2HRGA

Crystal structure of blue laccase from trametes trogii complexed with p-methylbenzoate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
496
structure length
496
Chain Sequence
AIGPVADLTISNGAVSPDGFSRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAKVGSPVPTADATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHVFSIDGHSLTVIEADSVNLKPQTVDSIQIFAAQRYSFVLNADQDVGNYWIRALPNSGTRNFDGGVNSAILRYDGAAPVEPTTSQTPSTNPLVESALTTLEGTAAPGSPAPGGVDLALNMAFGFAGGKFTINGASFTPPTVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATAAAPGFPHPFHLHGHTFAVVRSAGSSTYNYENPVYRDVVSTGSPGDNVTIRFRTDNPGPWFLHCHIDFHLEAGFAVVMAEDIPEVAATNPVPQAWSDLCPTYDALSPDDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Crystal structure of the blue multicopper oxidase from the white-rot fungus Trametes trogii complexed with p-toluate
doi rcsb
molecule tags Oxidoreductase
total genus 143
structure length 496
sequence length 496
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hrgA03
5I6NA 2CUAA 2XXGA 3PPSA 2JFCA 1GSKA 1IBYA 3ASNB 4QKTA 5I5IA 4AKPA 3AG3B 1ZDSA 1OE3A 1KDIA 1J5DA 2BP8A 1ILSA 2VN3A 5E9NA 3H4HA 5I26A 1YLBB 4X4KA 2J57A 3FS9A 1V55B 1FWXA 2XUWA 2ZXWB 1CURA 3BQVA 1AR1B 1URIA 3CZUB 1JVLA 5TK2A 1SF3A 1DZ0A 1GW0A 1IKOP 3FSWA 2FQGA 4DP0X 2GIMA 2PLTA 4DP8X 4AKOA 3SBRA 2BZ7A 3T6WA 1HAUA 4E9TA 3DTUB 4DP4X 4YSSA 5FC9A 1SFDA 4YVUA 3PXLA 1AZNA 3V9EA 1HFUA 1OOWA 3FQ1A 1ETJA 4BXSV 4HCIA 1BYPA 3QJTB 3GXUB 5AZUA 4HALA 1J9TA 4KO5A 3U25A 3QJSB 3X1BA 2HXAA 4WTQA 5D4HA 3IN2A 3FU8A 3NP3A 4AX3A 4W9ZA 2GHZA 2BHFA 1KGYE 3EH3B 3PCYA 4GP5B 1BEXA 1JZIA 4GYBA 5IY5B 1L9RA 1M9WA 1BAWA 3C75A 1CYWA 3QJVB 1GY1A 4YL4A 3X2QB 4DP6X 2A3TA 3X1NA 3QJUB 4DP2X 3FSVA 2UX6A 5B1JC 3T6ZA 1WAEA 1E5ZA 3NJFA 3NSDA 5B7EA 3WNJA 2UX7A 1ASQA 1A4BA 1I53A 2P80A 3FSAA 3NYKA 3TU6A 4L0PB 3CVBA 3FU7A 4E9QA 1OE2A 4GP4B 1E65A 4YSRA 1XB6A 5B1JA 3NJNA 3EF4A 7PCYA 1RZQA 3PAZA 4PCYA 1JOIA 1ET5A 3NSFA 1ASPA 2PCFA 4HHWA 2IH9A 1ZIAA 3NJGA 4HCFA 4HZ1A 2BP0B 2EIMB 3NJMA 1NDTA 3EHBB 5I6KA 2XVBA 3ABLB 2FJSA 2I7OA 1VLXA 1F56A 1AG0A 3QJQB 3BVDB 4HIPA 3OMNB 3TASA 3EH4B 2CALA 2DV6A 1WA0X 2GC4C 2J5WA 1J9SA 3CDZB 3N2JA 3ABGA 4DPAX 4BWUA 1BQ5A 1MG3C 1SHWA 3EH5B 3IBOA 3TBCA 2ZOOA 5PCYA 3SBPA 1KV7A 2QDWA 3QJRB 1ILUA 1UATA 1PZBA 2VW4A 1T5KA 4DP5X 2PPDA 1TEGA 4A68A 3IE9A 2E86A 3UGEA 4A66A 2HX8A 3H56A 3X1FA 3ZX1A 6PCYA 1IBZA 3N55A 2WO2B 1PZAA 1ZDQA 2WSDA 1X9RA 4BK5C 1JZEA 1OF0A 4A2GA 2BO0A 1GS8A 2NRDA 4GP8B 2PP7A 4UF7C 3ASOB 5B1KA 2BWIA 4E9XA 1PCSA 4KO6A 3L45A 2FT8A 3GDCA 4BWTA 5I6PA 2TSBA 2HLEB 4M3HA 1TU2A 4YVNA 2YAOA 3QQXA 2MRYA 4AI7A 4G70B 3UACA 1JZHA 1GS7A 2H47C 3FYIB 2IDTA 2HRHA 1RZPA 3SQRA 4DPCX 4BDVA 1MZYA 1TKWA 1ID2A 2FQFA 1IUZA 3NT0A 1NPJA 4DPBX 1SNRA 1ET8A 2YAHA 1CYXA 1V10A 2GBAA 1J5CA 2FNWA 4JKNA 4G7SB 2VSMB 2IWFA 1OCCB 3DKHA 1JERA 3AY2A 2VW7A 3X1GA 2UXVA 5I28A 1J9RA 2YQBA 2R7EA 1A4CA 4UAHA 4KO7A 3NJHA 4A2DA 4BWWA 9PCYA 4P5RA 5I5MA 2GI0A 3RYMA 3SBQA 2XX0A 1E67A 2W88A 1JVOA 5TK4A 1AIZA 5B1AB 2IAAC 4QLWA 5AFAA 2AVFA 1AG6A 2YXWA 2ZWNA 1PLCA 5B1BB 1AZRA 3NJIA 2TSAA 1BXUA 4KO9A 4FAAB 3AW5A 4DP1X 2AZUA 2IDFA 1ASOA 5D4IA 2XU9A 2IDSA 4HHGA 2FQEA 3TBBA 4ZK8A 3NP4A 1R1CA 2VW6A 2WO3B 2YAMA 3DIVA 4GXFA 4NB7A 2GB2A 3OQRA 1BXVA 2ZONA 4F2FA 2VMJA 4NERA 3OMIB 4FA7B 3GYRA 1CUOA 4UANA 1PNCA 1OCRB 3OMAB 2PPFA 2Y69B 3S8GB 5I6LA 1ZIBA 2BP8B 3FSZA 2OJ1A 5A7EA 2AZAA 1KBVA 3WKPA 1ZV2A 5ANHA 1L9SA 2YARA 4BDVB 1TEFA 1AACA 2XLLA 4YSQA 1AAJA 4K9JA 1A4AA 3KW7A 4E9WA 2QPEB 3FU9A 1XMEB 1GYCA 2MTAA 3MX0B 1AOZA 2CBPA 2VM3A 2XWZA 1GY2A 2UXTA 4KOCA 4CSPA 1JZFA 3AG2B 1OE1A 2IWEA 1BQKA 2XXFA 3NJLA 1EHKB 3H4FA 2VSKB 2R7EB 3S8FB 4W1TA 2IH8A 1JXDA 4HAKA 1AQ8A 1W8EA 1NIAA 1OCZB 1A8ZA 3NSYA 2I7SA 4MFHA 2DYRB 1N68A 2Q5BA 2PPAA 5B7FA 3KW8A 3WKQA 1PLBA 3PAVA 1QHQA 1AS7A 1FA4A 4G71B 4E9RA 4Q89A 1BYOA 2Q9OA 5D4JA 2I85A 4YSAA 4N8UA 4YSUA 1IC0A 7PAZA 1PY0A 3S3CB 1W6WA 3FQ2A 1ZPUA 1NPNA 5LDUA 2QDVA 1E5YA 3HB3B 1AZBA 2EIKB 2GC7C 5EHFA 5B3SB 2QT6A 3FU7B 1ADWA 4WKXA 1WA1X 4A2EA 1GR7A 2JXMA 2VM4A 4AZUA 1HAWA 1JXFA 3PLYA 1AS8A 3JTBA 2XX1A 3V9CA 2HRGA 1RKRA 2GSMB 3NSCA 3G5WA 3T6VA 1NIDA 3NJJA 4JHVA 4KOBA 3D12B 2H3XC 1M56B 2HZHA 3ERXA 3X1EA 3T6XA 1MDAA 3T71A 1E30A 4ENZA 4RH4A 1FFTB 2H5UA 2DWSA 2XV2A 1WS7A 2IDUA 1KCBA 4KNTA 1L9OA 1AANA 1AZUA 3WIAA 2FWLB 3WG7B 4E9YA 3FPYA 4DP9X 2EIJB 2YAFA 3MBWB 4E9SA 1AZCA 3S3BB 1SF5A 1BXAA 3QPKA 2BWDA 2YAPA 2EINB 4GY4A 4PAZA 4YSPA 4YSCA 1RCYA 1MZZA 2BP0A 4NAJA 3ZIYA 1B3IA 2OCCB 3PAUA 1PLAA 1ET7A 3UABA 1SDDA 2P80D 2PPCA 2BW4A 2X88A 1X9UA 3FYEB 3WNIA 1SJMA 1OCOB 1PAZA 2XYBA 1NWOA 1KCWA 1NICA 5F7BA 1WS8A 3CDZA 1KBWA 1OV8A 2PP9A 3T9WA 2AANA 1J9QA 4AKQA 4CSZA 1M57B 1W6LA 2BZCA 3OD3A 1KYAA 5F7AA 2CAKA 4JHUA 1QNIA 3ABMB 3CVCA 2LLNA 3WI9A 2BW5A 2FTAA 4YSTA 4YSEA 1L9PA 1CC3A 5I6OA 1A65A 1PMYA 3ZDWA 4A2FA 2J56A 4F2EA 3JT2A 4M4RB 4TXVB 2HX9A 4G72B 3FPXA 3UAAA 4N4YB 2UXGA 2W8CA 4G7RB 1MG2C 1PZCA 5I6MA 2PP8A 1KDJA 2X87A 1JXGA 1NWPA 2DWTA 2B08A 2FT7A 2FT6A 3AG4B 3HEIB 2N0MA 2UXFA 2CJ3A 4F7KA 1EZLA 2PCYA 1QLEB 4YSOA 1NIEA 3S3DB 2EILB 1SHXA 1V54B 4KNSA 5I5JA 3UADA 1SDDB 2IDQA 1JZGA 4A67A 2B3IA 1L9TA 2XV0A 2YXVA 2XV3A 1NINA 2HX7A 3IEAA 4P5SA 5B7MA 2YAQA 4E9VA 4KNUA 1NIBA 1SFHA 2OV0A 3FT0A 4BXVA 2PPEA 2JKWA 3ABKB 6PAZA 1JZJA 2CCWA 2Y1AA 1WA2X 1L9QA 2YAEA 3FQYA 2FQDA 3IN0A 1XB3A 1AS6A 3NJKA 1A3ZA 4HCGA 4YSDA 3ZBMA 5PAZA 1DYZA 3CVDA 4EF3A 2IWKA 4A2HA 5AKRA 1PF3A 2DY2A 2J55A 3OM3B 4DP7X 1BQRA 1GS6X 1XB8A 4Q8BA 3UAEA 1N70A 1NIFA 2QPDB 3TA4D 2RACA 1NZRA 2DYSB 3CG8A 4G7QB 2AFNA 1NTDA 8PAZA 3AG1B 1PNDA 3AZUA
