2O5YH

Crystal structure of the 1e9 leuh47trp/argh100trp fab progesterone complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTFADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVWAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords chimeric antibody Fab 1E9-DB3
publication title Closely related antibody receptors exploit fundamentally different strategies for steroid recognition.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5yH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2o5yH02
3FFCE 2VLJA 3FQUB 2UY7A 3WNLA 5I1LB 5I8EA 2BVQB 4P3WA 1VGEL 1QFOA 4OZGA 5MHSE 5EOTB 2Y06L 3VFPB 4FQLH 1BF2A 1TPXB 1R5VA 4XRCA 3BD4A 1J8HE 2GSIA 4PJ8D 3RWEA 1DUYB 2VXSH 1OSPL 2X4NB 2YWZA 4MJIA 1GYAA 3CX2A 4JZNB 4NWTH 4QRUB 3S5LA 1MF2H 1REIA 3IJYB 1S9WA 4LVOC 4WW2C 1MPAH 1Q0YH 3HUJE 5HYJE 5IUSA 3RGHA 4UT6L 3DX9A 5T5NF 1NAMB 3TN0A 3DV6A 4HDIB 5TF0A 4N9GB 2IPKA 4LBEA 4YHPB 4IHOB 3NACL 4JRXD 4KJYA 1A4KA 3O2DA 4NZRH 1U36A 1RZFL 4RRPG 2WIIB 2DI8A 1U8PA 3OTTA 2IGFH 3QHFL 3K74B 2MKLC 2D7TL 15C8H 4YE4L 1DEDA 2R8SH 2L4OA 1CL7H 4CL7A 1S9XA 4NO0A 2VSDA 4WO4D 5JPMB 1LO4L 1YY9D 4K8RC 2NY2C 4FNLH 3HG1A 1NEZB 3F7YA 4HH9A 4NCDA 4ONGL 3B9VA 1LWRA 2Y07L 1CN4A 4XH2A 3RX5A 1HWGB 4R7NA 4FP8H 3IDMA 4I5BA 1VFBA 3B2UC 1CGSH 2F53D 3Q5TA 1R5WA 1ZLSH 1Q9WA 2FGWH 4R6UA 3QFJA 2XZCL 1LDPH 1JPSH 1IQWL 1JZ7A 5CJQH 4K2UH 3ZZ1A 4KKAC 1S3KH 4LRNL 5K9QG 1PY9A 4NQUA 1A0QH 2R4RL 2GY5A 2P5WB 2A0LD 5EPMB 1Y18A 3GJFA 2P5ED 3MXWH 4ZD3H 1XMWA 4QRQA 2NYYC 3BISA 5T3ZL 3BZEA 2ADFL 1A7PH 5EC2A 3K8LA 5F21B 3MGOB 3FT2A 5IB3A 1HHHB 5JLZB 5TE6L 4ONOA 3MOBH 3W0WA 4W4OC 2Y7QA 1FO0B 3PP3K 5C0GB 5KSBF 5FAAA 4N8PA 1LNUA 3NN8A 1I85A 4LSRH 5LQBL 3C8HA 5TDOA 1P69B 5ICYB 2YKLH 5F96L 1G7JB 5H8DA 2YC1A 1OP5K 4YHNB 1U3HC 4GXVH 2FX8L 2ZOLA 3CDCA 1LVEA 5C07B 3JVGA 4XNXL 4ELMB 2A6JB 2XNAA 4Y4KD 3CSBA 1FPTH 5JW4Q 3L3DB 2R2HA 1MHHB 2N56A 4M7LH 5DFVD 1CICA 5HVFB 1HQ4A 4WWKB 1NCNA 5DJYA 1SYVB 5KS9B 1AI1L 3UPCA 3B2VH 5E6YA 4JGJA 1BFSA 1R3IL 1I1YA 3NIGF 1HHGA 1AHWB 1JL8A 1MY7A 3BP5B 5DFWH 4LHUD 4HPOH 1MJ7H 4YK4C 4GRMB 1QLFB 1UJ3B 5ITBL 3C6LB 3FQUA 4LCUB 5I1LA 5TE7H 3MODL 2P8PB 4XVJH 2BVQA 4YR6B 3QDJB 5EOTA 3E2HC 4N0RA 1FFOB 3VFPA 4HGKC 1RIHL 4PJ7F 1BVZA 1UWXH 3VWKB 4MHHI 2R0WL 1BX2B 1PGRB 2NY4B 5LAXB 1CBVH 4XI5C 2OTPA 1DUYA 3VD7A 2X4NA 4MMXC 4JZNA 4QRUA 3SDYL 1RJCA 5D7IF 2W9DH 3OZ9L 5T5NG 1KEGL 3QEQD 3MLUH 1RMFH 1UCBL 2LABA 3TJHD 2QADC 2XZZA 4HWBH 1NAMA 3VFRB 3QIUC 4HDIA 2FECL 4OCSL 4N9GA 2HFEB 5FXCH 2IG2H 1H0DB 4YHPA 3EOTL 1Z6JT 1KT2B 1U93B 3N1QC 4IHOA 4B7LA 3LQAL 3EDEA 4HJGB 5BO1L 1HILB 4M62H 2HT2C 2WIIA 3RAJH 1FLRH 3PV6B 2AK4B 4JFZL 1GZQB 3N50A 2XA8L 1INQB 5JPMA 3PWPE 4KY1L 4IMKA 5ESVB 4NNYB 1G7MB 3R0NA 5IF0B 3NCEB 5DLML 1C8PA 1NEZA 4ETQB 3CFKB 4GFTB 4JRYE 1PKOA 1IGIL 5ALBH 4CVUA 3QG7L 4WI5A 4JQIH 3Q1SL 2PETA 1YEGL 5GJSL 5F7FA 1F8TH 2FD6H 2D4FA 5F8QC 1ZHKB 5IB5A 2DBLL 3W11C 1QBMH 1NLBH 2P5WA 2YMXH 5EPMA 1TJIL 3S36H 5KZCD 2XA3A 1N26A 1WWAX 2VZ3A 3ZYZA 4YXKL 4LKCB 3JV5A 5DRNB 3BGMB 5JLZA 3MGOA 1ZWIB 1HHHA 3E3QC 4JM4L 5A3IC 3QXAB 4OLWL 1CFVL 4GMTL 1SMOA 5HYIA 1FO0A 3PGFH 5C0GA 5JMOC 1BZ9B 4RGNE 5C0JB 3R0MA 1DFBL 3ZKND 3WN5B 1GPOH 3RVXC 3H3PL 4LQFH 4YHZH 3P0YL 5B39G 4UV7L 1JRHH 3ARED 1G7JA 3MJ9A 4YHNA 3WIHA 5C07A 3QUZC 4ELMA 2HH0H 4LCIL 3L3DA 3ZDXF 5CSBA 4D2NA 2XWBB 1MHHA 1MFEH 3DWTA 3ARGC 2AQ3A 4WWKA 3RPIB 5KS9A 1SEQH 1SYVA 5D71H 4EEEA 3BGAA 1GC1L 2WUCL 4MAUL 5HHNB 4AYFA 3GHEH 1KB5L 4S2SA 1U0QA 5C7XH 2NXZB 4NZTH 5GS0L 1OD7A 1Z0MA 4RMVA 1AHWA 1RUAH 3QUKB 3BP5A 3GRWA 3MUJA 2HMID 5JXED 4XPHH 1EZVY 4GRMA 4L3EB 1UJ3A 4HPYH 3C6LA 4LCUA 2GW5A 3O2VL 1QFWH 2P8PA 5FA4B 4YR6A 3QDJA 1FFOA 2X70B 3V4PH 1SQ2N 4UV4L 3VWKA 1BX2A 1C7SA 5LAXA 4W6YB 3H42H 4WFEE 3FMGL 5GZND 4DVBB 3LS4H 2VZVA 3ARRA 3Q48A 2B0SH 4KKCD 5HXMA 3ARDD 1KJ2L 4Z7OE 2IH3B 2AJVL 2FRGP 4XP9L 4D9QD 4D8PB 4DUXA 3ZDYE 3VDAA 4KZDL 2VZ1A 3X3GH 4M7JL 2BY1A 1DANU 3VFRA 4AL8H 1C5CL 1WAAE 5E2TL 3I2CH 4AIXA 2HFEA 5JO5B 1H0DA 4PRHE 3SDAD 1KT2A 1U93A 3DVIA 3S34L 2R1WB 5AZ2L 4F3FB 3RPKA 1BFTA 4HJGA 1BF8A 1MCPL 1HILA 1YNLH 2Q20A 3PV6A 5I1KH 5GRJH 2GUOA 5HVWA 5D7KE 2R2BA 1E4WL 1AC6A 5ERWB 2C3VB 1GZQA 4D0DB 4F37K 2Q8BH 1ORQB 5FUOL 1INQA 3ORJA 4P9HC 1BGXL 1VFUA 4HLZH 5CUSH 1KENL 3S4SG 5ESVA 1H3PL 4NNYA 5MERA 1G7MA 4IRZH 1DLFH 3BKCH 4PP1D 1LDSA 3W2DH 3INUH 4ETQA 2BHUA 3CFKA 2AI0L 4B50A 4JN2B 4KPHL 4CDGC 3VFOB 3MA7B 3K46A 3G6JE 3HE6B 4HK3J 1N64H 1NLDH 5DC9B 2CLRB 4PJBF 3VXRD 4ZOEA 2WIMA 2MCG1 3HE7A 1ZHKA 5J4MA 5DUMH 3RVVD 2P43B 3D18B 1DDHB 4DZBA 5D7LB 1ZAGA 4ZOBA 5E0QA 4PPTA 2UUDH 5IM7B 4KUCF 3UZQA 4EUPB 3BN9C 1PKQB 1HQRA 1YY8B 2QBWA 5IBLD 4LKCA 5CSZB 5DRNA 1A5FH 4MA8H 1ZOXA 3EYUH 4PJHB 4MNQE 1ZWIA 2JJSC 5BW7C 3X12B 3QXAA 5ILTH 3NCBB 4L8CB 1MIEH 2DQFB 4JZOB 2IQ9H 3C5ZB 5C0CD 1BZ9A 5C0JA 5IHUL 1NDGB 2X44D 3WN5A 4X4XB 4OIBA 2V7NB 1LGVA 3WFCH 3KPPB 4XWOC 1N6UA 5M95B 4FFVC 1B9ZA 1FVCA 1KELL 4FFWD 3U2SB 5CEZH 4BM7A 1U8JB 4EN3B 1YYLH 4TPRH 2X4OB 4N1EA 1MH5B 4JR9L 5HYEA 2ARJA 1JZ8A 1HKLH 4L1HA 4YWGL 1YN7B 4R90L 4PJDE 2MCPH 1KJMB 3VD5A 4LLDB 5HHNA 3TFKD 2ID5A 2DB8A 