2K3TA

Solution structure of ig-like domain 23 from human filamin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Filamin-A
publication title Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k3tA00
3SDDB 1U3HD 4YE4L 4EUPH 2UUDH 2VXSH 4U6XA 4HK3J 3HNTH 5T1LA 2X41A 1BBJA 2VZOA 1BZ9B 1ZVSA 3TF7C 3MRMA 1H0DB 5E00B 3REWB 4DN4L 5DEZA 5L2KD 1BBDH 1M7IA 2WWMC 3VH8A 3ZDXF 5BOZG 4MJ6A 1EO5A 1U91A 3T0DA 2V2XA 1MCWM 1DN0B 1YEKL 2P5WE 2VLRB 4N9GA 1OM3H 3ARPA 2NY6D 3ULUF 1H5BA 3NZHL 1X7QB 2H3NB 3VWKA 2DQHL 4YGVA 4M6NL 3OTTA 4X5XB 1QD0A 4HUXB 2DWEA 1U3ZA 1FZMB 3S96A 1MJ8H 3DRTB 3ARVA 2WBJD 1XF4A 3MOQA 1FVEB 1XGYH 1S7VB 1KYOJ 4MLSA 2ARWA 4CADA 5IW6B 3VD3A 4Z7WA 4HWEH 5DGQA 1J8KA 4M5YL 2PW2A 1UJ3B 2FR4A 4N8CH 4XMPL 5HGDB 1JGUL 2AXGB 3UJJH 5KS9F 1WFUA 2NNAB 5D71L 4PGDA 1FC2D 4NO2A 2QQNH 3I6LE 3GMNB 4WV1C 1WQVT 1DQTA 1FL5B 1CE1H 3BUYB 5FYLD 4L4TA 3N1GC 2ZCKH 4HKXA 2Z93B 1EGJH 1FN4B 2XA8L 2DN7A 4DKFL 2MCPL 1AP2A 1J8HB 3MYZA 2WUBH 4Y19E 1F11A 5I15L 2F5AL 3WL9B 2OTUB 1QRNE 1RPQA 3BPNB 2D7MA 3OX8B 3GSWB 2EDKA 4D9RE 2NY7H 5LXGL 1WT5C 4QHMA 5I1AB 5KS9A 3F12B 1T89C 4F7TB 5DD3H 3FB5B 3VD5A 3B9KC 4KI5D 4Z7OE 5HGHA 3PWPE 2R29H 1DVFA 5HVFB 5CAYB 1P5UA 4UT6L 1QFWL 3RUGF 4N0CC 3HFMH 3VXUB 1R3KA 4OCLC 3QI9D 4HMCA 5EBLA 4DGYL 3MLVH 3RRQA 1A4JB 1OAYL 1U92B 3G6JB 2X70B 2DYPB 1RIVH 3QWOA 1FSKB 4PJBF 1DBJH 4ODWA 2ZCHH 4JDTL 5ESVB 8FABA 3TP4A 5MEND 1HIML 4QF1A 5DK0A 5AG8A 5C0AB 1NAMH 1B0RA 3VFOB 3TWCH 3ULVH 3QHZH 5D1XA 3RUGA 2HVKB 2O5ZH 1BZQK 1CT8A 1TZHA 2AQ3A 3HPJB 1S7QA 4XBGA 3L5HA 4LLDB 1KXVC 3KPLA 5CIPA 4LPVA 5DUPL 5J6GB 4JZJB 1D6EB 1R24A 1BIIB 1IKNC 5F7HA 1RJYB 5JR1L 4OCMC 1DZBA 4Y5YB 3D48R 4KJYB 2HT2D 4LLQB 4HAFA 4PJBA 4YGAB 5D9SA 3CU7A 1K85A 1Y6MR 1NBYA 3INUH 4OGXH 4OKVB 3QAZC 4TVPE 5L6YH 2WIMA 5DGRA 2DM3A 3VJ6B 1CGVA 1NCDH 1NANH 4IRSB 2DLGA 2MSPA 3C6LD 5MEQB 3FOLA 4JGJA 2C4XA 5CCKH 2NYYD 3OGCB 3BPLC 3KHQA 5HI3D 4P5KB 1DQDL 3MX0A 5DJCA 4YHIA 2BNQA 5ADPH 2ITDA 3VXRD 2DKSA 4AIZB 2DQEH 1BVLA 4MQXC 2YR3A 3DXAE 3PP3H 3TBWA 3NIFE 5ID1A 2A6IB 1HHGA 1U9KA 4FQ1H 5EOQH 1CFQB 1CL7I 4B5EA 4KUZL 4YHKH 2B8OT 3MC0A 3BUTA 1MFEH 2AI0L 3VXUE 1BM3H 1EJ6A 3QIBA 4HULB 4FP8L 2EDNA 2IAND 4ELKB 4OZFH 1EAJA 2OYPA 4L9LA 2NX5D 1MRCL 1OB1A 1J1XH 1YEGH 3IRPX 4M9PA 4TVPL 3FQTB 3FQXB 3OR7A 4U1MA 4XBEL 2GAZB 1IM9B 2YRZA 4YBHA 1OWWA 3RWJB 1X6NA 3OQ3B 5F89B 3BP7B 1ZKAA 3U30C 5ABDE 4Y19A 3RBSA 3D0LA 3NACH 3QDGE 1KCSL 1D5ZB 3O2WH 4WNQA 4L8DB 1VDGA 4F58L 2C3XA 3IDIB 1JNJA 1GCFA 2KZ1B 3GSNA 4KRPB 5DVKA 4HKJB 3EYOB 3BWAB 3ILPA 3RTQC 4YHML 5GGVH 4M3JA 5HDBE 4N90E 3UO1L 5ETUB 1OL0A 3O41A 4IRJC 4RGND 3U9UA 3KJ4B 1K4CB 1IE5A 4FFZL 2FIKB 1BJ8A 4DAGH 1OCWL 1RZJH 2FJGB 4MMXC 4PLKD 4JGUA 2QBWA 5TQ2L 1ADQH 5EO1B 1RU9H 3IDYC 1SYSB 1ED3B 2G5BA 2YXFA 2JELH 3C5ZC 4O51A 4NJ9L 2FO4B 1NAKH 5DR5H 4UOJA 3VW3L 3MBED 3UJTL 4M5ZH 1IJ9A 2R4SL 3U46A 3THMH 2B39A 2J6EA 3EDJA 4NM4L 2BVOA 3MRPA 4OGYH 5EC1B 4D0BB 2DQJH 3CX5J 1I9RH 2ATPA 2IFFH 4XZUA 4XAWL 3GMOB 2OJEB 3MUHL 4Z9KB 3T0WA 1W0YT 3H3BC 3UBXI 3GHBL 1EUUA 1NL0H 1AFVL 4ZUWA 4G3YH 4K71B 5E6IB 3ZE0E 3AS2A 5DF0A 1UVQA 5KN5B 1FO0B 4JPWH 2YWZA 3D5OF 3QIUD 5E5RB 1EHXA 5I16A 3OMZA 5I1JH 5D1ZD 4BQ8A 3LKRA 4W4NA 1KJ2A 3QRGL 4LAQL 1XZ0B 3BMVA 3EAKA 5J06A 2P7TA 4XNUH 4G6KL 2OK0L 3WEXB 3NGBC 2V7NB 4KROC 4G6MH 1NFDE 3WKMH 3KPTA 4JB9L 5SWQA 1II4E 2UZIL 2XICA 3ZKND 3WFHA 4J3OC 3S5LG 3DGGB 3BDYH 1FFQA 2MWCA 3K4AA 4KK8D 4YIQB 3BP6B 1KNOB 1ERNA 5B38A 5GHWH 3VI4E 2VDOL 1OP3H 4GW4B 4QRRB 4QRPB 1ZANH 2XG5A 4PTUA 3SDDD 1QEWB 5FO8A 1T6VN 1YEEL 3RWEA 3TIEB 3AAZB 4Q6IB 1OOAA 5HYSA 5LGHL 1BOYA 4LKXA 4XPFL 2A9NL 3BKCL 5BQ7B 4BH7A 1JHKH 2PYFA 1NKRA 4PLJD 5FB8A 3V6OC 1JZ8A 5I2IA 3AREB 1RULL 2BOCA 1MSPA 1NCBL 2MQCA 3R4DA 5F7WC 1QBMH 3V6BR 4MD0A 3A6OA 5ACZA 5ALCL 1TQCB 1CR9H 1AXSA 2ZOLA 5FGRA 1EFXB 2VZ1A 2EKSB 1NC2A 1ND0B 4OIBA 2WMPA 1U8PA 1LDPL 4X7CC 5F6HJ 1QFUL 3BQUC 3EJYC 3RX8A 5B3NA 1XCQB 3BISA 4OBRA 1MJ7L 4N8VA 3MJ9H 4LU5L 1R5VB 1PZ5B 4OF8A 3GSVB 5KSAB 1BD2E 3GM0A 5EA0L 1GHFL 3QO0B 3TYGL 3G9AB 5B4MC 4JFDD 3IXTA 1N3NB 1Z5LB 4GS7C 3RVUD 5IFJB 2EE6A 3QXAB 3L5XL 3LKSA 1J8HD 2OSLA 4Q9QL 1J1PH 4BK5A 1JHTA 2PR4L 1ETZB 5J6HB 1WC7A 3I02A 4E42B 4GMTL 4YWGH 4QNPE 1JPTL 1WITA 1C5DA 4U2ZA 4C83A 4CMHC 2R2BB 3HLAA 2A83B 3RY5A 4LLYB 3IFLH 4ZAKB 2VDLH 5FDYA 4BZ2H 3HCVB 2ZKHL 1FO0L 4NQEA 3S3SA 2V17H 1KIUA 2QSTA 3WFDH 2N7BA 4LBEA 1I9JH 3H9YA 1P7QA 1XR8B 2I60H 5DXWA 4BZ1H 1MRFH 4NUJA 5C0JA 1A6PA 2DYPD 1QOKA 2FATL 1J10A 1G7QB 3LKPA 5HY9A 5I76A 4EDXB 1CFTB 4QEGA 1XGRB 2DIBA 1NFDA 3O3DB 2OJZL 4RISH 1E28B 4OIIH 4ZQKA 1JWUA 2CDEB 2Z91A 5E8NB 3GSRB 3HI6L 3P11H 2K1MA 4MA8H 5C0AD 5SX5H 2P24B 5GS1B 4J6RL 43CAA 3HUJF 4MDJB 2W0PA 1CS6A 5T3ZH 3MRCA 3K4ZA 1HSBB 4D9LL 2EH8H 1YPZB 1G9NL 3OAZH 4X9BA 2Z8VC 1JYNA 1JWMB 1L0XA 3WFCL 3DROB 2CUMA 1CDHA 1NFIA 4JFYB 1D5BB 1P4IH 5L8JB 2ZUTA 4W70A 5EBMB 3HI5H 3GB7B 3U1SL 3MNZA 4QHUA 3LKNB 3T0AA 2Y23A 1OAXH 3HE6D 3DHMA 4X5WB 1IBGH 4PG2C 4NYLB 3TN0A 2DJSA 3HUJA 2VSCA 4IRSD 5HGAA 2FX8L 5C07B 2RCSL 1FGVL 4N0UB 5JNYA 4JKPH 4X6BB 4DGVH 1PW3A 1U8JA 4EN3C 