43CAB

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 117
sequence length 117
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caB00
4PV8A 3QIBB 4RRPG 1DVFA 1UB6B 3IDYB 4KDTC 1VFBB 4ODWA 4Z7VB 5LGJB 1MELA 3LH2L 4HKZA 1G7LB 3VXMD 3JTSB 4H1LB 3PQYD 1K85A 5DRNA 3LKQA 5E9DB 3GIZH 1MFCL 4RWHA 2XWJA 3HNTL 3MBXH 4F8TA 5F7NC 2UY6A 7FABL 4NIKB 4PGDB 5KVEL 1KNOB 1N64H 4TRPH 5AYUH 3QEQB 3LRHA 1OP5K 1DBAH 3MXWL 5E2JA 5I76A 3QXDB 2GAZA 5CWSA 1L9MA 2XICA 3LN4B 5CD5D 4M1GL 5I8KL 4S1RL 4J2XA 4JN1L 1IT9L 1BPVA 2VQ1B 1PKOA 1WISA 3L1OL 5B8CA 1JI1A 1GPOL 1HSBA 4OLYL 4AIZB 5I18H 5E8EB 3DI3B 5C0CE 3T0AA 5LGHH 4YHIA 5DUML 1IGJB 3OB0H 5HSFA 1GGIH 1SYVA 1NGZB 3QNXB 4XP6H 4L3ED 2CDEA 4Q7DA 1LVEA 5JQHC 4RMVA 2YPLB 4KMLB 3T0WA 1QUNA 1MFDH 1EX0A 1G1YA 1N59B 1J05B 1YEEL 2H1PL 5DSCA 4FQIL 4YDKL 2VZVA 3S36X 4GW5A 4OCYH 1CE1L 2EC8A 2JJTA 5C2BH 1MJUH 3ARXA 1LE5B 1WZLA 4RDQF 4XH2B 4Y5YB 4QF1A 2NW3B 1ZHNB 1YEGH 3AY4C 4DFIA 3T1FB 1IM3A 4U1JA 4XHJD 5BV7B 4XHJC 1Y18A 2NY0B 2BNUB 3DJ9A 4O9HH 1IAOA 4IIQA 5KANI 1HINH 4L8BA 3WYRA 3BKYH 5J1SC 1G6RA 3HE7A 1F8TL 4HCRL 3W0WD 5T1KA 5IFHH 2DKMA 3VI4E 1S7VA 3BXNA 3P3YA 1H3WM 4HKJA 3PGDB 5C2UB 4Z78A 1JNLH 1RUAL 2IF7A 1J5OL 3ALXA 4GAYB 1E6OH 3IFNH 4QHMB 3L3IA 4RZCA 4JDZA 4I18B 5T5NF 1YMHB 5HYJB 1ORQB 5ISZA 5DRXB 4ONHA 1HDMB 5I73C 5L8LB 4JM2A 4HWNA 1FAIH 4KMTH 4QHUB 4N9GA 5IIEB 1MCCA 1IAKB 3HN3A 4Y5XB 2R0KL 2W0PA 3V0VA 3CXHJ 1KJMA 5EOCH 3P4MA 3DX8A 3R8QA 3RZWA 3ECBA 5C08A 1T0MB 4R8WH 4HLZH 3U9PL 2XTLA 2ENYA 2PR4H 4N0UE 4HJGA 1F97A 4X5XA 1QVOA 3VXSE 1DVFD 1CL7L 4U6YA 1DVFC 1H3TA 3RL1B 4AG4L 5A1AA 1J1XH 1G0XA 4MAYB 1LDPH 4JJ5B 5HHXL 2GFBB 2HJKB 3BEVB 4JFYB 4H1LG 4RAVA 3OKLB 2JJSA 3FQRB 4EDXA 4LL9A 4JFZL 1G7JA 4AZ8A 1UXSB 2LU3A 2IH3A 2X41A 4FXGB 2CK0L 1S7WB 1DE4B 2PTUA 1RU9L 4S1QH 1EHAA 1OAXL 4RMSA 3QHZH 3FQWA 4MQ7B 4OV5A 3HFMH 4HC1L 3OXRB 5FHBH 1WFTA 3QWOB 4Y8DC 2LU7A 4NRYB 4J3XA 1RIHL 5B8CC 2Q76B 3BP7B 2WWKO 2J4WH 1JBJA 5JMOC 4HS8H 2AS5M 1S7RB 5HHVL 3MMEB 5D7JD 4TUOA 5D7JC 1JYNA 3HB3D 4JB9L 4WI2A 2HG5B 3HB3C 2X7LB 4YUEL 5F7EL 2VLKB 5DJ8A 1QLEL 4ZUTB 1A3RL 2V9QA 4TTGA 4TSCH 1VADB 1OP9A 3BRFA 1UACH 1AE6H 3PP4L 1T66D 4NCC1 5FGSA 3KYOA 3TA3A 1OAYH 5E99H 3W2DL 1EPFA 3S88L 2AK1H 3R06A 5IK3B 4DZ8B 5CEZD 4JDVB 2CH8A 4K7FB 4OSUL 2JJTC 3WHE0 3LS4L 1IMHC 4YHOH 1JPTH 4JQXA 1ZV5A 1RPQA 5DD5L 4BSWA 4MNQE 3I50L 2BSSA 1A6VL 5EN2A 3WDIA 1QACA 5CIPH 4XAKE 5B4MD 1DN2A 5C09B 3U7YH 5B4MC 4IIQC 4JFEE 1I3VA 3HE7D 2RFXB 4TVPL 3HE7C 2DLIA 5B21A 5T1KD 2QADD 3I6LE 3QEGL 4BUHA 2QADC 2NXZD 1MI5A 2AABL 2NXZC 2AV7A 3MGAA 4X6CA 3QXAB 3NZ8A 4DQOL 4OKDA 3EYUH 2AJXH 2AJYH 5A43C 1H3XA 2F53A 2HP4A 2VDKL 4C83A 5CLTA 5ISZD 1ODAA 1BQHA 4JM2D 3L7EB 4X0KB 4NZDA 4U7KA 2PXYB 4JM2C 4KHTH 3CFJA 1Q9OA 4OZHB 5GGUB 1WICA 4G8IA 1NQBA 5HHMD 3K0WA 2AJUH 4G9DA 3PJSB 4DEPB 5C08D 3IS0X 3UJJH 4G42A 4W6WB 1P84K 4WENB 1A6TA 2FEEI 4U6XB 1XZ0B 5HGHB 1X5ZA 1HE7A 5I75C 3RJQB 2XFXB 1I7RB 3NFNB 5FYJU 2G5RA 3QISA 4Z95L 2EEBA 2V5TA 1UZ6E 1FVCA 4Y19B 3L6FB 4JY6B 5IB2B 1Q72H 3QUML 4QXTA 3IFOB 1MFCH 4V2CB 3RWFB 4G6ML 1ZVSB 4PBVC 2JJSC 3U4BH 1NC4A 1XGYH 7FABH 1GGCL 5FO7A 5KVEH 1AI1L 4WIQA 2ZUTA 3MSPA 3SKUD 3JWOL 2V5RA 2H9GA 3BMWA 2IBZX 3IJYB 5EPMB 1ZGLB 4WFFE 2FGWL 1AGDB 4M1GH 3G5VA 3MLRL 4JN1H 1IT9H 1RJYB 3ZTNL 1GPOH 1RUPL 2XQBL 5F3HB 3SGJA 5C6PB 2OR8A 5DUMH 5H2BA 1WWWX 4LDLB 4NDMA 1PX4A 2YZ8A 4WHYG 4X6BB 3V6BR 3P73B 2N1KA 3OGOE 3F7PC 2ZKHL 2JIXB 3OR7A 3MLWL 5CSZA 2FEDD 1KB9K 4FZEL 2FEDC 2QR0A 3K2UL 4LLWA 3O3EB 3B6SB 4FQIH 3ZL4H 4YDKH 1WZ1H 3TA3D 4PJEA 4GMTL 4U1GB 1CE1H 1S9KC 1A6AA 4YEEA 1CN4A 2VISB 4QNPF 2YD9A 4YK4C 5J57B 4HULB 3AGVA 3T3MF 3H7LA 4LU5L 5E7FA 2J88L 2P44B 5EO9B 1QPXA 4OCLC 4WU7A 4ZSOB 5BV7L 1J0KA 4W4OA 3B9DA 3BP4A 3ARZA 1T2JA 3I9GL 1TXKA 5CJ5A 4Q2ZB 3TF7C 5HYQA 3D0LB 1RZ8B 4K7PL 3SDCA 4HXBL 1RUAH 3NFPA 2F53D 2UY7A 2HVJA 4P2OC 3H0TA 1DR9A 2BSRB 4P48A 43C9A 2E8ZA 4OD3H 3D0VB 2I07B 2YD7A 3EYQD 3ULUD 1FVEB 3EYQC 3ULUC 4ISVB 3S97C 4KRNA 4I0CC 3HUJA 3ELAT 5JO5B 4K3GA 4LVOC 3U0PA 4WV1B 4WCYL 3F7RA 4WUKL 3UO1L 1HHIB 3STZA 2ED7A 1CL7H 4Y1AA 3P30L 1AXSA 2MTPA 1E4XH 2WQ8A 3MV01 4RFOH 4P46B 3ULVE 4P2QA 5HHXH 1HHJA 3QEHB 2KZWA 4V2BA 3H7BB 4JFOA 4OLXL 3RGVC 4AT6A 5DDHA 4ORGB 3N1GC 3OKKA 1F3RB 5DQJA 4JFZH 4EZMA 2CK0H 2X40A 3TO4A 1RU9H 2DMKA 4PJCF 4V1DE 1OAXH 4YE4L 3W9DA 2EDTA 3DX7B 1KLGA 3NACH 5BS0B 4HC1H 5ID1A 4LPYA 4DTGL 2IAMD 5DGRA 2IAMC 1RIHH 1NSNL 4NWTL 3SGJC 4LLVA 2UZYB 2D4FA 4PG9A 2BDNH 3KLAA 2NY6D 5EORL 3PHOB 2ZJSL 2NY6C 5HHVH 2L7JA 5F9JB 3RX8A 1HHGB 3S5LB 4YR6A 1B4RA 4JB9H 4R7NA 3KLSA 3CC5B 3VFNA 4YUEH 5F7EH 1GIGL 1QLEH 3OZ9H 2VLLB 4WI6A 2FB4L 4P3DA 5F72S 4KV5E 1UCBL 4ODXB 