAA 3GXUB 4E9QA 1ZIAA 4E9RA 2FTAA 3QJRB 3FT0A 5I6NA 4W9ZA 3S8GB 5B3SB 3EH5B 1NPJA 1GY2A 3BVDB 3EH3B 1NIDA 1NWPA 2R7EB 1SDDA 2VW6A 4CSZA 2VSMB 2DV6A 1M9WA 5B7EA 1RZQA 2VM3A 2IDSA 1QHQA 4KNSA 4AKOA 4E9XA 2LLNA 4QLWA 3T6XA 3ZX1A 1CYWA 1PZAA 1OCCB 3QJQB 3CVDA 1PZCA 2IWKA 2PPDA 1OOWA 1HAUA 1M56B 4DP2X 1RCYA 5LDUA 2BW4A 2EIJB 3ABGA 3PAVA 1JZJA 4BWTA 3FU7B 2UX6A 2QT6A 1OV8A 2WO2B 1JXGA 1GS6X 3IEAA 2FT8A 2IDTA 2PP7A 4UF7C 4AX3A 3TBBA 4DP4X 4YL4A 1ZDSA 5D4JA 2UX7A 3G5WA 4GXFA 3GDCA 3OMAB 1BYPA 3T9WA 3ASOB 3T6WA 1J5CA 4P5RA 3DIVA 4GP8B 1ILSA 1ASPA 2YAQA 4M4RB 2XYBA 2JXMA 2IWEA 1AANA 3AG4B 3SBPA 3KW8A 2YXVA 1J9TA 2B3IA 1AZRA 3TU6A 2TSBA 4A2FA 4A2EA 2VW4A 1CYXA 2BW5A 3UAAA 2JKWA 2QPEB 2WSDA 1QNIA 2HZHA 2H3XC 3FSZA 2E86A 2OCCB 2FQEA 4GP5B 4EF3A 4G70B 2BP8B 1TU2A 4NERA 8PAZA 1L9RA 2MRYA 3OMIB 4CSPA 3AY2A 1I53A 2PPFA 1GY1A 1WA1X 3T71A 1NPNA 2YARA 1GSKA 2FQDA 3TBCA 2BZ7A 3ASNB 2EILB 1RKRA 2CJ3A 2HRHA 2IDFA 3H56A 4Q8BA 1N70A 1NINA 2HLEB 1PAZA 3FU8A 1OCZB 1ET7A 2BZCA 2XVBA 1WS8A 2OV0A 1A4CA 3ZDWA 2J57A 1JZFA 5I28A 1GW0A 3OM3B 1HFUA 3T6VA 2QDVA 2RACA 2YAFA 1AZNA 4L0PB 1WA2X 3QJSB 1SDDB 1L9QA 1JOIA 3GYRA 1NZRA 2I85A 5D4HA 1AZCA 3FYIB 2I7OA 1PF3A 3FPXA 1V10A 5B1AB 3WG7B 2CUAA 2B08A 4DPAX 3PAZA 1BXUA 1IUZA 5AZUA 2EINB 1BEXA 1BAWA 4G72B 4BXVA 1YLBB 2BO0A 3CG8A 1ZV2A 4BWWA 1FWXA 2FT6A 3NSDA 1DYZA 5B1JC 5B7MA 3C75A 2HXAA 2ZONA 1NWOA 4HIPA 1AACA 2FQGA 3AG1B 1WAEA 3FSWA 5B1JA 1ZIBA 4MFHA 1PY0A 3NJNA 1KDIA 3NJGA 1NDTA 1L9TA 4K9JA 4KO9A 2CALA 1NICA 3V9EA 2FT7A 3WNJA 3SBRA 3L45A 1KV7A
chains in the Genus database with same CATH superfamily
1AHWC 5K59E 4OLVL 3PDOA 3GSNL 3HEIB 3QZLA 4OI7A 4NUMA 2JI2A 1X7QA 3X3FH 3KCPA 1F18A 4LSTL 4HWBH 1VZHA 5TH2B 3UTSB 5IB3A 5J1SC 1TZGH 3AT8A 4JHZA 1CFQA 5IMMA 5L2KD 5EF0A 3OQ3B 3HNTH 3K4AA 4PUBL 1MFCL 4ODSH 4K3GA 1KTBA 5KYXB 5D8JL 2KZBA 4OFQA 4GW5B 3ESMA 1M2OA 3TEXA 9CGTA 5I1CL 4PRIA 1GPOH 1F3RB 1CC3A 2AJXL 3HJ0A 4PTUA 1MCLA 5LNEA 4L1TA 1D5BA 3QUML 1WZKA 4G8IA 4PJDB 1QTPA 4JY5L 4K9EL 4LF3B 3RL2B 2MPAL 4JZNB 4LSVH 3RZWA 3MCKB 4TNEA 5EUOB 4OZGF 2V2WB 1NLBH 4JPVL 4PJBA 2X4NB 1A4AA 3U30C 3AUVA 1PD1A 4H1LH 4ZMQA 5IJCC 4P2QB 3LMJH 2F15A 4NYLB 2WLNA 1N5AA 1RIVL 3E3QE 2APFA 2X6CA 2OMWA 4LLUA 3MGOA 2VH5L 3KPQB 4PI2A 2X6AA 3ILDA 1AG0A 1MH5A 2K7PA 2WYZA 2AK4A 1WBXB 1K2DB 5HGBB 3FJTA 4WLCA 4MA7H 1EHXA 5ERWB 4YSTA 1OM9A 1WCBA 4F7MA 2L7QA 2XG5B 1UFGA 3A67L 1IC7L 1TETL 1A1MA 1SXCA 4YNYA 1EFXA 3QRBA 1HEJC 4AH2B 1OW0A 4KUCF 4Z0BL 1M2VB 1M6OB 2ZWNA 2BC4A 4TKWA 4XZ4A 3Q2CA 4E9WA 4ZUSA 3L13A 4JKMA 4BFGA 4KKPA 2Y3AA 2BIOA 3QG6B 5DJDA 2GJRA 2Y7MA 1Q38A 2HVBA 4MB3A 5IG7B 3V4UL 3GMQB 5AYTA 4E5XG 5E2UH 5JNYA 4K71C 1C7TA 3RUGF 1PNCA 3LSOA 2EO9A 4P59H 2IALA 5T8IA 3SDXE 5FEBA 2ZXAA 3E3QC 1IC5H 5DJZB 2YAPA 4OT1H 2XQBH 2Y2YA 3P4LA 4PJGE 5D1ZB 5MEPB 1WK0A 3TWYA 1AJ7H 5C2BH 4GI9A 2EDFA 1TYJA 2DYPD 5EBLA 4M6NH 2DM7A 4JAMA 5GQBA 3BWAB 4KKBD 3TN0B 2FO4B 3U9UB 1S5HA 3E8UH 3S3JA 3D7PA 3QJFB 3SE9L 1MF2L 4MD0B 1ASOA 4UOJA 1GH7A 4TNWK 3PJLA 2DQDH 4LBEB 4PRID 4HG4K 4CVUA 1JRHL 3WFBL 1TZHA 2X4RA 3QORB 4JQVA 4CC0A 3UZEC 3WL9A 2B4CC 1QRNE 1N7MH 4DEPB 3MLRH 2FR4A 2H3KA 2GEEA 4KNUA 4NQVB 1RHHB 3FKUS 3UACA 1OQOA 1XSIA 4ZPTA 3W0WB 5J3HD 2ZAIA 1PSKL 3SIKA 3EZJB 1D9KC 2LFGA 3OKKA 2X09A 1J9QA 2CBPA 2NNAA 5IW3A 3LNHA 2QGCA 1SN2A 1OE3A 3SGDI 2EXTA 2IADA 4XMPL 4XPTL 2HLAB 5I6MA 4XP5H 2ZUSA 3SBQA 3P9LB 3US9A 1YEHH 4XGZA 3MRGB 4F8QA 3BPLC 4Z7VE 2AK4D 2NX5B 3CFQA 4XCFH 1TFPA 1TTCA 5HJBA 3VX0A 1K8IB 2DQCL 3CGTA 4PJIF 4YVNA 1IFHL 2APTA 4JG1L 3V4VH 3D18A 4WU5A 1DCLA 4X7TA 5FGSA 2P80A 1EFXD 3B2VL 4WNSA 2VZVA 5J13C 3W5NA 5FLVA 2CK0H 1XZ0B 1QSZA 4HV8B 4YR6A 4X4YB 3MUY1 4PJ5B 5IFAL 1BJMA 1KGJA 3NRFA 1OT2A 1MCPH 4XPBL 2BSCA 2XV3A 4KU1A 4N2FA 5BMFH 1KTLA 1KY6A 2R56L 3WO4C 5IESL 3T2NH 3KPMA 3JWOL 2N59A 4KKAD 2A6JA 4P46A 4WNJA 1DBKH 3OHXC 1TKWB 5FWRA 3KJ4C 5F70A 5KJ4A 2VDOH 5HTSA 2EECA 5TQ0L 4S2SA 1SPDA 4B96A 3L3OB 3CXDH 3MXVL 1ORQB 2LU4A 3HMXL 4L4TE 2ROYA 3EIFA 2WTRA 2EO1A 3N3EA 4GG8B 1CGUA 4LSPL 1C5CH 4JMNA 4UOW1 5DQDL 4HS8L 2V3EA 2V2XB 2ROXA 4XC3L 1EAQA 1NGWA 1TYRA 2CGRH 3N5AA 2WNWA 4XTRD 4G8EA 4JRXA 3VDCA 1JYVA 5FK9A 3MJGX 5AVZB 3VXQB 1BHGA 1JXFA 3QJTB 4APQA 1TJMA 1EEYA 4WNQA 1G6RA 3PV6B 4MQSB 4S1QL 4HX1B 2IJ0C 1DBJL 3CU1A 3EFOA 5C9JB 3SCMC 3MNMA 1CXKA 4BKLB 5DJ8A 4XN7A 2J4WH 4RAVB 5JPNA 2VM4A 2K8MA 3HCVB 1U3JA 5DK0A 1E28A 5K1VA 5EEXA 1NIAA 1X7TA 4RZKA 2CGZA 3S5LA 3F8UB 3GSXB 3HHRB 1UWXK 4M3KB 4WVRA 3IXTA 3GPEA 2BINA 3H9YA 4MJIE 5D7IF 1V3KA 3WBDA 3V79C 1AD0A 4KZ0A 1MHHA 4XC1H 3CLWA 1MCKA 5DEGA 4F9LC 3S3DB 2DQEL 1TVHB 2NQDA 3FTZA 3KNBB 4OKVA 2DKMA 4QHNA 4PJXF 3PWPA 2VGLM 3G04B 4L1LA 