43CAB

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 25
structure length 117
sequence length 117
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caB00
3D18B 4LMQE 1A14H 2X6MA 1SJEA 4JRYB 3PABB 4N0CD 4TULL 3HI5H 1D6VH 1BVLB 4MAUL 4NO5A 2J1KA 4RMUA 2XPGB 4DGIH 3PJSB 2PF6A 4PIRF 3FQNB 4XBPB 2ESVB 4XP5L 5DD3H 5F71A 1TVBA 5IV2B 2IQ9L 2BNQD 4H25A 1X7QA 4HCRH 1WC7B 2P48B 4R9HA 1VESA 2E5EA 3QO1A 2A77H 5DJ0B 5BMFL 5F6IB 1HKLH 1DP0A 4AENA 4K94C 4OGAC 3X11B 3TPKA 5F1IB 5JMOC 4JHBA 1I1AA 2D9CA 4XNXL 5GRJH 4LGRB 5I74B 3C08H 5C0CA 4XNQB 1NUFA 4TUJB 3VXTB 4LLVB 3TO4D 1EXUA 1F4WL 4J7RA 1NEZB 4AK1A 1XEDA 4YDKH 3OB0H 1MNUL 1QR1A 1XGUB 4GAGL 3LN5A 2CR6A 4NNXA 3VFPA 5CJBA 2B5IB 2H2PD 3Q6FA 4FZ8L 5SWZB 4KROB 1R5VA 2F5AL 1NCAH 1QO3A 4QYOA 4ZUWB 1S9XB 2EH8L 2R29L 4MHHG 4R7DB 3TV3L 3ZYZA 3C87A 1JPFA 4R7NB 4J1UA 5IVXB 2XTJC 3K46A 1H8SA 4DGVL 5JNYB 2VDOH 3REWB 1EJ6A 1XCQA 1MFCL 2J8UB 1EHLH 3EOTL 3GSNL 2XNAB 4U6XB 5EZLB 1W72B 3UC0L 5DA4A 4Y5XB 4KJQD 2HTLC 1FVCA 4GLRI 5AAMA 3C5SA 4IDJH 3U0PA 2GSIA 2P5EA 1RV6X 4G6JH 2VH5L 3EOAA 5T1LB 3CMGA 2MWCA 3MRLA 2FR4A 1NCBH 5JUEL 2G5RA 4DGYH 4ONGH 2X70A 1YQVL 1RUAL 3CIQA 5HVFB 3VRIA 3IU3B 4HXBL 1SEBB 5ESVB 3L3IB 4RBPK 3UJTH 1ULVA 5SV3A 3BDYH 4NP4L 5DMIL 1LO5A 3S5LB 3ARBC 4AM0A 1JGVL 4K3JH 2CIKA 4YWGL 5ESAA 3ZTNH 1JHLL 4JQIH 5GRWA 2BNRA 5C08B 1OSZA 2B4CL 2ZPKH 5FYJE 4PJXE 2EYRB 4PJGA 4Y16C 4PLJD 2V5RA 5FUOH 4DN4L 4NBYB 3HA0A 2EEBA 5AZEL 3UYRL 1TJHH 2VDRH 4MSWA 4AH2A 4ZO7A 2EIZB 3GSWB 1S7UA 3VW3L 1N2RA 2CLZA 5EU5B 1J11A 1OGTB 2ORBH 4YK4C 1UENA 2JELH 3MRKA 3MACH 4I3RL 5CILL 3ULSA 1OD7A 1Y18B 3I6GB 3L5XH 1IQDA 5IHUH 4O58L 2NXZB 2PYEE 3HG1A 5E5MB 4DCQA 2N4IA 1CT8A 3DX9A 3BIKB 2O61B 1A6AB 2CO7B 2DN7A 5JO5B 2V9RA 4M00A 3UTTE 1YEEL 5I71B 1C08A 2CMRH 4Z7VF 4QRPE 1MCCA 5K9JH 4OLWH 1DFBL 1S9YB 1JZ4A 3ZYIA 1TCRA 2ICWA 5HDQL 1FVDA 4Q9QL 3Q3GB 1CD1A 1PG7H 4B7IA 3FQXA 3AB0C 3L3DB 4NQCD 2G60L 3TNMA 1EGJL 3FMGH 4GKSB 5TE6H 4UT6L 1NLDH 4HQQH 3KNBB 3QHZH 5DUBA 1KXTB 1DN0A 4ZFGL 2AVGA 3RGHA 2X41A 1R3HA 3PWPE 4NBZB 3NVQA 2LQRA 4N0YL 4M48L 2ZCHH 1BPVA 3B3IA 4L3CA 3BAEL 1EJOH 3ARFB 5I1HH 1JGLH 3TCLA 2PN5A 4P5MB 1E4KC 3D0VB 4MJ5B 4CU7A 2XICA 1J1XL 1FGNH 4KAQL 3QEQD 5D4QA 3MBED 3C9NB 5HGBA 3DGGB 1FNAA 1AQDB 4TULH 3NFNA 5D2LE 5DJCA 3WJJA 3JWNC 1UEYA 4PD4J 2IBZY 4L8SC 2ADJB 5DK0B 3RVWD 5J9PB 2EH7H 4WU5A 1P5UA 3FHAA 4JRXA 5DS8B 3CVHB 1F3RB 2IQ9H 4JQXC 1XGRA 3VFSB 4R96B 2XRAL 1AR1D 3HPLA 1IGML 1L9NA 3D25A 2IBBA 5CZKA 5E2VL 3VDAA 3RJQB 2X10A 2BRQA 5HD8D 5TE4H 5J1AA 4L9LA 2Z31C 1AGDB 5F9WC 4AG4L 4PJXB 5C7XH 2EDFA 4S1DD 3BYYA 2VDNL 3EO0A 1KYOJ 1ZHKA 4FA8A 4OI8A 4RGNC 3EYFA 4X6BB 4MZ2A 4GAGH 5DHXB 5FKPB 1WZ1L 1P4BL 2VLRD 1CE6B 4FZ8H 5DMKB 3VGHA 4YZFF 3S97C 3TBYA 3H3PH 5C0JB 3VXPB 3TPUB 1AD0B 5MENE 2F5AH 2R29H 1HH6A 3HNSL 1R3JA 2PYEB 4AZ8A 2UWEF 1MFBL 1JN6A 4NZJA 3T2NL 5HBBA 2WWMD 4NZTH 3UJIL 2NY4B 3UTTB 3RPKA 3GSNH 4GXUM 3ESUF 2XWJA 5FO9B 4QRPB 3HNTH 3UC0H 3BDBA 3VGFA 5DT1H 4QXGL 4Z6AT 1I8LC 4M93B 5E8EA 3V6ZA 1YDPB 2YBRB 2W9LA 5D96C 2PTVA 3D3VA 3GMLA 3K0WA 4JFDE 5CINH 5GS1C 4GQ9H 1BZ7A 5EO1B 4G7VL 5I1EH 5GGVL 1ZA6A 2AABL 5JDJA 4XVJH 1B3JA 5DC4B 1S5IL 3T3PE 4JO4L 5I1DB 3F65A 4HXBH 3PWPB 4X5XB 4HJJL 1QLFB 4NP4H 5DMIH 1JGVH 5C6TL 4XPTH 1CBVH 4YWGH 1JHLH 1KG0A 1G9ML 4BH8B 4Z7UF 5IB3B 5D70L 4JKPL 4RIRA 1BOGB 1IILE 1RUMH 4DN4H 1X5LA 3UYRH 5D2LB 1P7HL 4TUKL 4E0RB 5TDOB 4PTUB 5F7UA 1YNLL 3O3EB 3EYOA 3MLZH 5EU7C 3NZ8A 1DLFL 1RD6A 5J6GB 2EDYA 3HAEA 1X5IA 1K2DB 4XWGH 4O58H 3DURB 1EVUA 2DWEA 5EO9A 3CAFA 2YSSB 1WV7T 2ITCB 3F7VB 5DRZB 1YPZE 3WXVH 1YEEH 4HLZH 1W8NA 1DFBH 4H5SB 3W9EA 1MJ7L 2E7LC 3HE6A 1UA6L 3D18A 3QDME 2MTPA 4JRYA 3PABA 1INEL 3DWTA 3BW9B 1FFQA 1BVLA 5TQ2L 1YMHB 2XPGA 4QRRE 4QWWD 3PJSA 1GOFA 1S9VB 1OTSC 4UT6H 2FGWL 2APTA 3FQNA 2OP4L 4XBPA 2ESVA 4YPGB 5K9OB 3GUTB 3HI1B 5IV2A 1NMBH 2CD0A 1VFAB 3O6LL 3OX8B 4EN3C 4ESKA 1WC7A 4ZFGH 2GQHA 5DJ0A 4LPWA 3U1SL 5LXGH 3JVGC 3X11A 4OLXL 4N0YH 5F1IA 1CL7L 4JPVH 4ODBD 1CG9B 1EO5A 2DL2A 2W60B 4I3SH 4MXQD 4XNQA 4TUJA 4XWOD 5JIPA 1A5FL 3LKQB 4OD2B 4LLVA 3VXTA 4KAQH 5BRZE 1NEZA 3L5JA 1S7SB 2IAND 1GGYA 5ALBL 5KN5B 4GMTL 3B8YA 1XGUA 2D4DA 3OB8A 4JFDB 1P69B 1OAZL 1QSEE 4HFUL 5SWZA 4PJ8D 4JGMA 3ZHKA 3VFRB 4ZUWA 1S9XA 2FO4B 2YPKB 4R7DA 1KPUB 1D5MA 1HN1A 4LFHG 4CGTA 3IFLL 1A9BB 5E24E 4R7NA 4MX7B 5IVXA 1H3WM 3ZKQD 4NFDA 4YXKL 4O9HL 1T5WB 5JNYA 3REWA 5EA0L 5CSZB 2J8UA 1W0YT 4BSWB 1OARL 1JWUB 1RJLB 2XNAA 4U6XA 1AQKH 5EZLA 2AEPL 1W72A 3CZJA 4M43H 3L6FB 3P2TA 3FRPG 4JEGB 4Y5XA 3O2DA 5EWIL 1I3UA 1AXTH 3DECA 2K7PA 4PG2C 1Q9WB 1MCEA 4PJAF 5C0DB 4Q9RL 4LCIL 4X83A 5T1LA 4NOBA 1WZ1H 3KPPB 4J3WA 4GRWE 4UBDD 2RB8A 4NCC1 4D9RD 1JZ8A 1BZ9B 3O0RL 3OJ2C 2PCPB 3IU3A 1SEBA 5ESVA 3L3IA 1EVTC 1A22B 2FDBP 3T2NH 5A2LH 4PY7B 4NQVB 4OGAD 4X9HA 1YZZA 3UJIH 3DX7B 1YPZB 3S5LA 3EJZC 4POZC 3MLXL 4ENED 5B22A 2FHBA 3H9SE 1HSAB 3ARDC 5E56A 5C08A 4AL8H 2FNBA 1AY1L 1BFSA 4QXGH 1GXEA 3JZ7A 1H3XA 3MRFB 2EYRA 4OIBA 3QDMB 1QACA 4NGHL 5LQBL 1F4YL 4XH2B 2EIZA 2X1WL 4QRRB 1MCHA 3GSWA 3O6FB 3BUTA 4CRPA 