1URLA 2X4OA 1MPAH 3PP4H 3SE9H 4R96B 1YC7A 4JGUA 2J8UE 4QHLA 3WDHA 5JNYA 4NFBA 3S88H 1BVZA 3TNNB 1Q0YH 1GXEA 1UJ3B 3IFPB 4PRIB 5MERB 2YD8A 3AU1A 5F7FA 3RWDA 1K2DB 2WLYA 4G6FB 5TDOA 3WIHL 4H0GA 2CO7B 1D5XA 2R4RL 3I50H 1BGXL 4JKLA 1IFHL 1A6VH 3JSSA 3LRGA 2YWYA 2BK8A 4W4OC 1JHTA 2YZ1A 1VCAA 5B38B 1MHCA 4MMZC 5FV2A 4TVPH 1TETH 3HZKB 5L9DL 1G0DA 2Z35B 4ELKB 5DVMA 1FG2A 3QEGH 3VG0L 4UV7L 1WT5A 4X5LA 3SDCD 2JK5A 1JV5B 3MRRA 3O41A 1C7TA 5CKAA 4NO5A 3SDCC 1NDGA 3VH8A 2OMNA 3CH8A 3FQXB 4PR5B 4XXDB 2F54A 1Q8MA 2GSGB 1OVZA 3VFPA 3TWCL 3KPNB 2VDKH 5IJVB 4JQIL 4X9FA 4BH8A 1TZGL 3OAYH 5SV4A 1L0XA 1EIBA 1KV3A 1CLOH 2IPKB 4NQEE 1WIOA 4HIJA 2NZIA 4F37F 4PD4K 4HWEL 3VFRB 1JMXA 4N9OB 1X5IA 5D1XA 3O9WA 4R26L 5JPNA 4PRBB 1F3DH 2YMXL 4Y1AD 4F7EB 4M6AA 1L7TL 1A14L 1IGYB 4DN4L 5ITBL 1R3JB 1U8OB 4L4TE 2ZP0T 2WBJA 3GKWL 3RP1A 4P2QD 5MEOA 1EEZB 2F58L 1ITCA 2R4SL 4Y16A 2C3VB 1QRNA 2X1OA 1S7QB 4H1LH 1N2RA 4G6MH 4JJHA 1NCTA 5T3XE 5IB4B 3GUTA 3KHQA 1DSFH 2OTWB 1GGCH 2YK1L 3TO4D 1A2YB 4ZG1A 3TO4C 3JWOH 2AGJH 2NCMA 4RDQG 2VTFA 4HSQA 4EQ2A 25C8L 3HE6A 3UROR 2QSTA 2ARWA 2FGWH 4LP4A 1KPVA 1DQJB 3ZTNH 1O5DT 2FX9H 2KBGA 1OP3H 1KPUA 2EKSB 3BD3A 3ILPB 1WAAA 4F33A 1WBXB 4GKSB 1DBBL 1S7SA 1BD2A 3L5HA 4NSKB 3K4DA 1CFQA 3VRJB 3S5LG 4PB9L 2Z8WC 3AREB 2DLEA 2A83A 5C6TL 3ZKMD 3MRMB 1NH6A 3ZKMC 4FZEH 5T5NG 5D71L 3KAAA 3E3QC 3ABZA 3VXUB 2FSEB 1PVHA 3KXFA 3LKRB 1EO7A 1D3CA 3BIBX 3Q6FA 4YDIH 4D9RD 4GMTH 4LVEA 4QTHB 1VENA 4KKCC 4JRXB 4O2CB 3HRZB 3ARVA 1DBKL 3PGCB 4MNHA 1F13A 4LU5H 3OAYK 2J88H 3ISWA 5DRWB 3TBWA 5HGAA 3T4YA 4Y89A 1FDLL 3RVXD 2FBJL 1HQRA 2XTJE 5C86A 5H8DA 5BV7H 2GI7A 4XRCA 3WUWB 1DN0A 5FA4A 5B38G 2ICEB 4BKLA 4ZS7L 3I9GH 4KKNA 1F6AA 4NQSA 1WT5C 4PJIE 3BMVA 1CLCA 4PLNC 4K7PH 4KDVA 4DCQB 2BNQD 2F54D 3FN9A 3S96A 3TPKA 5F7DA 2FJFA 4OD1H 3WNKA 2CLZB 3TVMA 5D7LA 4QRPA 1V7NL 5FYKD 2D9CA 4MCZB 2VERN 5BMFH 2Z4QA 4MB5A 4YXHL 4K71C 1PQZB 5D96C 1A9EA 4NQDA 4M00A 1BOGA 3RVVD 5TF1L 4R6UA 5D6CA 3RVVC 3D5OF 2VKXA 3GSUA 3AVEA 5DJDB 1I7ZA 4L9LA 4QLRA 5D1XD 4RMRA 3O9WD 5L2KB 5D1XC 3O9WC 4F58L 4ENED 5EU6E 3L9RB 3CDFA 4ENEC 4ELMB 1AQDA 2QQNH 4CAGA 4CU6A 3I75B 3QIUB 2RCSL 1R3HB 1F58L 2WBJD 5DEZA 1RK1B 4CDHA 2WBJC 5EU7E 3E1F1 3N50A 1DTUA 4K7PY 4Y16D 2EIDA 1QRND 4Y16C 5FUZH 5JLZB 2ZUQC 3QUYB 3ZDXE 3S3JA 2FD6H 2NY2B 4J6RH 5HHOB 4N8CL 4G9FB 4NO2A 4OFDA 3QI9B 3PG2A 4YE4H 3PWVB 2OJEB 2BCKB 3HE6D 3SDDA 1JHLL 3HE6C 4DTGH 4M62L 3UPAA 2YUXA 1TZIB 4Q6IB 4HUWA 1CZ8L 3WL9A 1OAKH 1NSNH 1U92B 2E9IA 3NH7L 6FABL 1IQDB 4NZJA 1MCOL 1YZZA 5C0AA 4M3JA 1F11A 1KG0B 1S9VB 1G7PA 3JWDL 3LKPB 1BD2D 3MRBB 5DHYB 5JUEH 3KPRD 4UMGA 5KBNC 3SGEH 5JDJA 3QNYB 2QJDA 3JV6A 5AD0A 2DQUL 5MENB 2EEDA 1GIGH 3GJFB 4YHLL 2FL5A 1V8HA 3IDXL 5INDB 4EKXA 3KXFD 1QBLL 1UCBH 1CXLA 3PWLA 5F7YC 1NEUA 1YPZA 1DZBA 5E95B 2DM4A 1SJHA 3DUSB 5E8OB 3MJ9L 4QRRE 1VEPA 4OZGA 1X9QA 5JHLL 4OCMC 4I8DA 5I15L 1PG7L 1W72B 2XACC 4CW1A 3T0EA 3WIHH 3L5XH 5ICZA 4AEIL 1OB1B 2R4RH 4PJBE 1BGXH 1CL7I 4FXKB 3RWEA 1E4XI 3H8NA 3NIFF 4FQLH 2X9YA 4OF7A 3WUWG 3VXME 2YD1A 2GIYA 3VG0H 1MWAB 3T0DA 5D9SB 3GMRA 3SGKC 4YHKL 2H26B 3EZJB 4G6AD 2V2TA 1KJVB 5F9WB 1KTLB 3VW3L 4G6AC 3TH4T 2VMFA 1BVKA 3TVMD 5D7LD 4QRPD 3TVMC 3CFCL 4XGZA 5DJXB 3KYNB 1TZGH 2R29H 4I48A 4BFIB 4BFEA 4LEOA 4NQDD 2DL9A 1JI2A 2VQUA 1AO7A 3NA9H 4X5WA 2R0ZH 3MLXL 5BQ7A 2IADA 3G6JF 4M1DL 4L9LC 4JANB 5DJCA 4HWEH 4NYLA 4L3EE 4R26H 4RRPA 3SDXA 1A7OL 1TPXC 3UBXI 2YMXH 4QYOB 3WJLC 1L7TH 5ERWA 3B2VL 4DN4H 1F90L 4G3YL 1I1YA 3TN0B 3GKWH 9CGTA 1A1NA 2Z8SA 1BQLL 2BERA 1ZT7B 2R4SH 1BJMA 4N0YH 4XHQA 3BH8A 2ZNXA 1Q9LB 3Q5YA 4LSQH 3EYVB 1P84J 3UC0L 4XNZB 5CMAB 4HUUA 2AXHA 4O2FB 3KJ4B 4X7SL 1ACYL 2VLJA 3MR9A 3OAZH 3S37X 4IS6A 2FH8A 3B5GA 3ME0A 5C0JA 3SDDD 2XPGA 3CFEB 3SDDC 1FJ1B 1NL0H 5SWZA 5D2NB 4XBPA 4UV4L 3RWHA 3U6RA 2XRAH 3GO1L 3VWKA 4JGMA 4OUOA 4U1NB 1YUHA 3W0WE 3GSRA 2CR6A 4NQCB 1BFVH 1NBYA 3D39A 4CKVX 2X70A 4JG1L 4M7JL 4APQA 1G7HA 1ND0B 2I9TA 2ADIB 2VITA 1KTDA 1DEEB 4ZFZA 5HDQL 4J1UB 1G0YR 5D71H 5FFLA 4K2UL 1U91A 2ICWB 3VXPB 5FUOL 1BJ1H 1G7MA 4ZDHA 2ZSWA 4KKAD 3MOBL 3LIZL 4KKAC 1DBKH 4CMMB 3T0ED 4FQJL 1BLNB 3BT2L 3BQUA 4X98A 3T0EC 4XPHL 3IGAB 3PP3H 3L3OA 4ZFOB 3C60D 2LVCA 3C60C 5F97E 2FBJH 2QLVB 4XCFL 1NMCB 5I0ZA 3BKML 3QAZC 1WIUA 4ZS7H 2PTVA 1Z9OA 4PJXE 4XPFH 1AGCA 3NCFB 3BGMB 3LY6A 1DBML 2F74B 3MUY1 2APTA 2NX5A 5GRJL 4NKMB 1V7NH 1H3PL 3VFWB 4CMHB 3NBNA 1XR9A 5IP4A 4RWYH 4FTVA 5AUMA 4EN3A 4C55A 2Y72A 3C9NA 2A6IA 4MSWB 3EAKA 4CVUA 1QYGL 4UBDD 1RULH 3ROOB 5TDNB 4LRNL 3OAZK 4UBDC 1MUJA 4GKZB 4WW2F 4EJ1C 1XF2B 1HCVA 2XZQL 1IZJA 3QIBA 3VD9A 1SEQL 1UB6A 1VFBA 2RCSH 5IFJB 5DVNA 4H20H 5H94B 1RUKH 3C5SA 3DV4B 4H1LA 2RAMA 