2K3TA

Solution structure of ig-like domain 23 from human filamin a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-A
publication title Molecular basis of filamin A-FilGAP interaction and its impairment in congenital disorders associated with filamin A mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2k3tA00
3IDMA 1EEQA 4X8JA 3RBSA 1AGDA 4KVNL 2IPKB 2VDOL 4ZXBC 5IBUB 1U91A 2H8PB 5JUEH 3AAZB 4FZ8L 4YX2L 1DDHA 2EXYD 4NQCE 2P43B 4F9PA 1HOCA 3DGGA 4IOFD 5BV7C 2R23B 4IRSA 3MXVH 4XP9L 2R0ZH 5F9DC 3IFNH 1SM3H 1XH3A 1EGJH 1S7QA 5E1AB 4ODWB 1JV5A 5HDQH 4GBXC 5C6TH 1BGXL 2DQHH 1EGJA 4HKBA 4GAGH 2FL5B 3DMMD 4YXKH 3IXAB 1MCEA 2DQDL 2YPLE 3EJZD 4GQ9H 3RWFA 3BGMB 2P5WD 3LN4A 3RJQB 1KJ2L 4K55A 5HHNB 1JZ5A 1TJIH 1Y6MR 4F7TA 4NKMB 4AIZA 4JFEA 4O2FA 2BC4A 1Q1JL 2FD6H 2DL9A 2CDGB 1U8KA 4J3SA 1ZK9A 1QFWL 1L7TL 4MQXD 3WUZA 5C92A 2X70B 5JQHC 3TA3C 1KFAH 4MAYA 1FNGA 4PLNC 6CGTA 1K85A 2YMXH 2FSEB 1CIDA 3FMGH 4ZFZB 1A3RH 5ADOH 1M71A 5D6DA 3EYUL 1HYSC 1N6VA 4JFFB 3RZCC 3CSBA 4HW6A 1I7UB 3BOVA 4OCYH 5EOCL 1Q8MA 2I27N 4EI6A 3VE0A 3S7GA 2XZCL 4EQ2A 4W4NA 3IB4A 5D2NB 1TZHB 3ARDC 4C83A 2CDEB 3LEXB 1R5VB 2CRZA 3G6JE 3VU2A 1RUPH 3S4SG 1VEMA 3TEUA 4WWKA 2VZTA 4JR9L 5I74B 5IK3B 3N0PB 2E7LC 4HWNA 4Q2ZA 4GJTB 2ZUQB 3GSNB 3I02A 3FT2A 5BO1H 1JGVH 5ERWA 5CEYA 2GKIA 4DCQA 3VG9C 5CP3H 5BVJA 1CICD 1I8KA 2IPTH 3F6IA 3WO4C 3T0EC 3QJHB 1YEEL 4R3SA 5E8DH 4KHTL 2NY1C 3RKPA 5AD0B 4XNUH 1HIMH 3QZWB 2VQ1A 1NAKH 4R97B 5J13C 1GPOH 3L3JB 5IMKA 2YZ1A 5E94A 2X4PB 4EXKA 1Y18B 4JN2A 1SYVB 3VFMA 2CIIA 2HVJB 3OKLB 1QHOA 4NO2A 2E8ZA 2ZKHL 1JNNH 3U1SL 4U3XA 4JVPA 1IGTA 3PGDB 5GRJH 2WUBH 1PKQE 5JW5A 1FFPA 3U6RB 3SE9H 3BSZL 3LZFH 2JTDA 1TVDA 5EG6C 5TGBA 1Z9OA 1KLUB 4X6DB 5DK0B 4OZHB 2M1KA 4KQ3L 2PTVA 4P57A 1INEL 4XRCB 3SDAC 3SGDH 4IHOB 3ZMRA 3BVNA 4HIJB 3ZYZA 1SJHB 3O4LB 2P8MB 1IGYB 3HE7D 3K80A 4NZJA 5FAAA 4FTVA 3GSXB 2W60B 5HVGB 4PJXE 4ZUWA 2AGJL 4JCLA 3S3SA 2B39A 3I50L 3I6LD 3KPPB 3S3JA 2GCYA 1HQRA 4EIGB 5F7DA 2ZUXA 3ULSB 4QRQB 1ZWIA 5I19H 4Z5RB 3S6CA 3D0LA 5E24E 2NYYD 1T7WA 4X9GA 3NMEA 4XVSL 1X5XA 1JTOA 4LRNH 3H3BC 3BIBX 1SBSL 3QUKB 1X5LA 3Q1SH 4N68A 5DA4A 2ATPB 4NBZB 3ARGD 3BP6A 1QBBA 1QQDB 4QRRA 3TBSA 1JNJA 4L4VD 3EO9L 1KYOK 4L4TA 4GW5A 4BKLA 4L5FL 1RIHH 4Y4FD 1Q0XH 1ZT1B 4C56D 2VDPL 2YUWA 3PWVB 4A6YB 5I8CB 2FIKB 1U95A 4MJ5B 5I8EA 1RZFH 1E4XH 2AKRA 3T04D 3I3EA 3BEVA 1DBBL 1F3DJ 1HYRC 3MPCA 5DQDH 4YR6B 4P5TB 5I1KL 5SWSD 1J86A 1T3FA 3Q6FB 4EVNA 5C0BB 1RV6X 4GAJL 5F6HJ 3BE1H 5CP7B 5HHOE 3QQNA 1OSPH 1Q9LB 5I30L 4OLZH 3S35H 3CCHA 4MA3B 3O2VH 4GQPH 5D5ME 1BM3L 4J2XA 4MA7H 3HNTH 5KVMC 2HP4A 1IGJB 1LP9A 4FFYH 3U4EB 4HUXA 2ICCA 4RISL 4LHQB 3KVQA 1HQ4B 1RZKC 5CJOL 1IZJA 5I0ZA 1EJ6A 1X5GA 4XPGH 5CJXA 4NJ9H 3CMGA 4U3HA 4LHUD 2CLZB 3CFEA 3CFKA 4W4OA 15C8H 3B9VA 2R4RH 2VO5A 1T66D 4L8SA 3KXFB 3SE8H 5T3ZD 5DVKA 1CG9A 2RAMA 3S5LA 5DRWB 1N7MH 3PXJA 4FXGB 1WWBX 3R8BB 1FO0A 5JW4N 2P4AB 2VN7A 3EYSL 5BOPA 2PYEE 5CUSH 7FABH 3D69A 3A0OA 4R7NA 2G9HB 2BSSA 4N5EC 3RA7L 4G9FA 1WWCA 5K9OB 4K3EL 1RUAH 4EKXA 4NZUL 5JXAH 3HI5L 3WFDH 1U3ZA 2WQRA 3BH9A 5BV7L 5LGJB 3NTCL 1UC6A 1F00I 3NPSB 3L3OB 1JPGA 1JF5A 2IH1A 3CAFA 3ZYIA 3PABA 2Z4QB 3TN0B 2XRAH 3QIUD 3D39D 4N90D 1U8JB 2GT9A 4ONHA 43CAB 3L3KA 1W8NA 3QI9D 2MHAA 1G7HB 3FONA 4OD1L 5FYJH 3MRIA 4U31A 1KB5A 3GMMB 3STLB 3U7YL 2Y5TA 1FZJB 4OCWH 1HILA 4WDIA 3C8HA 3B9AA 2KKQA 4I0CC 1GOGA 2X1QA 4OM0L 5T1KA 1AQKL 4FNLL 2IH3B 1J9CT 4U1SA 2BOBA 1ZHNA 4LSRL 4N0YL 1VADA 3T8XB 3BP5A 1BX2A 4FFVD 2CMRH 3MOAL 4JG1L 2MMXA 5HGHB 5SWQA 2APBA 5DHVB 3I6KB 5IB4A 2KZWA 4PJFF 2ICEA 4EEEA 1WT5C 4F7CB 4MNHA 4XWOD 5IB1B 1MAMH 1NC2D 1QSEA 2AK1H 4WHTA 5F1IB 2F9BT 4I18A 4WW1A 1IM3A 4WV1B 4FQPA 1CFNB 5A2KH 1KLGB 1QFHA 4UILL 4Y4KD 2A9ML 5SWZD 3RPIA 4LBEA 4OAWB 2GY7B 4U49A 4AG4L 3CK0H 4B0MM 3CDCA 3HI1B 2EKSB 3MFFA 5HYFA 3GJEB 4M5ZL 5GQBA 3JVGA 3LVEA 3MNWB 3OG6B 2P1YA 4NJAL 5C2UB 4RWHA 4PR5B 4FABH 3C5ZD 1LWRA 5E99L 3L3IA 4FS0A 1D9KD 3MJ8A 4LP5A 4ZDHB 4YPGA 1FGNH 3QIWD 5IJKC 3FQNA 3EJJX 1YEGL 1MFDL 1T0NA 5B38A 2GQHA 1X5AA 1PW3A 1XIWD 3VXPB 3MROA 1FZMA 5KSBB 5TE7L 2VC2H 1KTRL 4G7YL 4WFGE 3AFLA 1JFQL 3B9KC 5TDOA 3GSOA 3MREB 4JO2L 1OTTD 4Y1AE 4NC1E 1KJMB 5FFLA 5IVOA 1KPVB 2OR9H 3V0VB 1OAKH 1N6UA 1BFVL 2XA8H 3P0VH 2VISA 3DIFA 5C9JB 3QUXA 3T1FA 5DYOA 3QUMH 3VFRA 1AKJB 1TJHL 1A2YA 4YDIH 3QUMA 5HHMD 5HD8C 5HDLA 1TNNA 2BY0A 1T2XA 3JV4B 1J8HE 3ULVH 3BFOA 4HKJA 4QXTB 5AWNL 4U2ZA 1Q0YL 3G08A 3JZ7A 4XCYA 5EZLB 2BXYA 5MP6L 1FBIH 4PJ5E 2XQYG 1IGIH 3L9RB 3DXAD 5GSRA 3Q5TA 5IFHH 2APTA 2X4QB 4O4YL 3SCMA 3E3QE 1H0DA 2LTQB 5K9KB 3MRJA 3GRWA 4PJ8B 5F8QC 2EDWA 3MJ6A 3K4DA 3CVIH 4PJ7A 2HJKB 1LEKA 4H88H 1IEBA 3TJHC 3EJYC 1RHHB 2KDGA 5F7EH 4TRPH 5I6XC 3MV7D 2ADGA 4NN6B 1I9EA 4BQBA 3C2AL 4EUPG 3QDJB 3W0WB 5E6ZA 3NFNA 2VDLL 1KEML 1FVDA 3W9DA 3MLZL 1A6AB 1AXIB 5L2KB 2DWEA 3LKRA 4QNPE 3SE4C 1GSMA 3H9HB 3G9AB 3FRUA 1V8HA 1UVQB 3DMMA 2X6MA 4JQIH 1HSBB 3O6FD 4ODVL 1LE5B 4Z7NF 1NC4A 1P2CB 2XKSA 2UV3A 4OQTL 4GUPB 4NO5B 1M6OB 5HGAB 4E41B 1OAZL 1RZ7H 2D7TL 1AIFB 2EE3A 4Y2DA 5D7LD 4FQ1L 1MHHA 1MWAH 1RK1A 3ES6B 3V4VL 