2HTKC 5EU5A 1O7SA 1GZQB 1OGTA 2AABH 2CKBB 1Y18A 4YBHA 3I6GA 2Z93B 5KAQG 1JF6A 1TQCB 1LD9B 5E5MA 3BIKA 2O61A 2J6EL 2CJUL 5ADPL 1A6AA 1T21B 1YEIL 4HJJH 4PS4H 5JO5A 1G7MB 3SE4A 3RI5F 5C6TH 1T0MB 1YNTB 4XPGL 3STZB 3FN0L 3CFJA 5LBSL 1DEEB 2J8OA 3H7BB 1S9YA 5KVEL 1FYHB 3DMMC 3AMKA 2HTLD 5BRZB 4DUVA 3Q3GA 4PGBB 2QJDA 3L3DA 1CI5A 3DSNA 4TUKH 4KK8D 4GKSA 3RY4A 1A3RH 1QSEB 3IGAB 7FABL 3BMWA 2QHRL 5I15L 5HHMD 5C71A 1JTPA 3KNBA 3U36B 4FQCL 1G0YR 4F7MB 4NQDE 4G8GD 3V2AR 3GI8L 4MWFB 1R3IL 4ODWB 2DJSA 4V2BA 4FOMA 3LKSB 2A6DB 4NN5B 5JIKA 5BO1L 1JK8B 3ARFA 3CXDL 4ZFOB 3BPCB 4P5MA 2W59A 3D0VA 4JGJA 4MJ5A 5INCB 2EDKA 4WCYH 1UA6H 3DGGA 1AQDA 1X5YA 1NGWB 1B2WL 2DKMA 2ADJA 5DK0A 4GRWB 3V8OA 4U7KA 2OP4H 1T20B 5J9PA 1CF8L 1FRGL 4F8TA 4KZEL 5DS8A 4YHZH 3CVHA 1IMHC 2VWEE 4XNMB 2NNAB 1FZOB 2FRGP 4CMMB 3NPSB 3VFSA 1KCSH 4YC2C 4JY4B 5JDSB 3U1SH 3K4ZA 5D7JA 1MLBB 1HNFA 1NBVL 3FO9B 4OLXH 5HI3D 4LPVA 3H9SB 1VGEL 3PL6B 1QBML 3IAPA 4YPJA 3IAGC 4X8XA 1DVFC 4S1QL 5E6IB 5CJOH 5L2JB 1AGDA 1JMXA 4PJXA 4LGSB 4X4YB 3FOLB 3ZTJH 2N7AA 1I9IH 1J05B 5FKPA 3GSRB 5B39G 1CE6A 5DMKA 1U93B 5C3TA 3LPGA 5C0JA 3VXPA 3TPUA 1AD0A 3F8UB 4L5FH 1FPTL 2PYEA 3VJ6B 3B9EA 5EA0H 5DVLA 5GQBA 3UTTA 5L9DL 4WHDA 3SKUD 4IOIB 1KPRB 5HHOD 5FO9A 1N64H 4QRPA 3RIFF 2X4PB 3Q5TA 5AZ2H 5EWIH 5MI0B 4RAVB 4PJDE 3IVKB 1YDPA 2DD8L 2YBRA 1MCKA 3I75B 2DQJL 1WBYB 3NIDE 4LCIH 3IKCB 3E2HC 1QSZA 3GMRB 5EO1A 1VEMA 1AFVL 4KU1A 2EECA 3Q0HA 1G0XA 1BF2A 4QHMB 1BF8A 4NQDB 2ERJB 4MJIE 4YIQB 5I1DA 1WFUA 4L3ED 4RFEB 4XI5C 4ODVH 3PWPA 4X5XA 1BJ1J 1DBKH 3C2AL 4PV9B 1QLFA 2ZG3A 4LHUD 3EYUH 2J8HA 4BH8A 1NCWH 1KBGH 1I3RB 5DTFB 2R39A 5IB3A 2E27L 4NN7B 4WW2C 4D9QD 3D9AH 4JFFE 1BOGA 3S9DB 1OY3B 4RGND 2EO9A 5K9KB 4FQXB 1F4YH 2EIBA 1VA9A 5D2LA 3F7RA 4QOKE 5CJXA 4E0RA 5TDOA 4PTUA 5L6YL 3S36L 1ROWA 3W11D 3O3EA 3BPNB 3VWKD 5IB1B 5J6GA 1FJ1B 3UXFA 1K2DA 3OBAA 3S35H 1G7LB 3DURA 3ZDXE 2J4WL 2NYYD 4CKVX 1DZBA 2YSSA 2VZVA 4AY0A 2J6EH 3WJLC 5ADPH 1FLTX 2ITCA 3P40A 3SE3A 3WLWD 3F7VA 5DRZA 3O3DB 4APQB 4OF0A 2BJMH 1RZ7L 2VQUA 2LVCA 5HVHB 1B6DA 5L7XL 5TE7H 2NY2B 1YJDL 4H5SA 2GJ6D 4ODSH 3T0WA 1NLBH 4HPYH 3H42L 4PGCB 3ARUA 1KTRL 2NZIA 3BW9A 3MZTA 5FYKD 1YMHA 1S9VA 4LRIA 4JJHA 5I6XC 4P4KB 4YPGA 5K9OA 3HLAB 3GUTA 3HI1A 4H0GA 1PY4A 5CEZL 3T8XB 4I0CC 1VFAA 3BZ4B 3DV6B 1DR9A 3OX8A 5T3XL 1CFVH 3GI8H 3PP4L 1R3IH 4MLIA 4OCYH 5LKNA 1IEAB 4K3DH 1CG9A 3WFCH 4E5XB 5BO1H 3TO2B 1TVDA 3CXDH 1JBJA 2W60A 3LS5L 5T5FH 2I24N 3LKQA 4OD2A 3MRIB 1JMZA 3F62A 2VLMD 1S7SA 5KN5A 4JDVB 4PJDB 3PGFH 1GIGL 2AAVA 4LBEB 4U3HA 4JFDA 1B2WH 5E00B 3B2UD 3WNMA 4F15B 1FRGH 5E0QA 2H2SD 3VFRA 1NGXB 4KZEH 1WT5A 2FO4A 2YPKA 1RURH 1KPUA 1JYVA 4MJIB 3SN6N 5B8CC 1A9BA 5KJRH 4MX7A 2ENYA 3G5YB 1OHQA 1T5WA 5CSZA 1OOAA 3GB7B 4B0MM 3EFDL 1IAOB 4BSWA 1JWUA 1RJLA 5IFJB 3MFFB 3VFOB 1Z2KA 3HZKB 2DLTA 4R4NC 3L6FA 2YD9A 5IW1B 4JFFB 5BQ7B 2CIIB 3LKPB 6CGTA 2XN9E 4H0IA 2OI9C 3UTPE 4JO3L 2ADGB 5M95B 1Q9WA 3K8LA 5C0DA 1J8HE 4LQFH 4QOKB 4QHNB 1OTSD 1FDLH 3KPPA 3SDXF 3BUYA 3HS0B 1ZLSL 1U2HA 1U8MB 3EO1B 2QBWA 1BZ9A 2BMKB 2PCPA 4ZAKC 2AJVL 5FB8B 4LCWD 3QAZB 1RMFL 3V6OC 1SHMA 4PY7A 3LS4H 4LU5L 4NQVA 5C70A 3DX7A 1YPZA 3FO1B 4WUUD 5L9DH 3ALPA 1HSAA 1LE5B 5TF0A 4M6OL 5GHWH 3O4LD 2NY1C 43C9B 1NBZA 3CH8A 1WCQA 2ARJB 3P0VH 4JG1H 2YUZA 5ADOL 5EFIB 4YDIL 3MRFA 3FB7B 3QDMA 1NCDH 5DD5L 2DD8H 1NGPL 3HR5B 4XH2A 4YDVB 2DQJH 4R8WL 4QRRA 3O6FA 2Y36L 4RNRB 1OLLA 5CUSH 1GZQA 4AMKL 1AFVH 2CKBA 5I1JH 1RHHB 4JGUA 5E9DB 2Z93A 2DDQL 2OR9L 4PRDB 3F7QA 5HHVL 5CCKH 1T21A 4UTAL 1G7MA 4UOW0 3WFHB 3PXHA 2HFTA 3GBNH 4JG0H 2DLGA 5D2NE 3AS1A 1YNTA 3STZA 3VFVB 2DB8A 4U6VH 1S3KL 1DEEA 3H7BA 4YHPB 5EZJB 5CEZD 5BRZA 4DKAA 5FUZL 1XR9B 5T3XD 4PGBA 4R4FL 3EDJA 3HC3L 2IWGA 3HAEH 1ZT1B 3S36H 3IGAA 1QSEA 4JJ5B 4MNGB 4EDWL 3U36A 2OMNA 2L7JA 3JV6B 4F7MA 3S4SG 1J88A 3QHFL 1AXSB 4MWFA 2J4WH 1R5IB 1ZEAH 4ODWA 5C0AE 3LKSA 3EJZD 2A6DA 1A7PH 4LPYA 1JK8A 3ARDD 4ZFOA 1FNSH 5L7XH 3BPCA 4MAYD 3ARWA 4FQIL 3KR3L 5INCA 1NL0L 3BOVA 2UZXB 4IOFC 2HRLA 3KPOB 3KLHC 4Y5YB 2XN9B 5DZLA 1F3JB 1NGWA 4OKDA 4D9LL 1P6FA 1J8HB 4MQXC 4KQ4L 4M6ML 2HTKD 1CFBA 4U1GB 1T20A 4JM2F 4P3WA 4XNZB 4XNMA 2Q76B 2NNAA 4WFFD 1FZOA 3HTLX 4ODXB 4CMMA 5ICZB 1V7MH 3QUKB 3MCKB 3ZTJG 4XVUC 4JY4A 5JDSA 1MLBA 5IMLB 3FO9A 4YXHL 5FYJL 1TZGH 3LCYA 3H9SA 1LO4H 3PL6A 4JFZH 1EFQA 2W1NA 2DI9A 3LD8B 3RWJB 3H3BC 5E6IA 5L2JA 3DMMD 2FYYA 1FNGB 3P11H 4N1EA 4X4YA 3ZLQC 5CFHA 3QXTA 3FOLA 5IT2L 3MJ9A 4I4WB 1J05A 3GSRA 4R26H 1U93A 1LO0H 5IK3B 1IGIH 2YUXA 3BWAB 1UM4H 5IUSA 3AREB 4FFZL 4TOYL 5D1ZB 2FD6L 4YZFE 4WVRA 1EMTL 4UDTB 3U46B 1W72H 2UWEE 1Q1JL 4TNVK 4LSTL 5D1XD 3KXFB 1EV2E 1L7IH 4IOIA 5D2NB 1FL5B 1KPRA 1T2JA 3O2DH 4P2YA 3MPCA 4GXUN 1WIPA 4PJHF 5E8DL 5HGDB 2X4PA 3GEWB 5HYSB 3KJ6L 4Z7VB 3NCBB 4X6DF 4XHJC 4RAVA 3IVKA 1U42A 3I75A 4JO3H 1ZK9A 1WBYA 2ICCA 1QRNE 1LK3L 3IKCA 1MCFA 5EB9A 1ACYL 3BP6B 4WTZG 5DRWB 1TZHB 6FABL 2VR9A 4QHMA 4NQDA 5KSVB 4YIQA 4RFEA 1FN4B 1VKXB 3BGAA 2DQEH 1PEZA 4LCCC 2HJFB 1KGCD 5C0AB 4PV9A 5CJ5A 4QLRA 3V5HB 1PSKL 2HWZL 3VGBA 2ICES 1UADC 3QUYC 3DETD 