3GSXA 2FIRT 2ZNWA 1IGIL 3MTRA 5IFAH 1R3IH 4IRZH 2B5IC 4PGDA 1KNOA 5E6IB 2FWOB 1GJIA 1ULVA 4ZXBA 3QXDA 2BY0A 4XP5H 3BPCB 1QFUH 2VLJD 4YDJB 2YRZA 1ROWA 2H8PA 1MY7A 3CJJA 3VGGA 2D03L 1JHLH 2VQ1A 3A6BH 1NCDH 4UT7H 4AIZA 1CZ8H 4R97C 4HGWA 3VWKD 4NKOA 5E94B 4N1HB 3VWKC 3NH7H 6FABH 5BZWB 1MCOH 2PTTA 3D39D 1NGZA 1L7IH 5L7XL 5GSRB 1JUFB 3JWDH 4APQD 3KPQB 2UUDH 4APQC 1TNNA 2R69H 1HYRC 3PP3K 4KV5F 3BW9A 4LLUA 1N59A 1J05A 2J7LA 2CPCA 4JY4A 2QSCH 3E6HA 4FQHB 1CU4H 3IDXH 3RGHA 3HLAB 3CZJA 3PWJB 3RFZC 5LAXB 4OUUB 1XCTB 5IHZA 1I1AB 5J8OA 4Z9KB 1M6OB 2VRAA 5HHME 2P4AB 3DWTA 4UIKL 2MOVA 5C08E 1KN4L 4M7ZC 3VGBA 1LE5A 3MRIB 2NW3A 1ZHNA 2XWTA 3BQUD 5I15H 3T1FA 3BQUC 1QP1A 4AEIH 1HEZB 2BNUA 3MCLL 4MB4A 3DECA 5GGVL 3S6CA 2XWBB 5BJTA 2W65A 4HUMB 2FJHB 4IEFB 4H8WL 2Q7NA 3WE6B 4MJ5B 5JA8B 2C9AA 5GS0L 3SE4A 4QHMA 3P11L 4NN5B 4J3UA 4QGTA 4TULL 1YMHA 4GXUM 3VW3H 3UYPA 5DMGD 4RGMB 4I3GA 3X3GL 5DMGC 1PZ5A 3QIWB 3CCHB 4ORZC 3RPIB 4AYFA 2IBGA 5JW5B 1XF4B 1FZJB 2ORBL 4WGWB 2P5WB 5JXAL 4U0RB 3IDIB 4JR9L 4X99B 5EO0B 3VRLE 1TCRB 2A9ML 4M1DH 1ZA6B 4UDUB 4IMLB 1AGEA 5CZXD 1U3HB 3EZ8A 5CZXC 3SGEI 2DDQH 4OD2B 3BHBB 3QIBD 1SHMA 4ZODA 3QIBC 3RL1A 3IDYC 1RFDH 4OBRA 5I17A 3SKJH 1F90H 1JZ5A 3WNOA 1TFHA 3IKKA 4G3YH 4PREB 3BEVA 1BQLH 2HJKA 5E9DD 4JFYA 1BF2A 3OKLA 5HVWA 2A0LD 1X5YA 2A0LC 4FXGA 1WC7A 3UC0H 3PXHA 3JWNC 1S7WA 3KPOB 3MACH 4ZXBD 1WFOA 1NMAL 4ZXBC 4MQ7A 4H0HB 5I1KL 3MRQB 1DFBL 3EKCA 3SKMB 4KK8D 4JFEB 2A1WL 4KK8C 1T5WA 2W0FA 1UWXK 3DGGB 5D6DC 5FHAL 5IB1B 1NLDL 3WEXB 2Q76A 3BP7A 3MBEB 3QQ3A 4PJ9A 3GO1H 1CK0L 4LASL 3EDKA 4M6OL 5CP7A 2QV2A 1S7RA 3SBWA 2AEPH 1I8MB 1NGXB 1JF1B 4E0RB 4RISH 4AIXA 4M7JH 2X4RB 2Q8AL 4YEFA 2YPLD 3VXTB 2HG5A 2R2CA 2X7LA 1A7PL 2F53E 4FQCH 4ZUTA 3T2QA 1FV1A 4HIEB 1VADA 5KSAA 1U42A 3FQTB 5HDQH 1YQVH 1A7QH 2H41A 4ZTOL 4K2UH 4P2CG 4K7FA 2V7NA 3GKZA 4WY7H 1KPRA 1FZMB 4NCC2 4MDJB 4UNVA 1MLBB 1T0PB 3DHMA 3UTQA 4BQBA 2R23A 3MOBH 3G6JB 4YPGB 2YRPA 1NEZA 2GQHA 4C4KO 4XPHH 2JLLA 3VFTB 3VXNA 2WUCH 4PS4L 4A6YA 5BV7C 1XCQB 3ARBA 4G6KL 3U9UB 4HGKC 1T1YB 3U30B 4OZ4B 1KIPA 4FNLH 5E2VL 1RMFL 1P4LA 4HEPG 2X4NB 4Z0BL 1Z0MA 3BKMH 1NCNA 2R0LH 3QXAA 3SE4C 3X17A 3PWPB 3ZO0A 4HQQH 5IR1A 5HYJD 3WNPA 1E4KA 2DQEL 3AMLA 3LV3B 3L7EA 4U31A 4I4WB 4FFYH 3U46B 2PXYA 3O2DL 4BK5A 1H3PH 5E8DL 1CVSC 4PRDB 4I3SH 3OAUL 1N4XL 4ZPVB 4Y5XC 3T08A 1EGJA 3M07A 3PJSA 2DLFL 4C59B 3BKJL 5GS2H 3QUXB 2OR9L 5DQ9B 4U6XA 1MJ7L 1J1PH 5HGHA 1A7NL 3OKOA 4LHUB 1I7RA 1KUMA 3NFNA 4KMQA 5FEBA 3T65B 5IUSA 1LK3L 1T1ZB 4MLSA 5DD6A 2BZDA 4LAQH 1XFPA 1MHHA 4MA7L 1XIWB 1ZA3A 3AFLA 2JKXA 2OP4L 1ZVSA 3MFFB 3BYYA 3NN8B 5TH2A 3WKML 2W92A 2EDLA 4JPWL 2YPKB 3STLB 4PYHA 4HPYL 4TTDD 3FAWA 1IBGL 5IB3A 3IJYA 1Q38A 5F6HI 4TTDC 1KXQE 3O3DB 1S8DB 4LNRB 4DKEL 4X83A 1T22B 4YHZH 1RJYA 4JRYA 4PJ9D 2ZCHL 4PJ9C 1G6VK 2XN9A 1EJOL 2XIDA 3LN9A 2V7HB 4M93C 4L3AA 5DFWH 3QPQD 4HFWB 5I1JL 3QPQC 3QRGL 4HMCA 3EBAA 5C0NC 3BGFB 2CMRL 4QOKB 4XXCA 2DD8L 5I8CB 5TE7L 1HZHH 3C87A 3WXVL 1MVUA 4F15C 4MD0B 3GJFH 3DSFH 5CLWA 3MGTA 1YNLL 5LWYH 5MI0B 1CDHA 2QQKH 3HC0A 2ZUUA 1KN4H 1FAKT 2DBLL 4O02L 4WW2B 3P9LA 1W72H 3L3HA 4GAGL 3ARBD 5EO9A 4JO1L 4UILL 3S7GA 3TESA 3ARBC 3MCLH 4Y1AE 4G7YL 4RX4A 2C3WA 4G6JL 3ZE2F 1RZJH 4P2QE 3U1SL 2CKNA 3P4OB 1G9ML 1S7XB 1HXMB 2VLRE 4H8WH 1RZ8A 4YHML 3IU4H 4XPAH 3JTTB 5GS0H 4OM1L 5A2LH 1MWAH 3AXLB 3P11H 4K3DH 1K8DB 4BQ8A 4U1IB 4TULH 1E4KC 1NPUA 4CVZB 3D0VA 2YWZA 2PXYD 1BZ7B 3SQOL 2PXYC 5A2FA 1QD0A 4ZUSA 2CIIB 4ISVA 3MV9B 1R3LB 2ORBH 1ZMYA 1OT1A 5EU3B 3FQUA 5JXAH 3GK8L 1VA9A 4DEPC 4OF0A 3V5DB 4Y4HA 4JR9H 3FB6B 5EUOA 4PG2A 3V4PL 1WVZA 1HHIA 4M1CD 2D7QA 4M1CC 1INQB 4LHUG 3DUUA 4F3FB 1CDCA 5F9DC 4KGLA 2I5YH 1NJ9A 4Y19D 4DGVL 3QEHA 3H7BA 1JFQH 5I16B 2BY2A 4WGVB 5I8EB 1MF2L 4ORGA 4D9RE 4D94A 4JKPH 3DETD 2RJMA 3EO9H 3RUGE 5SWSA 3DETC 4RA3A 1CLYH 3VFUB 5I1GL 1NMAH 4G80A 1YEKL 5DR5H 1YEDA 3DX7A 1KELH 2OXGA 1R3KB 5BS0A 3U2SB 1I1RA 2VDQH 3HNVL 3D3VB 3GDBA 3VFOB 1UH2A 1NLDH 2XN9D 4M4PA 1P4IL 3MRCB 2BSTA 4GRWB 5DJAB 4M6OH 2A77L 5L2JB 2OQJA 2YUZA 3KJ6L 2A74A 4KAQL 5F89A 2W9DH 1KB5B 2Q8AH 3CC5A 4LGSB 2BNQE 2F54E 1ZTXH 1RJLB 2VLLA 5DK0B 3X3FL 1PJ9A 5GSVA 5MEQA 4ODXA 3U7WH 2EH8H 5FYKE 4I13B 1L4IA 2H2SD 4U1GC 3G6DH 2EIZA 2H2SC 3O6KL 2G2RB 3IFPA 4PRIA 1E28B 5EZLB 1IGTB 4Z0XB 4M6ML 5TGBA 4KZEL 5A2JH 1B6UA 3H42L 5IM7A 5INCB 3SDAB 5HGDB 2DWDA 2C4FT 1FGVL 3IU3A 1U3JA 5I9QB 5C0BA 5F6IB 2XY2A 3O3AA 1HXYA 3HZKA 3MUHL 4KU1A 5TFSH 2ADGB 1QRNE 1FL3A 5DI8B 1CDYA 3FCTB 3GJEB 3QCUH 4C4KT 2O5YL 3UEZA 2GSGA 5IJVA 5J1AA 5J6GB 3HMXL 4D9QD 1JPST 2VAAB 4GW4A 4PLOB 4B7LA 3O2DH 3GRWL 1Z9SA 5F21B 1EBPA 1FNGB 5E8DH 5FA3A 3OAUH 1N4XH 1OD9A 3IDGA 3UZQA 