2K3TA

Solution structure of ig-like domain 23 from human filamin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-A
publication title Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k3tA00
3EAKA 25C8L 4PYGA 4JPVL 1S5HA 3DIFA 3D87B 2HFFB 3DTXA 4NDMA 3ARWA 3MRHA 5CHNB 4OF5A 2ZCLH 1V3MA 2ZG2A 4X6EB 5C07A 3LQAH 2EDLA 4H1LA 5GZND 4HJJL 3FO2B 4OJFH 5HY9A 2BNRD 4KAQH 4KK6D 1DP0A 4UB0H 3O4LB 2DLHA 1CFVH 2JE8A 4YC2C 4RX4D 1LP9E 1TIUA 5E8EB 4AYFA 3UC0H 2IMNA 3T09A 3KHOA 2OM5A 1FJ1A 3AS3A 1AY1H 3VA6A 4OM1L 5B38B 5JZ7C 1XIWA 4IJ3C 1S5IH 3KLDA 3PWVB 4FQXD 2AGJH 4WUUA 1DQLL 4D0BB 3MLRH 5DHYA 5D2NC 4OAWB 5ID0A 1QO3B 1Q72L 4ZXBD 4ERSH 4GG8B 3VGHA 1EHAA 2AAVA 3L3IB 4YH6A 3HZYA 4P4RB 4HLZH 4PB0L 1OAKL 5IB2A 3VXMA 1HNGA 5EZIH 5D1QD 4RGNB 3MNVA 5JDSB 3L3OA 3V6OA 3ZKMC 1Q9OB 1BBDL 1CFSA 4PJEE 4OUOA 4JFFE 1G7QB 2VWEE 3BP7B 1NEZG 1OF2B 3RA7L 2UZIH 3ZYOA 1CLYL 4JANA 3QDGE 4NO2A 4NQEE 4DGIH 4K7FB 1G9EA 5HPMB 5TGBA 5DD1L 4PGZA 4LL9A 2XY1A 4ZUVA 4JGUA 1WAAE 2ZUTA 1IEBA 3HLAA 4XNQB 5CEZE 3QNYB 3QDME 1FFPB 4FRWA 1JPGA 2KKQA 1SHMA 2IF7A 4HULB 1WV7T 3AM8A 2DM3A 3QRFM 5ICXB 4QHLB 1A7PL 2BVTA 3BWUC 4G3YH 4EXPX 1ZLWK 1PLGL 2Y9RT 3L3KB 1QR1A 4WTZA 5A2FA 3MRJA 4R4BB 4HBCH 4HWZA 2UWEA 3LS5H 2E5EA 4TSAL 1XR8B 3O81A 2WBJB 3F7RA 1IARB 1OGAD 3D39B 2CIIB 2BY3A 4LMQE 4LSPL 4MXQC 5FK9B 5HDQH 4PGBA 5I8OH 3O41B 4BFIA 2C7UA 1E4WH 5ISZA 5GISH 3CSPA 3QT2A 1CE6A 2Q76B 5A40E 2LU3A 4WU7A 3BWAA 4HF5L 3SGDH 5BV7B 2W9LA 1FZKB 1S7XB 1U3HC 1FIGL 1FP5A 3HG1D 1LE5B 4HMDA 2VDPH 3QCVH 1KXVC 3P11L 2YUWA 1P4BH 1S7UB 3JVGC 1VEMA 3CSYA 1RFDL 1UJ3B 3HA0A 4PGDB 1RAMA 2YRPA 3U6RA 3C87A 2V5YA 3C5JA 1OHQA 3LKRB 4R90L 3MC0A 5EOCH 3N50A 1AHWA 4EDXA 1OWRM 2GTZB 3EOBB 1WFOA 3CFIC 5EO0A 5HGBB 1VEOA 4LVNC 2UY7A 1IGTA 2I27N 2Y7QB 3RGHA 1EGJL 4X6BB 3VD5A 3C8HA 3IJSB 2BJMH 4URTB 4IOIA 1Q9LA 3RVWD 5KN5A 3SCMD 2OSLB 4FQQB 2BXZA 2CD0A 2FSEB 1MI5D 4JHWL 5L6YL 4LPTA 4ZFGL 1I8IB 4JPWL 3QFJD 4P2OA 4GRMB 2F19L 5F6IB 5EORH 1HH6A 2R1XA 1BFSA 3PWPE 1DQTA 1KB5L 1YPZF 1DUZA 3RNQB 4DAGL 2A9NH 3TVMC 1CE1L 3MV8E 3UAJC 4RAHA 3RUGB 3SKOB 3DVFA 1BZ7A 3LVEA 2VL4A 1YMHA 2W0KA 3O4OC 1QLEL 4K2UL 4LAQH 1IAMA 3VXUE 3L6FB 3EFDL 4HS3A 1I3VA 5D1ZB 5D2NA 4PJXE 3OB8A 1J88A 2OTWA 4HJ0D 1O5DT 4GJTB 1YEGL 4JHBA 4HQQH 1NEUA 1SYVB 1A7QH 5D1XD 5FV2A 2P5WB 4OCRL 2FH6A 2C3VB 1UM5L 4KMTH 1IC4L 2ZSWA 3HUJA 3BVNA 4DWHA 4JKMA 3VFUB 4HIXH 1FFNB 4S1DD 3MUJA 2D4FA 1FNLA 3IAQA 1MCQA 2OMBA 5E8DH 4C83B 5FO9B 4M3JA 3IU3A 1FYTD 4NQDB 4KTDL 4P46B 1GPOH 3C09B 2ICEA 5F7HA 1PZ5B 4G8EA 4JKPL 2QHRH 4WW2B 5GRVL 3T8XA 1RULL 1RIUH 3JZ7A 4OD2B 1ETZA 5DUBA 4O4YL 1UEMA 4PJCB 5D8JH 5FF6A 4JFHD 4I3RL 3NA9L 5HHMB 3ALXA 2LU7A 3BPCB 3P9LB 3IDGA 4R26L 1PYWB 1RZJH 4U0RB 2MCG1 3ZE1F 4XP9H 3VH8G 5IFHH 4JKKA 2BVOB 3TZVD 3X11B 4LPWA 2QQLL 2APFA 3TNNA 3X3GL 1VFAA 4X8JA 4F9PA 5MEOA 2EE6A 5DS8B 2AJXL 3P0VL 3QIWC 1B0RA 5D7SL 3LPGA 4Y16D 3FT3A 1T66C 1K8DA 1V05A 4UV4H 2WMPA 1R3HB 5B39G 4AH2A 1NCDH 1MCSA 1YQ2A 2OZ4L 1CN4A 1TZGL 4JN2B 3MLSL 4ZUWA 1KJ3L 4ZS6D 5IB1A 2PYFB 1UADC 3IVKA 5T33H 2AJVL 3V0WL 5KVGL 4X9BA 3O6KL 5GZNC 4ELMF 3CXHK 1U8QB 3A6CL 2ZSVB 4R7DA 5C7XL 2VDQL 4KK6C 3F6LA 1QLFB 1AD0A 2HT3D 5SWZE 3EOTL 1EFQA 1U3HA 5CSZB 4ODUA 5IVNA 2P5ED 4G8FA 4PREB 1HHKB 1DL7H 4YHZL 4XBGB 4LSRL 1WFTA 3T0ED 4FTVE 5F6HJ 3H6JA 2KUTA 2P44B 4K7PL 4YBLB 2OL3H 1RJYB 4M62L 1UQSB 1NBYB 3D18A 1Q9KB 1EA9C 4PJAE 3WHXB 1NEZA 4X6CF 4ZXBC 1F6AB 4PBVC 1MIEH 3FHAA 5DJ0B 4CVWA 3BPLB 2A83A 2KZ1B 3QDJE 3SOBL 3WIIH 4LSVH 1KXTB 5D1QC 3V7AE 1T7XA 3WN5C 3STZB 4UIMA 4WW1B 4M7LL 4MWFB 4HCRA 2DQIH 4YZFE 1HHHB 1G9MC 5IBUB 4WU5A 4XB8A 4GXVL 2J1KA 3V7MA 1INEL 2GITB 5GSRA 3KYMA 4P9MH 1NAKL 3WS6C 1CGSH 4JQIL 3NABH 4RMSA 4NZUL 3A6OA 1NMAH 4TQEL 4OLEA 3AU1A 4NT6B 3ZT5A 4X7FC 4XCYA 5T3XD 3VW3H 4F7CB 2AK4B 3D0VB 1BJMA 1JWMA 3ZO0A 3O3AA 4UU9B 1J05B 3HAEA 4WY7H 1IILE 2EECA 4R0LA 4OKDA 1FAKT 4OQ1A 2JB5H 4XGZA 3W81A 5LGHL 4QRRE 5E94B 2NY4B 3QEQB 1IAOB 2ZUVA 1G9ML 4M7ZC 5EU3B 3A67H 4FABL 1D5MB 2AERT 1EAPA 2EZ0D 3VXQA 1LGVA 5B8CC 1MWAA 2HH0L 3G5XB 4NQXA 4Q58C 3ZKSD 1KC5H 5AWNL 4MD4B 5IG7B 1F8TH 3ES6B 1K2DB 4PJ8D 1EHLL 4BZYA 4AL8H 1HILA 3O6FB 4UAOB 3GGWB 4MCYA 4ONFH 5HYSG 3MBXH 4PRAB 6FABL 1J12A 2DQCH 3MOAL 3BFOA 1MLCB 5ERWB 1AXSA 3AY4C 5DJCB 4LCWE 2BVPA 1MCKA 2R9HD 3QWRD 4LU5H 1KT2B 5LAXB 3UTQA 4BZ2L 1UVQB 1A7OH 2C5DC 1MRFL 5FFLA 4PJEB 1BQHG 1IC1A 2GK2A 5J11C 1LO5A 2DQUH 4HZAA 4PJ9B 1DN0B 4L8CB 1KPRB 4CAGA 5J1AB 1SEQL 3KPMA 5JW5B 1RK0B 1IE5A 1CF8L 4LLVB 1NGYA 1MCLA 3QDGB 3VFOA 3ARGB 1SVCP 3EDFA 4M7JL 4MAUH 5HHPB 3BKJL 3K80A 1GXEA 4XCFH 3RVWC 5IVOA 1DLHA 3SCMC 3ZDXF 1OAXL 5DURB 2DQDL 1AFVL 2JB6B 4X5LA 4HSQA 1BD2E 1KCVL 3X14A 2EH8L 5IHZB 3N1FC 4LHUG 4PJHE 3TEUA 1R3IH 3PQYE 2N56A 1E4KC 1V7NH 4O58H 3TN0D 1A6UH 4GXUN 3WFZA 4YQXH 1A1OB 1DQMH 4Y1AE 4HUUB 5I1DB 1A7BA 3BHBA 2H8PB 1S78D 3QH3B 2WINA 4M48L 3ZSTA 1EBAA 3LEVH 3PUCA 3NH7H 2NY3D 1DVFA 3QI9A 4Y5YA 2IH3A 3O0RL 4HJGB 1AKJD 3VXPB 1I85A 4NWTL 4M03A 1UG9A 4I0PD 4R4FL 2X4SA 1GHFL 3S5LB 1NFDA 3EKCA 4HJ0C 5C0CD 3UDWA 2EIBA 1HH9B 2F74B 1OGTA 4U1MA 