chains in the Genus database with same CATH superfamily
2X1PA 2BMKB 5IHUH 3T3PF 5DVNA 5BZDA 5LNDA 5GJSH 3BYTA 5E2TL 4DEUA 4DVBA 4ZRGA 3ULVL 2LLGA 3QDMA 3TJEL 1A4JA 5EZOH 4AVKA 2BSTB 1CGVA 4NKDB 2VN3A 1SXBA 1MHEA 1YLBB 3F7VB 4JO5A 5IQ9B 1MIEH 1SMDA 4OQTL 3S97C 4MLSA 3G5YB 5JHMA 3FB8A 3WDIA 2DI8A 3JBG7 4OCWH 3TCXA 5J3HD 3V0FA 2MOQA 4NOFA 2HT2D 3VWKD 2PYEE 1HVXA 4K71C 5GZND 3CLWA 3MLSL 2BZ7A 4Y4HB 4YHZH 3EGXA 1RV6X 3VMPA 2VDNB 5DS2A 2Y06H 4DHLA 2DQTL 4DP4X 3MLWL 4MASA 3MAWA 4XMPH 3UTTA 5I71B 4AVHA 1S9XA 3VXPB 1KG0B 2X5PA 4P4RA 3S3SA 2FGZA 3AS0A 1HYSD 4GXUM 1LP9A 4HALA 3MLXH 2NW2A 4U33A 1T3FB 3KDMB 1QWUA 3J07A 2F19H 5TPWL 3GB7A 4E5XB 1RULH 3KHQA 1DBML 1P4BL 2GHZA 5D7JC 4L4JA 1UG9A 2GFBA 3Q5YA 4F33B 3TESA 3ULVF 1OOAA 4YJZL 5CNHA 4Z76A 4NRXA 3H7BA 3WO3B 1JGVH 5JNYB 2KPWA 3VFSA 5CWSB 3SODB 4L18A 3LHPL 4DEPB 2K70A 4BZYA 5I18H 3IETB 1WC7A 1K5NB 3BPLB 2OFQA 3D69A 3GSUB 4LT7A 3ULUL 5B1JC 4LHUA 3U7YH 3HG0A 1OTTC 5SX4I 5IHZB 2R29A 2P80A 1NDGB 3D85A 4PV8B 3PQYD 4WY7L 5FIEA 1OM3H 3VFVB 4ZMPA 5EU7E 4ZTOH 2F53D 4AV4A 1AKJD 3TA3A 5I8KL 3DBSA 3HBPA 2GUYA 5HYJB 2HJKB 1UYWL 3PAZA 3WL9B 1J7VR 3HBQA 3PGFH 4MDIB 4U6YA 1BF8A 3ZHDA 4LGSB 1ASPA 3WEXA 3NJGA 5ALBH 3RGHA 1U4FA 5HHVL 1FG2A 3H85A 2AGJH 1BP3B 3TVMC 3BI9X 4NQXA 3EGSA 4MZ3A 4XO8A 4J3VA 4CL7A 2C3XA 3JVGA 5KJRL 4NUJB 1A7QH 3BSZA 1LO4L 2J6EA 2ATKA 1INDL 1F56A 2BVQA 1AG0A 4JDTL 2CJUH 2VLME 3HW7A 4PW9A 4JFQA 4LPYA 4V1DD 3EH4B 4YHOH 2GC4C 2V9UA 1TTAA 2X89A 4KI5F 1Z0NA 1FIGH 4ZO7A 3FRPG 2P49B 2UZIL 3WHE0 4GMSH 1VAHA 2GBUA 1H9DA 1MI5A 5M94B 4QDGA 3TS8A 1EGJH 4X7CC 1NLBL 3FZUD 2K0RA 4TUJB 1P7QA 3P54A 1SXCA 2VDKB 4YHPB 4PCSA 3DRQA 2VZSA 3L2MA 4U3HA 5FYLD 5H37G 1MFEH 2EUXA 1JF5A 3GSOA 5AAPA 3GPEA 4BK5C 2BO0A 3U7WL 1SZNA 1PU0A 1RERA 2JTYA 1WGOA 4TVPL 4QHUA 4EUPG 5E5MA 3CFBB 1RPQA 1CD1A 2LTQB 3EOTH 2VERA 2WO4A 4ATWA 2VLRE 2W91A 3L54A 4F2ME 1UEYA 4UTBA 2HLEB 4MVBD 3EYFA 4PY7B 2R4SL 1BF5A 1V7NL 2VAAB 1IEBB 2IV9A 3D25A 4D8PB 1F6AA 3FYIB 4AYDC 2HRHA 4PBDA 2OBGA 3VFGL 3SQRA 1BOYA 1DUYB 3IPEA 1LEIA 5CR8A 3P4OA 3OGCA 2N4IA 1AO7B 1NEPA 3B4NA 4BFJA 3MLPA 1I1AA 5GGVL 3CZEA 1T0NB 4UQEA 4XMLL 1YEKH 4D8OA 3VD3A 4OZHB 4YDZA 3T0ED 3NA9L 5J6GA 2F54A 5EN2A 3BE1H 1MUJB 3O3DA 5I28A 5DJ2B 4ODUB 2WXHA 5C09B 2XX0A 2MCG1 3G7TA 1NBZB 4MA3A 4PJGE 5B1AB 2MCMA 1CG9B 4P57A 1FBIH 3MUY1 3SZ6A 2VQ4A 1VDGA 4M1GL 1MJUL 5AKSA 3NAAL 5CEYB 3Q0HA 4YDKH 2WIIB 1D6VH 4WI2A 3DO7B 4E0RB 4O02B 2RMNA 3VX1A 1QA9B 4GAFB 4W9LC 4ZS7H 1HK6A 2EJ1A 5F97E 1JHKL 2XU9A 2IDSA 3REVB 1WIOA 3C60D 5DC0A 5H8DA 2C9AA 2HRPL 4L48A 3SGDI 2OTUB 1RZ7H 3VWKA 3QAQA 5GZNA 3LHAA 1FORH 5DHVB 1KJ3H 3RJQB 1DL7H 1USZA 2K45A 3LN4B 1TQTA 1MCPL 2AZAA 1T5WB 1BZEA 1GH7A 4XP5L 3W5MA 4FFWC 3L4XA 5GIRB 4AT6B 4MQ7A 2FX7H 2OI9C 4J27A 3H2QA 4M7KH 3KYOB 5ICXA 1R3KA 2A6IA 4G83A 2Q86A 4X4ME 2NR6D 3HLAA 4WI6A 2V7NA 3VI4E 1FNEB 3MX0B 1Z3RA 1A0QL 4UV4H 3FF7A 2WB1A 1U8JA 2V9RA 3Q3GA 1I7ZB 1NOLA 2UXTA 4IKJA 4Y4KB 2Q7YB 1LK2B 5DMJB 2OJEA 4OZFA 3NJLA 5E0FA 3D5OF 1KV3A 1GAFL 4JFXA 1G9NH 3AU1A 4G6MH 1OCZB 2DQIH 4FP8L 3FXIC 1LO0H 2N7BA 3HFML 3UH8A 1YQVH 2DI7A 5IREA 1FV1B 5D7SL 3PQYA 1MLBA 4XCCL 1JPFB 1S2EA 2F53A 2J1YA 1AKJA 2XWBA 4FKEA 4NQED 4V2BA 2UWEE 1NCNA 1AHMA 4NZJA 3A6CH 1GZHC 2IADA 3UBXB 4BQCA 4Z7VE 5JW5B 4YSAA 2H1LM 3D7PA 2WZ5A 1B3JA 5AKVA 5LGJA 1AD9A 3WENA 4FHKA 3ROLB 4MJ5B 5E5LA 3VD2A 3ES6B 4G1EA 1WWBX 1TTBA 3DBXB 3TYFB 2XZQH 2MPVA 5EHFA 5DSCA 4E41E 4C56E 1O6SA 4PB9H 3VAEA 5B3JE 4CADB 5JIHA 2CDGA 3MUGA 2OMWB 5J9PB 1VGEH 5KWYC 4L8CA 4WFGE 2FAUA 4APQA 3BKYL 3RAJL 2IOIA 1KTKE 2F1AA 1JK8A 2QQNL 3EOAB 1MCBA 3IDMA 1ZS8A 3TONA 4WGWB 1MNUH 5EUKA 1GIGH 4HGWA 5BW7A 4PRIE 1MJ7L 5DMIH 2ARJB 4HEPG 1H9VA 5D72L 4B95C 1GMEA 4GW1B 3THMH 5DJ6A 1YEGH 4OJEH 3STZA 4DUXA 3OR7B 4JB9H 4J3TA 2GKIA 4DKFH 1FFTB 1LP9F 2DWSA 4WUKL 3R7RA 1QBAA 4YDLB 4XPAH 1IC1A 4MJ2A 2DIEA 1L9OA 3ML8A 1JGLH 3BW9A 3BH4A 3BN9D 1V3MA 3QEUB 1QYGH 1UURA 3E7JA 8FABA 2N0KA 4GBXC 5E8EB 4AJYV 1NGWB 4JKWA 2OMUA 4OJDH 1HXKA 3RTQC 2EINB 5IF0B 3W2DL 1JYXA 2W07A 3GLAA 4N26A 5I1HH 1U58B 3OLGA 4YMPA 4NS0A 4AYMC 4CMHC 2FEDC 1WFMA 5E9DD 2K4AA 4K3JH 5IMKA 2WGNB 2JMRA 4BUHA 3TBVA 2JF1A 4CN6A 2CO4A 3CU1A 5BMFH 5I16A 3ZE1B 2MPAH 1IKNA 1CDIA 4OLUH 2OK0L 2YPVA 1IBDA 4RDQG 1M57B 3JZYA 2VGLM 1IGCL 3T0EA 2NY7H 3X13B 3I9IA 3CFMA 4A7GA 3E38A 2VTFA 2OAAA 4IDJL 1MHHA 3I6SA 3H3KA 1CGSH 3AM8C 4FFYA 2IGLA 3WUZA 1IL1B 2EDXA 4MA8L 1IBBA 4XO4A 4F92B 2X3BA 4UTBL 4DTGL 2ITCB 4D9RD 1UGKA 3FO2B 5CLTA 3KLAB 4I0KA 3T2NH 4R3SB 1KTCA 4QAMB 4BD4A 5KVFH 3RL2A 2ZNWA 4CSTA 1CDHA 2APTA 2WC7A 3O4LB 4LLDB 3RRQA 1QI3A 2FNBA 4M7ZB 5AYUH 2Q0ZX 2WXPA 4YHNA 1PZCA 1A2YA 3S34H 3SPVA 1N26A 3ZYZA 4HAFA 2P26A 1F2XK 2D3NA 4KI1A 1EBPA 3FUHA 1YJDL 3C60A 1QO3A 2VDNH 3EO1A 3O2WH 