4Y4HD 4OF6A 5HYIA 5DRZB 2DLFH 4Y4HC 3BZEB 4CJ1A 3BKJH 3ARDA 4PG2C 2OR9H 3O11B 1BD2E 5DMIL 4KKBD 1QBAA 3KPRE 4LCUB 1ED3B 4F7EA 1QLFB 5I1AB 1IGYA 1R3JA 3B9AA 2CUMA 1U6AH 4XBEL 4OAWB 3P9MB 4IJ3B 4OZFB 4F7PB 4XVSL 2C3VA 1A6WL 1CWVA 1D5BA 4U6VL 3DIFB 4FQ2L 5SWSD 4ONFL 2YUVA 4ZO8A 2VXVH 3I85A 3WKMH 4JFFB 1A2YA 5IGXL 4JPWH 2YXFA 1NGQH 3F7YA 4HX1B 4G8GB 5BS0D 4HUVA 4HPYH 4HKBA 2R1XA 3EDJA 1RURL 5T1DL 4LMQI 4DKEH 4X7TB 1UXWB 2YXMA 5DJ0B 2KKQA 2J6EL 4OFKA 3C5ZA 1YNTB 1DQJA 5EB9A 5MEPB 3MRHB 4FHBD 2Z93B 3GSQA 1FLRH 3QFDB 1EJOH 2EKSA 3GZKA 1BMGA 3ILPA 1VKXB 3G9AB 4GKSA 5IROA 3SHSA 2D31B 1QFPA 3VRJA 4DKDC 4F37K 5FKAB 5I1JH 1FNLA 3QRGH 1I9EA 3DROB 5AAMA 2CMRH 4LCCA 4JM2F 5L6YL 2LAGB 4QRPE 5TE7H 5JQ6L 1UENA 3VXUA 3LKRA 4UUJB 1JWSB 4J12A 3WXVH 2XYCA 3FFCE 4HPOL 2CDGB 3LKSA 3C8HA 4QTHA 4NQDE 4PP1D 1UJ3C 3OKNB 4PRID 1FVDB 4JRXA 5IMMB 4PP1C 3TPUB 5AG8A 4O2CA 3HRZA 1BIIA 4G6FD 1QR1A 2R1WB 3PGCA 2EDBA 2VDNL 4OT1L 4RFEB 5EC1B 5GRVL 2B1HL 3IDNB 3HTLX 2D0GA 1J7VR 4F2MA 1UYWL 4UILH 4M9OA 1KT2B 5C0BD 4EI5B 4XT1C 3KDMB 3ULVL 3QT2A 4KK6D 2N4IA 3IS1X 2PCPA 2CRZA 4KK6C 1YNKL 1X6LA 3GSVB 3MPCA 4PGEB 4M8QB 1IGCL 4KJYA 4DCQA 4I77L 4OM1H 2R2BB 1IEBB 4UAOC 2CLZA 2HFFA 1EXUB 3E2HB 1CR9L 3B9KA 4JO3H 5BZDB 4UT6L 2P5EB 1SM3L 5IMOB 3O8XB 4L29B 3UCRA 1PQZA 1U8KB 3VRLF 4IHOA 5HHQA 3QG6B 3NGBB 1WQVT 4QHKI 1KJ2B 2VO5A 3P9WB 2R2EB 4Z76B 5L2KA 3MYJA 4XMKL 1ZT4B 4A2MA 3L9RA 1K3ZA 5BXFB 3RIAK 4ELMA 4KRLB 4N0CD 1W0WB 3I75A 2NNAA 3QIUA 4N0CC 4NKQB 3GBNH 5I6XB 1MFAL 3O2WL 1JGDB 4TSBH 3BE1H 2DQHL 2IPTH 1R0AL 1Y0LA 1MCBA 3FHQA 4DGVH 4HHAB 5DZNA 4OZFG 4KHXH 3BZDA 5C0FA 2BNRB 3QUYA 3UJIL 4JHZA 2VB5A 1PSKH 3B5TA 1MF2H 2Q87A 4JGJA 4HV8B 1HIML 4O51B 5HHOA 2NY1D 1E4WH 4OZGE 2NY1C 5I1GH 1KACB 3QI9A 4YHNB 1YEKH 1QSVA 3T0EE 4FQ1L 5DS8A 3W39B 3C5ZD 3SE3C 4Q6IA 1HH6B 4JZOA 3C5ZC 3FRPA 4R4FL 4XVUD 5IF0B 3VXMB 4M43L 1U92A 3QO0B 3PQYB 1P4IH 2BY1A 3INUH 5C7XH 5DGQA 2APBA 1WCBA 2F8OA 3FO0L 1D7FA 4X6CF 5IBUB 1IM9B 2A77H 3LKPA 4JFHD 3KJ6H 4M7KH 3MRBA 5DHYA 5IROC 3TBVB 3VXOA 4KAQH 1FLTX 3ARED 5GGRB 1EVUA 2DIAA 3AREC 1VFOA 4FOMA 1KB5L 5D7IE 5HI3D 3BN3B 2CK2A 3X3FH 5HI3C 5INDA 3ULUF 3VXUD 3PIQA 3L3DB 3HZYA 5KJRL 5TE6L 2YEZB 2B4CC 1EEYA 1JGLH 2L7UA 4NQVA 5TQ0H 4XCEB 5C70A 4G8EA 4JRXD 5E8OA 3UPRB 3MNWB 1F4WH 4M6MH 3SJVB 2DIBA 1NBZB 5CD3B 5ACMA 3H42H 3QNZB 3QJFA 2BMKB 3GHBH 4U1SB 3O6LL 1U8NB 5E00B 4YJZL 5F3BB 5E8PB 5E1AA 1OB1A 2X4PB 3E6FB 3EJZD 3SDXE 4AM0A 3EJZC 3V6OA 5F88A 3EFFA 1U8IB 1ADQH 4LPUA 5L0QB 2YSSB 3MRJA 4C56B 1INDH 2FECL 3EYOA 3B3IA 3QXUA 4RGOL 5T3XL 4OCRL 1BQUA 1SY6H 1UM5H 2O5YH 4KVCH 5EIIA 3WNMA 2AEWA 2FDBP 2AK4A 1WF5A 2Z0BA 1VGEL 5I1DB 4F7TB 1BEYL 3B9KD 2VLJE 4P9HL 5DJXA 1MCFA 3TP4A 2NLJB 1WZMA 2GTWA 3B9KC 3HMXH 1TJIL 3QP3A 4BFIA 4KUCD 4JZNB 3GRWH 5HDBE 5GS2D 3ZT6A 4PJFE 3EO1A 2NXYD 4WI9A 1EAPA 3DVNA 3MRGA 3IXAB 4JANA 4RMTA 5BOPA 5KVGL 5L2KD 3D39E 3HHRB 3O0RH 1NCAL 5EOTB 1A9BB 1E27B 3QIUD 1CG9B 1RJZB 3QIUC 4CU7A 1M4KA 2DMCA 5CUSH 1U8QB 1NCUA 4PJEF 3TH3T 4XBEH 3DUHA 3DV6B 4UNTA 4UT9H 1ZT7A 1GZPB 3D87B 3EYSH 1A6WH 3QUYD 1S9WB 2EDYA 3EYVA 3QUYC 4U6VH 1NGYA 2NY2D 1CI5A 3L3JA 3PV6B 3ZE0F 1C12B 2NY2C 4ONFH 4PP2B 1E6JH 2ICWI 3CFBB 5HHOD 3FQNB 1NUNB 1MFNA 3TO2A 3QI9D 2B2XL 4MJ2A 3OHXB 3QI9C 4PV8B 4XWGL 1DVFB 3CFEA 4ODWB 4PRNA 2GJZA 2JB5L 5D2NA 4HKZB 4Q6IC 2J6EH 1OLZA 5DRNB 4KZDH 2XWJB 4BZ1H 4NQCA 5IBUG 2BVTA 3U79A 3ARSA 4XCNA 1OSZA 4PJHB 2ADIA 4U7SA 1AD0B 2HN7A 5I76B 3M17B 1DEEA 5L6YH 4J1UA 1YEHH 2X1PA 5JQ6H 1HSBB 3BYTA 3HUJF 1QBML 4YHIB 3IB4A 2V5YA 3EDEA 3K74B 2E5EA 4KTEL 1TJGL 2CDEB 3GB7A 1BF8A 4OT1H 1CBVL 3ZDZF 2VSCA 3IGAA 2B1HH 4KI5D 2GCYA 1OM3L 1QFWM 1RZJC 4P59L 4KI5C 5DSCB 4Z7VE 4LCIH 3B83A 4QRTA 2DBJA 4ZO6A 3A6OA 1MY5A 4HK0B 4XP9L 3JUZA 5E9DE 35C8H 2APVA 5GHWH 2IALA 3TBTB 4I77H 4W6XB 4RA0C 4QF1B 5F9WC 3HS0A 2F74A 4LPTA 2I25N 1OARL 4DJMA 3CSYB 4U1JB 2BOBB 4NKMA 1Z5LB 5JORB 1CR9H 1ACZA 1Y18B 3VFWA 4L1HA 4IIQB 4UT6H 1SM3H 4OV6F 1NAML 3BXNB 1MCHA 4HKJB 1RHHA 4PJ8B 4MSWA 2AXJA 2X44D 3ROOA 1Z3GL 4YHYB 1B2WL 2ZG3A 2AI0H 3WO4C 2YPVL 5LBSL 4EDWL 1XF2A 4XNMA 3L3IB 4JDZB 2YPLE 3E8UH 3WFBL 4HMDA 5ISZB 1JYWA 4ONHB 3WD5L 3DX9A 5CILH 5IFJA 5IEKA 3O2WH 5FIEA 3TN0D 2DQHH 3HPJB 3TN0C 3GMLA 3NABL 1IKNA 3BP5A 5DUPL 3V0VB 4JPIA 1ETZB 3P4MB 4HUXA 3CAFA 5C08B 1RI8A 5E6IA 4XNZC 2W38A 4HJGB 3KJ4C 4YDJA 4JFDA 1MRCL 3LQZB 5ILTL 2FATL 2NY7L 3I2CH 4FQ1H 5D8JL 4KQ3L 3EOTH 1S9XB 4OFVA 5D2NC 3SKOA 1ZHBB 1RUMH 4PJAA 4M43H 5E94A 1K9TA 2BVUA 4RAVB 5BZWA 3EDFA 4NQCD 5GRWA 3FO0H 4EDXB 4P49A 3EIFA 1XGTB 2DTSA 1G7JB 2IH3B 1DQQB 1N8ZA 2FHFA 4W70A 5GGSA 4OV5B 4GMSH 2HT4D 1KB5H 2HAZA 2WIIA 5HYJE 2HT4C 1QEWA 1OAUL 2W07A 4FQHA 