2K3TA

Solution structure of ig-like domain 23 from human filamin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-A
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k3tA00
5FUZH 1G7LB 3ARDD 3EYSH 4Y5YA 1A1OB 4IS6A 3DGGA 2F74B 4O58L 1GGTA 4H5SB 4JPIA 1S9VB 5I15L 1U8NB 3VFSA 3MLZL 5IMKA 1VPOL 2YPKA 4O00A 3I6KA 1KUMA 2DQCH 2BX5A 3PGDB 3RVXD 2GJ6D 3KJ6H 1FV1A 2I07B 5HYSB 1XAUA 3WIHA 1C1EL 4P5TA 4ZD3L 5C9JB 4KFZC 4UQ2A 4NHUA 5BO1L 2NY2B 5L2JB 1XR9B 2WANA 3ARZA 4MAYB 4J1UA 4NN5C 1HDMA 2CK2A 3QZWG 4DGIL 4JR9L 2HKFH 3MJ7B 3VI4F 4K7FB 2ADIA 2YSSB 2BVTA 3IKCA 4ZXBD 4M1CD 4LLDB 3O2WH 4NPYB 5C8JB 5IMMB 5FIEA 1ED3A 1FL5A 4X8XA 1SMAA 3CVIH 3JXAA 2H6PB 1MJ7H 3BGMA 3PV6A 4PJGE 1FIGL 2AEWA 1XF2B 3WS3A 4ZXBB 1C08B 4PRNB 1BIIA 2MJWA 1S7XB 4FMFA 1OAKL 4OIBA 4L5FL 1WWAX 2BDNL 4GRWB 4NGHL 4FXGB 4ELKA 1UM4L 4D9QE 5K9OB 2R2BB 3T0EE 4LU5H 2JB6B 1CD8A 1LP9B 3FQNA 5AD0B 1JTTA 2A77L 3IDIB 5KANG 3RI5F 3MRCA 1G0XA 3PWNA 2BOCA 1CFSA 2FX9L 1II4E 32C2B 1GPOH 5D2NC 4FTVE 4MS8C 2CPCA 4HCRH 4JZJB 1GZQB 4NCC1 3FHQA 2BVPB 1VFAB 4HWBH 4G6ML 3QCUH 4UU9A 1LE5A 4Y88A 2CR3A 1KPVA 1DQDL 2E9WA 1KT2A 4WI9A 4ETYA 3CC5B 3UJTH 1R3JA 1YEGH 2WINB 5GGTA 5DD0H 5DRZA 4K3EH 2DD8H 5HYJB 5FYJD 1UB5B 2FZ3B 1Q0XH 2HT4D 5F97E 3B9KD 1RY7B 2F53D 4HXAL 4YBHA 3S88L 2X10A 4QGTA 2CKBH 5GGRB 4MD0B 4F9LC 2YUVA 4YDJB 3CFCH 3LPWA 3HR5A 3LEYL 5D6CB 5DYOB 3JZ7A 5GGSY 3RL2B 1C1EH 1BX2B 3ZKMC 3SKUD 3MRGB 1FSKC 1WSST 3AS3A 4Z5RA 5KS9F 3P4MA 2QR0B 4PRPA 3TN0A 5DHVH 3ULVL 3OKLB 1LEKA 1Y18A 5T3XE 4C56B 2FO1A 1JF1A 3SJVE 3PQYD 4KVCH 3U4BL 1FCCA 4KJYA 3MCKB 1IBGH 1JF5A 4E5XB 5FYJU 5ITFA 1QPPA 3MNWB 4RRPG 2EEBA 3BKJL 3UZQA 3W2DH 2XQBH 4O2EB 3MLYL 2GUOA 4N0YL 3IDGA 1N8ZB 3HAEG 1G0DA 2IAMA 4WU5B 4JO1H 1YQVH 4RISL 3H9SE 1XZ0B 1MNUL 1S9XA 5TF1L 1P9MC 1N6UA 3SY0B 1RVFH 5GZND 5F6HJ 1JN6B 3QDGA 1T0PB 2WIIA 4M61B 4KI1A 4HCRL 4F7EB 3THML 4UTAL 3LMJL 4X83A 4KROC 4ZPTA 3RNKB 4C83A 1NAMH 4R4BA 3M07A 1RU9H 3WN5A 1I9JL 3QXAA 2BRQA 4JQIL 2FEEI 2JIXA 5E2UH 5DURD 3EO9H 5EG6C 1RURH 5IMLA 3BD3A 3CFEA 3NN8B 3QUYC 2P8MA 5T33H 3BWAB 5CILL 2NY0D 4GLRH 4XBPA 3VCLA 3ULUE 5KS9A 4P9MH 3EYOA 4P4KA 4G8IA 4G8GA 1IVLA 1QLEL 4NFCA 1JGVL 1SEBB 5J57B 4ZUVA 4Z7UA 2HMIC 4TULH 3BAEL 4KMTH 4WHDA 3C9NA 1RZIA 5D9SA 4DN3H 3C2AL 5JTWA 1OAUH 4WW1A 1MCLA 2VWEC 1CD1A 4HIHB 2BSSB 1A5FH 4BQ9A 5EZIH 4NC1C 1BOYA 3VU2A 2P8LA 1HINH 4OM0H 4I2XB 4WY7H 4NSKA 1BM3H 1VEMA 4Z7QE 1BD2E 1U8MA 4X98A 3B2VH 1OAKH 3GSWB 5HDBE 3VGGA 4DK6A 1CI5A 3TJEL 1BD2B 2ZUTA 4WFFD 5F7DB 2NY5C 3TVMD 2IANA 1IAOA 4KPHH 1FBIL 3FONA 5HDBF 2X9YA 5CJBA 1MH5B 2YMXH 4U1HA 3OJMB 1KB5L 4ZUTA 4XWGH 5EU6B 5DR5L 4UOW1 1JI2A 3R8BB 4FFYH 3P4OA 4WWKB 4ETQA 2IC2A 3VXRE 2UVFA 3ZO0A 1OVZA 1VSCA 2YS4A 4CAGA 1NLDL 3OF6A 5C0CE 5T5NF 2B2XL 5H94A 3CLEH 1KXQE 3MCKA 3TF7C 5FV1L 2VMFA 4KK6D 4H1LB 5D1XD 4MB5A 3ZKXC 3ARED 2JJUA 1QRNB 1AGBB 2VQTA 4LK4A 4OZGF 3FB5B 4LNVA 3ZKQD 3ULUL 3D0LB 3WLWC 3DMMB 3U7YL 4Y16B 1QQDB 1D6EB 1ZTXH 1A47A 3ARYA 5IBTH 1NCWL 4Q58C 3LEVL 1ADQA 5CKGA 3DXAD 3L3HB 3BP5B 4U1KA 4HXBH 1N5AA 1SBBA 2WUCH 4XBPB 3VCLB 5A3IC 3VRLE 1FYHB 4GRLA 2Y5TB 4RMTA 2OJEB 3ILPB 4HKJA 2RBLA 1QSFE 3LMJH 2NY1D 4L8DA 4PJEB 3NPSB 4GO6B 4GMTL 4OCXH 1KCRH 5IK3A 2HJLB 5JIHA 4PJEF 1QZ1A 5FGCB 3KPRA 1MHCA 1GZPA 1UJTA 2P7TB 3VMPA 1X7QB 4WHYH 1JPFB 4FQXD 3TVMC 5TH2A 4AJ0A 2Q20A 2FB4L 1CS6A 1SEQH 5A2JH 4G6FD 3PDGA 2JE8A 3MRMA 2CXGA 5GRJH 5E8EB 2M1KA 2DMBA 5DZNA 3FN3A 3CZJA 3FQRA 4RQQB 4XPTL 1KJ3L 4ZS7H 3PWNB 1AI1L 4G8EB 1OP9A 3EO1A 4L8BB 2ZUQB 2AV7A 3ILQC 4OV6F 4QRSB 1NC4B 3QUML 2X1WL 4HKBA 5D7JA 3TZVA 2VSCA 1I75A 4GW4A 5MERA 3TCLB 5HHQB 2Z92A 1QNZL 4N0CC 1F00I 2K3TA 5HHVL 4R8WH 5IBLC 2YPLB 4JO4L 4X4ZA 4PV8A 3HI5L 5C0IA 1WEJH 43CAA 3D3VE 4HUWB 4X6CB 3HI6L 3V5HB 3C5ZB 3F7YB 2Z9TA 1JYNA 4UB0L 5EO0B 2WLYA 1BBJA 2R9HD 3GSVB 3MBXL 3AXLB 4JRXE 4MJ6B 4OB5L 4S1DC 3V0VB 5HGHB 3UTZA 3BKMH 4BUGA 3UTSD 1BVLA 4PJ8D 2ZSWA 1LQSR 4JG1L 4OJFL 3ZKSD 4OD2A 3QNXB 1ES0B 3F58L 4I0PD 4P9HC 5E6IC 5H2BB 1SJEA 5BV7L 1ORSB 2BJMH 1HSAA 4UAOB 4DW2H 4P46A 2V17H 3CFIC 2HWZH 3U46A 4WFGE 5EUOF 2YHGA 1GGCL 3DJ9A 2EH8H 1IZJA 4TVPL 1T6WA 1EERB 2B5IB 3QDMD 1KJ2H 1NCDL 4KI5D 3U30C 4E42A 3IF1B 2IH3A 4XVUC 5IB4B 4I0PB 4GMTH 3S37X 2P5WA 4QF1B 3PXHA 2L7JA 3E8UL 3MACL 4ELME 3QIBD 1MWAH 4S1RL 1ZLSL 4OCSL 4GJTB 1FFRA 2P8PB 5HTSA 3X3GL 4Z18A 1KBGL 3BWAA 1QUNA 4LVHC 3P73B 3T3PF 1ZVHA 2VUYA 3PP3K 4GXUM 3PG2A 1AI1H 4HKXB 3V4UH 5FGBA 4YO0B 3EFFA 4J3XA 3DURB 3D1MC 1CK0L 5IM7B 4F7EA 1P6AB 2DS4A 4KVNH 3KPPA 2CLZB 2BCKB 2KQMA 4YGVB 4P2YA 4XWGL 3QEQE 5ABDE 2HH0H 2H8PA 4L4TD 2AJXH 1MQKL 3O0RH 5ACZB 3FCTB 4Y7MA 4S2SA 4YUEH 2EZ0C 1AHWA 1FGNH 5T3ZE 5IUSA 3MBEA 1V3MA 4K23H 5I71C 1RZKC 1H3PL 2JLLA 3TFKD 4OLXH 4HFWB 5HHVH 1ZGLA 4NQCA 4IRZH 3QDJE 2C5DC 2Q7YA 3IU4H 3AAZA 3BH8A 3SDYL 3SJVA 3ZSTA 3R06B 5HVHB 1TITA 2EEDA 3QUMH 3IETB 2FR4B 1LNUB 3OKKB 1F90L 1Q9OA 4ODWA 4U1LB 4OF5A 2Z31C 4MJ2A 3RVWD 2VZVA 3BZ4B 3VH8A 4DOHB 1M7XA 3BP6B 1FG2B 4K3GA 4W6WB 5CINL 5DUBA 1UCTA 1EO8L 3PGDA 5EU7C 4X7FC 2C26A 3MGAA 3MJ8A 3ARGD 3D3VD 3OX8B 2IH1B 5DLML 3SDDA 