5E5RB 3RTQA 2CRZA 4K23L 4YBHA 5E4IA 1FAIL 1VCAA 3U0TB 5CJOH 2YPKB 4WCYH 5EB9A 3BGMB 1ZHLA 5EU7E 2FJGA 4S1DC 4QYOA 4FQ2L 4JFQB 4M8QB 5ENWB 3SDDB 3PL6D 1ZLVH 2V7HB 1S7RB 5LGJA 1AQDA 3BMWA 4OD1H 4JVWA 3RVTD 2ADIA 1SJXA 4OI7A 3QQ4A 3D25A 3MLZH 4OI9A 3MO1A 2YXFA 3B9KB 2J5LB 3VXRB 3BH9A 2HA1A 3CNKA 1HSAA 2ZNXA 2UVEA 1T1YA 5JNYA 5I2IA 2MCPL 3L3DB 2PW2A 2D2OA 4OLZL 3QULA 4NUJB 1RU9H 5H2BA 1UWGL 3KR3L 4KY1L 4AQOA 4MNQD 4P3CL 4PLJD 2J3SA 3VD9A 2WP3T 3TZVC 1CDYA 2K3TA 3PABB 1S8DA 3L7FB 2E6JA 5D93C 1J1XL 4L3EA 1EH9A 5D5ME 3EYVA 1F6LL 1C16A 3IDJA 4Y16C 5IF0A 1N6VA 4CGTA 1ED3A 4DTGL 4GH7B 3MRHB 5GGQH 4ZFOA 1NGQH 2V2WB 5C07B 3LDBC 3TH4T 4ZS6C 5B8CA 1D9KD 4JFEA 3SDCB 4GSDH 1UC6A 4ORGA 1JTPA 2AVGA 5DSCA 1MIML 1U36A 5GRJH 5HHNA 5JO5B 4UQ3A 3V52L 4UT9L 3SDAD 4P23D 3LHPH 4UUJB 4HPOH 3MGOB 2H26A 1T20A 5TDNA 5KSAD 4NN6B 4O5LH 3VXUB 1CDCA 4ORZC 5DUMH 4Z5RA 4F58H 4PJXB 3VGAB 3ARBD 1AGEA 2HT3C 3DECA 5IJKC 4OT1L 5L9DH 4FQ1H 1MJUH 2FZ3A 4NZTH 3R1GH 1GGUA 4QRTB 4HPYL 4B5EA 4HC1H 4JDVA 4HX1B 2DBLH 3HZYB 3MLXH 1NDGA 1GC1C 3L95B 4PJBA 3B3IB 3KXFA 3IDUA 4BSVA 3MV01 3UTTD 4JG1L 4QXGL 3MNVB 3H3KA 3MJ7A 5GGUA 3L3OB 3SE9L 2Q3AA 3C2AH 3NCEB 1CD1A 2W59A 2OR8A 4BSJA 4G6AD 1WZMA 2ATPB 4QKXB 3B6SB 4B53A 5K9OA 2EDHA 2NLJB 2C3WA 3V79C 4YHMH 5J1SC 1U9KA 1S9YB 5IWLA 1RZ8B 3IFNH 3RFZC 4APQB 1PEZA 3MFFB 1ZVYA 3VJ6A 4L4VD 4ZUVB 2FLBT 5E24E 1IEBB 3HLAB 5HYQA 1S7QA 1WJ3A 5E8PA 3CX2A 1JPGB 1R5VA 3PJSA 1MOEA 2JK5A 4J3VA 1YZZA 1FNFA 4QGTA 5DRXB 1A6AA 4L29A 1JGUL 5TE4H 3OHXA 5I30L 4RGOH 3P4OB 3SKMB 2YPLD 5SV4A 5HYJA 2F5AL 4J3UA 3B9AA 3UEZA 1QR1B 3MRJB 1CBVH 3GK8L 2C1PA 2I07B 5CJ8A 4HWZB 3UZVB 4XPHH 2N1KA 5LKNA 3ARSA 5BVPL 2HLFD 2AI0H 5HYSA 1IGCH 4Q6IA 4F33A 3ZDYF 5MEND 4U1HA 1CXLA 4Y5XC 2A6IA 4M6MH 2EDFA 1CLZL 3GSNL 4PGBB 4U1IB 4WV1C 4XB7A 5SWZB 3RP1A 2EZ0C 1HHGA 1T7ZA 2UV3A 1ZTXL 5IHLB 3FTGA 1XR9B 4ZD3L 4D0CA 4WU7B 2K7PA 4Z76A 2A1WH 4N5UA 2CUHA 43C9B 1L6XA 1FL6A 5GRUL 4LPVA 1Z5LA 4HLZG 2F9BT 3CPLA 4N8CL 3S6CA 3CFDA 1BVKB 3CSYB 3UYRH 1T2QH 5CEXB 3U6RB 1A9BA 4NUGL 1JGVH 1XGRA 3C5JB 3QDJB 1GIGL 1T0NA 1JZ7A 4OLWL 3AS1A 1OD9A 5C92A 1J0HA 3AFLA 5C08D 4JREB 1ZK9A 4EDXB 5CCKH 5C0DA 1QBAA 5AUMB 1M7DB 3RU8L 5F3BA 5JQ6H 2DQGL 1IGTB 4EUPB 5EU5A 2PN5A 4P5KB 2DKMA 3MZGB 2DTML 1SM3H 4LHUA 5DWUL 5TPWL 1Q9LB 4CVXA 1WEJH 4LNRB 4HT1L 3MRLA 5EIQA 3BJLA 1XZ0A 5E2WL 2G60H 3IFLH 4S2SA 3MLPA 2VXUH 5GGVH 1KF9B 4KRMB 5EFIA 1JHLL 3LQAC 4WRLA 5JOPD 3OZ9L 1KCSH 2P8PA 4PS4H 4YC2B 4YDVA 1EHXA 1N5YL 3TN0C 4G80A 1T4KA 4JO4L 1OGAE 3TIDA 1DBJL 1S78C 1FH5L 3JWOL 3TNMA 5IJKA 2ZNWA 1EUTA 1WK0A 4IJ3B 1VERA 1DJSA 3TIEB 5I17A 3BPNC 3GMMB 2NY3C 3QDHA 5D2NB 3VWKD 4JFXB 2J8OA 5AD0B 2ARWA 1NCAH 1FC2D 3HG1E 4I0PC 3NIGF 4OCYL 3VRJA 2ZCLL 3CK0L 3HUJB 1EEZA 3BVNB 4NYLA 2ICWA 5CJQH 1OTUD 2P8LA 2QTEA 5DJ8B 3T0DA 2VDML 4U6HB 4GW4A 1MCFA 3IU3B 5JORA 2ICEB 1R5IA 4EI5D 3DARA 1DTUA 1TCRB 4LFHG 5EUOA 4UB0L 3PL6C 3LS4H 1GGIH 1ETZB 4AQ1B 2JELH 4YHNB 1OPGL 5FF6B 3U9PH 3RVTC 2F53B 1FO0H 2VC2H 1FNGB 3S36L 2UY6A 1MI5E 2P47B 2B8OT 3MLRL 1OARL 1QYGH 1RZFL 2E9BA 3QFJE 3WMSA 2VMFA 4LRNL 1WTGT 2DQJH 4ACPA 3D85D 1GZPA 1DBBL 1WQVT 5A2JH 4JCMA 1K8DB 4DCQA 3MSPA 1F58L 4PLJC 5C6PB 5L88L 3OTTA 4X4YA 3SDYL 3DO3A 5GS0D 2DRUA 5F9AC 2VLRA 4GQ9H 3D3VD 1XCTB 2VERN 4V2CB 1E27A 4PJHB 3OR6B 1PAMA 1UB6B 3PQYB 4I2XA 1UH4A 2CIKB 2XKSA 4FHBD 2VLMD 4Y1AB 1IM9B 3V4VL 3BX7C 1HOCB 3LN5A 4GAGH 2PNDA 4Y5XA 3ILQD 5FO8A 4WV1A 4Z0BL 2EXWD 5BZWB 1D9KC 2P48B 1JMXA 4BSWB 5AG8A 4M3KB 2R0ZH 4HWEH 3HHRB 4WO4C 1A3RL 4RAUA 5EULV 1YECL 1U3HB 4P23C 3SDAC 3CVHH 35C8H 4Q97A 4G8FB 4FFVD 5KSAC 1BEYH 2IBZY 1WWAX 1A21A 5FGRA 1MHEA 1OAQL 1FYTE 2XZAH 2YMXL 4JN1H 3ARBC 5J6GA 1T7WA 4G3YL 1KB5B 5GGRA 3OX8B 5FYKU 3ULVD 3CC5B 3D18B 1J8HA 2BOCA 3WUWG 1NEZB 3CFJB 1CS6A 1JYVA 15C8L 4G9FD 4M1GL 1EFXD 4WI2A 4JFHE 4LVNB 4BJLA 3N9GL 2BC4A 3MUGA 4FQIL 4BUHA 2IBGA 2D03L 4JLRA 4GMTL 4TULH 4XVTL 5B3JE 4Z7OF 3C5SB 3O2DH 4G6AC 4KVCH 4YDJB 5FA4B 5GISL 4UDUA 2AJYH 5I66B 1ODAA 4LSUH 1U8OB 2D7NA 3TV3L 1X5GA 3IXTB 3UP1A 5EA0H 3MV11 3DX6A 1F97A 3U4EA 5FECB 2EC8A 5A43C 2X5PA 3MRNA 2NTFA 1B90A 5ITFB 1UFUA 1N8ZB 2A6JA 4XNMA 5EOTA 3UPRA 4MXVE 2ORBH 4QRQA 5T1DH 4OZFA 2AXFB 2H1PL 3ULUD 4LAJH 2VAAA 1LO2L 3CMGA 3QEGL 3BJ91 4CMHB 3U2SB 2I60H 2BDNH 3O4OB 3IKCA 4ZTPH 3TYGL 5F89B 1HNFA 1JGDA 2VABA 3SKNB 5HVFB 3VFMA 4NQUA 2DDQH 4S1SH 2YPVH 1OL0A 2Z35A 3TPKA 1JRHL 3GBML 1PY4A 2NCMA 3DSFL 2HG5A 4PRHB 1WBYA 1J18A 2CK0H 2P5EE 3TO4A 5DJZA 2W0LA 1YEDA 3JV5A 1H5BC 4JEGB 3VXQB 1TZHA 2HLFC 3F7PC 3T0EE 4EQ2A 3KPRA 5D7IA 4ZOBA 1PSKH 4NQXB 2GAZB 4P59L 5ICZA 1BPVA 2ZUSA 3U7YH 3D6GA 2Z31D 1V3JA 5AYUL 5TE6H 4HH9A 1BREA 2RB8A 3C9NA 1ZHBA 4GOSA 5KS9F 5DF0A 3DUHA 1YNLH 2BVPB 4LSQH 3QG7H 2EXYC 4CDHA 3Q5YA 3KPTA 1UA6H 3U1SL 2ZKHH 2FGWH 3LB6D 3VXTB 1LO0L 3ILPB 5TQ0H 1FGVL 2WAHA 1JV5B 3FO1A 4PV9B 2F15A 1QRKA 1AGCB 5ACLA 4ZNEE 1JL8A 4AT6B 2CDEA 3QIWB 4D9RD 5DK2A 2DS4A 5H35A 1I9EA 4KXZI 4FZ8H 4OZGE 2B0SL 3B5TA 3LQMA 3BIAX 3RKPA 1X7QB 4GW5B 4TVSa 3DI2B 4KKCD 4MDIB 3MX0A 3WDHA 5IBTL 2FATH 3HZVA 4CJ1A 5IHBA 2H41A 3H7BB 5IQ9A 