1J0KA 5E08L 3TPUA 3EO1A 3GMLB 5F97E 1G7MA 4NNPL 3VXTA 4KDTA 3QO1B 5C86A 1ZLWK 1S3KL 2Y9RT 1RZKL 1IT9H 1C5CL 1IEAA 3ULVF 5I16A 4HEME 1F58H 4DEPC 3MNVA 5BRZB 2VITB 5DWUL 1EJOH 3V95A 3V6OE 4EIZC 4ZPVB 3RWIA 4YJZL 4XH2B 4ZS6C 3LIZH 4TUOB 1JHTA 5SX5K 2HKHL 4MD5B 1AI1H 1YNLH 4PRDB 1ULVA 4HXBH 2UZIL 2EDJA 5JO5B 4UT7L 4YHYB 5EZJB 1TVHB 2P24B 5DO2C 4PJ7F 1FIGL 3KJ4C 4KJQC 4OFYD 1ED3A 2OCFD 3RTQC 2VDRH 1UJ3C 4Y5XB 1IRAY 4EZMA 4QHKJ 2XWTA 3MBED 3IDNB 1OWRM 4XVUC 3O9WD 5KSAA 5HYJD 1A9EB 1JRHH 5IVXE 4Y16C 4PJIA 4YHOL 4LCWE 1HHHB 1OD7A 2BNRD 4KKCD 4LRIC 3L1OL 5FK9A 4L1DA 4YHZL 3GNML 2V7NB 1MI5B 1DZBA 4LPCA 3D3VE 1MOEA 3B9DA 1TQBB 3VXUE 2AXJA 2R39A 5E95B 3B83A 2F8OA 2GK0B 4NM8H 3VXRB 1RURH 5A2IH 5ICYB 2BY1A 1ACYH 3SOBH 3V9FA 3P4NB 1TPXB 3ZHKA 3L3HA 2IBZX 1CZ8L 2F54A 4GS7C 5C0CD 1BWMA 1IQWL 3VG0H 5KZCB 3NIGE 4IBLT 4P2OD 2Q1EA 3NFSL 5DTFA 5FM8A 5GGSY 1M7XA 3L5XL 1QFWI 2ORBL 5IP4A 5D1XC 3CDGA 1RZJC 4ALAL 4IRJA 5AAMA 1I85A 5C09E 1YQVL 4L9LB 1EFQA 5F9JB 1P84J 1SJXA 2X09A 4PGDB 2FO4B 3SEPA 1QEWA 1HWGB 1H3GA 1OTUC 4YEFA 1KXTB 3TO4A 5LKNA 3AGVA 2AK4D 4CW1B 2YUZA 2N1KA 2B5IC 4GXVL 2AJ3B 5JDSA 4MD4B 4C55A 1U8MA 1F3JB 5JW3L 1NCWH 3TO2B 3OWEA 2JCCB 4C4KO 4HAGA 4KKLC 1YMHB 4XZUA 4HDIB 4I2XA 1XF1A 2PF6A 1P7KA 3MNZA 3R0MA 4PJIF 3VMPA 4POYA 3OPZL 3IU3A 4W6YB 4TTGA 3EOAA 5JLZB 4P23B 4GRWH 4YWGH 4XP6L 32C2A 1FHGA 2CLRB 4ERSL 1FIEA 1YUHB 4GKNA 2IPKA 4QOKB 3QHZH 4L4VA 5EC2A 1MRDH 5SX4H 1CK0L 1AXTL 4Y4FA 3H9SD 4C56A 2HLFD 1A7RL 5L9DL 2X1OA 4K7PL 4D0DA 1DN0A 3ZDYE 5JHDB 1ZLWH 1U6AH 4UNVA 3PDGA 2JJSC 5EZOL 1ZVSA 3ULUE 1BREA 1F3RB 2YD2A 1IM9A 2GSIA 1N59B 4JY5L 3SQOL 3HI6L 1TTFA 3N06B 3PHOA 1GGCH 1GGBH 5SX5H 1CFBA 4Y5YC 5EBWA 2R69H 3VXMD 3MMEB 4JPKH 5D1ZC 2DQCH 4GAYA 1J11A 4WI5A 3PV7A 3T2NL 3DO3A 5FYKL 5CKAA 1BVKA 1K2DB 1VKXA 1S8DA 3BD5A 2OTUB 1CVRA 4KI1A 4QXGL 1NDMA 5IMOB 1BEYH 3MRQA 3PWUB 4JQXA 2VDKH 2WIIB 5T3XE 2BHZA 1AP2B 3U2SB 2BDNH 1FH5H 2FATH 2PXYB 4M93B 3U0PB 5JW4R 2PW2B 4X9BA 2YZ8A 2QLVB 1CD9B 3CXHJ 2OYPA 4UQ2B 2H6PA 3KPRB 2KBGA 3WHE0 2BVTA 2K9UA 3OKNB 2XFXA 3JTTB 4UAOB 3W5MA 3B43A 2NY3B 2LU3A 1I8IB 1WJ3A 1G7JA 3BESR 1LQSR 2EZ0D 3FZUD 4DFIA 4GRWF 3DI3B 3S36L 4EI5D 1UEMA 5IR1B 3VFSA 4U0RB 4NWTH 3VFNB 5CLWA 3IDIA 3WIFA 1BIHA 4N0RA 3BH8A 3MLRH 4PB9L 4OF0A 2V6HA 3N50A 3FFCE 5KANI 4ZUTA 4OFIA 3IDYC 4RGMB 3C08H 3WJJA 4U6XB 4UNTA 3D39A 5CZXC 1HH9A 5ENWA 4AM0B 4DN4L 3BO8A 3RGHA 3T3PE 1TQCC 4ODTL 4YLQT 1DVFB 3T4AB 2AI0L 4X6BB 3DHJA 3EGSA 2FECL 3OB0H 5J1TC 4EN3D 5DMIL 1QA9B 3E2HC 2F5AL 4MCZA 4MHHI 2F74B 3TWCL 4S1RL 3BIKA 1CT8B 3GEWB 4U33A 3U4BH 1WZ1L 4AL8H 1G7PB 2D03L 1B9ZA 3GBML 5ITBH 2A38A 2A74A 5JNYA 4YBLB 3CSGA 5FGSA 3D25B 3MR9B 1QLRB 4NCC1 3UBXG 4ZUSA 1MPAL 4XC3H 4X6DA 1FFRA 5CJQH 4ZTPL 4XNYH 3HC0A 5DJDB 5GRYA 2B1HH 4U1NA 4JM2D 2DDQH 35C8L 1DQJB 1N2RA 3DRQB 1YYML 4M43H 4WJ5B 5FCUH 1IGCL 5EU5A 4HUVB 5HHVH 2GTWA 5JOEA 1F6FB 4HJJL 4PS4H 1M1SA 4QEGA 3A6BH 4WU7B 4OD3H 2VLRD 4FQXC 1I3GL 4WI4A 2ERJC 4ZAKA 5SWZA 1OGTB 3HUJB 4JDZB 5A16B 1EIBA 3ZYJA 3I9GL 1S7UB 4NQEA 2Z8WC 4OIAA 4I0PC 3TP4A 4F58L 4X4XB 4ZS7L 5ISZD 4P4KD 2Z35B 5JTWA 3H7BA 5IQ7L 3OGCB 3W11D 5F96H 2YPLD 4XMKH 3T09A 3QIWA 4JKMA 3ZT5A 1K8IA 1AGCA 3NIDF 3ROOB 2DM3A 4KZEL 2E7HA 3SO5A 2PO6C 5IJVB 2FBOJ 4OGXH 1A1OB 3LS5H 3WFBH 3SPVB 1NEZA 4A6YH 1KN2H 2AEQH 4JREC 3BIAX 5DSCA 4NN7B 1BQHB 3TFKD 2AXFB 1YY9D 1A0QH 3DUSB 3SN6N 4NRYB 2AQ3A 2EEBA 1A4JA 1S9WA 4BSWB 3QXDB 4ELKB 1FFNB 1T03L 1CBVH 1CDJA 2BERA 3MX0A 1I9JH 1UB6A 1E4KA 2GSGA 1RZJL 3EDJA 2FNBA 4KJWC 4ODXA 4P3DA 2YK1H 4PRHB 1ZHLA 4X6DF 3Q6FA 4DW2L 4LVHC 4KK9C 5ABDE 4DVRL 1PG7W 3GI9L 2JB6A 5I8OH 3WFEL 4UV7L 3SDCB 4OGZA 2HT4C 2D31A 3O6KH 3Q0HA 4XXDA 1I8LA 3U0TA 5J12C 4HSQA 5ESAB 3CJJA 2CLZA 4W68A 4NQDD 4MDIB 3WO3B 3M17A 4NSKA 3BPLC 1LEIA 4ONOA 4M03A 2VLKA 5FOBB 2ZJSL 3TJEL 1Y6NR 5H2BA 2EYRA 2F53D 3AS0A 5ACMA 3FO2A 4TSCH 2QADD 2PYFB 1JPFB 5FM5O 1A64A 3WL9A 1P4IL 3HPLB 4UOW0 1AE6H 4HIIA 2CIKB 3QCVL 2GJJA 1NAMH 1MCFA 3GMNB 4HF5H 5EU6D 1NAMA 2XI9A 3TBYA 2OJZL 4OF3A 5HHXH 4JM4L 3O6MH 2P5WB 5I75C 3TIEB 1GHFH 3TN0A 1VCAA 4Y19D 4CL7A 3A6CL 1FFOA 5HDBF 2A6IB 4M9PA 2XN9D 2KL6A 1VENA 1V05A 4J23A 2AJSH 2VNCA 1U58B 2YRPA 5JXED 3U36A 4O02L 3QNZA 4S1QH 1YC7A 3TCLA 3IU4L 4M1GL 2X89A 3D87B 4Y5VB 1QRND 4OD2B 2Z93B 1MF2L 4LCCB 1DL7L 4DZ8B 2VE6A 3RGVD 3O3BB 4EDWH 3HC4L 2IFFH 2LABA 3LV3A 1F4YL 1N5YL 4BK4A 3GSVB 1VGKB 5D70L 1IE5A 1FLTX 1MJUH 3HLAA 3MOBL 4TQEL 2H1PL 2AW2A 1FYTE 4PJEE 5GRVL 4G8EA 4IRSC 2ZZUT 2C1PB 4PB0L 4M6ML 3P11L 4OLWH 4V1DD 4OFYA 2W9EH 4G8GD 4Y8AA 4PJ9B 3W39A 5IB1A 1OSZB 5EIIB 3KYNB 2G2RA 5FKAB 5D9SB 1CGUA 2H45A 4CU6A 4ETQB 5JPMB 4JO4H 3EDEA 4YPJA 5I73B 4PJGA 3VFUA 5B39B 2LU4A 4Z77B 5E6IC 1CICB 3L7FB 3FO1B 1HZHH 2HVKA 4D0BB 1DLHA 3QA3B 3FQWB 3TZVA 1Z9MA 5IFJB 2BSTB 4PGEA 4PP2A 3EO0A 3WD5L 1R0AL 4JJ5A 2WW8A 3MO1B 2GJZA 4GG6E 4ZDHA 3WSQL 1UQSB 2J8UB 4HX1B 4FN0A 4ONFL 5DJ8B 3QISA 1R3JB 2XNAA 4LVNC 3RVWC 4LHJB 3U82B 5C8JB 4DGIH 5IQ9B 3OBAA 1CF8H 5IM7B 1NFDA 2D4FA 3WEXB 4KI5E 1HN1A 3G04A 3NCYS 4Q9QL 4NDMB 5LXGH 4CGTA 1CVSC 5D6DC 3JXAA 5DEFB 4R26H 2JJUA 3NFPA 