4LVNB 3PWJA 4G43B 5LAXA 1RV6X 1XCTA 2V2XA 4XZUA 1ZOXA 1M6OA 3CIQA 3V5KA 2AJ3B 4TUOB 5AZ2L 3CX2A 3MO1B 3CMGA 3FN0H 2DM3A 1HEZA 1CQKA 4E41B 3K46A 3EJYD 3EJYC 1I9JL 2XWBA 2FH6A 5LVEA 5GXBB 3TA3B 5FM8A 1PG7W 3NCBB 1NMCC 4QKXB 1RJCA 3VMOA 3MOAL 3N0PB 4RGOH 3JBG7 4BSWB 4DK3A 2I26N 1DBJL 2BSSB 3QIWA 3CCHA 4DOHB 5KVDH 4K07A 4P9HH 3CGTA 4X6EB 5EN2B 2D7OA 3PL6A 1TJIH 4CMHC 5JW5A 1XF4A 1FZJA 1D5MA 2P5WA 1RHFA 2LAAA 5HYSA 2GUOA 3TM6A 1WAAF 3BGAA 4FQXA 1MI5B 4X99A 1QSFA 2V5SA 4M5ZL 2AV7B 4MWFB 4UNUA 5FYLD 3QSKB 4UDUA 4X6CB 3NPZB 4IMLA 1RY7B 3NZ8B 5IW6B 1MREL 2ESVB 5JMRA 4ETYA 5DD3H 4OD2A 2F53B 1NCAH 4LVHB 4C83B 1QBBA 1FZKB 1N26A 4LLDB 3Q2CA 2CRIA 4OGAD 2GW5A 1BQHB 3LEXA 3MNVB 3QUMA 4OGAC 2C3XA 1R5VA 3GSWB 4NM8H 4ZFFA 3KR3L 1Q9OB 2BSED 4PREA 2KH2B 4ODSL 5B3NA 4G8IB 1V5JA 3ZDYE 2FO4A 5AWNL 3PHSA 4ZMAT 1IJ9A 4UQ3A 2DICA 4G42B 5E6ID 1HH9A 3VCLA 5E6IC 2XNAA 1A6TB 4P57A 4JFDD 1IRAY 3SKMA 4XWGH 3ILQD 3DGGA 2JB5H 5IB1A 5C09E 3WEXA 2WBKA 5CJOL 3ZSSA 3MBEA 2DKUA 3RY5A 2X2YA 2CDFA 3FT2B 1I8MA 1J1OH 1NGXA 2GK0B 1NC4B 1MCPL 3Q48A 2X4RA 1WK0A 1ZLUK 3R0NA 4PBWD 4H25A 2EDHA 5T33L 4OGZA 4RIRA 1AR2A 1GGYA 2H9GB 3VXRA 3GEWB 3FRUA 3IRZA 2GTZB 2HH0L 2AJVH 3FQTA 1ZLWH 2DM7A 3IDJA 4RGNB 4CL7A 1BHGA 1CD8A 2FZ3A 4U1KA 3REVA 4OZHE 4F8QA 1JF5A 1I1AC 1LO5B 4MZ2A 3H3PL 4YPJA 2HJFB 5ESQB 1FZMA 1SBSH 2NY6B 4MDJA 1MLBA 4KTEH 3G6JA 1TJGH 4YPGA 3TV3L 5J3HD 1UT9A 1ZWIA 5J3HC 1CBVH 1QKZL 3VFMA 4U1HA 3VFTA 4HS6A 1F6FB 2M26A 3SCMA 1XCQA 3U9UA 3UJTL 1OM3H 2KZ1B 2QR0B 4P59H 3QDMA 2XA8H 1LGVA 3ARTA 3WLBA 4URTB 5C3LD 4PJEB 3Q1SL 3BVNA 2X4NA 4Y19E 2FIKA 2QBWA 4XP9H 4TQEH 1HSAB 1LHZA 3TNMB 4FFZH 1A6AB 3LS5L 5J6HB 5CEZL 1R24A 4WRLA 1PX3A 2HKFL 1UGNA 4NN5C 1MCWM 4GG6B 3P40A 5DXWA 5E2TL 4RGMC 1CGSL 1OARH 3QIWD 3CSPA 2VL5A 3QIWC 3PL6D 4XNYL 3PL6C 4WU7B 4ERSH 2X1XR 2P5WD 1DDHB 2VZSA 3BP4B 3VGFA 4LIQH 4ZPVA 5DA0B 2P47B 2YD4A 4POZD 4U0RC 4FQXD 1G6RL 1NAMH 2XN9E 3BRDA 1QSFD 4P23B 4POZC 4FQXC 4DUWA 5HYQB 1Y6KR 5EZJA 3EDDA 5IW1A 5DQ9A 3SDCB 1GGBL 3NFPB 3LVEA 3GFUA 1GZQA 3H0TB 4KK9D 4LHUA 5LBSH 4EDWH 5GS1A 1BWMA 4KK9C 5GJTH 3T65A 2KL6A 1BQHG 1T1ZA 3H3KA 3WD5H 3I6KA 4XWOD 1YPZF 1IGFL 2FX8L 1ZAGA 4XWOC 1XIWA 3CDGB 3BKCL 5DUPH 1SVZA 4CBPA 3HUJB 4OZGF 4R0LB 1C5BH 4L4VA 3TZVB 1YEFL 2YPKA 5ANMB 3U0PB 2V9TA 2FLBT 3CUPA 3X13A 1OTSD 3STZB 4Z7WF 2HVKA 1OTSC 1MRCH 1S8DA 3EJJX 4LNRA 2AQ2A 5ILTH 2YS4A 4BYHA 5FO9B 2NY7H 2MCPL 3P77B 4KQ3H 1AXSB 3MBED 3JVGA 3BZ4A 4ZSOE 3MBEC 2OX5A 1HHJB 4IRJB 4JFOB 4UDTB 3B2UD 3S34L 5IHUH 4DVRL 2V7HA 3B2UC 3F65A 4JVPA 3MV8A 2DL2A 4AT6B 3OKKB 1MJ8L 4I0KA 5J9PB 2NR6C 1XMWA 4HFWA 4LAJH 3W9DB 1T7YA 4QOKA 3FT4B 1F4XL 1KLGB 1S7TA 5I8CA 4UU9B 3KLDA 3BDYL 1P53A 2F5AH 1J87A 3RU8L 5GISL 1T03L 3V0AC 4NP4L 3KLAB 4F9LA 5J11B 1VB9A 2EDFA 1XF5A 4KTDL 1A5FH 3FB7A 5EUOE 5LXGH 1CTNA 5AZ2H 3SDXF 2D7NA 4M48L 1EK3A 3SCMD 1EZVY 3SCMC 3ARPA 4P3DB 3FAXA 4KY1L 2HFGL 4M4RA 5IHLB 3U30C 4KJPD 2X4OB 4KJPC 1V3LA 1IZKA 5JNYB 1S7XA 4BA8A 4TUKH 4N0RA 4YBHA 1LEIB 4NHUA 3MOAH 4X4ME 3JTTA 5KSBA 3VE0B 3AU1B 1XR8A 4Z7OF 5TDOB 4AMKH 1P7KB 5F9OL 5TJWK 1D5XB 1DBJH 3OTTA 5BS0E 4RBPH 3HG1B 2CIIA 3IKCB 5JHDB 2IFGA 4LCWA 3MV9A 5EU3A 5TPWL 4L1DA 1FG2B 3V5DA 1JWUB 3O2VL 3O4OB 3MRRB 4A2LA 3CDYA 4NO5B 1NDGB 3BI9X 3VH8B 1FGNL 1MREH 2IGFL 4LHUD 3VFPB 1JRHL 1INQA 4H26A 4F3FA 1FE8H 2APXA 2LVEA 1XIWD 1I8LA 3KR3H 2XG5A 1XIWC 2J1KA 4ODSH 4Z7NF 3SKNA 3ULUL 4KJWD 1LEKB 4HIJB 3QWQB 4KJWC 2EDWA 4OI8A 1X7QA 4XPTH 3FO2B 1IAIH 1YECL 4PRIE 3D9AH 3VFUA 4OCNC 4YXKL 2GJ6B 5IVXA 5SX5H 3JV4B 4OCWH 3G08B 3VFOA 1MCDA 1MHEA 4P0DA 5ICXB 2WBJB 3JVGC 5CJOH 4I0PB 1ZSDB 3MRCA 2GKIA 3MV8D 2ZUQB 1LQSR 1N0XH 4RNRB 3U4EB 4L8CB 1N2RB 3LPFA 2H3NA 1QO3B 3GUTB 4S10A 2NTSP 2GY5A 3DHJA 2AKRA 4AENB 1GCFA 4QOKD 2CIKA 4PJDB 4LKCA 1RJLA 2D7TH 2HH0H 4NRXB 2O26U 1P7HL 1KPVB 4D8PA 3UPCA 2BP3A 3MREB 3Q3GA 3IAPA 2G2RA 4GXVL 4F9LC 2Q8BL 3OB8A 2P48B 5I74B 1KXVC 3BH9A 5C71A 3V5HA 3MLVH 3TV3H 5HGDA 2I24N 4JPKH 1FH5H 1T20A 4WW2C 2VDLL 5I66A 1QKZH 4XC1H 1K6QH 1MRDL 3HI1A 3UJTH 3OR6B 4GBXB 1CDIA 2XKUA 3KXFB 1FPTH 5LCVH 3HA0A 3MXVH 1MCJA 2R8SL 4OZIA 3FCTA 3LS5H 1WWBX 2V2WA 5CEZH 5KTEL 1A64A 3FTGA 2HKFH 3L5JA 5CGYD 4MNHB 3OV6A 5E2TH 5CGYC 2VJXA 1KIRB 2LV4A 5J6GA 1CGSH 3TBWB 3IT8D 2DQTH 5KS9A 4HZAA 1HQRB 3KYAA 4LCWD 1FNGA 3MV9D 2DQIL 4XRCB 4JAMA 4AEEA 5KSVA 4BKLB 1E4JA 1T1XA 1F6AB 4NQSB 5IBTL 1G6RH 2NQCA 1V7ML 5DRZA 3BZEA 5JA9A 5HTSA 4XPBH 3LKOB 4JFHE 5HHPA 1CDGA 3VH8G 5F7DB 3NIDE 1CF8L 5B22A 1K8IA 3TJEH 3HNSH 1FP5A 1QLFA 4L9DA 1OTTD 2X6MA 5D7LB 1QFWL 1OTTC 2Z4QB 4KVNL 4OZFA 1I8LC 3VXUE 1A9EB 1G9NC 1GC1C 4NQDB 3DIFA 5IVNA 2ED8A 3GSUB 3SQBA 4JRXE 4HX1A 5BW7C 4G8GA 4UZGA 4TNVK 