3O6LH 1AO7D 2NLJB 4L9LB 4PRAB 1Q0XH 3D2UD 3IJSB 4KDTA 4S0TD 5JHDD 1J0JA 3QUKA 1J7VR 4OBRA 1IC4L 1RHFA 4L3EA 3T1FB 1N0XH 3BT2H 5B4MD 1EXUB 5FA4A 2IBZY 4ZFGH 5I73B 3BP4B 4NIKB 2GEEA 4YDVB 1ZLVH 2X70A 1IARB 5J11C 2YUXA 4GS7C 4M5ZL 4HIIB 5C6TL 4E41E 2HFFA 5D6DA 1P4IH 4GAYB 4DVBA 1GGCH 1N5YL 4MD5B 1X5FA 2IH3A 1GZPA 2DQCL 2R29H 2I27N 1U8OB 4XNUL 4D8PA 2A74B 3DXAB 2XV6B 2DQDL 1OF2B 1RUKL 3AY4C 4EDXB 1T80A 2C3WA 2PUQT 4KK6C 3MV01 3GSNA 2VH5H 1AGFA 1LK3L 5DD6B 5JO5A 3SDCB 4MGXA 2RB8A 1EJOH 3SCMD 3WLWC 5FUZH 1TZIA 2R1WA 4HWBA 1EBPA 4F3FA 4M1CD 2VR9A 5BRZE 3AMKA 2HKFL 4P46C 4PJAF 3OGOE 3UJJL 2NPLX 5C9JA 3WLBB 4ZUTB 5T3ZD 3MO1B 4PGDB 1Q1JL 4WWID 5EO9B 5ERWA 1KGCE 2C3VA 3IAPA 2UWEE 4D0DA 5C86A 1J88A 1ORQA 3H0TB 3JWDC 1A9EB 3ESUF 3MRRA 4Q9RL 3QDHA 4NNPH 2DKSA 5DR5L 4F58L 1JP5A 5D8JL 3U36B 3FFCD 1PJ9A 5ECJE 2IPTL 5E2WL 4GAGL 4DEPC 1K8DB 5MHSD 4JN2A 3O6KH 1NDMB 3A67H 4IIQB 3VFOA 3MA7A 2C3XA 1J8HD 4YFLI 4NC1C 2O61B 2CLRA 3RY4A 1E4XH 3F65A 2P47B 4F9PA 4X4ZA 2O93L 3D18A 2R9HD 4X6DB 1CR9L 2EDOA 4QHMA 4I3SH 1I8LA 4NN5C 3T0EC 1JF5A 5IM7A 1RU9L 2AQ1A 4EUPA 3HRZB 1PKQA 1YY8A 2VZTA 5CSZA 4RA3A 4PJHA 3PJSB 5CD5D 1KFAL 3X12A 1MCNA 3BFOA 4NQCD 4P0DA 3QQ9D 4L8CA 2DQFA 3BQUB 1XR8B 4JZOA 2DQUH 4P2OD 1RK1B 1JI1A 1CD0A 1TTFA 3I50L 2EDFA 1WSST 4X4XA 1ZV5A 2V7NA 3KPPA 5JA8B 1EZVX 3DX8B 4OZFB 2OM5A 4NUGL 4UILL 3RZCD 4MA3A 4NOBA 3U2SA 3FRPG 5EBLB 4CW1B 1U8JA 3HKFA 4EN3A 3F58L 1JGLH 3LKSB 2X4OA 1QLRB 3MOQA 1MH5A 1I1AC 1PSKH 5FCUH 4EOWH 3VXSB 1YN7A 4AEHL 1NGQL 1EIBA 4QRPB 1KJMA 5D7SH 4LLDA 5CBEB 2CUMA 1DLHB 1FZOB 2RIKA 3H9SE 5TFSL 2NLJA 4Y19B 4L9LA 35C8L 4PRAA 4MA7L 1BM3L 1KN4L 3IJSA 2R0ZH 3RVUC 4IM8A 1UEMA 5JW3L 2AW2A 3T1FA 1UZ6E 1RJYB 5ISZB 2FNBA 3QHZH 3QNYB 3CDGB 1EXUA 1JZ3A 3ZKMD 1OAXL 3IVKB 3BP4A 1LQSR 4OZHB 4YDVA 1FFPB 2QJDA 1NCBL 3QCTL 3F6IA 3MRGB 4OUOA 2BRRL 3K8KA 4HIIA 3S5LG 2HT4C 1IM3B 4GAYA 2A1WH 2DD8L 5EOCH 1F4XL 1YQVH 4BZ2L 4MD5A 3ALPA 1HXMB 3VDCA 1GOFA 5I1HH 5JR1H 3PXJA 2A74A 3DXAA 1OF2A 3BJLA 3MRJB 1NQBA 3WIFB 4GG8B 4RMSA 4PJIE 4EDXA 3NFNB 2VDML 5DD6A 5IFHL 2DQGH 1R3HB 3SDCA 1YZZA 1U3ZA 4OF7A 4DKAA 2ZG3A 4Z18A 4JKKA 1L9NA 2CRYA 4KMLB 1G7QB 5DMIL 2ATPB 4Z7VB 4G3YH 3WLBA 1FRGL 4AG4L 1FCGA 1GRWA 2XICA 4ZUTA 3MO1A 4MA1C 4PGDA 4XX1G 3QCUH 5EO9A 1B4JH 3A6BH 3EO9L 3H0TA 4PJFB 1DVFC 3KYKL 1A9EA 3RJQB 1ZVSB 4JM2D 1MAJA 1ZGLM 5D1QD 2XY1A 3U36A 2GAZB 4YHIB 4LAQH 1K8DA 4NP4H 4CMHB 2C4XA 1Q9LB 4Y89A 2HKHL 1NCWH 1NDMA 4IIQA 1QVOB 3WO4B 3QCVL 4QOKE 1UKTA 3NCYS 1OM3H 4PB9L 3BH8B 1C5BL 2O61A 5JOEA 5IROC 1O0VA 3P0GB 4MLSA 1ADQL 1SVZA 1CE1H 4G6MH 3MPCA 1TVDA 3KXFE 4X6DA 5D4QA 3RY5A 5L2KB 4LFHD 1Q8MA 4L8SA 3HRZA 3X14B 5GS0D 4LIQH 1MFAH 5HTSA 1QLEL 3ZTJG 3K4ZA 1JHKL 3PJSA 4FXGB 4PJEB 4Z95L 4UOJA 3BQUA 5AG8A 1S8DB 1XR8A 3SKJL 2E5EA 1RK1A 3E6HB 4K23L 3KPRB 1LEIB 2QQNH 1YN6B 2LU7A 2PXYD 4N0CD 3ME0A 2Z31D 4P49A 4KWUA 4JFXB 3DX8A 4OZFA 3V95A 3GMPB 5BV7L 4M61B 3ZKXC 3PWPD 5HVGB 2GTZB 3RVWD 5IR1B 4OM1H 2IBZX 5EBLA 4CW1A 2SEBB 5I1GH 3LKSA 4K9EH 1JTOA 2EE3A 3LB6C 1QLRA 1CS6A 3E3QE 1F97A 2IJ0C 4JRYD 2OJZL 3VXSA 4JO4L 1ITCA 2BVTA 1G0DA 5DJ6B 4M5YL 2ZUSA 4QRPA 5CBEA 1DL7L 1XGPB 1DLHA 1FZOA 4Y19A 2ZKHH 4AIZB 3T09A 1AQKH 2ZPKL 3MYJB 5TH2B 3HZVB 4ZNCD 3QIBD 1RJYA 5ISZA 5CCKH 3JWOC 3QNYA 5IBTH 3CDGA 4JKPH 2C3HA 3BEWB 3IVKA 1WVZA 4OZHA 1FFPA 1B2WL 3MRGA 4RISL 2IANE 1EMTL 5SWSD 3PQYB 5JIHA 3MLXH 3BRDA 1IM3A 4RGND 5KSBE 1HINL 5GRXG 1EPFA 5IHBA 3H9HB 5IGXL 1VGKB 4HKZB 1GAFH 1HXMA 4FQXD 1VFOA 4M43H 5E8EB 1KCRL 1QP1A 4MB3A 3MRJA 1FNSL 2DMCA 3WIFA 1HSBB 4GG8A 1NFIB 3NFNA 2MSPA 4JPWH 1N7ML 1R3HA 1YMMD 1BVKB 4YHYC 3DURB 2J8HA 1Y0LB 1WIPA 2CRIA 3EYFB 1G7QA 1I9JH 3VJ6B 2ATPA 2IH1B 3TWCH 4Z7VA 1T83A 4XPAL 3NIGE 2JJVA 1IRAY 1CDHA 1MAML 4PJFA 4MNGB 3P4MB 4NGHH 1B0RB 1UYWL 1ZVSA 2E9WA 3FT4B 4LL9A 1NEZG 1G6RH 2FH6A 1CFSB 2OR9L 2GAZA 4YHIA 4JDVB 1E27B 3GNMH 3SDXB 1INEH 4AEFA 1CLOL 3OR7B 4F7TB 2LTQB 2I07B 5CJ8A 4XVTL 1QVOA 1XAUA 4FQHB 4PJ7E 3CSGA 5DD0H 4PBVC 3KHQA 3BH8A 1OAQL 1N6QL 4WFED 3MRIB 3KR3L 1F3DH 5D7IE 1SBBA 4U49A 3EAKA 3NPZB 5DWUL 1CFBA 3P4LA 3O3AB 4OGXL 1L6XA 3UTTE 5L2KA 2RR3A 3GM8A 2DLEA 5HD8D 2YZ8A 4F8TA 3X14A 3ZTNH 1D6VH 1WZMA 4FXGA 4PJEA 2XT1B 3O6ML 1T7VA 3LCYA 4XPGH 1FL6B 1S8DA 5E94B 4NKMB 3MLSL 1IEBB 3E6HA 1OGAD 4WCYL 2APXA 1IZJA 4YX2H 3KPRA 4HWNA 3I02B 1NCAH 3BWUC 5D7KD 1LEIA 3SJVE 1BLNB 1YN6A 3TH3T 4PRPE 2NR6C 4P23D 1AIFB 4JFXA 3GMPA 4M61A 1KC5H 3SGEH 2GTZA 4X5LA 5IR1A 3S35X 4R26L 2P8MA 2SEBA 3GSQB 5FGBC 2Y72A 1J5OL 4KRLB 3QEHB 3NCMA 4PJ9A 3CFEB 1TETL 3SO5A 3U83A 3S88H 1I3RB 1KACB 2F9BT 4XC3H 5DJ6A 3DROB 5J1TC 2DM2A 1XGPA 5E95B 5ADOL 5I6XC 1V7NL 4HIXL 5J1AA 4AIZA 4LSDA 3GK8L 1TMCB 3MYJA 4ZO8A 2D9QB 5FV2A 5TH2A 1MNUH 4L4VB 1MREL 1NC4D 4KV5F 2A6KB 2HVKB 2X1QA 3FQXB 5MI0B 5E5UB 3BD3A 2F54E 5LWYH 2X89D 4JPVH 4WI9A 3GIZH 1UCTA 1KCSL 3BEWA 3IFNH 2EDDA 3OXRB 1GGBL 2EYTB 3RDTC 4MNQD 4ZSOE 2YPLB 2VAAB 5IQ7H 4JFEE 3HC3H 3PQYA 3K1KC 2V7HA 3KNBB 4OCXH 2FHBA 1S7UB 1MHPL 3MOAL 5JNYB 2YUVA 3H9HA 1VGKA 2YD2A 4HKZA 2OI9C 1LO2L 3D3VE 5E8EA 1CDYA 1GGTA 3QPQC 4APQC 5BQ7B 1HSBA 1NFIA 4UUJB 2HT3D 4MWFB 