3SQRA 5ABDE 3GKZA 5SWSE 2PPEA 2YPVL 3FFCD 4M5ZL 5CSGA 3V6FA 4GO6B 1KGUA 5KZCB 5D2NA 5E6IA 3NSCA 3AMLA 3OXSB 3OGOE 2KMWA 1OCRB 4AL8H 4JREB 1AR1C 1BQ5A 2EDQA 4FKEA 1P4IH 4M48L 4QHKJ 3LKNA 3RB5A 3VWJA 3DSFH 4JFFE 4ZTEA 3TYFB 5KBPA 3NIDE 4R84A 3GXIA 3DA0A 1A1NA 4ONGH 2PYEB 5BZDA 3WHXB 4KK5C 3C6SB 1G7QA 4NHCL 4XNYH 1LNUA 3B9KB 5IQ9B 3WAJA 2EUWA 4JKLA 4WW1B 2LV4A 4NPJA 1SVBA 4L29B 4ALAL 3DX6A 4QYOA 2G5RA 4W9GC 5TFSH 4AENA 3HC0B 5C0RL 1ACCA 3JUZA 4JO3H 3KWUA 4ZFGL 4HJEA 1NEZB 3H3KA 4LSRL 1CJYA 1MIMH 4JRXD 3TP4A 1VGEH 3QARA 4U1JA 5IB1B 3GTVA 1A5FH 1L7IH 3HI6H 1GZPA 3GS0A 3GEWB 4XRCA 5AQ0A 4KKQA 1NBVL 1XVSA 4AIOA 2CRZA 5IVZA 2B2XL 1NIBA 3P0VH 4HGWA 7PCYA 4ABVA 1ACXA 4GFTB 3LNEA 2R2HA 2M83A 2NZ9C 5DT1L 3U7AA 1GCYA 4KDWA 3QYMA 2EYTB 1OTUD 2CDGB 1EHLL 2WSPA 5E0QA 4OGXL 3SDAD 1S7RB 3LJ3A 4UYPA 1VFUA 4FMFA 1ADQH 4YFEA 1OP5H 4WI0B 2BNRE 3F12B 1PL3A 4KROD 4Z5RB 4N1EA 1TPXC 2AXGA 5CEYB 3ZSTA 1KJ3L 3CX5J 3EJYC 2XZAL 1F4XL 3HJEA 1LEKB 2B4CL 3UH8A 4A7UA 4KHXL 3DURA 3IFOA 3F58H 4HK3J 3BAXA 3TH3T 3QFGA 5E6ID 3ZPDA 1NJ9A 3PIQA 5BS0A 4DKTA 5GS2H 4XWGL 3VWJD 5A40E 3QHZL 5I74C 3RDJA 2F5AL 4MA3A 3MHZA 5I6XB 1A9VA 3HC4L 3DOIA 2BW4A 3QDJA 3DSNB 4XBPB 2HH0H 4NNXA 5D1XE 4V1DA 3NQKA 2L3BA 3OKMB 1I4FB 1KIQB 1IRAY 3GZKA 5IHBA 1A3LL 3BKYL 2YD2A 4B53A 3TBBA 1ZRUA 2FWSA 4HFWB 1E50A 1EXUB 1S9XA 2Z8SA 2OMYA 5IFHH 3VFMB 3L7FB 4W9HC 5HXMA 1A7RH 4IEFA 2JIXB 4ABQA 5HJ3B 1T89A 3BGFC 4X6EA 1FVDB 2HRLA 1MCBA 2YAQA 3IJSA 2EDJA 1SJHA 3UMTA 1ZLWH 4KKZA 4JPSA 1MY7A 4S0HA 2DQIL 4C83A 3SPGA 1QATA 2DIAA 5EZJB 4UV7L 4P4KD 3HE7C 1AP2A 4WZ9A 4Z7NE 5F9OH 1FO0L 5D1XC 1PJWA 2X89D 3VMPA 4MCZB 3K0WA 3KWVA 5FCSH 3U82B 2F53D 1UD5A 3QDGB 5LGYA 2J12B 2H3XC 3ZKSD 3RFZC 4B9PA 4HWBL 2JELL 4EMZA 2FWOB 1JIBA 4X6DA 3BMVA 8CGTA 1QSEB 5E6SB 3UIYA 2VAAA 1I53A 3MNVA 3HNTL 1T5WB 3N44B 3Q8CA 2C1OB 2ZSWA 1E43A 4JFYB 3TJPA 4ZG1A 1BD2E 4HF5L 4ZAKC 1KGCD 1K3ZA 4G8AC 4NUJB 3STZA 1RPQA 5TE7L 4WFED 4YQXH 1DVFA 2OK0L 3FZUD 4LLWA 4KVNH 2JMRA 2ZXCA 3VH8A 1PTZA 1R75A 1A6TA 1UWEH 5D1QC 5BS0D 4HULB 1QI4A 4UU9A 3NA9H 1TO5A 1DL7H 3MTXA 3CSGA 3DXAE 5GGRB 5GIRA 2I85A 4BE6A 5KYWA 5AWNL 3QDJD 2ED9A 4AL8C 3E2HB 4D8OA 1NLBL 3PWVB 2H8PB 3IDIA 1E9PA 4EXKA 3W39B 1XAKA 3BUYA 1E5BA 4KI5F 4N2LA 5AZUA 3X12B 1D7BA 4J2QA 4K3DH 1RVFL 5DYFA 1PYWA 5G55A 4LKXB 5EU6A 1SMAA 2CDFB 3WIIH 2BP5M 3TF7C 5IF0B 3C8DA 3U6XS 4J6IA 4MA7L 4JGNA 2ADJB 2BHZA 2FE0A 3TZVC 3BD3A 1QFUH 2ZWLT 1QX1A 1T6VN 1ZT7A 1KSRA 2A9NL 1A4JA 1AI1H 3MYJB 4WY7L 4PR5A 1WUNT 2DWXA 4P8QA 1ZAGA 3L2LA 3WTXA 3CJJA 4UTCA 4Y4HB 3REVB 4BFBD 1CBVH 4Y2DB 2PO6C 32C2B 2F61A 1PY0A 5K93A 4UQIM 4N2HA 3BH9A 4MNQE 4LLMA 4DQOH 2DBLL 3TBTA 5C07A 3D52A 5F9JB 1O75A 2XJKA 4FFVD 1ZPUA 5E2UL 2I9TA 2VN7A 4HJJL 5E8OB 2UZIL 5IT2L 1FIGL 1FBIL 1OANA 1E90A 4F5CA 1AIFA 4HKXB 4TNVK 1YEJL 1IC5L 1XIWB 2DEWX 3D25A 1FLRH 5L4MA 3QE5A 4QT5B 2BLFA 1F6LL 1F5WA 4IKJA 5LO7A 3TIEA 5LHDA 3LRSB 3FB6A 3LYRA 1FZKB 2AAVA 1XF3B 4Y7OC 1FNSH 1YQVH 2DQDL 3PNRB 1DVFD 5E08H 2N7BA 2VDRB 5F7KC 4WK2B 4ZS6C 4BWUA 1GKOA 1SYVB 3O9WB 4U7SA 3QEUA 4M8VA 1N7ML 2Y7OA 3MLRL 4XMVA 5T5FA 4AEIH 1LK3L 4AGMA 4AIEA 2J44A 3T3PB 4RNRA 2VDPB 2QKIA 1YJDC 4H1LG 4G43A 4LNVA 5AAWC 3REWA 4DN4H 1P5UB 5E9DA 5AB0A 2QSVA 1BZ7B 1RUMH 1OM3H 4U0RB 3DOSA 2GFBB 1GYWA 4NKMA 3D85A 2MIZA 2FEDC 3L3GA 5D7LE 5I1DB 2Z34A 1U8NB 3BAKA 3G08B 4FNLL 3S36L 3BAWA 1EBAA 3PPEA 1BQRA 1SUJA 4QY8A 4HUXA 4YHMH 3X1GA 2MCMA 5EU6D 1YEHL 3WDIA 2FNBA 3EJJX 5JW4M 1UXSA 4X5WA 3LV3A 4ZOEA 4M7LH 1OAQH 3WD5H 43C9A 3Q9QA 4JGJA 4G42B 1RK7A 5ICZA 2CBTA 2N3JA 1E30A 1PEWA 2KYIA 2WANA 1JFHA 3F7LA 3VFTB 1UH4A 5EF2A 1JPGB 2CK0L 3MX0A 2EACA 5TJWK 4QR7A 3WN5C 3WNIA 3GZOA 5BMFL 4K3HA 3HS0B 5H94A 5FF6A 2FVNA 2FJFB 5C07D 3ZE1F 2H2PC 1FL6A 3EJRA 3HB3B 1SMOA 2P42B 4P2OB 1N19A 1EZVX 2ARWA 3P3RA 4FQ1H 2UWEF 3LN4B 3VGGA 1XF4A 1DBKL 5JPMC 5ABZA 1ZWIA 3I2CH 4UQEA 3VD7A 2VDOL 1FH5H 5AVXB 4OM0L 5HGGS 3WS3A 3CXDL 1FYTD 1O9WA 3UTTE 1BMGA 1T1WA 2VXSH 6FABH 4JDEA 4QLRA 1IM3B 4H8WC 1BWMA 4GSQA 3DHMA 4LEBA 3EBHA 4J4PC 1BP3B 4FLHA 3D9AH 3O8XB 2D2OA 2XJLA 3KVDD 4OLZH 4CN1A 5D93B 4XO3A 3AXLA 2VR3A 1M42A 3H2QA 3MBXL 5KS9F 3L1FA 4YDMA 5AENA 1IM9D 4H8HA 5E9DD 1NEPA 2IG2L 2ZOUA 5KVDL 4R8WL 5DVPA 5SWZD 2QJDA 3GD1C 3UXFA 4NJ9H 1XXDC 5CZXC 2FQFA 3WE6A 3WLWC 4YDJB 3E6FA 4GUPB 3KM2A 4FKKA 4QRUB 3AREB 2B1OA 3MA7A 4QXTA 3EUDA 4KWUA 4CBPA 4A68A 4I7ZC 1BQHG 3MRMB 4WUUA 1LYQA 2X3CA 4YPJA 3RWCB 1P7QA 4D9RE 4KKCD 3SPVA 5BXFB 4F2MB 2A77H 4PJCE 1ZLEA 4OV5B 2L04A 2NY3C 3P77A 3RTQA 3OKDB 2YA2A 1A6WL 4FP8H 3IMUA 3T4AC 2HKFH 2M2DA 1DVQA 3EYVA 2UZXB 2PPAA 4NRZA 4AL8L 3L5XH 3CE1A 3ZJAA 4XNQB 5C0AD 4H0LC 3QIUB 3QUGA 4MAYC 1NMCB 2HWZH 