4YDVB 1ZT7A 4PJCF 3UTSA 2JCCE 4YDKL 5T3ZH 1G9EA 1UA6H 1ONQB 1AD9A 2OTUA 5CJXA 4G3YH 5CZKA 2OL3L 4Q6IC 5F3HB 4NKOB 2H26A 1HH9A 2OXGA 2UWEF 3O6MH 4GG8A 5IGXH 4M93C 3WFDH 5KJRH 1KELL 4PTTB 1FH5L 3QWRA 5E03A 5BRZD 3VXUD 5T3XL 3N9GH 1S5IL 4N8VB 2WNGA 4FZ8H 2J6EH 3ISWA 4HKZA 4JE4B 4WTXA 1X5HA 3CJJA 1BZ7A 2X70A 3TYFB 2NY3D 3BD5A 1RZKH 2CUHA 4LLAA 5C08A 5KS9E 2Y1VA 1FVEA 2Q76A 1KFAH 4NKDA 3RJQB 3UPAA 4Y4KA 1JNJA 3V2AR 2YRPA 3MLVL 1C12A 1M05B 1KTRL 1N6VA 3ORJA 3DRTB 5ISZA 1B4RA 1X4YA 2EIBA 4TRPH 1TTFA 4XP1L 1TQBB 1I1FA 3GFUA 3RJDA 4GG6A 5FHAH 2CIIB 3LQAC 3GI9H 3RTQB 1U2HA 4HEME 1JMZA 5JXED 1R3IH 5J4MA 1G9NC 4XT1C 3QI9C 1MFNA 5GS0L 1CFTA 2DLFL 3MJ8B 5E4EC 5JHDB 4CMHB 3CGTA 2CRIA 4YHLL 3GHEH 4WGWB 3TWCL 2VDPH 5AUMA 4AENA 5I9QC 4MJ5A 3NIDF 5JMRA 1ONQA 3VGBA 3HUJF 5JOFB 4N9OB 5E9DE 1VKXB 2E27L 5GS1A 1FP5A 5D8JH 3HE7D 2GSIA 3UTPD 1CGSL 2NCMA 3U1SL 5I75B 3G6DL 3H42L 5F9OH 5FHBL 1ERNA 3GMLB 3W9EA 1OHQA 4DW2L 3RIFF 4OZ4B 2VJXA 3MRKA 4QRRE 1HOCB 4V1DA 1NFDB 1C7TA 2QQQA 5DQJB 4UDUB 4B5EA 1EEQA 4XXDA 4W4NA 1YNTA 4QY8A 1NAKL 5E2VL 3MREA 1NGWA 1F8TL 4U0RC 2IF7A 3QDJB 4XB8A 1WFUA 5TJWK 4AK1A 2V2TB 1N3NA 2A1WH 4WUUE 4R26H 1YNLL 2ESVD 4JM4L 2GAZA 5I0ZA 3O6ML 3SJVB 1CK0H 3MUGB 4UV7L 4K9EC 2B39A 4KK9D 4OFIA 2B0SH 2ESVE 3L95B 1EFXB 5D1XA 5C09D 5CGYC 2CLZA 5IMKB 4G9FB 1IE5A 1ZA6B 4D9LH 1G7MA 3FFDB 3OF6D 1Z5LA 4ODUA 5F7DA 2EDFA 4RIRA 1MVUA 5GIRB 2BVQB 4Y2OA 4YPGB 3OJDA 1IC4H 4O02L 4OGXL 4U6VH 3VWKD 1NANI 3VD5A 8FABA 1MRFH 5EIIB 5K9KB 1T66D 4EOWH 3HZYA 5E08H 3H9SB 4NUGH 4NNXA 5DRWB 4QRUB 8CGTA 3QXUA 3HC3H 3AU1B 1A7PL 1ZE3C 4FXLA 4QHMB 5IFAH 2BC4A 2R4RH 1FRGL 4QXGH 4KZEL 2FX8L 2BFVL 4QXWA 4ZSOA 2FO4B 1OW0A 3QI9D 4PFEA 3IRZA 4DAGL 1ZLWK 1I7UB 4OGYH 5JHLL 2N1KA 5KS9B 3ULVF 1LO3L 1RUMH 1T89C 3IDNA 3BO8A 5E94A 2PW2A 2ICEA 2BNQB 3TBVB 4Y16A 3UZVB 1SJVA 4KK5D 1I8IB 3SGKC 1B4JL 4UV4L 1I9JH 4PRAA 4NRYA 1P7KA 1GAFL 3C2AH 4K94H 1T1WA 4OZHB 4RMVA 2FIKB 2FH8A 3P40A 1MCOL 1DBAH 2L4OA 3CZFA 3EJYC 5FYLE 5CD3A 1HXYA 1A7OL 4Q2ZA 4EI6B 5I66A 4HH9A 3M1BB 2V6HA 3L9RA 4OLUH 3RY6C 25C8L 3EJZC 4PTUA 1VFOA 1NGWB 2QADB 2BNRD 5GS0C 1HHJB 3BIKB 4U6YB 4PGEB 4YDIL 3IU3B 1G7IA 3BX7C 3GSUA 2QQNL 4KK6C 3KJ4B 3F8UB 1XCQA 1X4XA 3B9DA 3MROB 4EVNB 4AH2A 3LKQB 1P4LB 3S3SA 3CAFA 5J6HB 4F9PC 3QEUA 3NA9H 2WK2A 4ACPA 4DJMA 5IBLD 2ZJSH 4U1SA 4JRXA 3LKNA 1WFTA 3S98A 4K9EH 4UT7L 5CJXC 3GJFA 4ISVA 4FA8A 5I30H 3BKCL 4EQ2A 3VDAA 1FJ1A 3HG1A 4LBEB 1ROWA 3EZJB 4UNUA 4K8RC 2XN9B 5KSBA 1RUPL 4KPHL 3REWA 4RIRB 5FF6B 5IG7B 1MIEL 3FN0L 1DCLA 4FXKB 4PJEA 4BK4A 5KVDH 4R4FH 5I6XC 5GGVY 4L8CB 4HLZG 4WUKL 3DO3A 4ZD3H 1R0AH 1D5XA 2XXCB 4M43H 4JHWL 1C16A 2BNUB 4RGOH 4LCIL 2ERJC 2VTFA 3KWWA 4OIIL 2P5WE 4AQ1B 3O45B 4MD5B 4RNRA 2PUQT 2APVA 3V6ZA 1G6RH 5T3ZD 1G1YA 2R0ZL 5GGVH 5EU4A 4OFPA 2OJZH 2D7NA 3GIZH 4M5YL 5HHOA 1FVEB 1NBYB 1MLCB 3F7VA 3S9DB 3DGCR 2E6PA 3RHWF 5D7KD 2ZKHL 2OJEA 1J1PL 4D0CA 5ICYB 4MA1B 4OLWH 3ZE0F 1PD6A 3MGOA 1H5BC 3QIBC 5ISZB 4PJCE 4I5BB 4HUXB 4Q6IA 1TMCB 4F7MB 4XNYL 5HGBB 1FE8H 5LBSL 1ACYH 4HV8B 4PY7B 3WYRA 2P24B 2QL1A 3KHOA 1R24A 2APFA 2JB5H 1A6WH 3BZFA 5J9PA 4ELMA 2UY7A 4YQXH 3ZSSA 1RHHB 1CQKA 4WUUA 3WUZA 5DD3L 5B3NA 3I6GA 1H5BA 4L8CA 4LFHG 4U0QB 1Y6MR 4GG6B 3NFSH 4KRLB 2ZUYA 1A7NH 1INQB 2YUXA 3QH3A 3TT3H 1QRKA 3B5GA 1D6VL 5I66B 1JNLH 1NPUA 1TIUA 4FFZL 1CFVL 3ZE0E 5E5UB 4DGYL 1PY4A 3IKCB 4NSKB 4RWHA 4I18C 1BQHG 2DWDA 4XNMA 5FKPA 1V7NH 4LCCA 4XAWL 1PLGH 4X6CE 2YKLL 4M5ZL 3GMMA 1R6VA 3EO0A 1QFUH 4LSRH 5D71H 2XOTA 4FFWC 3MQIA 4I3RL 4KMLB 3TBVA 3O2VL 5EU6E 4LARL 2Y72A 3HUJE 1OQOA 4N0UB 3CU7A 3FN0H 3CH1A 3K8MA 3MV9A 5EUKA 3RWCB 3MLPA 1UXSA 4BFIB 1E6OL 2FX7H 4HUVB 4FS0A 1AP2A 4FN0A 4PUBH 4OFDA 2Q8AH 3RVUD 1AIFA 5HJ3B 4LSPH 4XC3L 3SDCC 4F8TA 3BESR 4MD4B 5AAWA 4Q6YA 5EZLB 2H2PC 1GGBL 1RUQH 1GHFH 3AU1A 3QISA 5I1LA 3UJIH 5EA0L 5L2KD 3T2PA 1SJHA 4NQCD 3RWDB 3MRLA 3RZWA 3P30L 5HPOA 1LP9F 3BO8B 5IFHL 1CD9B 4XCEA 3D87B 5EIQA 2Z8WC 1GGCH 2DLEA 5I1GH 3EYFA 3MRQB 5INDA 2X9WA 1M7DA 2GW5A 4PRHE 4RBPH 1A7RL 3RVTD 5J3HC 1FFOA 3CVHB 1UM6L 4H20H 3T0WA 5KN5A 5FOBB 3E8UH 3SGKA 3V0WL 5EUKB 3Q1SL 3GGWB 2F8OA 1CFBA 4X5WB 1TCRB 1JFQH 5CBAA 3EDDA 1OCWH 5E0QA 4IM8A 5C0DB 1FL3B 4MXQC 5GGSA 4PRPB 4XAWH 3TN0B 5DC9B 2X89A 4W6YB 3QQ4B 4M7KL 2DBLH 4OZIA 3RGVB 4LNRA 1BBJB 1OW0C 2LU3A 1S5IH 3EFFB 4P9ML 1KBGH 2VLMD 3T65A 1KOAA 4GKSA 4XNMB 5KVDL 5F7NC 4R3SB 4DFIA 4LAQH 3HE7C 3KYMA 3GSNA 3MPCA 4F3FB 2O5YH 2XICA 2FR4A 3OXRA 5IKCA 1BWWA 3T2NH 1AKJB 2EKSA 3RY6A 4J12A 3FB7A 5D5MA 2FEDD 4QF1A 4DOHE 5HYJA 3QUZD 1KN4H 3SBWC 4NQEB 4M6NH 2FECI 4G6KH 4R97B 2BMKA 4QRTA 4XX1E 2FBJH 4E42B 1U8JB 1OGAB 2OTWA 3EOTL 4HS3B 2OZ4H 4Y19D 3BKJH 5CD5D 2V9QA 2VR9A 3BZFB 1KTLA 1E0OB 4LIQE 4MWFB 5ERWA 5KAQG 4RDQF 5FA3A 3MLXH 3W9EB 3NIFE 5FOBA 2MKWA 3T0EC 1A6AB 1C12B 4TSCL 3CCHA 5DFTA 4JGJA 3PE9A 3G5VB 5JHDD 4UT6L 1BBDH 5TE4L 1BZ9A 4OLWL 1BOGA 3GSOA 1NCBL 1CVSC 2GYSA 4XAKD 1JV5A 4Y19B 1INQA 3V5KA 2Q8AL 1FNHA 4D0CB 5ICYA 1ITBB 3MSPA 2X44D 3GI8L 1UYWH 2JJWA 4PJXE 3KDMB 2CIKB 2EXWD 5E6YA 3GMQB 2HRPL 2ITDA 3F62A 1T03H 5MHSE 1KF9B 3TZVD 