4Y88A 3ZDXE 2FWOB 1UJ3C 4O9HH 3QDGB 1BVKA 3BPNC 1E4JA 3DURA 1Y0LA 3ZDZF 4M3KB 1IGFL 1DBJL 1S78D 3EYFA 5I0ZA 3VJ6A 2IH1A 4NQEE 3L95B 2UYLB 4OCWL 5CIPH 4ZDHB 3DETC 4FTVB 3AROA 3EUUA 4Z0BL 5JDJA 1JZ6A 4MNGA 3P4MA 1FORH 2EDLA 2RQ8A 1B0RA 4I2XE 3FT4A 4XP1H 4WEMB 5FGRA 4ELKB 5J12B 3CD4A 2X4UB 1CFSA 3CVIH 2VB5A 2X9XA 4JDVA 1FG9C 1UKQA 1E27A 2XKSA 3SDXA 3RTQD 3OR7A 4F7TA 3HI6H 2I07A 3F7PC 4FQHA 4HUXB 1U6AL 1L7IH 5I1CL 3DI3B 3DMMB 1CT8B 4NQDB 5F9WC 5I8OH 2XIDA 1XIWB 1M05B 3UYOD 3BO8B 3B9KB 3O3AA 3QWOA 4JAMB 4M48H 4KRNA 1CLZL 3PWNA 5DURD 3IDXL 3U30B 4YHLH 1KV3A 3H6JA 1J0IA 4LQ1A 5FKAB 4B7IA 5MP6L 4PJHF 3DV4B 4RIRB 1AE6H 5E56A 1FL6A 5E94A 4NKMA 5BRZD 1QD0A 4NC1E 4CVZB 2DMBA 5D70H 1IEBA 3D6GA 4GSDL 1NCDL 4Y2DB 2Y36L 3I02A 4G7VH 4W4NA 4WENB 2V9TA 4JRWA 1BLNA 1DZBA 4LEXH 2A6DB 1LE5B 4C4KO 4ZXBD 1P53A 3RVTC 3T0EE 3BWAB 4PYHA 3WDHA 4PS4H 4V2BA 1D9KD 5I66B 4FG6C 4M6NH 1AC0A 3GSQA 3P0VH 3FZUD 3UROR 3TCXA 3ULVH 5DQJB 1VKXB 5K33A 3QEHA 1A3LH 3QEUB 3CFEA 3UTSE 4Q7DA 1I3RA 4WHDA 3D69B 4JFDD 2GJ6E 3PV7A 3DROA 5IK3B 1MRFL 5IB1B 4LK4A 4PJBE 4ONFL 3QIWD 4ENEC 4PRID 4L4VA 2A6KA 2HVKA 3CVHH 3FQXA 1U8KB 2FB4L 3TEUA 5C0NC 2NY2D 3RI5F 3DVFA 4L4TB 5AAWA 4Z7WB 4XMPL 3OXRA 2R39A 2EYTA 1MY5A 3PP4L 1QFPA 2YPLA 4IS6B 2VAAA 2YD5A 3LEVL 1CQKA 4LEOB 1BD2E 1VB9A 4G43B 1K8IB 3B2UD 3KNBA 1LO0L 1S7UA 1WEJH 5JNYA 3WKMH 5L0QB 4KKAD 1DQMH 1L7TL 1I8IB 3MXVL 3KPOB 3GSRB 3CLFL 3DIFB 1OCWL 2P45B 1HCFX 1WJ3A 5BQ7A 4MWFA 4KMTL 4G6FB 1F6AB 5F89B 1C7TA 4XCFH 2FWOA 4U1GB 4YIQB 4ZOCA 3QDGA 5J06A 5D96B 3JWDL 4C83B 43C9B 2HTKD 2F8OA 4OCYL 4FHBD 1YUHB 1CZ8L 2J5LC 4ZTPL 2LFGA 5FHBL 5JQHC 4DQOL 1OTTC 4X4YB 3QAZB 4QHKJ 4LVNB 3L95A 2UYLA 2FEEI 3SDDB 4ZDHA 4D9RE 5C0EB 4FTVA 2MWCA 3BE1H 4M6MH 1TQBB 1U3HD 3TJEH 2CDFA 1WK0A 4ELKA 5DEZA 4NN7C 4U1JA 1YJDH 2X4UA 4EI5B 1TENA 1I1CA 4AEIL 3LVEA 4BQCA 4F80A 1DQJB 5KANI 1G9NL 1MCDA 4L29B 3O4OB 5DK0B 5E8DH 4RGMB 2YA2A 3IFLH 2CLZA 3KPSE 1HHKB 3MRLB 3SE9L 1D5IL 1QTYT 1XR9B 3DMMA 4NQDA 1XIWA 1JNHB 1M05A 4GKSB 4MJIE 2NTFB 3BO8A 5E6IB 3HNVH 3B9KA 4JO1H 4XMKL 4NCC2 1ZLUK 4XHJC 4OGYH 4JAMA 4M00A 3QUXB 3QUMB 5FK9B 1X5ZA 5HDQH 2ESVB 4JHAL 1JHLH 1F4AA 3RIAK 4DW2L 1C16B 3BKYL 5HYSB 3Q3GB 3ALWA 3LZFL 4NKIH 1IAIH 5JZ7C 5FKAA 3BKJL 1NSNL 3DV4A 4RIRA 4JEGB 4NC2B 1A6PA 3H7BB 4G6KH 4PJAE 4CVZA 4YDKH 4G5ZH 2MKWA 1SHMA 4FXKA 4Y2DA 3HE6C 4LLAA 3RKDC 2IAMB 5I8KH 3P11H 2A6DA 4I18B 4NBYB 2K9UA 1LE5A 2QSQA 2XY2A 4F15C 4FQ1H 5D1XC 3BPOB 4XX1E 3BWAA 2A77H 5I66A 1PQZB 2PW1B 3QIUD 2P49B 3GO1H 1VKXA 3AS1A 2B2XH 4YAQB 3D69A 5HGAB 4QOKD 5IK3A 5IB1A 2HT2D 4M1DH 1MFBL 4GRWB 1F6FB 2VL5B 3C5ZC 4I13B 3QPXL 1S9YB 2GJZB 3NBNA 4WFFE 3UEZA 1I4FB 2DTMH 2VIRB 4OKVB 5C71A 3KHOA 3NPSC 1U8KA 2GIYA 4L4TA 2DWEB 1NANI 4Z7WA 4DUWA 1NC2D 5IFAL 4JY5H 2DL2A 4AEEA 4OI7A 1PYWB 5AWNH 3SKOB 2Z8VC 2OL3H 4IS6A 1M7DA 3VWJC 4LEOA 5J13B 1KXQE 3MV8B 4X6EB 4G43A 1K8IA 1Y6NR 5C8JB 4XWGH 4DGIH 1I8IA 3GSRA 3DIFA 3NAAH 3GMOB 4FZEL 1RZJH 4XPTL 3W82A 1GL4B 4X98A 5C2BH 4G8GE 5DJDA 1F6AA 5F89A 1JHTB 4YIQA 5C09B 5AAMA 2HLFD 4WTZG 2BK8A 5A3ID 4E42B 4NM8H 43C9A 4C83A 5I73C 4IRSC 3B9AA 1YUHA 4QKXB 1EHLL 4ZAKB 4LMQI 4Z0XB 2CJUL 4X4YA 4KROB 5CGMA 3JV0A 2AXHA 5DMKB 3RVXD 3SDDA 4Y4FC 5C0EA 4QHNB 2CGRL 1UWEH 1ZEAH 2DRUA 5D93B 3QUZD 4PJFF 5HDLA 4XPFH 5KBNC 3RWDB 3MLYL 1B90A 4D0CB 1NBYB 3RIFF 4EI5A 2NY1C 3NIFF 3X3FL 3E8UL 5EUOB 1G9MH 1DQJA 3ARGD 4L29A 1YEHH 2Q8AH 5DK0A 5B8CB 1HHKA 3MRLA 4U3XA 5CZVH 3SEPA 3W5MA 1XR9A 1FFRA 1QKZL 2NCMA 3V2AR 1EO7A 1PG7X 1JNHA 4P9ML 1AR1C 4GKSA 5E6IA 5GGVH 4OD1H 3PHQA 3QUXA 3QUMA 1MCFA 4HMDA 5FK9A 2O26U 1A6AA 2ESVA 2PO6B 5E1HB 4U0QB 5I16B 1C16A 4KTDL 5HYSA 2Y5TB 3Q3GA 3PNWB 2V5MA 4V1DB 5IKCA 4D3CL 1PX3A 3WDJA 3H7BA 1FGVL 4PJEF 1CDUA 4WRLA 1N3NB 4FMFA 3DOSA 4QF1B 1A7OL 1DQDH 2WUBL 5FV1L 3DO7B 2IFFL 5I17B 3I6LE 5ADPL 2NY0B 1T1ZB 2IAMA 2DTSA 4OZFG 3GBML 1MI5B 4KVNH 2WWKO 1A14L 3PHOB 4I18A 4FQIH 4UDTB 2EKJA 2VITB 1WF5A 4OV5B 1FGNL 1PQZA 1PFCA 3EW3B 2VTFA 4QXUH 2VQ1B 4S1RL 3CZJA 3EDFA 1VCAA 3TZVB 3V7MA 3QJFB 3SBWC 5GS3A 4R2GB 1Q94B 1CD1B 1T04B 1ZVYA 4R7DB 1R0AL 1HSAB 3DUUB 5HGAA 3JWOL 4MJ2A 2VL5A 3VXNB 3KYAA 1S9YA 2GJZA 4PYGA 5ICZB 2GHWB 2VIRA 4OKVA 2O5YL 1HYSC 5EBMB 3V4VH 1RUPH 3UTTD 1I3GH 5D6CB 4LNRB 2DWEA 1ETZB 5F9AC 1J10A 4EBQH 1YQ2A 4ZS7H 2N1KA 1PYWA 3SKOA 4Y4HD 5GIRB 4ZFOA 3MV8A 3SOBH 4MXQC 1F4YH 4X6EA 5AG9A 1QNZL 1UVQB 4BH8B 1BQLH 2E6PA 1WZ1H 3AMLA 3T2OA 2OL3B 5C8JA 5DRXB 5CKGA 2FX7L 4LGRB 1O7VA 2W9LA 3SJVD 1EGJH 1VEOA 1X4XA 4WI6A 5EORH 3U7YH 4PRPD 4OI9A 3QUYC 3GMOA 4J23A 1CXIA 2JCCA 1F11B 2ZSVB 4HCRH 3SHSA 1ZHLB 1JHTA 2P48B 3FHQA 2X1OA 2FO1A 4E42A 2CUHA 5FHAH 1KCUH 3STZB 3HMXL 4UT7L 4HGMA 4ZAKA 4Z0XA 3OKOB 5DMKA 5J9PB 4HUVB 4QHNA 5HBBA 1DBBL 3S35L 4I9WE 4GH7B 3M07A 3JV4B 4XWOD 3T08A 1I7ZB 4FFVD 4TOYH 4X8JB 1B6UA 3RWDA 4D0CA 1NBYA 3GI8L 2OMNA 5CMAB 5EUOA 4P59H 4O5LH 1OW0A 1B0GB 4K7PH 2R0KH 3NCYP 3MSPA 1ZGLB 5B8CA 3SDXF 2VSCA 5F7YC 1KPVB 4HF5H 1PX4A 2I25N 1KB9K 4Q0XL 4NQSB 3TNNB 1QSZA 5D5MB 4KK8C 3D3VD 1OP3K 2VO5A 3ZSTA 5M7QA 4TNWK 1S7TB 2PO6A 5I16A 3N06B 1TNNA 2Y5TA 3HLAB 3PNWA 3QXTA 4HWEL 4QRRB 