1I3RA 4N0RA 1ORSB 5DTFA 1ZLUK 5ADOH 2YPLE 4YE4H 4RAHA 4GT7A 4AQOA 1KJMB 2ZKHL 4TUOB 2I25N 4Z7UE 4FQXA 4FFWC 3D1MC 1J87A 3WUWB 3UDWC 3MRJB 2MFNA 4RQQB 5I73B 5IHLB 2V2XB 1JNLH 4XB8A 3FQWB 3EYSH 4X7CC 3T77B 5IB1A 1U91B 1FJ1A 3OKLB 3B9KC 5KSAC 2DWDB 1G7LA 2OR9H 4LHUG 1IARB 4L4JA 5E2TH 4EI5B 2E6QA 3O3DA 4JFEE 4APQA 2EDEA 5GZND 1S3KH 2RBLA 3CFEB 3QULB 3OG4B 5F3HB 4MCZB 1HI6B 5JHDD 4PGCA 2CXGA 3BIAX 4AIOA 3MLRL 1UJTA 2VZOA 2O26U 3VFGL 1Z0NA 5HVWA 2BP3A 4QKXB 3OR7B 4ODTH 4P4KA 5GISL 3HLAA 3QWRD 4P9ML 4EDWH 3UPAA 3T8XA 2XA8L 3BZ4A 3DV6A 4KVNH 2FHCA 4HWEL 2NY6B 4U1KB 2JB5H 1MWAB 1QFOA 5KOVC 5GRUL 1FO0L 2UWEB 1ZSDB 1T7XA 1IEAA 5GRZA 4E5XA 3TO2A 1IKNC 5ESQB 5CP3A 3OL2A 4TQEL 3QIWD 1IGJB 1S9KC 1G84A 3MRIA 3KR3H 4KK9D 2AGJL 4I9WE 4JDVA 4PJDA 3BSZL 4Q74A 5KAQF 1RZKL 4LBEA 5E00A 1EO8L 1QRNB 5I30H 4M6MH 1HIML 5FA3B 3VGGA 1YYMH 2Y5EA 2E8ZA 1NGXA 3O8XC 3INUL 4P23B 2DTML 1I9RL 1E28B 3G5YA 1FC2D 4HG4K 5F9OH 5H94B 5I8KH 2BXYA 3ZL4L 3GB7A 1IAOA 1NMAL 2GI7A 4NZUL 4XC3L 5IFJA 5FYJH 3MFFA 1J0HA 1N6VA 4OCNC 2RIKA 3VFOA 3HZKA 3SDDD 2F74B 5F7DB 1L0XA 2YPLB 3GIZL 1BD2D 5IW1A 1TXKA 4FQ1L 4JFFA 1I1AC 5GSRB 5BQ7A 5JW3L 3LKPA 1TJIL 4OCRL 1A0QL 4Z7UB 2ADGA 4NKIH 2RCSH 3HC0B 4QOKA 4QHNA 4C59B 3HS0A 4H1LB 2X09A 3BRDA 2FATH 3EO1A 5E08L 5I75C 2BMKA 2FD6H 3LKOB 5FB8A 5GJSL 2C1OB 3P0YL 3MV7D 1FIGH 1KTKE 3ULUL 2VDLL 4ZG1A 3FO1A 1Q1JH 4LSTH 3I50L 1WIUA 4F37F 4UIMA 2CKNA 5I18L 4KJYB 3QEUB 1LE5A 2I07B 3N1MC 4NQSB 43C9A 5EORH 1OTTD 2ARJA 5C9JB 1KJ3L 2EC9T 5EFIA 3QIUB 1WVZA 1KC5H 3FB7A 5IM7B 1CFQB 1N7MH 5GSVB 2P24B 5IW6A 3FKUS 3V5KB 3HR5A 4YDVA 4OCSH 4XCCL 2Y72A 4HPOH 2CRIA 3HRPA 4RNRA 3S3PA 3EDDA 1RHHA 1URLA 5E9DA 3RZCD 2IAMB 3K81A 4PRDA 4NN6C 2XQYK 5C0IB 1OL0A 3WFHA 4LPXA 4FZEH 1R3KB 1MAML 4RMSA 3VFVA 4QXUL 1DUZB 1Z3GL 2VXTH 2YEZB 3RY5A 1XZ0B 2FO1A 2VLJB 4YHPA 5EZJA 2WMPA 2AXFB 5K93A 4OD1H 4NM8H 5E1AB 2G9HB 3DUSB 1XR9A 3KLDA 2IPTH 1B0WA 2FGZA 4X80H 4IEFB 3HE7D 1ZT1A 1G6RB 3QBTB 4KK6D 1A7NL 1O0VA 4JJ5A 2R4RH 4MNGA 4B41A 4GKZB 4JPIB 3JV6A 5J57B 4GSDH 3KPNB 1AXSA 4MVBC 4ZAKD 1T03L 1R5IA 5EIIB 4O51B 4KWUA 1ACZA 5AYUL 2VXSH 3L7EB 3C6SB 3MRHB 1OM3H 3EO9L 3FT3A 2HLFC 2NY1D 3H2WA 3G04B 3LSOB 2J3SA 4J4PA 3KPOA 4HT1L 3BZFB 4Y5YA 2XN9A 4PP2B 3I2CL 5FFLA 2Z8RA 1OGAE 1U92B 1F3JA 2LV4A 1BFVL 1J8HA 4XPBH 2APWA 1RY7B 3QZWB 1U8PB 5GISH 4PJAB 4K3EH 3ISWA 2D7OA 2CLVB 2Q76A 3C8KB 3UTSD 2VIRB 2DAVA 4HWEH 1ZLVK 4JDTL 4ODXA 5ICZA 3QUKA 1TPXC 2W38A 3MCKA 4ZOCA 2XWTB 5GRUH 3PIQB 5IMLA 2XXCB 1T66C 2QADD 3RWJA 4DFIA 4IJ3C 4OCLC 3KVQA 1FNGA 2X40A 1MCIA 1JPST 2AJYL 1FORH 3SOBH 4WWKD 5KSUB 3UYPA 4I4WA 3ULUD 3M8OH 1C1EH 1EO8H 4Y7MA 1HIMH 5MHSE 5J12C 3LRGA 2EDXA 2R23B 4HKZB 5IK3A 3MCLH 5MP6L 4J3VA 3WJJC 5C3LD 3BWAA 3AREA 4YBLB 3INUH 1JVKA 1ETZB 2DTMH 2Q3AA 5D1ZA 2Y1VA 1A7QL 4GW1B 4R2GB 4KMTH 4OQTL 4UDTA 3U46A 3ZKNC 4UILL 1B90A 3ZL4H 3BFOA 1T6VN 3KXFA 4XC3H 5D2NA 1FL5A 1OAYL 4PJIF 5ID0B 3D5OF 5HGDA 4LLWB 5HYSA 1XIWD 4H8WC 4IOFD 3SGEH 4Z7VA 2DYPB 1Z0MA 4NCC2 3KLHD 1DQDH 2Y9RT 1YUHB 3MUGB 4L9LC 2YWZA 2J12B 5IB5B 3L3KB 2OJZH 3AY4A 4PJCF 5CIPH 4NPYB 5IBLD 3BP6A 5DRWA 4R90L 1TZHA 4ZTPL 3GSUB 4HUUB 3SCMB 5J6HB 5KSVA 1NPUA 4S0TD 5E08H 4IBLT 5FAAA 1VKXA 1FN4A 2VXVL 4OF7A 2A0LD 5ISZE 4XVUD 5GJSH 3P0YH 3ULUH 2HJFA 1OPGL 4FQ2L 5C0AA 3QUML 1FYTE 4HEME 3V5HA 3EZJB 1T89A 1JCKA 3UJJL 5DJ8B 4DAGL 4UDUB 1CFSB 1ORSA 3DTXB 3UX9B 1I8MB 2VITB 1PLGH 2E6JA 3TN0D 3WKNA 1KJMA 3MGOB 3JUYA 4TUOA 3WUWA 1OGAB 2CKBH 3QCUL 3QFJD 2XIDA 3FHQA 3OHXB 4YBQD 4XCCH 3MRJA 4RQQA 2DL9A 4BFGA 2OM5A 2V2XA 4KKLC 3LQAC 5LCVL 3FQWA 3T77A 1U91A 3NTCH 3OKLA 2YUVA 2DWDA 4M8VA 4Q6IB 1OVZA 1RFDL 2PR4L 3B6SB 2PKDA 4JPWH 2E7CA 1CDCA 1U8LB 4UNUA 5C0BE 3LH2L 3SEPA 4EI5A 2Z8SA 35C8L 1YMMA 4ODHH 3CFEA 2BY1A 3QULA 2VYRE 5IJVB 3MNWB 2W92A 5F3HA 1G7PB 1ZAGA 4MCZA 1HI6A 1CQYA 1QYGH 3RNQB 2H1PL 3ARQA 4FXLA 2JJTA 1REIA 5DFWH 4M7KL 2ZWLT 1J5OL 1D3CA 3OR7A 3QJFB 1WICA 3MV9B 4Z95H 4AEFA 1QG3A 4J3XA 4U1KA 1MWAA 1W2KT 4M5ZL 4YFLF 3VXQB 2I9TB 2UWEA 3I3EA 1ZSDA 2BVOB 5CD5C 4K3GA 4OB5L 3D69B 1P7QD 3L3OB 5ESQA 5DJYB 4LDLB 1XR8B 2R0WL 4TVSa 2B8OT 1IGJA 2C7UB 4QEGA 4WEBL 1JL8A 1FHGA 4HT1H 5K9QI 1RUKL 1VPOL 4GKNA 4LVOC 3C6LC 4GRWH 4FFWD 1I85A 3I2CH 2IG2L 1J0JA 3HE6C 1QRNA 3IYLW 1IKFL 3NZHL 5FA3A 3WV0A 2MOVA 3NABL 4Z7WA 1UH4A 4OCWL 4TSAH 3DARA 3B9KD 4Q0XH 4P23A 4C4KO 4JFPB 5ANME 1E28A 1GAFL 4KI5D 4QTHB 4Y4KB 3OMZA 5ISZB 2JLLA 1G9EA 5H94A 3BKYL 3MX0A 2DLFL 1GJIA 5F1KC 1ZLWK 5T5NG 2EO1A 2VDMH 4HUKB 1XF2B 2R2CA 5F6IC 3Q6GL 2F74A 5DK3A 5F7DA 2FEEI 4M02A 1NGYB 4LIQL 2YPLA 2UUDH 2DQGL 5GSRA 5BS0E 4AEIH 1MJUH 5I74C 4DW2H 3H0TB 1ZTXH 4Z7UA 1GYAA 2AJXL 2ICWJ 32C2B 3HC0A 4M9OA 2R0KH 4H1LA 2VZSA 3O2VH 5IB2B 2DOCA 2CQVA 3SDXE 2B5IC 2IPUK 2QQKH 3LKOA 3UTZB 4KROC 2C1OA 5I19L 3QDJD 5C0BB 4F7PB 2FIRT 4KJYA 3FZUC 1T3FB 3QEUA 4MMXC 4NKDB 2BC4B 2I07A 2B20A 4NQSA 4P46B 4U49A 5C9JA 3VGEA 3QIUA 3BKCH 5I8EB 5A1AA 2RGSA 2JE8A 3B4NA 4ELKB 3D0LB 3MRMB 1U41A 3RIAK 5IM7A 3RGVB 1CFQA 4NQED 1YY9C 5GSVA 2P24A 3CC5A 3V5KA 4Y5XC 2RQ8A 3KGRA 5D1QD 4D2NA 1MFDL 3T0BA 