4LEOA 4KKLC 1CXKA 2CUIA 3TJHD 5C0RH 2VDQL 1S7XA 4K3DL 4BH8B 3QUMH 5F7EL 2CDGA 2GCYA 5EZIL 5LGJB 2HFFA 1P7KB 4HK3N 4Z7VB 3CSYB 1QFWM 3IDMB 4WFEE 5LKNA 3QNXB 4P2OB 3EO1B 5FF6B 5D7KE 3QUZD 2VOTA 1P9MC 3AU1A 3P73A 1DBMH 2X4SA 3L1OH 1BQSA 4IOFC 4JKWA 4H5SB 3GNMH 3LQZA 1F02I 1TMCB 3UX9B 1IM9D 3C5JB 3SPVB 4JN2B 2ZUWA 1DL7L 3HR5A 4XCNA 3OF6A 4OLZL 5D4QA 3IJHA 3KDMA 1L7IL 3GHEL 3Q6FA 1UM5H 4ZO6A 3IFOA 2HA1A 4X80H 4FN0A 5J9PB 2ARJA 5IR1A 2E8ZA 1WEJH 1YC7A 3T77B 1L4IA 3AUVA 3IKCA 4CVXB 1LEIB 4OZ4B 1YPZE 3EDEA 1KTDB 5F7KC 3RGVA 5HHXL 3GDBA 5KW9L 2W59A 4HJJH 4Q9RH 3HMXH 5IQ9A 5JW4M 4FFWD 1DSFL 2WW8A 4G7YL 3HR6A 3UTTB 4Z7UE 1CICA 3MRGA 5I74B 3MROA 2JF1A 4YK4B 1W72B 4HUUB 3SCMB 3EFFA 4JFFB 4NWUH 3MXWL 4N5UA 4PRDA 5I73C 4PTTA 2RBLA 3H3PL 1H3VA 1UCTA 4U0RB 4N0UE 5MEPB 1X3DA 3MLTA 1WBZB 2X1PA 4M7KH 3KS0J 5JPMB 2DQUL 4LF3A 1HHIA 3PL6A 5D8JH 4OUUB 5GZOD 2XKSA 1JZ2A 4F9LA 4AENB 3MV7B 4CKVX 1FJ1B 1RUQL 4V2BA 4UTAL 2XXMB 2DLIA 3WXWH 4X6CB 2XWBB 3BYTA 5E6ID 3GMMA 4DW2L 1T03H 3ZO0A 5CGTA 2D03H 3TBSB 4LCIH 1KN4H 1S7WB 3MJGX 2EZ0C 4KJWC 1TFHA 1OLLA 2Q3AA 4ZFZA 3H7BA 3MA7B 5TE6H 5DRNA 2EDBA 1RZKL 2QV2A 1LQSR 5CJ5A 5FA4B 2AXHA 1MELA 3MRIA 4KTEL 2MFNA 3BH8B 4F37K 4TSAL 2V5SA 4NKIL 4F9PC 2B4CC 1TNMA 3NPZB 4Y4HC 3ZDZE 4YHYC 1LE5A 4DOHE 2XN9A 1NGZA 1OTSC 4P2RA 4Q97A 3CCHA 3MRRB 1I8IA 3QG7H 5E8DH 2JLLA 1DUYB 5HD8D 4GXUM 1CGTA 3KPQA 1BOGB 3E6HB 4RMTA 3IDGB 4XRCB 4QRRD 2AJ3A 2D9QB 4GRWH 4QRPD 5DFVD 3GBLA 3BMWA 3MJ8A 1MLCA 5DFTA 4I5BB 5D5ME 3L6FB 4A6YH 1L9MA 4PG9B 4OZIF 4R7NA 1INEL 4Y4FA 2NXYB 4ZMAT 4UNTA 4YFDB 5FGBC 1SM3L 3P30H 4ZS7L 3WSQL 4QY8B 2ORBL 3U4AA 2ERJB 5IEHA 4TSCL 2IALB 4PJCB 1EZVY 1J0ZA 1ZLVK 3PGDB 2NW2A 4N0FB 4IIQC 4YX2L 2YD7A 1QSFE 3KPMA 4JR9H 1A1NB 4X98B 4PJ7B 4LQFH 1QSEA 2IPKA 4RRPA 2FGZA 1F6AA 4BQCA 1GXEA 3ROOA 4NFCA 3MV7E 5KG9A 4NGHH 4C56A 2Q86B 4Y5VC 3IDNA 3CFDB 4R0LA 2NY1C 4AT6A 2YHGA 3STZB 5HHVH 3BE1L 4OZIA 1AO7D 5HPMB 5CEZL 4LSRH 1VFOA 3BGAA 3JV6A 4X6CE 1TCRA 5FM5O 3DX8A 5IGXH 5CINH 5EWIH 4M7JH 1CGXA 5EBWB 2XFXB 3W11C 5FV1L 1RUPL 3WNMA 1KTRL 4IHOB 3MACH 5BW7C 4Z7UA 2IG2H 1UA6L 4NO3B 5KSAD 1KB9K 5DK2A 5JUEH 1W72L 2NY0D 2XTJD 2C3HA 2L4OA 3IJYB 1PGRB 4XXCA 5TE4L 4XNXL 3HZMA 3W81A 3A67H 3F7YA 4GKZA 4WHCA 2DQIH 1RFDL 3MLXH 1NCCH 1AHWB 5J13B 5DC4B 4M8QB 4WFGE 3FRUA 2ID5A 1BFVH 5EPMB 1C5BH 3AS1A 1KT2B 4QYOB 3BO8A 2FZ3A 1PZUB 4Y7MA 1I4FB 1R3HB 3BJLA 4MJ5A 5ILTH 3PXJA 4UT9H 5F1IA 1EHNA 3MLUH 3V4VH 3RVVD 5CJOL 5GGTL 1MJJA 2F54D 3BEWB 4ZAKD 4YXLL 4X6FB 3UYRH 1NGPL 3O0RL 1BVKA 4UIMB 3O6ML 3RKDD 2V9QA 3UEZA 2E9WA 3UTZA 4PJXB 4JFQB 1OAUH 5C09E 5IV2A 2WIIB 3R06A 5C0BE 3OKEA 2Q6WB 1S7TB 3WCYA 3L5WB 3LRGA 2EDDA 4MNQE 5JTWA 2ZZUT 4JE4B 2BMKB 3RZCC 1LK3H 4PJCE 3RVWC 3T2NL 3FONB 4JFHD 3HE7A 3LIZH 4UUJA 5EU6E 4TULL 2HP4A 4MHHG 1T83C 2G60H 2IAMA 2BVEA 3L7FB 4NN6C 3KLAB 3T0XA 4LCWB 1MHCA 4RDQG 3SJVB 5J8OA 3WXVL 4UINL 3D18A 3WDJA 4ZXBC 2DL2A 3MLWH 2VN4A 1G7LA 1MLBB 1X5LA 4DJMA 2QQKL 1ZT7B 3JBG7 5D5MA 2XQYG 1QFOA 4JFZH 1AKJD 2XQBH 1IEBA 3GGWA 4E0RB 1E4XL 3PWLB 3JTSA 4MJ6B 1F3JA 4JO2L 4PYHA 2PN5A 5C71A 5C08E 4HBCH 3BX7C 2BSSB 4HFUH 4KKBD 5C0GB 3SOBH 2VDPH 3S3JA 2IQAA 3CIQA 1UKQA 4FTVB 4AY0A 4XPTL 1IT9H 5EOTB 5D7IB 1QSFA 5IVZA 3ARXA 1CK0H 4TYUA 4M61A 2X9WA 4KAQH 4UNUA 3S96B 1KIQA 1XF4B 3O6FB 3ULVC 1HINH 2DBJA 3B2VL 5DQDH 1ZGLB 1JYVA 5JXEA 4I18A 4UZGA 2DD8L 4LOUD 4OLUH 2FO1A 1T04B 3REVB 1NEZA 4YDJB 1KPUB 4GAJH 1A3RL 3C60C 5EZOH 7FABL 3VD7A 1FL3B 5EB9A 1P2CA 5EC2A 1VFAB 5HVHB 3V5KA 4OGZA 4F15C 4LLUA 2AJSL 1QTYT 1H3PL 5IBTH 1MFBH 3K81A 3HC0A 4TVSa 4JM2F 3PF2A 4NNPL 4ISVB 4PYGA 4K3JH 1F11B 4PGCB 4M93C 4XBPA 4ZUVB 2W9DL 4H25A 4EI5A 1NBZA 4Y4KC 3X3GL 4MAYD 1VKXA 1JHLL 4YEEA 4J12A 4PJ9A 5E5MA 1XGPA 3GSUA 1X5AA 3BHBA 5HGHB 1DVFB 2HT3D 1R0AH 4G9FA 5CEZD 4HJ0D 2JCCF 1PY9A 1R3KB 5DJ6A 4P46C 4RAHA 4HIEB 2BVQA 4WFHD 3O3EA 5FUOH 1T2JA 5TQ0L 4WEBL 3ECBA 3UTTD 5C09A 1H3WM 1LD9B 3IFPB 5C0DA 5C0BA 1VFBA 1KLGA 3DBXB 3SCMD 4KZEH 3D0VA 4JFFD 3DX7B 3Q6GL 5KVEL 3SO3C 1EDQA 3MODH 5D7IE 1JFQL 1KV3A 1CIDA 3DMMD 4LLVB 3RNQA 4CU6A 4U1KA 4QF1B 3V5HA 1ZEAL 4JQVC 5EU6A 5CD5D 2Y07L 4FQXC 4C54A 1IAIL 5D1XB 3RUGB 2JCCA 4K7FA 2GJJA 3PQYE 3B83A 3U7YL 1LO4L 3KPLB 1C16B 3STLA 4CL7A 5CIPB 2R9HD 2VXUH 2YD4A 3QDHA 4LHJB 4PV8A 1NJ9B 1U8IB 2YK1H 3GI9H 4R4ND 4YZFE 5E2VH 4BFEA 5HVGB 3H9ZA 2R1WB 1ULVA 4PJBB 1RZJC 3O6KL 3OKLA 2YD5A 2EDHA 5DT1H 4PY8I 1NBYB 4GBXD 3MMEA 3H9SA 1D9KC 2BOBA 1RVFL 1B88A 3FB8A 1DBBL 1U8MA 4R3SA 3QULA 5DRXB 3D39E 4OAWA 5EIQA 4MXVE 3G9VA 1BQHA 1PSKH 1KBGL 3SKNA 1G1CA 2I25N 5FDWA 1OF2A 5HHNB 3VGGA 3MRQA 5KSVA 5DJCB 4XH2B 2ITDB 5F72S 4Y5XB 3VCLA 1BVLB 3A0OA 2ICEA 1LO3L 3GJEB 4RWHA 1KJVA 3TBWB 2DRUA 2YD2A 1KACB 3ULSB 5ID1B 2J5LB 1F4YH 1T5WB 4XCCL 1PG7L 5C0CB 4RNRA 4M00A 1M1SA 4OJFH 4U1HA 3V4UH 4K8RL 5D2NB 2J4WH 2CRZA 4RCAA 1PBYA 1C12B 4GAGL 2FIRT 3V2AR 3ULUL 1VCAA 3JWDL 1N64L 3S37H 1GSMA 4L1HA 1ZTXH 4KGJA 1MFDL 5ECJE 3KLHD 4O58H 2H45A 4ZTPL 3IU4H 1ZSDB 5BRZE 1L7TH 3KYMA 4LL9A 4U1MB 3ARBC 4LVNC 4QXGL 3OXSA 2OR7A 4WV1A 4NQSB 5EOCL 4DTGL 3T8XA 1QQDA 3MUJA 4LRNL 3QDMB 