2O5ZL 2X4OB 3SE9L 3NVQA 1FFQA 5ADPH 3ULVD 1YJDH 4I4WA 3QXTA 1UJ3C 5T1LA 2O26U 3D9AL 4XMKH 1NEUA 4O5LL 3EFDL 1G9MH 1NLBL 3IT8D 5C1MB 2I9TB 3WNMA 4OQTL 4LHUG 4AEHH 3BJLA 2VDKH 3KLAB 1C08A 1QVOA 4PRNA 1BAFH 2BRRH 1CGVA 4FQXA 1H9VA 4JB9H 5C08B 4G80A 1AP2B 1D6VH 5CSBA 1J1XL 1T5WA 2ZCKH 2VLKA 2JK5B 4LCWA 4TN9A 1AO7B 1ZHKB 1K4CA 3GIVB 1OGTA 3JV6B 2QSTA 1R3LB 3PIQB 3RFZC 1G6RB 1J18A 1I3RA 2DWEA 4C58B 3FT4B 4Q97A 4KU1A 2B7DT 2R4SL 2X4TA 3BUTA 2QBWA 4PLJC 1L4IA 2HFEB 3J8F7 2VR5A 4KK5C 2MQ0A 4OCMC 3K2UH 5IHZA 4M9PA 35C8H 1NGQL 1E4XL 1FE8L 4KJWD 5LBSH 3CLEL 4FMKA 1E6OH 1QACA 3E3QC 5LWYL 1I1AB 4L8SA 5I9QB 5ACZA 3RAJL 3GSWA 3G04B 5D5MB 1C5CH 2OR7A 1JWUB 1Q72H 2DLIA 3ARXA 4WI4A 3U36A 3QI9B 2V2XB 3WN5C 4U6XB 5HYJE 3WDJA 3TBYA 1CFQB 7FABH 1MFCH 4NRXA 1CL7H 5DHYA 1KPUA 4LRNL 1ULVA 4F57L 4XVUD 2E8YA 4JFPB 4Z7NF 4POZD 2VDOL 3KYNA 5SX4H 1YEHH 4X7EC 5D70H 5EOTA 3PWJA 1EJOH 4PS4L 5T5FH 3SCMD 3A67H 3NTCL 3EDEA 1MAMH 1ZEAH 4LAJH 2VWEE 4HIEA 2VN7A 2D7PA 4NO3B 5HI3D 5FYLH 1MCPL 2VZ3A 5IW6B 4U1SB 2F53E 3WO3B 1ZS8B 3QIWA 1I7ZA 3T2OA 2XTJD 3NN8A 3HG1E 2V5YA 3IF1A 1MHHA 4HW6A 4XMLL 5SWZA 5TDNB 2C7UA 2D31A 4P99A 1D5MB 4F15C 5JPMB 5E2WL 3U9PH 5TDPA 4U31A 3F5WA 4DKDC 2IBZY 4WUUB 2UZIH 1IGYA 1RJLA 3LS4H 3MR9A 4JDVB 3GI9L 5IQ9A 4WV1A 3QUXC 5HYQB 5A3ID 3PJSB 4MB4A 1F6AA 1IGFH 4EOWL 5HHNB 4HH9B 2XTJC 3FFCA 3EJYD 2MPAH 3JVGC 2P8MB 1IAMA 1U93A 4ZPVA 4QTIH 2J3SA 4FZEL 3MRIA 3D9AH 1X5GA 4MX7A 4QCIA 4MSWA 1WWBX 1I8KA 2DQGH 3T0EA 1NLBH 3BH9A 5MHSD 1AY1L 4Q9RL 2H9GA 2FO4A 4G8GD 1U8OB 5JR1H 4NRYB 3RRQA 3TNNB 5FYKU 3NZHL 5SWSE 1XGUA 4CU6A 2X6MA 1NBYA 5JIKA 1GXEA 4ISVB 3CUPB 2I5YH 3HZVB 4FTVA 3MRJA 3SO3C 2D2OA 4G6AD 1J12A 1FZKB 3CXDH 3CVIL 3RUGF 1DBBL 4JFFE 4LMQE 4P4RA 5DRXB 3E6HB 4XPHH 4AG4H 2DJSA 1P5VA 3UDWA 8FABB 5D7KE 1EA9C 5MEQB 4R96B 5EIVA 5IMLB 3PQYB 4PP2A 1J7VR 3P4NB 1I7RA 2DICA 3QAZB 4NQUA 4OD1H 4X4XA 4I3SL 3OQ3B 4TNWF 3BN9C 1Z3GH 5EPMA 3QDHA 5CD3B 3FO0H 1WIPA 3U36B 1T04A 4CL7A 1UT9A 1FNEB 3HC4H 1RK1A 5IF0A 2GAZB 2FJHB 4DVBA 4L8SB 2DYPD 1QSZA 4K3JL 1CD1B 5F96H 4G6JL 2VZSA 3ZHLA 1XCQB 3MROA 4EVNA 3NTCH 4LVHB 5CP7A 4C4KO 2FX9H 3QQ3B 2FIRT 3CX5J 4G9FE 4LLVA 3KXFA 4YE4L 1NCNA 4XNXL 3FMGH 1F4XL 1U58A 5K33A 2EXYD 2BXYA 3JUZA 2FJGB 4GOSA 1E27B 5TE7L 1Y18B 3U4EB 1FO0H 4IMKC 3T8XB 1MOEA 5HGGS 4O51A 5DS8B 1KPVB 4LGSB 3QWOB 4PJIF 4M9OA 1IGYB 1L0YA 2F53A 4QHUA 4GH7B 2QHRH 2XYCA 3D0LA 3MV01 3LS5L 5JQ6H 1GOGA 1UENA 3QEGH 4PJCB 1U93B 3V6OC 1MIEH 1EDQA 1OWWA 4ONGL 3V6OA 5D2LF 2XN9E 4QRPB 4BZ2L 1I8LA 2EH7H 2IAMB 4JFHE 1E4WH 4C56E 3IJSB 4TSAH 5J1AB 2NX5E 3EOBA 4G42B 3KPSB 4XNUH 3MR9B 4D0DA 4NQDB 3MRNA 3MLRH 2HG5B 3IB4A 3CFKB 5CFHA 4XCFL 5BQ7A 3DUSA 4JFQA 4HIIB 5IBUG 1M71A 4P2QA 3U0PA 2NY6B 5JW4M 3O3EA 4RMWA 2J8HA 5SWQA 3S3JA 2ENSA 5C0BB 2EE9A 2J88H 4KTDH 4JFDA 4XH2A 4XP4L 2QR0A 2W0FA 4O2FB 2FL5B 4NM8L 1EJOL 3OJDB 4OLXL 4PS4H 3OB0K 3P0GB 4RCAA 4JFFB 4L1DA 5BZDA 4DGVL 5DRXA 3P0VH 4DVRH 4AH2B 4P23D 4XVSL 3O8XA 1RZIB 2E9BA 5D9SB 5DJ6A 3GSUB 1U8KB 4P48A 4ZDHB 4NQEA 4U6YA 2COQA 4Y5YB 4BSVA 4I3RH 2FDBP 1E4XI 3HUJB 5D7LA 5DRZB 3VWJC 4JRWA 4Z6AT 1JPSH 1UQSB 1U8IA 5HHME 4HPOH 4E9LA 1CVRA 1YQ2A 4LCIH 4F33B 5I1GL 3DTXB 1HCVA 3FFCE 3PNWB 4UINL 4X6BA 5A1AA 4X9HA 2OS7A 2O61B 1T6VN 1WIOA 2R15A 5H37G 4NZTL 2JTDA 3QDMB 4HK0A 1T5XA 3G6AA 4LKXB 15C8L 4KTYA 3HI1B 2XZAH 4NCDA 4AG4L 5F1KC 5DQDL 3KNBA 1U36A 4LQFH 3V6FA 4RFEB 1UWEL 5CLWA 3BPNB 3QIBB 1WAAA 1A4KB 5I2IB 1D5IH 3L7FB 4MJIE 1NC2B 2PF6A 2P5WB 1W72A 1UJ3B 2DLFH 4XHJD 4JDTH 3WIIL 3O9WD 4E41A 2HKHL 2APTA 1KSRA 1HK6A 1IC4L 1JNNL 1Q9LB 4JREC 3SDAB 1UEYA 1IILE 3D5OF 3H3BC 1R5IB 2WSKA 4OLYL 1FL5B 1JV5B 4Y19A 3QUXA 1BVKA 3LPGA 4K3JH 4HLZH 5AYUL 5IB1B 4R4BB 1CDIA 2VSDA 4JRYE 5E56A 4HZAA 5I6XB 4L4VD 4PRID 1AGDB 5CSGA 2BCKA 1U95B 2KL6A 3OV6A 4Z7UF 4P59L 1S9XB 1TZGH 1R5VA 1HYRC 1G7QB 3WE6B 3H7LA 3SCMA 4PGJA 3WJLA 4PJFA 1RIHH 3KPSE 3MRGA 3N9GL 5DMKB 3DLQR 3SKMA 2BHZA 4OSUH 2W0LA 1WBYA 5AZEL 4GQ9L 1WEJL 1ODAA 3U7YH 4HAFA 2F5BL 3K3QA 4EDWL 1P7QB 2R0KL 4OKVB 4NNPL 1U8LB 3BXNB 3Q2CA 2Z0BA 1UWXH 1H3XA 5I19H 3VXTA 4GG6E 1XF3A 5D8JL 1QEWB 4NQXB 4X7TB 2QSCH 3ARDC 5BS0D 5KVGL 3PXJA 2P44B 3TZVB 2AXFA 4NM4L 3ULVE 2X4TB 2FWOA 2MOVA 3E0GA 4W68A 3OX8A 5JQHC 3EFDH 2CR6A 3VGFA 4QRTB 3QUXD 3ZKNC 4PG9B 5GS0H 2QHRL 3BHBB 1FG2A 3RIAK 2GY7B 2Z35B 3RGVC 3D2UD 4JGMA 4LCCB 3FB7B 5MENA 2HAZA 5T1DH 2N7AA 4NO2A 5IKCB 1KLUB 2VQ1B 2EDKA 1GGBH 3DO7A 4MCYA 5IR1A 2GFBA 4NFBA 2AAVA 4IMLB 1S9YA 2ICWA 4M7LH 4N9GB 5TE4H 4KROB 2N4IA 4Y19E 1S7XA 4LCWD 4NQTA 1IGJB 5L2KA 2DQDL 4L5FH 3H2WA 3P3YA 1CXFA 3I3DA 5EO9A 4PG2A 2C3XA 1RZ7L 2EYSB 3G5ZA 3EW3B 1BF2A 1R5WB 2LTQC 4LSDA 1DBMH 2B1HL 1ZA3B 1A2YA 3C6SB 4CMMA 3QJFB 3V52L 3VRJB 5AAMA 1SJHB 1JPFA 1AKJD 2EC9T 4MMXC 1GJIA 2R1WB 5D7LD 5CGMA 2R1XB 1UM5H 4I5BA 3K2UL 4NQED 2Q8BH 5D7JC 2D7MA 4TQEL 5GZOC 3FQRB 4K71B 4FG6C 4MVBC 2MMXA 3O8XD 4HWEH 2Y6SC 4OI9A 2Y5TA 5B21A 3AC0A 2R0WL 2DQUH 3Q48A 1L9MA 4RFOL 2WWKT 1AO7E 4OSUL 4GW1A 1BP3B 2DQEL 4LMQI 4Z78A 1D7FA 4MDJB 3H9YA 4HWZA 2XWBA 1KTKE 3BPLC 4WHTB 5E1HB 5INCA 2DJUA 3F7YA 3RVXC 