5HJ3A 4LMQE 1TPXB 3W11C 3D3VD 1AGFB 1R6VA 1UXWA 3REWA 2MCPH 2P8LB 5MEPA 3MRHA 1EVTC 4ZS6D 1BAFL 2Z93A 3GIZL 5D2LB 4ZS6C 1QNZH 3S34H 4CJ0A 1VKXA 4DKFH 4WEUD 4UI2A 1DBAL 1MJ8H 1ZT1A 4PPTA 5ALCH 5EWIL 5FKAA 3DROA 3RKDC 1OL0A 1F4XH 3PDGA 3KS0J 1IAMA 5E8NA 3BDYH 1FNAA 5C9KA 1FORH 3EOAA 3RU8H 3WL9B 4NNYB 2CDGA 5GISH 1T03H 1PG7X 5LGHL 5GRXG 4NP4H 3UTSB 1KXTB 5IMMA 3KPSB 2CXGA 5C0AB 2EO9A 1GVIA 2P7TA 3MUGA 3OGCA 4KTDH 2X4UB 4RFEA 1RUQL 5EC1A 5L2KE 4M48H 1WFUA 1MFDL 4B41A 4ELME 2R15A 1JPSH 2FL5B 5I9QC 3FJTA 4KY1H 4WNQA 3LEYH 5F6IC 3PWLB 4NFDA 2LTQC 4JVWA 4JKMA 1LD9A 5L8KB 1YPZB 4MZ3A 3GSVA 4PGEA 1SJHB 4M8QA 3RVTD 1E0OB 3RVTC 1YEGL 4M7LL 1WSST 4CGTA 5HHOE 1IEBA 4G9FE 5ICZB 4J3VA 5F9OH 4D0CA 1TVDA 2OTPA 5F1NB 1WJ3A 1EXUA 4O9HL 2EKJA 5BZDA 5K9QG 1PLGL 4Z7WB 2P5EA 1KENH 2WANA 3O8XA 4I5BB 4KC3B 5EH1A 5IFHL 2QL1A 3VGAB 3QG6A 2ZCKL 1KJ2A 4MJIA 5DMKA 2C1PB 2NY5C 2R2EA 3DVGA 3STBA 4Z76A 3GMRB 2O5XL 2V2TB 1CFNA 1FGNH 3ZKND 4Y2DA 2IGFH 3ZKNC 3LOWA 2BXZA 1JRHH 5MENE 4XMLL 5DD1L 3HR6A 4XGZB 1ZEAL 3ZDYF 3L3GB 3LDBC 4IMKA 4I48B 4IJ3C 4HHAA 4LEOB 5FYKL 1NCBH 2P8MB 2CKBA 1AO7B 3ZYIA 4H5SB 3ULUH 5EOCL 4AK1A 5E4EC 2PR4L 3QYCA 2YA2A 5I8OH 4HV8A 3P2TA 4O51A 1MHPH 5DJCB 2AJSH 4PRPA 4HWUA 4YXKH 4NYLB 4G8GD 4YHNA 5A3ID 5A3IC 3W39A 2PW2B 3DURA 4KI5E 1HH6A 1J8KA 1U93A 3QO0A 3QXVA 3M45A 4BQ6A 1IM9A 2DJ4A 2F19H 5K33A 5BVJB 3TYGL 3TBVA 1JPGB 5GGRA 5CEYA 4OLZH 3QHZL 2ZUVA 2WUBH 3HFML 4P5KB 1WIPA 3MR9B 1XGUA 2WLZA 4IS6B 5J1TC 3QFJA 5HBBA 5SWZB 3FO9A 3RWHB 2YEZA 3U6RB 2J4WL 4XCEA 2A6DB 3VWKB 4KJQD 4UTBL 4KJQC 4GXVH 3MNWA 5KG9A 2Q8BH 3SJVA 1NBYB 1RZFH 1NBZA 2X70B 4APQB 1M7IB 1G7HB 1NUGA 2GJJA 2I9TB 5HDLA 5E00A 3F7VB 5E8PA 4DK6A 2VITB 4TSCL 2VDLH 4U33A 3ARGB 4BH7A 1UACL 4ZFZB 2HWZH 4EI5C 1LILA 2BXYA 4KDWA 1U91B 5I1IL 2R8SH 1G7MB 4F57H 4GH7B 4YHOL 1JPTL 5HGBB 1IAII 5LG1A 5DWUL 4P4KB 2IBZY 4X98B 3BQUB 4F7TA 4BSJA 1KOAA 1DUZB 3E2HC 2P5ED 3NCJL 3O8XD 3OJVC 3O8XC 4JZNA 1OQXA 5D2NE 4DGYL 2DQIH 4KRMB 4W81A 5JW4N 5JOEA 5IQ9B 4HWZB 2E3VA 3B43A 3S4SB 4MJID 4OF5A 5IBTH 3RWCB 1V7MH 3UDWC 4JCLA 4NQCE 4RAHA 4EIZC 3T09A 4TSAL 5EOTA 4Y2DD 1A9BA 2OSLA 5ID0B 3L5WA 4ONGH 2OXHA 4Y2DC 3VGHA 1BX2A 1CF8H 1U3ZA 2NX5B 5I6XC 1MFEL 1U8QA 1J86A 4KHTL 4WTZG 3IVKA 1QFWH 4KRPB 3IF1B 1ZGLM 3DV6A 4J3OC 4IMKC 3GNML 4DKAA 3RI5K 4NUJA 1GZPA 5CJQL 4KVNH 1OT2A 1XR9B 4TYUA 3B9VA 3OPZL 4M8VA 5DMYA 4FTVB 5AUMB 3UJJL 4PGCB 4EN3B 1C12A 4PP2A 3C9NB 3CFBA 2ZWLT 3FQNA 1S9YB 5DZOA 3GSNA 3QH3B 4OLWH 4RMQA 3OHXA 4PTTB 4GS7C 5D1QB 4HWBH 3L5IA 2YA0A 5TE4L 2ICES 2DN7A 4JQVA 5DJ2A 2YUWA 2ZSVB 3C5SB 3BWAA 1Q72L 1BAFH 4MJ4A 1FYHB 1I1FA 3ARYA 3GSXB 1IM9D 3UAJD 3U4BL 3DVFA 1XGYL 3UAJC 1MOEA 5CAYB 3ZE1F 3GIVA 4PJHA 4ZXBB 1AD0A 3ZHKA 5EWIH 3BWUC 1RQ5A 3M17A 2Y36H 1NFDF 1MJJB 1LO3L 2H8PB 4QO1A 3QFJD 4JY5H 5CD5C 3QG7H 4GG8A 4NBZB 4K94H 2UWEA 1IQWL 4HGWB 1X4YA 4NKOB 4BSVB 5JZ7D 1PY9A 5EUOF 5I1CH 2EDJA 1A8JH 1MCRA 3X11A 5JZ7C 3WS6A 3SJVD 1WFNA 2PTTB 1NBQA 3ALWA 1YJDH 3TT1L 4XMPH 5FYLE 3BX7C 1RUQH 4OM0H 5C9JA 4MD5A 5CGTA 3BW9B 4LLUB 5IWLC 4XNQA 1JGUL 1U95A 3ZL4L 4JY4B 1WZ1L 3VFSB 3E6HB 4C56D 5FOBA 5L0QC 4HK0A 4ZO7A 5IHZB 3K81A 1HK6A 5HI4D 4J7RA 3TBTA 2Q86A 3FT3A 1NKRA 4HF5L 5CGMA 4LPWA 2XWTB 1JNNH 4M7LH 4GLRH 2BFVL 3CSYA 1MEXH 2BOBA 2D4DA 2RGSA 1Z5LA 5JORA 1P6AB 3DXAB 1PLGH 4WEBL 4ZUWA 4OLVL 1H9VA 4OTXL 4WI8A 3QJHA 3QO1A 2HT3D 5BJTB 2W65B 1QA9B 5CZKA 2HT3C 4X6DB 2UVEA 2X4TA 4PJ8A 4WTWA 1PYWB 4YAQB 3S4SG 2ZCKH 3I02B 5DUBA 1T89A 2JTDA 2LFGA 2O5XH 4ZQKA 4MQTB 4RAUB 4OD3L 4RFNB 3LPWA 4XMLH 1PZ5B 3QZWA 4N90E 5DD1H 4OI7A 3FONB 3HPJA 1ZEAH 2IMMA 2VLMD 5FYKH 4WFGD 1ETZA 5CS7A 2VZUA 1QPPA 4NKDB 5FCUH 1JGVH 1OQOA 1AGEB 2BVOB 1ZS8A 3BPOB 3TT3L 3LQZA 4RFOL 1E4XL 1S9XA 1ZHKA 5I17B 3HC4L 1ZHBA 1HN1A 4EBQH 4YX2L 4WI3A 5DJZB 1PFCA 3S98A 1C8PA 1DLFL 3BZFA 1UWEL 3BD5A 1XGTA 3U36A 2R9HD 1DQQA 3TYGH 1WC7B 3F58H 2R9HC 3RY6A 4OQTH 1VESA 3NACL 5AZEH 5CP3A 3B8YA 4QY8A 1I7TB 2GY7B 1T5WB 2W0FB 3MRDB 1H3VA 4G43A 3OKMA 4PJ9B 3QQ3B 3V52L 2BDNL 2P5WE 3OX8A 2GITB 5CP7B 1KC5L 4UTBH 4M93B 1K5NA 1LEGB 4MYWB 5DFVD 1QSFE 2AJ3A 3ROLB 2DF3A 1T04B 5DD0H 3MO1A 5DFVC 3KGRA 3UP1A 4U6TA 1TCMA 3JZ7A 3OZ9L 3CNKA 2W0KA 1FV1B 2A6JB 4E41A 1JRHI 1MSPA 4U1LA 4PY8J 4YZFE 4DUXA 5KSAB 3WHE1 2AEQL 4HFUL 1MPAL 3SE9L 4F15B 1T66C 4HBCL 1Q0YL 1KYOJ 5I1IH 2EYSA 2V7NB 3FB5A 4JRWA 1KPRB 5FYJH 1D5ZB 3UTQB 1FFRA 2OK0H 2R23B 5A16B 2IC2A 5DWUH 1UEMA 1FFNB 3LPGA 1NEZB 3IRPX 1L0YA 4NZUH 3F7QA 3VXNB 4X6EA 3DARA 5C0CA 1ZVHA 3QPXH 3ARBB 3VDBA 2Q20A 3C2AL 3NCJH 1IE5A 2WIMA 1KIPB 1TETL 4DGYH 4MMXC 1P4LB 1NMBL 5J4MA 2D2OA 4X80L 3N1QC 3NIFE 4PJ8D 1CFSA 4PJ8C 4MWFA 1UCTA 1JCKA 5EZOL 3VJ6B 4GSDH 1Q9WA 