2PO6C 1GGBL 5DMKA 4IDJH 4I0CC 5JW4N 1TJHH 1ZA6A 2BNRB 4R2GD 2CXGA 4RISL 4XNZC 2BSED 1J0ZA 1OLLA 4WO4A 1JMZA 4LSTL 4P5TD 5IFHL 1JPST 2YXMA 4M6OH 5CMAA 3UZQA 1XF5B 4YDKH 1BJ1H 4N0RA 2JJUA 4PJFF 4FMFA 1S7WA 2BHUA 5I16B 1UM6H 1CZ8H 3MRIA 5FYJH 3RZCD 2X4SB 3FQXB 3BP6A 3GM0A 4L4TD 4XP6H 3VWKC 4ZXBB 1QBML 5E4EC 3TA3A 2D0GA 1PQZA 2O5ZH 3O9WA 3WFHA 4HAFA 3CLEH 5D1QB 3CX5J 1PKOA 1ZHLB 1OTUC 3WNKA 1CD0A 1QEWA 3VH8B 2X1OA 4U1LB 3QCTH 1E28A 3NN8A 4EI5C 3GHEL 2GSGA 2QQNH 2HFTA 4MJ5A 2ADIB 3VFGL 3MRBA 2A9MH 1JNLH 4Z7VB 5EIIA 3MO1B 2WNGA 1P9MA 2DQFB 1HSAB 2R39A 1T1YB 5JNYB 2H3NA 3UPAA 5HYIA 1RUAH 2PW2B 5B39B 3RY4A 1IAKA 4XPTH 3QULB 1QA9A 1FGNH 1J10A 2OL3L 4H5SA 4JFYA 3UMTA 4K3JL 3CJJA 4Y19D 4HK3J 1N3NA 3LIZL 4NM4L 3DUUB 1I9RH 1OD7A 5I1HL 1NLBH 4N0FB 1JFQH 1VGKA 4YXHH 3EYVB 4FZEH 5IF0B 1C16B 3IDJB 1B6UA 1ZA3B 4MJIE 3V5KA 3HB3D 5EO9A 5CD5D 4X4ME 2CLRA 4OBRA 3WD5L 2FEEL 3NCCB 3K2UL 2VH5H 3TBYA 2CQVA 5B8CB 2RR3A 3KJ6H 4JZOA 5BRZD 1SQ2N 3HE6A 4PTUB 1OGAB 3H3PH 4Q74A 5JIKA 4XNYL 2AKRA 3ILQC 5DXWA 5C3TA 1OM3H 1BQLH 1LK3H 2H26B 2WW8A 2EXWC 4NRYB 4NZRL 1LD9A 1NMAL 5TDNB 3BIKA 5CJXC 3ARFD 2B1AL 3PP3K 3VD7A 1AGEB 3BKCH 1G0YR 1GAFH 3HG1B 5GS1C 2FZ3B 3W2DL 1N59A 3B9VA 2GT9A 1B4JH 3CDCA 4JDVB 3G6DL 3DRQA 3GRWL 4X6CA 5GS0L 5KSUA 2EDJA 4DKEH 4DEPB 4O51A 1NDGB 3ARVA 1Y6NR 5BMFH 3ULVC 3P4NB 3WFEL 5EBWB 1UT9A 2VOTA 2YD7A 5J11B 2NTSP 3MA9H 4ZO7A 3MOBL 5F9WC 4U1NA 5MP6L 2HLAB 2Y06H 1ND0A 3RVVD 1AGBA 4OZHE 4MNQE 3PIQB 2APWA 4IRZH 3SCMB 1BOGA 3D5OF 3VFWA 3JUZA 1IT9H 4P0DA 2E6PA 4YPGA 1E6JH 4TVPD 4NO0D 3QFJB 2PO6A 3BAEH 3Q48A 4JB9H 1FNSH 1RHHA 5HPOA 5DFVD 5IGXH 5HYQB 1S7QB 5E8PB 3MPCA 3ULVL 3TO2B 2ZP0T 1R5VB 4LP4A 2BCKA 3GIVA 2JK5B 3HMXH 3DSNA 4G43A 2HVJA 4OCWL 5HHXL 3ULUC 1A7OL 3OKOB 2QQKL 1Z0MA 4L29B 5FGBA 3SY0A 3HC4H 4M43H 1LO4H 1KN4H 4MA7H 3IB4A 3PGCA 1I8LC 3B2VL 1CXFA 5DMGD 3P30H 4WGVB 2FX8L 5IESH 3JWNC 3TLRA 1KNOA 4GKZB 3TT3H 2XQBH 4X9HA 5C0AA 5HYSB 1KJVA 5EBLA 4P5MA 5E8OA 2ED8A 4M5YH 1UCBH 4MHHI 4NRXB 2A73A 1OW0A 5E6IA 2WIIA 1VFMA 3TBTB 3K3QA 1CVRA 1F3DH 1HHGB 4BH8A 1U95A 4ZOCA 3I6KA 3FTGB 4D0CB 1T5WB 3C08L 1R3IL 1KFAL 3OKNB 3UTTE 1FYTB 1JPTL 4YQXL 5EPMA 1DQML 3NAAL 4L1DA 3ULUL 3P2TA 4G6KH 1FL6B 2BY0A 4UZGA 1BQHB 3O3UN 2Z31C 3HE7D 4G8GA 4GRLC 2BVUA 4Z7QF 1B4RA 1Z5LB 3MJGX 2V5TA 5DYOB 5EUKB 2IC2A 1QZ1A 3TGXA 3W0WA 2Y6SD 1DSFL 2K9UA 3VXME 5I8CA 4OCLC 2MSPA 3FO0L 1NLDH 1A4KA 2FHBA 3ESUF 4AIZA 5GIRB 3V8OA 3LB6C 4XC3H 1EHNA 1XGYH 3F7YA 4WNQB 3TZVB 1ZLSH 1P7QD 3HMWH 4JDTH 4L4VE 5D93B 5EU5B 3GB7B 4WUKH 1A6WL 4LHUB 1H9VA 4CVXB 4Y16B 3GMRA 3L3GA 2MHAB 2G9HA 2R2BA 3TYFB 4DZ8B 3CFCH 5E95B 4NO5B 2C1OA 2XA8L 3IDYC 1ACYL 1U8KA 4LPCA 1H3PL 3HNVH 3LDBB 1MWAL 1IFHH 4U3HA 2YPLE 2H32H 2UYLB 5EFIB 1J0JA 1D5XA 3MLZL 4NCDA 4N0YH 1EO8H 2F54D 5TDPA 1XGTB 3RZWA 4ZOAA 2P8PB 4YDVB 2VISB 1DBML 2CMRH 5B22A 3EBAA 5KSBE 2VXVL 2HJFA 1D5IL 4FXKA 4G80B 3Q6FB 1YNTA 3L9RB 3TIDB 4R3SA 4R2GC 3RWFA 5MENE 3DO7B 2HN7A 4P5TC 3P4MA 1QFWI 2FBJH 2KH2B 3KPSA 2P5EB 1YYLH 2GI7A 3HNSH 5DK3A 1QFUH 3S37L 3UTOA 1G6RA 4KV5F 4MXWL 2DL2A 1YY9D 3OKKA 4K07A 1MNUL 3RZCC 2ARJA 1KLFA 3OKMA 5GGQL 2ICWB 3UJTH 4R6UA 2P8LB 1T03H 2YBRA 4PRIA 4PY7A 4KTYA 2ICES 2VR4A 4RMWA 5E9DA 2XOTA 5C08E 4GSDL 5JORB 4X4XA 4PD4J 2BHZA 4XMLH 5DI8A 3QNZA 3GKWH 3AUVA 3MCKB 4ALAH 1FL3A 1IC7L 1AGFB 5F1SA 1CL7H 5D6CA 3V6BR 1U2HA 5BS0A 4OD3H 3UJJL 5DUML 1ZLVK 4F58L 2DLIA 3HR5A 3S88H 3K81A 5L9DL 4BQ9A 1TFHA 1TJGL 4NZTL 3ZE0E 5I18H 4HGKC 2KZWA 4RMQA 4F8QA 3LEXA 3H9HB 2W60A 1GZPB 4HFWA 1PW3A 3T1FB 1DFBH 3U9UA 4WHDA 5HI5D 4OB5H 5IJVA 3HFML 5I6XC 2HAZA 1D5BB 2BFVL 3RHWF 3N1GC 3I75A 1F02I 3HI5L 5FUOL 5DVLA 3HB3C 1RJCA 3VGDA 5JPNA 1H3GA 1K8IA 3FAWA 3SHSA 3RWCA 1P4IL 4NKMA 5IMOB 2RJMA 5E1HB 1M7XA 4Y5XB 3RY6C 2P8MA 4GRWH 5FO8B 4WV1B 1N2RA 5DZNA 1I7RA 2EIZB 1WBXA 4MNGA 4X8XA 5EZLA 4NSKA 2CXKA 4LKXB 1WWBX 3UROR 1NMBL 4RAUB 4G7VL 2YC1A 5B21A 3KYNB 1H8NA 5L2KA 3RUGF 4JHZA 3VGFA 4J4PD 4GRLA 4YNYB 1IGJA 2W9DH 1A1MB 3ARFC 3MRKB 1MFBH 1MHEB 4ELKA 2NW3B 2A2QT 1GJIA 4J12A 4PIRF 3ECBA 3NFPB 5TE4L 2G2RA 2SEBA 1F90L 5D71L 5D2LA 5TJWK 1CBVL 4TTGA 1QNZH 2HYMA 1INQA 4NPYA 5F9OL 4XPHL 4D3CL 5HHVH 4DK6A 4UDTB 1JVKA 1T89C 3ARDA 5T3ZH 4KK5D 3QPXH 4LDOB 2R0KH 32C2A 3GHBL 4JQVC 2DQHH 2X6MA 3WIHH 2DLEA 1DQDH 3RVVC 5DDHB 4RMTA 2R2EB 3VRIB 4NJAH 3BD3A 4H26A 1A3LH 1UJTA 2YD6A 2PR4L 1CGWA 2XZQL 4WW2F 4HXBH 4E41D 1RZ7L 1EVTC 2UZYB 3DX6B 4RCAA 4MS8D 1LEGA 3MRNB 4PJCF 3EDEA 3BDXA 3UPRB 5A1AA 4XPBL 1IGFL 2CPCA 5DK0A 4OZ4A 1AGDA 1AXIB 5DFVC 1DBKL 4HS6B 3A6BL 2VLME 4POZD 3L7EA 5CCKL 4TUKL 1KEMH 4RMRA 4KZDH 1FL5B 4HIEA 1JI2A 1CFQB 2DYPA 1JGDB 3GI8H 5EU4A 5JQ6L 4E0RA 4ZUSA 3VFMB 5F7EH 3D1MC 3F65A 2NY3B 1MF2L 1SM3L 1AKJB 3MACH 3BP4B 4I0PB 1WBYB 5DMGC 5FYKD 2PTVA 4QT5B 5DJZB 2GJ6A 4HC1A 4KQ3L 3NVQA 1HHJB 2E9WA 5IEKB 5EWIH 5CINH 1T21B 5C0CB 5BZDA 5D7IB 2G60L 3ULVE 3IFLL 5I15H 4TVPL 1NGWA 4PV8A 2FD6H 5ICZB 5D72H 3KS0J 4CNIA 4G9FE 2OQJA 2WWKT 4IHOA 4L8BA 3NPSC 1IGIH 3PL6B 4JAMB 4U6TA 3C9NB 4YHLL 2FB4H 3JTSA 5FM5M 3HE7C 4PGCA 3SJVD 2BP3A 3DHMA 2ED9A 4W4NA 2Y6SC 