3O8XD 4HUMB 1K5NB 4R90H 1GC1L 2IAMA 2ADFH 2KQMA 3KJ4B 1X5HA 4PRIE 4E42B 4N8CH 1GOHA 2R69L 3W5MA 5C0IA 5HPOA 4N90E 4ZUTB 4BFBD 1R3KA 3UJJH 2UY6A 1BAFL 3HC4H 1DUZA 4DAGH 2YEZA 4TTDC 4X7TB 3L5HA 1XZ0A 5HHQB 2VLJA 1BX2A 5T3ZE 1H3GA 1I1AD 2AXFA 3X17A 1IBGH 5E1AA 2G9HA 3DUSA 3BN9C 4UV4H 1QRKA 4DZ8B 2FX7L 4LQ1A 5E03A 1G6RA 3JTSB 4ZO6A 2DQIL 1OAQH 5LCVH 4UT9H 1DQQB 4GKZA 1PG7W 3C5JB 4JPIA 1UGNA 5B4MC 1FLRL 3KPNA 4L4TE 1RFDH 5ANMB 5IMMB 3RWFB 4DKEL 5EIIA 4O51A 4LVNB 3L7EA 1F2QA 2AXHA 3TGXA 3C6SA 1GGUA 3MRHA 3T0ED 1CIUA 1XMWA 3SE4C 3G04A 4PYHA 3LSOA 4YFDB 5I71C 5BS0B 2H1PH 4JVUA 5B3JF 3BZFA 2WUBL 2UZYB 3HB3D 4PP2A 4S2SB 1A1MB 1U92A 4DUWA 1J1PL 4LSPH 1LO2L 1CXEA 7CGTA 5CAYB 3P30H 4KKBD 3QZWA 1S7RB 1U8PA 4PJAA 3ULVL 1I7TB 1NAML 2CLVA 2HKHL 3SDXB 5J11B 4YHOL 3C8KA 2HRPL 3BH9B 4P57B 2VIRA 1CLCA 4XPHH 4Y4HD 1MCQA 1JF5A 3C8DA 3QUXB 2XWTA 3PIQA 5CP3H 3ZYOA 1RUQH 3QPQD 3RA7H 3MLWL 2VR4A 1D9KB 1JRHI 5F70A 4OLVH 2R2BB 1CGXA 1BIIB 1I7UB 4XP9L 1OTUC 3ARFC 2Q8BH 3KYOB 4RX4D 1VPOH 2YD5A 1IAIH 5KSUA 5ECJE 1QNZL 4KUCD 3PWJB 2R23A 4HKZA 1NAKL 2OZ4A 4WV1C 4OCWH 2WIIB 1ETZA 1MHPL 4K9EH 4NWUL 2VSCA 1I3VA 3IB4A 8CGTA 1GAFH 4PRIB 4M7ZB 1INQB 4GW1A 4JY5H 1C16B 3LQAL 3HG1D 3TBSA 3SDCB 1JZ7A 4P2RD 3MLYH 1NC4B 4DUXA 5T33H 5ID0A 3Q6GH 5D7JC 3OXSB 4LLWA 4LIQH 4YHIB 4M62H 4PJHE 2DYPA 3WFBL 4ZS6C 1S7XB 3GMOB 2I60H 3GM8A 1A4JB 2KL6A 3S96B 3JWDL 3QCVH 1YUHA 3MUGA 5F96H 3RWDB 2WM0A 3EHBC 1QD0A 1QSFE 2AJXH 3ZSSA 5IB5A 2UVFA 3L3KA 3OSKA 5F9JB 1T22B 1U3ZA 4NPYA 1RAMA 3QQ9C 4KJWC 3SJVD 3GSUA 4HUUA 3SCMA 5J6HA 4L4TB 1CLZL 5D71L 2PUQT 2FBJL 1KUMA 1QZ1A 1JYXA 4YDLB 2XZQL 1OP5H 3DUHA 4I0PB 2F8XC 5DJ8A 3KWWB 1CZ8L 2ZOLB 4G9DB 4H88L 3MRRB 1MCRA 4UDUA 1CFSA 3RJDA 2NY4C 1NCCH 1L6ZA 3DTXA 1WEJL 3BEVB 4R4BB 4W6WB 1RU9H 2VITA 1I8MA 3DVIA 1CVRA 3MGOA 5ILTL 3KYAA 3IS0X 4HBCL 3RTQB 1OGAA 2BNQE 5E5RB 1ZHNB 2EE2A 3OHXA 4M93C 4CU6A 4BQ9A 3CFDB 4EIGB 3TBWB 5CZVL 2M8XA 4OFYA 2QSQA 1FV1B 4CNIB 2VXQL 3VXMD 3S36X 4OJFH 1RZJL 4LRNL 4Q6IA 4RFOH 4JM2B 3B6SA 1MCPL 2FCBA 4XXCA 3SQOL 1OWRM 4XCFH 2OMBA 3ZKND 1U8LA 3RL2B 1TZIB 1CN4A 4DZBB 3DO3A 1IEHA 4WFHD 4RWHA 4KHXL 3LZFH 1LK2B 5ICYB 3S34H 4BZ2H 3RX7A 4N0UE 5IJVA 3MNWA 1G7PA 3ULVD 4Z8FL 3RNQA 1JGUL 3MRBB 4HK3J 5T1DL 2BFVL 3AS0A 3E3QC 1I9JL 3EDEA 3TZVC 4JANB 2D0GA 1HINH 3QJFA 4ODUB 2IFGA 2DQIH 3GFUA 1JHTB 3MV9A 4LASL 5CJXC 4NHUB 3SGEI 1FLRH 2P45B 3QIBB 3QXWA 4NZRL 3EIFA 3FTGB 3FAXA 3QA3B 2ENSA 1EH9A 3VXQA 2I9TA 1A21A 5IIEB 1ZVYA 2BVOA 1KEML 5C8JB 1NGQH 3G6DL 3LHPH 3D69A 3SE3C 3L3OA 2OJEB 5DJYA 1SM3L 1XR8A 4QRUB 1EEZB 1ZANH 2C7UA 1AO7D 3OF6A 4PJHB 4BQ6A 4JM4H 3U7WL 5DA0B 2WUBH 5EDXA 2DLEA 1QSFB 2VC2H 4X6DB 1J1PH 1P4IH 2WBJD 4GS7B 3TBVB 4BELD 1QVOB 4LRIC 4YHOH 3WSQH 1OQOA 5IEKB 4JFPA 4QTHA 4Y4KA 5ISZA 3U4EB 1IC7L 2WUCH 3FO0L 3GHBH 5C07D 1A6ZB 2W0LA 5CS7A 1XF2A 4GRLB 3N0PB 1RULL 2GJZB 4BM7A 3DXAD 4Y1AD 3C5ZC 5C0GB 1NGYA 2XQYG 5F1NB 3QSKB 4P9HH 5FCUL 1LGVA 4XP9H 5FYLL 3QRFM 3SKJL 4XNUL 3H0TA 1MJ8L 1X44A 5DJAB 4MQTB 2BNQB 32C2A 3JBG7 1ZVHA 3CU1A 2MPAL 2BK8A 3K1DA 2QKIB 1QNZH 5IB2A 4RWYH 1MRDH 1NAKH 4XMPH 4YQXL 3OQ3B 3UPRB 1FZJB 1HXYB 3UTZA 3RU8L 3U0TA 4WU7B 5E99L 2FX9L 5C0BA 1R3LB 4F7PA 1WT5C 5DURD 1MREL 5CD5D 3TO4B 2IFFL 2AEQL 1T3FA 2F15A 1TDQA 4NKDA 2BC4A 3V95A 4N0UB 2Y6SD 1MCWM 4P46A 4NQCE 3G08B 5I8EA 4QY8B 4ELKA 3D0LA 3WFBH 4HMDA 3MRMA 1UWEL 3RGVA 1BWMA 3C6LD 2G75B 2MSPA 3JWDH 1F58L 3RVVC 1A7OL 3HE6D 3ZDZF 5FOBB 4G6KL 4JO2L 4F8QA 1JYNA 3P9LB 3MOQA 1K5NA 1JHKL 2AXJA 1DN2A 1CLZH 2ESVD 4F7TB 1LDPL 5DFVC 4E42A 5AUMB 2FBJH 5EUKB 4P3CH 3K8KA 4UT7L 4ZUTA 3QEQE 5FM8A 1CDGA 4BQCA 2VRAA 3OAUL 1ZV5A 4IRJD 4X7TA 5HHQA 2EC9U 1YEGL 5IFAL 1IEBB 1BGXL 2HT2C 2HFGL 4DZ8A 1NSNL 3GSQB 1A47A 1IGCH 4WI7A 4RDQG 3S7GA 1QHOA 2FECI 3JTSA 4YHKL 1DQQA 3GRWL 3C5JA 3OZ9H 5E70A 2VXQH 3BHBB 3O6FC 4NO0D 3T0XA 1RZJH 4PY8I 4KTYA 5ANMA 5IMMA 3RWFA 2PO6D 2EEAA 1TQCC 3FZUD 5DQDL 5IHZB 2R0LL 2GSGB 3V4UH 1JTOA 5H2BB 1HWHB 3IU4H 4OLUL 3L5WB 1OF2B 4HK0B 4P99A 2VLRE 2NPLX 5SWSD 1ES0B 2XKSA 1X5KA 4S2SA 5T1DH 1A1MA 2OQJB 1I9JH 3HKFA 1EIBA 1KB5L 1S7RA 3WDJA 4C57C 3UZVB 1I7TA 4KKCC 2HT3D 4LASH 2NZ9C 5IVZB 5T1LD 3SDXA 2WV3A 2IEPA 2XY2A 2VO5A 3BH9A 4KMLB 4P57A 4BQBA 3LDBC 1IJ9A 4MA8L 3IDGB 1GL4B 5FYLD 4KC3B 2L0DA 3QUXA 3ILQC 4R3SB 2P44B 3AROA 1RIVL 3G6DH 4HSQA 3OAZK 1V7NL 4F9PA 1D9KA 2EDDA 2XXMB 4Z7OF 2R2BA 4NQCB 1BIIA 3WFEL 4NN5C 1I7UA 3K1KC 1IAIM 4YR6A 5KW9H 4IOSD 3KYOA 5C08D 2MQ3A 4FS0A 4KY1L 2CH8A 4P5TD 1T4KB 1EERB 1TLKA 3O9WD 3CLEL 3PWJA 4UQ2B 5B21A 3W9DB 2WIIA 3BISA 5B4MD 2IPKB 1FL6B 1BEYL 4PJ7F 2CRMA 2FWOB 4PRIA 4N9GB 3G9AB 3T0AA 1S78C 1C16A 1IC7H 3FO0H 3NPSC 3SDCA 1NC4A 3MBEB 1RULH 4BZYA 3OXSA 3CX5J 4M6AA 4YHIA 3PQYD 3PL6C 1S7XA 3GMOA 3GSNB 1A4JA 3S96A 3RWDA 5I1GH 4TNWK 4LSQL 1FH5H 3CH1B 5E6IC 5B39B 1PAMA 5LAXB 3MQIA 4LCYB 4XNYL 2A6JB 2MPAH 5F9JA 1T22A 1BJMA 3RL1B 5DWUH 1A6VL 3TYFB 2NCMA 3A6BH 1MFEL 4D3CL 4L4TA 4OLYL 3RU8H 1NUNB 1FAIH 2YS4A 4C83B 5E99H 2FX9H 1N5AA 1MREH 4EBQL 4I0PA 5CKAA 2AEQH 3KWWA 2ZOLA 4G9DA 3MRRA 4KGLA 3TT3H 4I0KA 3RY6A 5HYIA 