4V1DA 3CLEH 5I30L 4KHTH 4FQJH 2OYPA 3LRSB 1N3NA 4QF1A 2EDJA 5KVFL 2A83A 5CJ5A 3I9GL 1FZKB 3VGEA 1YECL 3DO7A 5I17A 4NQED 1BQUA 3T65B 1ZMYA 1T1ZA 5GS1C 6FABL 4H26A 4WEBH 2E6QA 2AK4E 1MI5A 4YQXL 3PHOA 4UDTA 2ZZUT 5JUEL 3HNSL 4DGYH 2VITA 3WFBH 4OV5A 4DJMA 4U1LB 4KK6D 4JPKH 2VQ1A 3PL6C 3TZVA 3QJFA 2FIKB 1S7WB 4OUUB 3WLWD 4NRXB 4BQ6A 4Z77B 1CD1A 1T04A 1KTDB 5EZIL 1S5IL 4P46D 1HSAA 3DUUA 4UT9H 5C9KA 2C4FU 3FQRB 3WHXB 4D9LH 4JQXC 3VXNA 1NMAH 3EJYC 4LSQL 3IU3B 1HXYB 3CFIC 5ICZA 5F9OH 4XCEB 4DK3A 5EBMA 5AZEH 1OSZB 2QHRH 4JVPA 4JJ5B 1OPGL 5MEPB 5D6CA 3UBXI 4LNRA 2D7OA 2A38A 2Q1EA 1ETZA 2N4IA 1DQLL 2CKBB 1T22B 2NX5B 5KJRH 5FO8B 4UNTA 2AGJL 1QSEE 1MCQA 5GIRA 5HGBB 3QDMB 3CAFA 1A7QL 1LEKB 4NSKB 5HGGS 4BH8A 1T6VN 3RNQB 2OL3A 5DRXA 3AC0A 2VE6A 4YUEL 1L6ZA 1QBLL 2VISB 4H88H 4KHXH 3RWHB 4HXBH 2E7MA 1XCTB 5C08D 2FZ3B 1LO3H 3U0PB 4Y16C 1F11A 2ZSVA 3WDIA 2JB6B 1ZHLA 3UXFA 3ZO0A 5FM5M 3L5XH 1CCZA 2ZUYA 4FQLL 2VC2H 3UTSD 1JE6A 1JNLH 5F9DC 3STZA 5F7NC 2GJ6D 3UTPD 3MLWH 3ARYA 5C0AB 3OKOA 3T04D 2VXSL 1FV1B 5HHOB 4HUVA 4NWTL 1U8NB 1MF2L 2NZIA 2D7QA 3JV4A 4MQXD 4POZC 4AMKH 2AEQH 2XZAH 5JDSB 1I7ZA 4KV5E 4X8JA 5T1DH 1MPAL 1Q0YL 3BGFC 1GVIA 5CMAA 1URLA 1B0GA 4KUCD 1KG0B 2C9AA 1I1AD 2YK1H 3MRCB 5B38B 1ZGLA 1YEFH 2PYED 5GRUH 4NZRL 4PJGB 3BUTA 1KPVA 5KSAB 1MVUB 3OF6D 2IGFL 1BBJB 3HFMH 3QWRA 3U1SH 4AH2B 2R8SL 4HS3B 4XMLH 4H8WH 1CL7L 4LLVB 1O7SA 4NQSA 3TNNA 2P42B 2LVCA 5D5MA 3UC0L 4MVBD 4TUJB 1OGTB 5DVMA 1S7TA 4FNLL 3HLAA 1FH5H 4OM0H 4PJ8C 4KJQD 4QRRA 4ZUSB 2RCSH 3LRSA 3RUGB 2BSTB 4FP8L 4JKLA 4ONHB 3ZDZE 3RBSA 2LTQC 1QR4A 1FZKA 1BHGA 1CGSL 2OZ4H 4XVUD 3T65A 4JY6A 2FGWL 4XXCA 4ODBD 2VKWA 1LDPL 4YDLC 5FUCC 1JPSL 4WFHE 1UM6H 5CJQL 4K2UL 2WQRA 2BOBB 1A0QL 2XG5A 2HRLA 4X4ME 1JWMB 1IL1B 4U1LA 2UY6A 3MXWL 4ZD3L 3EDDA 3OR6B 2FIKA 1S7WA 4OUUA 3MV7B 2VLJD 4TVSa 4NRXA 1A7PL 5D72H 1X3DA 3D39B 4Z77A 1IT9H 1ZTXH 1KTDA 2DIJA 3H9ZA 2BVEA 3MOBL 5B21A 1H8OA 1UACH 3LIZH 4LPVA 4WO4C 3FQRA 3WHXA 4IRJC 3ARTA 3IU3A 4LSRL 1HXYA 2EC9T 1PDKA 5DYOB 4OFDA 4MJID 1DP0A 1X4YA 4LKXB 2X09A 2YKLL 1OARH 4XCEA 4GXVL 3L3KB 1FHGA 2H32B 3L6FB 4JJ5A 2ICWB 5MEPA 4J2XA 1FPTL 1XF4B 5D7LE 2CKBA 4TTDC 1IBGH 1T22A 2NX5A 4P2QB 1PKQE 3BN3B 4M7LL 5JIPA 5FO8A 3TN0D 4PJHE 4NN6B 5AYUL 5HGBA 2YRLA 3QDMA 3L3GA 4W81A 1EAPB 4OGZA 2CIKB 2NY6C 3LPFA 1LEKA 4ZUUB 1FNHA 4NSKA 3B2VL 3RNQA 2A0LC 3GM0A 4K9EC 5IWLC 2MQCA 2VISA 3DBXB 3RWHA 2DLGA 1JCKA 1XCTA 4YPGA 2FZ3A 1A6ZB 4HPOL 1MJ7L 3U0PA 3L3OB 4NO0D 3TA3C 5FA3B 4KI5F 1MCOH 5TE7L 5IVNA 1U92B 4XVJL 2JB6A 2PTVA 1FNLA 2VWEE 2WNGA 4EIGB 3J7HA 2VR4A 4BSWB 3ULUH 3HG1D 3GSWB 2W38A 5GJTH 3TBWB 5C0AA 1CBVL 1OTUD 3V0AC 1FV1A 5HHOA 1U8NA 1PZUB 2W9DL 4YO0B 5JDSA 4OLXH 4Q6IC 3MLUL 1A7BA 4G8FB 1RMFL 2FLBT 5DFVC 2ZUQB 1MAKA 3QULB 4AM0B 4HC1A 3IKCB 4HWBL 1J12A 4JHZA 3LB6D 2DN7A 1KG0A 4WUUE 2BVPB 2IG2L 1P84J 3MRCA 5B38A 4TYUA 4R96B 1JPGB 1YA5A 1FN4B 4NBZB 3MMEB 4Q74A 4PJGA 4M62L 5KSAA 2OMBA 4GQPH 1MVUA 3RAJL 4BK4A 1FLRL 3D85B 1BBJA 4HS3A 4OT1H 4LLVA 1CVRA 2ADGB 3ZHKA 2MNUA 4TUJA 1OGTA 1T21B 2VXQH 4G8GD 5DMGD 3M8OH 5J12C 4B53A 4ZUSA 3RUGA 4JQIL 2BSTA 4ONHA 1CK0H 4QHUB 4NO3B 1HNGA 3TJHC 4KQ4H 1U8HB 2JK5B 2FD6L 4NOFA 1X5LA 2DI7A 1ITBB 3O8XC 3MZGB 1D5BB 1QBML 1M71B 2BOBA 1NLBL 2YMXL 1EVTC 1JWMA 4PR5B 3S36L 2EH7H 3ECBB 3EOAB 3BP6B 3OR6A 4R97C 3MV7A 3D39A 1OAYH 1AQDB 1I3UA 4PY8I 4OSUH 7FABL 4UOW0 1G7PA 4S1DC 3LEYH 2WP3O 4OFKA 3CFJB 2G2RB 3ULVF 3BDBA 1GPOL 4ZUVB 2F8XC 4LQFL 4YHZL 1XF2B 4LKXA 1JRHL 3L3KA 2DOCA 2BDNH 2H32A 2O5XH 3CSYB 3L6FA 4KGJA 2AXJA 5CFHA 2UZIH 2ICWA 2HH0L 1XF4A 2V17H 3WFDH 2XXCB 3WSQH 4P2QA 2X42A 1MFEL 1E28B 1RZ8B 1SEQL 5D71L 3JUYA 3QRGH 1K6QH 5I75B 1EAPA 2CIKA 4G8EB 5EU6B 4ZUUA 1X5AA 1D5MB 2ADIB 4LVEA 1H3UA 3S37X 3GHEL 3V4UL 4O00A 1T03L 4NZTL 1JIBA 3I6LD 4UB0H 3DBXA 1NAKH 1RUAL 2EYSB 3UJTH 1FZJB 3MLVH 1A6ZA 4XPHL 5HVHC 5EDXA 3L3OA 4HPYL 5FA3A 4PV8B 4GG6B 3KWWB 1U92A 3EZ8A 4BSWA 3ZKNC 3GSWA 4U6TA 2H1PH 5HHMB 3V4PL 1W2KT 1SM3H 2D03H 3TBWA 3VXSE 1WT5A 1WITA 2VZSA 3H42L 4KTYA 4GQ9H 3LS4L 2B0SL 4Y19E 2EKSB 3MCKB 2NR6D 4YO0A 1ACYH 3BXNB 3N9GH 4G8FA 3GUTB 1JK8B 3QULA 4K3HA 2GK2A 4AM0A 3IKCA 1QRNE 4WV1C 4KI5C 1F4WH 4KK5C 4AL8L 2BVPA 3C5SB 3I2CL 3PWLB 1MCBA 4R96A 1JPGA 1QFUH 1FN4A 1O5DT 4K94H 5KTEH 4TUKH 3MMEA 4LU5H 2OXHA 1YNLL 2JJWA 2X40A 5JXEC 5I1KL 5GRJL 3D85A 4GKOA 1FAIL 2ADGA 2Q8BL 2CD0A 4JCMA 5JIKA 3IXAB 4HAFA 5CUSL 5HYSG 2X9WA 4XT1C 1JGVH 4IRZL 1T21A 1DLFL 3PWUB 3BKCL 3W2DL 3INUL 4TNVF 3RDTD 3BIKB 4Q58C 1ZT1B 5GZNC 2VNCA 2DQJH 4KKCC 4G6AC 4WWKD 5E99H 1N64L 1NLDL 4QHUA 5E4EC 4NO3A 2DMKA 3B5GA 1U8HA 2JK5A 2FR4A 2Y9RT 3O9WC 3CK0H 3QNZB 4I9WD 5E7BA 1D5BA 5DUML 1M71A 2WINB 3IYLW 4PJFE 1T89A 4PR5A 3SDAC 4TVPH 3UCRA 3NIFE 3ECBA 3EOAA 3BP6A 1A5FL 4MA8L 3C6LD 1R3JB 3EYUL 3OKMB 1ES0B 2BJMH 3V6ZB 4DAGH 3DYMA 5ILTL 1AQDA 4NT6B 1MIEL 5I0DA 4UIMB 2IQ9L 1MRCL 3QI9B 1FVDA 3CFJA 2G2RA 3CX5J 5F9JA 2NY4D 4ZUVA 2JTDA 3DETD 3IDGB 4Y5YA 4HQQH 1XF2A 2X1WL 3LKQB 1W8NA 1KCVH 3WFCL 5DT1H 3CSYA 1ZT7B 1EEZB 5L2KE 2AABH 1YYLL 4FABH 3BPOC 4TPRL 3VE0B 2OCFD 1E28A 3VRJB 3WFEH 1RZ8A 4UBDD 1HKLL 2CRMA 4PJEE 