5DHDA 3SBWC 5AB9A 2HN7B 4N2FA 4ODXB 5HDQH 1B2YA 1Q72H 1AR1C 4KKAC 3EDJA 3BEWA 3QZBA 4WO4C 1NM4A 2ZPKL 3S88L 3BRFA 1MN4A 4JFED 4UNTA 2AV1B 1E9OA 3GQFA 2Y1ZA 1RIUL 3K4ZA 1SFHA 1PVHA 3KWWB 2NYYD 1KB9J 3FT0A 2AEQL 4XMZA 1KJVA 1RK1A 2PPEA 4DFHA 4MAUL 3DV6A 4AIXA 3B9KD 3QUXD 1E9QA 2NR6A 4CAGA 1Q0EA 3QC6X 5I1KH 1XR9B 4I77L 4MAYB 3IJYA 1IGTA 4H2AA 1DE4B 3QZWA 4G9FD 2YEZA 4GSQA 1NGQH 4ZFZA 2X9WA 4HCGA 5BZWA 4LVNC 1NUFA 1DYZA 1G1YA 3QHTC 4NQDA 4OI9A 4DO5A 1AIFB 1S7VB 1ZLVH 1PF3A 2BOBA 4OFVA 5ICYB 3FTGB 3MJWA 2LE9A 4KVNL 3FB7A 5F9WC 4QRTA 3WCYA 5FA3A 3LOWA 1BQRA 2BS8A 3FB6A 4NT6B 3JWDL 3TPUA 2LFGA 3CCHA 5DTFB 2Q8AL 4ZFGH 1HKFA 1QBBA 5K1NA 1QWHA 1WZ1H 4B0MB 1T7YA 4XB3A 4TKWA 1BAFH 5CZXC 4DVRH 3PL6C 3EYSL 4NQEA 3ATFA 1F00I 1A3LL 1RURH 2DLFL 4ZZFA 1FI8C 5DUPL 3LZNA 5EZJB 5KAQG 1P4UA 1U8MA 1GRWA 4YDJA 3IFOA 5HXMA 4KK5D 5I73B 3ET9F 1VFBB 4UQIM 1ZDSA 1OE3A 5I1CH 3TBWA 1FE8L 4NBYB 3VD4A 4IMLB 4NZTL 4X4KA 5A2CA 4F37F 2J73A 2ZXWB 3CDFA 3QQDB 5J6HA 3SE6A 2WPGA 5SWQA 5KBLA 1OSZB 4M9OA 4D0DB 2IEPA 1B88A 1IGMH 4FZEL 3MC0A 4AH2A 2DD8L 3AWEA 4ZJ9A 4Q0XL 4X4XA 3GSNB 1GW0A 4HC1H 2GJ6D 1DLFL 3P2BA 4PJCA 4WHTA 5D71L 2ZD0A 3O2DA 1LD9A 3ME0A 2VDKH 2PMZA 4N2MA 3PXLA 4ZYKA 1CWVA 3K0WA 1VEMA 3ZGHA 2P3YA 3RY4A 2ZSVA 2KPNA 4YHKH 3HNTH 4AQ8A 2NXZB 1MIMH 1GZPA 2BIIA 1ZAGA 3VGHA 2P44B 1Q9LA 2NYKA 3K6OA 2MH4A 3CD4A 3CUPA 4XN5A 5AZ2L 4FFVD 1U3JA 5JO5A 1KXTB 4OGAD 1HJCA 3T0WA 5CZVL 4HETA 4LK4A 4DZBB 5IJVB 1BYNA 4JFPA 3IS0X 2BDNL 5L4MA 4LQ1A 3DYMA 4OV5A 4PMFA 1OP4A 3Q8AA 1DJIA 1AQDA 1TZHB 3CZKA 3QFJD 5EU6D 2UX6A 4CRPA 3FJTA 3UCQA 4FHJA 2AXFB 4MB5A 1L9NA 5E9DA 3RUGB 3U30C 5CKAA 5KVDE 2AJZB 5A40E 5MI0B 3IDXL 2BY2A 1T04B 3O9WC 1A4KA 1RZQA 4CVUA 2EICA 4IM8A 2DLIA 4QHKI 1NQBA 5FYLL 4CBZA 1PX8A 4P3DA 2VN4A 2X3AA 2IV8A 2NNRA 2AEPH 2YIHA 3JV6B 4UNIA 3RY5A 4KKZA 5DRWA 1U3YA 3S35L 3B6SB 3S37L 1YPZB 3NJMA 2Q1EA 4PS8A 3EADA 5EBMB 4AQ1A 3AMLA 3WYRA 4S2SA 1LNUB 1IAIH 4WI0B 1DO6A 1RIHL 4CN1A 2GEEA 2DV6A 3HCVB 5TE4L 1D7FA 1CZ8L 5GGVY 4O02H 4X6FB 1RUKL 1RD6A 2X70B 1S9VA 4QAWA 5DJYB 5B8CB 3G04A 4F1SA 4GAJH 5B22A 1UWGL 1FFOB 3OHMB 3DDFA 1MEXH 4JFTA 1LDPL 1OK0A 2YMTA 4P2OD 3TBCA 1QPXA 2ICWJ 3R0NA 3BFOA 2QDWA 1XIWB 2XWTA 4HUVB 2HJLB 4D0CB 1CYGA 1OT1A 4C47A 3CZNA 5C0DB 3R06A 1A6TB 1RZJH 2YPVL 2DS4A 5ACZA 3H56A 5DHVH 3Q5OA 1I3VA 5IMLB 3FULA 1L3WA 3VXUE 2QKIB 5ITBL 1JZEA 4CU7A 4G8FB 1M6UA 1A9BA 2QR0A 1GS8A 2VR7A 3ZMEA 1TCRA 2B3RA 5F1IB 2TAAA 4UILH 5HJ3B 5GISL 3C5JA 3I02A 3ZYOA 4LCWE 4Q9RH 3ULUC 3MUHL 2TSBA 1QSZA 4DK5A 3RGBA 4EOWH 3H1ZA 2WP3T 1ZV9A 3WN5B 4XPBH 3QG7H 3DUUA 1TJMA 3B9KA 3QUXA 4K2UL 4Z7AA 1A14L 3HE6D 4D0BB 4LFHG 2M1KA 1QSEB 2OS7A 3O8XC 4M8RA 1ZGLM 1IBHA 4G9FA 4L8DA 4F8PA 4X6BB 4FZ8H 1MZYA 4X8XA 1ACYH 1FH5H 2HMID 3M86A 1B4RA 4C83B 2D7MA 3RIKA 1WLHA 5IFJB 4GFXA 3NEEA 4N0UE 4Y9BA 4BCXA 1NFDA 3HKFA 1DUZA 1S7WA 3NG5A 4CW1A 1Q1JH 3WFCH 1SYSB 4MLIA 3LKSA 4XBEL 1NC2B 3SQBA 1A47A 4KTDH 2FO1A 4AE0A 1HXYB 5CBAB 3RVVC 1XF5A 1NAML 4KQ4L 3FTWA 4KRLB 4Q6IA 4ZPTA 1TTUA 2V7HA 4G5ZL 4Q4EA 4KO7A 4BWWA 4A7GF 1F6LL 1KEMH 4U3XA 5I5MA 1NGZB 1ZKAA 4JJOA 3GZOA 1PW3A 3FF8A 4ORGB 3FO0H 3F01A 5IEKB 3L4WA 4GUQA 4UNUA 1J18A 3HPJB 4P4KB 4TULL 2GSIB 5ECGA 3SD5A 1QFWM 4ANKA 1IQDB 4P46B 1OPGH 4NKOA 2ZWNA 5DQ9A 4ZW8A 3V4UH 1JPGB 1JPST 3Q9PA 4GUPB 5HYFA 1TZOA 2VJ0A 3Q43A 3RWEB 3P30H 1ML0A 5B38G 1C5CL 1AD0B 3LN5B 5FO9B 1YC7A 1IVLA 4AK1A 5LO7A 4ZTPL 5LHDA 3TBTB 2D8KA 1J0KA 3L3HB 3ZHFA 3S3JA 1AR2A 2Z4QA 4KKBC 2GJ6A 4LRIC 5GGRA 3TC9A 3UYRL 2ZONA 1P5UC 1FGVL 3VJ6A 3EOBA 5CU5A 3KEHA 4JS7A 5JDSB 5DI8A 1HEJC 4NN5C 1UM6L 2BY1A 3VVVA 1HH6A 3UZVB 4BDVB 4K15A 5HHXL 2FJHA 1FLTX 1U3HC 4ZUWA 4K9JA 3G6DL 3KW7A 4PJ7A 4PG2C 2I60H 2XFXB 3IJ8A 2P24B 3CBJB 4G43B 4HKBB 4EPSA 4KHTH 3MRIB 1WEJL 1CL7L 3AB0B 3HUJA 1SM3H 2WLYA 1W2KT 4HH9A 4IRSC 2IWEA 3VDCA 3PF2A 2ENQA 4Q9CA 2VSKB 3KLSA 5KG9A 3OXSB 4YGVB 1YVLA 3HE7B 1P7KA 4H1LG 1KB5B 4FX5A 2IC2A 4LF3B 3QFJA 5T3ZL 3G6AB 3RL1B 2MSPA 2QSTA 4DQOH 2WAHA 2DYRB 3MLUL 1R24B 4RBPH 4UT6A 5T1MA 3P0GB 4M3JA 1IGIL 4HWUA 4R0LB 5E1AB 1T1XB 3VGDA 1LO3H 4QR7A 1FFQA 4HIJB 4C4BA 2DKMA 3M17A 5IKCA 1BYOA 2XZAL 3ZR6A 3MNZB 4Y5VA 1D3CA 5CUSL 1I3GL 4P2RD 4BSWB 2Y6TE 1P4LB 4ALAL 3HZVA 3ZXAC 4HUMB 5CF3A 2MIZA 3FQNA 3BCDA 3UAJC 2A9BA 2XG4A 4Y4FB 5F7FA 3T1FB 4D9QD 1OAUH 3CZJA 4B60A 3F7PC 2DPKA 2FBOJ 4XH2A 4EN3C 3BUBA 2K8MA 3VD7A 5EF2A 4S1DC 2GCYB 3QK0A 4KFZC 3GTNA 4F9PA 5J1AA 1L3NA 5CJQL 1G4MA 5BQ7B 4PJCF 1JK9A 4J6IA 5FUCE 3DX8A 4XP9H 3DHJA 1L5GA 3LKOA 5DRXA 2Y23A 2C4FU 4P2OA 5GRUL 2FD6L 3W82A 2GSMB 4APXB 4N87A 2VXUH 1XGRB 2CDFB 3V0HA 1X4XA 4ZAKD 1M56B 3HC3L 3N6YA 1KGUA 3VA6A 3X1EA 5JIIA 3GRWL 3KYMA 3KLHD 4CJ1A 4ECNA 4R97C 1K6QL 1KCRL 5HHOB 2IDUA 5DD6B 5GJTH 4RA3A 4B7IA 1UJ3C 2DQDH 4JM2C 1D7CA 1MLCA 4G3YL 5AAWC 3UOAB 4M48H 4M56A 1GGCH 2R0KH 3KCWA 2FL5A 4NGHL 4QIRA 1IC4L 3VXMB 1IX2A 4BJLA 3N42F 4ANXA 4CNIB 5I1JH 5ISZB 1NEUA 4XNQB 4MTMA 5E6ID 5AOIA 3E2HB 1E5AA 2ZG1A 4OIBA 3RURA 5DD1L 3S5LB 5ILTH 4DERA 5C0FB 1Z9MA 2PYEB 1NCBH 3D4YA 2W65B 1XZ0A 3HE6A 2VLJB 5TTRA 3DXAD 3W9EB 5IHLB 5JPMB 2NX5A 2X6MA 2ZXGA 2E0PA 3LQZA 4LASH 4K3EL 1TVBB 4OGXH 2X9XA 5DJ8A 1OB1B 2R15A 2OMYB 1DVUA 2IXQB 4BBWA 