4BFEA 5J1SC 1OTUD 5HHXH 4R4BA 3ARFD 3T1WA 2VLRB 1NBYB 1UWEH 2B39A 2IC2A 4UB0H 3LOWA 3RTQA 2VN7A 1XF5B 1ZHNA 4Y89A 4KGJA 3BESR 3OTTA 5MI0C 3CFDA 4JO2H 3TBWA 4YHNB 3V52L 1FV1A 2J5LB 4JHWH 2YA1A 5T5NF 5GGVY 1OW0A 1JHKH 4CNIA 4EXPX 4JM2A 1FVEB 2F54B 1H8NA 1A1NB 3RL2A 1IAII 1TZIA 4DZBA 1MIML 1OAKL 1OCWH 2ERJC 1Q9OB 2I9LB 4KDWA 4P2OD 1LK2A 2FL5B 2IANE 1GZPB 3NFSH 5ICYA 5EBMB 4GG6F 5KG9B 3V7AG 5D7JD 3FO2B 2WSKA 1ZOXA 4K2UH 5TF1L 4YEEA 5C0RL 1YEGH 1O5DT 3MRBA 3KYKL 4ZNCD 1MCBA 2HFGH 4HFWB 5DD1L 4XX1G 1NSNH 4JCMA 4HEPG 4JANA 4NN7C 2GUOB 4N5EC 1YEHL 5HI4C 3D87B 4ODUA 4FQXC 1JHTA 3BVNB 3QQ9D 2R8SL 4DQOL 1W0WB 2O5ZH 1UM6H 4L8BB 2DQCL 4NHUA 3QIBA 4M1DL 1T7WA 3BPNC 4WENB 3FTGA 3FAWA 5FO7B 3QA3A 2VWEC 5IIEA 1CFNB 3B5HA 5C8JA 2IPUG 5GGQL 1PZ5B 4L29B 4HCRA 3LEYH 4MNQE 4KZDL 5JR1H 3O41B 1CICC 2OJEA 2NY4D 4FMFA 2WLZA 4QRUA 1FE8L 2Q8AH 4APQC 1UEMA 4QTIL 2BVUA 1EEZA 3ORJA 4PJIB 5C0NC 4PJHA 5HVHC 4LHJB 2XTLA 3TJEL 2YK1L 3X3FH 2NY2C 4Y8DC 4D9RE 1QSFA 4X6DA 4CJ1A 2VMFA 1KB5H 3TBVA 1G7HB 1QVOA 4OFPA 1VFUA 4PJBE 4PJCB 5DO2C 5IEKA 4P4KC 1N0XH 2DQTL 4MA8H 5GRVK 3M17B 3U4EA 4WFGD 3TH4T 2YKLL 4PRPB 1A6ZA 3WNNA 4J6RL 1E4XI 2FB4H 4DN3H 4GRLA 3DHMA 2GJZA 5F6HI 5C0GA 1KCKA 5F1NA 1WAAF 3OKNB 3HZYB 1JJUA 3MYJB 4O02L 4OAWB 4RGMB 4NJ9L 4F7CB 5DJAA 5IMOB 3TZVD 4UAOC 4NQTA 2HG5B 4KY1H 1MAKA 2AI0L 2OZ4H 2GYSA 2Y4SA 4JFHD 1K3ZA 2QKIA 4NCDA 4GW4B 5IMKB 3CLEH 2X42A 1BQHG 1B9ZA 1M7DB 1SY6L 3IJYB 3VGAB 3UPRA 2R1XB 2O5XL 3BRGC 1FZJA 1HXYA 4F15C 4WU7A 3P4MB 1R3LA 1MIEL 1UVQB 3TO4A 3TVMD 4PGJA 1E6OL 2IANB 3GSOB 4MXWL 3HR6A 3FRPA 4N0UA 4KHTH 4K9EC 3G08A 2VLKD 3IAQA 4I77L 2R15A 2CO6B 4QY8A 1FGVL 5JXAH 1OSPH 5HHME 1CR9H 2G75A 1I1RA 4PJ8B 5A2FA 1QKZH 1CQKA 3NACL 3KHQA 2GIYA 2EZ0C 4G8GE 5FOBA 2V9QA 4JFQB 3DVGB 3P9LA 1TTFA 1MFEH 4YGVB 2HAZA 4FFVD 4D3CH 1JWSB 4F33B 4F7TA 2C9AA 5F7WC 5AUMA 2RAMA 5D8JL 5JW4M 2H41A 5EUKA 4LSUL 2HN7B 1F4XH 4EBQH 1DBJL 1R5WB 3LIZL 4XBEL 2ED9A 4G6FB 1U3HB 4HC1L 5GZOD 3OKOB 3QAZC 3RHWK 1SVCP 4MNQB 1C5CL 3C5ZD 3AUVA 4OLZH 4XAKE 4XP1L 3L95B 4PYGA 1NJ9B 5H37H 1UCBH 1CXIA 3GSQA 5IBTL 3EOYG 3FN9A 3WIIH 2P8PB 2HYMA 2GW5A 2LAAA 3U7AA 5GRVL 3QWQB 3L3GB 5I76B 2KBGA 3V52H 4WTWA 3BHBA 3VFNB 4NC0B 3V4PH 3BQUD 4OGXH 3ULUF 1PZUB 3MV8D 1EZVX 3FQRB 2GSGA 2EXYD 3Q1SL 1U8OB 5H2BA 1XF3B 3L5WA 1OF2A 4HK0A 1CVSC 1QFWH 1ES0A 3OGCB 1QUNA 2Z4QB 4BYHA 3F7YB 4Z76B 1V5JA 4M7JL 2OQJA 5B3JE 3U30B 4JR9L 5HI5C 4X6CF 1U8NB 3S4SB 1JP5A 5DJ6B 5IVZA 1EHXA 3QXVA 4FFYL 5HHOE 1CE1L 5C09D 3IDGA 3JV4B 1YQ2A 2D0HA 4R3SA 4GUPB 4CU8A 5LWYH 3GSXB 5KVDH 1VADB 4TVPD 4CVXB 3CMOL 4NQCA 4O5LH 2VXUL 1T04B 3LQZB 4JVPA 2AEWA 3DRTB 1B0GB 2E9JA 2HT2D 4JZNB 4YDJB 3HCVB 5BVJB 3TJEH 2YK1H 2XZCL 5HHMB 3BP7B 1IQWL 4XP6L 1G7QB 1Q8MA 4NO2B 4ZS7H 4G8GB 5C86A 4BUHA 2PXYD 4J4PC 4L3EE 1T4KA 3JWOL 4Y5YC 4UQ2A 3W9DA 1NANH 2IPKA 1FL6A 4U1GC 3ARPA 2GK2A 1ZWIB 2FWOA 2DQTH 5HYFA 5E2JA 4XNZC 2YKLH 3QUZD 3VXUE 4D9QE 2K3TA 1YECH 3MBEA 5T3ZL 4RGNE 4Q97A 1WLHA 2NY3B 2XKUA 3PP3H 1YEDB 3T65B 3N1FC 4O02H 4WHYG 1DBML 3GSNA 2MQCA 3LD8C 3ELAT 3CH1A 2Y7QB 5B39A 4HUVB 5LAXA 2AI0H 4LCYA 2Z9TA 5L0QB 1TTUA 4FQHB 5KANI 2A6JA 5FCSH 2ZCKL 3RL1A 3P0GB 5DXWA 3TYFA 4P9HC 3BGMB 1MF2H 4IRSA 2BRRH 1G9NL 2O5XH 2WLYA 2IQAB 1A8JH 1KCUH 5F7EL 3AREC 3ILQD 4MXVF 2GJ6E 5D1ZC 1E6OH 1UKSA 3HMWL 4MXWH 3BKJL 3OKMB 1MQ8A 2BVQB 3DX8B 3AB0B 1CGSL 5FYKE 3WNLA 4X7FC 1V8HA 5D2NC 1FGVH 2VLRA 1NBYA 4KK5C 3S3JA 3MRDB 4OM0L 3SDYH 5ID1B 3NACH 1XF5A 1FC1A 4XCNB 1A6TB 5D7KD 5HY9B 1B4JL 2CDFB 1V3JA 3MBXL 3WFDH 4YHNA 15C8L 4PR5B 4ZXBD 3V0WL 1GGIH 4CJ0A 1FVEA 3AY4C 2F54A 3HZVB 5JZ7C 1FG9C 1Z9MA 1A1NA 2E9WA 2P43B 4U1HB 5GS0H 1FCGA 1S78D 2Q7NA 5L88L 3EZ8A 2I9LA 1Q9OA 1NFDF 5A43C 3LIZH 1MRFL 2FL5A 1GZPA 2VNCA 4HC1H 5EBMA 1NFIB 5KG9A 1C5CH 1WBXA 4ISVB 3FO2A 4OF6A 2ITDB 3PG2A 1T89C 5IVOA 9CGTA 4L8SB 4XP1H 3MLSH 1F13A 1CDIA 5AYQA 1K4DB 5EU7E 4LSDA 4KI5F 1Y6MR 4HFWA 2CK0H 5J7CC 5DUMH 2GUOA 3VG9C 4HGWB 4L3EB 3BD3A 4G7YL 1VHPA 3UP1A 3BVNA 2L4OA 1W0WA 4L8BA 4XBGB 2CSPA 3T2OA 5I73C 2NY7H 5DJZB 1EGJA 1LEKB 3THML 4HWZB 5FO7A 2HKFH 4P59L 3QNZB 2E9BA 1CFNA 3VXUB 4NFBA 1ZKAA 4L29A 4GBXD 4RGNB 3O41A 2DS4A 2VE6B 3Q1SH 4EI5C 1DBAL 4HS8L 1N5YL 1ERNA 4PJIA 4R97B 1WZLA 2Q1EA 4RMWA 5IG7B 3VWKB 5JOFB 2YHGA 3FB8B 5EBWB 4JR9H 4PP1C 2JJTC 4JN2B 2ZUSA 1AR2A 1G7HA 1QPXA 3ZHDA 1BJ1H 3MA7B 1C12B 3UO1L 3ZKXB 5ITFB 4WUUE 5EO0B 4PJCA 2ZNXA 3MZGB 3OKYA 2ARWA 1CLOL 2NMSA 1T2QH 1VEPA 5SX5K 1DEDA 3O4LE 3M17A 2H9GB 3VD4A 2AJ3B 4NQDD 2GJ6B 2NY6C 4PRPA 5F6HJ 3P4OB 4UI2A 4RDQF 1Q0XL 3FL7A 3EKCA 3HZYA 3MYJA 4OAWA 2WINB 2NY5H 4F7CA 5GJTL 1IQWH 4UZGA 5IMOA 4XP6H 1KEGL 2HG5A 4J23A 1DE4B 3RWGB 5HHNB 3JWOH 5IMKA 4GW4A 3N9GL 4FQXD 1T7ZA 1I85C 4AJ0A 1JGEB 1JF1B 2MJWA 1KENH 1M7DA 3V4VL 3IJYA 2R1XA 1KPVB 4DKFL 2WP3O 4XVSL 5GRXG 4G6AD 4RRPG 2D03L 3P4MA 4P23C 1UVQA 1CK0L 4QHKI 3WXWL 5CEZE 1X5AA 2R1WB 2IANA 3GSOA 5T3ZH 5T3XE 3KLAB 3U83A 2F5BL 1CICD 4NO3B 3RAJL 1XF4B 1WWCA 5J89A 3U4AA 2WAHA 1HH9B 3CSGA 4DTGL 4PJ8A 1O7VA 2ED8A 4OT1H 1WIOA 3BKMH 4HWBL 3DVGA 4JFQA 1N6QL 3ZDZE 2P47B 3GMPB 