5FDWB 4LOUC 2XWZA 2NOYA 4LCYA 3I50H 4PJHF 2AQTA 4FOMA 3O41A 5FA3A 3ATDA 4O51B 2VWEE 3FOMB 2WYHA 1U8LA 3A3YB 4XNYL 4AM0Q 2Z6FA 1YUHA 2R69A 3DX9A 2WIMA 1KJ2A 4XCNA 3ZYIA 3ERXA 2IH1B 1JYXA 1N64H 4NI6A 2WO4A 5LNDA 5TFSL 1HKLH 4HJIA 2GIXA 4JO3L 3ZE0F 1H5BB 1HEZA 2DL2A 1XB8A 3SBWA 1TCMA 2O72A 3OKEA 3IFNL 4XP4L 4F7EB 2YMOA 1DQMH 5T3ZH 1A5FL 3ZQ9A 1L7IL 4D8PB 4AKPA 1T0MB 3C5SB 2ZUTA 3EO0A 2OPCA 3A4EA 4I0KA 2WLHA 4K7PX 3VNYA 1UA7A 4PGDA 1V7NH 4IW4C 3IETA 4GKLA 2XLLA 1L3NA 1FSKC 2HJFA 4U1NA 3VU1A 3QQ9D 1UD2A 2XTSA 4RIRA 2YS4A 3KJ6H 4O02A 5EMYA 1BZQK 2NY4D 2ICWJ 3GM8A 3M17B 5JLZA 4IK7A 4F80A 1SN5A 3IKCA 3RIKA 1P7HL 5DRNA 3SJVB 5HPMA 1ADQL 2XI9A 1NFDE 1KNOA 4MS6A 1NGQL 1FZMA 3MRCA 1U8PA 1LK2A 3CVHH 3IDXL 4ELKA 5LLIC 4DZBA 5C6PB 1TTUA 5I26A 4AQAB 2CO7A 1P7QD 4MMZA 3RGVA 1F0LA 3DX7B 4GP4B 2ZKHH 4GBXD 3P9MB 3G6AA 2ALWA 1LQSR 4NSKA 5EN3A 1Y07A 1A21A 2YFOA 4HU2A 1SLVA 3RTQD 5MERB 2OTUB 2L0DA 1Q0YH 3EJTA 4UT9H 4NRYB 1NKRA 2Z8VC 3OKOB 4UQ2A 3VXMD 3C5ZC 5CBEB 1INEH 2NY5H 4G2AA 8FABA 1F3DH 3B5TA 1GGCL 3K71A 3IPEA 4Y1AE 4A1RA 1NMAL 1J0KA 1NBZB 3B8SA 4GKZB 1X5MA 2HH0L 1U0QA 1Z5HA 2ICCA 1DUZA 4MA8H 3BVWA 2EP6A 4AYGA 1K8DB 2EXYC 5DD0L 4LLVA 4YBQD 1JK8A 5DC4B 1F86A 4TLTA 4X4KA 3VRLF 1J5DA 4WGWB 1NAKL 4TQEL 2AJ3A 4DSYA 3IMTA 1Q72L 2YK1H 2DYSB 3N41F 2PETA 3FQRA 3SY0B 3OD3A 4O2EB 1L0YA 2YGNA 3HHMA 1KCBA 2XPZA 3GKWH 3GTTA 3IE9A 4G7YL 4DOHE 3D09A 2G0LA 4NRXA 4MGXA 4OZGB 4OZHE 2OL3B 4NENA 2P7TA 3JVFC 1N3NA 1FFTB 4W6YB 3DV6B 2G2PA 4X6CE 3H0TA 5F7WC 1IAOA 3B3BA 3FPYA 1L9OA 2EZ0C 2G75A 2BOBB 1TZAA 2WJ5A 4CU6A 4XVOA 2GG1A 3MRBB 2ZPKL 1DZ0A 4WI3A 4X9FA 5F9OL 5JHAA 2K9UA 2XV0A 3MRDB 5ESAB 5I1GH 3LEVL 1S9WA 4L3EB 4A2GA 2MHAA 2WVUA 2WLKA 3BZFA 2HT4D 3FW6A 4I89A 4OH2A 4IRJB 5KG9B 5KYYA 2PF6A 3T0BA 3FT0A 1WFOA 2WN2A 1MCNA 1K4DB 1T5XB 3LRHA 2MCPL 5B38B 1C8QA 2VDKB 3FULA 5EEYA 4U2ZA 3SYOA 2VXUH 4KK6C 3RPBA 4YQXL 4XBGA 3HUJA 4KNSA 1RK0A 3RUGB 4KVNL 2ADYA 1H0DB 1YYCA 2GPZA 1UWEL 2GTZB 2VMDA 1USZA 2X0WA 3G5ZB 1H6FA 5T3ZE 3RNQA 1DL7L 1CFBA 3FH7A 4NI3A 4FADA 5E5LA 3ZSSA 2WUBH 4XMXA 2VJXA 2X10A 5JMOC 5JORA 2W0KA 3CLEH 2JTYA 5I8EA 4BQ9A 2A73B 3GSOB 5BUAA 4QOKD 1NANH 3N40F 3CFEA 1ZTXL 2F54B 1CDIA 4FQJL 1XCTA 5BZXA 1GS6X 2WOYA 5IW1B 2PP7A 2B5IC 1RZKH 4Z3FA 3OKYA 4MA1C 5EZIH 3ZE2E 4MTMA 3BRGC 4I88A 4N0UA 1CICA 4W9JC 3PP4L 3GXMA 4MNGE 3VFRA 3DK0A 3KYNA 1T4WA 4AVIA 5GSRA 1I9RH 1Z1WA 2YEZA 1AI1L 3EYOB 1ZHBB 3VXRB 2XXCB 2P5PA 1ROWA 5LGKA 2XWEA 2HFEB 4GMSH 3WV0A 3BMWA 3MGTA 1R46A 1XFPA 2IGFH 3GJEB 2YJLA 5H4YA 4EI6B 1HHGA 3FN9A 2EEBA 1MHCA 2XWTB 5I16A 4AIZB 4Y4FC 3C08H 4QUOA 1ND0A 2JB6B 3V7MA 5HDRA 4YDIH 1OGAE 4PJIB 2FBRA 2W07A 3PGFH 5BCAA 1MKFA 1WHPA 2A0LC 3DTXA 3OLIA 4JFEB 1YEDA 1DE4A 5F96L 1HS6A 2V8MA 2MNJB 4PWEA 5EIIG 5CWSA 4YDKL 3ASNB 3D87B 3HNVL 2KHAA 5I1IL 4XO8A 1EDYA 4K4KA 3O3AB 4F93B 1FNSL 4FG4A 1YQVL 4PN6A 5BRZB 5E08L 4U1KA 1WFUA 2WCSA 3BH8B 1JYNA 3F7VB 4TLSA 3HR5A 5I28A 1AGEB 3FQNB 2AQQA 4Y2OA 3KYOA 2VLLB 1MCWM 3ARFA 4O00A 2Z91B 2XICA 4PG9B 2Y7LA 1L9QA 1DEDA 3DX1A 4QAWA 2KDGA 4LCIL 5AUMB 1QAWA 1RJLA 5C0CB 1OM3L 5J56B 2ADGB 4TULL 1IKNA 1R0AH 4HS3A 4PJ9C 1MCEA 2QEJA 2R2EA 1XCXA 4JKPH 4N2IA 1OP3H 1MVUA 4NWUH 2CJUH 4HIEB 4YHML 2A6KB 4FTVE 5HY9A 4ZFZA 3NK4A 1CICD 1J0ZA 1HNGA 4LP5A 5DHMC 5FO7A 5JIIA 2W0PA 3P0YL 4Y7MA 3VXNA 2J72A 4ZUTA 5IVXE 4DVBA 5DO2D 5E1HB 4ZW8A 3ECWA 1AACA 1IILE 3LH2H 3B2MA 1UZ8A 1P53A 3ET9F 3IDGB 4OCYL 2AJYL 4L0ZA 3OAYK 2E47A 3BW9A 3KPNB 4UBDC 1BAGA 5J06A 2GCYB 2ERJC 2VL5A 2RMNA 3ZKMD 1MRFL 5FO9B 2XVLA 3TURA 2Y7QA 1SOSA 4MB4A 2R9HD 4X98A 1JAEA 1YY8A 3CZUB 4PGBB 1FH5L 2AW2A 4M43H 4ONHB 4QNPF 1KT2B 5I17A 3EXJA 3P1VA 4WKZA 3QXTA 2VXSL 1H6EA 1WBZA 1F42A 4PS4L 4XMZA 5ESQB 4I4WA 2BNUA 2H6PA 2MTAA 3S8FB 4YGVB 3NYKA 4F7PA 1X9QA 4ENZA 1I3GH 2OXHB 4LDLB 3RPKA 5T5NG 4JGMA 5DJAB 3IGAA 3ATBA 1YECL 3JTTA 4V2BA 1OB1A 2EKJA 3EYSL 1ZHNA 5DZNA 1JMXA 3S7GA 4A6YA 1MELA 2CLRA 1HXYA 3GSQA 4MDRA 4R97B 4ETQB 3WO3B 3TH4T 3VXUA 4HS6A 4NJ9L 5E8PB 1PPIA 3D4ZA 3HPLA 3JXAA 4MS8C 2FD6L 3H3BC 2EEFA 4WO4A 5DLMH 1OAXH 4XNBA 2BPBA 1KXVC 1UATA 3GUFA 2VYRE 1JZ6A 2YBRB 2EDRA 5DVOA 4PGJA 1JL8A 1IQDA 3PJSB 5T1MA 4RQQA 5DRXA 3U0PB 2J55A 3RWGB 3GM0A 3C60B 1SN0A 1ZVHA 4NLAA 1JWSA 4U1LA 2GK0B 4ZFOB 5C0JB 4GAYB 4PJAE 5DC2A 1RZKC 4S1DD 2IANB 1DJIA 2X2HA 3ISWA 3GHPA 4XXDA 3T0EB 4DGVL 3W38A 4I1NB 4PJBF 3PUCA 3NN8B 3V55A 2AZUA 3UAEA 2NYYC 1BEYL 4LVNC 5I75B 1CF8H 3LQZA 4BINA 4Y4KC 1QSVA 4FS0A 4PV8A 4F7TA 2Y6SD 1X5LA 3CK0H 1P1ZB 5EDSA 5FWQA 4PJ6A 4Y19A 2FSDA 4AVKA 2VISB 4NM8H 1OF2B 4NKOA 1XF2B 2PABA 4E9VA 4KNQA 2G5UA 5DS1A 3O6FA 1PLGH 4U6HA 3RIAF 4WTZA 5GPRA 3ARGA 1HKLL 3VXTB 4ZYKB 5ILTL 4NZRL 4MQ7B 1P4BL 