3HI1B 1QVOA 3BKYH 4CW1A 4YFLI 5DEGB 2OJZL 4UINH 3VA2C 4P2RA 3FO1B 5A16A 4W6XB 5AZEH 2QLVB 1AJ7H 1Q94B 3ULSA 4R96B 2CDEB 5H35B 3OPZH 4MNQB 5CJQL 2R4SH 4U49A 1R3LA 1G1CA 3ULUE 3ZHLA 1KIRA 4JRYA 1CK0H 1J11A 2IH1B 3G6AB 3ZZ1A 2OP4H 1DEEB 3JV6B 4NOBA 4JQXC 5IFJA 1HQ4B 2VLLA 1ZEAL 5IB3B 1P1ZA 4MLSA 2MFNA 3PHOB 1ZA6B 3U7AA 5KTEL 2VC2L 1U92B 2BSTA 3BKML 1I9JL 4WO4B 5BQ7A 5KJRL 4ODHL 4PGEA 4I3GA 1NC4D 3SDAB 2CR6A 5KSAB 3EYQD 3SKUD 3C5ZA 3PP4H 4EEEA 4PG9A 3H9YA 3V6FB 3ARBB 1E4XL 1B3JA 1NL0H 3MRIB 3MLUH 1J5OH 1AXTH 1OLZA 1YYMH 2WANA 2AV7A 3IFPB 1RUPH 1ZHKA 3W11D 1N0XL 1TPXC 1YY9C 4LQ1A 4F7TB 3O3BA 5FB8B 3QRGH 2IGFH 3UTTB 3EFFB 2OLDA 3MRPA 4UTAH 3C6LC 3RWJA 5GJSH 1MAML 1IQDB 1FVCB 4PJDE 4MD5B 4JQVA 5FXCH 3ZHKA 3VE0A 3NN8B 5CD3A 4KKNA 2R0ZL 2GSGB 2E27L 3Q1SL 2GCYA 3CDFA 3MUZ1 1KG0B 4FNLL 5DC0A 1H3XA 2PXYD 3CVHL 4LVEA 4OF3A 1AI1L 5J57B 1KACB 5I1IH 4XAKD 4N68A 1DBAL 1LDPL 2Q7NA 4LKCB 5F1IA 2LAAA 3MYZA 5KG9A 5F7DB 1QA9B 4OZIE 2YD9A 2ENYA 3AXLA 3VFNB 4JFYB 4DGYL 2RCSL 4DVRH 3TJEL 1VGKB 4PJEF 3K4DA 5D7LD 4Q9RH 1M6OA 1KLUB 3MXVH 1G7JA 4LCYB 1TNMA 5HI5C 5HYFA 2ITDA 1QPXA 4TULL 4PP2A 3L5WB 3CVIL 2BNQD 3G5YB 4KVCL 2X4TB 3RIFF 3MLTB 1S7SA 1H5BB 1HINH 2NZ9D 2DJ4A 4NQCD 5KSBB 1WAAF 1UM4L 4JZOB 3ARED 4QLRA 1SJHB 2CLZA 2CKBL 1OCWL 2X05A 4OCSH 5MENB 5F7UA 2AKRB 3PWLA 4L4TE 2CDGA 3JV4B 4MMXC 5DUPL 1MFCL 4XVSL 3FHQA 4JZJA 3WUWB 3BIKB 5AZ2L 5C2BH 5EZOH 4FQJH 3U36A 1KJ2A 3KPQB 2MKLC 4P99A 1KIQA 1JHKL 5DD6B 2LVCA 3MNWA 4NOFA 4OLYL 4J4PC 4ETQA 2O61B 1N59B 1I7UA 2HT4D 3LN9A 2GT9B 4RAVB 3VWJC 4F9LA 1H15B 3GO1L 1I1AA 4S1SL 4RFNC 5ESVA 4JFPA 5C0FB 1FO0A 1XT5A 4PJIE 4NM8H 1CT8A 1TQBC 5C08B 1U42A 1YMMD 1KPUA 2VL5B 1ND0B 3I6LD 3CXDL 1AGBB 1F4AA 2O5XL 2FJHB 4KK5C 1BQSA 3AAZB 1U91A 2ZUWA 3ZT7A 4OIBA 1EBPA 3MCLH 4O9HL 4Y19E 3U7YL 2EYTB 5FKAB 1BOGB 4OQTL 4CU7A 1Z9MA 3VFWB 1QRND 3CU7A 4X7CC 3O6LL 1T22A 1ZANL 5IV2A 3P9WB 2PO6B 5IOPB 5IB5B 1T6VN 2YA0A 4PRPA 4WWKD 2ENSA 3WLWC 1I9IL 4MS8C 5DJDB 3P4LA 4XNZB 3PGDB 3GIVB 3WIFB 2M2DA 3MGTB 2HVJB 1KTKE 5GGTH 5F7KC 5TQ0L 2X1XR 2AJ3A 4ZAKA 4Z95L 1RIHH 5BRZE 3LPWA 4POZC 3SY0B 4MX7A 4M6NL 5CIPH 2VUYA 4PG2C 1QSEA 3PGCB 3MRCA 3F6IA 4FZ8L 2F5BH 1L6ZA 5CGTA 4OM0L 3STLA 5BW7C 4A6YL 2Q3ZA 4KMLB 3BE1L 5E4EB 5I8EA 5C0AB 1IC5H 3VFRA 1SMAA 2OL3B 1KJVB 4P5MB 3Q6GH 3RL1A 1P84K 2WIIB 3QUXA 3AB0C 1SVZA 1YJDC 2ZWLT 3C6LA 5F88A 2J12B 3QFDA 1MY5A 1U95B 2R1WA 1ORQA 2XFXA 3VXSD 1QFHA 2XY2A 1A14L 1TJHL 1MCEA 5EPMB 3UJIH 1F5WA 1I1YA 1C1EL 5KS9A 4DN3H 3O2DA 4G8GB 3W39A 4IMLB 2RBLA 3OQ3B 4XCNA 4YDKL 2MMXA 4PJXF 1A4JA 2EKSA 3MRFA 1N64H 4IDLA 3JWDH 2H6PA 3BXNB 3EDDA 4Y88A 3GUTA 1X5HA 1N6QL 5FYKL 2J6EA 4TVPE 4XP6L 4ZPVA 1SJEA 4AG4H 4PPTA 3VXNA 1DE4A 1YJDL 3L1OL 3G9VA 4HKBA 3REWB 3D2UA 3RI5F 5FAAA 1TZIA 2B5IC 3L3GB 4Z7NE 2G9HB 4Y2DC 1UXWB 3SBWC 3FN3A 4P9HL 1JNHA 1QLRA 4H0IA 3QISA 4QHNB 1BAFL 1I7TA 1XF4B 4TUJB 5GQBA 3D3VB 1I8MB 5E03A 1N5AB 1A02N 3ZMRA 4CN4A 3UXFA 1D5XB 2A9ML 3SPVA 1BFVL 3FRPA 4K71C 4XMKH 4FMKA 5ACZA 3HZMA 2XPGB 4OIIL 4BZ1L 3BZEB 2HJFB 2YSSA 4R3SB 4PJFA 4XPTL 2NY5L 3RWFB 3DURA 4OM1H 2FJFB 2GY7B 2R69H 4EUPH 2QQQA 5FGCE 4OLUL 1DQLH 2CR3A 5GS1B 3KPSB 4X5WB 1Q72H 4P2QB 1ACZA 3VWJA 3KNBA 3O2WH 4KK8D 1HZHH 1OAKH 3OKKB 4IRJC 1NUNB 2EYSA 5C6TL 1NGXA 5JLZB 4WFFD 5ETUA 3HC0B 3O6ML 5F71A 5HI3D 3DXAA 1BBDH 1RSFA 1XF3A 4ODVL 3PXJA 3FO9B 4G9FB 3KPNA 1EFXB 2OR9H 2VITA 1JUFB 1IAIL 4PY7B 5F9WB 2FH8A 5T3ZD 4OSUH 4FFYL 4PY8J 4NQVB 1A6TA 5FYJU 1FG2B 4TUOB 2BSRA 1CCZA 2NR6D 3BEVA 5E1AA 5MEPA 5HDBE 3KG5A 4X4XB 1VA9A 4YAQB 3QHFL 3QUML 3LMJL 4P4KA 5DI8B 3QNZB 3EUUA 1EMTH 4G7YL 1FVDA 5CSBA 4IMKA 3UTZB 2H9GA 1JWUA 1FQ9C 5LBSL 2ICWI 4LDLB 4KH2A 3ABZA 5D6CB 5DD1H 3KDMB 5JW3L 3RX8A 1BZQK 1EJOL 3CLFH 5I0DA 1GAFL 2QHLA 1X4XA 3WJLA 5DVMA 1KELL 2E7CA 4ENED 3S35X 5FKPA 2X7LB 4Y8AA 5BMFL 1A7PH 3RBSA 5C09A 1IBGL 5J9PA 3RRQA 3P0GB 3U9UB 1NJ9B 1PLGH 2F54E 2RGSA 2V9QA 2HFEA 4Y5VC 2BOBB 1G7LA 5DJAA 4I48A 2Y06L 5C0RL 4WEUD 3I75B 4YZFF 5TQ2L 2AP2A 4GKNB 1T1XA 5I1AA 3E6HA 1ORSA 2VLJA 4IRSD 5IB4A 1VFOA 2VZTA 3LH2L 5JPNB 4I3SL 1FV1A 3QO0B 1P6FA 1T1ZA 3SGKA 4C56A 1N2RB 1E6JL 2JJSC 3BAEL 3AREC 5IR1A 4JB9L 1WZKA 3O8XA 3E3QC 5IGXL 4WHTA 5L8KB 5L2KB 1JGEB 2JJTC 2Z31B 3HMXL 4GRLB 1IGJB 1RFDH 2OCFD 4L3AA 4ELKB 3DX9B 4L8SC 1MJJB 1WCQA 2WV3A 5BXFA 4MQXD 3ECBB 4R90H 5HGAA 5JW4Q 2ADFH 2G2RB 3P9MA 2HT4C 4H88H 4QTHA 1FORL 4HZLB 2X4RA 5D2LB 2Z9TA 3U0PB 5ADPH 1INQB 3KYAA 4XWOD 1EO5A 5IQ7L 1EGJH 2G75B 3KPOA 1U8PA 4MQ7A 2GTWA 2XQBL 3X12A 2KBGA 4HUNB 1F13A 1PEWA 2F58L 1R3JA 3HUJF 2YD5A 32C2B 3QO1A 3FJTA 5C0EA 4WTWA 4K3DL 1EEYB 4JHWH 5L6YH 1W72H 4WGWB 4JPWH 5FIEA 1TVDA 3RWIA 4ZFGH 2IADA 4LNVA 3SBWA 5F96L 1TMCB 1QSZA 4HK3N 1BVLB 2F19H 4H26B 3IDYB 4PRDA 5ICYB 3QUZD 4G6KL 1LNUB 4OZIB 5J1TC 4DAGH 5C0JA 3F5WA 1LEGB 1CE1H 3GSWB 8FABA 1G6VK 5DK0B 4AEEA 3BT2L 1FYHB 4OZ4B 1D5ZA 4WHYH 4OTXL 4JZNA 4WWKC 4ZDHA 1NLDL 2FO4A 2VDKL 3L7EB 4R2GB 1QLEH 2AJUL 4K2UH 2ADJA 4RIRB 1XGPA 5J6HA 3FQWA 4P5TB 2AEQL 2XZZA 2DYPB 3EFDH 4E0RB 2IPKA 4ZUSB 4OGZA 2NY0D 1ZLSL 3SDXE 4ODTH 1SY6H 1YEGH 3D0LA 3LPFA 1X5IA 