3E6HB 4XC1H 5DO2D 2F9BT 1G9NH 1TETH 4P4KD 4YGVA 4F33A 1JWSA 4KKAC 2X7LB 2CUHA 3TYGL 2HN7A 5E2WH 1AD9B 5BZWB 1R5WA 3HMWH 1HK6A 3RKDD 1U3HA 2QHLA 3OKOA 4MNQA 5DJ2B 3WKMH 1PKQB 2W0KA 1PD6A 1CDBA 2YD6A 2OTUB 3BO8B 4FNLH 2EDJA 3STBA 3L95A 1T1YB 1NJ9A 5DZNA 5DLML 5HHPB 5B38G 2B1HH 3QIUC 1YEFL 4XPAH 2P8PA 4FABL 1KXQE 4FQLH 3L3GA 2Z35B 3EFFB 5I76A 3D39D 4WUUB 4OBRA 3V0WH 2A73B 5GS3A 3CVIL 1I3GL 1ITBB 2W9EL 5EZOH 3VFNA 3TA3B 2IAMC 5L88H 2BVEA 3VXRD 1CLYH 1MPAL 3CSPA 4FHBD 3FQRA 4UINH 1BBDH 1U8OA 1QFWM 3MLVL 1GRWA 1KCLA 2BDNH 2DQDH 1XF3A 5A16B 1N4XL 1UWGL 3OGCA 2Z4QA 2Z92B 2FBOJ 3F7YA 4Z76A 4OD3H 1KCRL 1KIPB 1WUNT 5DEZA 5EOQL 1JTTA 3GNML 4UTBH 4ZOEA 4HF5H 1C5BL 1U8NA 5E95B 3S4SA 4RMRA 5DJ6A 5FXCH 3GHEL 2DQHL 4G3YH 2QSCH 3VWJD 4UIKL 5TQ0L 4NOFA 3L9RB 4J3OC 3JV4A 4F57L 5JMRA 1BLNB 3TJHD 4QNPF 1M1SA 4MQ7B 4GUPA 3H9HB 3GSXA 3SO3B 4K23L 2V6HA 1VADA 2KZWA 4CVXA 4U1SB 1DBAH 1T04A 1N5YH 3LQZA 4F58H 3DRTA 1B0GA 1Q38A 4JZNA 4YDJA 4Z7OE 3HCVA 3BP7A 3QISA 2N1KA 2NXYC 1G7QA 4NO2A 3EJYD 4G8GA 4Z78B 4JN1L 1I75A 3VA2C 2BHZA 3N50A 4FQPA 1KGCE 3QDGD 1U6AH 3RVTC 3QI9D 1MFAL 2NX5D 1P84J 2EYSB 4TSBL 1DBBL 3CFCL 4TRPH 4HIXH 4MAYB 4KJPC 5E9DD 5F3BB 4TTGA 5BJTB 4OGYH 4S1RH 4PJ7E 1PW3A 3BT2L 5FDYA 4PJ5D 2E7HA 1LMKA 1AGCB 1YEDA 3T65A 5T1KD 5KVGL 3KPSD 5JQ6H 2UZIH 3E6FB 4K7FB 5GJTH 4HUVA 2Y7QA 1KEGH 2ZUXA 4MGXA 5LGHL 4FQHA 4LSSL 1TJGH 4LCUB 1I1FB 2AK4E 3BEWB 3N9GH 3BGMA 4NC1E 2PW2B 5D72L 4OM1H 1U3JA 3ARRA 3V4VH 2ATPB 3S37L 3DPBA 3U48A 4DKFH 3ULVF 2IQAA 3SGDH 4KPHH 4BK5A 1J1OH 3ZO0A 5CLWA 2D03H 5DD6B 4YBLC 3BZDA 4NUGH 1JPTL 5JHDE 1TNNA 2VKXA 3HNVL 2DLIA 4R2GC 2P1YA 2F5BH 3OKMA 2X4OB 3DX8A 2IBGA 3RIAF 3KPLB 4BFIB 4LOUC 3MRDA 3H9ZA 4DTGH 5ID1A 3SGJA 3VFWB 4FRWA 4XCNA 1A6TA 4J4PD 5HY9A 4WTZA 2CDFA 3W0WD 1RI8A 3MJ6A 4MA7L 3ALWA 4G9FD 4HWBH 3ARGC 4PR5A 3WS6A 5D1XB 2K7QA 5DRXB 3SE8H 4LSRL 3HZVA 4HZLB 4FN0A 2EE6A 5DR5H 5I1KH 1E4KA 1F90H 3LKRA 4U1HA 5ACLA 2NR6C 2IH3B 1AP2B 2X4UB 3SCMC 3MRNB 1SJVA 2O5YL 1RIUL 2H3NB 2BCKB 4K8RC 1RZFL 1A3QA 1NFIA 5SV4A 3V6FB 1JZ5A 4ISVA 4K71C 2YR3A 2J6EA 2ITDA 1FBIH 2X4TB 2MNUA 4GG6E 4PD4K 4ZUVB 5MEPB 1K4DA 3RDTD 5DLMH 5DYOB 2F58L 3S6CA 4HGWA 4L3EA 3L7FB 1Q94B 4FABH 1EBPA 3MUY1 3MXVL 4XBGA 1TNMA 2ZCLL 4LLYB 5DJZA 3TBTB 1LEKA 1I3GH 4HWZA 4MHHI 3ARED 3QNZA 4Q6IC 3D2UB 4PJ7B 1BD2E 2FZ3B 3VXUA 4XXCC 1UM5L 1MPAH 3NIFF 1KT2B 1MSPA 1KYOK 3OPZH 2VE6A 1W0VB 4MZ3A 4ZOBA 5DSCB 3DBXB 3KXFD 1MEXL 5IF0B 4KQ3H 4KK5D 3CLFH 5IG7A 3UAJC 4KH2A 4TPRL 3VWKA 4OTXH 1KCRH 5JOFA 3FB8A 4QO1A 5EBWA 1EFXD 1OT2A 1F4AA 5EOQH 3SGKA 5HYEA 4JN2A 4MAUH 1EA9C 2AK4B 1H8OA 3MV7E 3MA7A 3TF7C 1C12A 2C3XA 5EO0A 5ITFA 1KN4L 4XP5H 4UIKH 5TQ0H 2H9GA 5BV7L 3MRQB 2AJ3A 2DBJA 3LQMA 5BMFH 4X4ZA 2GJ6A 1RK1B 5JHDB 1J7VR 5D6DA 1FNEB 2C4XA 1FZKB 3P4OA 3RWHB 1HXMB 1QLEL 4XNXH 3E2HB 2WINA 1YEKL 1F97A 1WAAE 5CEXB 3NGBB 3KS0H 2A9ML 1F4WH 1UT9A 3BE1L 1DE4A 3RWGA 1MNUH 5HHNA 3R1GL 1KSRA 4KRMB 4YUEL 1ADQL 1JGEA 1JF1A 2J88L 1UC6A 1MFAH 1R24B 4I1NB 1KPVA 4TSBH 3CFCH 2EH8H 3TV3H 4QHKJ 4HIEB 2XY1A 3FFCD 3QIWB 1YN7B 5EC2B 5HYJD 4DGVH 1ZGLM 2R1WA 4Y4KC 4WHCA 1MFCH 3KLAA 3EOTH 4GAJL 2LTQB 4NO3A 2Z8VC 4H20L 3TIDB 1YMMD 2YOCA 4BJLA 1XF4A 4GG6B 4GXVL 4KTDL 3QNXB 4O2CB 5IHBA 4LPUA 4J8RB 1DQTA 1MCWW 4LSSH 2VH5H 4PRBB 1SEQL 3N06B 3GMPA 3E6HA 1ORQB 4KV5F 5JUEH 3NCMA 3OKKB 2HP4A 1YQVH 2X7LA 3SDDB 1RUAH 1KJ2L 3RI5K 1AD9A 4D0BB 5BZWA 3HNVH 1XCTB 5DJ2A 2AS5M 1PKQA 2HH0L 1KB9J 3T2PA 2OTUA 1TENA 3BO8A 2ZJSL 5I6XB 2B4CH 1T1YA 1JIBA 5HHPA 4X7SL 3LEVL 4P46C 2WW8A 3CJJA 4IIQB 4K94L 5I1CL 3PE9A 4KVCL 3RGVC 1OP9A 1JE6A 5AZEH 4QF1B 3RFZC 3MV7B 4MA7H 5JOPD 1D6EB 3VW3H 2Z35A 1C7TA 2FHFA 3EFFA 4V1DD 4ZDHB 4WUUA 2A73A 3NIGF 5CILH 4I3RH 1K6QL 3QHTC 1FZMB 4O2FB 4I5BB 2DICA 2X05A 2Z0BA 3TA3A 3KJ4C 1H3TA 2O5YH 4XPFL 5IR1B 4XRCB 1NUDA 1RZFH 3IFOB 3PV6B 1LEGB 3ULUE 5A16A 1B6UA 4JRWA 5GS0C 5J06A 2Z92A 5JHLL 2F58H 5HDQH 2UYLB 1KIPA 2EXWD 1UACL 4QGYA 3RZCB 4Q9QH 5B8CB 5EU4B 4Z5RB 1KIUA 5I8OL 3QQ4B 2G60H 4RCAA 2R0ZL 1EGJH 1MCLA 3SDAC 3MXVH 4WY7L 4X6CE 4C56D 2BERA 2D31B 4PV8B 5EZIL 2ZP0T 4KKAD 5MENB 1CIDA 4ZPVB 3L9RA 4DVBB 1BLNA 4JFXB 4MQ7A 1CD9B 3ZKMC 1EZVY 3H9HA 1UM5H 4M48H 4LVNC 3BAEH 2OBGA 4U1SA 4RFNB 4OLEA 1L9MA 1WISA 3KAAA 1FO0B 3HE7B 4PLOB 4TPRH 1J1XH 3I9GL 4XMKL 2V2TB 4Z78A 1HHHB 1JV5B 4WO4B 3T3ME 3I6LD 1P6AB 3NCJL 4PFEA 3P3YA 2WQRA 4QXTB 4OGZA 2EYSA 1KN4H 4RBPH 4N8PA 1ZT7B 4HUWB 2NY1B 4MAYA 5F3BA 5J11C 5BJTA 2IAMD 4MQSB 3LV3B 1OQXA 1IT9L 1XGTB 2XRAH 1NQBA 1IGMH 2Y5TB 3VMOA 2F19L 4OF8A 1AGCA 5E2VH 3QUXC 3QFJE 4W6YB 4PREB 2VN4A 4F9PC 1D9KC 3E6FA 4K7FA 4AG4H 4HJGB 2VLJD 2FJFB 5DMGC 2VDNH 3MSPA 3V6BR 4LCUA 1I1FA 2XQBL 1XFPA 1ADQH 3BEWA 2F53E 3IJHB 4Y2OA 2OTPA 4GW5B 2LFGA 1P4BH 2PW2A 1UB5B 4CVZB 3WBDA 3BJLA 2ATPA 1PGRB 3QEGL 1QEWB 3ZYJA 2QADB 3HNSH 1VFMA 5CIPB 5DD6A 1MFBH 4A6YL 1J0YA 1WSST 2EDWA 3B43A 3MODL 5D7SL 2HLAB 4M7ZC 2P46B 4MXVE 4P2QD 5H8DA 3J8F7 4MJ6B 2X4OA 4WWKB 3SDCC 4EI6B 3KPLA 4BFIA 3BGFB 4KTDH 1WF5A 2NXYD 3CGTA 4M1CC 2APVA 3VFWA 3AFLA 5AEAA 3SBWA 2WANA 4OFDA 4ORZC 2AK1L 