4TVPH 2QTEA 2R29H 2YEZB 1WUNT 1NBVL 2XIDA 4WTZA 4JFDD 3BGFB 3D2UA 4MQ7A 4ZQKB 1SM3H 1VEPA 3BEVA 2EIEA 2K1MA 4I9WD 4I77L 2HJFA 3B9AA 3SKJL 4YFLI 1C5DA 1YNKL 3HR6A 1S3KH 1T3FA 4J3TA 1S9KC 3U83A 1E4KA 3ARGB 1CD0A 2JJTC 4YHZH 1XH3B 1BEYH 4RGNC 3QUZA 2DTML 3KGRA 3LOWA 4QEGA 4WUUD 5EOCJ 1KCSL 1Q9WA 1JRHL 2OMNA 1ETZA 1YC8A 3KR3H 3EYQC 4NZRL 5F44A 1HZHH 3IETA 4KUZH 1NBZA 3F6IA 3RHWK 3O2DA 2UVEA 4U3CA 1EZVX 1J10A 3C5JA 5J12C 1MJJA 5I76B 5TQ0H 1ZGLB 3OXSB 5CKAA 1G6RL 4FQPA 5C0IB 4JPIB 4WUKH 4RGMB 2UUDH 3K0WA 3V6FB 1BF8A 1N26A 4JKPL 3V5DB 1CDYA 4JHWH 1MJ8L 4IS6B 2RJMA 5FKAB 5EH1A 3RBSA 4EDWH 3MNZA 5E00B 5FUOH 3ILPA 5D7IB 1T2XA 1VFBA 1M7IB 4K3EL 4XPHL 1EEUA 2VLJD 4QRQB 3WCYA 2ZOKA 3FO9A 1UB6B 4D2NA 4XBEL 2FSEB 2YBRB 5C7XL 2XWTB 1SY6A 1U8IB 5DHXB 4Z95L 5JUEL 4MA1C 1INEH 2XZCL 5ANME 2Q6WB 5J9PB 3QDGB 4PJAA 4EEEA 5DRNB 4P59H 2DQFA 3HMWL 5EZLA 3O9WA 5EU4B 4HG4K 3GHBL 5DI8B 2BVEA 4UQ3A 1XGRB 2NY7H 4PJDA 1SY6H 3Q6FA 1FFNB 4R4NC 4RGMC 5JOEA 4D0BA 5FGSA 1Z6JT 5CJ5A 1FGVH 1IFHL 2G60L 2WM0A 3JUYA 4HIHA 2EICA 1VGEL 4YZFF 1SM3L 3SKNB 3M8OH 4C56D 1D5ZA 1K8DA 4JJ5B 4U1IA 3LKRB 3DVNA 2VDRH 5EC1B 2EDJA 3NAAL 1OAXH 5HHOE 1OM3H 3A0OA 1DLFL 4ZAKA 2WIIB 1WBYB 4YUEL 3QHFL 2NY0B 4RGNB 3OAZH 5DJ8B 2ADJA 1RFDL 4K3DL 4RMUA 3BOVA 2VAAA 2BNRA 1HHKA 1TFHA 4HZLA 4PG2C 2VAAB 3NCJL 4D8PA 5MP6L 3MV9D 5CJOL 1F4YH 3EHBC 4YHZL 3BPOC 43C9A 1WZ1L 1XF1A 5TGBB 4KY1L 1B2WH 3SKJH 5HVGB 1NAMA 4G9FD 3C08L 3LZFL 1H5BB 2NR6D 5FDWB 3LCYA 3UXFA 2XKSA 2IADA 1A3RL 4D0BB 5ANMA 3EAKA 3HCVB 2R39A 1BJMA 5C0GA 2QSQA 5D7JB 2V2WA 4OD1L 5DQJA 5DC4B 4OZ4A 5E99L 4P2QD 4QCIB 3GJEB 5I8KL 2R2CA 2ENYA 1ZMYA 1W0YT 1W0WB 3L3DB 4A6YA 3MXVL 5DDHA 3X12B 2X42A 1XR8A 1RK0A 2J88L 4HDIA 3ULSB 1RZ8A 3CIQA 3VXSD 1A8JH 1NSNH 1NEZA 1F3JB 4L4TE 4S11A 2AKRA 3WNLA 2IG2L 5EZJA 4TTGA 4F33A 3RPIA 1F45A 3CDCA 2B1AH 2DI7A 3ET9F 5DD5L 2PKDA 4H0IA 4OZGA 3BAEH 5FK9B 1X5ZA 2D31B 3SDCA 2DQUL 5D6CA 1B0RA 2FHCA 4U05A 5B39A 2BNQD 2OYPA 1F8TH 4KDTC 3QHZL 3ARTA 5B22A 1BD2D 1OP5H 1C16B 1HE7A 1KIPA 2FH6A 4M8QA 2C4XA 1PDKA 2ZG2A 4PJBE 4JZJA 3T2QA 4U6TA 1S7QB 4FQ1L 2SEBB 5HHOD 4LFHD 2H45A 5C09A 4FQQB 1S9WA 4R7NA 4UIKH 2ESVB 4LGRB 3DXAB 2ZPKL 2KDGA 2ESVA 4R7DB 1LD9B 1I3UA 4WEBL 3I3EA 3LS5H 5JQ6L 3TJHC 2QADD 4KDTA 3QIWC 3FRUB 3ABZA 4ONOA 3QUKA 2JELH 4OCLC 2OR9H 3PV6B 4MZ3A 3KPQA 3SY0A 1YUHB 2DYPA 3MUGA 4WI2A 1OPGL 3VWKB 5C6TH 1AXIB 5HHPA 5BQ7B 2Q3AA 1G7IB 2D03L 3HG1D 4MAUH 1VERA 2WBKA 4EI5A 5K9OA 1U8OA 3M17B 3JWDC 4IDJH 4HAGA 2XKNB 2CDGA 1MIMH 3KYKL 4MDJA 2Z31D 3WFZA 2IH1A 3FQWA 3RVVD 4JRXD 5CWSA 3QZWA 4BSJA 4CVUA 4U1GC 3OAYK 2NX5B 3G6JB 2FZ3A 4OZFA 4U7SA 5FAAA 2B4CH 3LKOA 1QSVA 1I9IL 1W72L 1QYGL 2W1NA 4KQ3L 1KJVA 2HA1A 5DXWA 5F3BB 4G6KL 1I1AC 4LSUL 5L8JB 5C0GB 3E6FA 2YSSA 2DIAA 1NCBH 1HKLH 1NGXA 4UNTA 5D4QA 3FFCB 4MA3A 2IADB 3C60A 1W0WA 2P5EB 3L3DA 4R9HA 4S1QH 5FKAA 1UACH 2VDMH 1MI5E 4PV9B 2EECA 3EUUA 5JORA 3UO1H 2FD6H 3RPKA 3U0TB 4M62L 2FCBA 1T22A 1ZT4A 3EGSA 3KYOA 1HHGA 3OR6B 5HGAB 1WK0A 43C9B 1N4XH 3FFCD 3FQUA 1FN4A 1H3WM 4IMLA 1BIIB 1IKFH 2EYTA 2P43B 3BZDA 2R69L 1SEQL 4Q9QL 1VFUA 4G6MH 2NPLX 4LLUB 1CT8A 2PR4L 3HFML 3N1PC 5GRJL 3KDMA 3NA9L 1XGYL 3UTOA 3RA7L 2V17L 3DURA 2H3NA 4NNXB 3TIEA 1QSFD 3H0TA 2PO6A 5KSAB 1I1FB 1MRCL 5SWZD 4U1MB 2VH5L 5D2NE 5JW4Q 2NY4C 3RZCC 1UEMA 1MVUB 5GIRA 1IT9L 1P6FA 2BVOB 3P4NA 4XMKL 1JN6A 2V9TA 1JYVA 2IQAB 4X7SL 2EEAA 3GM0A 3T1FA 4K2UL 1CZ8H 3L3KB 1FQ9C 4K7PY 4FG6D 4JQXA 1MCCA 5D1XC 4UBDD 2HVKB 1QRNE 3UTTA 3UP1A 1A6VH 4I13B 3GI8H 3SE4C 1DN2A 2AABL 4PREA 4OLZL 1CDCA 5HI3C 3I3BA 1QLRA 4OKVA 3GRWA 3DARA 4XC1H 4XNQA 1NAMB 4NFDA 1UZ8A 2Z93A 4NJAH 3VGDA 5GJTL 1AD0A 4BQBA 3VD4A 1C5DB 1RJCA 3KYMB 5E2JA 1H0DA 2VITB 4WFEE 5E8NB 2BVYA 5DO2C 1U91B 3P4MB 1YC7A 1I85C 4OUUB 4P2RB 1LDSA 4LKCA 1E4KC 3S34H 4HUUB 2PXYC 2VDML 3VFRA 3SE3C 5INCB 5CZXD 4OI8A 3MX0A 2NR6C 2VZOA 1N6QH 3D18B 3QWQB 3DV6A 3AM8A 4ZNEE 3QEHB 3FO1B 4CU8A 4X5WA 5CBAB 3ME0A 2FHFA 2ATKA 1I1YA 4JZOA 5JPMA 1KG0A 4ZYKB 4BKLA 3AMKA 3HE7A 5F89B 1Z2KA 3DX7B 4F7PA 3LN5B 1OB1B 1INDH 4JO2L 1J0ZA 1HHGB 1T66C 1FL6A 4HKBB 3TPKA 3W5MA 1FFNA 3PF2A 4JPKH 3QUYA 5HGDA 2ZCHL 2CUMA 3OKEA 4AEIL 3KYNB 4NQSA 4FHBD 3VFUB 1A5FL 5EU3A 1FIGH 3VA6A 2HT4C 4X6CF 5BS0E 1FO0B 5DLMH 3CVHH 3WFBL 1XGYH 1P7QD 1FO0A 3G5YB 1IM3B 4D9RE 3O6FA 3TYFA 3UYOD 2AXHA 1NUNB 5SWSA 2X2YA 3WNKA 4ONFL 4LLUA 2FECL 3QXDA 3OGOE 4KRNA 5IHBA 5J3HD 4MHHI 4PTTA 3ZLQC 4KVNL 4I0PC 2R1YB 2CLRA 1IAKB 1F13A 2LABA 5C08D 3TJHD 5KTEH 3QNZB 3NA4A 3WIHH 1K85A 4ZUUB 3QNZA 1BFVL 3ARQA 1ORSA 3MNVB 2Y7QB 3QFJD 3LDBB 1X44A 1IAIM 1OD7A 4GG6F 2EDHA 3DMMA 5FO8A 1G7QA 1YQVL 4RISH 3WE6A 1SVCP 3OG6B 2BHYA 2J4WH 4Z0XB 5T5NG 1G6RA 4WIQA 3QJHA 4AM0B 3CDFA 2YPVL 3BQUC 4WW2B 1FORL 1AD0B 5GHWL 4ZODA 1BLNB 4MVBD 5EU3B 3CDGA 3U1SH 3BDYL 3LAFA 3H3PH 1J11A 2ZUWA 5SWSD 1LHZA 3RKDC 1BVLB 5C0CB 1QLRB 1DBKH 5T3XD 1AXSB 3B3IB 1P7QA 1TQCB 3FN9A 2A73B 1RUAH 3W0WD 2CO7B 1FNSL 5JIPA 2V7NB 2XFXA 2WUCL 2A1WL 2VXTH 3V5HA 1L0XA 4JFOA 4BKLB 3L7FA 2YPKB 1Z9LA 3CH8A 5IVNA 5FUCC 5LQBH 3OKMB 4KTEL 4U6HA 1U8PB 3L5WA 4CJ0A 5DUPL 1MFAL 