2WMPB 3I75B 3L95A 4KTYA 4Y2NA 2QKSA 5F0PB 3S96B 2VQ1A 1ONQA 3ETSA 5KBMA 1JPFB 5T3ZL 3HE6B 2OM5A 2ZCLL 4P2YA 4FQHB 2BFVH 1FJ1B 2X2JA 1NGYB 5FUCE 2XG4A 3LPFA 1XGZA 4LSQH 1HXMB 3F62A 4Y16C 3W9DB 1MG3C 4UANA 1R5VA 3LH9A 3QWOB 1V7NL 4AQEB 4WEUD 1J10A 2C26A 2DQTH 4U3XA 4Z7OB 2BS71 2ENSA 5TE4H 4JS7A 3BYYA 1R3KA 4UAOB 5CILH 3KJ6L 4HPHA 3P30H 5J11C 1UENA 4G8GD 1ZHLB 4TL4A 4RDQG 3AFLA 3WAKA 5LNGA 3VXUD 1YPZA 3NJFA 3C5XA 2BP0A 4OVUA 3SDDA 4Y9GA 1F58L 5JW4Q 5DD1H 3CVHL 4TVPE 3QPKA 5A2LH 4M62H 2IVFC 4K73A 3RBSA 5E56A 5FYKH 2OYMA 2GJZA 4O2CB 3ZU8A 2HN7B 1QEWA 4KZCA 4ERSH 2RAMA 4IMKC 1GMEA 1ZANL 4FQXB 4HU8A 1DQLH 4KX7A 4PRBB 3SOBH 1HSBA 3KS0J 1EDHA 2OLDA 2Y2WA 2W59A 3ALPA 3VX1A 1RULL 2Q8AH 1OAYL 3CSBA 4N1CA 1INEL 2WCPA 1E67A 3GMLB 2PCFA 4IS6B 3PWJA 1MVFA 3MI6A 3VCLB 4N6RA 4TVUA 3GSUA 3WIFB 2WXPA 1KCVL 4Y19D 4LZKA 2D31A 2ICWB 3FB7A 4P5KB 4DP7X 1C7SA 4L37B 4BH8A 2X4OB 5TDNA 4DGYL 1C16A 5L0QB 2V3DA 4ZW3A 4R26H 1CU4L 5INCB 3MYZA 1Q94A 3Q48A 4R7NA 1OPGH 3O6FD 4PMEA 3BZDA 1A7BA 3OPZH 2C3GA 4I2XB 4JN1L 3T8XA 2YK1L 4UM9B 5HHME 1PNDA 3ARGD 3KXFA 3BSZA 3DDFA 2WP3O 4KJQD 3ORJA 2KZ1B 1QPXA 3GKWL 3X3GL 2HRPH 3W81A 3CMOH 2CU9A 4ZTPH 1F02I 2HMID 3AABA 4WCYH 4HCRH 5L6YH 3DGCR 1CD1A 4XNZC 2XPGB 4TNGA 4LHQB 2MH4A 4P23A 3X1FA 2YN3A 4OLYH 4PW3A 1UFUA 2NUTB 3W1ZA 4P3CH 4Z23A 1VCAA 4AEHH 5I1GL 1B4LA 5M94B 4I85A 4FI7A 1SLUA 1A7NL 5F7HA 2CXGA 4PRHE 2YKLL 4XMLH 2X4TB 4PJ7F 5FO2A 2A9BA 4XO5A 3ALWA 3QXDB 2XWBB 5C09B 1OCOB 2I9LA 3UO1L 1DBMH 5E1QA 1QLRB 3D39B 3MRIB 1I82A 3PQYB 3QWRD 5F1NA 4G7VH 4DVRL 3D1MC 1ICTA 4AZUA 2R0WH 4X5LA 3FOLB 3PGCA 1RHFA 1NUFA 4HOMA 3JV5A 4JHUA 4M5TA 4UM8A 3ME0A 4KK9D 5DYOB 1IZKA 5I5IA 3LN5B 3QBTB 4KV5E 2AGJL 3MZTA 3IJEB 2F7QA 4Z6AT 5I1JL 4IDJL 3K81A 5IQOA 5KSAB 1BYNA 5D7JC 4AQ1A 5MP6H 5AB2A 5LXGL 2KZKA 2CCVA 1WAAA 1FH2A 5TDPA 3UTZA 5B8CC 3MNDA 1NBYB 5DHYA 5HHQB 3MV7B 4UI2A 4GS7C 2WY3B 3DHUA 4NJAH 1BFVH 3LDBC 3H4FA 2XX0A 1Z5LB 3LD8B 3QNYB 4DP0X 5HGHB 3IAPA 3NZSA 1RZKL 2CKBA 4QKTA 3RY6C 3CMGA 4PB9H 3BWUF 3KXFD 4PJFA 3MV8A 2RA1A 3LB6D 1KYUA 3X1EA 1M1XA 4YXHH 2MCG1 2FH6A 4L05A 5DMIH 4IKLA 5IW6A 1W72B 2YUXA 5IVOA 5K39A 3GUTA 2VLRA 4K5PA 5FYKE 1I9RL 2OMZA 5BQ7B 3TNMB 4LCCB 2OZ4H 1CI5A 3JTSA 3EGXA 1IFGA 3IMVA 1ZVSB 1U3NA 4P23D 2DLIA 3QEQA 5K9JH 4WEBL 4I87A 2NNRA 3WELA 2CPCA 3MUUA 2IGFL 3OLDA 1RUKH 5FFOA 1MQKL 4E5XA 2ATPA 2QLYA 3KZ8A 3C08L 5T1LA 4PGEA 4YDIL 1WIPA 1BIIA 3DX8A 2NY1D 2Q86A 5D71H 5J12B 1JWMB 3QEGL 2B7DT 3ZRSA 3O2VH 3VFOB 1MFEL 2XNAA 3L9YA 1GCFA 4GT7A 1S9KC 3QI9A 4P49A 2YXMA 5BOJA 5B3SB 2E6QA 5D2LA 3QUMA 3ZE1B 1PQZA 3I84A 4RMBA 4H0HB 3UTSE 1XCWA 1NL0L 3HHSA 1IGYA 4LXFA 4NN6C 3VSUA 4MKMA 3BEVB 2Z7UA 1KPVB 4PW9A 5KEZA 1KJMA 3INOA 4NC2B 3TO4C 1KIPA 4H26A 4PIRF 1LO4L 2WBWB 4OTXH 3MV01 1YO4A 3N1MC 3APCA 4MJJA 1O5PA 4FXKA 4ZUWA 5CZKA 4HLJA 4RCAA 3PAVA 3AQDA 5EO1A 3D69B 3FU7B 3MFGB 1M7DB 4NC1E 1CL7H 4PJDE 4HD9A 3LNDA 1UXWB 4TVSa 1R3HA 3P4NA 3BP6B 4JM2A 4NLHA 2FT8A 2IDTA 4Z3GA 3V5HA 5GS0D 5EUOE 3KPRB 3PL6B 4Q74A 1HHIB 1RZ8B 5C7XL 3G5WA 1J1OH 5HBBA 2VNCA 5FIEA 3T9WA 2C3VB 1CXLA 4HQQL 3CFDA 4P2QE 2VLRD 4UIKH 4GP8B 3CH1B 1TT6A 4K23H 4KJWD 3M1BB 3P02A 5AG8A 3LH2L 5GGUA 5F7EL 1RUQH 3QEQD 4GXUN 3N91A 4EIZC 1C1EH 3KVQA 3Q8EA 4W9LC 1CMOA 4TUJB 3CFNA 2RFXB 5H37H 3LQAH 3IBEA 3ROOB 5BZWB 1J9TA 1U8MB 4TVPL 5DD6A 4A2EA 2VW4A 5T1KA 2B59A 2BW5A 5T1LD 3SKUD 1J05A 1O0VA 2JKWA 3BKCH 4LCUA 4A2MA 4U7KA 1OZTG 3SKJL 3GLEA 4G1MA 1OB0A 3X14A 2WWMC 5ID1B 4ZZKA 4X2UA 3CSYA 3QXAB 3U2SA 2FECI 3MA9H 2JWYA 3H1ZA 1BVKA 4GXVH 4QMEA 3OMIB 5GHWH 2P5WA 5CJ5A 1MCWW 3T71A 2OYPA 4PBWD 4E0RA 2ICES 1J8HB 1G1OA 2KERA 2NNCA 4Y5VB 3GLZA 4R90L 4F9PC 1SRDA 3B9AA 4NNYB 3ARPA 3D2UD 3LHPL 3NPZB 3H8NA 3V5KB 4X6DF 3L5JA 3CUPA 1GW0A 1P7BA 3TJEL 1W0WB 3W9EB 1FFPA 5EU4A 2AK1L 3C5JA 2HVJB 3GMMA 1UB6B 4A7GF 4BZ2H 4EDXA 4ELDA 5H2BB 3ZE0B 5KANI 5E6RB 3DYPA 5D1ZI 4CADA 2G5BA 4ANWA 2QVMA 3QUZA 3BFWA 3BHBB 4WRLA 2NR6A 5BQDA 4WHTA 4AXWA 4K3EH 2QQQA 4JM2D 4NQEB 3VUAA 5ETUB 5FOBB 1KN2L 5ALBH 5L9DL 4FG6C 4FFYA 1YMMD 3WIHL 1RFDH 1FE8H 4PY7A 3RG1C 2CLZB 2YPLD 2OMUA 3VFWA 3GBEA 4XI5C 1DQQA 4ANUA 3GMNA 2O5NA 2AJZB 4ZJ9A 2NX5E 3EYQC 3QVAA 5BO1L 1CF8L 3SE4C 5K9OA 1A22B 4OCWH 4JRYB 3B7TA 5C0DB 2RR3A 5BPPA 3FQUB 5I73C 5CKGA 1U95B 4U6XB 2CALA 3VI3A 2BNQA 3F04A 5I8CB 3CK0L 3HMXA 4GI8A 5LAPA 1UB5B 3CH8A 1FVEA 4GIOA 2LQRA 4JFVA 4XN9A 5CEXA 3VG0L 3PCYA 1P9MA 2V3FA 3PHOB 4P5MB 4PJ5E 5EBWB 1VFBA 1W2KT 5EZPA 1Q9LA 1HU8A 4LSSH 2C9PA 3ARYA 3EYFA 2PP9A 3WS6C 1KELH 4HA1A 3IFPB 2P8MA 2FZ3B 3A0OA 1TVBB 3TFKC 2VKWA 1E9OB 1YNTA 3U46B 5LKNA 3FCTB 5A2AA 1ECYA 3R06A 2NY2B 2DWEA 3X11B 3A21A 1XQ4A 4LSQL 2XKNA 2DMBA 3ZQXA 2NUPB 