4K4KA 1KIUB 4PG9B 3G5VA 5FYKE 4CVWA 1MVUB 4LNRB 3BVXA 4H1LB 1JPSH 1FP5A 2D03H 3EFOB 3OD3A 3OMZA 1CK0L 3QI9D 4OJCA 3ROOB 3LZFH 3CSFA 1KZYA 2XWRA 4PJFA 2Z3FA 1THCA 2MCPH 1NBVH 3T09A 2WVVB 4ELMA 1VFUA 4U1SB 4LLMA 5I6OA 1T83A 2A74B 1A21A 4JPIB 4GG6B 1PY4A 3HN5A 2VR8A 2MQ0A 3FO1B 4GUCA 5C07E 1CTNA 2NUPA 4F2EA 2WWOA 3H9SE 3PWNB 1I8LC 4G72B 3P4MA 4M8VA 4R2GD 4GG8A 3KPRE 2CPCA 3GSNH 4LOEA 2BHYA 2XN9B 3ESVF 5BS0B 3B5TA 1V7ML 1UT9A 1UZ6F 4ODWB 4XPTH 1ZT1A 3OKOB 2WCGA 5E8OA 1Z2KA 4AC4A 2X7LA 4KDTA 3V2AR 1NIEA 2JQMA 1TYJA 4KY1H 1FVCB 2F7IA 4KNSA 4L3CA 4KPHL 1A5FL 2IPUK 2APBA 1W0WA 1XGPB 1SDDB 2BH0A 3MRRB 4YBLB 1T1ZB 3IRCA 2XV0A 4KXAA 4S11A 3SZKC 2JCWA 4N5UA 2P1YA 2AC0A 4KNQA 1W0VB 4BQBA 4WV1C 3PS6A 2JKWA 1I1FB 1X4YA 3ARGD 2OJZH 3FONB 4LLAA 5C3TA 4PGDA 4ZS6D 5H94B 4KDWA 3FHEA 2Z8RA 5ANMA 2QEJA 2CA4A 4JG9A 5MHSD 3ZBMA 1S9YA 5LB1A 3SDAC 4ZT1A 3UTSE 5AKRA 3V4LA 1YNLH 3C6LC 1TZIA 1XGTB 3AWFA 2MNWA 4L29B 3V7MA 2C1OA 4LAJH 2YD8A 3SO5A 1NFDF 5J6SA 2ZWYA 1YY9C 3QIWC 4X6DB 1QATA 4OLYL 2J5LB 4XCEA 3P9LB 1OARH 1OHQA 3PWPD 4HS8H 4GKNA 1HCZA 2NZ9C 4F7MA 2G3XA 4FN0A 5A1AA 3MLVH 3QXAB 4LLUB 4Y89A 3G3LA 1YN7B 3ECUA 1J86A 4HSCX 5E8PB 1XF4B 4BCYA 5DMKA 4F2MB 3GJEB 4LRNL 4X7FC 3EDEA 4P2RA 1UOWA 2C9QA 2JELH 3ZRFC 2WKGA 1WBZB 3PRZA 5FOJA 2A9ML 5KBNC 2VXQL 3H4HA 1U33A 2VXTH 4YXLH 2A6DA 4TQEH 1KIQA 3VRIA 3U46A 3ARXA 3WTTA 4XVSH 4BKLA 2F5BH 1JVLA 3CZUB 3T08A 3ZDXF 4AGPA 4CU8A 1HNYA 4QXTB 4P59L 4OU3A 1BD2E 3RVUD 4UT6L 2RAMA 2BNUA 4R7DA 5I0YA 3S9DB 1VSCA 5D1QD 4FXGB 3QHFL 5IOKA 4G1MA 3FB5A 4GKSA 3DX0A 3II2A 4ZAKA 2X4SB 3IWUA 1PSKH 5D1XB 4QTIH 3FMGH 2BNRE 4HLJA 5AVSB 1KENL 3H9YA 1KIPB 3LZLA 4PJ7F 3WNLA 5D8JH 3WD5L 3NCXA 4DAGL 1VKXB 2EZ0D 1ZVSB 1ODAA 1AXSA 3V6OE 3NIDB 4M4PA 3HUJF 1X9LA 3CN3A 4IBQA 2FO4A 4NNXA 5E2VH 3DV4A 3SN6N 4XVTH 5E6IA 1KCLA 3FTYA 1CBVH 5G55A 4G11A 1WAEA 1E5ZA 4WUUE 2BHZA 1EDQA 1OZTG 5GGSA 3TU6A 3S6CA 5J7CC 3FU7A 1M7DB 3DXAA 4OT1H 1ZHLB 4G6FD 3ESUF 4LCCA 1UH3A 3EF4A 1E8ZA 3WHXA 4HEME 2NDFA 3FRUB 1CLOH 3ZE0E 4PRHE 4Y4HD 5EO9A 5B3NA 3BP7A 3BEVA 1J8HB 2OKMA 2RTTA 1GJIA 3SGDH 1OO2A 1T1YA 3QZLA 1I31A 2GVYA 4R6UA 4Z7QF 3QI9A 1U6AH 5IBTH 1VACB 4I0CC 2NSQA 3T2OA 5C6WH 1T2JA 5FW8A 2XIBA 2YQGA 3OKEB 4GI9A 3TBYA 1KPVA 1XD1A 4X5WA 4XMVA 2O5ZL 1QLEL 4OZIB 1E42A 4GSDH 5T3XL 3HJ0A 4X9GA 4FI6A 5B4MC 1GPOL 2F18A 4FXLA 5ESQB 5GQBA 1MFAL 1F3DH 1Q1PA 2W80C 4K8RH 4MCMA 2CCLA 4N2KA 1A1NB 1DVFC 3C6SB 3QUYA 4P2YA 2VW4A 1JZ7A 2QBWA 3N41F 4XN9A 4JFOA 2KZWA 3IE9A 4RMBA 3DX9A 4O2CB 2ILLA 4N2HA 2OMXA 4Z7VB 5TF1L 3C5ZC 2F0CA 2MOGA 4YHZL 4WEBH 5HYJD 1FNSH 1ECZA 2PP7A 2RH0A 3QNYA 3L7FA 4XMXA 2X4PB 2ZWLT 3H3BC 5I2IA 1FL3B 4AMKL 3KWVA 1CFQB 2DKUA 4JFDD 4G42A 3R4RA 3BO8B 3CHSA 3MJ9H 5F1OB 3S4SB 4LOUD 3ARGA 4XOAA 3L7EB 3T8MA 1CGXA 3BKML 3GHBH 3LXAA 1PDKB 2JJVA 4NQTA 2BNQB 1U92B 3UP6A 4RISL 1R3JB 1KB5H 1U41A 1HI6A 3CHRA 2MWCA 2E47A 1ZEAL 3KBEA 2A9DA 4WFFE 2WAQA 4Q9BA 4WU5B 4M6OL 1JV5A 5F9OH 3VSVA 1IRAY 3F62A 4IBVA 4LLWB 5BVPL 3W56A 3IMSA 4FQJL 4RWYH 2ID5A 4R4BB 3WFDH 2OMZB 4ENED 4LLQA 2IWFA 1OCCB 3BZFB 1DDHA 4RGMC 3SEPA 1OM3L 2DJUA 2EABA 4KKLC 3W9DB 4TUOA 1BQHG 1ZLUH 5I75B 4PJFF 3PWPA 4ZG1A 2A73A 4I0PB 2EECA 2R2HB 1JRHI 2D7QA 4N0CC 2IPKA 1SXNA 1LEGB 2P5WE 4UMSA 3MRKB 5IQNA 4ELMF 1EO8L 4QLWA 3MU3A 4MQSB 2IAMB 4RMUA 4B0MM 3BSGA 1QFOA 4WU7A 5DR5L 3ZK0A 5AAMC 1H19A 3QDGB 5GHWL 2TSAA 2FZ3A 2J1KA 4JHZA 4IMKA 1OAQH 2XWCA 3HC4H 4TUUA 3GC3A 3T77B 2BXYA 3AY4C 1BX2A 2OULB 4I87A 1HZHL 5EOQL 5TE7L 5ICUA 2EYSB 2ZUTA 2R1YA 5HHME 4L5FH 4UQ2B 2HWZL 5F6HI 2CM5A 3X14A 1HHIA 1CN4A 4F58H 2SEBB 1OCRB 2HUHA 2PPFA 3RIAK 2IANE 1JTOA 2ESVB 3L3OB 1T03H 3MBXL 4RMQA 4LEOA 2VO8A 5D1QA 1G1CA 2VAJA 3VGFA 2NY2B 1AO7D 2NY4B 4FTDA 1M7IB 4FLSA 1Y1UA 4RIRB 3DSNA 2YARA 3QPQD 3IDYC 5DD3H 5IIEB 2DIJA 2YS4A 4TQHA 3JYCA 3WY2A 3FUJA 3T0VA 1D9KC 4XPFH 4XNXL 2IQ9H 5J89A 1C12A 4H7VA 1AOZA 2B1AL 5C09D 2LGNA 1MW3A 1ETA1 1I7RB 4OF8A 4WVRA 3CH8A 5I1IH 5J57B 4GO9A 4YHLL 1JZFA 2BMKA 4KX9A 4L23A 4TSBL 2EVIA 4JFHD 4K71B 4P9MH 4QRUB 5I1LB 3EO9L 2V2WA 1P1VA 4FL4C 4HJGB 4XTRD 5E6SB 2DQHH 3II3A 4NKDA 1A8ZA 4QXUH 2I7SA 4FG6D 3BLPX 5L2KE 2JTDA 4PRDB 2DQJL 3IRZA 5IQ9A 3N5AA 4ZFQA 3SCMC 3STLA 1H8LA 1AS7A 2BFGA 2FYYB 3GBLA 4PRBB 2HTLC 3BPCB 5F3BB 4Q89A 4QI3A 3BVWA 4UM9B 5D7JB 2ZUSA 4KUZH 3HJEA 3LJ3A 4Y4HA 7PAZA 4JO1H 2QV2A 1YEKL 3HS9A 5DZLA 3TO4A 1T1WB 5HDOA 3EJRA 5TF0A 1SDAB 2CM6A 2VMEA 2YC1B 3AQZA 5L88L 2NY1C 2GK2A 5B3SB 4HKJB 2K3HA 1S8DB 3OB0H 5D9SB 5ACMA 4HOZA 4LP4A 3G5XB 1T2QH 4GRMA 2BRRL 1T3FA 3KDMA 4PJ6A 5IWLC 1BQHB 3N04A 3KZ8A 2BZDA 3OX8A 5ECJE 2Q8BH 4XX5A 4E5XA 1UFGA 3B5HA 4KXZI 4PJEE 4B27A 1PCXA 4NYLB 4UT9L 4EDWL 2EXYC 1MFCH 3HG5A 3ZDYE 4F33A 2ZUQC 5C08B 5HYQB 1JBJA 3DLQR 3V55A 4Y4KD 3QJHB 2XFGB 4X99B 5CWSA 1ZMYA 2GI7A 4HDIB 3BUTA 2AJYL 4QGTA 2VLKE 3U0PB 1WHPA 4PHZA 2Z7ZA 4XCFL 4ZBJA 2H5UA 3N3EA 5IHZA 3VXTA 2BOCB 3VFVA 1RY7B 4KNTA 1AJ7H 1KXVA 3WIHH 1U2YA 3MRNA 2ZYHA 3BP5B 4LSTH 2HJKA 4PB0L 3WL9A 2EE0A 1RZKC 4MDIA 1RP9A 5T1DH 1Q0YL 4M6NL 4YXHH 3EO0B 2YBRB 2DQGH 3U0WL 3L3GA 2EYRA 3MRFA 3ZE2B 1I9RL 2WV3A 4M7KL 3A67H 4JFDA 3LEVH 4QWWC 4B96A 3TFKD 5INDB 1G4RA 4TYUA 2NY5H 4OCXL 1XH2A 3MBEC 4UV4L 