2X89D 4B0MM 3WFBH 4HJGA 5F7MC 4A2MA 2XTJB 3U30B 4X4YA 5JPNB 4GRLD 4YJZL 2XTJE 4F2MA 4Z77A 3FT2A 1MJ8H 4U3HA 1CXHA 4XX1G 5DMYA 5I1KH 2AI0H 3NH7H 3FB8A 4UAOC 3MGOB 5E2TH 2FLBT 3JSSA 2VQ1A 3OB0H 1UQSA 3VFPB 1H3TA 2DMKA 3I75A 4F7PB 5MENB 3G5YA 1FN4B 3MOAH 5ID1A 1OCWL 4HUVA 1OP5K 2JJSA 3S5LB 1MF2L 2NTFA 5FGCE 1A4JA 1QG3A 3S35H 4HS3A 2CKBA 4OLVL 4V1DE 3SDCB 1FVCA 2MNUA 4GMSL 3IDYC 4HQQL 4ZXBC 3AROA 2W60A 4EBQH 4NRZB 4JVWA 2F8XC 1A6TA 4BQCA 3WEXB 3SEPA 3S36X 5JZ7C 1QEWA 2DM4A 1WVZA 3P4LA 1N59B 1NANH 1ZHLB 4NQXA 4X7TA 2NY5H 1NEZB 1FAIL 4RAVB 5TGBA 3UYRL 3GSNB 4Q74A 1TDQA 3MOQA 3GZKA 3M8OL 3OHXA 3SKOB 1OGAD 1CLOH 3RQ3A 1P4IH 5F7HA 3DHMA 5GGTH 1DBAL 4UT6H 2FX8H 4ORGA 5B8CA 3T65B 4OCRH 2NY3C 5EFIA 5LGHL 2PO6B 3KS0H 4KTDL 3C8KB 5DGRA 1EZVY 1JCKA 3HB3C 4KRMB 5DJ6B 3GBMH 1LO0H 3WUWB 4LVNB 3BDBA 5EN2B 5E8NA 3QFJE 1EXUB 3TA3C 2B4CC 5J12B 2GUOB 3PWLB 4D0DB 2DLGA 5A2KH 3EYUH 3NFNA 2XQYG 4PJXB 5LGJB 3SGJA 2HMID 4DQOL 3WIFA 1MFBL 1ZHNA 5C6PB 3S4SA 3L3IA 5JA8B 3MRBA 3LSOA 2DYPB 5ITBH 2PW1A 4HJJH 1GGUA 3D25A 4F7TA 4JRYA 1RJZB 2VL5B 4MX7B 5GQBA 5C70A 3SE3A 3OKLA 4GS7B 3RX8A 3QXVA 1HQ4B 1Q0YH 4JKPH 2YWZA 5C0AB 4OF3A 2D9QB 5F6HI 2ZG1A 2ZSVA 3ARSA 3VFNB 3LRGA 5FYKE 2P46B 4LPXA 2W9EH 3QRFM 2D0FA 1LEIA 3RIAF 5IIEA 3MYJA 4MXQD 1G7JB 4Y16C 2A77H 3K7UA 1QSEE 4MNQB 1T22B 3RWFA 3DPBA 1MWAA 3GSXB 3Q5TA 3HHRB 1BFOB 5IROC 2AJUH 3RWHA 3MXVH 5DEGB 5IB5A 4HIXH 4PV9A 1MLCA 5BZDB 5EZOL 4K71C 1RPQA 3BP5A 5C2BH 4E41B 2DLHA 3BYTA 5HGAA 3FT2B 4QHMA 5CS7A 2EDTA 2IAMD 2ZCLL 4MNHB 3SE9H 4O51B 4EBQL 1URLA 1U41A 1B6UA 2E7HA 3GNMH 3LN9A 4RFEA 5DJAA 4PJAB 4WTZG 4RA3A 3A6BH 5DHYB 5MENE 2Q6WA 5B4MC 5ESVB 5DO2D 1ZVSB 5EU5A 4ZTPL 3WJJA 4WFED 4JFYA 4AEHL 3QG6B 2MCPL 2A6DB 2NY6D 1R3KA 1TTGA 4PB9H 3BRFA 4MA8L 2UYLA 3V6OE 1EBPA 1ZEAL 3U7WH 1DQJA 5HPMB 2HTLD 2AXJA 1NMAH 1HKLL 4BELD 1I1AA 3VXMB 2ZKHH 1A9BB 3MRFA 1LO0L 3LQZA 3Q5YA 5CEZH 3AREA 2NNAA 4M00A 1WWWX 3D39B 3U0PB 3CZFB 1YUHA 3IGAA 4JFZH 4PJXA 1XGUB 2NY1C 2J6EL 2I25N 4DN3L 2A73A 5HY9B 1I8KB 4PBWD 1I7RB 4QXUL 4Z7VA 1BD2A 2YKLH 4M5ZH 4NZUL 1F3JA 2VC2H 4K8RL 2BNQA 5J6GA 3MRRB 1MPAH 3D39D 2GSGB 3QA3A 1XEDA 3B8YA 1FFPA 4QHNA 5D6DA 2JJTA 3QUKB 4YDJA 1Q94A 4NP4L 3IU4L 3VMOA 3O4LE 4LU5L 2Q7NA 2IBBA 2IAND 3MRJB 5HI5D 1BVZA 1IKFL 5ISZD 4U7KA 2YUWA 1GL4B 4Y0GA 3VJ6A 3CSYA 3U4EA 1TZHB 2CJUL 5I1AA 1I8MB 4Y4KD 5DYOA 5IW6A 2AJXL 4YWGL 1U8NA 1LMKA 2GHWB 1WBXB 3V4VH 2XY2A 2A74B 4ZFOB 2XY1A 1CDHA 4PJ7B 1FAKT 4PPTA 5CP7B 3TLRA 4HBCH 3BEWA 4FQIH 3TP4A 2ADFL 1VADB 3O6LH 1B88A 1CFQA 3B2UC 2H2SD 5K93A 2PTVA 2RFXA 1IM9B 3HZKB 2YZ8A 4PR5A 4R4ND 4G9FA 2FSEA 4P49A 5IWLA 3QI9A 2AKRB 3RI5K 2QQLH 4MXWL 3CSGA 5BXFA 3RVUC 1TQBC 1N8ZA 1A6UH 3AY4A 1MCJA 5F7EH 4NKOA 1FSKB 4NT6B 1EGJH 1ZA6A 4NYLB 1ED3B 3TBTA 4FXGA 4I77H 1S7RB 1UZ6E 1A1MA 3NCYS 2YXFA 5FO9B 5JOPD 1SBSL 2QQKH 3OWEA 1WZKA 4Z0BH 2X7LB 2ARJQ 1T2JA 1NBVH 1NCUA 2DWEB 1KB5H 1A7NL 2C1PB 1ZTXL 1YY8A 2VDQH 2H41A 3K4DA 4KAQH 3WLWD 4JY4B 4GKOA 3ES6B 1DZBA 3VWJB 1RJLB 1MCIA 1J5OH 3RGVA 1U2CA 3HPLA 2XPGB 2VYRE 3BN3B 1YMMA 3H7BB 3MMEB 3QSKB 3SDDC 4G9DA 2NW3A 5BRZE 4WI6A 4ZQKA 4F9PA 4GAGL 4OCXL 4R90L 5D2NB 4YX2L 2FRGP 4I3SH 4P2CG 4PRPD 4P2OC 3TN0D 3ZDXF 4P4RB 4KKAD 2F54A 1S7SB 5JO5A 1M05A 4V1DD 4AENB 4TSBH 4RWYH 2QHLA 2VLJA 1KLGB 3DHJA 5I1IL 2HVJB 4QLRA 1KB5B 3GBML 5IVZA 3P77B 1V05A 4MS8D 2JK5A 4LCWB 3O41A 2VLLB 4N0FA 1FNGA 1U92B 1QO3B 3QPXL 4FOMA 4RAHA 5LGKA 2H2PD 3PWPB 4G5ZL 1DEDA 2D0HA 3GSQB 3B9KA 1A4KA 3FB8B 4Y5XB 2K7PA 3SCMC 3GNML 4G3YL 4PGBB 1C8PA 4YHNA 1VADA 5FM4A 4IBLT 1EHLL 2P5WD 4P5KB 3HA0A 3FMGL 3BEWB 3W0WA 5I71B 2P5EE 1WJ3A 3N50A 4DUVA 4D3CH 3VRLF 1X6LA 2P4AB 5KVFH 1YMHA 4M7LT 1EEZB 3HMWH 3INUH 3JV4A 5BW7C 4LCUA 4FFWD 1T1ZA 3GHBH 3TO2A 5KG9A 4QRQA 2ITDB 3SGJC 3C5JB 2J4WL 5MEOB 4GT7A 5DK3A 3TYGH 2YD4A 5EBWB 4BYHA 1DR9A 3MLUH 1J9CT 4UIMA 5CEZL 3I02A 4MYWB 1A7PH 2V2TA 4Z7WB 3U0TA 4OT1H 3WKMH 5I18L 2R0LL 1K4CB 2EYRB 4JVPA 1QKZL 5MEPB 4O4YH 5D2LA 3VXUA 3QWRD 4AMKL 1O5DT 1NJ9A 5I15H 2F9BT 3AB0B 1P69B 1GGYA 4J3UA 4JEGB 2AJ3A 4XHJC 4GUPA 2JCCA 4UDTA 3NIGE 2BNRE 4MNGE 5L2JA 3HPJB 3O3BB 3NGBC 2A9NL 5BS0B 4JQXC 2W38A 3SDDD 3FKUS 4L1HA 1IGML 4JKWA 3NAAH 3QQ9D 1MY5A 3GGWA 5DSCA 3ARGA 2AGJH 3DYOA 4F37K 4XZUA 3MNVA 1MCQA 4X99B 3GMOA 1AKJA 3B43A 3D69B 1A64A 1HHIA 2HJFB 3O6FD 4S1SH 4CRPA 3UTTB 1YYML 3HRZA 4LCUB 2G5RA 1E4XH 1NGQH 3EYFB 4IMKA 5GSVB 2A83A 3NBNA 5KSUA 2OZ4L 3SKMB 1R24B 4KVCL 3QFDB 5IR1B 1LK2B 4GKNB 1IC5H 2AXGB 2BDNH 3QUYD 4NDMB 4WEUD 1CIUA 3KPRD 4XHQA 4F7CB 5C9KA 4TNVK 3SGEI 1QR1B 1I85A 3D3VB 3FB6A 1OGTB 3WL9B 5E99H 1FYTA 3LIZL 5L9DH 1LILA 3ZE1E 1UZ6F 4LLYA 1AE6H 1C7SA 2A6JA 5KN5B 5DS8A 5F9WB 4NCC2 2AEQH 4CVWA 4L4TA 1BOGB 1BFSA 3GSOB 1IM9A 4PR5B 2HTLC 4U6VL 5IVOA 1EH9A 2BJML 3CPLB 1R5IA 4WEBH 1AIFB 5HJ3A 5T1KD 4HXAH 5T5FL 5E5MB 1S7QA 3DX7A 1A6AA 1NCAH 1QTYT 3KWWB 1BFOA 3RWHB 1KIUA 2DD8L 1JPSL 1DSFH 4NKMA 4QRPA 1MFCL 3RKDD 2ATKB 4U1KB 4OZFH 3HC0A 2B5IC 4C57C 4KHXL 1IGJA 3L6FB 2Y36H 4OQ1A 2AK1L 3NPSC 2LV4A 2GFBB 4J7RA 3AY4C 2NXZB 3V7AE 1ZOXA 1AGBA 1J0YA 4X9BA 1WV7T 5F7WC 3QO0B 