4XCCH 2F58L 2VZ1A 3BP5B 4GW4B 1UOVA 1M7IA 2DQTL 3TWCH 5JO5B 1RIHH 1Z9OA 5TE4L 5B1KA 4R6UA 5A43C 1AOHA 3IAQA 3LXCA 4MX7A 4PP2B 5CILL 2PLTA 3ARBC 1KYFA 3DETD 2BVPB 3AU1A 5JYMA 2ZD0A 5IBLC 1MIEH 3ZR5A 4PS7A 2R1YA 3CFBA 1E40A 1N4XL 4Z77B 4EI0A 1TQCC 4QHUA 2HX9A 3WEXA 3QUYD 1E5UI 3S97C 3E6HB 3NJKA 5INDA 1W6LA 5AL8A 5I0ZA 2YPVA 4C56D 3ARDB 2EDDA 2W94A 4I5BA 4ILDA 3N43B 4MJ4A 4S1RL 5DZOA 3GBNH 4IBLT 1JHKH 4UIMA 3MLSH 1HWWA 4YHPA 2DKSA 3EYUH 4JO4L 4WSJA 5MI0C 4JZJB 1AO7B 4FRWA 3UCRA 1HH6A 1U8HB 1CLCA 4HKZA 1DVUA 1P0SE 1HEHC 4JFHE 4LGRB 4N2DA 4UZGA 4ERSL 3MJ7A 5JDJA 3ZKNC 1RJYA 4JL2A 2WZPD 2FUQA 1T7ZA 5ICUA 2F7IA 3UYPB 2P8LA 3L3OC 1S7VA 3MBWB 1RJCA 2Q8AL 5SX4H 3MLTA 4XCEA 4DPBX 4KQ4L 3QNXA 1TZIB 1ZA6A 5DWPA 4BZ1H 1DZBA 2BNQD 3Q1SL 3RA7H 3PLYA 5DJCA 3EO1A 4KXDA 2XXMB 1WZ1L 1XGPA 1BOYA 1MY5A 3MJ6A 3N0PB 2HCZX 4WFHD 2E7HA 1W80A 2LOEA 3FDWA 1NDGA 3KR3L 5F3HA 1A9EB 2IDQA 4R26L 5E8NA 5DJ6B 3BZ4B 4XODA 4W70A 3OPZL 4LLAA 1KCUL 5I6LA 4UINL 5FYLL 1UJ3B 1HHHA 3DTUB 4K2UL 4DK5A 4Y88A 4QO1B 1SEBA 1MAML 2D7TH 2PYEE 5IOPB 3HN5A 1GOFA 2HRPL 3K6FA 4M7LT 3CMOL 3TC9A 4A7TA 4HAKA 3KLAB 3P2BA 1G9NC 1NOFA 3A6OA 1HCZA 1IC4H 3DO7B 5TE6H 3JV4B 2V2TA 1GGBH 2ZSVA 3K91A 4HCGA 3C12A 4ZUVB 3M07A 3S35H 4WWKC 3B6SA 4D94A 3PXLA 2I07A 1O6TA 1R5IB 3LVEA 3QCVH 3ES6B 1Z9NA 4FNRA 1G5AA 1AQDA 4PRDA 4V33A 1F1GA 4YO0B 1KCLA 1DBML 5D4IA 4M9OA 1KEML 5E95B 3ZT7A 2R0KH 2CNZA 1KXTB 1GS7A 1FZJB 2CM5A 4LRIA 1AQKL 4IU2B 3ZO9A 3HPJB 4BA8A 2IWGA 4XMUA 4N3UA 1MAKA 4MBOA 5JOFB 1FI8C 2WKOA 1RJZB 3GF8A 2FECL 3B9KC 3ZTNL 1JNJA 2D7NA 5I71B 3OJVC 4PJGA 3WNOA 1N26A 5E51A 3DMMB 4KOCA 3VXOB 3QDHA 3B2PA 5AEAA 2GT9A 3QYNA 5MP6L 1EO8H 3CBRA 2BDNH 5DUMH 4WTXA 3MNWB 4P99A 4N2CA 3D0LA 2Y5TA 1N59A 4PJ8B 2C1PA 1DQIA 4WIQA 1BFVL 2JJUA 4NGHH 5DJXB 5GISL 2DB8A 4JK0D 2EEAA 1QRNA 2X4SB 2PCPA 2FSEA 2DQJH 2NLJA 3FCBA 4AGQA 4D7PA 4GG6E 1BQSA 3BSGA 3LS5H 1U3ZA 1EGJL 4JZOB 1CXEA 4KBPA 1EHKB 4NQCD 4OJFH 1MNNA 2Y4SA 1MUJA 2G30A 2G2RB 3IB4A 4P2CG 2HT3C 3B3IB 3GJFB 1JDAA 5DMIL 4DKEL 2GBTA 3FTUA 1B4TA 3BDXA 4OF6A 4CDHA 4PPTA 3ZLQC 4G7RB 1N8ZB 1IBHA 3PGDB 1FO0A 2W1NA 5IWLC 1XD1A 4BFOA 5DVKA 4HUKB 1I7ZB 2C7UA 2OZ4L 4P5TA 4U1HB 4LCWA 1GAFH 4UMGA 4WK4B 3CXHJ 2CA3A 4JRLA 4Z7VA 7FABH 4HWBA 2VDRH 1H3TA 5K9JL 5GRXG 1RXLA 3R4DA 1L0PA 2J5LB 5GGSA 4CJ1A 3D0AA 4DKDC 4KY1H 3MV9B 5DA4A 1BBJB 4LFHG 5I9QB 1O7DE 1KPRB 2VQTA 3K6SA 1E5YA 2VDPH 2GUOB 4OCXL 4RLDA 4XVSL 3RWHA 4PLKC 4OIBA 3KWTA 3STLA 2R0ZH 3LX9A 5D71L 5AAMA 2WQXA 5DDHA 4HK0A 4YBHA 2Q76A 2D3LA 2Y1VA 1H8LA 3OKNA 4GLRH 3SCMA 3V0FA 5B4MC 3PWNA 5I6XC 1D9KD 4XOCA 1ZHKA 3ILQC 4J3UA 4DPRA 1S6NA 3QDGE 5SX4I 3RVUC 3ASWA 2Z3FA 1KJVA 4QEGA 4Q9RH 2J7LA 5ACZB 3FC8A 4PWHA 4DUWA 1DUYB 1ACYH 5K9KB 2JJWA 1CFTA 1EMTL 4L4TA 5DZVA 5JQIB 1Z9MA 1KBGL 1ZK5A 4L3CA 2FJHA 4H1LA 2P24B 3T2QA 1S7SB 3DROB 4UT7L 2BCKA 3VM7A 3WJJC 5CF3A 1H6TA 4LSDA 3QIBA 1WZMA 1O7DC 1YEIL 4RMUA 5BOZG 1Z0NA 2Z92B 1D5IL 1ID5I 1WFIA 5KANG 5IHUH 2J56A 3CIAA 1F00I 4EIUA 2Q7AA 2XWJB 1KLFB 3CSPA 4PLNC 3D30A 3KCPB 4ZPVB 4AEFA 4P2AA 1BLNB 5IMMB 4RGNE 2CCWA 5JHDA 3O6KL 2ENYA 3WE1A 4BFIA 4BQBA 2A9CA 2AKRB 5I30H 2DYPB 4ODTL 5HGAA 1DN0B 4RWYH 1L9NA 2VIRB 2WINA 3LNGA 4ISVA 5KSUA 1KB5H 1S7TB 3CC1A 1F8TH 2NW2A 3QYCA 5HVGB 3RDTB 1KB9K 2YRPA 3BPCA 2XN9D 4LSUH 4K23L 1FPTL 1RLWA 4LCWD 2HJKB 2WXKA 3O6LL 1GS8A 3MRQB 4C54A 3CDCA 1C1EL 1FZOA 3CFTA 1CR9L 2ZQKA 3MBEB 2LHAA 1UT9A 3VA2C 5SWSA 4HEPG 1J1PH 1EXGA 2CA4A 1D5ZA 1OCWH 4OZ4A 1BIHA 3QCTH 1TCRA 3ULVH 4OD3L 4HPOL 1ETJA 4Z7QF 4GMTH 3VYPA 3MA9L 1S2EA 2YWYA 2X4QB 4GXVL 4JFFA 5KVEL 3BZEA 2ZWZA 4YZWA 3SCMD 2OSLB 5HGDB 1G9NL 3QJRB 4MHHI 3OJDA 1G5GA 3E2HC 3DBXA 2X9YA 5DJ2A 1MH5B 1WICA 4FQIL 3ZYJA 1NWPA 2JCWA 2ZG2A 4G9DB 4KMQA 3QWNA 4LNRB 2B1AH 3LEXB 5HHVL 4U1SB 2DI9A 1NC4A 4P9ML 3LH8A 25C8H 2N0KA 3CVIL 4L4TD 3O6MH 3T6XA 4WSKA 4R5TA 3HG1E 1ZEAH 3EFFA 4O4YH 3LPOA 2E46A 4GKSB 4BZ2L 1G7LA 2C4XA 4BGLA 1UM4H 2DN7A 4UUJB 3UZVA 3UFIA 2B14A 2EH8L 2VN6A 5D7EA 4P06A 5LGJB 1FRGH 1AGBA 4HC1H 5FUOL 3IRZA 1UQSB 3QCUH 1IZJA 5CGTA 5CCKL 1KACB 1UD4A 4Y4HC 1HH9B 5FS5A 3HUJF 5AOLA 3I6KA 3MLUH 1JF1A 4G6KH 4JFPB 1BQHA 1KIRA 1AZVA 3GPSA 5SV4A 1HOCB 1PX8A 3GC3A 4KPHH 4RA3A 5AKSA 4ABUA 5JHDD 3QZMA 1YEEH 2QV2A 4D0BA 2XRAL 4YH6A 1HVXA 4ZNCD 1RMFH 1U8OB 5DD3H 2F1BA 4KK5D 2WLMA 4UMSA 5FM8A 1JHLH 1BYPA 4FZ8H 4UDUB 1EVTC 1CLZL 2BNRA 5DURD 5H37G 5A2IH 2O4EA 3I6GA 5IHLB 1XIWC 5K1NA 3DIVA 1J12A 3NZ8A 3OJMB 3A6BL 2YSSB 4NHUA 4R4FH 4EUPB 3AAZB 3FUNA 3TEZA 4A7SA 3QZPA 4KI1A 2AABH 1OXYA 3T77B 1BX2A 4OCWL 2A74B 3OBAA 3WLBB 4GLRI 4RFOH 4WFGE 2V4LA 4J3OF 3ZZSA 2FBJH 3FTGA 4X4XA 1UD3A 5AW4B 1OW0C 3CZJA 3O9WC 4N5UA 1N6QH 4M8QB 3L5WB 