5SV3A 4AJ0A 3LDBC 4G8EA 2DM3A 2YD8A 2ADIA 1LO5B 3I6KB 4HXAH 3RVVC 3O6LL 1MCJA 3D0VB 3ULVC 1Q0XL 2XQYG 5C0BB 1DR9A 4ZO9A 2AK4D 1C08B 2EYSA 5IBLC 1FZJA 2RFXB 2ZG2A 3JTSB 3BT2L 5IMMB 4PV8A 4ZO6A 4EQ2A 3KWWA 1A22B 2ZUVA 3QEQB 4OZIB 1MWAH 4ZFGL 5GISH 2DKMA 3OWEA 1QSFE 1JYVA 3TO4B 4Z78B 2AP2A 4HIJA 3IDYB 1I9EA 4J3VA 2EDBA 1P4IL 4W6WB 1GGCL 2AV1B 4GJTB 2EKSA 2YD7A 3C87A 2R29L 3MCKA 4JDTH 1IILE 1M7IB 3BXNA 3IDUA 4GBXB 43CAB 1JK8A 3GUTA 3FKUS 4A6YH 2OBGA 4FG6D 3W9EB 2YPKB 5GGVY 2VH5L 2XFXB 1I3VA 3C5SA 4YHOH 3CSPA 3TFKC 1EJOL 4HG4J 1UADC 5FUZL 1QSED 3DNKA 4RWYH 3TVMC 4XNZB 4FRWA 3DX6B 1WBYB 2HP4A 4HIEB 4PLOB 3UZVB 1NGZB 3MRPB 1I9RH 5F88B 2NY7H 1RAMA 2IALB 2OX5A 3IXAA 4NNPL 5C0ND 4RFNB 4YBLB 3PWUA 2P7TB 3BIKA 1YNTB 1ZT1A 3BUYB 1J86A 3O6KL 3A67L 2D31B 5DJ0B 5B8CC 1YJDC 3N1PC 2W0PA 1E4XL 5GXBB 3ZHLA 2J6EH 1NMCB 2V6HA 1NFDB 3QNZA 2NXZD 3LH2H 2WINA 2X6MA 1HEZB 3SCMC 3PUCA 1OSPH 1W72B 2APBA 5CINH 4I3SL 3WNPA 3AREB 2C26A 5DC4B 5FKPB 2F15A 3OKMA 1R3JA 1KIQB 1ES0A 3QRFM 1GOHA 3V6ZA 2QHLA 1QYGL 4NT6A 5J57B 1WICA 4UQ2B 4UIMA 2DQUL 1OTTD 2OJEB 5I74B 4U3HA 3CXHJ 5FUCE 3WD5L 3IDGA 4YPJA 4J4PC 3QWQB 1KXVC 1HNFA 5EFIB 4QHLB 4B5EA 5DHVH 2Z92B 4NZDA 4MAYB 4UDUB 1ZT7A 1F3RB 3DYOA 1FE8H 4JRXE 4BZ1L 1EEZA 4XP6H 3ARSA 5D2LB 2EEAA 2C1PA 3O6FB 3VRJA 3HMWH 1PSKL 5FCUL 4EOWL 5EU7C 4XCYB 4XP4H 4R2GC 1F42A 5D7SL 1LO5A 1MOEA 3I6KA 4UAOB 4LIQE 4UNUA 2C1OB 5D1ZB 4BA8A 2W92A 3D0VA 4OF5A 5FGCB 5C0BA 2EDQA 2CO7B 1RVFH 5IMOB 1FIEA 1UJTA 1C08A 4WFHD 4XHJD 4YC2B 2RFXA 2HTLC 3ARDB 5CD5C 3JTSA 2DLFH 3QHZL 5IMMA 1CFQB 2FBJH 3QEQA 4OZIA 4P2OC 2F53E 5JZ7D 4PLJD 3TO4A 1RFDH 2R2CA 2X4TB 3NFPB 3MGAA 4Z78A 1MWAB 2YWYA 4K7PY 4FZ8H 3C6SB 1JMXA 2A1WL 5EOCL 3HE6D 3QQ3B 2WBJB 2ADFH 1YQVL 2P5EE 2XTJB 1LILA 4QXGL 5GGTH 4NO2A 1KPRB 4JB9H 5JR1L 2EH8H 5ID1B 3DTXA 1M7IA 5D1XD 5DSCB 4GBXA 43CAA 1TJHH 1F2QA 4NFCA 4DUVA 1UH2A 2YPKA 5D7LD 2XFXA 5DZNA 2DQGL 3M1BB 5F96H 2EIDA 4U1IB 2E7LA 1P6AB 4A6YB 2FX8H 4JO3H 4EVNB 3BRGC 3HAEB 1RZJC 4I0PB 3TBYB 4PJXB 1KNOB 4G3YL 3PWVB 4PJGF 4PJ5B 2OS7A 3DX6A 3C5ZD 1WBYA 3NA4A 3QCUL 4HIEA 1NGZA 3MRPA 3A6BL 5F88A 4EDWH 2D3VA 3ZKMC 4Y7MA 4X99B 3DI2B 5T33H 2OR7A 3T2PA 4LSSH 1JPFB 4LAQL 2J7LA 1A9BB 2P7TA 4NP4L 4EN3D 1YNTA 1X5GA 3BUYA 4U7KA 1NCWL 4FQ2H 3OJVC 4RAVB 4FA8A 2D31A 4BQ9A 5DJ0A 5ITBH 1JFQH 1MFDH 1OM3L 1G6VK 4Q9QH 1S7QB 3IDNB 2NZ9C 5EO0B 1G9MC 1KYOJ 1I7RB 3BH9B 2YD4A 1ZA6A 5C0CB 3ILQC 3SGJA 2B1AH 4G6ML 4FTVE 1HEZA 1T7XA 3VH8B 1IC5H 1W72A 2DI9A 3AREA 1TQCB 3J8F7 3FTGB 5FKPA 2N7AA 4LIQL 3VD3A 1MFAL 5C3LD 3U4BH 2OK0H 1KIQA 4WUUD 3VXTB 1MCCA 1UCBH 2YS4A 3KYNB 1UM4H 4UQ2A 2DQTH 4X7TA 2VDLH 2OJEA 4OF0A 1BJMA 4X83A 4OQTA 4JM2C 12E8H 4Y4FD 3N85L 4NQDE 5EFIA 4DN4H 3BPLB 2PCPB 2QQNL 4QHLA 2Z92A 3OKEB 4MAYA 5BO1H 4UDUA 1A6WH 2ICEB 2NY1D 3DXAD 4OM1L 3SN6N 1ZVHA 3OHXA 1CLCA 2VQUA 4K9EL 5D2LA 5DHVB 5DUPH 3O6FA 3UO1H 5BS0B 4XCYA 4HK0B 2HJLB 2VDQL 3KJ4C 3AM8C 4LSVH 1XF3B 5D1ZA 2C1OA 2ZKHL 4J3OC 3DSFH 4NO5A 1AQKL 5IMOA 1J0ZA 3TIEB 4YHKH 1DBAH 2L0DA 5L2JB 3Q1SH 1K3IA 2UZXB 3U46B 3ARDA 5CCKL 1CWVA 1Z9LA 5CP7B 3CFDB 1W0YT 1CFQA 4DZ8B 3PIQB 4JKPL 3CCHB 3DX7B 2KQNA 4C57C 4LCWB 4LGSB 3RJDA 2X4TA 1XF1A 3V8OA 3NFPA 1TJIH 1UQSB 5MEQA 4U31A 3ZT5A 1MWAA 4ISVB 1RSFA 4N0CC 2Z31C 3DO3A 3MLXL 3C6SA 4RFEB 3DARA 3QQ3A 2WBJA 3RVWC 1I75A 1OD9A 4JM4H 5SWZB 1GAFL 1KPRA 3V6OC 3O2DH 3LN9A 4M43L 4KC3B 5DSCA 1TCMA 3ARBB 4X5XB 3PE9A 1DFBH 5EA0H 3VGAC 3H3PH 4BZYA 3NH7H 5B38G 4JPWL 2ZJSH 4N5EC 1WZLA 3M1BA 5IBUB 4L4TE 4JREB 2EICA 4U1IA 4C58B 4A6YA 2ZUXA 4LCCC 5F8RC 4EVNA 5CS7A 3HAEA 3R4DA 5I15H 4I0PA 5DA0B 3TBYA 1I9JL 4PJXA 4PG2A 3BQUD 4U7MA 1KNOA 4NZJA 3PWVA 1WFNA 3QIBC 3TWCL 5KVGH 3F7QA 5L88H 1J8HB 1NGXB 3VXRA 4NGHL 5IB4B 3C5JB 4X99A 1JNJA 2EZ0C 1G6RL 4R8WH 1YYMH 3LKOB 4G9FB 1Z3GH 2IMNA 2APTA 4KI5E 1MJUH 1JPFA 3H9YA 1MCKA 4GUPB 3HPJA 3NZHH 1IGMH 3GNML 3HUJB 1INEL 5HYJB 3PHSA 3TLRA 3IAQA 3K80A 4RAVA 5DD0L 5FFLA 4FQXC 2KL6A 1KIPB 3VXSD 1CXHA 5CEZD 1S7QA 3IDNA 5EO0A 1I7RA 3V7AG 5C0CA 4Y19D 4KJPC 5HSFA 4UV4H 3C09C 3VH8A 3N0PB 3TBSA 4M7LT 3FTGA 3ZTNL 1D6VL 5KOVC 1IC7H 2EE2A 3RZCB 2ICWI 4LDOB 2P1YA 3KYNA 3LY6A 4QLRA 3OKDB 4XPGL 3IJHB 3LV3B 1QHPA 4D9QE 5F7HA 3RWJB 5DJ2B 5DXWA 4YX2L 4ODSH 4OLUH 3TPKA 3WXVH 3R8QA 1NCAL 4OAWB 1UC6A 2PCPA 1T5XB 4F33A 3OKEA 4U6VH 5HHVH 3RQ3A 3HR5B 2ICEA 3CH1B 4K3JH 1E6OH 1KTLB 3VMNA 4NM4H 5DHVA 1SBSL 4M1GH 1A21A 4XNQB 3S88L 1KBGH 4J3SA 4LLUB 3ZT7A 1FFNB 1WFUA 4XC3L 3ES6B 3RY6C 1K4CB 2HJLA 2PW2B 1CDGA 4HK0A 3L1OL 4K7PX 4RFOH 1HK6A 1XF3A 3GDBA 4LDLB 3VW3H 3SGKA 5HD8C 2RBLA 5EG6C 2HJKA 3TIEA 5CLWA 5L2JA 4XBEH 5EULV 4XNYH 3U46A 5CP7A 3CFDA 7CGTA 5LWYL 3B9DA 2XYCA 3MUGB 4JPVL 3PIQA 2F8VA 4BELD 3CCHA 4DZ8A 3GIZL 3FB6B 3LMJH 4EQ3A 1AR2A 3DX7A 4GG6F 1BP3B 3IFNL 4UQ3B 4G6JH 4LCWA 1KEMH 5JW4M 2BXYA 1UQSA 3UZEA 3U7AA 5JXAH 5IQ7L 1RZIB 3HC3L 1NAMH 4M6AA 4P23C 3WNMA 4OCXL 4RFEA 3ULVE 1AY1H 2YRZA 1MCHA 2J88H 4OD2B 3ULUF 1UZ8B 2WWMD 4P5TB 4DKEH 3S8WA 3M17B 3VFVB 5IJKC 2Y6SD 4X5XA 4M9PA 4XP5H 5L2KD 3VGFA 2YD6A 5JW4N 5D1QB 5KG9B 2EDKA 4JN1H 2ZCHL 4O9HL 4LLYA 2YD1A 4J3TA 2R1XB 3WS6C 4PGBA 4QXWA 