5J13C 4HX1B 1Y0LA 5CBEA 4ZNCD 4WU7B 3TO4A 5ICZA 2ADGB 5IJVB 3MRRA 1JZ8A 3KXFB 1HNFA 1BQHB 3ECBA 2V5SA 4EN3A 2CDEA 3QZWB 3O3AB 4WFHD 4QXTA 1U8LA 3BXNA 4Y4KC 3S96A 4PRIA 3IAQA 1JP5A 5D96C 3FQTA 5DVLA 2X4UB 2D7TH 1KULA 3JVGA 2G75A 1EHNA 3IDMA 1FYTE 3FCTA 1RVFL 5FM5M 5I1HL 4MXVF 1CL7I 3L3KA 3A6CL 1JPGB 2BNRB 2GI7A 1PJ9A 3GHEL 4QOKB 1U95A 2EDOA 5CMAB 4FABH 4L9DA 1QR4A 3GDBA 5E1AB 1UH4A 4E41D 3QPQD 1TVBB 4QHKI 3QH3B 4EQ3A 1JZ6A 3LH2L 1K9TA 2XA3A 4UUJA 3IRPX 3PNWA 3ARPA 3A67L 5E8EA 2PW2B 2AW2A 2Y6SD 3V7MA 1S8DB 4P4KD 3PHQA 2QSVA 3LEXB 3BP7B 4MA8H 1VFMA 2ZUUA 2GJZA 1OOAA 2AJZB 5DK0A 4YPJA 3MLTA 4YIQB 3FQUB 1GZPB 2P7TA 4Y5VB 4P5MB 2APWA 3G5XB 1I4FB 3LD8C 5F7UA 1I9IH 1W72H 1CFNB 5HHXH 3VGHA 1DANU 1F4XH 3BYYA 4KXZH 3DSFL 3UO1L 4H20L 4JY5H 4K2UH 5L88L 1MI5D 4JN2B 4HBQA 5JW5B 1MAJA 3QDGD 3EKCA 4NNYB 4MLIA 1QA9A 1A6PA 4NN6B 4XGZA 3VXUE 2YBRA 2RCSH 4UQ3B 3S8WA 3WKML 3ZKMD 3ZDXE 1S5HA 5FGBC 2HFFA 4AEEA 3FT3A 2HLAB 3F7VB 3VFWA 1H15B 1JZ5A 1QHOA 2W9DH 5H94B 2Y9RT 3V5DA 4XPBL 4PJAE 1X6NA 4X0KA 3RDTA 2ZOLA 1D9KB 1F90H 5E6IA 2G9HA 1IAIH 1N64H 1S7TA 1A6VL 4JFEE 1YN7B 5K9JL 5IVXE 3MNZB 5E00A 5C2BL 3FONB 1YMHB 4OBRA 1JPTH 1UC6A 4YC2C 3VD9A 4I48B 1DE4B 3QDJA 5BVPL 5MP6H 3D0VB 3L3IB 4D94A 3VXME 2IFFH 5IBUB 4BSWB 3R1GL 4HXBL 3S7GA 4JFPA 1SQ2N 4WHYG 1R3KB 5IFJB 2NY4D 3RZCA 2Z31B 4KGJA 1I1CA 2PETA 4DQOH 2WP3T 3AFLA 3IFOA 1NBZB 2UZXB 4QHUB 5FM8A 1P5UA 1F3DJ 1M6OA 1HWGB 1RSFA 3Q1SH 4PRAB 1J8HB 3SBWA 5CEZD 4PRIE 5KJRL 1OLLA 4ODHH 4L4VE 1CIDA 2D0GA 3HAEB 1N6QL 2OK0H 5MEQA 4DGVH 3OKDB 1KIQA 5MI0B 2GY5A 4MD5A 5HXMA 1N7ML 2E9JA 3DVFA 1BEYL 3MV7E 5GGRA 4FQXB 4WCYL 4I1NB 1DL7H 4PJGF 2EDNA 4B50A 2VLRE 4XNXH 1XMWA 5L88H 1UB5A 2FHBA 5GGQH 3MGTB 2XPGA 3H7BA 3MMEA 3DUSB 3O8XC 4JFQB 4CDHA 2ILLA 3DRTA 1ZV5A 3BE1L 4ZPTB 3UC0H 3QDGE 4OLEA 3ZT7A 1QBLL 1DVFB 2H2SC 2CKBB 4GKZB 3E3QE 1PSKL 3RPIB 3RUGB 5D93B 2NYYD 2EDQA 1FNEA 3FOMA 1K5NA 1MLBA 3MLRL 4YHIA 1XR8B 4L9LB 5CZXC 1S5HB 3TA3B 2Y07L 5ACLA 1QBBA 3IDMB 2OL3A 4KI5E 2F19H 3ARBB 4WV1B 3MRCB 3REWB 1A1MB 1QA9B 3GK8H 5ICXB 2R1WA 4R96A 4DKAA 2PYEE 5TDPB 3RIFK 1E4WL 1U3JA 5D1ZC 3G6JE 1RZFL 1S7VA 3E6HA 4BUHA 3RWIA 1LGVA 5HHOB 3VFTA 3VGAB 2X9XA 3QHTC 2HYMA 4MWFA 5ERWB 1RFDH 5TQ2L 4E41E 5DURB 2ITCA 4YDVA 1UKQA 3LZFH 1UWXK 5IVXF 5SV4A 4XNZB 3RVWC 3WFEL 2BNUA 4UILL 1T7XA 4PD4J 2ZUVA 5D1ZD 2G5BB 5LWYH 5B39G 5E6IB 5DK2B 1A9EB 5JHLH 4FQJL 3I85A 3V5KB 4M4RA 5ICZB 4YHYC 4FTVD 4HHAB 5J56B 3LH2H 3MV9E 4MCYB 5TE6H 3MZTA 1K6QL 3C09C 3EOYG 2ICEB 3BW9A 4C56A 3RVTC 3SDAD 1K5NB 1F11B 3FOMB 3M45A 2IPTH 4XI5D 1KEGL 1YA5A 4JM2D 1UCBH 3T0ED 2DLTA 4NHUB 1XF3B 4XNZC 5I8OL 2R2HB 5C0FA 4Q0XH 4ZFZB 1LO4L 4FTVB 3MA7B 4P2RD 5TF1H 3FAWA 1CFTB 4U1IB 3PQYA 1QD0A 1KT2B 4PGZA 5AG9A 1ZVYA 4U3XA 4NP4H 1AHWB 3U9PL 5DQDH 2WIMA 4HIJA 1SEBA 2VIRB 4U7MA 4YEFA 3ZYZA 5KZCB 4PTUB 3MOAL 2RCSL 5LGHH 3MRIB 2QQNH 3WLBB 1G9ML 4I18B 3OXRB 1JGUL 3BJ91 3T4YA 1X5LA 4GRWF 4YBQD 3TBWA 1TQCC 1MCRA 2EDBA 1B0WA 5D93C 2RB8A 4BH7B 3GIZL 3TNNA 3C5SA 1N5YH 3QUZC 1BWMA 3TBYB 4NQDE 5F1IB 4U4BA 4JCMA 4M61A 1JYXA 4J8RA 3MRHA 4CW1A 3DXAE 1J88A 3H8NA 4QRPE 4YR6A 2OI9B 3WFHB 4OIIH 4JDZB 3I50H 4WJ5A 4OIAA 1XF5A 4XPGL 4R4FL 2EYSA 2R8SH 5KSUB 5FO7A 4RBPK 3KNBB 2ZUSA 5CP3A 4ZOAA 2Y07H 1S7TB 5TDNA 2DDQH 3LN5A 1T5XB 1RJYA 2AI0L 3P11L 4HF5L 1NL0L 1LVEA 1CE6B 4OZHF 1FCGA 2WQ8A 4J1UB 4ODTL 4WDIA 4NKQB 2WMPA 4HKZB 3S35X 1OSZA 3N85H 4PD4K 5CEYA 5DRWA 1WISA 2C3HA 4EN3C 3VE0B 4NM4H 1BGXL 1XIWA 4IOSD 1CICA 5CSZA 2R0WH 3LIZH 3TC9A 5I1DB 3MJ7A 5ISZE 3AGVA 4LSPL 4WV1C 4OCRL 4NRXB 2LQRA 3GO1L 5HHMB 4AMKH 1T1ZB 3TO2B 3O4OC 4L9LC 1ZGLM 3HRPA 3X3FH 4K7PL 3D2UB 4JFDE 3ULVC 1IEHA 4FQJH 2BOBB 1GRWA 2F5BH 3QRGL 2DQJH 3T08A 3CDYA 2VLKD 3E1F1 4FQCL 5C0RL 1NGPL 4TPRL 1J1OL 3V8OA 2HLFC 2KZWA 4KRPD 1HIMH 2VQUA 3PHOB 1HQRB 3TBSB 1JL8A 2X05A 1MREH 3QCVH 5CJ8A 4PGBA 3O8XB 3KPPB 4DCQB 1FLRH 3OZ9H 3RP1A 3C6LC 3VFNA 1L0QA 5IGXL 1MVFA 1DP0A 2DQDH 5T1LD 1OTSC 1HOCA 2AQ3A 2GITB 2DQHH 7CGTA 3ZHKA 3RAJH 1G9NH 4OZIB 1B3JA 4F7MA 3MRNB 1DEEB 3MUHL 12E8H 5CMAA 4GSDH 2F19L 2E27H 5DHVB 5HDLA 3QG7H 5TF0A 3AS0A 3Q5OA 3ZTNH 4KZDH 4W6XB 5D2NA 1NAML 4YEEA 4UTBL 3WFHA 1XF4B 3ARDA 5TQ0L 2BMKB 2HVJA 1UG9A 5MEND 5CGTA 5ALBL 1PG7X 1HI6A 4LCWE 1KLGA 4ORZC 2DOCA 4J4PD 4BH7A 4KMQA 4DKEL 3K2MC 4HKXA 1K4DB 3N1MC 2VXQH 5I1JH 2AJVL 4Z76A 4P5KA 1JWMA 1P2CA 1KXVC 4M1GH 3SDDB 1J05A 4LLQB 4GLRI 1RURL 5HYJD 2E7CA 4NC2B 5GS0D 1NGXB 5TE6L 2YD3A 4H88H 4XP5L 3RGHA 4QXUH 1CICB 5E70A 1KNOA 5IB4A 3RA7H 3HB3D 3T8XA 1NMBL 1RIUH 3TT1L 4PYGA 1KTDA 4X6EA 2XNAA 1KYOK 5BXFB 4JFZL 4RNRB 3V6ZB 3B9VA 5DD6B 3IFNH 4YAQA 5ECJE 3QCTH 5TPWH 3H42H 3MRHB 4KHXH 4NQVA 3BW9B 3MODL 2DL9A 5HYFA 1F4WL 1GC1H 2XACC 3M17A 4R6UA 2NYYC 1ADQL 3VFMA 3LD8B 2YXMA 1K3IA 5D7SH 3W81A 5C0FB 2I60H 4Y5VC 3WXWL 4U1MA 1YNKH 1WWCA 5F1SA 5DD0L 4YHLH 3FB6B 5EOCH 5JMOC 3RWDA 4KDVA 2VDPL 5TH2B 2H3NB 4QOKE 2CGRH 1UVQA 1Y6KR 4G7YL 4GKZA 5IOPB 5GRUH 4WDIB 3KR3L 2ADFH 4RMSA 3JWNC 2A6IA 4M02A 3LEYH 4LLWB 5EO1A 4AIXA 5DA4A 1K6QH 5CUSL 4Y8AA 3MZGB 1MRDL 1HHJA 3GMOB 4YHML 4RA0C 5F9WC 3QIUB 