5TFSL 2GSGB 4PM1A 4P2CG 4LHJB 4CBPA 1KCWA 5F7BA 4XXDB 2EE3A 5FHBH 1GMIA 2X4OB 5K9KB 3T9WA 4DFIA 2XYCA 3B37A 1QLFB 5DMGD 4N5EC 4OJAA 2WQVA 2JV6A 4OGZA 2H8PB 2MMXA 3LNDA 5CEZH 1IIKA 1ZCRA 3QJXA 3VG9C 3NBNA 2DQIL 3S36H 4TUJA 3BWAB 3BD5A 2F5AL 4YHPA 4IBYA 3DVNB 2NCEA 4A63A 2DKSA 4MMZC 3ZGIA 3I3BA 5DK3A 5AG8A 2PO6C 4FMKA 4QRPE 1QKZH 5GGRY 1DZBA 2IMMA 2DL9A 5E1HB 4ZSOE 3K5SA 3P4NA 2J56A 2NY6C 4TQ8A 3RGVC 3WJJC 5BRZE 4J12A 5GRJH 1QABA 2C8NA 3CFBA 3IU4L 2B4CH 3ARDD 3G08B 1ZTMA 2PUQT 5I6MA 4C4UA 3VB8A 4W9EC 1I7UA 5IJKA 2ICEB 1HWGB 3UL4A 2RR3A 2X87A 4FXKB 4X7SH 2HT4D 2VAAA 1CU4L 4L9LA 4D8PA 35C8L 3D3VE 5I6NA 3O11A 2P5PA 1P9MC 3UJTL 1FAIL 3KYAA 3MFGB 4WJ5B 1LEKB 1DUYA 2ITFA 3NTCL 4Z7UE 2C26A 2H41A 5ADOL 4WCYL 1AO7A 4EVNA 1U21A 1RHHB 1MCRA 3KPPA 1BWWA 2I25N 3V4VB 3E9TA 3JUYA 4OZHA 2J4WH 3BT0A 5DD0H 5DUMH 1MUJA 2YAEA 5IUCA 2FQDA 3AREC 4QLRA 3KPNB 3PV6B 4NO2B 5DJ2A 1KT2B 4H44C 4HUKB 2E9GA 5C09A 2LQRA 3NJKA 2W1NA 3W39B 1NBZA 3NDYE 3D9AH 1CG9A 3RWFB 1LM8V 4EBQL 1KLFB 2O6FA 4V2CB 2P4AB 3B2VH 3EYQC 4IKNA 1Z6JT 2WIIA 4FFZH 4RESB 1EEYB 1U9KA 4O02A 4Q8BA 4L2LA 2RACA 2FB4L 1K9TA 1NZRA 1L7TH 2DYSB 2OI9B 2Y7MA 3HS8A 2XNAB 1A6VL 1O9WA 1HWHB 1F0LA 5EU5B 2Y2TA 1R5VA 2OTUA 1JPEA 2D3VA 3FCSB 4PS4H 4YIQB 5D2LA 3N1GC 1BBDH 3GINA 3HI6H 2A9NL 4ZD3H 4XZ4A 3R7QA 5DHVA 1RK0A 4F9LC 2XQBL 4UIKH 1QFWL 1TXKA 2VZUA 2O5XH 1XTMA 3LN4A 3WMPA 5HGHB 3OLDA 5EIVA 4Y5XB 4A55A 1T5WA 1EDHA 1TF4A 3FS9A 1FWXA 1F6FB 1G7PB 5GIRA 4AT6A 4R90H 2VLLB 5MEOA 3VRJB 2N56A 1ZHKA 4NN6C 3KYOA 1JPTH 3CK0L 3MJ6A 4EI6B 4F8OA 4GPVA 1EJOH 2OYLA 3BQUC 4HW6A 3WJLA 1AXTH 2UYLB 4PLJD 4LDEB 5KVGH 1FNEA 3SDYH 4Z3IA 3OVUB 3O6LH 3MX0A 4MAYD 4Z7OF 3WFBH 3PNWB 2XTJD 3H9ZA 5AW3B 4CGTA 4HT1H 2NOYA 1AZNA 3ZTNH 3ARBC 2WTPA 4BXSV 2GJJA 2Q7YA 4K07A 4Y4KA 3D0LB 3RX8A 1OIOA 4WW2B 4YHYB 4N90D 4M6MH 4UQ9A 2RFXB 2WXNA 2GIXA 2Q3XA 3GBML 3U83A 1U91B 3VQ1C 2VDRL 3HMWH 1ITBB 2VDNL 3F04A 3O2WL 4JDVB 1B2WH 2CHZA 3NP3A 3O0RL 3VFPB 3CPUA 4YDIL 1FV1A 4AZ8B 3GMRA 1BVNT 1JPFA 5D7IF 1EUUA 2HAZA 3FOLB 2JJTA 4GYBA 5CGYD 3UBXA 1CYWA 4P3CH 4ZMXA 5K9OB 4XP6H 2D0FA 1R3IL 5EUOB 3BKJH 2A3TA 2X41A 5EIIG 2OXGB 3WNMA 1CDGA 2YMXH 1HH9B 2CO2A 1S5IL 5GGTH 5DMYA 4BFBD 1HEHC 2E9WA 4M1CD 1DQMH 1AZZC 2AABL 3DBXA 3TYFA 4EZJA 1S9WB 3U4BL 3ARFC 2AV7B 3FTSA 4HWBL 4CADA 4GP4B 2OMWA 1E65A 3J2PA 5J9PA 1EUTA 5E4EB 2X12A 1ES0B 4HULB 5AW9B 5F1SA 2EDTA 5TE6H 1JOIA 4K5PA 5EA0H 5SWZE 3OF6D 1AMYA 4NZ8A 1KJ2L 3PP4L 3EOAA 5IFAH 2APVA 2BJML 5EO0B 3NH7L 3OKYA 1GGUA 1LO2H 3QRGH 1NPUA 1F8TL 2EDQA 4S1QL 4TQIA 2G60H 5IROC 4Z3TA 3DUHA 2R0WH 2ARJA 3NCJL 3CGTA 4ZFGL 4AM0B 2WGXA 3QJQB 4B9CA 2MHAB 4GW1A 5HGBB 3I84A 4RSYA 2NXZD 3QSKB 1VPOH 3OR7A 2YGNA 4OB5L 3RKPA 4C55A 1PG7L 2MEJB 4M5ZH 5ADPL 4BWUA 1CLZH 3QGVA 4WWID 4D9LH 5FA4B 3QEUA 2R27A 3EYUH 3UJIH 5HTSA 4G59C 5I1CL 2F15A 3ESPA 3ARDA 4M61B 4NZUH 1H0DB 5CJBA 3O3UN 5E8EA 1NGWA 5IF0A 3GLZA 5EC2B 3D0AA 1XCTB 4L8SA 3UGEA 4JVUA 4PLNC 4Z3GA 1N67A 4QF1B 4PGJA 4Q7DA 2V8LA 5J8OA 4DK6A 1EEZB 1BVLA 5HGAB 4Y2OA 1BFTA 2O61A 2ZOKA 1CXIA 1SMAA 2ZG3A 2ZKMX 3T6QC 2EE6A 5I8CA 2PW2B 1PCSA 4KO6A 4MS6A 2FYVA 4WSGA 4HJEA 5FYJU 4IGBC 4IIZA 3FC8A 5KBMA 1UXMA 1X5AA 4FYRA 4WK2B 1MVFA 4NQCB 4Y5YB 3X13A 4ZUTB 4ZMOA 1HDMA 2H47C 4L1TA 1NFIA 1M1SA 2DYPB 2IDTA 4ABVA 4JHAL 3WS3A 1HWWA 3VQ2C 1IL1A 3CU7A 4PRPB 4PJXB 1CLCA 2EC9U 2ITCA 3GFUA 3APCA 3FO2A 2O26U 3KPTA 3KLAA 4R3SA 5EU3B 4JPVL 2VRKA 3QDJB 3WXWL 5LKNA 2M8XA 5IB1B 1IQWL 4WO4B 1J10A 3NIGF 3BFQG 4XC3H 4H5SB 3VE0A 4Z7WE 4LOVA 1P4IH 2Y3AA 1OB0A 1XIWD 1ZANL 1NUGA 4N2LA 4ZFFB 4L4VE 4QHNB 4IHOA 4UAHA 2JQAA 1DFBH 2L8AA 2HN7A 3ZR5A 3RWIB 4JFVA 2GT9B 3KVDD 3MV9E 3BAYA 5E8DH 5L8KB 3B2DC 2Z9TA 3MRLB 1FFNB 1VEOA 3QO0B 3U1SH 1URZA 1XEUA 3UPRA 4LVNB 3EJQA 5EULV 4HEPA 1FO0B 3QH3B 4RMRA 4B5ZA 5LDSA 2IALB 2CGRL 1WWWX 2W0FA 1IC7L 1R1CA 4CC4C 4CVZB 1JS4A 4XE5B 4N9OB 1SJXA 3NABL 1R0AH 4YH6A 4MAYA 1GTFA 1QSED 5DLMH 3QXVA 1MW1A 3PL6B 1DE4A 1XXFC 4FTVE 5B39B 4XI5C 1MF2H 4DJMA 3RVXD 5JQ6H 1HQRB 2MKLC 2AI0H 3Q13A 4N0YH 3AQYA 3U9UB 3BRGC 3LYRA 1AIFA 1S7VA 4RFNC 5GRVK 1TPXB 4GSUA 5ICYA 3FTGA 1L9SA 3O4OB 2N7SA 3KPQB 4QYAA 1IZKA 1TEFA 4Y2DC 4L4TE 1DANU 1NC2D 2XA3A 3TURA 5DTFA 2R2CA 4JCWA 1E0OB 2QPEB 1GYCA 5FF6B 5GGSY 3O2VL 4OZHF 1BJ1J 1CICB 1WJ3A 4X8CA 1E3ZA 3ZKXB 4L37A 3LS4L 5LG6A 2Y25A 3RI5F 4FULA 5EZJA 4D7BA 1KCKA 1A1OB 4P4KD 2LU4A 3T3PB 1BLNB 5IB4B 1VFBA 4HXBH 5FB8B 3IB4A 4P46D 5C9KA 4HUUA 3VD5A 4IMLA 4JE4B 4MFHA 5DQJB 4XMKH 4F3FB 3NFNB 3QQDA 1OP5H 2FE0A 1VEPA 1F58L 1N8ZB 2WINB 1OSZA 4ONOA 3WKQA 5A6LA 1E8XA 1FA4A 2E6JA 1IBFA 2BY3A 3ZTDC 4G71B 2LU3A 4BZ1L 3GSNA 4NC2B 3WIIH 4NHCL 1ACYL 5BJTB 3OF6A 4RDBA 4H26B 2NPLX 5FGBC 3FQ2A 3I6LD 4KK8D 4LO9A 4S1RL 1IAMA 1Q1JL 3BP6B 5D2LF 3E80A 4UINH 3MV8B 5IB3A 2Z64C 1QNZH 3QIUB 4WEUD 4KJQD 3M88A 1YUHB 5IW1B 4OW6A 1PLGL 2R69A 3GI8H 5E2WH 3N06B 4YXKL 5ACLA 5KSBE 1JP5A 3U30B 2O5YH 2WUCL 4HZAA 4LCUB 4N1HB 4YPJA 1CDUA 3PHOB 5KVDH 5DWUL 4JDEB 4PN6A 5G5DA 3MV7E 1KXTA 1YMMB 3VXRB 1ONQB 4OD3L 3WO4C 5IJVA 1DHKA 3G5WA 3ASWA 3IJ9A 4Y16C 3LEXB 5DHYB 3HE7D 3TP4A 4I85A 3BD4A 5CINH 1WFUA 2GITB 1NOFA 2P5EB 2XRAL 5IW3A 4UU9B 1EK3A 4MJ6B 4ZMQA 5D6DC 5E99H 2AXFA 