2FGWH 5ESAB 1T0MA 4JRWA 3MZGB 4YJZL 4ZOCA 3CK0H 4X6EB 4HC1A 1OGAB 3FO1A 2R0KL 2PCPB 1GGIL 3O41B 5E9DD 3TJEL 2BC4B 3MGTB 4GKNA 3U9UB 3WD5H 2J12B 1I1RA 1U2CA 1WT5A 3R1GL 4JQIL 4JCLA 1T89A 2F19L 3B9KA 3FFCA 3RWCB 1DP0A 3HA0A 1HOCB 5DQ9A 3U0TA 4X99A 2G5BB 2DQDH 4KKCD 4O51B 3BZ4A 1KENH 2VXVH 2H2PC 3VXPA 4DFIA 3D85B 5H2BA 4OT1H 2D7NA 2EC9U 4M48L 3ZYJA 4FQCL 2DLTA 1IQWH 3U46B 2I5YH 1FNLA 2BVOB 3QWQB 2IH1A 1NKOA 3WNNA 3QEUA 3U9PH 5DJ8A 35C8H 5IVXE 3W5NA 3PQYA 4HIHA 2BJML 3FT4B 3HS0A 2Z31C 3ELAT 3SKMB 1QBAA 2XWTB 3FTGA 2BNRB 1FAIH 3ARRA 4WI9A 5D2NE 4KMTL 3VGEA 4GKSA 4ETQA 4CGTA 4WCYL 3WV0A 4LNVA 1OLZA 1T1XA 4YHZL 2X4OA 4LP5A 4UAOB 4PJ5B 3EFDL 4JRXA 1NMCB 1EV2E 4NZTL 1IKNA 4MWFA 4LK4A 4NDMB 4APQD 1A8JH 4NWTH 4F33B 2VLKA 1XFPA 2HMIC 3CFCL 1ZT1A 4XPHH 3EYFA 3CFIC 4MNGB 1I1AC 1X5ZA 4I3SL 5B3JE 2GTWB 3C8DA 3EO9H 4M5YH 3RU8L 1O7SA 1QO3A 4NN7B 3DWTA 2E27H 5J1AA 1G6VK 3WNOA 3GO1L 3RQ3A 5K9QI 5D71H 3GSQA 4GO6B 2DM7A 4D0DA 3SGEH 4AH2B 1MFNA 1BREA 1PJ9A 4RAUA 1W0VA 3CDCA 4LCWD 1JPGA 2EYRB 3TCXA 3SJVD 1MCWW 3PHQA 1T2XA 2FECL 1AXTL 1FVCA 2VLJB 2PKDA 4M3KB 5T1LD 4XCFL 4Z76B 1WAAF 1SEBA 5HYSB 5MEOA 2H9GA 5I15H 3SQOH 3FT3A 4YDVB 2XY2A 2PYEB 5DS8B 5C0FA 4I3RL 1ORSA 5BRZA 3QCVL 1MH5A 5D96C 2A1WL 3W2DL 1VSCA 3F7VA 3OAYK 4KHTL 4FTVD 1KTLB 1GPOL 3SKJH 3VWKD 4Q9BA 2H32B 2V7HA 1SJXA 1PEWA 3SDCC 1M71A 3JSSA 5JW4N 1QFWH 5IFAL 3DX6A 3NMEA 2OL3A 1J5OL 5BXFB 3KS0H 4DGYH 3TBVB 1DLHB 5KJRH 3CU1A 5ACZB 3ARFC 4RX4D 5CBAB 3V6OE 5ICZA 4G8IB 3S37X 4CVWA 5C6PB 3T0EB 1WZMA 1FL6A 1N2RB 3S36H 2CD0A 2DKMA 4GAFB 4Y1AA 3F7QA 4JGMA 2LV4A 2BRRH 3ULUD 3RTQA 3AGVA 4K9EH 4N8VB 5ANMA 4DWHA 2X10A 4IRJA 3LN9A 1IL1B 2HH0L 4NO0A 3GSNH 2FSEB 1TZIA 3ARSA 4L4TD 1RZIB 5D1QC 1MCOH 5DUPH 3F58L 1JPST 4MNGE 3LKOB 3KR3H 1NGXB 5JR1H 5DI8A 3MQIA 1LWRA 2NY2D 2GFBA 3C5ZA 2GSGA 4P23C 1WC7B 4XHQA 3MZTA 3CSPA 4G8GE 4ZPTA 2PO6C 4KPHL 3CXDH 5FO7A 3LPWA 4Z77B 1G7HB 3VXOB 3S35L 4C83B 2PTTA 4L3CA 4ZOEA 3U79A 3HLAB 3T2OA 1JJUA 2IPUK 1TITA 4DEPC 1DVFD 4U1NB 4MXQC 2VLJE 3MLSL 4NQEB 2APFA 4BQBA 4DQOL 1O7VA 5E8PA 3X12B 3P9LB 3WS3A 2BVTA 4PJAF 5KANI 3LS4H 1P7QB 2PYEE 3T4AA 2QJDA 1KB5A 4NUJB 4ZOBA 5C0JB 4G5ZL 3TO4B 3QHFL 1J9CT 4LNRA 2A74A 2BVYA 2XXCB 1KIRB 4HUWB 5MP6L 3IJSA 1AY1L 2FEEL 4X4XB 3ZT7A 43CAB 4FP8H 3PIQB 4RAVA 5D1XD 3VFWA 1KJ2H 2DI9A 3PHSA 3QXWA 4KJPD 4XCEB 3QUYB 5A3ID 3T0EE 4PJAA 2XRAH 3CDFA 3OGOE 2Z8WC 1BHGA 1CD9B 4HZLB 4AIXA 3QEGH 5HDOA 1KULA 1F5WA 1DUZB 4J8RA 4NT6A 3I3EA 1OAQL 3L3KA 2UYLB 4WW2F 4PB9L 3VFNB 4UILH 2BRQA 2MPAL 2ZG3A 2YS4A 4WTZG 4RBPH 3V5DA 4JREC 3ETBF 3K2UL 3HUJB 3CDGA 5JMRA 3UO1H 1EHLL 4BJLA 5F21B 4LASL 5CILH 5JNYB 3LCYA 4R7DA 1CVSC 3MBXL 4FFZH 1I75A 3ILQD 1OCWH 2BNQD 2LQRA 3RWHA 3OPZL 4JY5H 3DYOA 4HXBL 1CDUA 5DO2C 3V6OA 1T1WA 1X5KA 1RHFA 3KWWA 5C0CD 2GCYB 3PWUA 3S6CA 3O6LL 2QHRL 3WHE1 3VW3H 3TBYA 3UJTH 4CNIA 5LWYH 1MY5A 2JIXA 4JKLA 3ZE1E 5LG1A 3QIBD 1TETH 3KPOA 3W9EB 4NM4H 3F65A 1J0KA 2AAVA 4HIXL 4UBDC 3HAEH 3P73B 1GIGH 4XPGH 5HVWA 2ESVE 4JANA 1K3ZA 3BQUA 5I6XB 4Q6YA 4PP2A 1KB9J 4PJEE 5I18L 1DQML 2DLHA 4HLZH 1OTTD 4OLWL 4XVSL 1AFVH 4NO5B 1A9EB 4X7SH 5FA3A 2DKUA 3CC5A 1FIEA 4XCNB 2ADGA 4WEMB 5I1KL 3T4YB 2QSCL 3N85L 3QDMD 5KVFL 2CIIA 3Q6FB 3QQNA 1JRHL 1O5DT 1X4XA 1E6JL 4LAQH 2ARJB 4MXWL 1IAIM 2FD6L 4ZUSB 2VSDA 1KUMA 1OGAD 2D31B 5DZNA 3IKCB 3QCUL 4JDZA 4FFYH 4BKLA 1G9ML 5LBSL 1MAKA 5HI5C 3MFGB 5F7YC 1IEAB 3SDYH 4B53A 2DF3A 5IQ9B 3TFKC 2J1KA 5IB5A 2VL5A 3QZWG 5GJSH 4LDEB 3BSZL 1MI5B 1CICB 1UWGH 1XH3A 1YN7B 3LDBC 1QLRB 4UT7L 1Y0LA 1ZHLA 1WBYB 1UEYA 2L0DA 4UDUA 2VDOH 3T2QA 3D85D 3VXSE 2VWEC 2X09A 2F8XC 1D6VL 1KC5H 3QA3B 2GQHA 3BAEL 4EZMA 3ZTNL 5I75C 2WQ8A 2I07B 2AXFA 2LU7A 4J4PC 5LGHH 3KPSE 1OP5K 4Q0XH 1B0GA 5IMKB 3ZHDA 2GJZB 4O4YH 1WFTA 4XPFH 4OFPA 4F57H 1Q9OB 1ZGLM 3ES6A 4LVOB 1I7ZA 2BNRD 2A9NH 1JNNL 3QQ9D 4JFEA 5AEAA 1BZ7A 1UXSA 2LAAA 4POZC 1D5XB 3PHOB 1KLUA 2IPTL 1C7SA 3LPFA 1NBVL 4XAKE 1UC6A 4PJ5D 3U6RA 4ZFZB 2X40A 5HYJA 2W0KA 3H7BB 2XZAL 1AC6A 5INCA 1AR1D 1NCBH 1ZHNB 1XF2A 3GJFB 3MRIB 4U1SA 5ALCH 4QO1A 4YDIL 5MHSD 1B4RA 3GRWA 3R8BB 2XN9B 4KKAC 2ZG2A 3MXVL 4RGMB 2G9HA 3OR6A 4P2RB 4DN3H 3BZEA 1LDPH 3MRBB 4WO4B 1EEZA 5D7JC 4OF3A 2EXWD 2VABA 2FECI 5E1AA 3CJJA 1EVTC 4LU5H 5D93B 4M4PA 5F7LB 4EOWH 3RX7A 4ORZC 1U58B 3TYGH 5GSVB 3DYMA 4L4VB 4EN3A 5C3LD 1LO0L 4GG6E 3PWNA 3UBXG 3TESA 3EOYG 3CAFA 3L5XH 3AROA 4WJ5A 1JTTA 4UV7L 3MRHA 3VXQA 3NABH 1MI5E 5F88B 5FUCC 4D8PA 1UT9A 5E0QA 4TQEL 5K59F 4F7PA 2ESVA 1UZ8B 2QADC 5EIIA 3VG0H 2NW2B 3BD5A 1N59B 4Z5RB 3KPMB 1FFPB 3IGAB 4I4WB 5FHBL 2I26N 1QSEB 4UIKH 4FABL 1KIPA 1P9MA 4EDWL 4U6HA 2JJTC 4FA8A 2ENYA 2ZUUA 2JE8A 5JW5B 3ROOB 4OI8A 4WI6A 3C09C 3P4NA 3LB6C 3QEQB 4KTYA 4OZIB 2WSKA 5J0BA 4HIJA 3QIWC 2YUZA 2P42B 5EOCJ 1NC2D 4IRZH 1SY6L 3U82B 3LD8B 4KV5F 4R4FL 3JWOL 3MRKB 3CXHJ 1JPSH 1J12A 3LQAC 3O8XC 3SKOB 5IESL 2AKRA 5DUML 4J6RH 1Q0YH 2FEDD 4Z7QF 2HJKB 4LVEA 1FNSH 5F9DC 5D2LF 4HQQH 5DWUL 1NGQL 4P59L 2C1PA 2RQ8A 4HDIA 2R56H 4HCRL 2YA1A 1DQLH 5IEKA 3JV4A 4U3HA 2OTWB 1I1CA 1A6AA 5EORH 2FB4H 5FM8A 4POUB 4OF0A 4YQXH 3ZT5A 3BW9A 5E5UB 