3T0DA 1CG9A 3EJYD 5CILL 1J8HA 1NGXA 1FORL 3KPRD 5AEAA 5IB4A 3C5JA 4XP1L 3TV3H 4UIKH 4KRPB 4G9FA 3LKOA 3CVIL 2NNAB 4GUPA 2ZUQC 1AO7E 2E7CA 1BWWA 3AS0A 3HUJA 5HYJA 5KVEH 3HI6L 5C09E 4IDJH 32C2B 1L7IL 1KIPA 3BVNB 4LARH 5I8OL 1BFVH 3HHRB 2APFA 5BJTB 1WBXB 3PGCB 4N68A 4QRQB 4RMTA 2HT3C 3VI3F 4M48L 4Y16D 1RZGB 2J8UF 3FT2B 2LQRA 4U1SB 1H5BC 5DUBB 3OAZH 4NQTA 4GW1B 1MSPA 5MENB 4KVCH 1S78C 4YHLL 3MJ9H 4H8WC 3RZCA 4ZUWB 3WIHH 4Y5XA 5HI5C 2DYPD 1AE6L 3OKDA 3IJHA 1KJ2B 3LV3A 3FB5A 1I7TA 1HH6B 3RWJA 5D70L 1RULH 2JJTA 4ESKA 3PQYD 4M02A 5J8OA 2BVOB 4PJCF 4G7VL 4OAWA 5DK2B 4YBQD 1T5XA 4POZD 2HKFH 2E9IA 3HRPA 3HR5A 2EIEA 4PS4L 1LMKA 3SO3B 3OSKA 4GAFB 3CH1A 4F9LA 4M6NL 1KTLA 5F3HB 3ULVL 4ZTOH 3OKKB 3GRWH 5INDB 2QQKH 4XNQA 2NW2B 2DQHH 4Y1AE 4LLUA 1FFNA 3KS0H 3ES6A 1K4CA 2PW2A 3O4LB 4W6XB 4GAGH 1P7QB 4JZJB 1TZHB 2VN7A 1T0NB 2BY3A 1T66D 3RU8H 1XGRB 1A6VH 4RGNB 3T2NH 1PEWA 2VJXA 1Q9KB 3CVHL 4JHWH 1OHQA 1MJ8H 3MUGA 4LPTA 3FB6A 1I9IH 4OB5H 1V3MA 4EJ1C 5HHXH 4UQ3A 5DGQA 1WC7B 1CR9H 5EU7E 4WI2A 1BOGB 1RZIA 2CQVA 2FJHB 4KFZC 3FAWA 4HFUH 2WAHA 4ZXBC 3ZKSD 1WEJL 3WEXB 4OD2A 4TQEH 1UZ8A 3WKML 4AQOA 1D9KC 4P5TA 1DQML 1J18A 3M17A 3FZUC 4U2YA 3U0TB 3VFVA 3VMPA 1KOAA 3FO9B 4NQCE 1MCRA 1FLTX 4XCFL 5T1KB 5D1QA 5KG9A 1AKJB 3U48A 4N1CA 3QIWC 4M8VA 2VLRE 2V9QA 2R1XA 4PGJA 2X5PA 5TE4H 4JGUA 3SE4A 4DGVH 4IRJD 3U0WH 3ZE2F 3ULUC 1U3YA 3BE1L 5L9DH 1NGQH 2LV4A 3LOWA 1H8NA 2VDPH 4K3DH 2VKXA 1YJDL 2NNAA 3ARFB 3B8YA 2NXYB 4LPUA 4TTDD 2Q7NA 5JW3H 1FSKC 1KB5A 1G1CA 3SPVB 5E8DL 1OWWA 2AJXH 2MTPA 3IFLL 4PLKD 3T0AA 32C2A 3L5JA 2NY6D 2M8XA 5IB5B 3CC5B 1CLYH 3BVNA 4PRHB 3F12B 5T1LD 4FN0A 5BJTA 1WBXA 4LLQB 3PGCA 3HNVL 4P3CH 4JO1L 4OGYL 1NFDF 4HFWB 1RZGA 3MUZ1 3KLSA 3U4AA 4U1SA 5DUBA 3TA3D 4L4VD 2PXYA 2HTKC 4WY7H 1JNNH 4BZ2H 5HDQL 1T0MB 1JHLL 4GW1A 5MENA 4G42B 4BKLB 2BSED 4NKIL 4ZUWA 1IAIL 3PP3H 5EO1A 4IJ3B 4TSAH 4DVRH 3P30H 5T3XD 4L9DA 2W91A 1GCFA 1KJ2A 4G6KL 3W9DA 1QZ1A 1HH6A 4YDKL 2YPLD 5I76B 4KKNA 4G5ZL 3L9RB 1GIGH 3VXUB 4JRYA 3DYPA 1OP5H 1IKFH 2BVOA 5DDHB 3THMH 3KPMB 1YMHB 1ORSB 3N1FC 4YFDB 3P11L 5DK2A 1RUQH 5I8KL 1BJ1H 3K81A 4H5SB 1N8ZB 3WJJA 3VFUA 4FQ1L 1X5IA 2BSSB 1RIUH 4K8RH 4OFIA 4TULH 1WCQA 2A77L 3SE3A 4BH7B 1NC4B 5BV7C 5F3HA 2GSGB 3EO9H 3GO1L 3OKKA 4KI1A 5INDA 4OJFH 3SKNB 5D2LF 4S2SB 5JTWA 2NW2A 2AEWA 2B2XL 1AGEB 3G9AB 4M1DL 4MNQB 3RHWK 5I1IH 3O4LA 3HA0A 4IDLA 1P7QA 4JZJA 1X6NA 1TZHA 3QI9C 1T0NA 5LVEA 1XGRA 2Z0BA 2HKHH 4H20H 3MCLH 3IF1B 1NGWB 3SKUD 1Q9KA 2DTML 1HN1A 1NL0H 4FTVD 4PB9H 3DRTB 4RAUB 3V6FB 3RL2B 4LAJH 4JY5L 4L5FH 5A2JH 2XQBH 1WC7A 5AWNL 1AD0A 2OL3L 2CRZA 1MQKH 1BOGA 2FJHA 1T0PB 3MBEB 5IVXE 3GSNH 4O58H 4WU5B 2EE9A 1JHKH 3WEXA 4MHHG 3G08B 3O8XD 3DMMD 4XWGL 4Z95H 4NQDD 3KYOB 4DGIL 5L8KB 3U0TA 5I71B 3BHBB 3NAAL 1ZLWK 1RZJL 3AFLA 3C60B 3FO9A 1ZLWH 3B9KD 1CI5A 1J87A 3DUHA 1RIVH 1A6UH 5C2BL 2BNRB 3WIIH 2I5YH 5T1KA 1AKJA 4JQVA 2GUOB 5CGYD 2WMPA 4NM8L 2R2BB 1SEBB 3DVGA 2A2QT 3AUVA 1IKNA 4Z7UF 4KZEH 4S1DD 3TO4C 3QDME 4AK1A 4M93C 5DC0A 4WU7B 5E6ZA 3ILPB 5MERB 4GRLB 3V6OE 2FX9H 4E41B 1ZEAL 4XGZB 5EZJB 4XPFL 4CJ0A 5IMKB 4MCYB 4M7ZB 3ARFA 4GBXC 1G9ML 3WJLA 3EJZC 2CK0H 1YEHL 2Q8AL 5DURB 4EIZC 4OD3H 3SPVA 2VMFA 3C9NB 4RMWA 3HE7B 3MBXH 1WAAA 2KDGA 2E6JA 2MHAB 4EUPH 3CC5A 3WE6B 1XFPA 4PRHA 5I8CA 3F12A 4DZBB 1A1NB 3L3IB 1E4KA 4LLQA 5SX5K 1HQRB 1P84K 4OD1L 1S5HB 3MFGB 4K94C 4HFWA 2AJSH 2HLFC 1IZKA 1BBDH 1U3JA 2UWEB 5SWSE 4LVOB 1X5XA 1T0MA 4QWWC 4G42A 4BKLA 2BFVH 4L4TD 2VDNH 1T3FB 1CGYA 1P9MC 2EDYA 1JGUH 3TCLA 5I76A 3L9RA 3VXUA 4UTBL 4MSWB 5SX4I 2EIZB 4PJGE 5JW4R 1IM9D 1FVCB 5DDHA 1JTTA 3KPMA 1YMHA 1ORSA 3G6JA 1B4RA 1K85A 4NYLB 1T5WB 3ETBF 1N8ZA 4H5SA 4KVNL 4FQIL 1YMME 1WBZB 4G9DB 2BSSA 2ARJB 4BH7A 4ERSH 1PG7H 1PW3A 4XPAH 1AXTH 3WKNA 1NC4A 4KI5D 2B5IC 2GSGA 4KK5D 2EIBA 4MQ7B 3SKNA 2GKIA 4KAQH 5DEFB 2NY2B 4G6FD 4BJLA 4K3EH 1AGEA 5HGDB 2KBGA 4MNQA 2BSRB 1YPZE 5LCVH 2VLKB 2YN3A 5ENWB 1VENA 3TP4A 3IF1A 3SDDD 1NGWA 3LD8C 4KTEH 3V4VL 3V5HB 1RUPL 4KK9C 3DRTA 4RAUA 3V7AE 1I3GL 3FQNB 3V6FA 3RL2A 1MEXH 2HFFB 4U2ZA 4WTXA 1NANH 3HN3A 4EI5D 2IQAB 4EBQL 2YXFA 4ZS7L 1T1XB 4OIIH 4QO1A 4KDWA 1GZPB 4G6AD 1WV7T 3MBEA 3BESR 1RZKH 3SOBL 1R3LB 4WU5A 1BQLL 3EDKA 1WZ1L 3G08A 3O9WD 3SY0B 4HUWA 4GW5A 3KYOA 3GSNB 3H9SB 1EGJL 5EORL 3U7YL 1AGFB 1J1XL 1T2QH 3BHBA 4PGCB 5E6ID 3C60A 3KPLB 1TZIB 3VFTB 1NCCH 4HCRL 2BNRA 4P4RB 1OGAE 3CZFB 5C9JB 3PDGA 2GYSA 4P2QE 4J6RH 5J1SC 5FHAL 1SEBA 1KCUL 1WGOA 4X7CC 5CD3B 4LF3B 3MRRB 3OAYK 3ARUA 1C12B 1XGYH 1W0VB 1RJLB 1ZHBB 3MC0A 4WU7A 1F6LL 3ILPA 3AXLB 2J3SA 2Z4QB 4GRLA 4BFGA 4OKDA 4E41A 4N0UE 4XGZA 3R1GL 5EZJA 4TOYL 1DCLA 3OQ3B 1UT9A 5IMKA 4MCYA 4Y4HC 3MRFB 4P59L 4O5LL 4K7PL 4AT6A 2R0KL 4J12A 2BHZA 3RWFB 4PJIB 3C9NA 3FB7B 2V5RA 2MHAA 3E2HB 3CFCH 4YDIL 5FYKU 3WE6A 1MIMH 3OV6A 2PKDA 4HF5L 4QHMB 3ULVD 4Y2OA 1A1NA 2R15A 3L3IA 2WM0A 5HYQB 3VH8G 5BZDB 1EUUA 1S5HA 4NKDB 3QISA 2ED8A 3HZKB 3VXME 2UWEA 4BQBA 3TF7C 5GS2D 4WW2A 2QADB 5E8OB 4OZFH 5FGSA 3CLEL 4CU8A 4KHTL 4FQJL 2XN9B 1ODAA 3V5DB 1T3FA 3IFOA 3I3BA 4XVSH 1RQ5A 4MSWA 2EIZA 3TYGH 3MV8D 5HY9B 2XACC 4MA3B 4NFDA 4WEBL 4NYLA 