5ADOH 3NIDF 5IW6A 1DQMH 4YHYC 2ESVA 3CLEH 4TSAH 5IR1B 1H5BB 1FZKA 1XGPA 4LLDA 2VXQL 3WFDL 3MNVA 4K23L 1PAMA 1MFEH 2C7UB 3GSWA 5D5MF 3MRLB 1CLOL 4Y0GA 2OI9B 4EIGB 3GNMH 2Y6SD 2UZXB 5CJQH 5GRUL 2ENSA 2XV6B 2Y6SC 3OPZH 5CSBA 1G9EA 1GAFL 5SX4H 3PDOA 4MX7B 4PJGB 5IW3A 4PIRF 1A1MA 4JFXA 2BHUA 3G6JE 3OKOB 4POYA 5D1ZA 3SN6N 1WITA 5IHBA 4PB0H 3GI9L 4QHKJ 5F1KC 4X6FB 2P42B 4YGVA 5DD6B 3RNQB 5TE4H 2XI9A 2P45B 4HKXA 1MHHB 1LMKA 1ZA3B 2DJSA 3P0YL 3BN9D 5C0RL 1T6WA 3FT2A 1V3KA 4PJ7F 3PHQB 1WBZB 2GK0A 2ZCLH 1DSFL 1WTGT 5TH2B 3MLTA 3RY6C 5FM5M 1J0IA 3PWPE 2AGJL 2Y5EA 2G5BB 2GTZA 5IB3B 1N6VA 1LO3H 4KUCF 4D9LL 4PUBL 1DLHA 4JRYB 4LVNC 2FX9L 4N0UA 2XN9B 1HHHB 1IQWH 2EDDA 1KEGH 4L8DB 4S1SL 1LO5A 5K9KA 2HJFA 5ESQA 3VXSA 2X89A 2Y25A 2QHLA 1UVQA 3TT1H 3SY0A 1MH5A 3LB6D 1HNGA 4ELMF 3LB6C 5CBAA 4ZD3H 1CFTB 5FGBA 4E41D 1T5XA 5B3JF 1JGUH 4NJAH 1QFWI 2W0LA 4L4JA 3WFHA 1MVUB 3TA3C 4YDIL 3IFLH 3DGCR 3N1PC 3MGTB 4ZPTB 1S5HB 1HSAA 2V6HA 2JCCB 3EUUA 3TNMA 2EH7L 1Z9MA 5J6HA 1MQKL 3HC0B 4JQXC 4HF5H 1T0NB 4GG6A 3BAEH 4HXAL 4JM4L 1GH7A 3T4AA 3ARQA 1AHWA 2BFVH 3QXTA 3P9LB 1NEZG 3OMZA 3L3HB 1J12A 1AR1D 4NT6A 1AR1C 4WEBH 1DDHA 3K7UA 4OLVH 4OTXH 5C0GB 2VDML 1MI5D 1AP2A 3NA4A 4P23A 3VMPA 2OJZH 2F5BH 5DC0A 3MV8E 5HVHB 2ESVD 2IPUG 3MLSH 4BK4A 2VZ3A 3UX9B 4ZNEA 5GRYA 4Z18A 1T4KB 4LVHC 4OD1L 1DQLL 4QOKE 1NFDB 1CQYA 5BMFL 4LSSH 4ZUSB 3LHPH 1GHFH 2VL4A 3CDGA 3DSNA 5FAAA 4YHPA 3FQUB 1YY8A 4R0LA 5JXEA 2ZG1A 2W60B 1FIEA 1DCLA 4Y4HB 5ENWA 2OL3A 3TZVA 5EUOB 2YKLH 4HLJA 3ZTJG 5ANMA 5JR1L 2C4XA 1ZANH 5KANG 4HWBA 5D1ZD 3OKDA 1UEYA 2QQNL 3U0TB 4KI5F 3TT3H 2EDXA 3QEUB 3DUUB 5FO9A 1BREA 3P77A 1NJ9B 3D69A 3VWJB 5BRZB 4Z8FL 3HC4H 4HDIB 4IRJA 5FUZL 4YX2H 4UDTA 5KN5A 1U3YA 2ITCA 1ZK9A 1DLFH 2FD6L 1UWEH 1NC4D 5SWSB 4J6RL 1A6ZA 1GGUA 5J9PA 5DEGB 2Y07H 5KSBE 4LARH 1BECA 1S7UA 4G80B 2YC1A 3FT4A 2DYPA 4GLRI 1YEDB 3CVIL 4UU9A 2ZZUT 4RGND 4RGNC 1EUTA 1OAKL 1RZ7H 2IJ0C 4LCWE 3V52H 3MV9E 4UQ2B 4L8SA 2BSTB 3VXSD 2X89D 1J0JA 5CFHA 2OQJB 1KC5H 2A74B 5JUEL 1CDJA 5EOQH 5F89B 5GZND 4LPCA 4R4ND 5GZNC 1QLRA 4R4NC 2LABA 2WWKT 5FGBC 3CVHB 1OCWH 5I1LA 5GSVB 3DI2B 2AEQH 4HFUH 5MEQB 3FO1A 4N5UA 4HBCH 2EIZB 1LEIA 5FK9A 1OPGL 5LGKA 4LLMA 3VE0A 5TGBB 3A6CH 3L5XL 5IM7B 1P7KA 3D2UB 4LOUD 2DWDB 4LOUC 4M6NL 5F7UA 5C0DB 2EDNA 3HG1A 3IU3B 4CVXB 3D3VE 3IKCA 4U3HA 1F2XK 3C2AH 4A6YL 5JHDA 4FQLL 5C0BB 3DBXA 4NKIH 4HMEA 4H88L 3O3AB 1HXYB 4P23D 1NMBH 4P23C 4X80H 4GRWE 1FL3B 1JWUA 4J23A 2HRPL 1MFBL 4OIAA 5EZOH 5ALBH 1UZ8A 4PLJD 5EUKA 4MGXA 1JYVA 4PLJC 3WIFB 4UAOB 1BZ9B 1KLUA 2FHBA 5SWQA 5J1AB 2VXQH 4NQXB 3WFDH 3BRGC 3PABA 4K23H 2R29L 4GW4B 4AIOA 2ADJA 1YQ2A 5FA3B 5GRUH 3NA9L 5JIPA 5JDSB 2H32A 2R0ZL 3IDGB 5JXED 1LEKA 1ZHLB 1GAFH 4R0LC 5JXEC 1O7VA 1EGJL 3FO2A 3TZVD 4M61A 5FOJA 3ARDB 3TZVC 4XAKD 2OTUB 4KXZH 2GJ6A 4K8RD 4K8RC 3JV4A 2VSDA 2JF1A 3HI5L 4FP8L 2AERT 3G08A 3GI9H 5ICXA 2D7MA 4IRJD 1NC2B 5I30L 1BWWA 4I0PA 1ZSDA 1A3LL 4IRJC 1Q0XL 4N0YL 1UB5A 3KVQA 1MCNA 1OAZL 2CRYA 1D5BB 4LSQL 3P0YH 4RNRA 5C0RH 4LSTL 3U4EA 4L8CA 4OZIE 4OQTA 1QO3A 2EYRA 2FX7H 1IKFH 3H2WA 4AENA 2NY1B 3F7YB 4WWKB 4HG4K 2DYPD 3J7HA 4PJDA 4WWID 5GS3A 1M05B 4HUVB 4HKBB 2R1XB 3DMMB 3G5XA 2BC4A 4DW2L 5LQBH 2EDQA 1NL0L 4NRXA 4K94C 5M7QA 3QUZA 4D9LH 5K9QI 4WW1B 2XRAL 3C5ZB 4PUBH 4K3EL 1KBGL 1YDPB 3MREA 5KAQF 3GSQB 1YJDC 4P3CL 4L8SC 4S1SH 5J11C 1BFVL 4FZ8L 1ZKAA 3PWNB 2Z8VC 1YN7A 1KIQA 4LCCB 1JK8B 2M8XA 3OR6A 1N0LA 4GBXA 1HKLL 5DF0A 3RX5A 1I9RL 3WFEH 5D5MB 1KCUH 1KEML 3LKSB 3TCLA 3MA9L 1FO0A 1XH3A 4EEEA 4JEGB 5A40E 4Y5VA 2EH7H 1BIIB 1MQKH 1EFQA 3RIAF 1QR1B 5IEHA 4JFFE 3RJDA 2E7HA 3EOBA 1KIRA 1AFVL 4HXAH 4JM4H 4G8GE 3HG1D 2E9JA 3F12A 3LRSB 4F2MB 5JHDD 2I9LB 4NNPH 3RVXC 4PJAF 2WSKA 2BVPA 1C16A 2XOTA 3WJJA 3ULSB 2PCPB 4N1CA 2VDMH 3L7FB 2QTEA 1S5IL 4G5ZL 4XPFL 1AC0A 1C08A 3O4OC 5JW4R 4PJ7B 3LKOA 4KJYB 1FL6A 4RQQA 1T2QL 1EO8L 5GQBA 2WW8A 2J8UA 1DQLH 2HFFB 2FO1A 1I8KA 2IMNA 3B9KB 4PLKD 1HI6B 4PLKC 4EI6B 3RTQA 1PW3A 1FL5B 3E0GA 4NNXB 4RWYL 2IEPA 2KDGA 3GBML 2RR3A 4JO2H 5HHQB 4IHOB 3FFDA 1FFOB 3IDUA 2NXYB 3GI8H 4JVUA 1IL1B 1RULL 2GJ6D 4YIQA 3MYJB 5JR1H 1TITA 3KNBB 1I75A 4MDIA 4Q58C 4WU5A 2EEAA 1KN2H 4DZBA 4Y88A 5I19H 2NNAB 1AGFA 1RZGB 4H20L 2P24A 1KCSL 1RUKL 2P8LA 1Y0LB 1NGPL 4I0PD 1NGWA 4Z8FH 3LD8B 5I0DA 1N5AA 4I0PC 5D2LA 5IFAL 1UQSA 3RWIB 1R3IL 5C0FB 4IRZL 3KYMA 3N9GH 2JELH 2P43B 4XP5L 5H35B 1QFUL 1CCZA 1V3JA 2RBLA 4NQEA 3CVIH 3MQIA 4OCXH 1OW0A 3RAJL 5ETUB 1TVHA 4GKNA 5DS8B 4LIQE 3A6BL 1NCDL 2ZUYA 4UT7L 3LQAH 2P5EE 4IRSA 4JZOB 1FFPA 4NNYA 1PY4A 3ARFA 5EU5A 2XKNB 4B5EA 5EO1A 4G8FA 3UTSA 3KPSA 1CGTA 1WCBB 1L7IL 4LPXA 4I3RH 3QQ4A 2YR3A 3K1KC 5FKPA 5I74C 2O61B 5C07A 