3QNFA 1GL4B 4B9FA 5IMMB 1U8OA 5EORL 3ALXA 3MXWH 1ZLVK 2JI2A 3L3IB 2D2OA 3H54A 5H2BA 1T04A 5TDNB 1OCWH 4AV5A 4ZX4A 2LHAA 2O1AA 3V4VH 3CSBA 5KVEL 3JV5A 3QCVH 3VFNB 2B5IC 2JJSA 4HV8A 3KS0J 3FT2B 5ID0B 1V8HA 4KITB 1HHGA 3B6SA 3IT8D 4IU2B 1YPZA 2PCXA 1DVTA 2OCCB 1OK8A 3GUFA 2YN5A 2DWEB 2ZOLB 3AXLB 1EHLL 3FYEB 1AYRA 4OV6F 2B1OA 1LNUA 1XCWA 4LP8A 4Y4FD 5TDOB 4WI0A 4KC3B 3LKRB 5D70L 3BUYA 4N1CA 5F7KC 4AEHL 4X6FA 2X70A 4NWTH 3BGMB 4WFED 5DJYA 5B8CA 4YS4A 1DSYA 3ZHLA 1DQKA 1FFOA 1N6QH 1KYAA 5F7AA 3SOBH 5E5UB 2BNRB 2CBOA 4JG0H 3ILQC 3CQPA 4HUVA 4YC2C 3SE9L 4D0CA 3V6BR 2VDPL 3CSGA 5C0DA 5CJOH 4YSEA 2D9CA 4W4NA 4EI5D 5IVNA 1CC3A 3L9RA 4KXBA 5IMLA 2ORBH 5HHOD 1A65A 3DX6B 2AVGA 3LMJH 4G8FA 3O8XB 2V3EA 3MOQA 1B4JH 3UEZA 5HJ3A 4ZW5A 3RA7H 1L4IA 2YLKA 3VXMD 3GNMH 5L2JB 1MG2C 3ARRA 1N5AB 1PIFA 1UXSB 1SUJA 1NWPA 1VRSA 2F2HA 1QR4A 3WN5A 2FX9L 1ZTXH 4WI3A 1JHTB 3GPSA 2PCYA 2CHWA 2PYED 3FUIA 2VLJD 4JN1L 1DBJL 2VERN 4QHLA 1BW8A 1YN6B 1QSEA 5GGQH 1BHGA 2HKFH 5I5JA 2RBLA 3UADA 5H35B 2P48B 3LV3B 4O9HH 5IFJA 2AQPA 3BAXA 3K4DA 5D2NA 1TENA 1YEFH 2R1XB 3EJPA 2FR4B 4MZ2A 3BD3A 2Z92B 5KSAC 4KI5C 5HD8D 3K1KC 1RFDH 1NC2A 1XH3A 2X40A 1HXYA 5FW7A 5A2LH 3C09B 3Q8EA 3MXVH 4HSQA 4NBXB 1BFVL 4IJ3B 3O3EA 5GSVB 2G2RB 5IVXB 4KKQA 5TGBA 2CLZB 1NGZA 5HPMB 2AHIA 5HYSG 1RMFH 2Z31D 3Q44A 4L8BB 3T8XB 1SEBB 3CFQA 3M46A 2R0KL 3MFFB 4ORGA 5IEKA 2CLVB 5MENE 4P5TC 2QQQA 2CIKA 3HPJA 3BESR 4OLVL 5E70A 1IQDA 3ZDZB 1O0VA 3HMXL 4ISVB 4NN5B 1JPGA 4OZGE 1UH4A 2YUVA 3BUIA 3LN5A 5BS0D 4K7PX 2OR9H 5FO9A 1KCUL 1UZ8B 3CG8A 1NKGA 3RX7A 4JVPA 3SKOB 4LIQH 1HE7A 3L3HA 1DVXA 1F11B 1QWNA 1K8IB 5L6YL 1SYVA 1XD0A 4U1GB 4YX2H 1CLVA 3LNFA 4LSSH 4N2AA 1JPSL 2WBJB 3SQOL 5C9JB 3OKDA 1CBJA 4OLEA 2J57A 1KTLB 1BEYL 3UZVA 5BO0D 4NRZB 2ZYRA 1EPFA 4WI8A 1M6OA 3LDBB 3EHBC 4UT7H 1XGYH 2ATPB 2OM5A 4J3XA 1XTLA 3IXTB 3Q6GH 3EJSA 1M05B 1THAA 1IGFL 2P24A 4HKBA 1T0PB 4G43A 2FQGA 1A3RH 2OX5A 3A4FA 2FLMA 4FEIA 4I13B 3KPSB 1BQSA 3GHPA 5E4OA 3MRIA 4UBDC 1HTYA 8CGTA 3RB7A 3MJ9A 2VR3A 3MUJA 4TLUA 5C0IB 2XQYG 3GMPA 1YNKL 1OWWA 4JQXA 3OXSA 4YGVA 3HE7A 2FATH 5AENA 4Z7IA 1BCIA 4JRXB 4W6YB 3FN0L 2WIMA 5I24A 4NJ9L 1G9MC 3C6EA 2D0GA 1A1MA 1D5MB 4JKPH 2Z1PA 4FC3E 5E1AA 5CEZD 1T1XA 2ZYIA 4PR5A 2FWSA 2WOBA 4QRBA 4HIJA 1O5PA 1QASA 1BAWA 2VKXA 4QOKE 4UOW1 1PBYA 5JA9A 1H3UA 2R69L 4ZMNA 4KDVA 5L8LB 3M7OA 2KBGA 1FPTH 4X98A 1J8SA 2DEWX 4B9GA 1KNOB 1JRHH 3QJUB 1WAAA 5FUZH 1P4LA 2ZCKH 1ZLWH 1GHFL 4JHWL 1SQMA 4TUKH 4Y19E 2CXGA 1DCLA 5HHMB 2WQ8A 4HS6A 2IGFH 3QDMB 5G4MA 4L0PB 3U2JA 4HWNA 4Y4FA 4L2YA 5HI4C 3RPIA 4NM8L 3WU1A 1A66A 5DFWH 1IU1A 1UOVA 4FG0A 1YZZA 4R97B 1CXHA 4XP4L 3UDWC 1U95A 3GTTA 5HYSB 4N1EA 3A24A 4JRFA 2GCYA 1D5IH 4ZOAA 1ZE3C 2IH9A 3U0TB 1JCKA 1QUPA 4TNVF 1T66C 5BQ7A 4ONHA 4R96A 1H5BC 3TIEB 3VW3H 4HIHB 4G8AC 3UERA 2RGSA 4GT0A 2NY3B 3MRDB 2CKBL 3MTRA 3EGXB 1BSIA 1XGRA 2CDFA 2X4QA 4XWOD 5B38A 4UIMA 1EAQA 2P45B 3HZYB 5AVYB 1YG9A 5D1XD 4EI5A 1SGKA 4P4RB 3LEYH 2W92A 3VG0L 3ESNA 2NW2B 3Q48A 5K93A 1CL7I 1FO0H 3CFDB 3CMOL 1UADC 1MG3C 4JBSA 4ZX3A 2AK4B 3VXMA 3NCYP 2GFBB 4RFOL 4G7VL 2AK1H 4CNIA 5FYKH 1TEGA 2WK2A 1NLDL 2BSDA 4RCAA 1NCIA 4W93A 4XNQA 4Z76B 2VUOA 1IBZA 4XVSL 3P0VL 4WNQB 4RQQA 2E8YA 5LLIC 3PE9A 2CR3A 3U9PH 5C0FA 2PYEA 2IJ0C 2W65A 5JPMA 4JY4A 2VLJA 1A6UL 3FO9B 3W9EA 4JPWL 4O58L 1TVBA 4NNYB 4JL1A 3QJOA 1UCBH 1OB1A 3C8HA 3TN0D 2OMYA 3QXWA 3KR3L 4PG9A 3GLEA 3EUUA 1J8HD 4QXGL 4YBQD 3WMQA 2ZG2A 1BVKA 4M3HA 4QJ3B 4H1LA 3EFOA 5TQ2L 4U6YB 4J1UB 1IB5A 1NGPL 3ROOA 3IFPB 2Q76B 5I6XB 3MOBH 1AY1L 1WPCA 4AITA 5JHDE 4NQXB 3DOHA 1YPZF 5DK0B 4X6CE 4A7SA 5HI5D 4U1SA 3WXVL 4AW4A 5D8JL 1DVQA 3SDDD 1AE6H 4DCQA 3VH8B 4IRZH 2Z31A 4OUOA 1KMGA 1IT9H 4JPIA 4GG6A 1ET8A 3FO1A 2YAHA 4GINA 1MCOL 1WCBB 3PWNA 4WWOA 4AVJA 1SN2A 4KXZH 3B34A 5JW3L 5KAQF 4MA7L 1MRFL 2DQCH 1U8CA 2YD6A 3MRJB 4ZMTA 1KZQA 3I9GL 1YAIA 3OZ9H 4OGQC 3GJFH 3TXAA 5BS0A 5IM7A 1WTGT 2DEXX 1DQDL 1J1OH 1LMIA 1SHMA 4HJJL 3OKOA 1P7QB 3SO3C 2B8OT 4A04A 1ROCA 2IAAC 3BAKA 3DRQB 4GNKB 5J1SC 5JZ7D 1OGTA 2YXWA 1UD4A 5FGRA 3GMNA 4K7FB 1XGPA 3MRRA 5E5RB 1T1ZA 1USQA 3SDAB 3BJLA 1T21A 3VFRA 4MA1B 4C56D 2XBDA 4AYFA 1QTYT 2Z93A 5F1NB 1W0VA 1QHOA 2NNFA 3ZMRA 1VGKA 2BIMA 2L0DA 3NP4A 4ANVA 3VM7A 1YYLL 3CDCA 1U30A 1QW9A 5E2TH 3UTPD 2VB5A 5K39A 3ULVH 3TJEH 2CKNA 2WXGA 3FONA 3O45B 3QEQE 4X9YA 4UYQA 2VMJA 2BNQD 3A21A 2CK0L 3D25B 2Z4TA 5I1AB 4AMWA 4PRID 5I6LA 4OQTH 4NFBA 5LAXB 1XGTA 2AXGB 3F3HA 4D2NA 4WTWA 2XLLA 3KYNA 1LEIB 1F3DJ 1G7QA 3N85L 3OGCB 3MLSH 1VADB 3FU9A 4X6DA 4GQQA 2DQTH 4FABH 3MLWH 1G6RL 2XY1A 3APFA 2PR9A 2LABA 4HFWA 3V0JA 3Q05A 3P9LA 3DWTA 1PFOA 4KXDA 1T7VA 5EN2B 4Z78B 1QG3A 2Z35B 4D7PA 5KW9L 3PFUA 4LLUA 1PZ2A 4DNLA 4L0YA 1X4ZA 1XF4A 5E8PA 3S8FB 4F2MA 5IBLD 5TPWH 1YUKB 2IAMD 4JO4L 4PRAB 2OTPA 1P69B 3HZMB 3QDGD 1DBMH 1P4BH 1WBZA 3LRMA 2L7EA 4OBSA 2WXFA 3U48A 1HL8A 4XZUB 4TTDD 5FW6A 3ZHKA 3HIZA 4LPUA 1T0OA 3GHBL 3IKCA 3WN6A 1GCYA 3QZPA 1LO5B 3LHPH 4C57C 2RB8A 2GTWB 5DWPA 5ESAB 5I1DB 3KVPA 5LQBL 2I85A 4QXTA 2RJMA 1RI8A 1MPAL 3ULUH 2FHFA 4HAGA 3E8VA 1MXDA 2X6UA 4FDWA 4ACTA 2ICCA 5JIDA 3HI5L 2CCVA 3C8DA 2QDVA 3VFWB 4WY7H 4RZKA 4JREC 1VERA 4HWEL 3BN3B 3IJSA 4FXGA 