4U6VH 4QWWD 5CMAA 4OGAD 5F1IB 3LZFL 4YBLC 2C1OB 4G8FA 5DUBA 3RWFA 5IW1A 1FYHB 1MFAL 2V5RA 1Q0XH 3DPBA 3LEVL 4NOFA 3UTPE 1B2WH 3T3PE 4NQED 3KXFA 1BVKB 2FX8H 5D2LA 5TDOB 5IHBA 1FGVH 2FRGP 3MV9E 5F9WC 1BX2B 5I1HL 3DURB 2VDRH 4RFEB 4HUVB 1LK2A 2J8UF 3R06B 3DO7A 1P7QD 2FEEI 4I0PC 2FLRT 2V2WA 3V0WH 1EXUA 4MCYA 4OD3L 4C59B 3BZDA 3U7WL 1IZKA 2IFGA 4GUPA 1XF3A 1IM3B 1RZGA 4UTBH 5JQ6L 2AK4A 2DIAA 2QR0A 4HWZA 2VJXA 4TTDD 5TGBB 4ZUUB 1D7FA 4ELME 3DO3A 2W65B 3C08H 1BFTA 2IAMB 2A6KA 4YC2B 1RIHH 4M1CD 3KPRA 2DTSA 2F74A 2VQ1A 4B41A 2YPVL 4F9PA 3BGFB 1WBXB 4Y4HA 1WZKA 4WUKL 4ZNCD 3LVEA 3JTTB 5KSUB 2F53E 1AIFA 5IM7A 4GG6A 5B8CC 1TTGA 4AM0B 1IEBB 1DL7H 2E6JA 5BMFH 5E8EB 1FZKA 2PXYC 3VRIA 3RNKB 2ILLA 5E2UL 4JG1H 2IQAB 1QVOA 1S9XA 2AV1A 3TN0D 3QISA 5FGBA 4M61B 4Z0BH 4KRLB 1CBVH 2DQTH 5EBGA 1KGCE 1U8NB 2GK0B 3KPPB 3S34L 5HHXH 1ZLUK 2WBKA 1C08A 4XCYB 1CXFA 1WWCA 2KBGA 4QT5B 4D9QD 4E41E 3CZFB 2YEZB 1QLEH 4NQCE 1MPAL 5F9OL 4LARH 3T3ME 1DSFH 2X44D 3QFJB 1SJEA 4IIQA 4G7YH 4Q2ZB 1AGFA 5DJDB 1T1YA 4QXUL 3BPOB 3IU3A 1MWAA 5BVJA 4U05A 4PJGF 5F3HB 3MNWA 1R3IH 1RZFH 4QRSB 3MNVB 4EKXA 3MV8E 4Y5VA 2FX9H 1KEML 1FFNB 4O2EA 4WFFD 4ZD3H 1QFHA 3LMJL 5EC2B 1RAMA 3EZ8A 3V5KB 1SBSL 4LLUB 4GT7A 2DQGL 1U8LB 3QJFA 5HHQB 5BJTB 4PB0L 1RUQH 2GSIA 3UTQA 2D7PA 3HC0B 4HFWA 4FXKA 4KI5C 1V7MH 1Y6KR 2Z8SA 5ISZB 5BW7A 1JRHI 4P3DB 3QI9C 1FG2B 4LRIC 4EI5B 4UDTB 3F5WA 5J11B 4RZCA 3TVMB 1K2DA 1XGTB 5L88L 4PJ9B 3T0BA 5C0IB 5FEBA 1NUDA 3RI5F 4Z95H 4MA1C 3BHBB 4L3AA 5BZWA 5HYFA 1H5BC 4JO4L 1HXYA 2ZNWA 2NY4C 4G9FB 4N9OB 1NSNH 3IS1X 3F62A 5DJ6B 2EC9T 4NC1E 3GIVB 2XI9A 5FO9A 2AK1H 1U8QA 3MV9A 1FV1A 3WHXB 4WTXA 1FVDB 1RK0A 4JM2B 5CUSL 3U36A 3GEWB 3L3HB 3QO1B 3VGAB 1FBIL 4XT1C 1CICD 1VFBB 2HKHH 5IBLD 1G7JB 3FT2B 3D0VB 1EAPA 4QHNB 4PGEB 4PRNA 3X11B 3DVNA 3G5ZA 2OP4H 5T5FL 5ICXA 3ZE2F 4NRXB 1U0QA 3AC0A 3SE8H 4P0DA 4KVCL 4NKMB 1MNUH 3PP4H 3RZCA 4L8SC 2JCCB 43C9A 3IDXH 4K7FB 4DVBA 3QFJE 4G6AD 3ZKXB 2F58L 4J3SA 4GW5B 4WEUD 1J0HA 3STLB 4AL8H 4ZS7H 3CFKA 1X9QA 3SO5A 3CVIL 2F15A 5TFSL 5I1GL 2F53A 5JORA 4PV8B 3NCYS 4TSCH 1NMAH 1T83A 3U4EA 4MJIA 1VACB 4N1HB 1CFVL 4FZ8H 5DHYA 1MUJA 3LHPH 3OKLB 3RDTC 3J8F7 4ZXBA 2Q8BL 3GUTA 5T1MA 2Z4QA 3TNMA 4F2MB 3ULVF 3MMEB 1A64A 1S7SA 5INDA 1CG9A 1U8MB 3QUKB 4R3SB 2X6MA 1UM4H 1CLZL 1J0JA 4K23H 1BQHB 5J12B 2OR9H 5C0ND 4PRHE 1IGCL 2XN9D 3MRQB 4OFIA 3K4DA 2DLFL 4P2RD 4PJ8B 4NQDE 3VFPB 4KHXH 1X5HA 3J7HA 4NQCA 4WO4D 3NIDE 5F44A 1LO5B 1CLOL 2ICEB 2X4TA 1S5HA 4QRQB 3V4PL 4FFVD 4XNMA 4X7TA 3NCBB 1P84K 1C5CL 3RPIA 5IMOA 3O4LB 3MGOA 2MCG1 1RMFL 1WGOA 4M7ZC 4RNRB 2CRIA 1T5XA 3KYKH 1OD7A 5TE4H 1ZLUH 1JPFA 1MHHB 1YYMH 5BZDB 4L4VD 1RV6X 4TSBL 1IEHA 3MV8A 2UWEE 1F8TL 5E6YA 5GRUL 3MYJB 1MCDA 1PEZA 5KSBE 5GGVY 1VADA 3IKKA 3CPLB 4OLVH 2MHAA 3KYMB 1UWEH 3C60A 2ED9A 4DGIL 4WI3A 1T0NA 3BN3B 3JZ7A 3VXNA 1FNHA 3FMGH 4JQXC 2X4NA 1FFOA 4MS8D 3SQBA 5GGTH 5IHUL 3CVHB 1QSED 4M6MH 1ROWA 1YY9D 3GIZL 3ZDYE 1T0MB 3WIHL 1S9KC 4QTIH 1FRGL 3LH2L 4C56D 3FO1B 1A6UH 2LTQC 5CSGA 5C92A 5F1KC 3X14A 2WINB 3QEQD 2PW1A 5I30H 5EUOF 4GKNB 1UYWH 4Y4KA 1MCIA 3HC3L 1YZZA 2ZPKL 3MBEC 3BVNA 3GMPA 3H2WA 5DMYA 4UQ3B 4JPVH 4YHLL 3VFTB 4H0IA 5HHME 2IBGA 2LFGA 3OZ9H 2W07A 4S1RL 5I8KL 3WFZA 2VXQL 1NGWB 2EH7L 3FFCB 3VXMA 4LPWA 2N7AA 4YHPA 3U0TB 4XGZA 2BFVH 2FWOB 2YC1B 4P5TC 1YEHL 4RGOL 5AZEH 1GGBL 4P46A 1IKFH 5I66A 5DYOA 2XG4A 3WXVH 3UC0L 1KELL 3EO0B 3Q3GB 1HYRC 4PRAA 3DSFH 5GXBB 5EUOA 5DMJB 4MSWA 2DJ4A 1JL8A 1X5XA 4K3HA 3MRNA 4J3TA 2I9TA 1BFOA 3Q0HA 2AP2A 2AEIT 4JQVA 3ZKMC 2VITA 2Z35A 5CZKA 4FQXA 1Q8MA 4GKSB 4QLRA 2VZUA 5BV7B 5EU3B 3VD9A 3MO1B 3S88H 5ERWA 5I9QB 3ARQA 2AJVL 4HG4K 1G84A 4MWFB 2AABL 5E56A 3HNSL 4KK8C 2J2ZA 3ZYIA 2FLBT 2HFEA 5GGSY 3B2VH 4YBQC 4AMKL 5T5NF 4JFOA 1I1YB 3EYFB 2DD8H 4WHYG 1DE4B 3WO4B 4XP1H 3LOWA 1S7UA 1CGUA 1U95B 2IC2A 3HE7D 4PRHA 2ZSVA 1D9KA 4M62L 2FJHA 3DECA 3L3GB 3N9GL 4NQDA 4FQ2H 4HH8A 3WIIL 4CBPA 3DV6A 4OBSA 1INQA 2IAMD 5JHDA 4RAUB 4HS3A 1EO8L 3C6SA 3L5JA 4PBVC 1H3PH 4R8WL 1TJIL 1U6AL 4ZUTA 3V7AG 4GAYB 4NNPH 4OD2A 2EKJA 4YEFA 1XCTA 4H8WL 5MEOB 3HRZB 4ONHB 5I19H 5ACLA 2W9DH 4G9DB 2EYSA 3L3IA 1T2QH 3PWJB 3UZVB 2VDML 5CJ8A 1OSPL 1JHLH 5BCAA 4U1JA 3WYRA 1SEQL 1DLFH 4IMKA 4LDLB 3E2HB 3F7VB 4OIAA 4F7CA 1OAZH 2LU4A 3U0WL 2V7HB 1UJ3C 4H26A 3CVHL 5TH2B 2FX7H 3ARBA 2EXYC 2OL3B 5GS2D 3VA6A 1CD1A 5DMIL 1UM6L 3U30B 1A6TB 5TQ0H 1I8LC 4WEBH 3TPKA 3DUUA 5ICZB 3FOMA 5F3BA 5JXED 4RFNB 5DD1L 5IK3A 1MVUB 1UENA 4HEME 1CLCA 2AJXL 4Y1AB 3RL2A 4G80B 4U7MA 1A7RH 5GISL 2ZOKA 1CF8L 1EEYA 1HI6A 3RTQB 1K9TA 1WIOA 4K07A 5JW3L 2C3VA 4P4KB 5T1KB 1OWRM 3BPNC 4HGWA 2NW3B 4OLEA 5FXCH 5GJTL 5GGSA 3WMSA 4DKAA 4IRJB 2GK2A 1IAIH 4NHCL 2RGSA 4PUBH 3PNWA 3R0NA 1PLGL 2YN5A 3SDXE 4HC1H 4HWBA 3VMNA 3C5SA 2W60B 2X9YA 3QPQD 5ISZD 2E7LC 3TA3C 3NZ8A 5DHVA 1B4JL 1ZOXA 3VFVB 3KYOB 1WTGT 4TN9A 2GFBB 3OAUL 4EI5D 4ZO7A 1CTOA 1R5IA 3ROLB 2VLLB 1EH9A 5FO7B 1ZS8A 1JWSB 3OKOA 4ZS6D 4LLMA 4PJ9D 3UTSA 3TCLA 1KFAL 4L3CB 1Q9KA 4KVNL 5GGUA 4EBQH 4XHJD 2CKBA 1HHJA 3OJ2C 1FSKC 4G9FD 5BV7L 4M6OL 3Q1SL 2A6JA 4H1LB 4HF5L 3AXLA 