4UNUA 2BRRH 4HLZH 3I6GB 3P0GB 2ARJB 3RDTD 3MODH 2B8OT 2W91A 5LGHL 2DTML 1KPVA 2YHGA 2R2HB 4NKOA 5KS9A 2F19H 2ENSA 3EDFA 4WO4D 4NBXB 1QD0A 2YD1A 2AK4A 1FG2B 1NGWB 4CADB 1WLHA 3MRKB 2NW2A 4HXAH 5DVMA 2NR6D 3HRZA 1PEZA 2ITCB 1E6JL 1UB5B 5C9KA 2DQIL 5A3ID 3QCTH 5DLML 1N4XL 3BZDA 4MA1B 3PE9A 3JV6B 1S9XA 2DJSA 3ARFD 3DX7A 1YEKH 4PJGF 4F7MB 2UZXB 4NP4H 5C07A 3QG6A 2DM7A 3QUYC 3ARGB 3WKNA 2D9QB 4K07A 3QEUA 1AR1D 3HZVA 1J1XH 4N0FA 4U1MB 2BXZA 2DQJL 3ARBA 1CLZH 3I3BA 3ZE1F 1IARB 1WZKA 4TVPE 1PY9A 4YHKL 3H9SA 4K9EH 4GW4B 1EO5A 4MAUL 3CXDL 4L3EE 1U2CA 1G9NH 5K59E 2NY6D 2NLJB 1EEUA 1H5BB 3O8XD 5DGRA 2WZPD 4O51B 1YPZA 1NFDF 4LEOB 4X7SH 5EA0L 3N9GH 2LAGB 4LLQB 4P0DA 5LQBL 5FO7A 4JPVL 5SWSB 3A67H 1P6FA 1QTYT 3AC0A 1P7QD 3FAXA 4DOHB 2P5EE 1RVFL 1EO7A 2CKBL 1YMMD 4HIHA 3VXMA 5JQ6H 3KPQB 1U3HB 2IMNA 4G42A 1N64L 4YDLC 2VDQH 3MLVL 3LRGA 5KS9F 3C60C 1GL4B 4KDWA 1J10A 3ME0A 4UOJA 3LKPB 2R1XB 4KGLA 1CL7L 5IBUG 4PRNA 4LPWA 3CU1A 2PTTA 4M7ZC 1HHIA 4TUKH 4LHUB 5ALCL 4KTDL 4D0CB 1F8TL 4PRPA 2HFEA 1NBVL 5KVFL 1BMGA 2H9GA 1DE4A 4MJ4A 1I7TA 5DQJB 3IFOB 1INQA 4YHIA 5EOQH 5E5RB 1I4FA 1W0WA 4G6JH 1JCKA 4LLDA 1CFSA 4DVBA 5JA8B 1CIUA 4C54A 4Z7OE 4ZPVA 1Z0MA 1QG3A 1PSKL 2C3GA 2F58H 3TT3L 1EEYB 2BFVL 1E6OH 3VFVA 2EH7L 4MNGB 2EDNA 5LAXB 1YDPA 5IB2B 5C70A 4KKAD 3SKMB 4Z9KB 4WUUA 4TSBH 3BP7B 5FO8A 3P0YL 3NABL 5EORL 4Y5XA 2GAZB 5K9QI 1T7VA 3MBXL 1CTNA 5IB5B 5GZNC 3LB6C 3QIUB 5IVZA 1C5DA 1X7QB 3O3EB 1CYGA 3WDJA 1S9YA 3HPJB 1BIIB 12E8L 4Y1AD 1FLRL 3OR7B 1WIOA 3QI9B 4JFHE 2NX5A 5CBAB 1DP0A 2VZ1A 3CPLB 4KXZH 2VXUL 1YEHL 4P49A 3ZDXF 2LFGA 3VXQA 2FJHB 1BVLB 3CVHH 1MFAH 2X42A 2NTFA 4PV8B 5IBTH 1ZSDB 3T77B 1CE6A 3BWUC 4G8IB 5IBLD 3CVHA 4Q0XL 2YN5A 4JRYB 4NUJB 1RUMH 3ZDZF 4KAQH 2DI8A 1J8HD 4QRTA 3QFDB 1JE6A 1ZT7B 3CC5B 4N8CH 4X7TA 2H2PD 2EYSA 4JVWA 4WCYL 4J6RL 3M45A 5DMJB 1PZ5A 1MVUB 4OZIB 2FJGB 4DK6A 3SKNA 5BVPH 1JHKH 4J1UA 4LFHD 3RY5A 5HSFA 4KRMB 3K81A 3OMZA 3O4LE 5HI3C 4RFEA 3FOMB 5JUEL 3FOLB 5IV2A 1NC2B 2RBLA 1B2WL 1NGZA 4ZFFB 3DUHA 3MC0A 3T4YB 3RUGA 5D7IE 1BPVA 2DKSA 3U46B 4Y4KB 2J4WH 4Z7UA 2W65B 1T21B 3MXVL 1P4LB 2R0ZL 4R7DA 2CO6B 3QZWG 1BBJA 1P69B 3IFNL 5F9WC 2XTJE 2DLTA 3TT1H 1EGJL 3C5ZB 1VFBB 2FJFB 3RAJH 5J8OA 5HDQL 4PLKC 3MJ7A 5AEAA 5C6TL 4M6OH 3S9DB 4HHAA 2DQHL 2HMIC 5EBLB 1P5VA 1IKNC 3GMRB 4GAGL 1QOKA 1KT2B 5ISZA 3UO1H 3QEGH 5DMGC 4GSDL 4YXKL 5FDWA 3L3DA 2OXHA 1XIWB 3RWEB 1I1YA 4GQ9L 3UJIH 1X5HA 1DQLH 1OT1A 1KNOB 4XAWH 1TJIL 4YDKH 4K7FA 4ZUVA 4PJDE 1SVCP 5EDXA 3J8F7 3KPTA 1BD2B 3MV9D 3PL6A 2FD6L 3AM8C 5C08D 3X12B 1I1AB 1WCBA 1FSKC 4ODUA 5IKCB 2FECI 4IJ3B 1ZAGA 5GRZA 3UZEA 5ICZB 1KFAL 3K2UH 2YMXL 1ND0A 5F1NB 1ZLVK 1B4RA 3FMGL 2PETA 1U42A 4KROB 1WGOA 4GRLB 4QGTA 2V2WB 1A3RL 1NMCB 2BVQB 5ADOL 4P9HH 5HHMB 4OCYL 1MCBA 3RKDD 1U8PA 4ZD3H 1S7RB 3HZKB 3RUGF 4F2MA 5CZVH 1OCWH 2OK0H 4K7PY 1RUPL 3KXFE 4Z7UF 4POZC 1PQZB 2W92A 3AXLA 4G5ZL 4UDUB 5KN5B 5D1QD 1CDBA 3FO0H 1VACB 3DXAB 2HJLA 4ZXBD 3U2SA 1R24A 4XMLH 2DQGH 4G9DA 5BO1L 1JGVL 4NQDA 2YXFA 4HGWA 4XPHL 1QSFA 3D3VD 2IPTL 4Y0GA 3VWJC 1CFVH 2BJMH 3QFJD 3MV7B 2OXGA 3KAAA 5E8DL 4DWHA 3WN5C 3K1KC 4XNUL 1HIML 2F53A 3BPCA 2IAMA 5MEOA 5GISH 3THMH 3BQUA 1GPOL 3FAWA 4ZPTB 5DI8B 1IGFH 1UZ8B 4MSWA 2D0HA 4GBXD 5FO9B 1S7VB 3G5YB 2CKNA 4MXWL 1JNNL 3QO0B 2WUBL 5GRJL 1D6EA 5EU6A 3QUXC 3SE9L 4Z7VE 5D6CB 1YN6A 3O2DL 1EVUA 3O6FB 2IADB 3LZFL 3C8KA 3WUWA 4WENB 2UUDK 5CIPH 5J6HA 5HVHB 5KVGH 3H2WA 5F7WC 1FVEA 2FHCA 5D7LB 2XN9A 1GZPB 1ZT4B 5CD5C 4CJ1A 5CIPA 2GTZA 1HXMA 3ET9F 3F7YB 2JJTA 5JXEA 1DVFA 2ICWA 3P4OB 3ULVC 1WEJH 4X99A 2QQQA 2W0PA 3DUUB 1QRKA 1MCHA 4NM4H 4X6CA 4BZ2H 5BZWB 1QRNA 1H15B 1WZMA 3ARPA 2Q8BH 4JAMB 1LGVA 4RAVB 4YE4H 3RGVA 3SCMC 5FKPA 1HYSD 4RAUB 2CK2A 2WBJC 5I19L 3WHXB 4UINH 4XP1L 4ZQKA 4M8VA 1S7WA 3QDMA 4LRNL 1D5XB 3Q1SL 5E2TL 3UTTE 5D4QA 1XCTA 5DZLA 4KK8C 2Q8AH 3U0WH 5CEXB 3BN9C 3BPOC 4WHYH 5DJ6A 3OHXB 3PQYE 1Q0XL 2Q3ZA 1T83A 3FB6A 4GG8A 3MBEB 4J12A 4Q6IC 4QRPE 3O9WB 5HYJB 2GK2A 1E27A 5DUPH 2KQNA 1RJYA 5DJZA 3RL1B 1JK8B 1RZFL 1E4XL 3ULUD 3WNLA 1FNAA 3QULA 4QCIA 1ZLVH 3DSFH 2BNRB 4NZRH 3MLTA 1QVOB 1TZIB 4KPHH 3IF1A 3T0ED 1OGTA 2BNQD 2W07A 4UQ3A 5DQDL 1HI6B 4FP8H 4Y2DC 5ESVA 1WK0A 2CGRL 4IIQB 1T1YB 3BE1L 1ORSB 2QEJA 3OJDA 1B0GB 1MH5A 1RIVH 4OLZL 5C0CB 1JZ3A 1CDHA 1FL6A 3O2VL 3K74B 4MA7L 1N5AA 5MEPB 1T5WB 4P2OB 4FFYL 4JKWA 1RJLB 2FDBP 4YZFE 4ELMA 1OAUH 2BMKA 2NY7H 3DX9B 4X6CF 2R8SH 2VAAB 1NGQH 4XPGL 5HXMA 4NJ9L 1FRGH 1JNHB 1FJ1B 3VI3F 5INCA 5DJ0A 2VLJA 4O2CA 4OFKA 3UYRL 4NOFA 2R4RL 3EYOA 3SE8L 3GIVB 4RDQG 4UZGA 4HZLA 3SDAD 1KOAA 1N7ML 3G9VA 1WWAX 4OV5A 4JFXA 3PWPE 3NCCB 1AD0A 1D5MA 3O6LL 5C0GB 4OUUA 1R5IA 3WXVH 3GMQB 2FZ3B 3O0RH 5CUSL 2HFFB 7FABL 5D93C 5I1LB 4ZFGH 4KFZC 1RUAL 4KZDH 3QUZC 3ARYA 2VDOH 5JXAL 1RHFA 2BNUB 3WFDL 2IANA 2VSDA 4FZ8H 4J3OC 4HLJA 5HYIA 5E8EA 3ARFA 1CR9H 3L5HA 1RI8A 3QEQD 3GMPA 5HYEA 1P9MA 5MHSD 5IROA 5DRZB 4XP9H 4OKVB 2UUDH 3KDMA 5ESAA 5BOZG 4R4NC 3VFPB 4WTZG 5B4MC 1S5HA 5FYJL 3QDJE 1KF9B 4NGHH 2D2OA 3T3ME 1BGXH 4KH2A 4OCWL 4QHNA 3VD5A 3IJYB 1CXHA 1P1ZA 5F7FA 4ESKA 3T0BA 3CH1A 3FQRB 1MQ8A 2OLDA 