4QO1A 3D6GA 2Z8SA 4QHNB 4BFIA 4JPWL 4LSVL 4OZIE 1LE9B 2H32H 2FGWL 1QFHA 2ICWI 4NO0A 2VDNL 2YPLE 1RZJH 1TZGL 2FIKA 3MA9H 3EHBD 3HLAB 4N8CH 1NFIB 2V7HA 2X4NB 2XWJA 5KSVB 2H9GB 2QQLL 3PWUA 4RGOL 4UOW0 4MD4A 3X11B 4QTHB 1MREL 3IDXL 4TNVF 3WIHL 3O11B 3JV5A 3QXWA 1F42A 3QA3B 3G6JA 4OD2B 1IMHC 5EC2B 2EC9U 4MNGA 3FHAA 3QIWB 4K7PH 3PGCB 4N68A 4PGDA 5DDHB 3X12A 2ZSWB 3JWDH 2VC2L 1U58B 3O4LD 4M3JA 3OG4B 2N7BA 2FJFB 3KLSA 1BFTA 3HUJA 4MA7L 4JANB 5EBLA 3IS0X 1K3ZA 1ZLSH 1JK8B 4S0TD 3CSYB 3SDXE 5ICXA 2G9HB 4EUPB 5BMFL 3N1FC 5ID0A 3U9UB 1I7ZB 2W0PA 4JFEB 5F88A 4ONHB 3TA3A 4FP8L 3MRFB 1EBAA 1QRNA 1ETZB 4XBGB 4QYOA 1WFNA 4OCWL 4TOYL 4NN5B 1U8HA 3ARRA 5I1CL 3BWUC 4OLUL 5TDOB 3LRSB 3KLHC 4WCYH 3L3JA 5IW1B 1RUAL 4KRPC 2ZPKH 4Q6IB 1EGJL 5A2FA 4Y4HA 5CHNB 3VXNA 2MQ3A 1KN2L 1YEFH 4DN4H 3NFSL 3KLDA 5KW9H 3O0RL 3BEVB 1M71B 4GBXC 4P2QB 3IAGC 4LF3B 1J8HE 3U4BH 3V4PL 2P47B 1F2QA 2IGFH 4GMSH 4HQQH 5BOPA 4MNHA 4N0RA 4XP9H 1G7PB 3VMNA 4MJ5B 2VLKE 4P5MA 5D1QB 4JN1H 4EUPH 1RZKL 1UYWL 5DJDB 3OPZL 4LRIA 1C5CL 4MMZC 2W65A 4QTIL 3CXHK 5D7IE 5MERB 5ESAB 1AO7A 1ZHKA 2HLAA 1KENH 1J8HA 5I1IH 4OTXL 5CGYD 3T77A 2DQJL 4QRSA 3IFOB 3ZT6A 1KXTB 1JTPA 4PJ9A 1IC7L 3ARUA 3RWFB 5DT1H 2BVUA 3PWVA 2F58H 2MFNA 3MBEC 4PJ9B 3G08A 4IIQA 3S88H 4OFVA 4K55A 1U42A 5IVXA 5GS1B 3MFGB 2VDLH 4UI2A 4GXVL 3WHE1 3MRMB 3BIAX 4U1NA 4KKBC 3GIVA 3BPOB 2OJZL 1WC7B 1YEGL 2UUDK 4XPAH 3MJ9H 5HSFA 1J86A 3P4OB 2I9LA 1DQDH 1T83C 5D70L 2ZOKB 3FO9B 1N2RA 1OAZH 3KAAA 1LO4H 2LAGB 3FZUD 5LXGH 2C3VA 1F4WH 1ZS8A 4APQD 3S3PA 2JIXB 1AD9B 4HIEB 4NO3A 4G8FB 5DZLA 1RIVH 5IG7A 3DUUB 5EU6D 3G5XA 1KEMH 3UMTA 1Z0NA 5DMJB 2OLDA 1H15A 3FOLA 1FJ1B 3HG1B 2P5ED 4WVRA 2HFFB 1UXWB 2FBOJ 1QFUL 5K9KA 4LSSH 4GBXD 3Q0HA 2A6DA 3MFFA 1CT8B 4XGZB 1FO0L 5J1SC 3ALWA 2XA8H 3U9UA 1AHWC 3WS6C 5DD1H 1BJ8A 3V0WH 1VESA 5DJAB 1DFBL 5E6ZA 4AIOA 5C86A 1DLHB 3L3JB 5JIIA 3ZHDA 3MNWA 3S97C 1U8HB 1WBXA 4M48H 3DX9B 2NW2B 2RAMA 1DBBH 1H3GA 4PJIA 4KKCD 1BJ1H 3KYAA 3LKNB 3BP7A 4BZ2H 3LEXA 1QBML 4ZSOB 5CUSH 2D03H 4MAUL 1S9VA 1MNUH 1PYWB 3Q6FB 5F7LB 3F12B 3T04D 5DMIH 4YQXL 4YHPA 4FFVC 3A6BL 2ARJA 5HBBA 1BQHA 4IHOA 4HUKB 1CDUA 5LVEA 4NWUL 3MYJB 4M1DH 1I8IA 3NIGF 5DWUL 3ZTJH 2GSIB 2R23B 2A0LC 1LE9A 4KI5C 4R3SA 4YPGA 4ZO9A 4JDVA 4OZHA 3C8DA 4KJPC 5L8LB 2VB5A 1LP9E 2VO5A 3O81A 4PJ5B 3VXQA 2EIZA 4EXPX 4OGZA 4QHLB 2A9MH 5D1ZB 1R3JB 4ODVL 1YPZE 4YFLF 3VWKA 2A0LD 1SY6L 3WIFB 5JA9A 3QNYB 1NC4D 3CDGB 5BZWA 4AYFA 2XKUA 4JDZA 4WJ5B 5J1TC 4FZ8L 5DHVA 1WTLA 1HILB 1KTDB 3BGFC 1I3VA 1P4BL 1NGYA 2PYED 1MQ8A 3RUGE 4CJ1A 2AGJL 4KQ4L 5F72S 3P9MB 3I6LE 3TVMB 4JM2B 1RUKH 4UDUA 1Q9WB 5E2VH 3CFEB 5FECB 4JPKL 3WMSA 1BX2A 1HNGA 1JF6A 1C5BL 1T1YB 1PG7W 3W0WE 1NUDA 4MAYA 3SOBL 5DJ2A 2DI8A 3DTXA 4J6RH 4JR9H 4LHUB 3CMOL 3EDJA 2PYEB 3T0VA 3PL6C 1LEKB 5IFAL 5DC0A 5DJZA 3V52H 4FQXC 2R4RL 3IKKA 2CJUH 4YK4B 5DD6A 4X80H 3BHBA 1UWEH 5D7IF 5DUPH 1EAPB 4LL9A 2VDQL 3BKYL 2X4RB 4KAQL 1Z5LB 3CK0H 1J1XH 1V7MH 5F71A 3TWCH 5GRVK 4M7ZC 3V7AG 4GAYB 3MV7D 3HC4L 4IOIA 1KNOB 5FCSH 3UZEA 4GW1B 4Z78B 4QXTB 3UX9B 4ODTH 3MLSH 4B7IA 2D7OA 1OAYH 4HDIB 4HFUH 5D2LE 5C07D 1HEZA 4W4OC 1Y0LB 1HSBA 4XVJL 4XMPH 2CDFA 1OARH 4M7JL 4NKDB 4PJBA 2VXQL 5C0BA 3ZKND 3HMXA 3S35L 2DF3A 5GSVA 5SWQB 1ZT1B 4GRLC 2DBJA 4PJFB 5EBMA 5CP3H 1DLFH 1GZQA 4KKAC 5TE7H 3P77A 1T20B 2LE9A 5DMIL 3UBXG 1UXWA 5HDQL 3C87A 2BOCB 4HFWA 1RHHA 4LOUC 1DVFC 4XTRD 4HBCL 2I9TA 1N5YL 3GSRB 4F58L 2CKBL 4C4KT 3DGGB 4HJ0C 1V3LA 12E8L 1KEML 2J5LB 3LHPH 4ALAH 4I4WB 1ZANH 1TJIH 3HRZB 3TZVC 1EXUA 1EHAA 5JHDA 3KS0J 5I0DA 1I1YB 3NZ8B 3ARDB 4JZOB 3BPCB 3RBGA 2L7UA 3H9HA 4TUKL 1KLUA 3C8KA 3BP6A 4NUGL 3BUYB 4H26A 3GJFH 4WW2A 1KJ2L 1NCDH 4CNIB 2I60L 3D3VA 3T4YB 2FJGA 2RR3A 3EYVB 5HGDB 5SX5K 2OL3H 3HKFA 5HYSA 4TSCH 3CFBA 5EORL 5F8QC 2FNBA 4UTBH 5LJYH 1KYOJ 1YEKL 4HC1L 5GRZA 4PP1D 4L8DB 3VXSE 2WAHA 4PYHA 1MIML 3C5ZD 3KYKH 2Z93B 1IBGL 4G43A 4PLNC 4DCQA 1JNHA 1V8HA 1KG0B 3T3ME 1UM4H 2EIDA 4DKEH 3JTTA 1KCUH 3IYLW 4N1CA 4UB0H 1E6JL 1NMBH 5LKNA 3H0TB 5KSAA 1TLKA 4JHBA 3K8KA 4H1LG 3QNXA 1JMXA 4IRJC 4QRRD 2HH0L 3MBED 2CMRH 3Q6GL 1MF2H 2EYTB 1CE6A 4XMPL 1KJMA 4M1GL 3RZCB 3WKNA 2DWDB 5D96B 3P73A 4RGND 5DK2A 3IJYB 2X40A 2AJSH 4HS6A 4LASH 4BA8A 4KKCC 3LN4A 1G84A 4QYOB 4JFDB 4XH2B 5BOZG 4DGIH 2HTKD 4PV8B 4QOKD 2B1HH 2J8UE 4LQ1A 1FNFA 2R0KH 1OD9A 1CCZA 2Y25A 3CUPA 1FNGB 4WFHE 5FO9A 2WP3O 3UC0L 1RAMA 4U1HB 2VLRA 3V8CA 4QHLA 1ADQH 1WITA 5IM7A 4O2CA 3QIBA 4NYLA 3U0WL 1ITCA 2I24N 4N90E 4TVPE 4YO0A 4P4KB 3K4ZA 3MODH 2X4PB 4WRLA 3SOBH 3Q3GA 1SJEB 1UACL 1T3FB 3NMEA 3W2DL 3MXWH 5E94B 1IGTA 2HLFD 2XTLA 1MI5B 5IEHB 1UWGL 1S7UA 1OGAE 2YN3A 1JZ7A 2P45B 2UWEA 3PJSA 4NGHH 5T1KB 1MAKA 4ZTOH 4JQVC 1DTUA 4ODSH 4X80L 5LG1A 5M94B 5HD8D 4ZO8A 3VH8G 4I0PA 4JVUA 3NABL 1F5WA 5CJQL 2R69H 3UBXB 4J2XA 4HK3N 4PJ8A 4TSBL 5EDXA 5FA4A 1K8IA 1JPST 5CIPB 2HFGL 2YPLA 4PLKD 3BD4A 2P8PA 1V3KA 2YK1H 3OKOB 3QPQC 3IFPA 4G43B 5C0NC 3VFTB 4IDJL 4LLVB 1T89A 3N0PB 3RNQB 4NNPH 3VJ6B 5JDSB 1U8QB 2VE6B 5I19L 3G6DH 5F9OL 5FHBH 3SE4A 2P49B 2YD6A 2K7QA 4FQ2H 4MJ6A 5J13B 3O6FB 3QJFA 3VRJA 1AGEB 