2YMXH 2Z31A 5EU5A 5GIRA 5FECB 1HEZA 3RL1A 2IGFL 5D6DC 2YPKA 5I1LB 1YYLH 1KB5B 3EYVB 4EXPX 4PRIE 1LO3H 1OAKL 5A2KH 4OFYA 4LSSL 1PG7H 5JOFA 2A6DB 1FH5L 3MJ9A 3GMLB 4K8RH 1MIMH 4I77L 5T33L 3BXNA 4Y5YC 3LRHA 3UCRA 1XIWB 4IJ3B 1ZLWH 4OZHF 2RHEA 3JWDH 1N64H 1VEPA 1GZPA 4NCC1 3VFWB 4KROB 1I1AA 1N7MH 2AGJL 1OARH 2QQLL 1MCSA 1XT5A 2ZUXA 2MQ0A 1S9WB 4N8PA 1UZ6F 1HSAA 2PTUA 2D7TL 4IRSC 1QYGL 2KL6A 1A21A 4HMEA 5EOCH 4DTGH 4ZTOH 3VXTA 3O11A 3M1BB 2K7PA 3G04B 1KJMA 2Y7QA 5ELIA 3H9SD 3W0WE 3SY0B 4DZBA 3F6LA 4XWGL 1UH2A 5M94B 5TDPA 4OZHA 4S2SB 4GMSL 4YAQA 2HLAA 3CDGB 3MRLB 4P57A 1R3JB 4S11A 2CMRL 1FIGH 4KQ3H 5TPWH 1Q38A 1D5IH 2WWMD 4NBZB 3O3AA 5K9KA 4OQTA 1JV5B 4HH9A 1WK0A 1RJLA 1YEFL 4R7DB 5IF0B 4M1DH 3LS5H 2P5EE 3R1GH 4HT1L 3QNYA 1T4KA 3RWHB 1JUFA 2F19H 2BSED 4PJDF 3SDCA 1QBBA 5CLTA 1T1WB 1ZK9A 2HRLA 4NKDA 4NP4L 3X3FH 4KDVA 4WW2B 1NCWH 3I75B 3O4LD 5JIKA 2YPLB 3NAAL 1EJOH 1VB9A 4KQ4L 2D7QA 3TBYB 4LLWA 4B7LA 4FQCH 1F97A 3ARFA 3C9NA 3KPOB 3QRFM 4XP4H 4YR6A 1VFUA 3OKMB 2R0LH 3ZKQD 4WI7A 3QDJE 4M1GL 4DUWA 2D4DA 3ARDA 4KRPC 5T3XE 4CVZA 2BJMH 4OUOA 4XC1L 1NCNA 1LMKA 1TZGL 2AJYH 4G42B 5KVDH 3ISWA 5FA3B 4MX7A 12E8H 3KJ4C 3NA9L 4NNXA 2O5XL 2ADGB 3OV6A 5C6TL 5IVNA 4DZ8B 5AD0B 5C1MB 3ZLQC 5D1QA 4O5LH 4XVTL 4GS7B 3ARGB 5D70L 3TV3L 4NZTH 3NFSL 2R23A 1DN2A 4HS6A 1JF1A 1A2YB 5SWSB 1YUHA 4P23A 3CFCH 4PJIE 3DIFB 2PO6A 4YNYA 4NCDA 4YDLB 4PBWD 5I1DB 3MRJA 4GKOA 4Z0XA 2BSTA 2AV7A 3T0VA 1HHHB 3B6SA 3B9KD 4IDJH 1JGVL 3FFCD 3UJIL 5CKAA 1NGYB 1U2HA 4N0CD 5DRZB 1H8NA 5DMGD 3RWIA 2GTZA 2XZQH 5KVMC 5CSBA 5E6IC 1FORH 4I48B 1AXTH 2HN7B 3ZHLA 3TGXA 1SYVA 2VZSA 4DVRL 4XVUC 1B0GB 4MNHA 3NFPB 1BEYH 3TYFA 3QCVH 3I6KB 1GGCL 3ES6B 2YPLE 3TT3H 1F45A 3V0VA 4U2YA 2HKFL 3BPCA 1UFUA 1BZ7B 1UXSB 5BS0E 1GPOH 5C0EB 4H20H 1JGDB 4NN5B 1QFPA 3AVEA 5CEYB 4WWKB 2YD8A 3MCKA 5E08L 1LP9F 5H37G 4FNLH 4JRXD 1PG7X 3U6RB 2BCKB 2VXTH 1GOHA 1Z0MA 3O2VL 5INCB 1S5IH 3BT2L 5GRJH 1XF2B 4D2NA 4XVJL 2RAMA 3CSGA 1IC5H 4U1SB 4WHTA 2VLKD 1BQLH 1PQZA 4NHUB 1GAFL 5DFVC 5C8JA 4V1DA 5F70A 4W4OC 1E4JA 3RX5A 2C26A 4LP4A 1A5FH 3OR6B 1UXWA 4OFDA 4WRLA 5AYQA 4YHNA 4Q6IC 1QG3A 3DARA 4PJFF 4RA0C 2V5TA 5IIEA 3NIGF 5LCVL 5FYJE 2CK2A 3HC4L 1VERA 3FQWA 2Q3ZA 5FIEA 5JO5A 3BH9A 4EN3B 2WZPD 5D7LB 4TOYL 4HKZA 3F58H 5CSZA 2HLFD 4FQIL 4NJAL 4WJ5B 2V2TB 2WM0A 4WTWA 5CFHA 3QDJA 2X4PB 4FXGA 3AREC 3BKYL 4OZGB 2R1XB 1OT2A 4AJ0A 1CFBA 1A0QL 1CQKA 1X5FA 3IF1A 4Z18A 4Y16B 5L2JA 4NSKB 4PJFA 3ME0A 4GRWF 2E5EA 3HG1B 3NH7L 2EIDA 1KIPB 5A40E 1IC4L 4Z78A 1Y18A 1FDLL 3X13B 2VISA 25C8H 3P4NB 4YDKH 5B39A 3H0TA 5FYJL 4UOW1 1FLRL 1KCVH 3PDOB 1FYTA 5IB4A 4P3CH 3TNNA 4P9HH 1U93B 5K9QG 3KPNA 5DQJB 4LSUH 3MLYL 4AEFA 4Y1AD 3OWEA 3M17A 3O2DL 4PJIA 1AE6L 2FNBA 3NCFB 5MP6H 4OF7A 1Q1JL 3RTQD 2NY6B 3WNKA 3VWJC 1IGTB 3U4BL 5I1CL 3EOBB 1OSZA 5HHPB 3I3DA 3QCTL 4IRJD 4OI9A 2HFGL 4MB5A 4NO0D 2OQJB 4FXLA 1LNUB 1N5AB 4GW1A 4G7VL 2R8SH 1VFMA 3RVVC 4HDIB 5I1EL 4WY7L 2HVJA 5IP4A 4PGBA 4L4JA 3LKQB 1HXMA 2MKWA 1NDGB 5HGBA 2HTLC 4LSQL 2HT4C 3Q5TA 4L29A 3WUWB 2QL1A 3JV5A 2A2QT 2X05A 5H35A 5JMOC 2O26U 3QNZA 2BY2A 1D5MB 4PRPE 2OZ4H 2MPAH 1IGJA 3ALWA 4XWOC 5JA8B 3RWFB 1BLNA 5L9DH 3GI8L 4TUKL 4Q9CA 5DJ0B 3UP1A 5GS0L 4J4PA 2W92A 3KXFB 2D0HA 3DJ9A 1YA5A 5FM5M 1EHLH 1N4XL 4PR5B 3B9DA 1F4HA 1HDMB 2CSPA 4ENEC 4ZO8A 1UH4A 5GS1C 3DO7B 2XPGB 3VGBA 3MBXH 1CIUA 2DBLL 2YZ1A 3IXAA 4K3EH 1A4KB 2V2WB 4OZGE 3FN3A 3E3QE 3D9AH 2OS7A 4OCYH 2NR6C 4LPYA 1YNLH 5DD0H 1HNGA 5I8OL 4NQXB 3BP5A 3MV01 1RZGB 1JK8B 2QR0B 4UQ2B 1EFQA 1B90A 4YPGA 1ZLSH 3VRJA 3K2MC 1CFNB 3CFBA 2A6KB 2JK5A 5DD6B 3KPRB 4YXHH 2F74B 2E6PA 4Y4HB 2HWZL 4KROD 1AGDA 4KKBC 2SEBA 2XZCL 2OMNA 1TQBB 1RZKC 1EPFA 5D7JA 2J8UB 1XGQB 5L2KE 1MCEA 1P84J 4JJ5B 5C7XH 3MR9B 3CUPB 1DQMH 3GRWH 1UB6A 4OCXH 4Z7NF 3G5XA 2VDNH 5HHOB 3VI3E 5H94A 3GM8A 5I1KH 1AD9A 1CE6B 1GZQA 5D72H 1FZKB 1ZVHA 3VRIB 1XF1A 5B21A 3O9WC 3OKKA 4EJ1C 1FCCA 4CDGC 3BKML 1CU4L 1E6JH 4QRUA 2R1YB 4ZPVA 5FYKU 2AV1B 3LPGA 3L95B 1I7UA 3QCUH 3WLBB 1Z3GH 1IAKA 2P44B 1U8OB 4JG0L 3LN5A 3CLEH 1TJGL 4NFBA 4RQQB 4MJ2A 3VFSA 4IIQB 5BVPH 3I2CL 2VR9A 5SX4I 1KSRA 5HDQL 4P2OC 1ITBB 2RIKA 4HPYH 4UT7H 3JXAA 4AZ8A 1MWAB 3EYQC 3MA9L 4CUCA 2JB6A 1KLFA 2YSSB 2VDKH 4XMKH 1DFBL 3U48A 4OTXH 1RUML 2AW2A 1D6VH 5DVOA 5HJ3A 2CLZA 5FUZL 5FYLE 3S35X 1CXLA 3FCTB 4BM7A 4EUPB 4WI4A 3P0YH 3QIWA 3PABB 1DCLA 4RIRA 3EUUA 2P46B 3BQUD 3EJYD 2HT3C 5E99L 2WANA 3MPCA 4DUXA 2OM5A 3O8XA 2UUDK 4HJ0C 4BFIB 4ZYKB 1JNNH 4D0CA 3F5WB 4PJGB 5B4MD 2IPTH 4KI5E 5DC0A 4FQHA 4GXVH 4PRPA 5I74C 1R3LB 4YK4C 2B2XL 3SCMC 3F7PC 3GSXA 5E03A 3D25B 1GC1L 3EOTL 2W9EH 2NXZC 5SWSD 1FNGA 2HTKC 1JTOA 2DM2A 1CL7L 3ZTJG 2NX5B 4EXKA 4GSDL 1YEIH 1FV1B 2H8PA 1CWVA 3P4MB 5AWNL 4HW6A 5JA9A 5IMMA 5EZJA 1MCCA 2CDFA 5MENE 4HG4J 3LN4B 3QXVA 2VH5H 5E2TL 5ICXB 3QQ4B 3RWGA 4OCWL 4Z8FL 4NRYB 4I0PA 1LO0H 4KKNA 5CWSB 2H2SC 3RZCB 1AQKH 1MHEB 4U7KA 4L9DA 5KVGL 1LILA 4PJHF 4LGSB 5ID0B 3CFKB 3RI5K 4TQEH 3GMRA 5JORB 2FJFA 1S7RB 4MDIA 4PV9A 3AFLA 4HJGA 1JGEA 2YD9A 5GS0D 2AJUL 4NN6B 4JFED 3WBDA 5FHBH 5C3TA 1MUJB 5HGGS 1Q94A 5CZXC 4WWKD 1RK1A 