3QNYA 1XGQA 3RNQA 4NHUB 1KJ2H 5JA9A 5EU7E 1OTSC 4X4MA 1I85C 3QR2A 4JFEE 3D18A 2A0LC 4LIQH 5BW7A 1KJ2A 3PDOB 1Q1JH 1Y0LA 4E41E 3UTQB 1P7QA 4M3JA 5DHYB 2E6QA 5ACLA 1A3QA 5C0AD 1HHJB 3BGAA 4U1LB 4R4BB 3DX8B 4KMLB 4S0TD 3SGJA 4JZJB 1MIMH 4BJLA 4RZCA 4HFWB 1MAML 3IS1X 1WQVT 5GIRB 3JTSA 3KS0J 3ETBF 1IVLA 2CR6A 1J0ZA 5F71A 5GS0C 3WLBB 1BJ1H 1NLDH 2ZNWA 1H3TA 5CJ8A 4R8WL 5E70A 4NQXB 2A73B 2X40A 3BWAA 3CK0L 3H8NA 5IB3B 5EU4B 4LLUA 3BZ4B 1BOGA 4P5MA 3V6FA 1R3HB 5IG7A 4FABL 1JWMA 4RCAA 2DQFB 4XX1G 2R1YA 1ZLUK 3RU8H 4EI5B 5EUKA 4N5ED 3WFZA 2Q3AA 1B4JH 3MYJB 1V7NH 4P46D 1MRFL 5I18L 1T1WB 4YDVB 2P8LB 1PDKA 4NZDA 2YKLH 2RHEA 1D6VH 4U4BA 4HS3A 4D3CH 5C1MB 2NY4B 4KHTH 5GGRB 3AROA 2A6KB 4X4YA 3ARED 2EDOA 2FBJH 4L3CA 2WINA 4RX4D 2QSTA 5E2WH 3PWJB 3VXRE 5DRXA 5CINL 3GSQA 3ROLB 3NVQA 2OR9L 1KB9J 4PLJC 5TF0A 3TV3H 1OAKL 4OZGA 1EAPB 1QLFA 2A6DA 2XA8L 3P0VL 5GGVH 4WY7L 2J12B 3QUML 4EN3B 3RL2B 4JQXC 3RWGB 3MO1A 1M7DA 1C08B 3VGAB 3L95A 2VKWA 1HHKB 2PKDA 4HUWA 3ULVL 1NCAH 1A7BA 1XGTA 3IXTB 3QIBB 3QT2A 5FYLE 1CGSH 4HIEB 1CL7I 5BQ7A 1Z0NA 1MHPL 2VWEE 4NPYA 3SDDA 4JQVA 3PHQA 1FBIL 1D5IL 4GLRI 4FTVE 1IGIL 4NRZA 5IFHL 4KJYB 2AGJH 2QQNH 4JM2B 3X11A 5D2NC 4MWFA 2JCCE 4F37K 1EERB 4QWWC 4JY6A 8FABB 1BZ9B 4H88L 3V0AC 5F7EL 1G7LA 2BZDA 3P4LA 4TRPL 2OTWA 1XF3A 4G3YH 3WJJC 2VLRB 5I74C 4QLRA 1SBSH 4LASL 3DETC 3HNSH 2ZUQC 4L4TE 4NFCA 4L5FH 1G7IB 5B3JF 1F11A 4P4KB 2LQRA 1GYAA 4LLWA 5M95B 4PRIA 3M1BB 2YPLB 3DX6A 3OKMB 3RWHB 3NCYP 2BVUA 4OF8A 4PV9A 2IQ9H 3ZKMC 4MQTB 4JQIL 2PN5A 1MHCA 4R97C 2AJXH 5TE4H 5JOFB 5D7KE 1RJZA 4AH2B 4DFHA 1Q9WB 4MQSB 5D2LA 1MLCB 3B9KD 4U1JA 4QTHB 5CGMA 4OTXH 2J8UF 1MWAL 5HI4D 1VA9A 3ILQC 5DC9B 1HXYA 3K4ZA 5HYSB 5I30H 5FYKD 1MFEH 4JFYA 3ZTJG 4M00A 4NYLB 1F58L 1LP9E 4LSTH 5DGQA 5I1AB 4U2YA 1RFDH 3MRMA 1ZLUH 3LIZL 1AGBA 2XXMB 4P59H 3L5IA 3P2TA 3PGCA 1AI1L 1Q9OB 1YNLL 1IJ9A 1J1PL 4XAKE 5HD8D 1F4WH 1FYTD 3K2MC 1WAAE 1G6RB 4ZOAA 5F9AC 3G6AB 3INUH 4NO0A 1OB1B 3CU7A 4WW2B 1JIBA 3F7VA 3WNPA 1MFCH 2VIRA 2DWDA 1UXSA 3PJSA 3V0WH 3F12B 1K8DA 2GITA 5FA4A 2P49B 4D0CA 2H32B 3WHE1 3C5SA 4E42B 4ZXBA 2X4UB 4NZUH 4KC3B 1P4BH 5IUSA 5FGBA 3HI5H 3TJHD 3EJYD 3KLSA 2UZYB 3JUYA 1AQDA 1MAJA 4M7LT 2I26N 3MRNB 2WV3A 4HPYH 3EOTH 2OJEB 5AZEH 1RURL 4JPIB 3NCJH 1ACYL 4XNZB 3SOBL 5D2LF 5ANMB 3REWB 5T1DH 2B7DT 2WP3T 3RIAK 2DAVA 1PKQB 3VG0L 4GBXA 2C1OB 4U1HA 4YHNA 4AT6B 5J6GB 3NA9H 2CH8A 3IGAA 1IILE 4MCYB 4UT6H 4HEPG 4RGNE 4Y19B 4OM0H 3KPLB 3OX8A 3ZE0F 2ATKB 4MQ7B 3RVTC 3W9EA 5BJTA 1BZQK 4XPFL 2F15A 1T22B 4TULL 3UTZA 4CMMA 3FN3A 4JG1H 1BJMA 4LU5L 3D85D 3EIFA 5IEKA 4PJXB 3TA3A 3D48R 3V4PH 4XNQB 3HR5B 5BS0D 1JL8A 1NCWL 4U1IB 4AENA 5C0FA 4ZS6D 1MUJB 5ETUB 5MEND 4LGSB 1IZKA 1LO0H 3PWLB 5KAQG 2OL3B 4HJGB 4B7IA 1QSEE 3KG5A 3S96A 1AO7D 3KPSA 3RZCA 1UEYA 1JF1B 4KK5C 4P2RD 1QNZH 4WIQA 2IQAB 4M9OA 5A40E 1U8HA 5HGBB 4NBYB 3RTQD 3PIQB 3ARDA 4G8GB 5IMMA 1P5UA 5GGSB 4M5ZH 2FB4H 3QHZL 4PJBA 1DSFL 1BQLH 4ZFFA 4RMQA 3P9MB 3IRPX 5E99H 4XVUD 1NJ9A 3U4AA 3NPSC 1BBDH 5E5MB 1R3IH 3MRCB 3JV5A 2CQVA 4RMSA 3MRFA 5GS3A 3TN0C 1YEDB 3DECA 3I75A 3DRTA 4H8WH 4WFEE 5DC0A 4BZYA 3T0EA 4M4RA 2BNQA 1UADC 3PWNB 2Q6WB 1GGBL 2I07A 1EEZA 2ZG2A 2R69L 3VGEA 4JO3L 4JPKL 2DQCL 5D5MB 2GW5A 4JHWH 4KRPD 3TCXA 4N8VB 3B6SA 4NRXB 2H26B 4F37F 2N4IA 2ICWJ 4NQSA 5F89B 1BEYL 1NFIB 3VXOB 5EO1B 1KJ3H 3LQAH 2VDKL 4M5YH 1KC5H 3SGDI 1A4KB 5D1XD 1BD2A 5E2VL 1MVFA 4P4RA 1KJVA 3HG1D 4N0CC 3RDTB 3NCFB 2BDNL 1FH5L 2FATL 4HV8B 5EOTB 4PRHE 1I1FB 4R96B 1OTUD 3O3DA 4WO4B 1LK2A 5BZDA 3VGDA 4OZIF 5F7YC 2PYEB 3VH8B 1FNEB 4P9ML 1JTPA 1Q0YH 5CAYB 3VXNA 5EPMB 9CGTA 2QKIB 2Y06H 5KG9B 3VI4E 3PV6A 1ZGLB 5HVWA 1T2QH 3T0VA 1N3NA 3HN3A 1MNUH 5F72S 4NWTL 2HA1A 4P2QD 4YIQA 4WV1C 1DUYB 1I7RA 3OKYA 4KKLD 3TNMA 1UENA 4XVTL 3V5KB 2E9JA 3MZTA 2YUVA 3MLRL 4TSAH 5T1LA 3TVMD 3OXSB 1KULA 4K8RC 3P77B 3TZVC 4YHLH 5B8CB 4W70A 4KV5E 1JPST 1NBZB 2J5LB 3C2AH 4I48A 3QEQA 1E4XI 5HY9B 1BQHG 3B2VH 2VDLH 1U8QB 3MLZH 1D5BA 3MV8A 1KXQE 4F57L 1E4WH 1GIGH 1NBQA 5E9DD 4Y8DC 4FXKB 1JGDA 3EOBB 3SJVD 3O8XB 4JY4B 3CMOH 4Y4HB 4IEFB 3M8OH 2DQTL 1T1XB 4FQQB 2YD5A 2RIKA 5JIPA 2P5WE 3U4BL 4XNXH 4AL8L 1NBYB 1HINH 4YGVB 1OY3B 1BOYA 5ITBL 4F15B 3MRHB 1E0OB 4OQTA 5I17B 1YMMB 5D1ZD 4ZTOL 5K33A 3W81A 5JR1H 5LG1A 1K6QH 3Q5YA 2DLHA 3I2CH 2Y4SA 4XT1C 2IADA 3IDXH 4XC3L 3CFBB 4FQIH 3MJ9H 4N9GB 5CJQL 3T0WA 4XNYL 2MWCA 5I1DA 2B1HL 4RMVA 3UX9B 1GZPA 3MJ9A 3HZMA 3UTSD 3NGBC 4M43L 2YC1B 4JRXA 3AMLA 4NQVB 5HHVL 3RIAF 4PS4L 1MIEH 1YNTA 3GKZA 2VAJA 3ARZA 4GKSB 4OD3L 2ENYA 2ZSVA 1TZGH 4HGMA 3VJ6B 2X4OB 3GSRA 1LHZA 2LTQC 4PJ8C 2WK2A 4X6FA 4X5WB 3HZYA 3UCRA 2BHUA 5F96L 3BKMH 1KBGH 4HG4K 2G75B 3ARTA 1F90H 3GI8L 5IMLB 1VSCA 4NN6C 3V5DB 4K9EC 4D2NA 4OGXL 3CFJA 4QHMB 2AJZA 3LS5L 4PTUB 1G9NC 1QPPA 5AUMA 4OZFH 3WFBL 1FYHB 3X17A 4A6YL 1KN2L 1ZEAH 2AEQL 1JGEB 1DR9A 4Y1AB 4OZFA 1GZQA 3KYMB 4WU5B 5CZXD 1JPTH 5FV1L 1NKOA 3TGXA 3BKYH 2V2XB 3QEHA 3EYQC 5BMFH 4RX4A 1WF5A 1I8MB 1L0YA 2F54E 3I85A 5E2JA 5EU7C 3MLWH 1RZ8B 2Y7QB 1CXFA 1CBVL 4KUZH 1EHXA 3WKMH 1NPUA 2V5YA 2J6EH 2YK1L 3NFSH 2ORBH 1FV1B 2V7HB 1J8HB 5E8PB 