4G7VH 4U6TA 4XGZB 3G5ZB 3RVTD 5GGVH 4CDHA 5D1XA 5DRXA 4X6CB 2ZUTA 3T09A 3HPJB 1S5IH 3KPQB 4HZLA 4N8VG 4UUJB 5M7QA 3MNVB 2IH3A 1AP2A 2XTJD 4GMSL 4JO4H 2X4UA 5CKGA 1KULA 3MRNA 1XIWB 2PNDA 1NC2D 2DQFB 2HVKB 3KHOA 2H3NA 1AJ7L 2BCKA 3ZE2F 2QV2A 1J86A 1JFQL 1M4KA 4K7PX 3DHJA 4ONHB 3V6FA 2EC8A 3WNKA 1NFDE 5TDPB 2HH0H 4I0PC 2X4TA 4EEEA 4U0RB 1G9MH 5IJKA 3FONB 4ZUVA 1D5IL 5MEPA 4QHLB 3RY6C 5D70H 5DYOA 4JKPH 3TIEB 4YO0B 1ND0B 5I1CH 2KZ1B 1CYGA 4LP4A 5D6CB 3L7FA 4KI5E 1Q94A 4Y0GA 2AERT 3RTQC 3U0WL 2D7QA 4LVHB 1T5XB 1YNLH 4ERSL 4LLYA 3TBTA 1DLFH 1K6QH 2D7TL 5IQ7L 4IMKA 1OW0C 4JE4B 3WDIA 3N85L 4JQVA 3D2UA 4JM2C 2BY0A 2FZ3A 12E8L 3ARBD 1EUTA 3TN0B 4U1MB 3FRUB 1KT2A 3F12B 5HXMA 1W0VA 4G6ML 1QSVA 5DSCA 3QFJB 3DBXA 2LAGB 5IF0A 3TNNB 4MLSA 5JIHA 2CR3A 1A9EB 1MJ7H 5F7KC 4Y16D 3TESA 4M7LL 3BD4A 5JHLH 4KXZH 3VD9A 2DYPD 3MLTB 3C9NA 3VH8B 3E1F1 1INEH 5I8OH 1K4CB 1Y6NR 3QDJE 5TQ2H 2AK4A 3ARGD 2F53B 1VFBB 2YD7A 2FGWH 1AE6L 5FM5O 5EZIH 1U8KB 5LVEA 4B53A 3RX8A 3O6LH 4OI7A 4K55A 3T1FB 3MRQA 3TC9A 4R96A 3RX5A 3QIBC 5FYKL 1RK1A 5JHDA 2OL3L 4K8RD 3UBXI 1FNEA 4NQEE 1NEUA 4P2CG 2P49B 4XCYB 1CL7H 1FZKA 3F6LA 3RWHA 1CTOA 1HXMA 1F3DJ 3N1PC 4HAGA 1H3PL 4PJFF 3B5TA 1N59B 1A5FH 5CEXA 3QWRA 2HT4C 2WWKO 5ALBH 1HWGB 4XMKH 4GMTH 2OK0L 4X6BA 4XMLL 5AD0B 1EK3A 1OAZH 4HFUH 1KELL 1R24A 5IWLA 4GS7C 5CGMA 3ILPB 1P7QB 4OZ4B 4HIEA 3O6ML 3IFLH 2YPVL 3QIWA 1YN7A 5EC2A 4YXKH 4O9HH 3STLB 2B0SL 1NUGA 1XGYL 1OARH 1NFDB 1OP3K 2AEPH 3VD3A 4GG6A 4GRLC 1YNKL 3IDYB 3QNXA 1UXSB 4O2CA 3B9KB 1AKJD 1T1WB 4EUPG 4J8RA 1WFOA 3CXHJ 3M1BB 5CSBA 4Q9RH 2XQBH 4PRBA 2EEDA 2A83B 2OSLB 4R0LB 4BQ8A 1NKRA 1ORQA 3T0EE 5MHSD 3OKKA 1VFOA 3SDDA 3MV9D 4PRNB 3O0RH 3IRZA 4HULB 4A6YH 4D0BA 1EHAA 1TQBB 2EKSB 1VDGA 1XCTA 2IGFL 3MLXH 1CD0A 4HAFA 2FX8L 4JO1L 2W65B 3DV4B 4HXAL 4M6NL 3QUMB 3LEXB 5DHYB 3GJFB 2Z31D 1AY1H 1HHIB 4IIQA 4NGHH 4LIQE 5LQBH 2H2PC 4HD9A 1DQJB 4QF1A 3QDJB 3UZEA 3MV7A 2VDPL 5F97E 1D6EA 1DQLL 2COQA 3HMXL 3F58L 4ZDHA 1SVZA 3MYZA 4GLRH 4HWNA 5TJWK 5CMAB 1FZMA 4O2FA 4I5BA 3QRGL 1S5HB 2CJUH 2XKNB 1YEIH 5IESL 1S7QB 1FAKT 1UYWL 5IR1A 5ISZD 4XRCA 4NQEB 3IFOA 3PV6A 1LEGA 5GS2D 4LL9A 4XPGH 5K33A 4PJGE 4QXWA 4KJQC 3FN0H 5LBSH 4OV6F 4AEHL 3NH7L 5D1QB 2BX5A 5KVEH 4LLAA 1WAAA 4KTEL 3BI9X 3O8XB 2OLDA 3H3KA 2NW3B 3WO4B 3RZCA 2UYLA 1I8IB 5B8CA 1WITA 5EU4A 4Z5RA 3QQ4A 2XZAL 3DGCR 2N56A 3HG1E 7FABH 2QHRH 5I15H 4ERSH 2D31A 4PV8A 4P2RE 1MQKL 4FQCH 5MENA 5FUCE 4ZPVA 2D7TH 2X1OA 4WDIB 3O11B 4DVBA 2N7BA 4JFXA 4OZFG 1OT1A 12E8H 3MCG1 4UNTA 3WD5L 2MQ0A 4QNPE 2VKWA 1MVUB 1FO0A 3HE7A 1YYLL 5F1OB 4Z7NF 4M7LH 3LN5B 3SJVE 4CMHB 2V2TA 3CX2A 4ZD3L 1HHHA 1JV5A 1U58B 4WO4A 4EQ3A 3F6IA 4ONFL 5GS2H 3IS1X 4H1LG 4NDMB 4G8FB 4QXTA 4GQPH 1H3UA 4OV5B 1CF8H 3T0EB 4PRHD 1YC8A 1ZT7A 4HUWA 4X4ME 2ZSWB 3V7AE 3LV3A 5FYKH 2VDKL 4OZHF 2OL3H 2Y5TA 1NBVH 2AEIT 4ALAL 4W68A 3ZHLA 3RPIB 1VGEH 4S11A 2YN3A 4PREA 1QBMH 2XOTA 4XX1E 4S1QH 1C7SA 5CBAB 3K3QA 2P5WD 4HJGA 4N5UA 3VXME 2FJFA 2EDBA 3KPMB 2OK0H 3OB0K 4Y4HB 4XMLH 1QFHA 1CU4L 1SMOA 3BP5B 3IJHA 3SDAD 4GW5A 4JPKL 1UB5A 4WFHE 4X6FB 4CVZA 3EJJX 1MY7A 3MRGB 2CDGB 3RVXC 4EN3D 1QEWA 1FPTH 2MHAB 2GKIA 3IETB 5CIPA 3O6MH 2YPVH 3QQ3B 3ULVE 2B0SH 2AV1B 2HLAA 1RVFL 4MJ6A 1OAXL 4WWKA 4S0SD 1N0LA 4EI6A 1A2YB 1NBQA 3MBEC 1YNKH 5TDNB 3ZT6A 1VGKB 2X89D 4YHML 2YD1A 1NCNA 1VACB 3RVWC 4HS6B 4JB9L 4QRSB 4XGZA 3G5ZA 2R1YB 3OJDB 3U7YL 4X6CA 2M2DA 3HPJA 4X98B 4P2RB 4BZ1L 5HDBF 3U9PL 1AR1C 1HHJB 4UUJA 2KDGA 3MNVA 1LD9A 4X9IA 4NRZB 3TLRA 4IRSC 1XIWA 1AO7E 2DQFA 5FYJU 2HVKA 4D94A 2YRLA 3C2AH 1HYSC 2W9DL 5HD8C 4Q9BA 4ONHA 1OLZA 1T0MA 4HIIB 5TDPA 2FX8H 1A14L 5E6YA 4S1DC 4M6NH 3FONA 4GRMB 3HI5L 4QHLA 2E27H 3TIEA 4DGIL 1LP9F 3SJVB 1P9MA 4YO0A 1ND0A 3GO1L 1I1YB 1QLRB 1WCBB 4DEPC 5D6CA 2VQ1B 3HN3A 5DD3L 1I7RB 2VDPH 3U6RB 5L6YH 1T5XA 2B4CC 5C07E 4AT6B 1HKLL 4WI2A 4HUXB 1A7BA 4EXKA 3DXAE 4Y1AE 2WWMC 2ZZUT 2J5LC 3QRGH 3RWIB 4L3CB 3MO1B 2C3HA 2PETA 3M45A 4NZDA 1P7KB 4PRID 5IESH 3C08L 3TT1L 4J3UA 4OI9A 4U1MA 1CDUA 3PXJA 3FRUA 2AJUL 4POZD 3TN0A 3F12A 3EBAA 1WQVT 1RZ7H 4C4KT 4ZFFB 4YHLL 4FP8L 3NIFE 4LSVL 4AEHH 3TNNA 4YDKL 3NH7H 1YJDH 1A9EA 4KTEH 3A6CL 3HRZB 3QO0B 3H42H 5HGHB 4M1CD 3VXMB 3IFNL 3MLTA 3VH8A 1U9KA 3G6JF 1K4CA 1NCAL 4H26B 2F53A 2XZAH 5A40E 3QP3A 4MS8C 4WW1B 1VFBA 3AU1B 4P4RB 2NTFB 1U8KA 4W4NA 2V5YA 5CEZH 5T3XH 1Q9KB 3VFTB 2NLJB 3PP4H 1NAMB 4X8JB 1JGDB 2RR3A 3UPCA 1WFTA 3LPFA 3WD5H 4XCYA 1M6OB 3CK0L 3HHRB 2JJSC 1K85A 1A6WL 3LS5H 3VRLF 3VMPA 4JHZA 1YYLH 1N59A 3CDCA 2JCCF 3A67L 4G6JL 4NNYB 3G6AB 4BA8A 1NCBL 1A1OB 4ZD3H 4DGYL 1GIGH 4WFEE 4ONFH 4XVTL 5AD0A 3B2VL 4J3SA 4AEEA 4D8PB 1NKOA 3SPVB 3UJTL 4PTTB 3QYCA 3ILPA 3BDYL 1P7QA 4OZ4A 4K3JL 4JM2D 4Y19D 3STLA 1AO7B 3VJ6A 2CUIA 2VDKH 2XACC 4M5YL 5BZDB 3EFDH 2HMIC 2ZPKL 3FB6B 4PJEF 2B2XL 1WTGT 1EX0A 1NFDA 2GTWB 2XYCA 5DC9B 3HUJF 4OQTA 3MMEB 4DFHA 2WBJB 5L2KD 5IROA 1TJHL 1UXSA 3H6JA 3ZT7A 3B9KA 1T1WA 2W0PA 1ZXQA 3M1BA 1QQDB 1BQHB 3MACL 4RGMC 5MERB 2A83A 3L5XL 3D85D 3GMRA 4JPKH 4R0LA 3SE9L 5IHUL 3X14B 5C07B 1ZLSH 5DMYA 2JIXD 3CZFB 2OS7A 1Z6JT 