4ZXBB 4EDWH 3SE9L 3GUTB 1EMTH 5DDHA 5ALBL 4YHOL 4AYFA 5HYJD 5B8CA 1HH6A 3PGCA 3I3BA 4YXKH 3TPUA 4S1DC 4K94L 1WCBB 2B4CH 3TH3T 2D2OA 1LDSA 4PJHA 3VXRE 4N0YL 1NLDL 5CJQH 2PXYA 4X8JA 4WGWB 4XPBH 5LQBL 2AQ1A 1IC7L 1SY6H 4DCQA 1TPXB 5L7XL 5F7DB 5MI0B 3L3OA 3HI1A 4LIQH 5FHAH 2R2EA 1SJHB 3EYUL 15C8H 3DRQA 2NXYC 1YNKH 2HYMA 4BA8A 5DUMH 4RWYL 5IMOB 1RIUH 1VEOA 4JRYA 1NAMB 2ERJC 1BIHA 1ORQB 1KCRL 1JPFB 2H1PH 5CD3A 2IANE 4NKOA 5D1ZB 5J4MA 2A77H 5DWUH 1NGQH 1FCGA 4URTB 3QZWA 2WP3O 4EN3D 4KKLD 2RFXA 5D7LD 2NX5E 1ZT4B 1OGTA 2M26A 4J2XA 5D7SH 3BEVA 2MHAB 3HNTL 1CCZA 3C60B 4PRBB 2VKXA 3CSBA 4LHUA 4XB7A 1BBDL 2AJZA 2VQTA 4P2QA 4GFTB 4Y16D 2VN7A 2ATKB 4F15B 1FHGA 3LQMA 4CU8A 3HG1D 3LEVH 1FGNH 3S4SB 3HKFA 4JY4A 3FO9A 1JIBA 1F6FB 5DEFB 4P4RB 3DV4A 2DDQH 4MZ3A 4RGNE 3C8KB 1DDHA 2HJLA 4M93B 1MJ8L 2CIKB 3QI9A 4LRIA 4QTHB 3GJFH 3MJ6A 4OD3H 4GRMB 1XGYL 3G6AA 1AHWC 3IDUA 5J13C 1QLFA 4Z7WF 2Z92B 1CGSH 4R97B 5JQ6H 1T1ZB 2A73A 2YUWA 1CYGA 1P4LB 5EZLA 1GJIA 4FG6C 1S3KL 1Z9OA 4XGZB 4CU7A 4N8CL 3PP3K 1BFSA 1NCAL 2JB5L 4GLRH 1HN1A 3UJJL 1ONQA 2YPVH 5I66B 4OZFB 3W82A 2W9LA 2QQNL 5IT2H 4WUKH 3VE0B 5A16B 2X1WL 5C9JA 2MKLC 2X4UA 2ICWJ 1CE1L 4PRAB 2HRPL 2ZCKL 5EUOB 2E7CA 1IFHH 1EGJL 2ZJSL 2BX5A 4ESKA 3GMQA 4R26H 4J23A 3KNBB 2I9TB 3EBAA 2WUBL 2X2YA 1G7PA 4U1LB 3VRLE 6FABH 5IG7B 4MCZA 3M8OL 2VITB 3IS0X 5E2UH 3QEHA 5CEXB 4JCMA 3TEUA 2NY7L 1ZA3B 4L8SA 2CLRA 2JJSC 3KXFD 5DD3L 5ERWB 3B5GA 1G6RA 4LFHD 4XAKD 3S34H 2R29L 4JFDB 5FOBA 2GT9B 1BJ1J 2EDLA 3HFML 4HS8L 3SGDH 3C6LA 1MPAH 4WUUA 4JFOB 4F3FB 1A1OA 5DMKA 1U8KA 2WUCH 3HZYA 4MA7H 5E94B 2BERA 5EO0A 1K8DA 3RDTA 1W0WA 3HB3C 4HX1A 2EZ0D 4QOKA 4LEXH 2R0WH 4QHLA 4KJWD 4F7EB 1RIVL 3S97C 2AK4D 2FJHB 3OJDB 2FBJH 1DBJL 3B3IA 1KEMH 1PYWA 2Q1EA 1CZ8H 3NPSB 3KPRD 5JHDB 1CD8A 4Y4HD 1SBSH 2XY1A 1NAML 3C6SB 2DQGH 2IANA 1OTSD 3RIFF 1K4DB 3QHZL 1AR2A 4TUJA 4ZUTB 4MD5B 4OD2B 3MREA 3FQUA 1ODAA 2ZSWA 2VLRE 2DS4A 3K3QA 4MAUL 5HHOD 2XKNB 3L3IB 2R69H 3O6FC 3TO2A 3WFBL 5L88H 1A7OH 1KN2H 4WW1A 3IVKA 3NFNA 3NN8A 1M7DB 1KPRA 2EIZB 4BSWA 5I8CA 1UACL 2ZUQB 3X17A 1TVBA 3P0GB 3KGRA 4K8RC 4IS6B 2L7JA 4JO4H 3U7AA 3INUL 4B7IA 3MCLH 1JTPA 4HLJA 4OGXL 4ORGA 2GY7B 5L6YL 4LVNB 4TNVF 3JWDC 1NCDL 1A7QH 1IGML 5HVHC 2NY3B 4JQXA 2WQRA 3IYLW 3FOMB 4KY1L 5CCKL 5F3BB 1JYXA 1UB5A 2EYTB 1H15B 3RL2B 5EULV 1CQYA 1EO7A 4LKCB 5AYUH 5ADPL 3KYNA 1SVCP 1WIPA 2DQEL 5L0QB 1MREL 2ZOKB 4BZYA 2P5WA 4O2FA 5GZNC 5HYSG 4FQ1L 3KYAA 3HE6B 2NY1D 1G7IB 5GGSB 2CGRH 1YQ2A 2X7LB 2CJUH 3MBEA 3R0MA 3OHXA 1QNZH 1BM3L 5IB2B 3PNWB 2F58H 1J8HE 3W11D 4WWID 4E5XA 1KPVB 1OP3K 4KGLA 3WFEH 5IMLB 2X89D 5TFSH 1NDMB 2Y6SD 3BZFA 3U0PA 4ODXB 5D6CB 3H42H 1WICA 1IGYA 2BVUA 4P5TA 1L6XA 1FZOB 1R5IB 4RMSA 2B0SH 2GW5A 4ZNEE 4LLMB 1CGYA 5AZ2H 3NACL 4MD4A 5FK9A 3O2WL 5GGUB 4KWUA 4GG8A 5GRVK 2K7QA 1HHJB 4L8CA 3PDGA 3UPRA 1F90L 4Z7OF 2VUYA 4LAJH 5DD5H 1MJUH 3QUZB 5AUMB 1G9EA 2Z31B 4WU7A 4RMUA 1U41A 3T09A 3RL1B 4N8VG 3G6JE 3EDKA 6CGTA 1A02N 2Y4SA 3CFEB 2DLFH 2CO7B 4LPCA 4ONGL 4K7PL 5CHNA 1TTFA 4DAGL 3ARTA 1RY7B 1RZJL 5A3IC 1QRNA 2NLJA 5C0AE 1ADQL 1KJ3H 1RU9L 4LMQE 3DVGA 2FL5A 2JELL 3LV3B 1AGBA 4QGYA 2IPUG 1I3RA 3ZSTA 5IFHH 5DR5L 4ODHL 4L5FL 1GZPB 3RZCD 2OI9B 4OF5A 3PWPA 4OLYH 1JNLH 1I1AB 4JO1H 1X44A 1YN6B 4OGYL 1U8HA 2YOCA 2DQJL 4DGIH 1NBQA 1BZ9A 1I9RL 1HSAB 2IFFL 4WGVB 1H0DA 5E00A 3REWA 4X83A 1CVRA 4QRTA 4MJID 4ZFGH 4Y8AA 4FQQB 3EYSH 1DN0A 5HSFA 2VLRA 1Y6NR 3VDBA 4ZXBD 3ILQC 1X7QA 3GIZH 4Y5XC 1KJMB 2H3NA 5IWLA 4HIIA 4ZSOB 4F7MB 4JPWL 2E7BA 4X5XA 3LH2H 5I1JL 4YAQB 2HLAB 2J5LC 4HUXA 4P57B 4U1IA 5D2NC 5DJZA 5A2LH 5GSRA 4I2XB 3PV6B 3HC3H 3PJSB 5D96B 1INDL 1FVEA 4RFOH 1AQDB 4XNUL 1J05A 1HQRB 1T20A 3VFMA 4YHLH 4X9GA 5CKGA 5TDNB 2IMNA 1T4KB 5I8KH 5IW6A 3DTXB 4O9HH 3WKML 2EH7H 1IRAY 3SDCB 4TRPH 4NKDB 4W6WB 1UJ3A 3LEXA 3WN5B 1VGEH 3NIFF 5HGDA 4DKEH 1FQ9C 1I8KA 3UTOA 5HYIA 2AXGA 2VERN 3BDYL 3ULVD 1KCKA 2VZVA 1OTTC 1M4KA 3GMNA 5GHWL 3UC0H 3CLFH 3DX9A 1I8LA 2OXHA 3ARFB 1FL5A 4BFGA 3BUYA 2BNUB 1ZANL 4HGKC 1WVZA 5SX5K 2Z93A 5GRWA 2VB5A 5IOPB 4Q74A 3C60D 4D3CH 1J8HA 1U42A 4PY7B 3WJJA 2UZXB 4GOSA 2NTFB 3WL9A 2OTUA 3OSKA 4JHWL 1YMMB 3FB7B 32C2A 1T21A 3OAZK 4PJDB 4I3GA 4MX7B 1MIEL 5KAQF 2R4RL 3GSWA 2DI7A 3DXAA 3TIDA 5EN2A 3SN6N 5I1AA 3STBA 3F12A 4F7TA 1JHKL 1Q9WB 5SWZB 3FB5A 1I85C 1MCBA 2E7LA 2AJVH 5FGSA 3WJLC 4NRZA 2R23B 3TA3A 2V5MA 3VXUA 2UVFA 5F7UA 2I24N 4Y4KD 5HDBF 4HWBH 1MVFA 5IHLB 5TF0A 1GRWA 3VDCA 3BP4B 1A4JA 3QUMB 3MRJB 2X1XR 3QQ3B 1U92A 5DHVH 3G6JA 2X70A 1MRDH 3BRGC 4LCCC 4UB0H 3B6SB 3EW3B 5KTEH 3W39B 4DEPB 3WIIH 3VXMD 4JFPB 1PKQB 4OCRH 3ESUF 4ZSOE 1H3UA 3ARWA 4P46D 3QDGA 2Q7YB 2GTZB 3MJ9L 3SGDI 3BESR 5C0AA 3C87A 5D6DA 2CKBH 4HMDA 3MLZH 3HAEA 1WCQA 2QSVA 3VFOA 5A2JH 3MFFB 2HVKA 4R8WH 1Q9LB 7CGTA 1QBLL 3BIBX 4LLDA 1BF2A 3V6FB 4LSPL 1AO7B 2J3SA 3B9AA 5J6GA 3QJHB 1D6EA 1BIIA 4MNHB 2YKLL 1AR1C 1RJYA 1J1PL 2YWYA 4Y5YA 1OSPH 4P9HC 1EIBA 3V7AE 4KJYA 3T65B 1QUNA 1EX0A 5IBUB 4YWGL 1TVHA 3IETB 4CW1A 3GSOB 2CK0L 3ZE0F 2NY0B 2XTJB 2VAAB 1FZJB 2P8MB 4NN7C 4OKVA 2EEBA 1OW0C 3IFLL 1HYSC 2EXWC 1EK3A 4BZ2L 4LCUB 