1ZS8B 3R06A 4YFLI 3L6FB 3MFGB 1UA6L 5I8OL 5HGDA 3GUTA 2YA0A 3HB3C 1KXVC 2FEEI 4UIMB 5C0IA 4X6EA 2VQUA 3OXRA 1J0JA 4LSVH 4PJ5B 3O6KL 4H1LB 4WI7A 4GXVH 2VTFA 43C9A 1BJ1J 3RHWK 5EOCJ 1WT5A 1Q72H 4BFIA 4JLRB 4YHYC 3DVGB 4I2XE 5EN2B 5B39G 5E8NA 2A9NL 3IVKA 1G9MH 3RVUD 4Y5XC 2R2EA 4TSCL 1J0YA 1S9VA 5TDNA 1T6WA 4FQXD 3DTXA 4NCC2 2APXA 4YQXH 4MJIA 5DVOA 4YH6A 5HI5C 3OKOA 4ERSH 4BFGA 1UXWA 3W5NA 4L4VE 1KACB 4PPTA 3T65B 1OAXH 4HF5L 1CK0H 4C56E 5IJKA 5JW4M 2UY7A 1NMAH 5HHXL 1TQBC 4OLYH 4HS6B 3O6ML 4BSVA 5J56B 1GHFL 5D7JA 2X10A 5I1CH 5JW4Q 3ZE2E 1C12A 1BF8A 2NY0B 3DV6A 1TPXC 1JWUB 1G0XA 1QR1B 1NDGB 2AJSL 2R0LH 4JY5H 5C08B 2NNAB 1MCWM 5C0JB 3KPOA 4S1QL 5SWSE 1HHGA 1OAYH 3MACH 2X7LB 1FORH 5SV4A 4DKDC 5M94B 3O45B 1BQUA 2BHYA 4MDJA 3LMJH 4EDWL 2IFFL 3P9LB 4L9LC 3B9EA 4PJCA 2GJ6A 2YD7A 3FQTB 5DA0B 5DF0A 5IW6B 2WWKT 4MZ2A 2WLYA 5JDJA 4KK9D 5KSVB 3VDAA 4GW1B 4TUJB 4JGUA 1WVZA 4FQHB 4HK3N 1T20A 3G5ZA 2DM4A 2HN7A 4OLWL 5T3ZE 2HT4D 3E6FB 1T7XA 2AQ1A 2W9EL 4CDGC 5TPWH 3EHBC 1W72B 4MXVF 2X2YA 4PJAA 5D1QB 4KRNA 5DHXB 5E8OB 1XGYH 2DLIA 1ZANH 4JB9H 3BD3A 4JO4L 4U6YA 4P23C 4FMFA 4K8RL 3D3VB 4HUKB 3T1WA 4H25B 1RZIB 5DUMH 4HT1H 3P40A 4MS8C 1KTLA 3QFJB 5BV7B 3LKQA 1GH7A 3DLQR 2NW3A 3FRPG 4P2YA 3PL6C 4OZ4B 3IAGC 1K4DA 4JANB 1KIQA 1ES0B 1S7TA 5HHQB 3D39E 4N90E 1JJUA 3PXHA 3O3AA 4N0UA 4X0KB 1KN4L 5EIVA 3VWKB 4DGIL 3SE4A 1WBZB 4LCUA 2YOCA 4Z0XB 3NIDE 3QG7H 2AI0H 4OCSH 3UPRB 5EBMB 1LNUA 2HJFA 3FB5B 5IF0B 3RVVC 3BZFB 5LXGL 3TBTB 4LMQI 5DJYB 1CLCA 1PG7X 4RIRB 4R26L 3LCYA 4PG2C 2BRRL 2YPVH 4LHUG 4CVUA 3GDBA 1OW0C 3C6SA 1EXUB 3KYOB 1GOHA 4PJCF 3H3PH 2Y25A 4OBSA 4XNMA 4P9HC 2NZ9C 5FA3A 3MODL 3LN5B 2CSPA 5C0DA 2D03H 4F33B 1KCVL 3PWPD 2J3SA 1YNKH 3LSOB 3GBMH 2GFBB 4OIBA 5EWIH 4CNIA 2F19L 4LOUD 3GMOA 4HH9B 4DKEH 4GO6B 1A7QH 4ZAKD 4CVZA 1N8ZB 1MQKL 1MJJB 4HXAL 5T5NF 3JWDC 3R1GH 1OGAA 4S1SL 1MPAH 4PJAF 5BS0A 2R4SL 1FGVL 3BRDA 2QJDA 4M93C 1NGYA 2PXYC 1EPFA 5MI0B 3QCTL 3IDUA 2FGWH 3S8WA 1KPUA 5MENA 1YEKL 4IRZH 4UAOC 4IMKC 1YYMH 4JO1L 5DFVC 3WLWC 2NY3C 3G5VA 4NP4L 1AO7A 1XF4B 4IRSD 1ZMYA 1K4CB 3L7EB 4PGBB 2IAMC 1K9TA 4HJJH 3BQUC 3LKOB 1SJEA 4OT1H 2E5EA 4RA0C 4UUJA 4U0RC 5KSUA 5SWZE 3RTQA 1B88A 2IJ0C 3B3IA 1UJ3A 2EIEA 5DQ9B 4G43A 1DEEA 2DBLH 5FUCC 5KW9L 4NQCA 1I7ZB 1M7IA 4KU1A 4QF1B 1DQQA 1CLZL 3EYFB 2Z92A 4V2BA 4K9EL 2BCKB 2FH8A 1JZ2A 5CD3B 3VG9B 4RGMC 4Y16A 5EC1B 1G9NL 4AMKL 5LJYH 4XMPH 4X5XB 4LRIA 4BH8A 4Z78A 3N9GL 4XGZA 3S4SA 4JFED 1BFOA 3GSUA 4MB3A 3SGKA 3A67L 5H94A 1KPRA 4JPWL 5EO0A 3CSYA 2YD6A 1W8OA 1DVFC 5DRNB 4MAYD 3H9YA 1J0HA 2VDQL 3RVWD 1F97A 1RK0A 1E28B 5ELIA 1RZGB 3LQZA 4HUUB 5HDBE 2FWOB 2BP3A 5JPNA 4U6HA 4TUKL 4X9FA 1MCSA 3RX5A 5D1XA 4YBLC 4NNXB 2JELH 4QHLA 1L6ZA 1OP3K 1U8IB 5T33H 3D0VB 3RNKA 1UM5L 3WFEH 3VMNA 3TYFB 2HLAB 4QXWA 4WWKD 4G6JL 3V6ZA 4JKLA 1SY6H 2F58L 4NT6B 2HG5B 2XY2A 1SY6A 1TVBA 2HFGH 4P2QA 3G6JA 3KNBA 1UM6H 3DXAE 1R6VA 4TSBL 3ARSA 1NGXA 4AEFA 4XPAH 5AAWA 1BLNA 3TJEH 2JK5B 1JZ4A 1ORQA 5SX4I 3QUYD 3RWCB 3CFCL 1EX0A 1HCFX 1BFTA 2D7NA 3FQXB 2X4NA 4NO3B 3IETA 4UT9L 5FECB 4HKXB 3MV7E 1F4XH 3FB7A 3V5HA 4KK6C 1A1NA 3BEWA 1I3RA 1FAIH 5T1MA 1S7XA 5I66A 4TPRH 5HPOA 4PYHA 3BISA 4HQQH 2P47B 3KPNA 4XBPB 3W2DL 1SBBA 4PJHA 1MFAL 1OL0A 2E7CA 3MUGA 2AVGA 2OJZH 1AGFA 2AP2A 4JM4H 3MLPA 1IQDA 4NN7C 1RUML 2JJSA 2DJ4A 1FL3A 3HMWH 5DS8B 4KAQL 8CGTA 5J9PB 3K3QA 2R1WB 5C0EA 4YAQB 4N8CL 4KUCF 4CN1A 1XGRA 5FGCB 4F7PB 3IKKA 2YA2A 4Y5YA 1L0XA 5D7LE 1EFXD 1ZV5A 1F4HA 5D1ZA 3STZB 5C0AB 4OCXH 5BVPL 2CDFB 5TF1H 4I5BB 1B0RB 5GZOC 2VXVH 1CLYH 1N0XH 2ESVA 1YJDH 5JIHA 1BWWA 2XWJA 4JFPB 2LVEA 3MLUH 2CLVB 5F21B 2JIXD 1C16A 3SDCC 1A7PH 5I2IA 4XBGB 3G6JF 3N1GC 4ZO6A 4M1CD 1CE1H 2J4WL 2B1AH 2BVEA 3WNOA 1CD1A 3QNXB 3PNWB 4WW2F 4QRRD 1ZA6A 4L4TD 3BZEB 3EZJB 3P11H 1QLEH 3TT1L 1YN7B 2OL3H 4X9HA 5DDHB 3RAJL 2EIZA 4M8QB 4P46B 3HAEB 3UO1L 3O41B 3QEGL 2DM2A 5DJCB 2MCPL 2UWEA 3BUYA 3UJIL 4PJGE 5HYJE 4MGXA 4PJHF 5HGBA 1FVCA 1P53A 1Z9SA 5LBSH 4IM8A 2H3NB 4XAWL 4JFDD 4YDKL 4NNYA 5EUOB 5GZND 4R2GD 2BNRE 3LB6D 2MCG1 3VFTA 3Q3GB 1XGUA 3IFLH 1R0AH 3WD5H 3AREB 4H26B 3OKDA 5GS2H 5HJ3B 2HRPH 3IDJB 1OP3H 4BZ1H 3K2UL 3ECBB 2JLLA 4X98B 5CWSB 2W9DH 5C0CE 1AD9B 3MXWL 3HKFA 3MTRA 4UU9A 1F5WA 1PFCA 4M1DL 5HHOA 4P9HL 2DBJA 3LD8C 2AJUH 3C6LB 2C9AA 4Y5VC 2OQJB 5CZVL 1OCWL 3MRDA 5ADPH 2DTMH 1ZA3B 4LCCC 1PG7H 1JI1A 1ZHBB 3OAUH 4PJXF 4M6NH 1AXSA 5DVNA 3BYTA 3JWDL 5IEHA 3IFPB 3U9PL 2AK4E 4OJFH 1U93B 3B5GA 1A9BA 5H35A 3TIDA 4G9FD 4JHAH 2VR4A 2C26A 5F88A 4KMTH 5HI3D 4L8BB 4XMLL 3FTGA 2DQGL 1NL0H 1D5ZA 1E6JH 4L29A 2DQIH 4F3FA 3V2AR 4OQ1A 3C9NB 4LLVB 1CDYA 1Q94A 5L8KB 2X44D 1XCQA 2UWEF 3KHOA 1CFVL 1UKQA 2BJML 2PCPB 4KGJA 5CEZL 1BQSA 4PJ9C 3SDXA 5GSVB 3MRGA 5C07E 2DQEL 5GISL 3THML 1EK3A 1CFQA 1G1CA 2IF7A 4FQXA 1HH6B 2P45B 2VABB 1J05A 1FNHA 5I73C 3P9WB 3DV4A 3HCVB 2G5BA 4PLKD 4YFDB 4I0PA 5JORB 2A6JB 2DQJH 5FYJD 1CICC 1MLBA 4E0RB 3VXSD 5DMGD 2CXGA 3H9SE 5ID0B 2FYYA 2FX9H 5T1KD 4PD4K 1JF6A 4DAGH 1GJIA 1JWSA 1YPZE 2PO6A 2R0KL 4G8FB 2BVOA 3VDBA 5T5FL 2GUOA 5KVGL 3B9KB 2D0GA 4LSSH 5IHUH 1JUFB 3TF7C 3OR6B 1NEUA 1RVFH 