4P9HH 1T5WA 2VDKH 1R24B 1WBZA 4DGYL 4G9DA 3WFBL 3W39B 2HFTA 1RURH 3GMLB 2O5ZL 4JPKL 3BIAX 4P4KB 3KXFB 4MQ7A 5T5FH 5DEFA 1TQCC 3X13B 3QG6B 4HWZB 5C09D 1NC2B 4O51B 3TVMD 5HGDA 2BSRA 5J7CC 2VLKA 4D9LL 5ENWA 4ZAKD 1NMAL 2B1HH 5F9OL 3QZWG 3O3BB 1QPPA 3V5HA 5AZEL 2QHRL 4OZGF 3FQNA 3EYSH 2A6IA 5KJRL 2IQAA 5FM5O 3UYPA 1BEYH 1T1XA 4X6FB 1PLGH 1ADQA 2ENYA 1DANT 4X6BB 1R3LA 2YRPA 2QTEA 1ZE3C 3S3SA 4W4OA 2EXWD 3LPWA 1EX0A 3BOVA 3SY0A 4H88L 4KHXL 3H9SA 4HXBL 4PGCA 1LO3L 3MJ7B 3KPLA 2NMSA 5IBUG 5LKNA 3VFTA 2Y36H 4P4RA 5IHZB 1B0WA 5T1MB 2VZUA 3VFWB 5IV2A 2ICES 3CZFA 1K2DB 2PO6D 3L5XL 4H25B 3S98A 1U8QB 2VC2L 1EO5A 4XBGB 4ODHH 4Y1AD 1JNLL 4V1DD 5CD3A 3MLWL 3ARGB 4S10A 4LF3A 3BIBX 2XOTA 5EU6E 1F90H 1J0KA 4NDMB 1C12A 1ZHBA 1W0VA 1RJLA 2DJUA 3T0XA 2IANB 4J4PD 3AXLA 2Z4QA 1DBKH 1TJGH 2NY0D 2XZAL 5T1DL 4JFDE 3O3DB 3MRFA 5EH1A 4WEUD 3ARBC 2Q3AA 3P4NB 1YDPB 4GG6E 2YK1L 4LSTL 1K9TA 4PJIA 1HI6B 4QGTA 1YEFL 3RWFA 5EZOH 3TZVD 4PRIE 1G9NC 5EOCJ 5GRUL 3FB7A 1I1FB 4R2GD 5HHME 1QEWA 3GJEB 3ISWA 1KCLA 2DF3A 3HFML 3U1SL 5HYQA 4XMLL 4H8WL 3ULUE 3KLDA 4L8SB 5BZDA 5IIEB 4X9FA 4NKDA 1NUNB 2ZG1A 2HTLD 2WLYA 3HZKA 4R0LC 2QKIB 4OFYD 1BQHG 5CJBA 5DQDH 2FECI 3VRIB 5E8OA 1FH5L 4HMCA 4OM0L 3IS0X 3UJIH 2RCSL 2XN9A 3QIUA 3GI9H 2VLRD 3V5DA 1EHNA 3RGVB 5CEXB 1MCSA 3QH3B 4L8DB 1UWGH 4MQXC 3NGBC 2M26A 2OZ4L 3V9FA 5HY9A 2EECA 1HHIB 4JFQB 3JWDH 5I9QC 4MZ3A 4NWUH 3HC0B 1R24A 4K71C 2EDHA 1OOAA 3W39A 3U9PH 5D7IB 3GMLA 2QLVB 2P44B 4P4KA 3U7WH 3KXFA 2E27H 2W65A 4M6OH 4C59B 3X13A 3QG6A 4HWZA 1IT9L 1ZTXL 2EXYD 1NBVH 1NC2A 4O51A 1SVCP 5F7WC 5F3BB 1UACL 3LIZL 4MVBC 3WHE0 5IVZB 2PN5A 1BWMA 2UV3A 3O3BA 3VI3E 1OARL 5LG1A 4KJQC 1YC8A 2J8UE 1OAZH 1LK2A 4IOFC 3SJVB 4N8CH 2YA0A 1U8LB 1IBGL 4LDEB 2HVJB 3BDXA 4I4WB 4X6FA 5F7EH 4XVUC 1TFHA 4NQXB 1XEDA 1TIUA 4CN1A 4X6BA 4MJ4A 2NZ9D 4TSBH 3LZFH 5CZXD 3BKJH 4PJCE 3ILQD 2X1PA 3QWRD 1EEUA 3GHBH 3MJ7A 1MCOL 5IHZA 2A9MH 5T1MA 3VFWA 1WFOA 2W59A 4P5MB 1EERB 1K2DA 2F54B 3ULUL 4H25A 1U8QA 3H3BC 4XBGA 5GJTL 4QRRD 1JYWA 5GRVL 2ZCLH 3ARXA 4Y5VB 3ARGA 3UAJD 4QYOA 4NDMA 4ZSOB 5M94B 4PG9B 4LHQB 1CXKA 2IANA 5KN5B 4KUZH 4JFEB 4OLXL 3Q6FB 4OLYH 1HDMB 3TN0C 3O3DA 2HFGH 3IB4A 3ZKQD 4FQCH 2KUTA 3P4NA 1YDPA 3EO0B 2A9NH 4U7SA 4HT1H 3MRHB 1HI6A 2CK2A 1UA6H 1I1FA 2BNQB 3ARWA 3FO2B 4ODWB 2H9GB 1KULA 3GJEA 3T1WA 3PG2A 2NTSP 3QHTC 5J11B 3FONB 3KLAB 4GS7B 1WWBX 1D5XB 4NRZB 4OT1L 5IIEA 3VG0H 4Y0GA 1N0LA 4NQEB 4DKFH 4X6CB 4R4FH 4P5KB 2QKIA 4GLRI 2ADJB 3D9AL 1TITA 2VXQL 1UXSB 3VRIA 4I2XB 3M8OL 3HZMB 4KRPC 4AZ8A 1TXKA 1OTUC 1H3GA 1ZT4B 5CSGA 3ZE1F 2DIAA 2NX5D 1IJ9A 3RGVA 5CEXA 1JMZA 3QH3A 4L8DA 5GGUB 4CMMB 3QDMD 4F2MB 3K8MA 2DLTA 4KQ4L 4POUB 1HHIA 4JFQA 3FOLB 2P8MB 3ZE2E 4ELMF 3HC0A 5CJXA 2Z8SA 2F5BH 5BZWB 1A3RH 5H94B 1A7NH 4PJ9B 1PAMA 5I1JH 4PP2B 5HJ3A 3PABB 5D7IA 1EFXB 2NY3B 5BOPA 3V52L 5KS9F 2JB5H 4N5ED 1EK3A 1JN6B 2DICA 3NFSH 5JPNB 3BP7B 1OAYL 5J1AB 3KLHD 3KGRA 5LXGH 4M9OA 4OSUL 4DEPB 1S7RB 5F3BA 1X5HA 4JE4B 1I85C 5T3XH 1F3DJ 3LEYL 4PD4J 4BK5A 4JFOB 5IOPB 3P3YA 5IVZA 5IP4A 4PUBH 3JZ7A 3JVGC 5TF1H 5DMGC 3V8CA 1A4JB 1UB5B 1NFDE 2BDNL 2O5XL 3MA9H 2EZ0D 2Q7YB 2K7QA 3SJVA 4AIOA 2KQMA 1TVHB 2V17L 3WFDL 1QHOA 2W1NA 1CICC 1U8LA 4Z5RA 3WSQL 1GGIH 2V7HB 3U82B 2HVJA 2PNDA 3T0EB 4I4WA 4NQXA 3QRGL 1VFMA 4LVHC 4TVPE 4S1QH 3UBXB 2JJSA 5BW7A 5KVDH 3UTSB 4RMQA 4HULB 3OBAA 3ULSB 1H15B 2GJ6B 1TDQA 5KSAD 4UB0L 4KJPD 3WNOA 4R4NC 1NAKL 1WZKA 4JZJC 3UJTL 5DD1H 1DUZB 3LEXB 3MLVL 5DA4A 1FDLH 2IFFH 3BAEH 3GJFK 3EYQC 4G8IB 4P5MA 3D87B 1A14H 1TPXC 5LGKA 5D2LE 2F54A 2XTLA 1ERNA 4O02H 2N7BA 2H1PL 4Y5VA 1SM3L 2D03L 2FHCA 4NRYB 1I1AB 4ZSOA 5F71A 4PG9A 4PY8J 1VDGA 4GQ9L 5KN5A 3DVNB 4JFEA 4RX4A 1BD2B 1U41A 5KSVB 1R0AH 2CR3A 5FGCE 1ACYL 2CDGB 3N9GL 3S37H 3Q6FA 1HDMA 4HW6A 1DEEB 4PB0H 2JF1A 3EO0A 5LBSH 1F4WL 2DAVA 3MRHA 5INCB 2O5YH 4F7EB 4IMLB 3LS5H 3MV7D 1QFUL 2AV7A 4K94L 3NABL 2BNQA 4TUKL 5ACLA 3D39D 3FO2A 2AJUL 2H9GA 3GSVA 4LU5L 4ODWA 3MLRH 3FONA 3KLAA 4HWUA 3QWOB 5BVPH 1EHAA 3PWNB 4JANB 1D5XA 4NRZA 5CHNB 3CJJA 4B41A 2ITDB 1TTUA 2XTJE 4IMKC 4NQEA 4W70A 4X6CA 5FIEA 4P5KA 1JGVL 5H35A 5FYKH 2ADJA 2G5BB 1UXSA 4I2XA 4Z9KB 4MD0B 3AY4A 3HZMA 2Z91B 1V3JA 9CGTA 3ARFC 1ZT4A 5JOPE 5CP3H 2DQJL 4P2QD 1F13A 5GGUA 4Z7UE 4CMMA 3WXWH 4F2MA 3GMQB 3BYTA 4P46A 3KPSB 4W68A 2H26A 1VA9A 3VGGA 3FOLA 4PJ5E 1YEIH 3PDOB 3O0RH 3CK0L 2HLAB 2GFBB 3HMXH 4MA1B 5BZWA 5H94A 4MX7B 1SY6H 4U4BA 4PP2A 3S3JA 3PABA 4TVPL 1DVFB 5H37H 1EFXA 4RQQB 4PRNB 1JN6A 5JPNA 2DQEH 4Q9CA 2D9CA 2LE9A 3BP7A 2BJML 2NW3B 4XCCH 3REVB 4DAGL 5E9DB 3GEWB 2AK1H 1S7RA 3BPCB 4IJ3C 2X4PB 2ZUUA 4P57B 4Y8DC 4HK3N 4JFOA 5IOPA 4AY0A 4QT5B 4NHCL 5EOQH 5DO2C 4ZQKB 4HQQL 4PJAB 2A73B 5F6HI 2E9BA 1A4JA 3GGWB 1UB5A 1GHFH 5DT1L 4MXWH 5ANMB 2Q7YA 3VXMD 3CXDH 1TVHA 2AABL 3C2AL 4FABL 2RAMA 5E1AB 4WWKC 1BQSA 3T0EA 4J3XA 1JWSB 3WFEL 1I1RA 2YPVL 4KXZI 3UBXA 4HS8H 3FRUB 3OX8B 4HXAL 3UTSA 3WFZA 3ULSA 1AHWC 3WNNA 4AENB 4HWEH 1NMBH 1H15A 2GJ6A 3D85D 1CD9B 1U8MB 1DUZA 3HPLB 3LEXA 4PJBA 3C6LC 3GKZA 3WHE1 2DM4A 5ITFB 4G8IA 1AGBB 1IE5A 3ZKXB 1MWAL 4YQXH 3RNKA 2HN7B 5GISL 5CWSB 5IVOA 3VWKC 3UPAA 