5DRZB 5IQLA 5IGXL 5I8KH 1UYWH 3K5RA 3L5JA 2X4SA 2VR5A 5F70A 3HG2A 4TNWF 5D1XA 4YUEL 3B8YA 4FLQA 4A2EA 2VWEC 5HHVH 1QAWA 2VM4A 4PJGA 4X5PA 4ERSL 3VDAA 5JTWA 1HAWA 5ICXB 5IQ7L 5KJRH 4PWEA 1LO4H 3MI6A 2Q86B 4Z77B 1CVSC 1INDH 3BC9A 4JDTH 4CU6A 5F9DC 2V7NB 4MRCA 3F2LA 4ES9A 1NEZG 5FR3A 1KN2L 3HC4L 2G2PA 5DJ0B 1RXLA 1K4DB 2AEOA 2OJEB 2UZIH 3RY6C 2G4EA 2UV3A 3CVHL 1FHGA 4NQVA 5M7QA 3BPNC 2VDLL 1M7DA 5DVMA 2L7QA 1ZHLA 4KI5E 1F42A 1PEWA 3X3FL 2ADFL 5D55A 5DU7A 1YQ2A 2EIJB 3TN0A 4UM9D 3FRUA 1T03L 3JWNH 3PQYB 5D7JD 2NTFB 4NQUA 2J6WA 2Q87A 5C7XL 1ETZA 1BXAA 3FQUB 1J8HA 2FBJL 3CXHJ 1CDCA 1KYFA 3QT2A 2YPLE 1OTUC 3BDBA 2KUTA 2ETWA 4XX1E 4NAJA 5DD3L 5DQDL 1HHKA 3U7WH 1VACA 1WP6A 3DETC 2VDOB 1NMCC 1WAAF 1XCQB 1AD9B 3LXUX 4TVPH 4NWUL 2ZXAA 1Z5LB 2MJWA 3KD4A 5FWRA 3KWUA 3VWKC 2HT2C 1OGAE 1PAZA 2BXZA 1OTTD 3I2CL 5GZNC 3SDDA 2ZP0T 3FFCE 1NICA 2AEWA 3D8MA 5CO1A 3QAZC 1O6SB 3NK3A 3TPKA 3MUUA 5LJYH 5ESQA 2R4SH 2CDGB 1NMBH 1V7NH 3H2PA 4LCIL 5I17A 2AJSL 5C08D 4APQB 3ZUNC 1UD6A 3ABMB 2AJXH 2WSPA 1NDMA 5BPPA 3RWGB 1ZS8B 4ZDHB 1TQBC 5EUKB 4JQIL 4EJ1C 2UWEA 4S1SL 5KZCD 4O2CA 2R2BA 5GGVH 2KS0A 3TFBA 4F24A 1LL1A 4GQPH 4XMLH 1QI5A 4Z7VA 2X0UA 4NHUB 3FNKA 4KWUA 1K4CA 3IFLL 3NA9H 2CJSA 2A0LC 2JLLA 1S7TA 4JO1L 4K5NA 5F7MC 2FBRA 5CLYA 3BZ4B 4BKSC 5IMOB 2X4PA 3BVTA 3BW9B 1NCUA 4C56A 1FL3A 2PTVA 1MWAL 5E6ZA 3K2IA 1CFQA 3PYCA 5KOMC 3MNWA 2B08A 2FT7A 4PSRA 3L4CA 3MCKA 2CHNA 4M1GH 5J56B 1MJUH 3NAAH 2OMUB 3L7EA 4RGMB 5DJAB 5GGTA 3EIFA 4ODSL 2W07B 1PDKA 2J1XA 1U92A 1R3JA 2E7DA 1CGWA 1JHKH 1BZ8A 4NKIL 4PRIA 5K9JL 1N5YL 4LMQE 3TBVB 4S0SD 2CLRB 1DQQB 2HRPH 4FA6A 5I16B 4KNUA 4WU5A 3TYGL 1HZKA 1I82A 4R4BA 1F4XL 3OKLB 2OMZA 2P8MB 5IFHL 3BZFA 1WA2X 5F9JB 5DYOA 3CLFL 3L4VA 1MCPH 4XP5H 2OLDA 4GFTB 2BS71 2R2HA 1U93B 2WP3O 5BUGA 5BOPA 1BF2A 1LEGA 1JMXA 5LNGA 4G80B 1XVSA 2DQGL 3I3EA 2IAMA 2ZKXA 4GG6F 4P06A 3QDGA 4UOZA 2JJUA 4DOHB 1Z5HA 1A0QH 3T8VA 1LILA 3A23A 1CT8A 2J72A 4I3RL 4F7CA 1MSPA 2ZUUA 1WHOA 3SKMB 2X10A 3GMLB 1GKEA 2EYSA 4X4ZA 3ZTJG 3K2MC 3U7AA 2IIJA 2IG2L 3V6FB 4U6VL 4A7VA 5AOKA 4FP8H 2H0FA 3HFMH 4HUCA 5D7SH 1IEHA 3KVQA 4XCCH 1M7IA 4PCKA 5BOJA 3V5DB 4HBQA 3ZZLA 4RIRA 4AIEA 5DEZA 1BXXA 1R46A 2COVD 3V8OA 3NCCB 1NAMB 3HI1A 1E9OB 4HCRH 2DQFA 2QGCA 2SODB 5IIEA 1SF3A 1UEMA 3IE4A 3NZHL 1EDYA 4IQHA 2HCZX 3S98A 1JNJA 1PKOA 2ZCHL 1WICA 4AKOA 1PJWA 5JXAL 3IPBA 1ECYA 4OKDA 1I7RA 3KBHE 4Z7WB 3PAYA 1E9QB 1OOWA 1IGYB 3TJPA 3PHSA 3UG4A 32C2A 2NQCA 3IJYB 5I1LA 3GXUB 2EDDA 3KPLB 2XACC 4L4VB 4HJGA 2O6PA 1IJ9A 2HKAA 3S48A 3BKYH 3IN2A 3RAJH 4NQDB 2QQNH 1MY7A 4LEEA 4OCYH 3VXUD 2XQ0A 4FFWD 4PRDA 4W6XB 2QGEA 2BHFA 3QVAA 2EVGA 5FX3A 1MJ7H 4OGYL 3TPUB 2FYYA 4PRBA 2APSA 3CCHB 4X6DF 3DO4A 3BPCA 5D72H 5F3BA 1M9WA 5EPMB 1GY1A 4UM9A 2HG5A 4NI3A 5D7JA 3HLKA 4B97A 3NDZE 3S36X 4WUKH 4OTXL 1FNLA 3FTVA 1ZLUK 2X6VA 3QJZA 4GW4B 1U8MB 2YC1A 3IFOB 4ZPVA 3UTTE 1ICTA 4HKJA 1CXLA 4JY5L 5D9SA 1DBBL 3CVBA 1OE2A 5IOPB 2XN2A 1MFDL 3TBWB 2CUIA 4YSRA 2YZ8A 5B1JA 1BQHA 4G8GB 3L3KB 3CAFA 4I2XE 5J6HB 2PKDA 3W2DH 5E00B 1I7TA 4U1IB 4P48A 2I5YL 4AGQA 2ZUVA 4HZ1A 2ZKHL 5DFVC 5C08A 7TAAA 5HYQA 1A6ZA 1NCCH 2R4RL 4AV0A 2PETA 3QJHA 4MQXC 3WV0A 4X99A 3ABLB 3K6FA 4XWGL 2JNZA 3CXHK 3F7YB 4W4OC 1PFCA 4ZYKB 3U0PA 1SXAA 1K2DA 3TASA 2CALA 3U6RB 4M29A 3NEOA 3VGEA 2J5WA 3EYOB 1F45A 1IGCH 3MBEB 4BH7B 1UB6B 4A6YL 3BP5A 3W11C 4PJGF 3KAAA 4EIZC 1F90L 4IDJH 1X5FA 3BAJA 3NFPA 2ZOOA 5PCYA 4N2GA 3EO0A 4MA8H 4Y9EA 1XO8A 1PZBA 4OLZL 3V5HB 4UTBH 4DTGH 2FIRT 3E1F1 4R90L 3NIDF 3X1FA 2ZX6A 3T0DA 1GSMA 5EBGA 4JFPB 2IGTA 1EJOL 2W38A 2XCMC 4TQPA 2WSDA 5KVGL 3O6LL 2XXMB 4GP8B 4MMZB 2GSGA 2EXWC 5FCUL 2JI1A 3ASOB 5IUSA 2PO6B 1EZSA 1WWCA 3V0WL 5F7WC 2PWEA 2X4OA 1YJDH 3C2AL 5CD5D 1OY3B 1QLFA 1NFKA 2KLRA 2JKNA 2NY6B 3D4CA 2E9IA 2BCMA 2DTML 3KCPB 2HKHL 5KSBB 1G1OA 2FEEL 1MI5E 3V5KA 2KLSA 4GBXD 5ES4B 1J9CT 2ZPKH 3BWAA 3S88H 3M1OA 3LAFA 5DRWB 3B83A 1HHJB 1CF8L 4PBXA 4PJDE 5M95B 3UBHA 4K94L 4XXWC 5MERB 2CHDA 2FEDD 2J8UE 2OL3L 3FSOA 1HINH 3N91A 2BINA 1RIUH 3FQ4A 2EDEA 2WTOA 5AYTA 5BRPA 1UA6L 3OB0K 2AEQH 5INCB 3OJ2C 4MAUH 5T1LB 2GBAA 4KVCL 3GDBA 4WFHD 2ZXBA 1HL9A 1UH2A 4AQAB 3G08A 5GRXG 1TNNA 2CDEB 5EMYA 4LE8A 4DF9A 2X05A 4M03A 1OT4A 2J2ZA 1A4CA 3IAGC 3NJVA 5KOVC 2XWTB 1RZIA 3IVKB 1QPKA 3C5XA 4KVNH 1ZSDA 2UWEF 3R06B 3W37A 1JNHA 3JWDH 4Z7VF 4WWKC 4HJTA 4WJ5A 1UTDA 3FUNA 2VWEE 2VABB 3ARSA 3NJIA 4KO9A 4DP1X 2QR0B 3EYSH 3MA9L 1A3LH 1RHHA 1TLKA 3EJYC 4I9WE 5DUPH 3C5JB 3T4AB 3V4VA 4BIKA 4NQCD 4NKMB 2RQ8A 1KBGH 1TTGA 2EE9A 2DYPD 3N40P 5CMAA 4F2FA 3A3YB 2F54E 3KPNA 3PV6A 1FE8H 4X5QA 3TV8A 4I88A 4NZTH 4PRPD 1JYNA 1P7BA 1Q94A 5BV7C 4AYBA 3QUXB 1OGSA 3E6FB 4UZSA 2R0ZL 3QDJD 1JV2A 2G9KA 5KSUB 4FZEH 1AI1L 2DD8H 4WO4D 4JO8A 4L8DB 4Q0XH 5CFHA 2FK9A 5F7EL 5D71H 4BFNA 4OF6A 1IBGL 1GGBL 1IGJA 3VXUA 3NQIA 4H20L 3TGXA 1FCGA 1NFDB 4NCC1 5A2IH 1S7WB 2BOLA 4GQ9L 2GBVA 1NA8A 3GD1C 1AVAA 4JY6A 4CMMB 3LKSB 4WHYH 5AB2A 1BECA 2DJSA 2WLJA 1SLWA 1F5WA 3GBEA 3K2UL 2BVPA 4K5MA 3VYPA 3AG2B 3DHMA 1MAJA 3FCSA 1TUPA 4ZPTB 3JXAA 4YIQA 3Q7JA 3H4FA 2VDOH 5FLUA 2DH3A 4AMXA 3TEZA 5T5NF 1EZVX 1UOKA 1W8EA 3ARBB 5HGHA 4ONFL 2VIRB 4NEHB 1MNNA 3ALWA 3RJOA 5AZ2H 1NBCA 4HLZH 