3ZDXE 1O0VA 3STBA 3VXME 3SDDC 3NZHH 2WAHA 4NM4L 5I9QB 1JYWA 2ARJQ 4Y4HA 2QR0B 5DUBB 1R3LA 3BGFB 5C0NC 3QXVA 1UH2A 4YE4L 3QHTC 3JSSA 4WFFD 4RNRA 1X5KA 2WP3O 4P3WA 5DJAA 1FYTB 5MERB 4BUGA 1KEGH 4PY7A 3J7HA 2QHRH 4PRPE 3LKSA 3NZ8A 1EUTA 1BP3B 3VRIA 3KR3H 2Q8AL 3U0WL 4PGCB 3QXAA 4I4WB 5F9OL 2P8PA 3RRQA 4MA1C 4R90H 1FN4A 4JGJA 1IAKB 3DBXB 4HK0A 3TT3H 2BRQA 5DUPL 2NYYC 5ID1A 4NFBA 5E00A 3MGTA 4R9HA 2CO7B 1UZ6E 3LOWA 1GGTA 4NQVA 3BPNB 5FB8B 4GKSA 4OLUH 4NZRL 3ARGC 1KIPB 1BAFH 3DURB 4KPHL 2O5YH 1XF5A 5INDA 5CMAB 3NABH 4GG6B 1SEQH 4FP8L 3RQ3A 3MBXH 1AY1L 4JDVB 1S7SA 2DYPB 2VXSL 1WBYA 1FLRH 5KOVC 5L6YH 5KVEH 1H3WM 2ADIB 5IWLC 3BXNA 3WFHA 5FUZH 3QUXD 4EUPH 4DKFH 1OAUL 2NY7L 3VGBA 2R8SL 5CHNA 4P3CL 5LVEA 3IT8D 1LO4H 1NGQL 4Q0XH 4EUPA 1FRGL 4ORGB 5I1IH 2J2ZA 3OKEB 3O11B 2AV7B 2EDBA 1U3HC 4JFOA 5DD3H 4WI6A 1RZ8A 2A83B 1PKOA 5TH2B 3ULVD 4MNQA 4CUCA 3D85B 1LD9B 1F6AB 4IDJH 3O0RL 3D2UA 1JI2A 1L9NA 1OLLA 3DVNB 1C5BH 2DL2A 5EU3A 2E9WA 4UBDC 3VA2C 4ZFGL 5FEBA 3Q2CA 2X4RA 1N6QL 4Q9RH 4KZDL 1A21A 2C7UA 3SCMD 5J57B 1HSAA 5L2JB 1KLFA 1U8NB 3QXWA 1B2WH 3SKOB 5FGBC 2WBJD 1A3LH 1KG0A 4H1LH 4RRPG 5CJBA 3MUY1 5J1AA 1CR9L 4P2RB 5JMOC 3MA7B 1MREL 1RY7B 4Z7UE 3BN9D 1LMKA 1R3KA 3CX5K 1LO5A 2IBZY 2VLRE 4LVOB 5CBEA 2EDTA 1ETZA 4NGHL 4Y89A 1YY8B 2R2BB 1X6LA 5D71H 1CGXA 3RWJB 4ZOBA 3WE6B 4L3EB 1MCPL 5ISZE 4A2LA 4G6AC 4GSDH 3MRBB 3MGAA 1NC4D 2DMCA 3FB8A 1FDLH 5E6IA 3QI9C 3LHPH 5KTEH 3KHQA 2P5EB 2C3VA 3FCTB 3LPFA 4Y2DD 4YO0B 4LIQL 3C8DA 1BF2A 4LPTA 2EDFA 3C09C 3EUUA 3O3UN 4NKDB 4GS7B 4KRPB 1DEDA 5MEQB 4O2EB 3VCLA 5CSZB 3DROA 5F7HA 3BHBB 1K5NB 5TDPB 5A2LH 1MIML 2KZ1B 2IEPA 4GRMA 4FFVC 1UH3A 3GHBH 3HG1B 4D8PA 2AABH 1CDGA 2XKNA 1LEGA 1NLDL 5B21A 3V6BR 2FR4B 1T5XB 4CAGA 4G7VL 3V6OA 4HWZB 3QQ3A 1T1ZA 2LE9A 3RU8L 4HKZB 4G5ZH 5KSAD 1W0VA 4TYUA 4ETYA 4U1KA 2CUHA 1B4JL 5D96B 1FZOA 4HCRH 1V7NL 4RQQB 2YEZA 3GJFB 4Y4KC 4JZNA 4MX7B 3T2PA 1W72H 2X4SA 4NQDE 2YKLL 3ZKNC 3TVMB 1D6VL 2OZ4H 3MRRB 2BOCA 4XPHH 1QSFE 3UPCA 1XZ0B 3HMXL 4UB0H 4D3CL 2YSSA 3RWDA 3C5ZC 2OZ4A 5CP3A 4H8WC 2F53E 3QUYA 2VL5B 5IVXA 3IDGA 2FBJL 4OGYH 4QNPF 1IAOA 4R4ND 5E2WL 2F54D 4LCWA 1XIWC 3TV3L 5HYSG 5E9DB 1FL5A 5FOJA 5ANME 4LF3A 1XGPA 3VXUA 4MXWH 1UM4H 5GGVL 4GXUN 2P44B 3OF6D 5EU6E 4ZYKA 3IKCB 4N8PA 3SJVB 4EDXA 2ADJB 1WV7T 1P7HL 3O2DH 1DUZA 4K94H 4IRJD 1OTTC 1G7QB 5F7NC 3DO7A 3LQAC 1I1AC 1OTSD 3O2DA 4Y19E 4IJ3C 2A0LD 2EECA 3KWWA 1NCAL 2XN9E 1U0QA 3W82A 3ZHDA 3B5TA 1CGSL 3TO4D 1CGWA 4KROC 4R0LB 4YDJB 4LNRA 3TM6A 3HFML 2P42B 4GRLC 1EFXA 2Z91A 4QKXB 3QQ4A 4ZFOA 5IOPA 2EYTB 3C60A 2NXYC 1QRNE 5C09A 1NGPH 2O5XH 2QQNL 3VI3E 5F7KC 3RX7A 3VFOA 5CILL 2ITDA 3PDDA 5D7IB 5IHZB 3AY4A 1AHWB 1Z5LA 3UTSB 2JIXA 2HTKC 3BKJH 2VUOA 4HD9A 5F8RC 3U9UB 4G3YL 1A5FL 4XCNA 4XP1H 1HDMB 3QDGD 3QDME 1U8LB 2XTJB 4JFZH 5E2TH 4MJ6A 4QGYA 3HNSL 4PYGA 4LDEB 3V52H 4V1DE 1ZXQA 4WNQB 5IVXF 4G8GE 1T4KB 4QRUB 5A43C 1QR4A 3OKKA 4BH7A 1X5ZA 2DB8A 5ESQB 1JZ8A 3F5WA 1EUUA 2IQ9L 3UC0L 3X13A 1YC8A 1IM9D 1WTGT 5IW1B 2WM0A 4PJDB 2R15A 5HHPA 2AJXL 3IDYB 5TE4L 3CD4A 4KXZI 1SYSA 2YN3A 3QDAA 4JDTH 4JFDA 4KTYA 4OTXL 5IGXH 1J12A 2CGRH 1I1CA 1XMWA 2AXGA 3GSWB 3NIGF 4E5XA 1PLGH 1MFEL 4RBPK 2CK0H 2GIYA 2OM5A 4PTTA 2NMSA 4LSTL 3MCKA 5HVHC 1RFDL 6FABL 3REVA 4ELME 5B22A 2DOCA 4P59L 1AFVH 2WWMD 1KGCE 4I77H 4U6VH 5EBGA 4QT5A 1F4WL 2VR9A 1CFTB 2VLJE 3UYRH 3WBDA 2NY2B 1XF2B 4QY8B 4HPOL 5T3XH 3INUL 1T80A 3F8UB 5D72L 4PJFA 1TDQA 1MFCL 3O6LH 5DURD 3GGWA 3V0WL 4PUBH 4JFFD 1B3JA 1JYVA 2C4FT 3QPQC 4QHUB 2VLLA 4OFVA 1Z2KA 4QO1A 3UAJD 1P4BL 4QWWD 4Z7WB 3P73A 2IANE 1F2QA 1M05A 3FN9A 3VMOA 1H8NA 1ONQB 1U8OB 1FZKB 3C5JB 4LLMB 4DZBB 5BXFA 1OT2A 4HPYL 3EOTL 5I76A 4JZOA 5AZEL 2W1NA 3UBXA 3NCJL 3LKNA 3O9WC 3N85H 4KY1L 3KYAA 1U2HA 2WWKO 1JN6A 5T1DL 3BAEH 2I9TB 3FFCA 1TCRB 3ZDYF 2OMNA 4W6WB 4N8VG 3D1MC 3H0TB 2UYLB 2IALB 2YRLA 4Z7VB 1IKNA 3NA9L 3QJFA 3VXSA 2AQ2A 4G80B 4UT6L 1MHEA 3QAZB 2X41A 1A6TB 1KIRB 5KJRH 5DD0L 4S2SA 4IIQC 3FFDB 5J4MA 1Q9KB 3IJSA 3MGOB 4APQB 1HEZB 3L5WB 3G5XA 2KUTA 4X4ME 5DK2A 3GBLA 3FT4B 1TLKA 3CUPA 3AM8A 4CRPA 4GKZA 1A6VL 2XWBB 2CKBB 3VH8G 3VGHA 3EZ8A 1YMME 3G6DH 3V4PL 2Q7YB 3FQUA 4YNYA 5I1JH 3MRLA 2PW1B 1A1MA 5DXWA 4PRBB 3IJHB 4ZO8A 1U92B 2A77H 4PREA 5DJXA 1WUNT 2RFXA 1LO0L 2ZOLB 5HPMA 1UJTA 3TC9A 1WCQA 4MVBC 3QB7C 4HWBH 5GS1A 3UTTB 1KTDA 1PYWA 1Z6JT 4G6FD 2HT2C 5DD6B 1QNZL 2Q76A 2BSRB 1SEBB 3S37X 4R8WH 1G9MC 2HH0H 5EFIA 4HZAA 1XR8B 4F7EA 2IPUG 3EYVB 4LL9A 3PQYB 4NQED 3AU1A 2B0SH 1WC7A 2FB4L 4QRPB 5J12B 4CKVX 1BQLL 3WS3B 5F6IB 3PUCA 2H41A 1BBDL 1R3IL 1ZHKB 4IOIA 1MRFH 2J88H 3SY0B 4DQOH 3NN8B 4ZSOE 4RBPH 1J5OH 5I18H 3RFZC 5D7JC 2G60H 4LLYA 4YHPB 2VSCA 4H8WL 5ITFB 4MXQC 3VWJA 4L8DB 1S78D 1NANH 3CZFA 3DVIA 3UDWC 3LRSB 4FOMA 1QYGH 3GB7B 3WN5A 1FNSH 3T3PF 4LKXB 4XCEA 4P48A 5F7LB 4JHWL 4L8CB 5ICXB 1LO3H 2R2CA 1FG9C 5CINH 5F3HA 1DBAL 1IAIL 4OZGE 2AV1B 4S10A 4Z76A 1YYLH 1GGIH 3MRPA 3C87A 4ISVA 2ICWI 1CGTA 3VRJA 1KJ3L 4WY7H 3LQAL 4M5YL 1ACZA 1KC5L 3P30H 4LCYA 5C0BD 2X4TB 4YFLF 4J8RA 2WBWB 3P4MA 3LEVL 2HYMA 2P7TA 3PWPB 3KLAA 4CBPA 1FE8H 3F65A 3TNNA 3H3KA 4JZJC 