4UMGA 1E6JH 4YNYB 5JQ6H 2IC2A 2NY5H 2NY4C 5HI5D 5HHPA 5C0RL 4I0KA 1HKFA 4LASH 4LOUC 4NRYA 1I1AA 5BS0E 4MCZB 1JWUA 2CDFB 3DVNA 4U6YB 4U1JB 1KSRA 1BD2A 5KSVA 1T1YB 4JDTL 3OF6A 5K9JH 1J1PH 5F1KC 8CGTA 2CDGA 2R23B 2FO4A 4A6YL 2CLZB 3MCG1 4UBDC 1RI8A 4LPYA 1DEEA 2V9RA 4YHOL 4F57H 4IBLT 5INCA 5KAQF 2Q3ZA 3I6GB 3QUMH 4F7EA 4IMLA 4G8GB 2HG5B 1OPGH 4RWYL 1Z9SA 1T4KB 4DCQB 3FRPA 1TLKA 4JANA 5CHNA 1I9RL 3HS0B 2NY7L 2ITDA 2HRPH 4WUKH 4LNVA 4QTIH 5SWZE 5DMJB 1OTSD 4B0MM 3G6DH 2G5BA 1JGDA 4MD0A 2Z91A 4WFGE 4M7ZC 4OV6F 4FXKB 2J4WH 1J05B 1OP9A 5C08E 3NA9H 5CKAA 4YHYB 1YEEH 3HE7C 3QR2A 2YUWA 5EU6D 3GMQA 3KPSA 3Q6GH 5LJYH 5I18H 4FQQB 2J6EL 1I8KA 3PDOA 1VSCA 2HLAA 1C5DB 4HEPG 2GFBA 3LH2L 1NKOA 3MRKB 4MX7A 1JV5B 4GRWH 4YEEA 2FATH 1FNEB 4WI4A 5CINL 4WHYH 1DVFA 3UTPE 3MACH 3T4YB 4RQQA 4L3CB 4PRNA 4G9FE 5GGQH 2CSPA 2NW3A 3REVA 1H3TA 5GS2H 5E9DA 5IESH 4NCC1 4JDZB 3BPCA 3WN5C 5HHMD 2X4PA 1G7IB 4P57A 4BFBD 1G84A 4QT5A 4RAHA 4ZQKA 5FYJU 4PJAA 2A73A 3ULUD 2XRAH 1A02N 5IROA 3GGWA 1KPUB 1NUFA 5DD5H 5ANMA 2W9EH 1EO8H 2PYEE 1FE8L 1BPVA 3LKNB 2EO9A 4XP6L 1KJVB 1M7DB 3V0WH 5E1AA 4F7CA 5TQ2H 3A6OA 1AD9B 4XNMB 2R4SH 3UC0H 1JWSA 2F19H 4LSUL 3HMWL 4Z8FH 2V5SA 4Q97A 5GRYA 2DQIH 2XXMB 4XP4L 3FRUA 2NXZC 3B5TA 3NMEA 3OX8A 4G7YH 2QSCH 2V2XB 3TH2T 3CPLB 4KDTC 4AENA 4Z6AT 4HZLB 1OAUL 5K9QI 1RVFL 4H0IA 4X98B 2J2ZA 4J7RA 5DJDB 2BMKB 1R3KB 4L1DA 4ZNEE 1U8MA 3HPLA 3STLB 2CIIB 2DLFL 4NZUH 1C1EH 1CXFA 5ITFA 2FBJL 1AGBA 4BUHA 2HN7A 3W5NA 2D7PA 5CWSA 4YNYA 4I1NB 1RFDL 2VXTH 3FN3A 5D6DC 2CLVA 4JKMA 3MFFB 4MCZA 4WVRA 4FZ8L 5BMFH 4U6YA 4RGOL 5GRWA 4P2RE 5GGTL 1T1YA 2G9HB 4JB9L 5I6XB 4RCAA 2EH8L 2VLJE 4L4JA 5F1NB 1XGUB 5K59F 4OCNC 2R23A 4F37F 5KAQG 1TJHL 1RPQA 3MJ6A 1A6TB 4OZGE 3GBNH 2H6PB 3V6BR 3EHBD 2BY2A 2DLHA 2R69H 2R1YB 3I6GA 3WO3B 4JO3L 4G8GA 2HG5A 1MFCH 5KANG 2V5TA 4O4YH 3RDTB 1T4KA 2X05A 1NUGA 4DCQA 1ZLUH 4EUPG 3PHQB 1II4E 3QI9D 4X6DF 2WBKA 5AYUH 1A6AB 3HS0A 4EDWL 1RK0B 2I9LB 5IKCB 4PLJC 2VLME 2OI9B 2DLIA 3O2WL 3TM6A 5T33L 4JLRB 2AJYL 4LSSL 3CMOH 4FS0A 3OAUH 4APQB 1U42A 3K4DA 1WTLA 5F72S 1KN2H 2FSEB 4ZOAA 4FQ2L 1FCCA 1J05A 4N90E 3SQOH 1JFQL 1MFDL 3DGCR 4JG0H 2Q87A 4KDVA 4O2EB 3BPNB 4Q9QL 3U79A 1F58H 4F9PC 5CP3A 4U3CA 4FQQA 1HHJB 1UWXK 1H3WM 2BERA 2B1AL 1C5DA 1FVEB 4XPBH 1G9EA 4BYHA 5C0BD 2V2WB 3MRKA 1I8LC 4XAWH 1JV5A 1CD8A 1EH9A 1IC5L 3HG1E 1FNEA 4MS8D 4R3SB 1FL3B 3T4YA 4K3GA 3IJYA 2FLRT 4GKNB 4L3CA 3HMXA 3U4BL 1T1WB 2OK0L 4CGTA 1SY6A 1A1MB 5EUKB 4CADB 2X10A 4MJ5B 5L6YH 3IAGC 5H2BB 4X80H 1UM4L 4JDZA 2DQTL 2VDLL 3TO4D 3QFJE 1G7IA 12E8L 5FOJA 1RHHB 2JIXD 2AERT 4DN4L 3KJ6H 5F9WB 2CXKA 3TC9A 4M03A 2VWEC 3QYCA 1KPUA 1A6WL 4EN3C 3TBTB 3VI4F 3LKNA 4DTGH 4OZHF 5DRWB 4ZFOB 1KJVA 3F6LA 4GBXD 1A1OB 4UTAH 5DUPL 4Q9BA 1AD9A 2FYYB 1PVHA 4XNMA 3EJZD 3W0WE 2OR8A 3UO1L 5MENE 2AEIT 4P4KC 3QFDB 1KTKE 1L4IA 3OKNB 4L9LC 4XZUB 4PBWD 4LSVL 2V2XA 3CPLA 1BREA 2ARWA 1XGTB 4LCYB 2JCCB 1J1OH 4HZLA 3DSFL 4X7SH 5EWIH 2BMKA 2P24B 1R3KA 1TZGH 4NJAH 1JTPA 1DBAL 1XF5B 4YHKL 3LKRB 4WNQB 2M2DA 3STLA 5L7XH 2CIIA 3MQIA 2GT9B 3V5KB 5I1EH 4ZFZB 4QWWD 1FNFA 2KKQA 4N8VB 3AB0B 4FFYH 3QJHB 4JFPB 5B3JF 1GXEA 4Z7VF 3ZL4L 5FGBA 4N0YH 3MLZH 2H8PB 5DTFB 1V3KA 3MFFA 4UI2A 5FOBB 1DQQB 1QSEB 3BKMH 5D9SB 3O4LE 3B83A 5D7JB 4JCLA 2AJ3B 2OLDA 2G9HA 3G5YB 3DHMA 3TT1H 7FABH 3O2DL 5F1NA 1XGUA 4LRIA 1V5JA 4GMSH 1EJ6A 5IHLB 2AVGA 1K3ZA 1RZKC 1A6TA 5EA0L 3GMRB 4MD4B 3IETB 3SDCC 3NH7L 1T7ZA 2ZJSL 2H6PA 1ULVA 4G80B 3OKLB 5ICYA 5IMLB 1J0HA 4U0RB 2R1YA 5HDBF 1XCQB 2A6JA 4GT7A 3FN0H 5I15L 4TVPD 3RDTA 1X5KA 1NGPH 1YEKL 2RJMA 4OF8A 4U33A 5KVGL 3VA2C 5SV4A 5L88L 4X9BA 1L9MA 4C56B 1WUNT 4WI3A 1RK0A 3EFDH 2EE6A 5DJ8B 2I9LA 4KK9D 3RI5K 3V4UH 4X6CF 1WIOA 1VACB 4R8WL 1YYML 4MAYD 1T03H 1Z3GL 4JLRA 1P7HL 1A8JH 3UYRH 1MJUL 4APQA 2A83B 3D25B 1TVBB 1IGML 3NZHL 4IIQC 1SJVA 5IT2H 2FSEA 1QLFA 3O6FD 4H26B 1FNAA 3TH4T 4O2EA 3JWNC 5F93C 2C5DC 2J5LB 3UTOA 1HHJA 4ACPA 5D1ZD 3DHJA 4ORGB 1FVEA 2V2WA 4L8SC 2KZ1B 5E2UH 1Z0NA 1UM5H 4R3SA 1FL3A 4GKNA 2VXUH 1IC7L 1T1WA 4NN7B 4CU6A 1A1MA 3L7EB 1HIML 3BQUC 5EUKA 4CADA 4MJ5A 4HKBB 5H2BA 5F6IB 3AU1B 2CKBH 4RNRB 1KB9J 4ODSL 4OLUL 3RGVC 1INDH 1BMGA 1Q72H 1RHHA 4YHMH 3WXVL 2P5WE 3LPGA 2WBJD 5JW5B 2XTJD 1M1SA 1X7QB 1FYTB 4U6VL 5HHVL 3TBTA 3QXWA 1MHCB 2Y4SA 1FAIH 5DRWA 2AK4A 5CJXC 3T0BA 4M7KH 4K3JL 1A1OA 1E6OL 1HE7A 4EKXA 4M4PA 4NM4L 1YEDB 2DJSA 5E2VH 1F2XK 1N4XH 1T7YA 2FYYA 3O11B 2PR4H 4M1GL 1KBGL 4OGAC 4YLQT 3QFDA 3BMWA 4PTUB 2VE6B 3ZE1E 5JOPD 3OKNA 4ZYKB 4MLIA 4RFOL 4XZUA 5CZKA 5DVLA 5IF0A 3MLPA 3VW3L 3EJJX 2APVA 2DDQH 1XGTA 4LCYA 4I0PD 3L5HA 2IF7A 3VXUE 5C07E 4GAJH 4PJ5D 2P24A 5GZOD 4ELME 1XF5A 3LKRA 4XBEL 2ORBH 4WNQA 4XNYL 2GT9A 5IW1B 3V5KA 4ZFZA 4F15B 3K2MC 3HB3D 4N8VA 5KS9E 3LMJL 1OY3B 5D1XB 4QXTB 1B88A 1CGUA 3QJHA 2QSVA 4G6JL 4S11A 4WJ5B 4PRDB 4JFPA 1KEML 4HSQA 2UUDK 5JXAL 4HC1H 3TESA 4YXLH 1NAML 2H8PA 2ICWJ 5DTFA 1CF8H 1MRDH 2R0LH 5AYQA 3BGMA 5FOBA 4YXHH 1AY1L 1DBMH 1DQQA 1QSEA 2RGSA 4ZPTB 5D9SA 1Q9OB 5HI3D 2J88L 5C6WH 5D7JA 4PTTB 2AJ3A 2AKRB 3G5YA 4DKEL 2KH2B 3TT3H 4GOSA 1MRCH 4LGPB 2APWA 2CMRL 1EDQA 3VRLF 4NJ9H