4HKXA 4QPEA 4JO3L 4QRRB 5DZAA 2VLLA 5DQ9B 3VRJA 3PAVA 5CZVH 1SJHA 3CNKA 4WKZB 4EI6A 3HS0C 2BDNH 3HHMA 3OHXC 1YMHB 2UYLA 3ZDXB 5FYKD 2JCCB 5EEUA 4YNYB 4N0UA 5CZXD 3PL6D 3PNWA 4YHML 3RIFF 2EEBA 1GZHA 2J71A 4Y8DC 2GJ6B 5GGRB 1C5BL 1M4KA 3D0LA 1CS6A 3Q2VA 3VJ6B 2JH2A 2RFXA 1F18A 4HJIA 5EV7A 2V2TA 1CE1L 4KKRA 2V5TA 1SRDA 5EEVA 1U91A 1IFHL 3G5ZB 4FI8A 4ZUSB 2G5BB 5GS0C 2XA8L 1DFBL 3B7UX 3VFPA 1JZ3A 2ODIA 4AZ8A 4HHAA 3BH8B 1H3VA 4IS6B 4WHCA 3S35H 3S37H 5FHAL 1OP3H 3AROA 3FOLA 2HFFB 2F53E 3KPRD 5K9OA 1QTSA 2DQEL 4RGNB 1RIHH 2QMKA 1NIDA 5EUOA 3QRFM 1EJFA 4TPRL 4IYKA 2OXGA 1CZ8H 2ZX7A 3D12B 1HH9A 2AAVA 3T6XA 1T0MB 43C9A 1E2WA 1ZPLA 4XMWA 3FCBA 1OANA 4AL8C 3IGAB 3FQRA 4J3WA 3P2DA 5D5ME 4JO2L 4UQDA 2AV7A 1LDPH 3HBGA 1MELA 4HPYL 1W8NA 1ES0A 4S10A 4XNDA 1MF2L 3GGWB 1RJCA 3QWQB 4G5AA 4KK5C 4MMXC 4FQXB 4E9SA 4V1DE 3ZJAA 4HUXB 1UKTA 2YPVH 3GXDA 4PWIA 4KRNA 5DZJA 1UXWB 5IKCB 2B77A 2K1MA 3BH9A 5ITBH 4YSCA 3AXIA 3MV8D 1B3IA 4GBXA 1ORSA 2DEYX 2X88A 5GISH 3PIQB 1GC1C 1E40A 4HZLB 4YZFE 4ZX5A 1JD9A 3LQAL 2EVHA 2OR7A 2Y2WA 3MHZA 1ZSHA 4N9GA 3SDXB 4DGVL 4AKQA 4CDGC 3O9WD 3PABB 1TU2B 4K2UH 1MCFA 1A14H 1I8MB 2YBGA 4M61A 4IGBB 4XMKL 1E3XA 1FSKC 4TOYL 3DX8B 4E68A 5EC2A 2P5ED 1L5GB 1MFBL 3RLSA 5BNXD 3ZQ9A 4KROB 5DD5L 1N7ML 3RBGA 1B6UA 4HOMA 4PJ5E 2DMCA 5HGAA 4N6QA 1C16B 2Y7QB 4GSRA 5I0XA 2DMKA 3S2CA 3CZSA 4XBEH 3KYMB 2H0PA 4M4RB 4TXVB 2PW2A 1NAMH 4HMEA 4KQ4H 4N4YB 4BZ2A 3G9AB 3US9A 1A64A 3SGEI 3W38A 4G5ZH 4K5OA 1JCVA 1QNZL 4FJ6A 4ZUUA 4ZZKA 3KG5A 5JDJA 2FLRT 1FFPA 2FL5B 3VMNA 5J11C 3HEIB 1L0QA 2N0MA 1ZK9A 2XZCL 4TULH 4Y2NA 5F3HB 1QLEB 2DYPA 4YSOA 5C0AB 3T0EE 1E43A 5KVDL 2NNXA 1SHXA 4MSWA 4PRPA 9CGTA 1I1YB 2XKUA 1C5CH 5EU3A 1MRDH 4I1PA 4YBHA 3QDJA 2NX5B 3D07A 2A1WL 4WO4A 1M53A 5EIIA 1RJLB 4H5SA 1LLAA 3MREA 3UYRH 5MEPB 3ULUD 2H3NA 5KYXB 1FGVH 2BNRD 1E28B 3SE3C 3C5SB 4ZFFA 1XB3A 4QHNA 1I1RA 3WNNA 1UM6H 1V3KA 2KZKA 2B2XL 5HHNB 4Z3FA 3KLDA 4PJFB 3RWIA 3LNEA 4F9PC 2GT9A 3V4VL 5HHXH 1Z66A 3O8XD 3MRLA 3G6DH 2AJ3A 1FFNA 4WHDA 4XXCC 4ELMB 2F6AA 2APWA 4LKCA 4E9LA 4AIZB 3F12A 5F89B 3LRLA 4X83A 5EH1A 1N70A 1WEJH 1CL7H 4RFNB 1Z0MA 1XFPA 2EP6A 3VXSE 4IRJC 2IALA 4Y2DB 4A2MA 4PVLA 3HAEB 2CR0A 4GG8B 4CVZA 5AQ0A 1X5GA 2MNJB 1MWOA 2RD0A 2EVJA 3B1TA 5FYJE 3RVVD 1RZKH 2HSIA 2XXGA 1IFRA 1Z3GL 2ZSWB 1NFAA 5T3ZH 3U1PA 3ASNB 3PL6A 4AKPA 4HP5A 4Q97A 4LLVB 1A7NL 4J3OC 2CRIA 3MLUH 1IGIH 2XWEA 3SOBL 1YCSA 3ZTJH 3ISYA 3KPQA 2XZAH 3UROR 5CJOL 5TK2A 1A6WL 3D4ZA 5DZPA 5CUSH 1DZ0A 1I3GH 2EEXA 2Y1VA 2ZNXA 1IKOP 1GOGA 1S78C 5FF6A 3N9GH 2PWFA 3GI9H 4QD2E 4ALAH 4DP8X 3SKUD 3T6WA 4X7TB 2N1TE 1QBML 1E6OH 1B4JL 4LDOB 4HCIA 3KPRA 3OAZH 1J1PL 2DM7A 3WTYA 1BLNA 5IB4A 5FB8A 3U25A 4KUCD 1KSRA 2TRYA 2FJUB 1S9YB 4K3GA 4DN3L 5IHBA 3RHWF 2VRQA 5AVWB 1YECL 4XPHH 5CJQH 5DQJA 4F3FA 3WLWD 2VYRE 3NFNA 1N8ZA 1EANA 2WINA 1VZGA 3JWOL 5GRUH 1ZT7B 3MZGB 4K3DL 3C75A 1BVOA 4OFIA 1X44A 3HC3H 3CFNA 3HZKB 4I1NB 4I3GA 1Z9SB 4H26A 4PJCE 3GRWH 3K6IA 3US1A 4MBOA 4QMEA 4GKNB 3RNQB 1K6QH 3T3MB 4BFRA 2WBJD 1I75A 1A6PA 1QRKA 2G0LA 3MV8A 3T6ZA 3WO4B 2W81C 1TYEB 4G3YH 4Y16B 1ASQA 5DMKB 1A4BA 1OF2A 4Y9FA 1NCHA 2BSED 2EH8L 1YUHA 5IW1A 3F58L 4NGHH 1IC4H 1QTPA 1JFHA 1XB6A 4FNSA 7PCYA 1CTMA 2A6DB 3ULSB 3P3SA 4OIIL 4LCUA 1KIQB 4WFFD 3WIFB 3PHOA 5FOBB 2YN3A 4M9PA 4DUVA 2QSCL 4JDEA 5DD1H 3I85A 3O9WA 5LXGL 2WLLB 4XX1G 4W9KC 3L16A 4X4YA 2BP0B 2GIYA 1ONQA 4FRWA 2B5IB 3KM1A 4NZRL 4K3EH 3LEXA 2VL4A 3CFUA 2EC8A 2GITA 3K81A 4UU9A 4OQTA 4JRXD 4MJ6A 4ONGL 3EDKA 3V0IA 4Z7NB 3UAJD 2G0KA 1J0ZA 3N2JA 2CG9X 3WKNA 4ZAKB 5IMMA 1BG1A 3DX7B 1CK0H 3L3IA 5E9DE 4Y8AA 1DCEA 5TDNA 2P42B 1AGCB 3IBOA 3VU2A 5C0JB 3C87A 4QTHB 5CD3B 3SBPA 3VFNA 5ID0A 1CFVL 3RP1A 2X28A 5FFGA 5JW4M 3O3AB 3ARUA 3VRLF 5EUOF 1QP1A 1KELL 4HUWB 2DWEA 2WB7A 2UZYB 2ZOLA 3AXLA 5HHMD 3QDMD 3VWJC 2XETA 1BREA 1A3RL 2NYZA 3DV4B 4OLWL 1OM9A 3BPOB 5E6IB 5I74B 1WIUA 2YLHA 3UIYA 5B1KA 4ZNEE 4E9XA 5FGCB 3D2UD 4PWGA 2R83A 4HJSA 1V7MH 4QRSA 5GGSB 2V9TA 3DXAB 4JM2D 1OP5K 3HG1E 4D9RE 3OZKA 2P43B 1DJYA 2F7PA 2DTSA 3WHXB 3QQXA 2WYIA 2WLIB 1ERNA 4G70B 4KAQH 1ADQH 2WNGA 3ATAA 1JXJA 4FLRA 2Y4SA 4PEEA 2BNRA 4P49A 3RVTC 5AB1A 3TTYA 4HK0B 3AS3A 1A5FH 4KPHH 5E1GA 4BZ2L 3NMEA 1T7ZA 4GLRI 1FNAA 1UZ6E 5JW4R 3EFFA 4ODHL 1BFSA 4NZFA 3OC5A 1BIHA 1EJ6A 1O5DT 1BBJB 3QQ3A 4NRYB 4FJYA 5I9QC 3RNKB 4YGAB 1KPVB 1RH8A 1X7SA 3O8XA 2CO6A 1MCWM 1A7OL 2OXHA 4NPYA 4JFFB 5AALA 1IC5L 2HRLA 7CGTA 2B39A 4XVJL 5L2KD 2AK4D 1XGUA 5L2JA 2PCPB 1MDTA 1EQWA 2VW7A 3DPDA 4JFEE 3SYPA 5DUBB 2HPTA 1UXSA 4ETYA 1J9RA 2EADA 2DQUL 5KSAB 3MYZA 3QUYB 4XRCA 4OFPA 3QYCA 2Z91B 2KKQA 3ABZA 4GI6A 2FGWL 4U1LB 1OSYA 5DK2A 3CBRA 1NCAL 5AFAA 2ATAA 1D5IL 4OR1A 1YN6A 2OMVA 1M2VB 4PW3A 2OMXB 2W0KA 5KYNA 4OLYH 5H35A 2NT1A 3K8KA 4JN2A 1I85C 1BXUA 4G9FE 3LV3A 4P5TB 2IDFA 2HTKC 1Y1DA 4P05A 2P46B 4PI0A 1CFMA 2R1XA 3QNYB 2ED8A 1S7SB 1HNFA 3NQKA 3MYJB 3GBNL 4LRNH 1I9IL 5C0BB 1KY6A 2D4DA 1MXGA 1S3KL 3KL5A 4OBRA 2IO5A 4NOBA 5B1CA 4S0HA 2A9MH 2EEFA 5C1MB 2VXQH 1WBYB 3E1ZA 2G2RA 4IJTA 2CLZA 1L0YA 5HPMA 3T8XA 4LRIA 3HR5B 3MFFA 1VFOA 2ALAA 2C4FT 4XOEA 1P5UA 5JHLL 4XNYL 1HX0A 5FYKL 4KY2A 1HI6B 2XSKA 4K7PL 4P59H 3BRDA 3FT3B 5LBVA 4XNZC