2DKMA 1AD9A 1AGEA 4ZAKB 4P5KB 5FF6B 3IDMB 1MHPH 2Y06L 4OI7A 1MCIA 4X8JB 1AGDB 2X05A 1T2QL 4IMLA 1MNUL 1D5IH 1U91B 1IMHC 1OLZA 3O4OB 1DDHB 5IIEA 4KMQA 5FM4A 4TSAL 2VLKD 1VFAA 1HOCB 3DGGB 3ESVF 4XPTH 2YPKA 4KK5D 2WBJA 4M61A 4IRSB 4YHLL 4U1GB 2EO9A 2W0FA 4XHJD 1J7VR 1XH3B 4X83A 1S7QB 3B2VL 1JV5B 4LASH 2MPAH 2Z8SA 4ZMAT 2CD0A 2EC9U 3O2WH 1E4WL 1GIGL 3BRFA 4Q6IA 4AEIL 3ALWA 2X5PA 3L3GB 3RWFB 4FG6C 3LQMA 3R0NA 4ZUUA 2APWA 3TN0D 1R5WA 1D3CA 2CJUH 1WBXB 2NY4C 3ARWA 3CMOL 3LN4B 5E2UH 3M8OL 2SEBA 4F7TB 4AIZB 1I1RA 2DIJA 4JFEB 1IFHH 4O2FB 4TVSa 1DBMH 2ZOKA 4XNXL 2BC4B 5DJ2B 5GGUA 3ARRA 1HINL 5D2LE 1U8KB 4IS6A 2LV4A 2MSPA 4JRWA 4PIRF 2MQCA 3N1QC 3KPMA 3MV9E 4MAYB 1FNGB 5JR1L 5C08E 4IDLA 2X89D 1K6QL 4CMHB 1UYWH 3CLEH 1MWAA 4LFHG 2Y07L 4H1LG 3I2CL 3IDXL 4WGVB 5HVFB 4FQIL 4JFQA 3MJ9L 3VGAC 3DGCR 3QSKB 4OFPA 2V17H 1M71B 1CLOL 1CTOA 4NKQB 3QIBC 2OR7A 3O81A 4EI6B 3VE0B 1J1PH 5DZOA 2A2QT 3T2OA 4C83B 3HS0A 1MIEL 4PGZA 5HYQA 1NUDA 3TBWA 5DFWH 1TZGL 4WWKB 4MD0A 4JM2C 3BRGC 4LSQH 3OL2A 3LS4H 4Q2ZB 1T04A 3I02B 4PD4J 3BKML 4PJEA 1KBGL 4CVXA 5ERWB 5CEYB 1S5IL 4UDTA 4DCQB 1F90L 2OSLA 3QUZA 4LAQH 3RZWA 5BVJB 1I8KB 1T0MA 1CGYA 1A6ZA 4ZOEA 4R3SB 3TZVD 3VFWA 4QRSA 2XXCB 2VQ1B 1ZEAL 3SGKC 4TNWK 3SE3C 2Z31A 5EB9A 4P4KC 3QFJE 3MUJA 5IMKB 4GMTH 1IAKA 1OF2A 5E94B 2XPGA 3BW9A 3LH2H 4XP5H 1JPTL 4JN2B 3LEYH 3BKYL 3VFMB 1H8OA 2CIIB 2MQ3A 3K8KA 5BMFL 4NO2B 4MHHG 1IGTB 1CXEA 3MLWL 3TBVA 5JW5B 2Q86A 1FFPB 3BT2L 4KUZL 2ARWA 3EFFA 1JNLH 3CFDA 5F3BA 1CD0A 4EOWL 3WKML 1X6NA 3F7QA 3OF6A 2J6EL 5TGBB 5E03A 4PG9A 3GJFK 4C57C 3TFKC 2ZSWA 5JHLH 3BVNB 2DRUA 1IL1A 4XPFH 1F42A 4YDLB 4TULH 4LSVL 4LU5H 1J0IA 4FTVB 4XB8A 5C6PB 2HKFH 4ZUWB 2YBRA 1A6PA 2GCYB 3E6HA 4H0IA 4PP1D 1HQRB 5FUOH 1Q72L 5F7DB 1QBMH 1ZE3C 3QH3A 1FPTH 4LEXH 4QYOA 1ZWIB 2I9LA 3H7LA 1MCWW 1QFUH 4PJEF 5GS0H 1OARH 3D0LB 1G9ML 4WW2C 5ACZA 5F7UA 5C07D 3DSNA 3V79C 3NAAH 3BP6B 4L1HA 3CNKA 1LE9A 4QRRB 3TBSB 4L4TB 3QDGA 4YQXL 1PGRB 4GW5B 4BKLB 1CDIA 2NXZB 1JHLH 3ALPA 4JEGB 4AEEA 4PJ8D 1CDUA 3ARBD 2H8PA 5I1GH 4PJBE 2EDLA 1DSFH 1U95B 1OAXL 2JJWA 3AAZA 5I8EB 3S37H 2AKRB 2W38A 1DLFL 1NMAL 4OLYL 1F4AA 3BEVB 2R23A 3W0WD 5I1CL 3ZT7A 3ISWA 4XNZC 4GG6F 4TVPH 4R2GB 3V7MA 4ODSH 1KCSH 1MJ8H 3T0EE 1T3FB 2BNQE 2OI9B 2R0LL 4EVNB 1WIUA 5E1AA 4ODWA 3UYPA 5I1EH 4JO3H 1KELH 3CCHB 1OAYL 2FL5A 3MACL 1O7VA 1DJSA 1FORL 2MJWA 3IXAA 4KI5F 1LP9B 1RPQA 5AYUH 4KVCH 2HAZA 4HUXB 3BGMA 4TTDC 4EBQH 1NCUA 5HHNA 3LMJL 3VW3H 3BP4B 2KPNA 4NKMA 4XHQA 5GRXG 4AEHH 1YJDC 5A2FA 3CFKB 3CFEB 5E2VH 4PRPD 4XB7A 2CDGA 4L8SB 3ESUF 4NUGH 3H42L 1CG9B 3U83A 3S5LB 2X70A 1BVZA 4ZODA 2FSEA 1FO0B 2R9HC 5TPWL 4F80A 4ZFZA 1G9EA 3UEZA 4P9MH 3D69B 4R7NB 4J3XA 4NN5C 2BSSB 1FAKT 1A6UL 5FHAL 1VDGA 3ARUA 4G9FB 1XGYL 4M62H 1ZANL 2P46B 5C7XH 2W0KA 4JB9L 4JFFA 1JZ6A 1DANU 3ZYOA 1I7UA 2YXMA 4MB5A 2EKJA 3BH9B 3HE6B 4XVTH 4WUUD 5D2NA 1TZHA 1JPGB 2CDEA 3LEXA 1R5VA 2AEIT 2IH1B 4HT1L 3PABB 5DUML 1F6LL 1II4E 3PP4H 2F8XC 2GT9B 4X80H 4ONHB 5HI5D 5F9WB 3GJFH 3L3KB 5GGQH 3GSNH 2NX5D 1ZGLP 5IK3A 3QEQE 3FONB 3MRIB 5MHSE 1RUQL 2VZSA 1KB5B 3GSNA 4YC2B 1RU9H 2Y5TB 1HILB 4WDIB 5K59F 4F57H 3DHMA 3QG7L 4U7KA 4OCSL 4RGNB 2QL1A 5T1KB 4EJ1C 3QJHA 4U1SB 2BOBB 1ZHNB 5AD0A 2EC8A 1VADB 3QZWA 2YPVL 1GGYA 3BP5B 2DQTH 1BX2B 3H3PL 3L3JA 1F3DH 2X4PA 3A6OA 3M07A 1Y18A 1YNKL 1SYVA 5DK3A 3ZKQD 5EWIL 5KZCD 5SWQB 2HVJA 2PR4H 3OKLA 5IB4B 4ZTOH 4DKEL 3PGDA 5FGCE 3U6RA 1A7QL 2ICEB 4ZNEA 5C0AE 4WHDA 1IGMH 3R1GL 4MNHB 1F13A 1KLUA 3AMKA 5DK0A 1QSEB 2FGWL 4TNWF 4OZHA 1ZGLM 4I18B 4WW1B 1IM3B 1MCKA 4K3GA 4XRCA 2Z8RA 4IRZL 4WO4C 1U36A 4IHOA 3RPIB 4LBEB 4JRXE 4CN4A 4HIJA 3MFFB 5TQ2H 1SJHA 3O4LA 4H0HB 1EHAA 2P8MA 1IGYA 5GGVY 4Z7OF 2NR6C 4OT1L 4BM7A 3GSXA 2W60A 3EHBD 2EE9A 5A3IC 4J4PC 2DBLL 3L3IB 3KPPA 3MJ8B 4YPGB 4A2MA 2ZCHH 1VHPA 5D7IA 3FQNB 2D7OA 3ULSA 4QRQA 4O9HH 5B38B 1T0NB 4YEEA 4J3TA 3WS6A 3MROB 1FZMB 4P23D 4Z5RA 5B8CC 1U8LA 2N7AA 3GI8H 2J5LC 3QUKA 2HWZH 2ATPA 4S1DC 4XMPL 3TESA 5IFAH 1J8KA 2QHLA 1QQDA 2X9XA 2C5DC 4AIXA 3DNKA 5TDOB 3PL6D 3GSOB 4OB5H 1ZT1A 5EUOE 3PWVA 4A6YA 5I8CA 2W0LA 2FIKA 1B0WA 3QQ9C 4MJ5A 5JHDD 1YQ2A 4GT7A 3U7AA 3I3DA 1NCBH 1MCJA 3MUZ1 4XWGH 4Y4HC 4BUHA 4PJDA 3DIFB 3QUXB 3T1FB 4R4FL 5DYOB 3VFRB 3RVVD 1A2YB 1XFPA 1UT9A 2BSED 4YR6A 2DN7A 4P5TA 3QUMB 2IWGA 3QXUA 2QSCL 4OIIH 1I9RL 5C0BA 2D7QA 2NZ9D 2JELL 4OZHF 5CP7A 4HKJB 1Y6KR 3RVXD 1Q9LA 5T33L 1KYOJ 4MA3A 1UA6H 3G08B 1IGJA 4XCYB 3U4EA 3GHEH 3KLHC 1HQ4A 1SY6L 2B2XH 5GSRB 1G6RL 3RBGA 3DWTA 2PXYD 2FH6A 3HAEG 3SCMB 1H0DB 1CFTA 3MRJB 5D7IF 2HFGL 1UM6L 4PJ7B 1LEKB 2E27H 3KXFA 3KPRD 1QSFD 1IEBB 4O00A 3OAZK 5DRWA 3QCUH 5DFVD 2A9NH 4XPAL 3SO3B 2NY3D 3WLWD 2XZQH 2ADGB 4FXGA 2IAMD 3BQUD 3NFNB 4WRLA 5JZ7D 3NOIA 5C0RH 1FVDB 1F4XL 3W9DB 4AJ0A 4MJIE 2G9HA 2CRYA 2DWEB 3LKRB 1FAIL 5K9OA 2YR3A 4TPRL 4KKAC 3H9ZA 3VRLF 4HQQL 4KHXH 5LGJA 3DMMB 2E8YA 3L3OA 4PJDF 1NC4B 2Z4QA 3GFUA 4NC1C 3HMWL 1U8JA 4JKPH 43CAA 2IG2H 1G7HA 4XCFH 1MHHB 1RK1B 3ARQA 1DVFD 1MCLA 3GMMA 1RMFH 3TPUB 3EO1B 4H5SB 3STLA 1G7MB 3VXTB 1FZJA 4YBQD 2DIAA 4OCXL 1XAUA 1IEAB 1BFSA 5I16B 4WUKH 5TF1L 3MNVB 