4G6ML 5EC1B 4Q9CA 2HFFA 4OCRH 4IRJA 4M93C 5CHNA 2GJ6B 1R24B 3RZCB 1IC4H 1I4FA 3CMOH 1U93A 3NA4A 2LQRA 4X6EA 4L4TB 5E8NB 4PJHF 3VCLB 1XCQB 3FO2A 4B7LA 1YEHL 4JKPH 4CNIB 2OQJB 5CS7A 4D2NA 4G6FD 4M4RA 3R0MA 4NN7C 4L8BB 1RULH 5JQHC 5TE7L 2VDNH 3ETBF 3BYYA 4I3RH 1JF5A 3NA9H 4R26H 5C70A 5B38A 3EJZC 1J8HE 4U3XA 12E8L 4JM2D 4MNHA 1Z3GL 3PWVA 3QIUD 4PJIB 1K5NB 4D0BA 2FBJL 1EEQA 4OAWA 1P7KA 3ME0A 2V5RA 2QQLH 4GG8A 4CW1B 3X3GH 1G0XA 3BRGC 4YX2L 4P2RB 2AJXH 5K9JL 4E41E 4HUWB 1XF2B 4PYHA 4YBQD 5JDSA 1S9KC 4Z7UE 2Y36L 4QRPD 5JXED 3UJTL 2VDLL 5I6XB 2EC9U 1ZKAA 5ADOL 2OZ4H 4NP4L 1TZGH 3CUPB 3BP7A 3MLSH 2NY7L 4JVUA 1KJ3H 4JRYB 1OF2A 4L3CA 1F4XL 2AJVH 4ALAL 5EC2B 3OGOE 1TITA 1T7YA 3V0WH 4YUEH 5E00A 4PJ5D 5KVGH 3BDBA 5HPMA 3O6KH 5I19L 5I1EL 4OKVA 5C7XH 3TCLB 1P1ZB 3TBWA 4XNQA 5BRZB 5FYKE 2BSTB 3EOTH 1FFPA 4MA8L 1NUGA 4PGEB 2RAMA 4CRPA 1CYGA 1FC1A 3H42L 4YHZH 2APVA 4LSRH 3C5ZB 4QHLA 2M1KA 43CAA 3WE6B 5KVDL 3IS1X 4K7PH 1DFBL 2LAGB 4M62H 3RHWK 3MRGA 1LWRA 3PNWB 4OB5L 3L3KA 4NZDA 2YUXA 4IOFD 3IJHB 2AV7B 3VGEA 4OFIA 5CEYB 3SOBH 3VD4A 1XR8A 5CILL 3SGDI 1WGOA 2WBJA 3SJVE 2NYYC 2P49B 4MJ4A 4O2EB 4YE4L 2DTSA 3T4AA 1MCWW 3RWJB 5HI3C 5FK9A 5JTWA 3O41A 4M7LH 4KZEL 4KKLD 5I73B 3R06B 4QF1B 5K59E 4NKDB 5IROA 3VE0B 2NR6C 3OF6A 2NPLX 1YC8A 4RWHA 1INEH 3RDTD 4XPAL 4I8DA 3QR2A 2DLTA 2XXMB 5IMKB 2WWKO 2YD3A 4TNVF 4YFLF 4JQIH 3ZLQC 1S7UA 4NZUH 1Z9LA 2W9DL 1UJ3A 2BRRL 4PGDA 2JF1A 4TQEH 3OJ2C 5HGHB 2EH7L 4NO0B 4Y4FD 1JRHI 3LKRA 3GM8A 3V2AR 4JPIA 5SWSD 4UT6L 3AXLB 4JO1L 5IUSA 2GTZA 3EOBA 5AYQA 5D7JD 4KDVA 4ENEC 2Y7QA 5LGHH 2J8UA 5HHVL 3PV6B 2IPUK 4X6BA 1HQRA 1G7JB 2R0KL 1PDKA 4HH8A 1YPZE 4FQQA 4M02A 2FSEA 5DHVH 4WFED 4QY8A 3X3FL 1DQDL 4OGAD 1B2WL 4ZPTA 4DUVA 4GW1B 4GT7A 3QDAA 4GRMA 3QEUB 4IRSC 1KLGA 1AC6A 3V5HB 1XGQA 1U8IA 5AWNH 4J3WA 4ZG1A 5FCUH 2J88L 4E42B 1EHLH 2UUDH 1CU4L 3UBXG 5IKCB 3SKOA 3RUGA 1L0XA 3DGGB 6FABH 3NPSB 3FFCD 4QXWA 3MOAH 1QKZH 3P0YL 1KIQB 3QQ9D 2JJVA 2XTJD 3HE7B 2VXQL 3I9GL 4BZ2H 1EEUA 3MUHL 4FXLA 2X70A 1V3LA 4MQXC 3B5HA 4JFPB 1MRFH 1MRDL 3HRZB 3PWNB 1JNJA 2P5WA 4XAKE 5T5NG 1SEQH 1KPUB 4XWOC 1CF8H 3LD8C 1EK3A 3BQUC 5T1LD 3WFCH 1P7QB 4TN9A 1OT2A 4M7JH 5F7YC 4NQDA 5I15L 3BKJH 1IVLA 3GSRA 3OKDA 4P46A 2AXGB 5BO1L 2FD6L 1OAXH 2DQDH 1AFVH 2CKNA 1VSCA 3ZE1E 2P43B 1KCVH 4X99B 4WW2A 4OFPA 1T22B 5CLTA 2D31B 5D7LE 5EG6C 1X6LA 1IGIL 1L7IL 1G84A 2X9WA 4PJCA 1CGYA 4PRPB 2V2TB 1PYWA 4NWUL 4Z7VF 2FL5A 1C08B 3L5JA 2A6DB 4M48H 2BNQE 2F54B 4M4PA 3RGVD 3X11A 2C4FU 1I1FB 1I7ZA 3UTSA 1OAUL 3O0RH 3E3QE 4NWTH 3CVHB 1QSEB 5E6ZA 3WFBL 3MRCB 3OPZL 4R4FH 4X4ZA 4GBXA 1J0KA 2NY0C 4LLAA 3FMGL 4PUBL 4K8RL 3STLB 5JW4R 4ELME 4YHYB 4NQTA 4A2MA 3VFRB 1TPXB 4K23H 2PYFA 3WBDA 3QUXB 4LEOB 1U8JB 3CXHJ 1DN2A 1NCTA 1K6QL 3C6LB 4FQ2H 2R1WB 1ORQB 2XFXB 5DFTA 5IVXE 5HHOD 5J3HD 4I18C 2ZSVA 4JPKL 4WI5A 3I85A 1I1YB 4KDTA 4XXDB 3C60D 3T0AA 5IK3A 1YMME 5CSZA 1JTOA 5H37H 2YUVA 4PREA 5HDOA 2E7LA 3O2VL 1HHKA 3FT2B 3LQZB 1ZSDA 3PP4L 3P40A 1NBQA 4JM2C 4OLZH 3S7GA 2FECL 2H6PB 3H2WA 1RJYA 5C0BD 1NL0L 2J2ZA 1UQSA 1UWGH 1CLOL 1Q9KA 4KY1H 1QRNE 3K4AA 4P3CH 3WHXA 4S1RL 1UXSA 3V6ZA 5DJ0A 4EQ3A 1J1XH 3JSSA 4KJPD 4HKBB 2VLKD 1RZKH 2VZ3A 4YBQC 2AEPL 1E6OH 2IGFL 1XMWA 5ANME 4LCWD 4DTGH 2V17L 5JXEC 2ZPKH 3STZA 5HD8D 4WW1A 1RZIB 2OBGA 4E9LA 4DKFH 1CQYA 4MWFA 1QLRB 1HHHA 1MAKA 1UKSA 3U82B 1MCWM 3O11B 3T0BA 2IAND 1MIMH 1VKXB 1Q8MA 3V52H 4UT9H 4JM4L 2WUBH 1YC7A 3N1PC 1T0PB 4NT6A 5E2VH 4F7CA 2Y5TB 2PUQT 1T7VA 3DURB 3ZSSA 4MAYD 1MJ7H 2XQYK 4OT1H 1J05A 1RJLB 1FSKC 3VXSE 4G5ZL 4HPYH 4DVRL 2QR0A 3VWJB 4RDQG 3KNBB 4J23A 3M07A 4N1HB 5E94A 4RFNB 5K33A 4JG1H 1IAOA 4QXGH 4QRUB 4Q0XL 5ETUB 5EU3A 3RIFK 3SE9H 2IQ9L 1TQBB 4OFKA 2ZUUA 4IOFC 5I74C 3DXAB 4I4WB 1BOYA 1XF3B 4P3DA 3FQUB 4ZQKA 3G5XA 1F2XK 5IIEA 5DJ6A 2BSRB 2NMSA 3TM6A 3GJFH 1FLTX 4V1DD 5IG7A 2DM2A 4BK5A 1K2DA 5J4MA 1QSFD 4KKLC 3SQOL 2DOCA 4D8PB 2IFFL 2H9GB 3O6FA 2H2PD 3GGWA 1MLBA 4LLDA 3V4PL 3E6FA 2KQNA 4PRAA 2Q20A 2V5MA 4LQFL 1MLCA 5ERWA 4OFVA 4QOKD 3RDTC 5J7CC 5DJCA 4QCIA 2GHWB 3KJ4B 3LRGA 5JHDD 1U6AL 1OP3H 2I5YL 1KT2A 2EKJA 3E1F1 5F21B 5LAXA 4YPJA 4Z7UB 2VR9A 3E2HC 4X6DE 1T04A 4Y4FC 5EU6D 5FKPB 4D9LL 3L3HA 4PJEA 5I30H 1JGUH 5AG9A 2ZOKB 2BXYA 1ZE3C 4JFFA 3QG6B 4L8CA 2F5AH 1KPRA 5D7JC 5B3JF 5J1AA 5FDWA 3GK8H 1RK0A 4LLVA 4M00A 5DJAB 2ZOLA 3RAJH 1KEGL 3X17A 4CMMB 3QDGA 4NQEA 3ARGA 5BVPH 1T1XB 4U33A 1ORSB 1F42A 5C9JB 3DX7A 3IDMB 4V2BA 3ROLA 1WAAA 2JB6A 4XNUL 1M71B 1CLZH 3DMMC 3GSNH 4XPGH 3QDMA 4OGAC 5IHZA 4Z18A 1KCLA 3AB0B 1RHFA 4JRXD 1A64A 1Q38A 2QJDA 4MD0A 4ZD3H 4BQ6A 5IR1B 3AVEA 3OV6A 3MYJB 1A1OA 4WFFE 4I18A 5I1DA 4HUUA 5IBLD 3EZJB 1S7TA 5JA8B 5GRUH 1PG7H 4N8CH 1UZ6F 3S34L 1NCBL 5GGTL 1CICD 2Y25A 3J7HA 3M1BB 1CIDA 1F45A 5BXFB 1GIGH 3QQ9C 4OLWH 4HJGA 3VXPA 3P9MB 3WL9B 4Y4KD 4JY5L 1QBBA 2EDDA 4QTHB 4NKQB 1HEZB 4TNWK 2M26A 3S5LA 5A3ID 2D7QA 2DQGH 4MB5A 4MQ7B 2BMKA 1HH9A 2F74A 3KPOB 2GTWB 3X12B 3IJYA 3SE3C 3LV3B 2DTMH 1A6PA 2V2XA 3ZYJA 5TPWH 1R3JB 3U0TA 2B5IB 2QBWA 2WLZA 3BGMA 2ESVD 4IIQC 4X5XB 4Y2DB 4M8QA 3AMKA 5ENWA 3SDDA 1OOAA 2NW2B 3OAYH 