1DBAH 4WDIB 3VJ6A 4IRSA 4X4ZA 5MEQA 2AEPL 3WFDL 4I8DA 4WHTB 1I1FB 4JVUA 4XXDA 2Q76B 3OGCA 1I9JL 5DD1H 5E4EB 2V6HA 2AJXH 2I60L 3MRFB 4BZ1L 1LE9A 1MRFL 4MB4A 5GISH 1NFDF 5GQBA 4CMMB 5JHLH 1QKZL 1QHOA 4RISL 4OIIL 1CFQA 4QRRE 2F54B 4QRPE 5GJTH 5JHDD 3O4OB 1RHHB 4NHCH 3H7LA 1LP9B 3P11L 2GJ6B 1JZ5A 5ITBH 3VI4F 4ELKA 5E1HB 5ITFB 2J88H 3HRPA 5T3ZL 1L0QA 1V7NH 3ET9F 3G6DH 1ES0A 5CSZB 1TJHH 4OQTH 1B4JH 1T22A 3FQTA 3FQXA 4FXGB 1AGCB 3FQRB 4JDVB 1IM9A 2QSQA 3RWJA 4JJHA 5F89A 2ED8A 3PGFH 2JJVA 3IF1B 1KFAH 4KI1A 2G75B 3T0EC 1NANI 4KVNH 1D5ZA 1KYOK 4PJFB 5K9JL 3HI5L 3IDIA 4G8EA 1A7PL 2P4AB 3V52H 4KDTC 4FMFA 3VD4A 3Q1SH 1OAXL 1JGLH 5C2BH 1Y18B 4HKJA 3QXDB 1AO7E 1J87A 5B39B 2IGFH 3FFDB 2OX5A 1WUNT 2FEDC 2NY3D 1FNAA 1K4CA 4DGVL 5FCSH 1AKJB 5LAXA 3CH1A 2FIKA 2EDOA 5GRYA 1OAKH 2FJGA 5C0RL 2HAZA 4JZOB 4LSSH 3AY4C 3P77B 1OHQA 3DOSA 1ACYL 4S1QL 3QUML 5EO1A 3F6IA 4X9IA 4I0KA 5FKAB 4GRWB 1S9YB 3MOAL 4NNYA 4KK9C 4A6YB 2FYYB 3OG6B 4KDWA 4JFXB 2RB8A 1Z0NA 4IDLA 1G9MC 2KDGA 3EIFA 1DBML 3L1OL 4RRPG 5HGBB 2OJEA 4U4BA 1LHZA 2GUOB 2CXKA 1IQDA 3K46A 4L29B 2H2PD 3RVTC 4O2CB 4WI8A 3RVXC 2W91A 1I9IL 3UTSD 2F54E 1UCBL 5E6IA 4A2MA 5KN5A 1YY8B 4QNPF 1FO0A 3D2UB 3TO4C 5I75B 3FB6B 4X4YB 1UM5L 3C2SA 1MFCL 4QXWA 1LEGB 3RHWK 1XZ0A 1BD2A 5DJAB 1WEJL 3V0AC 2Z31D 4K2UH 1JBJA 3AM8C 4M9OA 1T7YA 3IXAB 3HMXL 2V7NA 3T1FA 5GRXG 4JFHE 3V6ZB 4JY6A 4JPKH 2EDJA 4NFDA 1FE8L 1A3QA 3QUYC 4MAYB 5T1DH 3VFUB 3NAAH 5HI4D 2D7OA 3G08B 4NWUL 4BSVB 1YJDL 4KQ4H 4YIQA 5KOMC 3BD3A 3WE6B 3Q5YA 5A43C 4QRRA 3ZL4L 1I1AD 1QEWA 3H8NA 4W4OA 2SEBB 4M1GH 4M7KL 5E2WH 4ODUA 5EU7E 4BQ6A 1G0DA 3TIEA 4Q6IA 3DGCR 3SDAC 4XP9H 1UB6B 1TZGH 3EJZC 1EA9C 3WXWL 1FPTH 5IHZB 1YECH 3KAAA 4OV5B 1E4WH 3DMMB 5C07E 1T7XA 5D70H 3TV3H 1KN4L 1BAFL 3NFSH 4B50A 4YPJA 5DVLA 2GEEA 3K8KA 5ESQA 2UVEA 1IAKB 3AREA 5I8EB 1YEDB 5IKCB 2QADB 3N50A 4O02H 3OB0H 3VFSB 1F6LL 3FRPA 4OB5H 3A6BH 1G7MA 1XR9B 1R5WB 3AB0B 3R8QA 1EFXA 1S8DA 1ND0A 3SDCD 1DANT 5T3XH 3QG7L 5F6IB 2FCBA 1IAOA 2X4RB 4LPTA 4Z7VE 1H3XA 3D3VB 3UYPA 3C09B 5KSAA 5T3ZD 1I3UA 1R5VA 4GBXB 3GSVA 4IMLB 1B6UA 2X4QA 1GL4B 1T6WA 3ARFD 2XV6B 3EJJX 3MSPA 3QO0A 3L3DB 1A14H 4KMQA 1N3NA 4MHHI 5FV2A 1Z5LA 1MQ8A 4A6YL 3QXAA 1BJ1H 4Y88A 3L7EB 3RIAF 4LPUA 5EDXA 2A9ML 1RJCA 1BMGA 1ZHBB 3P30L 3VWJA 3L9RB 1AH1A 1YMMD 1ETZA 5J6HA 3OB8A 4NUGH 4EI6B 4E42A 2DTMH 1RZ8B 4QHKI 1RZ7H 3JWOC 2P45B 1YQVH 2R2BA 2EDFA 3MUGB 2H6PB 4JR9L 5SWZD 5D1QD 2A83A 4LQFL 5CEZE 4LLYA 2EE2A 5K9OB 3GSXB 4C58B 3BT2H 3HCVA 5JZ7D 4TPRH 1FNGB 3I85A 1J1OH 2OMBA 3G5YB 4OM0H 3DETC 2PO6D 1GAFH 3UTTE 1YPZF 1CFSA 1XR8A 5HHVL 1PDKA 4JFFE 2O93L 1JF5A 1F4WH 5F9JB 1VGKB 1G7QA 2KH2B 5IGXL 5CINL 2L7UA 4EDXA 4Z7UF 4MXQD 1XGRA 5B22A 4P5MB 5JXAH 1JYWA 3GSRA 4IOIA 3NCJH 1IAMA 4NZJA 4OM1H 1HILB 1F4AA 5GS1A 5GRZA 3U2SB 2RR3A 3SEPA 3BKJH 2BSRB 1HSBA 1K5NB 2ITCA 4FQIH 2C9AA 5E9DB 2P8PB 2F8VA 1YPZA 2ADJB 1N0XH 1JWMA 3GMRB 4L3EB 1H9VA 1MCQA 1JGEB 4ERSH 1MF2H 5ILTL 4J3WA 4KC3B 4X6DB 3GB7A 4RGMC 3LKNA 3MLUL 3V4VL 3CNKA 3MLRH 4WO4C 5CP7B 3ZT6A 4NYLA 2BVPB 4FFVC 3PGCB 5B8CB 3TPUB 5C07A 4N0UA 2D3VA 1CDIA 5IROC 4LSTL 1RJZA 4X6BA 1OAUL 1NMBL 4HPOL 4AQ1B 2PXYB 4V1DD 4X8JB 3O2DH 4DCQB 3O9WA 3JWNC 3ZDZF 5FYKH 1Q1JH 3QG6B 4ZFFB 2IH3B 1RUAL 5GGQL 3LIZL 1M05A 2AS5M 3QCTH 4JRYB 5H8DA 4OKDA 1WF5A 2GJ6D 4JZNB 2G60L 3IDMA 4G7VH 2RFXB 4WY7H 1K8IB 4P2OA 3EO1A 5FF6A 2VE6B 2UZYB 1ZHKB 3HNVH 4APQB 1Z9LA 3IFNH 1YY9C 5D5MF 5DO2D 3MLWL 4LSQH 3BEVB 3QDJD 2FHBA 1I3GH 3EGSA 3C5JA 5T3XD 4JFZL 2XQBL 3QXTA 3SPVA 3A6CL 1A9BB 5DZOA 1P1ZB 3UAJC 4PJ7E 4TNWF 4P2QB 2AERT 4ZDHB 5DRWA 5TJWK 1BQHG 1S9VB 5F9AC 4HBCL 3RJQB 4TUKH 2VDPL 4UBDD 1DQQB 5ENWB 1WFNA 2IBZX 1E6OL 1CD0A 1N4XH 4N5EC 4L8BB 3T77A 1V3MA 4BQ9A 4OZ4A 2HJLB 4KTDL 4U6XB 1KTDA 5T1LB 1BBJB 1FYTD 1ZVSB 3MRMB 4NBYB 5J1TC 1HINL 1VPOH 3FKUS 3G6AB 1QLFB 1M7IB 3VH8B 3UTTA 4X6CF 1U91B 3LQAH 2V2XB 4OLUL 4X6DE 4N9GB 4XTRC 4HUUA 1KCLA 3SCMA 5EZLB 4JFFA 1H5BB 2APXA 2NY4B 1F42A 1NUGA 3VWKB 4YGVB 1BJMA 1ONQB 5EIVA 2HWZH 2DWEB 3DI2B 4AEIH 5MEPA 3TFKD 5M95B 4KK5C 4OUUA 1KEGL 4AENA 4JN1H 3MV7A 2GKIA 1MFBL 4CADB 4MQSB 3VGDA 4Z7WB 4K3JL 4X6CA 2PW2B 1OPGH 5GGTA 4MCZB 2FR4B 3P4OA 4KK6D 3QEHB 3DUSA 2IQ9H 3D2UD 1CU4H 1I8MA 4PGDB 3TBSA 4NO2B 4XP6L 2DQCH 2VNCA 4LHQB 3RFZC 4PJXE 4L4TB 3RA7H 4HKXB 1R0AL 5FA4A 4QCIA 4YC2C 5CP3A 1AP2B 2Y25A 5JIHA 3I2CH 3DUHA 1A1OB 1N5YL 4POZD 2CH8A 4HK0A 3HZYB 1IGFL 2NY2B 5EO0B 5FUOL 1K8DB 3RDTB 4S1SH 5DJYA 3GBMH 3UPAA 4HX1B 3MRRA 4PJCF 4QHLB 4ACPA 4IM8A 1DUYA 3SGJC 4NC1C 4KZEL 4QHMB 5KS9B 3B3IB 9CGTA 4LCWE 1A3LH 1BOGA 3MODL 3SJVE 3E6HA 4ONFL 1X5IA 3IDGA 1EEUA 3JUYA 4KKAD 2YUXA 5EBLB 2WP3T 5D7JD 5E99H 3FQUB 1CXEA 5FYKD 3N06B 2ZSWB 2VXUL 4QY8A 3UMTA 4MNQA 1TDQA 1MAMH 3QWOB 3TO2B 2IALA 2YK1L 4PJCA 4FTVE 3PGDA 4ODWB 5E2VL 8FABB 4WW1B 1E27A 1A1NA 3NFNB 4X98A 4PJ7A 3JVGC 5DK0B 4BSWB 1B0RB 1GC1H 3S98A 3WNLA 5F1OB 5I71C 2IADA 2Y9RT 1CT8B 1TZHB 4JAMA 3ZMRA 1X4YA 5C2UB 4KZDH 1S7QB 4XBGB 4GSDH 4AEHH 3CFDA 2QADD 2EDEA 5FYLH 3STZA 1PSKL 5BO1H 1R24B 5HPMA 3S3PA 3ZDXE 5JOPD 2Y06L 1WLHA 2Z9TA 3JUZA 5EBWA 