3FSZA 3HE7A 2NZ9D 4GAJL 4L9LB 4YHIA 3GXFA 5JIMA 1KELL 3U4EA 3AY2A 1CFSA 4U0RC 5D1XA 4BCXA 3LKSA 4N2GA 4FYQA 4N22A 1BGXH 4LARH 1SXSA 3IKKA 5F1IA 3CAFA 2UY6A 4LOVA 1C08A 2K7QA 3RFZA 3AWEA 4NQDB 2WLIB 5CUSH 3W2DH 3FK3A 3VXPA 1NC4D 4N0YH 4UILH 4JN2A 3FFCB 3CC5A 4N0FB 4Z95H 2APXA 4ZTOL 1I1AA 5C9KA 2ED6A 3LPWA 2QDVA 3EJYD 5G5DA 4PCKA 4KKNA 1AZNA 4N0RA 1G7HA 1VPOH 1ZCRA 3DGGB 1GW6A 1WCQA 2VAJA 3QJSB 1EPFA 1MCFA 2NQCA 4JDTL 4OUUB 3FSOA 1G9MH 3G6JB 3P4OA 4J23A 5FB8A 3KPMB 3QT2A 4A04A 3FQWB 4M1GH 3NCJH 1CT8A 1A2YA 5CZRA 3MR9A 1IEHA 4FD0A 2WBJB 1BXUA 1AXIB 1NEZG 2PR4H 3GBNL 1T7XA 3LOWA 1JHKL 4BELD 3MLSL 2J1WA 3HB3C 4M7JL 4P2OC 1M9SA 4TPRL 5FFGA 3ULVE 1F45A 2J88L 4LP8A 1EA9C 2E75C 1ODUA 2NTSP 4EVNA 4FXLA 5IFJA 3NIGE 2BNRD 3QEHA 4DEWA 1IGTA 1IGFH 4PJ7B 1NKOA 4FQLH 3U2IA 1JN6B 2Z7ZA 2OL3H 4J8RA 5AAPA 1S78C 2Q6WB 4HHAA 1XF5A 5KVFL 2AXFA 3TZVA 4F2ME 5CIPH 3MZGB 4BSWB 4LU5L 2BIIA 3NJXA 3UZQB 4BZ1L 3VFPA 2YHGA 2HVKB 3EFOB 3HI5H 4BSVB 3RA7L 5KBLA 3TBSB 1UA6L 2MOQA 4DCQA 2H32B 3B5GA 3SDAB 4I48B 3ZUCA 1MN4A 1X44A 2PO6A 3CFCL 5E94A 1KLUA 3HE7D 4RZCA 1QLEB 4R3SA 1OAZH 4NBZB 5IMOB 5E70A 3DXAA 4CILA 3GO1H 4J27A 1PZ2A 5D1XD 2XV2A 3ULVC 4J7RA 1MHHB 3A4AA 5DEGB 2V0AA 4P46C 2F5BH 3GINA 3AREC 2YD8A 1BA9A 4O58H 5L8LB 3SQOL 2H45A 3PABB 2IH8A 3EKCA 1BVLB 2O5ZH 4XOAA 1ADQA 2PR9A 1XSJA 2RQ8A 3O4LA 3RZCA 3LEYH 2XTJB 4JRWA 3U25A 1U8JA 5JW5A 4ZAKD 3S35L 1MFAH 2QTEA 3QZOA 3LKNB 4F37F 1A8JH 3QCVL 4XN2A 4LASH 4OLUL 4APQC 4GEIA 2H1PH 2ADIB 4HSCX 5D1QD 5BZDB 1LE5B 3KPSB 4MNQA 4AWJC 2DWYA 5AAWA 1A3QA 1HQ4A 3BGMB 4HBCH 3U9PL 5KOMC 1WA0X 1RI8A 3O2DL 1B3JA 4I9WD 1YCSA 4EJ1C 1HHJA 1Z9SB 3MRKB 3SJVE 4HZLB 3RY5A 3RWEA 4I77H 1LWJA 4ZNEE 1VLXA 3TA4D 4PGCB 1PDKB 1AZUA 4QHKI 4KVCL 4Y9CA 1RZIA 3P2TA 2VZTA 4X42A 1FNEB 3TZVD 1PLBA 5DUML 2CSPA 2VDQB 4CVZA 4P4KB 2G3ZA 1JV5A 3CHXA 1QFHA 4HIJA 4UDTB 4UQCA 3OAUL 2A3TA 5D2NC 1S3RA 4X7SH 1CLVA 2F53B 1M05B 3OG6B 2PO6D 1OY3B 4FABL 2DQJL 3WN5A 1AOZA 1MWAB 2Q8BL 1YN7A 3W3BA 3CSTA 4KUZH 9PCYA 4UV4H 3SD2A 4OIAA 3CNKA 3KPOA 3EH4B 4XP6L 5D7LA 2Y7SA 1QWUA 5F88A 2AP2A 3RHWF 3SDXB 4DP6X 2Z65C 4GQ9H 4MCYA 4P07A 3A24A 5GGSY 1UCBH 3PE9A 4AKQA 1LP9F 4OM1L 4YSCA 1W9XA 2F6AA 4Q0XH 3CQPA 3HC3H 2VDRL 1ANUA 3O4LD 4FNUA 4J28A 4OB5H 1KPUB 1HSAA 4KY1L 3IRPX 3KWWA 3QQNA 1GGYA 2ODHA 4OZGE 4FG0A 2VDPL 2CLVA 1V54B 3ZUNC 3NFPA 3MOBL 4ZS6D 1KN4H 2R0ZL 1XO8A 5F7BA 4NQUA 5E4AA 3APNA 1MI5B 2H6OA 3FMGH 4DO6A 4KH9A 4CN4A 5EIIA 2PTTA 2J5WA 1VZIA 3NP3A 5AFAA 4BIKA 1D6VH 5ESVA 4L3EE 5HYSB 2PPCA 4MHHG 4AGPA 1JHTA 3ML9A 2HSIA 2FIKA 1JZHA 2FEDD 4JHWL 2EIEA 3IN0A 4WGKA 1YPZF 1SLWA 1V55B 1JXDA 5DQ9A 5IMKA 2OMTA 2G2NA 2XZQH 1IAMA 3AS3A 4NO0A 1AAJA 4I3RH 4OVVA 4JQXC 2P28B 4LHJB 5EIQA 3UTTA 1SJXA 4AM0A 2H6UA 3OX8A 1DLFL 4KNTA 4O9HH 3H53A 3S37H 4AW7A 12E8H 2F1AA 3RUGE 1IQWL 4HGMA 2ENJA 5MHSE 2DLEA 4UNIA 4OFYA 1GR7A 1RU9H 4JPKH 2VDLB 2NSXA 3M1CA 4MAZA 4X5PA 2MNUA 4NXKA 2GBAA 3FCUB 5DUBA 3T65B 4MAYA 4EZLA 4KDTC 4XP9H 5TD4A 1HINL 2H2PD 4XP1H 4JDZA 2GC4C 5IB5B 3UMNA 4PBDA 4EZKA 5GJSH 4RH4A 2V37A 2QSQA 1A64A 1NCTA 1LM8V 1F8TL 4IRJC 5CBAA 3D4CA 2IOOA 4M7KH 2NW3B 4LSUL 3WMQA 3ABKB 2E6JA 3B1TA 2GUYA 1QUNA 1RSYA 2ZAHA 3BFQG 2BOCB 3KLHC 3NBNA 4EE2A 4PJCA 4Q97A 4J4PD 4D3CH 2YA0A 2EABA 5DRZA 1EFQA 1PZBA 2IDCA 5I8OH 5CD5C 3U0WH 1UZGA 2NSQA 3KYMA 3VXRE 3UC0L 3MJ8A 1XGUA 5D7HA 1KZYA 2ENPA 3ULVL 1KG0B 3E0GA 4C4UA 4N0CC 5KSVA 1O9VA 4MD5B 3BVUA 1GGIH 5I6PA 3R18A 2IH3B 1DSWA 2E4TA 3H85A 3U7YH 2VZ3A 5CZXD 1HT6A 4DUVA 3WLWD 1ECZA 3FUDA 4PJIE 5F89A 4F1SA 1A1OB 3AGVA 2VMEA 3LNFA 4AUJA 4JFEE 4LPCA 1H15B 1TQSA 4NO0D 4MJIB 1XBDA 4GYBA 4HIIB 4TF4A 3U36A 5AW8B 3UTTD 1A4JB 3O6ML 5AL0A 2W60B 4MNHB 1KULA 4U1MB 1ZEAL 5JIPA 2AEWA 1MCSA 4K5NA 3CPLA 2NY3D 4GSDH 5BRZE 1DJGA 4GRMB 1G6VK 1CB4A 5DO8A 2Y7NA 2ZOKA 3J8F7 1H6UA 5DS8B 1FN4B 5IR1A 4OFYD 4AQOA 1SMDA 4XZUA 1G7IA 2VDNB 1IX2A 2V17H 3M88A 3OAYH 4MAYD 4OLEA 5ACLA 4ZMLA 4LOUD 4JDVB 3WKPA 3NIDB 1FYTB 2DM4A 1WAAF 3ARSA 4LPYA 4PWKA 1F56A 1RMFL 1DJZA 3HBGA 5DD3L 3TIEB 3O3BB 2P4AB 2FWUA 1NFDA 2DLHA 1NCNA 2A6IB 2LVEA 4FZ8L 4JPWH 3V6ZA 4W9CC 1AGCB 3QSKB 3SGKC 4L8SA 4R4FL 3S0PA 4YHOH 3NSJA 2WWKO 5CLTA 1RP9A 4ZO9A 4D9RD 1E42A 1JGDA 1QZ1A 1UASA 4L4VD 2Y1AA 3BPOB 3PREA 4OI9A 2BRQA 5M7QA 4PJFF 5DJYA 5B1CA 4ZDHB 3SY6A 4OIIH 1IM9B 2XN2A 2B77A 3O2WL 2NCEA 5E9DB 2FBJL 4FJ6A 4W93A 5SWZB 1E4WL 2D8KA 1N8OE 3WY1A 5C08A 5I18H 4NKMB 1KYDA 1SYSA 2ZX8A 3SQBB 1N6QL 3O11B 1EBPA 2Y1ZA 2HG0A 4D9LH 3VG9C 5IEHB 1T6BX 2FTAA 4GEJA 5E2VH 1BZ9B 5IB4A 1BGXL 3DI3B 1GHFH 2VERN 3IK2A 3UP1A 2EEDA 3EH3B 5E2WH 2IXQA 3W2DL 4Z76B 2X6MA 2XACC 5DMYA 2F0CA 4YBLB 3QAQA 4Z95L 1JZ2A 2A1WL 2RB8A 1FFOB 2IQ9L 5DK2A 