2BNUB 4PRNA 3DXAB 4Y1AB 4KV5E 4KXZI 3VGAC 5JIIA 4M4PA 1FQ9C 4DK3A 2AJVH 4ZSOE 2CMRL 1RMFH 5K9JL 4LU5H 5SWSE 4OLWL 1TITA 2EKSA 4XWOC 1OAXH 2W65A 3DV4A 4M6OH 3QUMA 3LEXA 5DHYA 1DVFD 3GJFA 5DD0L 2M26A 43CAB 1PG7L 4FTVE 4YDIH 2HT4D 3C2SA 3NA9L 1HHIA 4Y4FC 3FMGL 4B50A 1NLDL 5DD5H 3VRJB 5K9KA 1NGPH 1DQJA 4P0DA 3R06B 3QHZL 1MCSA 4PJ8C 3QDJA 4R8WH 1JI2A 2XZZA 5FYLE 2Y36H 4JB9H 5JLZB 5DURB 3KS0J 1X6NA 1RQ5A 4AMKH 3R8BB 3U7YH 2BOCB 4CN1A 4BZ1H 5CMAA 3NCCB 4W6XB 2DDQH 5TFSL 2ZCHL 1S5HA 3NIGE 5HHVH 4HMEA 1EJOL 2XKNA 4WRLA 5F72S 5I1HL 1JGLL 4HKXB 1S7QA 5FGBC 4UTAH 5C08E 4U05A 3C6LB 4NQEA 2DKUA 4LKCB 1FGNL 1VSCA 1IRAY 2D2OA 4GRLD 5D1QA 1U3HC 3IJSB 3O8XA 5ACZB 5EIVA 2NW3A 3GO1H 1SBSL 5FUZH 3B9DA 5JPMB 1I8IA 1BIHA 3QXUA 4UBDC 4R4FH 2EH7L 1SJXA 3HC3H 4A2MA 5DEFB 1G9MC 3WIHL 2ZUQB 4ZUUB 4Y2DB 4MDJB 4LFHD 2I26N 1NCTA 3QHFH 4IRJB 3O11A 4WDIA 4XI5D 1CGUA 4ENEC 3PQYE 3WHE0 4EVNB 4X5WB 5TE4L 3TT1H 3AM8A 2AJUH 2X4SB 1BM3L 3VDCA 1MVUA 4NUJB 5C7XL 3L3HB 3IDXL 4YHLH 4FP8H 5FKAB 4LSVH 4EQ2A 5EG6C 4FQIH 5F21B 1NL0H 3A6CH 5C9KA 4NO0B 3IFNH 4HS3B 1NMCC 3VXNB 1U58A 1R0AL 5E7BA 2YA2A 3H3PL 4D9LH 1AHWB 2PO6B 4KQ4H 2QL1A 4NDMA 4G8FA 1Z5LB 1D5MB 1ED3B 3U30C 2FSEB 3F5WB 3WUZA 4OV5A 2NY0C 4HHAB 3T0EA 4MCYB 4NHCL 4NZTL 4MJIA 1FIEA 1OD9A 3C8HA 4KRPB 1UQSB 5F1SA 2ZSWA 2YMXL 4NNPL 4ZSOB 2OR7A 5EOCL 5SWSB 3HNTL 3WN5B 4YXHH 5DT1L 4WI8A 3CK0H 3RPIA 1A6WH 3PHQB 3GMQB 5ITBL 5CBAA 4FTVB 3A67H 5CINL 2CIIA 1DDHB 4GQ9L 1J0IA 3KPMA 4KK8C 4YX2L 5A2IH 5I1EL 3BH8B 4Y4HA 5IT2H 4XVJL 4XVTH 3BP5A 3B2VH 3KPRD 5F7HA 4X6FA 2ICWI 5HYQB 3G9VA 3MRGA 2CDGA 1U8MA 3Q2CA 4JKWA 4FFZH 1X5ZA 4TOYH 3GKZA 3KYMB 2MHAA 4LAJH 3IETA 3S37X 4XPTL 1CBVL 3QQ3A 5L8LB 1NDMB 1EMTH 2AV1A 4M5YH 4RX4A 3MUHL 4JFEB 2B2XH 3PNWB 1AC0A 5HPMB 4RGOL 3BWUC 4E41D 5E8DH 4P5TB 1A2YA 3QDAA 1FSKB 1RUML 3F7PC 2J7LA 3O9WB 4RISL 5TDNA 1ZT4B 1DTUA 3KJ6H 1KIRB 2NY3C 2QR0B 1VGKA 1F5WA 1VACA 3MLZL 5CZXC 3AC0A 4HS6A 5FHBL 1LK3H 4BSJA 4QRSA 4XWGL 4GAYB 3SE9H 2EE3A 2R1YA 3OJDA 5L0QC 1A64A 1ACYH 1FFRA 5HTSA 4X98A 4P2RA 3QWOB 3R8QA 3H8NA 1HHJA 4N68A 6FABH 4NBXB 5C6WH 2VB5A 4JFYB 3GZKA 1S8DB 4NRZA 5IBUB 5HI3C 3WXVL 4PLNC 3PQYB 1PVHA 4OCMC 5CGYC 3CFJB 1PSKH 2HWZH 2ZUYA 3QEHB 4HIIA 4R4ND 3R4DA 3ZE2E 1SYSB 2Q6WB 3VU2A 5DD0H 4GRMA 3NA9H 3SJVA 2YC1B 1E27B 3I3BA 1BZQK 1I1YA 1QLRA 5J13B 2VAAB 5D93B 1WCBA 5FGCE 2ZKHH 2VQ1A 2X9XA 2Q3ZA 1NMBL 1IM9B 4WFGE 1I7RA 3U6RA 3SGJC 1SQ2N 2CDEB 4UQ3B 3RVXD 4AT6A 4HUXA 1HILB 5LXGL 4X4MA 1L0YA 3WS6C 5TFSH 2X1QA 4JPVL 3RWIA 3JTTB 3MO1A 5IOPB 1VEOA 2D3VA 2DJUA 1P7KA 4I3SL 4K7PY 2GFBB 5I66B 3E3QE 4ZFFA 4JFHE 3VCLB 1PX3A 5HGHA 3HRZA 3QO0A 4WV1B 1A3LL 4PRAB 3VXMA 1SBSH 2KPNA 3MLRH 2KKQA 3RWCB 5I2IB 4NQXB 2APBA 3MGTB 3VFGH 4H26A 4WHTB 4WW1A 3HFML 5SX4H 4OKVB 3WIHH 2UY7A 3AU1A 4P2OB 5L8KB 4P4RA 2NTFA 4P9MH 4W81A 2XA8H 1KB5B 5D7JB 4YAQB 3PDGA 1Q9KA 3VFTA 2NLJA 2VLKE 4IRSD 1NAMA 1AQKL 4X8JA 1JGDA 4HIHB 1HYSD 4M43L 3SQBA 1FO0H 4U6YB 1OB1B 1M6OA 5JXEA 3IKKA 1BM3H 3MUZ1 3CU7A 3IDXH 5EU6E 1AXTL 4TQEH 5HSFA 3P77B 1MI5E 4NNYA 2AGJH 3G6AA 4PJFE 2I27N 4GH7B 1X5GA 3O3AB 4R97C 3BSZH 3W11C 1A1OA 3GM0A 1R0AH 1RZKH 3QCTL 4BUGA 3VWKC 1AGFB 5HJ3B 4D8PA 5AG8A 4HV8B 3SGKC 2NYYC 3SPVA 1IGFL 5BCAA 4PTTA 3OJMB 4NHCH 3WLWC 4GJTB 1IGTB 5JTWA 3RUGF 3ZKXC 1I9RH 2YMXH 1AO7A 2F54D 4NNPH 2ICEB 3MLPA 3RKPA 4AL8L 5EOCH 5BZDA 2YRPA 1NMAH 2WIMA 3FB6A 4NZUH 1ZLUH 2GTWA 3LN9A 3C60B 3G5XB 5D6DC 3FQTB 3IRPX 3MMEA 2WBJA 3ZMRA 5ITBH 3GIZH 2EDLA 2HJKB 4FQ1H 5E4IA 4Z7WF 5JW3H 4YX2H 5FGCB 1DLHB 1TJIH 4OCRH 1A0QH 2F8OA 3MJ7B 1QQDA 2ARJQ 4JVWA 1BQHA 4MQXD 3VI3F 4MS8D 5MERA 2DM4A 4PB9L 5E8OB 3X14A 3BPOB 3VXOB 5C07A 2OCFD 2DJ4A 1J0ZA 3CZFA 3MV8E 4PS4L 3BIBX 2BNUA 3DXAA 4Y1AA 4L4VD 3ROLB 2DIAA 4B7LA 2VDLH 5FM5M 4EKXA 1BQSA 1FCCA 3I50H 3VFUB 5I18H 3TZVB 4RGOH 2VAJA 4KRNA 2B1AL 3VD5A 1KJ3H 43CAA 4RISH 3C09B 1HQRB 1BQLL 3B2UC 4WI5A 1A3RL 2V17L 3VRJA 5C09E 3R06A 3GKWL 2H2SC 5FHBH 5JLZA 1F8TL 5GGTL 3TVMB 2PYFB 2DKSA 2J2ZA 2BOCA 2A2QT 1L7TL 4TVPE 3BN3B 3A6OA 2VLKB 4HZAA 2YA0A 5IEHB 4HKXA 1YY8B 2HMID 3C6LA 5E4EB 4LKCA 2YD2A 1MAMH 4PRPD 4WCYL 4HKBB 5B38B 4QXUH 1Z3GH 4OQ1A 5EU6B 5DK2B 3IJSA 3ARSA 1MI5B 3NPZB 5ACZA 4XHJD 3X12B 4EOWL 4PJFB 5JPMA 1MELA 1QHPA 1XAUA 4YHZL 1KLUB 5DEFA 1RJCA 1IAKB 4G8IB 1A7NH 4ZUUA 1KCSL 3CDFA 4Y2DA 1BBJB 4HGKC 4MDJA 3CSYB 3C5ZB 2FIKB 4IRJA 2DI7A 2H6PB 1T03H 5CSGA 4EVNA 1CGTA 1FP5A 4X5WA 4ZTOL 5AYUH 2BVTA 3FT2B 2X4SA 5CJOL 3EO9H 3TA3C 2FJGB 4NKOB 1E0OB 4NUJA 3L3HA 5FKAA 3QUYD 3P73B 2IH1B 4MA3B 1IZJA 1I9IL 4Y4FD 3A0OA 1A3LH 4NO0A 3ZDYF 1HE7A 3SKOB 3CPLB 4HS3A 3VXNA 4Z7NE 1GCFA 1AHWA 3QPXL 1BFVH 2PO6A 4C58B 2OTWB 4L5FL 3BQUB 1Z5LA 3HFMH 1ED3A 4PJBF 4LMQI 2FSEA 1YJDC 1ZVSB 3F5WA 1IL1B 4HHAA 4MCYA 3MV8B 1G7JB 5KSAD 3CFKB 1ZHLB 1F4HA 4JDTH 1UQSA 5D7LD 3RBSA 1N64L 4ZSOA 4MA1B 5SWSA 1FYTB 1FNFA 3WN5A 5FIEA 3VDBA 1H5BB 1KOAA 5AZ2L 4OZHE 5D7KE 3IDUA 4LF3B 3SO3C 4G6FD 1U3HD 3JV0A 3PHQA 4LEXL 3GMQA 4MNQD 2BVPB 3DYOA 4FTVA 1WK0A 1DDHA 2AJYH 1UKTA 2YD4A 3BUYB 5I1AB 5C1MB 3BH8A 1F02I 2ZUUA 5C09B 2BHUA 3QCTH 3R0MA