2VXVL 1CLYL 1N0XL 4I9WE 3TYGL 4DTGH 5FYKE 2IH3A 3S88H 5ILTH 1YJDL 3RWIB 3T8XA 1JHTB 3MLUL 2XT1B 3BX7C 4MA8H 2H2PC 5GPRA 3FT4A 2VDML 1A7PL 5DHVH 2V9TA 5HGHA 2GYSA 3QDMD 4YXLH 1CE1L 2B1AL 5DHVA 1ED3B 3I6KA 4RWYL 1VEPA 3FKUS 4OF7A 3KJ6L 3WV0A 3E3QC 2I60H 1QLEL 2OL3L 2XWTB 4F7CA 4PJAE 1GGUA 2VRAA 5KSAB 5K9QG 3CGTA 5F1IA 4PJIB 4WV1A 4DUWA 1HE7A 1CFNA 1KLGA 5FK9B 1X3DA 5LBSL 2ZCKH 4K8RH 4OAWA 2DIBA 1P84K 4XPBL 3HI1A 2EKSA 2XYCA 5DFTA 3GJEA 3MNWA 1MCRA 4NC2B 4PR5A 3IFLL 3L3HB 4KK6D 2ZPKH 2HRPL 2F54B 4BZ1L 3SBWA 4Z7VF 1KN4H 2W9DL 3VXPA 5KSBA 1WIPA 1EO8H 2XZAH 3S35X 2NY0C 4LSUH 3LDBB 5E7FA 5DTFB 1KGCD 3CDGB 4JCMA 4IRJB 2VLJD 3FN0H 3ZL4H 2AJUL 3MREA 4WTZA 1KJMA 1QEWB 3OAZH 3TO4B 5ADPL 1KCVH 1PG7L 4CVWA 3V0VA 3V6OC 3TH2T 3OAUL 3AS2A 4M6NL 5JDSB 5C9JA 1U8MB 4OJFL 3HE7B 4DUXA 5GZOD 4E9LA 2V5RA 1AKJA 4JVUA 1IC4H 1FC2D 4JHAL 1MQKH 5IW3A 4KMTL 4S1SH 4XZUB 3QWRA 4I2XB 5BS0E 2R4SH 1FGVH 1NL0L 3S3PA 2IAND 1P7KB 3MNZB 3JV4A 3SDCD 3U48A 2EDEA 4QXTA 5MENE 3EOAB 4RDQF 4JO1H 3MLSL 5D1QC 1AO7E 5EZLA 32C2B 4GRWB 4GKNB 1X9QA 4P2RE 4L4VB 3L9RA 5EC2B 3RJDA 1MAKA 2FRGP 4Y4FB 4C56B 5KW9H 2DQUH 2X4QA 5K9KA 4PJ8A 1KENH 2VLME 4D0DB 1DN0B 1YEFH 2ID5A 3B8YA 2HJKA 1LO2H 1RHHA 1ZVSB 2FX9L 1AJ7L 3X3GH 5KSBF 2EH8L 4YHML 1IM9B 4N1EA 1CI5A 4AMKH 2GSIB 4DAGL 1GOFA 3CXHK 3QDJA 3W0WA 1TTGA 2X9WA 2ZG3A 3PHOB 3V8OA 5EBWB 4K94C 4QTIH 4LSSL 1A6AA 1L4IA 5L2KA 3VWKC 5IHUL 2I5YH 4GAYB 4JPWH 1BVKB 5E1HB 3H9HA 1VKXB 1S8DB 3L3GA 4YZFF 3NZHL 1CQKA 1F02I 1UVQA 1WBXA 3FHAA 1NDMB 2XZZA 1HSBA 2Y36L 3MRQB 1LE5A 1P2CA 2CRMA 4GUPA 5DJ2A 1DFBH 4NO5A 1M6OA 5FDYA 5HGAA 2ZUTA 4E41A 4OCLC 1CXIA 3AY4C 4LCIH 1AIFA 2MFNA 3ES6A 1KEGL 2QHRL 3HG1E 2Y5EA 1QSZA 4UIKH 2H6PB 3OJMB 3GMLA 4MMXC 3F58H 2XFXB 3QO1A 4K3JH 2DMBA 3KR3L 3B5HA 1OHQA 1UM5H 4FQCH 5DURB 1G7JB 4D9LL 5BRZA 1GVIA 2VITA 5MI0C 4R90L 3VFSB 4RFNC 4XH2A 3SHSA 4TUOA 2OTPA 3QP3A 3IDIB 5IT2L 4MD5A 3WIFB 5I71B 4PRDA 3BH8B 5JO5A 4P2QE 5EZJA 1TVHA 2P24A 4OLUL 4ZUTB 1BAFL 1A6WL 1JMXA 2O5YL 4PJ9D 4D9QD 1SEQL 2YS4A 1XR9B 1X5IA 3CFCH 3D39B 1HH9B 4UT9H 5ENWB 4WI8A 3T3MF 3IDNA 1PVHA 2YWYA 2ZUUA 1JGLH 5AZ2H 5EULV 5L6YL 3BO8B 5KVEL 1A9EA 3ULUC 4X8XA 1Q38A 1MRCH 2V9RA 3CFIC 5IHLB 4K23L 3EGSB 1HHHA 5FUZL 4PJHE 3W2DH 5F1OB 4DKFL 2V7NA 1MI5A 4PY8I 5E9DE 1DBJL 1RIUL 2VERN 2Q7NA 1LO4L 4MCZB 5I1IL 4BFEA 3BIKB 2GK0A 3VXRA 3SJVE 5ICYA 4WFHD 3P4NA 4BQ6A 1ZOXA 2A74B 5FM5M 5DD3L 2H2SC 5JNYB 1OPGH 2LU7A 3WNKA 2ED8A 2E3VA 3SDDD 1JMZA 2AERT 3VD3A 4IDJL 4NCDA 4ZUSB 5FYLH 5C0ND 3SGEH 1C5BL 3HC0B 4Q9RL 2ESVE 4U1NB 1G6VK 5I15H 1N2RB 1EBPA 4L9LA 2VL4A 3LN9A 5F9JA 1A3LL 4HS8H 4PGDA 2FO4A 2DF3A 5EU5B 2GTWB 4G6FB 4XVJH 3ZTJH 1T7ZA 3JBG7 3WCYA 3UTSE 4CW1A 1IBGL 5SWZB 2AJ3A 2FLRT 4MD4A 4NQEB 3BDBA 1F3JA 3TO2A 2JCCA 4MLSA 4EQ3A 3H7BB 1YMHA 5D71L 1D9KB 2YUXA 2FIRT 2O5ZL 4HDIA 4PRID 3QIWB 1UH4A 1K8IB 1T89A 4C58B 1CQYA 2K7QA 1AGCB 2YD3A 1MFBH 3CDFA 2MCPH 2UWEE 5JLZA 4P23A 1S9KC 1FDLL 1SVZA 1NEZB 1CCZA 3LHPL 5CGYD 2CLRA 5KTEL 1YUHA 4OLXH 5DSCB 4H20H 4QOKA 2NTSP 4OCRL 5SV3A 1JYNA 2WUCH 4D9RD 4Q7DA 1A4JB 1S9WB 5GRWA 2O61B 5JHDA 4OUOA 1UB6B 2GSGB 3GBNH 4Z0BH 4ODXB 4P3DB 3MXWH 1ZHLB 1N59A 3GHBL 3CH8A 2EE2A 4M1DH 2AABL 4OLEA 4PG2A 3MMEA 5GS1C 1U3HD 1OW0A 4HUNB 4X7FC 2JB6B 5ECJE 2NY5H 2EC9T 1K2DA 2DJUA 3BMVA 2MKWA 1OP5K 4NO0D 1A47A 2YRZA 2D31B 3T0DA 2OTUA 4YK4B 4XXDB 3U0TB 3BP4A 2E6JA 5IMOA 2VXTH 3BI9X 4K71C 3JWDH 3PWUA 3U9PH 4JHBA 4UBDD 4B50A 2V5TA 1GAFH 1WAAA 2WIIA 4LPVA 2JCCF 4HCRL 3M17B 4NSKB 1AP2A 3R8QA 3GIZH 2PXYA 3U0PA 1LEIB 1FO0H 3UJJH 2PW2A 2VLKB 4JJHA 1W72L 5H2BB 2V9QA 2EYRB 2OZ4L 5GGTL 4UQ2A 1OOAA 3KPRA 3FO2B 4ZO9A 3OKNA 4UB0L 3JTTA 4IMKA 5CEZH 4Z7WE 5F70A 3WL9B 3SDXE 1I8IA 4FFWC 5D8JH 2DQEH 1MSPA 4OGYL 4HIIB 3OJVC 4P46C 5IR1A 1LK3L 4U05A 5ALBL 4HC1L 4Z7QF 3SQBA 3VFNA 2VKXA 3HE6A 1NAMB 3TBYB 1UM4L 4G6AD 4S11A 3RI5K 1FFOB 2WANA 1EZVY 3AREC 4K94L 1KB5H 4U6XA 3EFDH 4MMZC 4HGKC 2R0KH 4HUMB 3B4NA 5T5FH 3U36B 3QNZB 4AM0A 3NIFE 3TCLB 4ZFOL 3WDIA 4ACPA 3T4AA 4LPUA 1LP9F 3TA3D 4X6BA 3OG4B 4JRYD 1A7OL 3BMWA 2VE6B 3IAPA 2ADFL 1NGPL 1QA9A 2O5XL 1B6UA 2F74A 3C6LC 3LV3B 3ZKXB 1CT8A 2VZOA 3VA6A 1G7PA 1WAAF 1W2KT 3MLXH 3X3FH 2WSKA 3KPSD 1WFNA 4AK1A 3HLAB 3RZCD 3BKJL 4G8EB 2NPLX 2E9IA 3D25A 3MR9A 1QLRA 3ARDD 2VDNH 3Q48A 4JFZL 5GGRY 3WYRA 4N9OB 2UY6A 3W39B 2J8HA 4KJPC 3V52L 2N7BA 2G2RB 5DJDA 3WIHL 5F9OH 2RCSH 1IKFL 1EVTC 1DQJA 3DRQA 4PJGB 5J3HC 3VFUB 1HKFA 4WJ5A 2XICA 5KAQF 4HUVA 1SQ2N 3NA4A 2HVKB 3ZKND 2XTLA 3S34H 1DLHB 3V4UH 4WU7A 3TZVB 4F8QA 4PGEB 4DN3H 3HUJA 1MELA 3EO0B 4JDZA 4PP2B 5A16A 4JJ5B 3U30B 5HBBA 2GJZB 1S7UA 2NY1D 4JDTL 3ULUL 1AY1H 5IGXL 4X4XA 1NFKA 1CN4A 5H37G 2Z35A 3OAYK 2VXSH 3OGCA 4UTAH 2XNAB 4HIXH 1OP5H 1PLGL 3ROOA 2CK0L 1NFDB 2EXWC 3D6GA 5IJVA 3G04B 4BQ9A 2AJYH 1A1OA 2ILLA 2K7PA 1RJCA 3SPVA 4XC1H 1VFMA 5FIEA 1BD2D 3NFPB 4HH8A 4RSVA 4P3CH 1AFVL 1UWEH 5HI4C 4I77L 1I1AD 4U6VL 2EDHA 3BDYH 1BQHA 4NKOB 4ODHH 2AXFA 5KS9B 3DUSA 5I9QC 1PZUB 5T3XL 4NRYA 4BELD 4KROD 3BGFC 2AK4B 3QXDA 4BSWA 4ELKA 1FFNA 4GRLD 4MNQE 2DLFH 2NW2B 3HRZB 2NXYD 4PBVC 3NCMA 1TXKA 4PUBL 1OAQH 2C3WA