2NNXA 5LG6A 3EXLA 4KMTH 4APXA 1CYWA 1TVDA 3QJQB 3OF6A 5C0AB 4MJ5A 5FYJH 4OZHA 4U6TA 4DQAA 5J6GB 1SJEB 1G9ML 1HAUA 3NABH 4X6CA 3SPHA 4G9FB 1J0HA 4RMRA 5F6HJ 4M1GL 2ZWSA 4ZS7L 1F6AB 2QQLL 4M7ZB 3C5ZD 1CCZA 2PXYB 3EOAA 1DQJB 1VEOA 4MYWB 2XCMC 2QKIC 5DZAA 1ZLUH 2GITB 2PR4L 4I0PB 4BHUI 5F7UA 3HR6A 4L18A 4LHUA 2I60H 3UTPE 5EO9A 1BPVA 3A5VA 1OP5K 4R9HA 2EXYD 4ZZFA 1QA9A 4IRZH 5ALCH 2HG5B 2ZXQA 4ODXA 2FJGA 4RBPH 4BZYA 2OL3L 1LEGB 3ILPA 5JW3H 5KYNA 3L6FA 4G5ZH 4JM2F 4K8RC 4N8CL 5H8DA 1WWWX 1XH1A 2W65B 3DPBA 3KH3A 1XAUA 4JO5A 4NZTH 2K6YA 4NDMB 3VD0A 2YEQA 1I7UA 1Q9WA 1BCIA 3HI5L 3TCLA 5IKCA 5DEJA 2ZP8A 2X7LA 3RVXC 1AXSB 1AZRA 2HUHA 2TSBA 2ZIDA 5I5RA 2NY4B 3GMPA 1FL5B 5I66A 1CFVH 1S8DA 4DAGL 3NEXA 4HMDA 5C08D 4H25A 2FGWL 1KWKA 1QSFE 3MRPA 4TN9A 2EZ0D 4XN8A 3BCFA 2QADC 4JCLA 2BVTA 1OAZL 2BIMA 3V10A 1DBAL 5DFWH 1UOKA 2YZ1A 3ALXA 1TU2A 3GO1L 4GIAA 4X83A 4EF3A 4R97C 2MRYA 3FAXA 3GHEL 4LPWA 4Y4FA 3VWKA 3K8MA 3BUDA 3TO2B 1OIOA 3MVSA 5BUGA 5AD0A 2BM3A 4N9OB 4WWNA 2F5BL 4GBXB 2VDKL 2BVUA 3H3PH 4O58L 4QPEA 1MJUL 2R83A 4L8DB 1ZSHA 3JVGC 1OCZB 1ET7A 5I2IB 5E03A 3ZDWA 3ESPA 2WXNA 4LVEA 4MVBC 1Q9OA 1WTGT 2O5ZL 5I76A 2H0JA 3C60C 2APSA 4JFQB 3VXMB 3CVHA 4MNGA 3I6LE 4KK6D 3T0EC 2NT1A 2C5DC 3INUH 4F33A 1B0GB 4KDVA 1F3JB 3E1F1 4JY4A 2CO2A 3DJSA 3F5WB 3F64A 3DX3A 4I13B 4YAQB 4Z7OE 2I7OA 3PS6A 5IMLB 1V10A 1OGTA 4AUUA 5ID0A 4MZ2A 1CDUA 5FYKU 3ZT6A 1JZ4A 3BT0A 3GMOA 1W8NA 2MMXA 4LHUD 1NGPH 2BVQA 1PGRB 4U6VL 1YLBB 2DJUA 4GNKB 4BFKA 4M61B 1XH3B 3N85H 3OGCA 4OZFB 1F3DJ 4PJ9A 1Y6MR 5JYLA 5EN2A 3GDBA 1MEXL 1W72H 4P48A 1WDAA 4X6FB 1F13A 1U42A 2DICA 4LVHB 2EJ1A 1LO5B 4FQCH 2ITDB 4U1NB 1JK9A 1WSST 4RIRB 5ENWA 3HE6C 1KDIA 4M6AA 4Z7UF 5AOJA 3WHE0 3VJ6A 4H7VA 1NICA 3LKRA 1AXTH 4N9GA 5F7DA 4ORZC 3MLWH 3M8OH 2HKHH 15C8L 2D0GA 2Y07H 2YOCA 3IKCB 3O4OB 3EHBC 5FYJE 3O0RH 5EBMB 2VXQH 5B38G 3D07A 1GJIA 1A0QH 1L7TH 2JXMB 1D5XA 3TBYA 5HDQL 2FB4H 4B9JA 2EKSB 4AMWA 1T4KA 1RIUH 4Y4FD 5EA0H 2PWEA 4MQXC 5C0IA 1HZKA 3UPAA 3VI3F 4YHLL 3WTVA 1UEYA 4X0NA 4GQ9L 2A0LD 4ZSOE 1UCBL 4FX5A 4FTVA 2A9AA 5IIEA 4I2XE 1P5VB 4FA7B 2IF7A 3K6IA 3QNZA 4Q0XL 5EO0A 5KN5B 5DEFB 1P69B 4ICWA 3Q43A 4OB5L 1FDLH 2DY2A 2ICWI 3SBWC 1E6JH 3WY4A 3MAWA 1V27A 2YD5A 1LE9A 4FQXC 1NDMB 3L9RA 5J6SA 2H26B 4FI8A 4QJ5B 5IVXA 3EUUA 3K71B 1A25A 3S88H 1YNTF 2K9FB 2L8AA 3DJZA 2J8UA 2CMRH 3FHAA 4KI5E 4PAZA 1ES0A 1KN4L 2X6BA 3G6DH 4HUUA 3WI9A 4QOKB 2JB5L 3B7UX 1OP4A 6PCYA 1PBYA 4DZ8A 2NSMA 1LILA 5IBUB 2C4FT 1FNLA 1T22A 4AT6A 1KIUA 2DBJA 3PHAA 1G0XA 1AC0A 3BJ91 4HH9A 1LJMA 4FQQA 1BXVA 5I1LA 1MFBH 4EN3B 4PJ9D 5C09E 5L88H 4LRNH 1CFNB 3JWDH 2GJJA 4JM0A 1KXVA 4JO1H 5J6HB 4LLDA 3D39E 3H2PA 3JSSA 4HZ1A 4QHLB 4F2EA 5DK3A 3U83A 1HOEA 4Z7QB 3DRQA 3ABZA 1EEZA 4HBQA 5IJKC 4MMZC 5E00B 2NDGA 3RGVC 4BH7A 3LNIA 1B4RA 2NT0A 3S37L 5T5FL 1XGYH 3LZPA 2VE6B 2EIMB 4RX4A 4BK5C 3O3EB 3F00A 3ULSB 3HKZA 5CINH 5I1EH 5IM7B 1R3JB 4PY8J 2CDEB 4CUCA 4LPXA 3MO1B 3X13B 4E41D 2ZXWB 3BZFB 4UBDD 4QXGH 1PFCA 4JB9H 4ZUUA 4A63A 2BSRB 2C9SA 2PTUA 5FLUA 1B0RA 2XU9A 4XP1L 4JHBA 2Y5QA 1A9BA 4ICXA 2DLFL 2OMXA 4PD4J 3AGWA 2R23A 5DFAA 1KCSH 1AC6A 5CJQH 5GJSL 4JRFA 4K8RL 5F2FA 3O3DA 2D03H 2DH2A 4IMLB 1N2RB 4QD2E 4MMXB 5GGTH 4NPYA 2EVFA 1CLOH 3EGDA 1N12A 3BO8A 1A6VH 4EN2A 1ZPLA 4AYEC 4KOBA 3D12B 2NZIA 3FU9A 5TDOB 3QAZB 4HW6A 4ONFL 1D5MA 2I7SA 3L4CA 3TH2T 2X40A 3U0WL 4Y16A 3RIFK 1BXAA 4G8FA 4XVTL 5E99H 1HILA 2HLFC 3BKML 3CFEB 2QVKA 1SLXA 3SYPA 4JLRB 1GGIL 2VXVL 2DJMA 2OA9A 2ZT9C 3IDUA 5EOTB 5G4NA 5ITBH 1A6UH 3TGXA 4PRPA 1Z3GL 2JJSC 2HJLA 4Z8FL 1TYEB 2JCCF 1MW3A 4MJ6B 4MS8D 5IK3B 3FS9A 2BERA 2YPKB 5I0WA 1HE8A 1UHVA 4ZFOL 2XBZA 4TRPL 3V4PB 1QFWM 2WLLA 5I1AA 5FHBH 1X5XA 3ZE1E 1JFQH 4LB8A 1RUPH 4IMKA 3BN3B 1I9JH 1WLHA 5DJ0B 2E7LA 4M6OL 1N0LA 3D4GA 1T1XA 1MJJA 3RL1B 3FB5B 2R15A 2WKOF 4LCCC 4GAAA 1CLYH 4KGJA 2NYYD 3MPCA 1NC2B 4OGYL 1F4YH 1QVOB 1TJGH 4J3BA 4QIRA 5E4IA 4CC1A 4JPIA 2V17L 3WJMA 2XQYA 4Y4KD 1J11A 4FJZA 4LK4A 1A8ZA 1BZDA 4NBXB 2X6VA 3ARTA 5CSZB 2EE6A 4XBMA 4ZOCA 1J88A 3QQXA 2UV3A 1INQB 3LCYA 4M1CD 4P9HC 4B9FA 1J18A 1NIEA 1SXNA 3KW7A 3L3DB 3UTOA 5J12C 1BQUA 1FV1A 4YHOL 2OZNA 1EAJA 3HR5B 3KPRE 4CBZA 2WB1A 4XVUC 4QTHA 2HX7A 3DO4A 5C6TH 4OIIL 5FV2A 3R8BB 2UZYB 2J71A 1VAHA 3LZRA 4DFHA 2FJSA 2OW6A 1WH0A 1XGRA 2EDOA 4Y16D 2HFFA 1F4HA 4E9TA 1J87A 3BQUA 2OX5A 3CCHB 1BF8A 3ZL1A 2GI0A 2R2EB 4A67A 4JNXA 4X99B 4Z7VF 4F8PA 4JGUA 4DK3A 3BAYA 2R69L 4JVUA 3S2CA 4PRPD 3LRLA 1A6ZB 2F2HA 3T0VA 5J7CC 1JZIA 1YDPA 2PWFA 4G1EA 4OZIF 2KLSA 3QJHB 5HYJB 3US1A 3AADB 3IMWA 3I9GH 4PHZA 5FO7B 1T20B 1U33A 3DIFB 1U8KB 2X44D 1Y18A 3IDNB 4MB5A 3V52H 3PL6C 3MNZA 2CRIA 2NCMA 3CFJA 3OKLB 3N0AA 4XNAA 