1IGYA 5E08L 2EEBA 1A1NA 3UJIL 4UTBL 4HV8B 3KLSA 1ONQA 2PYED 3K1KC 5ECJE 2ARJQ 3OGCB 3R4DA 3OZ9H 8FABB 3B2UD 1N5YH 4K71B 4O00A 2ZG3A 2JIXD 4I0KA 2F8VA 2LTQC 1D5ZB 4JO4H 4JZNB 2DAVA 1DBJH 3QUMB 4KU1A 4ZDHB 4FQCH 4NUJA 2FO4B 2XN9D 1FH5H 3OG6B 3JWOH 3S97C 5JIHA 2ADJB 2YK1H 3V5DA 3RGVC 4WIQA 3PABA 2GUOB 1OTTD 3RI5K 2NXYD 4AG4L 4MYWB 4YHIB 1C12A 4N0UE 1UWEH 3D0LB 2XACC 4OCYH 4IRJB 3QUYD 4HIHB 4P49A 1BP3B 3PWPA 3S9DB 2AQ2A 1F4WL 1I4FB 3CK0H 4QXTB 1IJ9A 1AR2A 1U93B 1YEFH 2V2WA 4MNGE 4Q9BA 3WFDL 2VDMH 3MV8A 4W6WB 3QQ3B 2IAMD 2Q6WA 3SDCA 3W5MA 4K7PX 1KUMA 1WBZA 3PWJA 4DN4L 1HKFA 4JY6A 2VAJA 5JO5A 4UUJA 3MGOA 4LRIC 4XMKL 1CVSC 5L7XH 2CH8A 5J3HC 3VXUA 1I75A 1WSST 1OPGH 4PJXA 4J1UB 2R69L 4WFGD 3C60C 3NFNB 5ID1B 4MNHB 3S36H 3O4LD 4ZOEA 1OY3B 1RVFL 5FGSA 3MOQA 4JHAL 4QRTA 4OCNC 1OARH 5BJTB 3MV9D 1P7KB 1RZFH 5ALCL 3V95A 2P7TB 4HX1A 4LRNH 4PRNB 3O2WL 2AW2A 3O3EA 1XGUB 3L95A 1HZHL 3D69A 3B3IA 1DBBH 1YUHB 3MBED 4MVBD 1F58H 1NDMA 3FFDB 5DR5L 4L9LA 5L88H 3SDYH 4DOHE 4ZS7L 4EZMA 4NNYB 3MJ9A 2OR9L 3NCYP 4LLUB 3QAZC 4F80A 2R8SL 1VFBA 4KJPC 4Y5VB 4LSDA 5LWYL 4OSUL 2ATPA 4NGHL 1F00I 4FP8H 3B6SA 4TSCL 3NTCH 4GQPH 3RWDA 1TENA 3GBNL 4FQHA 3OAZH 2X4OB 2NLJA 4L3CB 1EMTL 3U4BH 3V4VH 4WHYG 3EYSL 5E00B 2BNQB 1A2YB 1S9YA 3DMMA 1RZ8A 4APQA 4Z0BH 1JGLL 3MFFA 4OKVB 4XCCL 4NQCB 3TBWB 3CLFL 1A3RH 3AREB 4HWBA 1NAML 4NC1C 1YECH 4XPFL 2R2HB 2R1YB 4RSVA 3HN3A 1YA5A 3AS2A 1OAQH 4EN3C 2FO1A 1H3WM 2YMXH 3FN0L 4R8WL 5DRXA 4MAYC 43CAB 1BFOB 2X42A 4L8SB 2B4CL 4KGLA 3P4OA 5F1KC 3SKMA 3QBTB 5JXAH 4RFEB 3BN3B 1HKLL 3MRGB 5D96C 3ZDYE 3JTTB 3ZYZA 5D70L 1VENA 4B7IA 15C8H 4M1GH 4U1SB 2I07A 2C4XA 2G5RA 3N9GH 5IVXB 2DB8A 3C6SB 4FQIH 2D03H 5BOZG 5FA3A 3T4AB 1NGZA 4GMTH 4XVTH 4U1IA 5SWZA 4DVBB 3SO3C 1X44A 1YMMB 1A22B 4X7SH 5D7IF 2V7NA 3OXRB 1XR9A 3RWGB 4UOW1 1F3JB 3OKYA 4H1LH 3D39D 3TV3H 4FTVA 43C9A 3AC0A 4QRPE 3BESR 1IQWL 4YGVB 2D7PA 4PJAA 1QRNB 1P2CB 1BVKA 4LP5A 1L0YA 5FUZL 3GSVB 5CEXA 4Q2ZB 4JE4B 2EE3A 4N9GB 3GSUB 2H32B 2H1PH 1ZS8B 3QDJA 3V0AC 3ZE2E 1LO2H 2ADFL 3QEGH 4JPIB 4AMKL 5EN2A 4WWKB 1BF8A 2ICWJ 3PGFL 4H88L 1Y18B 5AUMA 1M7DA 5ANMB 4PJ5E 5EU7C 3TYGH 3VDBA 3MRDA 5ADPL 3M45A 3KHQA 2J8UB 4EUPA 1V8HA 4P5KA 2GEEA 1HQRB 1JRHH 3GBMH 3DSFH 2FX9L 4P48A 2NX5D 4XT1C 3KAAA 2D7TL 3MLVL 4F37K 1ES0B 2VXTL 4LNRA 2I26N 1Y0LB 2HKFH 5I75C 4QY8B 4M93B 1W72L 2JLLA 4KRPD 2BY2A 4ZPTB 5HJ3A 3L5XL 4LLYA 4YHPB 1A7RH 2PETA 4UILL 2VUOA 3NFSL 1KTLB 4P59H 2GFBA 1KLGB 1FBIL 3SGEH 1XGQB 1U8IB 2R0WL 2Q7YA 5J13C 3E0GA 2X4PA 3WYRA 5AYUH 1I1RA 2WQRA 1LQSR 3VXSB 4LRIA 3MV7D 3H9SD 2MTPA 1YY8B 4M5ZH 5ESAB 4QRRA 3NIGE 1YEIL 1NCUA 4G6JL 3H3BC 1R0AL 2WWMD 3TIEA 3U1SH 3GMMA 1CICC 2X70B 3CDGA 3RY5A 4YJZL 2WM0A 5C6WH 1LO0H 4JFXA 4ODTL 5DHXB 5AD0A 1SY6L 1FGVH 1IL1B 4FG6D 4J8RA 4Y4KC 3PF2A 5DMYA 3T3PF 4WI3A 2ITCB 4YXKL 3CMOL 5A3IC 3I84A 1KCUL 1NC2D 2B0SH 3DRTB 5JDJA 1JP5A 5D1ZD 5DJ8A 4U6HA 5DRNB 1HXMA 2J4WL 3N85H 5SWSE 3KGRA 3GSRB 3OKDB 4FN0A 1S9VA 5IBTH 4JY4B 1TCRA 4C57C 4QHUB 5DVKA 5HSFA 5FHAH 3MFGB 2VDNL 1GGBH 5C86A 2N7AA 4YHNA 4X6DB 1ULVA 4R7NA 5IEHB 1MCPH 4O2FA 2F53A 3QWOA 2FL5B 4RISH 1FNGA 2EDNA 4N8VG 2Z8WC 4LSTH 4WFEE 4YWGL 4GRWB 4MCZA 2ZUQC 3PHQA 3B2UC 3HPJA 3NCFB 5FOJA 3EYUL 4LK4A 5DLML 4JJHA 1I7ZB 4EN3A 1INDL 3UTSB 4LIQL 4TRPL 5GRWA 1V5JA 3FQRA 4HFUL 2MJWA 1J0IA 1G7HB 5DA4A 1OTTC 4GBXB 3T1WA 2NXYC 1BIIA 1UGNA 1BD2A 1GOHA 2RIKA 4Y89A 1QBMH 3FFCE 2PW1A 1XCTA 2YD2A 4PJHA 3OR6A 4OFYD 2XTJE 1UB6A 3PQYA 1VB9A 1ZT1B 3BO8B 3QUYC 2CIKA 1FHGA 5FM8A 4Y1AA 1IM9A 3LKOA 5LGKA 5A2KH 5JPMB 2BK8A 1HOCA 4YUEL 3WNOA 5C2UB 2IAMC 5KSBF 2W9EL 2PTUA 1E4JA 5BZWA 4BSWA 3GHEH 5CWSA 3FKUS 4OCXL 4WI6A 2EEAA 2Z8VC 3P77B 3ARYA 4W68A 5DVOA 5IK3B 3VFGH 5DO2D 3W5NA 1I1CA 5HBBA 4RA3A 4J3OC 1ZSDB 5GRVK 3CCHB 3JVGA 3K7UA 1KB5A 3OX8A 4FQXC 4JFDD 2Y1VA 3CC5A 4KHTL 3U48A 3ZKND 4LGSB 3CFJA 4K3JH 1UXSB 5TF0A 3CSGA 2XT1B 4NM4H 3LIZH 3V6ZB 1QSVA 5I1HH 3WXWH 4XXCC 2GJJA 2VXSL 3MBEC 1H0DB 4MVBC 4Y4HD 4ZTOL 3G5VB 4KJQD 2Z4QA 3C5SA 3MODL 3CSBA 3WD5H 4YDJA 3GJEB 1Q0YL 3K2UH 1MQKH 2GQHA 5FA4A 2X89D 4TNVK 5I66A 2JCCE 3VRLF 1U8OA 4IRSB 2GY5A 3IXTA 2MPAL 3ZE0F 4XNYH 5FECA 4NZRH 5ITFA 3IETB 4H20L 1N8ZA 3TVMA 1X5ZA 2AXFA 5ALBL 3DETD 3F12A 2B1AH 5D5MA 1JTTA 1FE8H 2BVYA 4N0UB 3U2SA 3FOLB 3W2DH 1ADQL 1A9EB 3DHJA 5F89A 1QFWM 2QSTA 3JV0A 3SKNA 5HHOE 2QR0B 3G6DH 4ONOA 3GRWH 5GS0H 4ETYA 3OMZA 3BZDA 1HXYA 4CVZB 4IEFB 2A0LD 2AK4D 5T5FL 3WFEH 1ZHNA 4OFDA 4PFEA 4PRHA 1JCKA 1S3KL 3MOBH 1TJIL 1CXHA 3BD5A 5MP6H 4P3DB 1U58B 3EOYG 1LP9B 4ZQKB 3RWEB 4DJMA 3LD8B 3PXHA 5IIEB 5DJ6B 2GAZA 3QIBD 3BQUB 5H37G 5GRYA 3QEQD 5C0BE 1AO7D 4RWYL 3FT4A 4DZBA 1X5LA 5FCUL 3WV0A 3T77B 4X9GA 3REVB 1FZJB 1MLBB 4LLDB 3E6FB 2XIDA 2VLKE 5L0QC 2W1NA 1QKZL 3WXVL 2YA2A 1IKFL 4QCIB 4NHUA 5FYLD 5KVFL 3ULVH 3T4YB 3BP5B 3V4UL 4OCWH 2IBZX 1T04B 3VXTA 4DOHB 5EOCJ 3ILPA 1VGEL 5HHXH 3S3PA 1E0OB 1HCVA 3L3HB 2QQKH 1JV5A 2IANE 4PV9A 2HJKA 3BUYB 4CN6A 4JFFB 1AGCA 3QEHB 4NC1E 4AT6A 3QIWA 1YEEL 5FDWB 3B2VH 1UACL 2ZOLB 2FX8H 4NQEB 3UBXB 2NY0B 2BRQA 1X7QA 3WEXB 3WFCL 4GW5A 3U46A 4XCEA 2E7BA 4MDIA 