3ULUE 1WWAX 4JHAH 3RIFK 5FFLA 4IHOA 1HNFA 5D9SB 2EC8A 3D3VD 4Y2DC 1KCUH 2P5WB 1F4YL 4NO3A 5C08A 2LTQB 3LB6D 3IJYA 3GKWL 4OJFL 3V4UL 4Z8FH 1FNEA 2J4WL 5J11C 3TVMC 2LAGB 2EDWA 3QIWD 1AHWA 3FOLB 2E7HA 2B1HH 4E5XB 2WLZA 1ZTXL 1I7TA 3FO0L 5EPMA 1AJ7H 1A47A 3IU4L 4NZUH 4YHIB 2BNQB 1L7TL 4QYOA 4XNZC 1I4FA 2AJUH 1R3HA 1QR1A 4TNVK 5KS9E 1HHGB 4JM2C 3SE9H 3RPKA 5ALBH 2JKXA 3QIBB 4X6FA 1DTUA 3AS3A 4IMKC 4K94H 4UIMA 3UPRB 1PFCA 4ALAH 4L9LB 1OB1B 4PJXA 1SBBA 3BN9D 4UNVA 2Q6WA 3OR7B 1IC7H 3L5WA 1UWXH 5L7XH 3QYCA 5DA0B 4GRLC 5CHNB 4XNQA 3PDDA 4Y19B 4OD1L 2JJSA 3D0LB 4F8QA 2NLJB 3B43A 4WNQB 4HWUA 2XYCA 2Y36H 4Q58C 2GY5A 4ZG1A 3GSNB 5D7IF 3RUGE 2VXVL 3L7FA 2HG5A 2X5PA 3ILPB 3KLAA 4I0PD 3DNKA 2LU3A 3SJVA 5CZVH 4P48A 1G6RH 1OY3B 3PWPB 1IQWL 2APTA 3D69A 1MLBA 2I5YL 3I9GL 1JI2A 1ZT7A 4HV8A 1U8HB 1T80A 3U9PL 3LSOA 4L3ED 35C8L 3O3BA 4PJBE 5DVNA 4E0RA 2PNDA 1YDPA 3PWLA 4QRTB 5J12C 4H1LG 1RURH 2R0ZH 1HKLH 4YZFF 2BSSA 5C0GA 1FAIL 4PJ8C 4FTVA 1LVEA 4HIIB 4FQJH 5EOTA 4YUEL 5D7IA 1BGXL 4YE4H 5DJXA 4U1IB 4S10A 3MRPB 5DJZB 5EFIA 1NC4A 5GSRB 3FQNA 3O6FA 4XZUB 2ATPB 2BNQE 4NWTL 4DN4H 4MXVF 2PXYD 1J05B 1T20B 3VFMB 1ZGLA 4RX4A 4XPHL 4H8WC 3MTRA 4PFEA 1YEKH 5C0CE 1J86A 3TT1L 4ZUWB 3EO9L 1T04A 1S3KH 3NZHH 3REVA 3W9DA 4YDJA 1KPUA 1UVQB 3LEXB 2DQHH 3Q5OA 2WV3A 4JRYD 2E27L 3LAFA 1NCAH 1I8KB 2JB5H 3QUXC 4M6NH 4DUVA 1FL3A 4OSUL 5I16B 4R2GC 3LKRB 2KKQA 1KJ2B 3QWRD 1VFAA 3DX9B 4R9HA 1J88A 2P7TB 2HRPH 1GOGA 3EDFA 2ZJSH 3N1MC 1H8SA 3D39A 1IILE 4ISVA 1X4ZA 4LHUD 4PGCA 2PETA 5SWQB 3SQOL 3WFHB 4ZUVA 32C2B 3M8OH 4P2QD 1T21B 1GVIA 3QDME 2IMMA 4XMPH 1JGUH 3O81A 4W6XB 3DXAB 3TIDB 5EN2B 5B38B 3ARZA 2BXYA 3SKJL 1OGAE 3ZHKA 4PY8J 4PTUB 4NRZB 3TA3B 2N56A 3OKNA 2XA8H 5FO8B 4RBPK 4HS8H 4DKFH 2BY0A 2MCPH 2NY5L 5DMGC 3RWEB 4HIEA 4MQTB 2F5AH 4MGXA 5KJRL 4I13B 4LKXB 1LD9A 3FZUD 3IFPA 4HUMB 3S36L 3DBXA 2F8OA 5CJBA 5DTFA 5LXGH 3DX7A 2NY4D 4BH7B 2PYFB 2BRRL 5FB8B 4LLVA 4K9EL 3QDGB 4UT6H 5I2IB 3HAEB 2BOCB 5BV7C 3C8HA 3GSNL 5ICYA 1A6VL 3UDWC 4MD0B 1C16A 1SQ2N 4HKBA 1CDCA 1OAYH 1MCOL 1AXSB 2ZOLB 5I9QC 1SMOA 4MAUH 2BNRE 4MQ7A 3KR3L 1NC2B 4NM8L 1NJ9A 5IVXF 1U8IA 3ARDC 4MZ2A 3WFBH 1U8PB 4JDTH 2R1WA 4JVWA 1HIMH 3CXDL 1TVHB 1UACH 2CR6A 4CW1B 2Q87A 4PJ5E 3WO4C 1CI5A 5GS3A 1N8ZA 5IB3A 4HHAA 1JN6A 4LGRB 3IXTB 5DRXA 5MHSE 1IGMH 4NQTA 2GYSA 4WUUD 3LKSB 4XXDB 4KY1H 2OSLB 2J6EL 5HHNA 3LS4L 3MCG1 1JHTB 3RDTD 4NPYA 1LE9B 4XH2A 3I02B 4Y5XA 4QOKD 5IVXA 5JLZA 1MREH 3GJEA 4QKXB 2HLFC 1C5DB 3UZEA 5B3JF 3ULSA 1CDBA 1T5WA 5C0CA 2VLME 5D2NA 3HMWL 4U1GB 1C12A 2DQFA 3TH2T 1GH7A 4LBEB 2OTPA 3E2HC 5CJXC 1KJ2L 1ES0B 1DQDH 1UADC 2KQNA 4GXUN 1FAKT 1ZSDA 1T22B 2XRAL 5F6HI 3LKPB 5HY9B 3QEGL 3ALXA 5I76B 4I9WD 4MB3A 1NFDB 4ZQKB 4NQSA 1JWUB 2Z91B 4P3WA 4KUZH 4RFNC 3QDMA 3QBTB 4UILL 2AI0H 5TE7L 3PV7A 5F96L 5ESAA 1LGVA 4G8EB 1F3RB 3NCYP 1F90H 3MRCB 2YA2A 4X6EA 1MRCH 1OGAA 4P4KC 2ICES 2PCPA 1BECA 4TVPH 2GI7A 4XBEH 2BP3A 5CILL 2BC4A 3MGTA 1QSZA 2XIDA 4ONGH 4K7PH 1NFIB 1URLA 2F5BL 5LAXB 3CH1B 3TBTA 1F13A 1AI1L 4JY5L 1KCSH 1BWWA 1I85A 3WHE0 3MNZB 3RWCA 3WJLA 4F58H 4QHUB 1HOCA 2P5WD 4XI5C 2D9CA 2B5IC 1D3CA 4RMWA 3D85A 4YHMH 1MAJA 3TN0B 4ODHH 4NNYB 4XNYL 5LWYL 4L5FH 5HGAB 1TETL 2X1QA 4LCCA 5HDLA 1W8NA 1W8OA 1U8JB 5IJKC 4LEOB 5JW4R 1GIGL 1I9EA 4XPGL 4P2YA 2W0LA 2WK2A 3FT4A 1S7XB 2C7UA 1IQDB 5TQ2H 4P5TD 5KOVC 3SKMA 1M6OA 2XWTA 2BNRA 4X7SL 2CDGB 4NJ9H 1EHAA 1Z2KA 1AD0A 2ADFL 4NQEE 2HFFB 2FHFA 4YO0A 2R4SH 2BHYA 2VAJA 3I6LD 4PJ5A 1JZ4A 1BD2B 1CDGA 1X5YA 5E8OA 3AU1B 5DFWH 4NDMA 2X4SB 1VA9A 4XAWH 5DLML 1INDH 4F33A 2QQQA 1XIWC 3B2UD 4FFYL 4IJ3C 3ZKMD 1V5JA 4G6JL 3LQZB 2D0GA 3GHBH 3SDYL 4NQVA 3T1FB 4JY6B 4MNGA 3ALPA 2GTWA 3E8UL 4Y19D 5GJSL 3HR5B 5CGYC 1QRND 1UWGL 1OW0A 4WI5A 3IJHB 3KDMB 4DKDC 4G8GA 4D9RD 2YUVA 3IFOB 1OD9A 3QRGH 4AH2A 5IR1B 1GYAA 4YBQD 3NTCL 4WVRA 4R4BA 3WUWG 2EYRA 1KC5L 2NZ9D 3PWPD 3RGVB 4G6KH 2OK0H 2VLJA 4ODUB 5AAWA 2NCMA 1U3JA 4Z76A 3GKZA 4JB9H 2P47B 2UZIH 4JHWH 4Q0XL 4YDVA 4BELD 2OZ4A 3MRGB 2PYEA 3MROB 5DHXB 4LFHG 4O4YL 5DS8A 1MIEH 4F57L 2R4RH 3EFFB 2VLRD 3TM6A 4PRDB 4PTTB 3HUJE 1KTLA 4LSDA 1S78C 2H32A 1GGTA 4WW2C 3MLTB 4D9QE 1YEEH 4LF3B 5ESQB 1HHIB 3PL6B 4MVBD 5BXFA 3TBVA 1DLHA 2N1KA 2R2HA 4XMLL 5A2FA 5CBAA 4G8IA 1G7MB 2E9JA 3T0EA 1N2RA 3SGEI 4LCYA 1S8DB 3BKCH 4DN3L 4KDTA 1AXIB 3GMMB 1WZ1L 2EEDA 2EXYD 1IAOB 4WFFE 2ZCLL 3OKDA 4EOWL 2X4QB 3K8LA 1RULH 1IL1A 5DRNB 3ZE1F 2FSEA 4TVPD 1QBLH 3BIKA 1RZIA 4LSPH 4PIRF 3K7UA 3AY4A 1LE5B 3ARGC 1H3GA 3LKOA 2GITA 2YKLH 1NGXA 1NGZB 3NABL 3VWJB 3CCHB 3OJVC 1ZWIA 3EOAA 1I8IB 1QFUH 1OTUC 1CXHA 4PJEF 5C9KA 1GGYA 1QFWI 1MJ7H 4PPTA 3DXAD 3VG0L 1G7HA 4YDLC 4K7PX 3KPQB 3VXOA 4Z77A 1CDJA 2CK0H 2DAVA 3ABZA 5EA0H 1GHFH 2AJ3B 4UIKL 2APWA 4U1NA 3TA3D 1F58L 3MJ8B 1MLCB 4WHYH 3VXUD 2AEPH 3X12A 3P9LA 3BD4A 4R7NB 5M7QA 3FO2A 4Y4FB 4Q9QH 1K6QL 1E4KC 2PR4H 1CFSB 1IGIL 4GMTH 3TO4A 4EUPG 3IRZA 2J8HA 5IEHB 1TCMA 2DMKA 1JPTH 4IRZL 1T66D 4PJEA 3T1WA 1KIRA 1QKZH 5F1SA 4HUWA 1JPSL 4X4XA 3RIAK 2IPKB 3QDGD 4IOIB 1WWBX 2MJWA 1FO0H 2ZKHH 1F6AB 3AM8A 1Q0YL 5GS0C 5KG9B 2ZUVA 3PIQA 1JMZA 4C56B