1OF2A 1RK1B 5IF0B 3FO2A 4WI7A 3PP3H 3LKOB 3BE1H 3KPNA 3LDBC 1EO7A 1QLFA 3OGCA 3VFUA 1ZGLP 2AEPL 4OFYD 4R7DA 4KJPD 4MA7H 1CLYL 4WU5A 4ZO6A 5EOQH 1WFOA 3K46A 3BT2L 5C92A 3BVNA 4O9HL 3JWDL 2D9CA 4N9GA 4KJQC 1IRAY 3DX6B 2DB8A 1S78C 1IEBA 1IFHH 3NIDE 1QFOA 3GK8L 2I27N 3HS0B 1SJXA 5DVMA 4BZYA 5IJVA 1FZMA 5C0EA 1W8NA 4RAUA 1F6FB 3AB0C 1A02N 2NNAB 4RFNB 2GK0A 4MNQD 2AEIT 3ARBC 4X5XB 5F93C 2ITCB 1IQDA 1INDL 4JO2H 3EZ8A 5FK9A 2NY2C 1FDLH 2FGZA 4NBYB 5HD8C 1T7WA 3HAEA 4WHCA 2YD7A 4ZTOL 1U3HD 2E7LC 3F12A 5DMGD 4CN6A 5GS2D 4PB0H 3GRWL 4HUXA 5DJYB 5GSRA 2VL5A 1VGKA 2L0DA 4LEXL 3ARFB 4YFDB 2MWCA 2DMCA 1FFPB 4HLJA 4JN2A 3CU1A 4XP6H 1FRGH 4QXGL 2NX5A 4XNUL 4YHIB 1DFBH 2CSPA 4V2CB 3VXTB 4NKMB 5EORH 1VKXA 2W65B 3RWEA 3S36H 5GRVL 1GSMA 3T0AA 3DYMA 3LKPA 4URTB 3HE6D 3EYOB 1H8OA 4FQHA 4P2QE 2HFGH 2XQYK 3ELAT 5FFLA 4ZUTB 2UWEE 4WFGD 3LKSB 3MGTA 4PJ9C 1X5KA 3O9WC 5BV7C 3UTQA 4X0KB 3VXMD 4AY0A 1U9KA 1RZ8B 4LLYB 3VXNB 4OKDA 5FF6A 4LHUA 1KIRA 1FYTB 3KJ6L 1A22B 4NM8H 3UTSE 2ED8A 4KZDL 1PG7H 1AQKL 3LRSA 5IV2B 2VE6A 1AXTL 1K2DA 4OFYA 3TVMA 1LO5B 2M26A 3RWGA 4P2OB 4YC2B 3DETC 2XXMB 4LOUD 4XTRC 1ZXQA 5AYQA 5HHXL 3LEVH 1EFXA 5D1XB 4NWUH 4LVOC 4OGAC 2VDRL 4CBPA 4NZRH 1YYLH 4YHKL 3RDTB 5JXAH 1FVDA 4XVSH 1DN0A 1A0QH 1T2QL 4MCZA 1VGEH 1DUZB 3NABH 3VRIB 3QG7L 4IOFC 1B2WL 1ORQB 1KCVH 3CSPA 5F70A 5AWNL 4J3WA 4Y16D 4X6DE 5C0ND 1OTTD 2HKFL 1YEHL 5D5MF 2DM3A 3V4UL 4OZFG 3T77B 4ZFGH 1M7IA 3S5LG 5KOVC 4ZPVB 5KZCD 2Q7YB 1U0QA 3X3FL 2ZOLB 3UYPA 4XC1L 4PRDB 5I1HH 5DEFB 2X4SA 5EU5B 3GJEA 5GGUA 3NCJH 3MRBB 4PJDE 5DTFA 4MJIA 4PB0L 3BN9D 4OAWA 1G7PA 3CFJA 4XBEH 2JIXD 1CE1H 2C9AA 1OTSD 5CWSB 4XPFL 2AJZA 5DK0B 1YY9D 3IJHB 2IFFL 3D25B 3CPLA 2MQCA 3HNTL 35C8L 3IDUA 4XCNB 2W9DL 5BVJA 5EFIB 2NY7L 5L0QB 3CSBA 2X4QA 2YWYA 3DV4B 3VI3F 2H32B 1ZHBB 5EUOA 4QNPE 5E1AA 4LRNH 1T4KA 3JTSB 4HCRA 4M6MH 4ONHA 4CW1B 1XCTB 3WUWA 4QOKA 3PHQB 2CRZA 3MFFB 2CXKA 4HZLB 5FO8B 4Y89A 4U1GB 5DA0B 4OGAD 3B83A 1MJUH 4HPYL 4N0YH 3GB7A 2A9ML 4ZAKB 1TVBA 1BQUA 2NY4B 3WV0A 3HC0B 5LAXB 2VRAA 1QP1A 4NJ9L 1KGCD 3B6SA 1IAII 4S1QL 4POYA 3VXRD 15C8H 4I8DA 5HI5C 2DL2A 1I7TB 2OP4L 1XGPB 4OF8A 5I1KL 2H6PA 1HSAB 3GRWH 2GCYB 4YZFE 3TO4B 3THMH 4UTAH 4CGTA 4OT1L 4R2GC 5KSAD 4PJ5E 2R1YA 3BRGC 1L6XA 1ZT7B 3UTSB 4F2MB 4Z77B 4WFFE 2JB5L 1NEZG 4KUCF 4KTEH 1A2YB 1VFAA 2WWMC 3U46B 2O5XL 4XRCA 1MHEB 2NY1B 2HJKB 3VFPA 1IQDB 1JRHI 5D2LB 4OM0L 3KPMA 5JR1L 2XWTA 2MPAL 5JXEA 2C1PA 5DJCB 1CLCA 3TEUA 1JUFB 1DSFL 4RAVA 4AM0A 2Z4QA 3AS1A 3S4SG 2DQTH 3WHXA 1OB1A 2D3VA 1BQLH 4L3EB 4S1SL 2PR4H 3HFMH 5KAQF 1EHLH 2G5BA 2WQRA 1NDGB 3MJGX 5SWSB 3BSZL 4L4JA 3LN4B 3KPRE 1BLNA 4RFOH 1IEAA 3DX6A 3WFEH 1MAML 4CVZB 2Z92B 4BQ6A 1AY1H 4Q9RH 3MLVH 1FFOB 3CVHA 4P23B 1ZT1A 1AGCB 3FRPG 4R0LC 5BRZA 1YN6A 3U7AA 5DFVD 1OTUC 1IC5L 4RDQG 3TH3T 5INDB 3L3GA 3QFDA 1OT1A 1AC6A 4L4TB 1MCHA 3GMRB 1OARL 5FM5O 3GMPA 1EPFA 1XFPA 4XI5C 4RSVA 1NKRA 2EE3A 1QO3A 4KKBD 1HXMA 4K8RD 3HE7B 1T0NA 1FZOA 1FZKA 2DTSA 1FDLL 2A74A 4WTWA 4ZFOA 4U6HB 2Y5EA 3PV7A 1YPZA 1A3LL 1CXKA 3CFDA 3QEHA 4EUPA 5I1LB 2AXGA 5FCUH 1KCSH 5ETUA 4Y8DC 3INUL 3QULB 3R4DA 3MA9L 4M6AA 5I74B 4M6ML 1TNMA 4OCNC 3QULA 3TN0C 4TUOB 1PW3A 1FBIH 2XWBB 4P5TD 3IFPB 4CN1A 1EEZA 2IQ9L 4X6DA 1I7TA 1J05B 4LLQA 4WO4C 1B90A 3B6SB 4RMRA 3SJVD 1MFDH 4NHCL 5CIPA 4YHOL 2GJ6A 4MQXC 1Q94B 2W0KA 4YNYB 5F9JA 3C6LB 3LRHA 3U0WH 4K23L 5DRNA 5H2BA 5EZIL 5FYKD 4Y1AE 1QKZH 5F9AC 3CNKA 3X11A 3OPZH 3OKEB 3VG9C 4H8WH 5BVJB 1G7HB 1IZKA 3ARWA 4Z7WA 4ODWB 4P5TB 5KSVA 4U1JB 5A40E 2XI9A 1CE1L 4XCCH 1JHTA 3PWPA 2BY3A 5BMFH 3BQUD 5HI4D 1JFQL 3P9LB 1Z9OA 1YDPB 2F58L 1RJYB 4KV5F 2JJVA 3MTRA 1OSPL 1HDMB 5GGRY 4X6CA 4M8VA 5I2IA 1INEL 2XZCH 3H3KA 1WZLA 3B5HA 3DYPA 4OGYL 3X14A 3UJJH 4O02H 5DTFB 3KG5A 2YD2A 2NY3B 1RMFL 2MSPA 3L9RB 2VOTA 4L3EA 3C60B 4IRJA 2A6IB 5AG8A 2BSRA 5L7XH 1NLDH 1KJMB 1NC4A 1VENA 1VCAA 5KG9B 5DJCA 3QG6A 2ZNXA 5IFHH 4Y5XC 3BPNC 1UVQB 1YYLL 3C8HA 2WBJA 3T1WA 1AGDA 1DUYA 5FEBA 2IPUG 1TTUA 1GGIH 4ZOEA 1UH3A 1ZHBA 4PJXF 3PABA 4HV8A 3QDMA 1QFWM 25C8H 3I2CH 1JVKA 1JNHB 4OCWH 4TOYH 2HTKC 2X7LA 1VB9A 5JO5B 1KENL 1MPAL 2LU4A 4P46D 5AYUH 3OKNB 4O58H 2E7BA 4O5LH 2CD0A 2E9IA 3AUVA 1TZHA 5I1AB 4HGWB 2HT2C 2NW3B 3FRPA 3K80A 1BHGA 1NC2A 4K94L 4IRSC 3C9NB 1PX4A 3CFDB 2F5AL 1TENA 5HHMD 1NCCL 3CX5K 3T4AB 1RI8A 3MOBH 5IP4A 1G7JA 2W9LA 1A21A 4KROD 4P46B 1CDJA 1DQLH 4XPAL 4XVTL 1Z0MA 4OUOA 3BUYA 4H26B 3VFRB 5FB8A 4PP1C 5JOPE 3DNKA 1JGDA 1PEZA 1XGQB 3JWOC 2GJ6B 1PBYA 4PRHA 3U6RA 5I1EL 5FECA 2PO6C 5IQ7L 4UUJB 1JI1A 1WBZA 5ESQA 2J12B 4ODUB 2QSCL 5IEKA 1GVIA 1RJZA 3ROLA 1F4HA 1ACZA 3PL6A 1ZWIB 1IKNC 4LVEA 4HD9A 5D7JD 1F02I 4XCCL 5A43C 4K94C 1TPXC 1JPTL 1MUJA 4HPOL 1PSKH 4APQC 5BJTB 4KJYB 5A16A 1P1ZA 4Y4FB 4M5YH 3WO4B 4TUJA 3NACL 1MQKH 1T20A 4IDLA 4M6NL 3IDYB 2HWZL 1Q72L 1S7RA 4P2OA 4CADB 6CGTA 5DD5H 2IAMC 2KPNA 5JXEC 3R0MA 3WHE0 3OAZK 1YPZF 3MLXL 1S9WB 3EO1B 4JAMA 2ATPB 3D85B 2PCPB 3WLBA 2ATPA 3D85A 3OHXB 2AJVH 2P42B 4JY5L 4ZS6C 3SDXB 1V7ML 5FOJA 3GO1H 4L3AA 5JOFA 5EWIL 2Q87A 2YPVH 2AERT 4N90D 2EXWC 4NC1E 5B39B 3LKSA 3DXAA 1F6LL 3W5