5DXWA 3FH8A 1J8HE 4DK6A 4G6AC 5HHNA 2EIZA 5AVSB 3PNWA 3KL0A 4LLQA 3NABL 4O02L 5E1AB 5EU7C 3RNKA 4OSUL 2YOAA 2WZ6A 3POCA 3VSTA 1HQRA 4CMMA 4W4OA 5EZLA 4DP1X 3TTSA 1G7MB 5D7JA 4FFZL 3AXIA 4F8OA 3ARFC 1QR1B 1JGUH 5B8CA 2XN0A 4JFXA 3ZE0E 5I17B 1WBYB 3QUKA 2I60L 3R0MA 1FHGA 4HOWA 1MRDH 4MB1A 4AI7A 1VEMA 1MJ7L 1SBBA 2KBGA 4IRZL 4NZUH 5ALCL 4TVPD 2E8YA 3ZHNA 1MW0A 2IAAC 3TV3L 1QPKA 4NQEE 4D9QE 3FT9A 4F7PB 3RY6A 4AGOA 1IGML 4BK8A 4YXKH 4G5ZL 5HYQB 2QR0A 5CP7B 4NOFA 4KTGA 4DOHB 2W9EL 2OSXA 3VFUB 3ZMRA 1P2CA 3B5HA 4A6YB 4MXQC 4DNLA 1Q1JH 1EQWA 4G8GB 5C3IA 1KWGA 1JUFA 1U58B 1MLCA 2A4EA 4MCMA 2IGTA 1W15A 4XVJH 3VXUB 2ZXDA 4P2RE 4WV1A 4XXWA 1W0VB 2C4FU 4R5VA 5ANMB 1BOGB 3BIKB 1L3WA 2NY6B 3ROLA 4NNPH 4OJYA 4JRYE 4OCLC 4IGBB 1TIUA 3OXRA 1KFAH 1GKEA 2YSTA 3MUJA 1AD9A 1JDDA 4ODVH 5AVRB 5CGYC 1F11A 3D2TA 4Q9QH 3FUMA 1ACZA 1ZA3A 4YHKH 2VSMB 4ODWA 4HXBL 5ICXB 1QHQA 2Z7WA 3F84A 5BO0D 2CR6A 3WFHB 3IXAB 4POZC 2YC1B 5D96B 3D0VA 5HJGA 2WXIA 3I9PA 2Z31B 4TSAH 3INUL 1T7WA 4XBEH 2D4FA 2VZSA 3DUUB 3QULB 1QO3A 1PD0A 2YZ8A 4PTTA 5EEUA 4U6YB 5FHAH 4NO3B 3VRLE 3I9AA 5D7JD 5IQ7H 5LG1A 2CO1A 1LP9B 5L4FA 3PHSA 5IREA 4ZO8A 4OFIA 3GB7A 5CJ8A 2CIKA 3QA3B 2WO2B 3QRGH 3O6FB 3FUFA 4PMFA 4QHPA 4CN6A 5CZVH 1NGPL 3FQXB 3MRFA 3TFBA 4J12A 1R24B 2EDBA 1CGWA 3CZLA 3H7BB 3WDJA 2WZ5A 3MSPA 4WO4C 3V5DB 2ITCA 4TOYH 2K4WA 3GJFH 2VR6A 4UOW0 3UCQA 3V0WH 1V3LA 3FB8A 3MXWL 3OV6A 3MCYA 2BK8A 2ETWA 4FNSA 4HJGB 4MDIA 3T6WA 2MFNA 1J5CA 2N1KA 4LKCB 1CVSC 1M71B 1Z5YD 1AO7E 3LS4L 2XYBA 2YQ3A 5TH2A 3UTSA 3GXDA 4WW2B 1EZSA 3CHRA 4ETYA 2B3IA 3MLWL 3M8OL 3OAZK 1PFOA 1I9IH 5KYXA 2QPEB 3O0RL 4GW5A 2VXQL 2IPUG 2EIBA 2OYKA 3QUXB 2LT9A 3DC0A 2FB4L 1MFDL 2BP8B 4UNTA 3ECBB 2Z0UA 3TCXA 2A9ML 4KJYB 43CAB 1J86A 1OGAB 4KVPA 3TL5A 2D73A 3RP1A 5KSBB 4TSCH 1WEJH 3VM5A 3QR1A 4PJDA 2CGYA 1G7PB 2AQNA 4UB0L 3MFFB 1PX3A 3FU8A 1UM5L 1VA9A 4JZNA 5HDBF 3MCKA 1DVXA 5EUOA 2ICEB 1KUMA 4JZJC 1FAIH 2V2WA 1DR9A 5L7XH 1HFUA 4E42B 2X4NA 2ZAGA 4DWHA 5F7YC 4P2QA 1IMHC 1FG2A 1O6SA 1A14H 1VB9A 4FXTA 2Z4QB 4K94H 4NYLA 1SBSH 4ATWA 4AV5A 5E1IA 1F90H 1SDDB 3NQIA 3KPQA 2APBA 2CMRL 2MOVA 4N6RB 3GSUB 4AMKL 1BJ8A 3MLYL 4FXGB 5HGBA 3TO4D 1WBXA 1K2DA 3MOAL 4PD4K 1T03H 2YUZA 4KITB 1JPSH 3CFMA 5ERWA 3SPJA 5KBKA 4OY9A 4R7NB 5AKVA 4DPAX 1QW9A 2XG5A 2FRGP 4WDIB 3LRGA 3UBXB 1PVHA 4Q6IC 1M2VA 1M6OA 1L6ZA 3SDDC 3AS2A 3U79A 3JWDL 2E9WA 1S7QB 5EC1B 3QG6A 3DVIA 2OW7A 3DYMA 1GVIA 1PKQB 4NQTA 5B7MA 5IG7A 2V7HB 1M1SA 1UJ3C 3GMQA 4PYGA 1YEKH 4Z7NF 1NWOA 3FUJA 1W8OA 1PIGA 1P4LB 4XCYB 1PS3A 4KH2A 3MJ9L 1OGPA 3IFLL 4TSBL 5DJZA 5FYLD 3EDKA 4FJYA 5D1ZA 5MEPA 2IO5A 4JFDE 1KTKE 4GW1B 4MXVE 4UZUA 1Q0EA 1B0WA 2BH0A 3BWAA 3TN0A 1IGCH 2FO4A 2R4RH 3U9UA 4IOSD 2VO5A 3SE4A 5A6LA 3QJFA 2VITB 1NCWH 4Q89A 4JB9L 4Z78B 2WLZA 4LBEA 4OLXL 5TGBB 2OZ4A 4A7VA 1C5BL 1IAIM 4XH2B 1ET8A 4AY0A 1OWRM 4WI4A 2VZUA 1QFWH 3IDMB 1KCSL 5CJQL 2DM2A 5E8DH 2DQFB 1JZGA 1OE2A 2W0FA 1JPTH 2WWMD 3ME0B 4HFUH 1OP3K 1YEGL 4NQVA 2ZNWA 1RHHA 2VRKA 5TQ2H 3FO0L 5A1AA 3W0WA 3EF4A 2JTDA 1CE6B 1AKJA 2ZG3A 3PHQB 4NQSB 1K9TA 4U1GB 5DUJA 4KFZC 3STBA 5ADOL 1ZKAA 1BMWA 2DWSA 1TLKA 4HEPA 4UTBH 1MNUL 3GEFA 3SKOB 1CGYA 3H9SD 4P2QD 3E7JA 5EOCJ 2HLAA 3CIQA 5I71C 5T1JA 3P9LA 3DV4B 5DHYB 1EANA 1MPAL 2A38A 2Y69B 3MRGA 3ETTA 2NX5A 2F8XC 1YNKH 2XZCH 5GZOA 1K8IA 1OLZA 1TO4A 2IMNA 3VRIB 1NCJA 3MV9E 1Z3RA 1W6WA 5LCVH 2W92A 1T0OA 4BA0A 1ORSB 3L3IB 3BI9X 5F97E 3PPSA 1QWNA 1XZ0A 2H9GB 2QSCL 4HV8A 4JVPA 5CHNB 4PJ5A 2Y9RT 5F8QC 4X4YA 1BZ8A 3AB0C 1CZ8H 3Q06A 2R7EA 3ARZA 3RVWC 4PLJC 2VLRB 4YDZA 1IU1A 3AACA 3GSNB 5I15L 1CTNA 3R1GL 4JW3A 2EC8A 1DEEB 1CD9B 4EUPH 2CUIA 3RTLA 4WTQA 1TKWA 2GTWB 4N2NA 2BVYA 3VFSA 4N8PA 1RZFL 3L3OA 2E59A 4XI5D 1CLYL 3TV8A 5T1LB 1NLDH 4GG8A 1IKFL 4HIXH 3EYQD 4AQ1C 2V2XA 1Q8MA 4QNPE 2AEQL 2C9RA 2DIEA 3S36X 4QF1A 2Q10A 3UERA 4X6BA 3VXQA 1JNNL 4WU7A 1FVCB 1OAKL 3PV6A 2P3YA 4JJ5B 5C8JB 1IL1B 4HX1A 5H37A 1AMXA 2KZWA 4J5VA 3N9GH 5IHHA 3KYAA 4KTDH 2W9DL 1MVYA 5J9PB 1A6PA 4LPUA 3W0WD 4BKLA 3TEYA 1IGYB 3D2UB 4RAVA 3HCVA 1AKJD 4MASA 4IOIB 3K2UH 3TFKD 4HHWA 3GSXA 4UZSA 4RFNC 4BJLA 3WEAA 1DANT 4K3JH 1JTOA 4JY6B 4RMWA 2VN5A 4JJOA 3LZNA 4TM9A 2B16A 1SNRA 1MCIA 3BIBX 4G7QB 2NX5D 5LWYH 3DX0A 5E7FA 1TVHA 3KNBA 1SDYA 3ARBD 4Z0XB 3ZR6A 3G04A 3JT2A 2ITFA 3BIAX 1UGNA 3BD5A 5IBLD 2RALA 3TASA 1ZTMA 4YVUA 1KENH 3OXSA 1U8CB 4BZ2A 2AAAA 5F7FA 3HFFA 1EO7A 4N90D 4PJ5D 4F91B 1YMMB 1SXAA 4W9DC 1CD8A 1HKFA 3I9GL 1YHPA 4PJBE 3QHFH 4HGKC 4GSXA 2VUKA 5D6DA 5E4EB 4NXSA 3WUZA 1CG9B 3GLAA 4LPTA 3V52L 2YPLB 3QI9C 5C7ZA 5F3BB 1ED3B 4BDVB 2PYEA 3WHXA 2CUMA 3ZKND 3B9KA 5IQ9A 3OR6B 1FL3B 4KQ3L 4WW1A 3RDTC 4ZD3H 4KO7A 4YDLB 3JUYA 3V6BR 3HTLX