4R97C 4QEGA 4K7PY 4PJ9D 2N4IA 3DX7B 1WFUA 1WUNT 2WUCL 3ROLB 2B20A 1Q9WA 3LOWA 4AEIL 4PRBA 1MCDA 4H25B 1OAYL 3H7BA 3QDMB 4KRPC 1HYSD 4MD0B 3C08H 1KFAH 1JPTH 5H8DA 3C8KB 3NAAH 4I18B 2BNRA 5DURD 4N1EA 3OJDA 3ULUH 1S7TB 4MJID 1W8OA 2UUDK 4G6FB 1XF5A 1DSFH 5F6IC 2PKDA 5KVEL 1JPFB 3FCTA 3CH1B 3FO0H 5IVZB 4V1DE 1WC7B 5I16A 5GGSY 3FQTB 4JM2B 1QSFE 4K3GA 4FQXA 5F6HI 5LCVL 4J3TA 2W92A 3HAEH 3FQXA 4ZXBA 4PJGE 2QSQA 1IKNC 5HI4D 2BMKB 4QOKE 3IDNA 4FG6C 3EO1B 3IJYB 3ULVF 5JHDE 5D1XC 1A6WH 2KPNA 2V2XB 3T3ME 3S36X 5D1QA 5CGYD 4GKSA 4XVJL 5D1ZC 4ZO8A 3WN5A 5EU6E 1RZKC 2IQAB 2AEIT 2EE9A 3VH8A 1CR9L 1IGYB 2XA8H 4K94C 4XNXH 4U1LA 1ACYH 1RZGB 5IFAH 1H3PH 5DD5L 1A1NB 1MWAH 3QZWG 4JGMA 1ONQB 3PV7A 4FQLH 1JE6A 3IGAB 4Z7VA 1GGCL 2VTFA 3QB7C 2DQFA 1IZJA 3WS6A 1DBMH 3K2MC 4PJ5B 5KOMC 2HVKA 2VXVH 5CAYB 1D5IH 5B39A 3T0XA 1NCWL 1ITBB 2DN7A 1FNEB 1KYOJ 1MFAL 5B3NA 3ZDZF 1B0GB 3V5DB 3B9KD 3VXRD 1HSBA 4JRXE 3DUUA 1BIHA 3EYOB 5IW1A 4N0FA 1IAII 4X6FB 1FSKB 1OB1B 3FB8B 1C12B 3S37H 4MXWH 1RZKL 3WHE1 1E6OL 1ZA3A 4K94L 5DGQA 1MNUH 3K8MA 4HG4K 4YO0A 5K9QG 2ZPKL 3MMEB 3PWPB 3SN6N 4DKFL 5I74B 3RL2A 4BFGA 3MV8B 3BMVA 3VFPB 3VFVB 4X7TA 2Q6WB 4LF3B 1D6EB 3NCBB 4PTUA 1OGAA 1WBZB 3PWJB 4MA1C 1KCRL 5KW9L 4JY6B 1ZGLB 2WUBL 3FZUD 3DVIA 4NRYA 5C07D 3T2NL 2NY6B 1IC7H 3STBA 4LIQE 5C8JB 1EV2E 5E2VL 3UJJH 1EJ6A 3RIAF 5SWQB 3O45A 1MJ7L 3RDTB 3AY4A 4G42B 2ESVE 3HG1A 1TJGH 2EDBA 3DLQR 1NSNL 5DO2C 4HGMA 2FBOJ 1EXUB 4LCUB 5IW6A 1MEXL 3T0EC 1TDQA 3E2HB 3O3EB 4KUCF 3BGAA 4LDEB 5E99L 4Y4FB 4QWWD 3D69B 3P4NA 4WEBL 2PYEE 1XIWD 1YN7A 4JFZL 1WF5A 1T2XA 5EBWA 5D2LF 3ZKNC 3MQIA 4WHCA 4WUUD 1NDMB 4KJWD 5AEAA 4L9LB 4BQ8A 1WWCA 3A0OA 1L4IA 3HFMH 2QKIB 5D7JB 5LXGL 2BFVH 1QPPA 1Q0XL 2HLAA 1V7MH 1VFBB 5C0IB 4I9WD 4Y4HC 3HS0B 3OKEB 3HI5H 4LEXL 5FUOH 2XN9E 5CIPB 3VXMD 4KJQC 3B43A 3RWDB 1MJ8L 4FQHB 4KGJA 3PIQA 5LVEA 1C7TA 3SCMA 1MY7A 4DQOL 3BPLC 1HK6A 1P4IH 1MI5A 1U3YA 1TVBA 3DMMB 5D9SB 4XP1L 1NBZB 2FIRT 1JK8A 3QFJA 5JIIA 3QYCA 3D48R 2EIEA 2F8OA 4OZIF 1NMBH 1AP2B 1E4KA 4G7VH 2NXZD 4CBPA 4P57B 3TO2A 3PDOB 1X4ZA 4EI6A 5GZOD 1PZUB 3LKPB 2R0LL 1A6ZB 1UWXH 3DETC 3OKOA 4JO2L 4U05A 2ZCKL 3B5GA 5F8RC 2UVFA 1F90H 5D71H 4LLQA 4UNVA 5LQBL 3WNMA 4BA8A 1VACB 2ZUYA 5MHSE 3GMQA 3RAJL 2CO6B 4KJYB 2A0LC 5F9OH 4D3CH 4GKZA 1G7MA 1K3ZA 4WFGE 3BW9B 3QXAB 3IYLW 4KTEL 3O4LE 4JDZB 3U30B 1TETL 4NRXA 5FA3B 5D1XA 3GHBH 1NGZB 3TBTA 3MV9E 4XPGL 4Z7WE 2C3GA 4IIQB 2V7NB 2Y5EA 3MREB 3QIBC 1T5WA 5T1LB 3OKNA 1FYTA 2XWTB 4PJ7E 2PR4H 4X0KA 4FTVB 2XZQH 4PJ8C 4OF6A 4U6VL 1BQHA 1RZ7H 3GJFK 4ZUTB 1PG7L 4D9QD 4LCCC 2FWOA 4LARL 4PJAB 5DYOA 5EUKA 3GFUA 5ISZD 4XPBH 4KROB 1IGFH 2W0PA 4LASH 4HDIA 4CJ0A 4YXLH 2R9HC 3HPLB 4PJIF 1DBKH 3A6BH 2LTQB 5EN2B 4TUKH 4WI7A 4YFDB 2YEZB 4ZYKB 5GIRA 1EZVX 3PHSA 3BSZH 3MRDB 2OXGA 1OP3K 1BZ9A 3RGVB 4WNQA 3U0WL 3TZVA 5DZOA 2XA3A 1YN6B 3JWOC 4QO1A 4U7MA 1GZQB 3GB7A 2ZJSL 5DRWA 1MF2H 4Q9QL 2OXHA 3IDXH 2CUMA 3NBNA 5SX5H 2JCCB 1RK1A 1MHHA 4Y16A 3EGSB 2MHAA 2V5SA 1RUML 3EJYD 3AGVA 5CP7B 4KQ3H 3TYFA 4DZ8A 3KLHD 1GVIA 1CIUA 4NO5A 2FIKB 5HJ3B 4LLYB 3S98A 2EIDA 1MHPL 4PJ9C 4TVPH 2A6KB 3B8YA 4YR6B 2GFBB 1DLFL 2UYLA 1P4LB 3B9EA 4I13B 2P4AB 2Q7YB 3ARZA 3VDCA 5FYLL 5JOFA 1XGTA 2X4PB 5DQDL 2VISA 4P2OD 1KXQE 4XAWL 5HHOB 1Y6MR 3Q6FA 4U3CA 3L9RA 4YHLH 1NBVL 3GJFA 4FQCL 2L7UA 4ZSOE 4QRRB 3N0PB 4KPHL 3DO7A 3C60B 2YK1L 1P6AB 5JR1L 1K4DA 4K3EL 2P5EA 2E8ZA 3CDGB 1G1YA 1K85A 2OJZH 3D39E 3T0EA 1UWEL 4J8RB 5GJTH 5D7KD 5JZ7D 2D0FA 4RA0C 4GG6E 3QZWA 2AV1B 4A2LA 1YEFL 4H1LG 1CL7I 5HI4C 3THMH 3GIZL 1JYNA 1PKQE 3QAZB 1HXMB 3NOIA 4OV5B 1S9VB 1EO7A 4AIOA 1QBLH 4AJ0A 4NQSB 5J12C 3LRSA 3UX9B 5CFHA 4LCWB 4MB4A 5IHUH 3MCKA 1J0YA 2E3VA 3EHBD 4L1HA 5L7XL 2EYRB 1AGFA 3WJJC 2E9JA 3OAYK 4R7NB 1X6NA 1ZEAH 4O2FB 2IG2L 2NX5E 3QWOB 5KTEH 3QJHB 1R5WB 4NN5C 3GSNA 3BKMH 1I9JH 3WNLA 2YKLH 5KJRH 4ODHH 4MCZB 4ZNEA 3FQNA 3PHQB 3HPJB 2X9XA 4OZGA 2CGRL 4WI9A 3H9HA 5FO7B 3G9AB 4EN3B 4LCIL 3T1FA 1E4XH 3FQRB 4MAYB 1OSPH 3B9KC 4Z7NF 3UYOD 4XC1H 3HC3L 5D96B 1BIIB 1D5BA 1BD2B 1SBSL 2PW1B 3MV7E 1J8KA 2YA1A 3H9SE 1N0XH 5DMJB 4FP8L 3NTCL 4HMEA 4PLNC 3RNKB 4Z78A 3P3YA 1YDPA 3LKOB 1MAJA 1MAMH 3U4BL 1MCNA 4LOUD 5IMOA 1QTYT 4HGWA 4KKBD 1X9QA 1U8NA 3SO3B 2EIZA 4LKXA 5CWSB 3MRRB 2E27H 2BZDA 3Q1SH 1WVZA 5K93A 1RV6X 4FNLH 4V1DB 1TCMA 1TVHB 3KYNA 3P73B 3FZUC 4PJ8A 1W72B 2P46B 1AI1H 4KC3B 2BX5A 1B6DA 1RJZB 4YNYA 4WJ5A 1A1MA 3MRKA 1DBAH 4LCCA 1RURL 3NGBC 2NW3A 1LDPH 1L7TH 2AABH 4PJGB 4XBEL 1FCGA 4HKXA 2ZCHL 3NFPA 2P5WE 4HXAL 4QOKB 5JIPA 4XZUA 4WTZG 5JHDB 4KRLB 5JXAL 1U3HD 4DGYH 3QWRA 2GJZA 2RCSH 4NN6C 4D94A 3TJEH 4J7RA 4QWWC 3VGAC 4UDTA 1XIWC 2P42B 3UO1L 1Y6KR 5HDBF 1KIUA 2Z4QB 1C8PA 5F7MC 5D6DC 1QQDB 2PCPB 4MDJB 3WO4C 3CVIH 3MJ8B 2FYYA 2RFXA 4X7SL 4ONGL 5DDHA 1AE6L 4AEHL 5I75B 2R2EA 3VRIA 4U7KA 1L9NA 4DGVL 1UM4H 1Z0NA 2AQ1A 2CKBH 1OCWH 3DV6B 3OAZK 3QXUA 4LLMA 4EVNB 4ONHA 3ZHDA 5J13B 5DUPH 1MFCH 4XVSH 3TVMB 5AZ2H 4JRXB 2I9LB 3F12B 3TN0A 3MTRA 1BWMA 5D5MB 4HS6A 4ZO6A 2NXZC 1DQJB 1JHKH 3FRUB 5I1JL 4OLYH 4KVNH 5GZOC 1FL5A 1N4XL 1CFQA 2C26A 3GO1H 4X4MA 2Q86B 1CICB 1VHPA 1HXYB 3UAJD 1I3UA 3TJHD 1ZHNB 4X9IA 1AKJA 4RGMC 3BP4A 2B2XL 4I0PA 4QT5A 2VYRE 5T1KB 2HKFL 3NCYS 2I9TB 4M61B 1HCFX 3AM8C 2QL1A 1HHJA 5IEKA 1WIOA 1MCJA 3FONB 5GRZA 2HJLB 4DFHA 3I6GB 3CXDH 1A7RL 3MJ9L 1T21A 2O5XH 4UNUA 5C0CA 1RUKL 3GKZA 4JFDE 4JJ5B 3FT4B 4KQ4L 4DZBB 3BH8A 4O9HH 4OQTH 2ESVB 3O6LH 3OG4B 3PL6A 4QTIL 4JAMA 1ZANH 2QADD 2BSSA 3WJJA 4M5ZL 3BI9X 4NHUB 5E2UL 1I9IH 1MREL 5DD3L 2HWZL 2VE6B 3GNML 3HI1A 3T2OA 1R3KA 2ZUQB 1ERNA 5DEGA 4Z95H 2JIXB 5I1CL 1R6VA 2HJKB 4H0GA 4M6NH 4P3WA 1Q94A 2O5YL 5CSGA 5HGDB 4R96A 4FA8A 4MNQA 2X09A 1MFNA 2VIRB 3RWHA 1NPUA 2X4NA 4Z8FL 4N90D 4OM0H 2NXYB 4A6YH 5I0ZA 3U46B 3BE1H 4XCEB 3N85L 4YFEA 3MRMB 1AHWC 4UV7L 1NGPH 2IH1A 3MUY1 3G6AA 1Q9WB 2VZSA 4PRBB 5EO1A 3KLHC 5FHAL 1DEEA 3JV6A 4GS7C 4HS8L 3GEWB 2D7OA 4XP5L 3Q2CA 3LN4A 3NCJL 2AK4E 1HQ4A 4AEFA 3S37X 3F58L 3UBXI 2IAMB 5IB3A 1A14H 1MCPL 1D9KA 3PHOA 2FECI 1C1EH 3OJDB 1U92A 5GHWL 1QG3A 1Q1JL 2X4QB 1MRCH 3SDAA 4P23A 4P2OC 3RPIB 5KSAA 5F1NA 3SDXF 2LU4A 2M8XA 2DI9A 3FCTB 3QEQE 1AO7E 4RNRA 3V6FA 3OSKA 3ARBA 4HIJA 4S1QH 4OZFH 5GGSB 4FQXB 5IMMA 4YDLC 1JZ4A 3G6JE 1N6QH 5FYKH 5TF1L 3MV9B 2EDRA 3IFPA 1DVFD 3QI9D 4F7MB 4Z7WB 4M9OA 3IDNB 1YJDH 1M4KA 3L1OH 3UZEA 4KHXH 4F7TA 5FYLE 1Z9SA 5FB8A 3MBEB 1NMCC 3UTTA 1UKQA 3EFFA 3VXOB 1Z9OA 4GKSB 4PJ7B 1FVCA 1IQDA 4MD5A 4N8VB 2KDGA 5D6DA 1OAZH 1MFDH 1MSPA 3WN5B 4P9HH 1WLHA 4LMQI 3LKNB 1BAFH 4XP4L 3QXDA 3RTQD 3OB0H 3V8CA 4NBYB 3QXVA 2L7JA 1RUQH 1I8KA 5DHVB 1KG0A 3I50L 3EHBC 1FZMA 3DGCR 1BFVH 5CP3H 2OK0L 4U31A 1QFWL 1LEIA 3OR7A 1CQKA 1ZAGA 4XRCB 4OIIH 4BZ1H 2HVKB 1W0VB 1ROWA 5MI0C 1EDQA 4LKCA 3F8UB 2NY5H 4L4VA 5F7DA 1AQKL 3VFNA 3QHTC 4OLUH 4Z7UF 1MVUB 1HSBB 5C9KA 5IW1B 5KSVB 1CGUA 3WXWL 5BOPA 1GOFA 1T1WB 3FB6A 1EPFA 1KLUA 1CDBA 5C6TH 2Q8BL 4LCYA 2VQ1B 4PB9L 4YO0B 2YPLA 4YHOL 5GS0C 4OLXH 3L5WA 1JPSH 1QHOA 4GAJL 5DT1L 3O6MH 4M7ZB 4ODVH 3G5YA 2VZOA 1IAIH 2X4TA 4L3ED 3RL2B 1MQKL 4F9PC 3MLTA 1F11B 4FFYH 1H5BA 4X7TB 5KSBA 1VEPA 1SJHA 3QHFH 3QUMH 1JN6B 1MCOL 3LMJH 3U79A 3CFBA 4LOUC 4G7YH 4KKBC 5MENA 3I3EA 2I24N 1EIBA 4ZSOB 3VG0L 3JV4A 5LBSH 3WUWA 4HHAA 3BDYL 5JW3H 2XNAA 3O45B 3KPQA 4JFED 5INDA 3HAEG 5L0QB 1IM3A 1FE8L 1EJOH 5F3HB 2AK1H 1OP5H 5DD6A 1K3IA 3GMNB 4U7SA 1EZVY 4FFVC 2O61A 4RAVA 2FGZA 3V0VB 1KELH 4UMGA 4GG6B 1H15A 3VMNA 5IW6B 4XH2B 5HDLA 5DJXB 3K8LA 5C0FA 3VI4F 4WVRA 1PKQB 1PJ9A 1IBGH 1NH6A 1YN7B 4LGRB 1UYWH 5C08A 3K1DA 1H3VA 1YQVH 4BQBA 5TFSL 3EO9H 2FHCA 2EEDA 1C5DB 3LKSB 2VL5A 2XZCL 5C0RH 5K59F 3EDJA 4NCC1 2DI7A 5TQ2H 2FJHA 2VDOL 4G9DB 4CU8A 1VPOL 3KXFD 3AAZA 2WBKA 3W9EB 3LH2H 4R97B 2NX5B 2I25N 3VXRE 1DDHA 4I3SH 2AXJA 2EYTA 4X80L 5FKAA 1MI5B 1GGTA 1TVBB 3MROB 4KRPB 2HKHL 3KWWB 4FS0A 1JK8B 5IOPA 5CUSL 2ATKB 2YZ8A 5IB5A 2LE9A 2AXHA 1UENA 2PTTA 4E5XB 5DRZB 4TPRH 5DJDA 1GH7A 3PGDA 4EI6B 3WIFA 3MGTA 2DM7A 2VSDA 5TDOB 3DWTA 3MV7B 5HVHC 5CBAB 4HW6A 3H9SB 5C71A 1CXKA 4LLQB 1U3JA 1JYXA 2WP3O 1FORH 5FOBA 5C07E 2HT2D 3RBGA 2DL9A 4JR9L 5E5MB 3GMQB 1P84J 2FR4A 5EDXA 4BKLB 5IQ7H 3TJHC 4L8DB 3VWKA 1G7MB 3Q3GB 4CMHC 2OL3A 1ZVSB 3MRQB 2F58H 3IU4L 5D1XB 5HYJD 5DJ2A 4R0LC 4K3DH 4NFBA 1NC2B 5F96H 4HCRL 5ABDE 1J86A 1BGXL 4WUUE 3DROA 3AMLA 4X0KB 4QXUL 4EI5A 4IMLA 2FWOB 2Q87A 2QADC 4I9WE 3RX7A 4ZUUA 4PTTA 3BT2H 4HDIB 2LV4A 5F7LB 4OTXH 1A47A 1YEJL 1KIPB 3BXNA 2VDKH 5FDYA 2GIYA 3V6OE 2AJUH 2CDFB 3HZKB 3IXAB 4J6RL 3DBXB 2AEQH 3DNKA 1S9XB 1BZ9B 1MH5A 3O3DB 2Q8AH 2DBJA 3REWA 3D85A 5DRWB 4O02L 4G6MH 1RK1B 1MHHB 1UXWA 3GRWA 1JHTA 4JCLA 2D0HA 4NKOA 4QHNA 1T0MA 4XNXL 1XF4A 3FN9A 4KKCC 4TUJA 5ITBH 3D3VA 4Z77B 5IFAL 1I8MA 2H45A 4LHUD 4NFDA 1N5AA 3H8NA 4FQLL 4B50A 1YEHH 3S3JA 2GK0A 5JOFB 4MA1B 4HUVA 5TE7H 2XPGA 3BZEA 5CJXA 3GJFB 3EOAA 2FJFA 12E8H 1BJ1J 1H3TA 1Z3GH 1FLRH 1FZOB 1K4DB 5FUCC 5GS1A 2UWEE 4X5WA 4P2QA 3HCVB 4J3XA 4M7KL 3WDIA 3PP3H 1FPTH 4YX2H 3T0EB 3WSQL 5K9JH 2NNAA 4JFDB 5JLZA 5SV3A 1NUDA 4D9QE 1SEBB 1H8OA 1KN2L 3HC0A 5DC9B 3QZWB 4FQPA 2Y36H 4Y2OA 5ISZE 2VZUA 5EC2A 2VDLH 3FO9A 1DVFC 3QI9C 1EFXA 4G9FA 1JUFA 5IVXF 3IDIA 5ADOH 4Y5YC 3QJFB 2YRZA 4NP4H 4NQVA 1FG2A 4TUOA 1I85C 4Y4HB 2NY7H 2R56L 3D9AL 4YAQA 1M7IB 3LRSB 1F4XH 1CGTA 4J3SA 3RIAK 3UTZA 1OSZB 2AEWA 1WZ1L 3PE9A 3UDWC 4L5FL 3RTQC 5I19H 2B1HH 3KDMA 1C5CL 5I1EH 1HYRC 3I3BA 1TQCC 3GSNB 4MA8H 1ZVHA 1CXEA 4EKXA 3FQNB 1REIA 1W0WA 3H42H 2CLVB 4OZGB 5FHBL 1ZWIB 2X7LA 4TSBL 3TH2T 4RFOL 4D0DB 5KVDH 3WKML 3N06B 1UB5A 3ZTJG 1NJ9A 4KI5F 5F7NC 1CI5A 1IGML 2BOBA 2J8UF 1I8LA 1V7ML 4GKNA 2CK2A 5CILH 1RMFL 2FNBA 5J89A 4YE4H 4GXUM 1OT1A 5EBMA 3RJQB 3TT1L 4Z78B 5CD5C 1YDPB 5E0QA 4HMCA 3QO0A 2VLRD 2XWBB 4HGWB 4KZEH 3TBSA 3QHZH 4C55A 1A6VH 1U8NB 3SEPA 5KAQG 1U8MA 3QIBB 5D7KE 3TP4A 2BNUB 3EIFA 5DD0L 1AO7B 4XPAH 2XKNA 2K1MA 2R2CA 4PJ8B 5I1GL 1JGEA 2Z31A 5D2NE 3VD3A 4ODXA 2OI9C 3G6JB 3M17B 2BRRH 4LCCB 4WJ5B 1M05A 3DX9A 1FDLL 2EH7H 5KBNC 3BOVA 1MJJA 5JHLL 4HKXB 4XZUB 4UT6H 2DIAA 4BQCA 2Z93B 4JO1H 1XH3B 3HUJE 4HZLA 2GJZB 5EBGA 4WDIB 3U0PA 4U6YA 4ZMAT 2Z8SA 4PJDA 1JBJA 2G75A 2XYCA 4QNPF 1J7VR 1G6RH 2V6HA 1J8HD 2BVQA 3TBVB 3CFEA 3L5IA 1EEYA 4M1DH 3DVNB 3X3FH 2FYYB 4DEPC 2RFXB