5F70A 3VXOB 2X4UA 2R69L 4L4TA 3QHTC 4WHYH 4YZFF 1EBAA 4YQXH 1JZ6A 3LAFA 2B1AH 2ATPA 2QSCL 4GBXD 2EDOA 1CU4L 5T5FH 4JREB 3PIQB 4GBXC 3HZYB 5BOZG 2EZ0D 5T3ZD 4B0MM 4PGBA 5FYJD 2EZ0C 2PYEA 1EEYB 3G04A 4NQVB 1VEMA 4G8EB 2VNCA 2R1YB 2BNRE 1T80A 1OPGH 2D0FA 4Y5VC 2IANB 5EBLA 1IC5L 3P0VH 3QJFB 3V0WH 2MKLC 3Q6GH 5GGQL 5F1NA 5E1AB 4YDVA 4M6NH 3C08H 1KCVH 4Z7WA 4AM0B 2W9EH 2HT2D 4I5BA 5F88B 3EFFB 2HT2C 3ZSTA 4A6YH 1Q9KB 1BFSA 2ZOKB 2JE8A 1JTTA 2X4SB 4H88H 5CBEB 1CFVL 3M8OH 3FOMA 3MRJB 1A7BA 3ZE2E 3PQYE 2C1PA 3RBSA 3EYOB 3IETB 3UMTA 3B3IB 2HRPH 2WMPA 1MFBH 4XNUL 1EHLL 3MNZB 2ID5A 5EIIB 5C6WH 1JGEB 3MLZH 2IQAB 4LPVA 2AK4B 3LKNB 4WTZA 2GTWB 3L3GA 2DQCH 3HZVA 2RB8A 4LNVA 3QFJE 4NC0B 2P8MA 1A4JA 2E7BA 4P4RA 4H5SA 5BO1L 3RWJA 3EO1B 4NUGH 3T2OA 1EAPB 3DVNB 3MRGB 3WIIH 1EGJH 4G7VH 1J18A 4BZ2L 1OY3B 1JMZA 1SJXA 3SJVE 3WO4B 2DDQL 1JHKL 5HY9B 3ZTJH 1NDMA 3RHWF 1RFDL 2XZAL 3HI5H 4FP8H 5ESVA 4XB8A 2PW2A 5F7KC 4IOIA 1OWWA 5ITFB 3SKJL 2DWEA 2IBBA 4PJIA 4C58B 3CPLB 2EDEA 3SE8L 3D18B 5I30H 1A3LH 1Q0XH 3KWWA 4XVJL 3WXWH 1OAZH 4K9EH 4C56E 2NMSA 4BZYA 1NGYB 4LSTH 4P2YA 3L3JB 5BVJA 5LKNA 4P9ML 3CSBA 1FC2D 3MACL 1JPGA 3X14A 4OCSL 4ZOBA 3T8XA 3TO2B 4P5KA 4GQ9L 1DANU 4DW2H 4PRNB 2GJZB 3NAAH 4IRSD 2HJLA 1KTRL 4XC3L 3ARFD 3OKYA 4IRSC 3ORJA 4K3EH 3FRPG 2EYTB 1KBGH 2A6DA 3UTSD 3KPSD 1P1ZA 4OB5H 4KWUA 2VE6A 4Y4FA 5C0AD 4FA8A 2AEPL 4P3CH 5EU6A 2A9NH 1LNUB 5C07D 4FZ8H 4RISL 4L4TD 1M7IA 3QUKB 4GW1A 1EJ6A 4AEHL 4XCNB 1OSZB 3D25B 5HYEA 3F7VA 4FQCL 4XPGL 2HN7B 3DNKA 5E08L 3CFKA 3ARGA 1BFOB 1Y6NR 1YQVL 4ODHL 4Y4KA 1HKLH 1I8IA 1M7DB 1A7QL 1I9RH 2PYED 3MJ6A 4MB3A 1KEMH 3OBAA 4NQUA 1WWCA 2B4CL 3MA9H 4WY7L 2VLME 4WFGE 2IWGA 5D72H 4NOBA 2IPUK 4QT5A 2AAVA 5HGBA 3NOIA 3THML 2F8VA 4KXZI 5KVFH 3GB7B 4P4KA 1VGKA 2WQRA 2H6PB 5D70L 5K9OA 3T2NH 4D0DA 3U83A 2WUCL 1DUZA 1AFVH 2GCYB 4GUPA 3G6AA 4E42A 3EFDL 4TVSa 5ELIA 4FNLL 3NCYP 2EE2A 5CZVH 3WS3A 4BM7A 4QRTB 5DEFA 5IQ9A 4HWZA 4EOWL 3VGAC 3S4SA 1IC7L 1CDBA 3RWCA 1S5IH 2R0LL 4G5ZH 2IALB 3DYOA 1Q1JL 1TTFA 3H9SB 5F7MC 4YC2B 4HQQL 3QDGB 4YBLC 4Z6AT 5ID0A 1T2QH 3RL2B 4PJHE 3HS0B 5HPMB 1MLCA 1EO8H 4EVNB 4FFYL 5D7SL 5DK2B 3IF1A 3PF2A 5DLML 4I3SL 3EYFA 3RDTA 1F02I 5HGGS 1AO7D 3GBMH 4PGCA 1RHHB 3SPVA 1S9YA 1J1PL 4PJBA 3QH3A 3MRFA 1CXKA 4ETQA 4XNMB 4PTTA 5D1QA 5KSUA 1TQBB 1GRWA 4LSPH 5DVOA 3DX9B 3FMGH 1EEUA 2AXFA 4LAQL 5IEKB 5L8JB 1KCSH 1B0RA 3GMLB 1NGPH 2ZSVA 2WM0A 3BP5B 2NY4B 2AW2A 4PV9A 3P4NA 1QSEA 5KSBF 4JPIB 5CEZE 4HUXB 1MJJA 4JFDB 3JUYA 1EFXB 5SWZD 4YHZL 2DI7A 3RAJH 3SKOB 4IOSD 4PJAB 1D5IL 4IDJL 4DAGH 5EU6D 4BSVA 4L3EA 3UBXB 3LCYA 1W8NA 1I85A 1JWMA 1LK2A 4HH9A 1IEAB 1N8ZB 4OFYA 3QCVH 3VGDA 4F7MA 5JW4M 4R90L 5GGSB 1BZQK 3ARGD 4ZUVB 2WIIB 3O4LB 3ARGC 1QEWB 1HZHL 3AC0A 3R0MA 5ISZE 3VFSA 1PEWA 3DSFL 3CVHH 1MRFL 1UWXH 4U2ZA 1XGQA 4LSVL 2V2XB 1ITBB 5LWYL 4XZUB 1P2CA 2CLVB 3AY4A 2QQKL 4PBXA 1O0VA 2DQGH 3V5KB 5IVXF 4P4KD 2XQYG 2EICA 1IC5H 4N0FA 4P4KC 3SDYH 4MNGA 1W72L 5GGQH 3DVIA 1CD1A 3DXAA 1PKQB 4Z5RA 2HRLA 3W0WA 1RZJL 4PTUB 3TBYB 2J8OA 4GRWF 3SO3B 1BVLA 1QA9A 4X6DA 4TUJA 1CFVH 3MRPB 4NJ9H 1JVKA 1PYWA 4YAQA 4M5YH 3IU4L 1EMTL 3I02A 4XPAL 1MWAL 4XNUH 2VN7A 1EHLH 3ESUF 4NM4H 4K3DL 2NX5D 4RAUA 1CD0A 3W9EB 5F1OB 4KRPD 3QR2A 3WFZA 3FONA 4KRPC 3PL6B 3RDTD 5IG7B 1RZKC 5ADPL 1D5MB 3MLUL 3RVWD 1B90A 5EG6C 4FTVD 4EQ3A 3RVWC 3PNWA 2E9BA 2GUOB 4EN3D 5BO1H 4Y7MA 5HYSB 3W82A 4EN3C 4FQXB 4Y2OA 1QSFB 1YEIL 3L3KA 5KAQG 4NKDA 3MUJA 1PZUB 1S3KH 1NFKA 2BVOA 4BZ2H 3GSOB 4U3CA 4YNYA 6CGTA 1JHKH 1FG9C 5D1QD 2NW2B 2WBWB 4R7DB 3HC3H 5D1QC 2I5YL 3LEXB 2XZAH 3QUMB 4E41E 1N6QH 4Z7UB 1R5VB 4GXUN 4P2RB 4PJXA 4ZFFB 1JFQL 4U2YA 5DJZA 3SE8H 4OZIF 5GRZA 2FO4B 1Z2KA 4XVJH 1QSED 3TBSA 3TYFB 4JKPL 3EO9L 2HKHH 4UQ3B 1HH9B 1CLYL 3VCLB 2XNAB 4OIIL 4P9MH 4XX1G 3HZMA 3D1MC 2Y7QA 1RK0B 4OCSH 4P57B 5DR5L 1K4CA 1QFOA 4ZNCD 2G75A 1KELL 3NMEA 3QCTH 5KS9F 2VDQL 1AIFA 5C0IA 3DRTA 4GQ9H 3RPKA 1I7TA 4DOHE 3MRDA 5J12B 4XC3H 1WV7T 2MPAH 2GITA 2Q1EA 5D7JA 2CDFB 3QHFH 1MCLA 5FO8A 3QDJB 5T1MB 1LO0H 3UBXG 1LEGA 1MI5E 4CU8A 4X4YB 3ROLA 2W9DL 1HHKB 1T04A 1I85C 2VAJA 4OFYD 1BP3B 4X6CE 4AEHH 4HG4J 4H25B 2ESVE 5EZIL 1A21A 4RIRB 1ZTXL 4XPGH 3VXRB 2A6JA 3FRUB 2GT9A 5E08H 3VG9B 3IDJB 3U7WL 2ATKA 4ODHH 2EH8L 2X1WL 2FZ3B 3ET9F 3MJGX 4U1KB 2P1YA 3REVB 3ULUE 2DAVA 3G6DL 2B4CH 4HW6A 3GMNB 1WWAX 4FQPA 1D5ZA 4L3CB 1G84A 2JJWA 4LFHD 3THMH 5A16A 3W5NA 1FFNA 1WEJH 3CZFB 2QQQA 4WJ5B 1ZWIB 5D70H 3VFMB 4U1HB 4HS6B 3DXAD 3SCMB 3EFDH 4ZFOL 3QDMB 3WLBB 2FBOJ 5E1HB 4ZOCA 3BVNB 2DQJL 3BD4A 3V6ZB 3C8KB 5TFSL 1OGAB 2FIKB 4EOWH 4GAJH 1IC7H 3QCUL 4YFLF 3RA7L 3VJ6A 5CEXA 1R24B 1Q1JH 3QA3B 1ZLVH 3CH1A 1H5BA 1I3GL 4RFNC 4HJJH 2VL5B 3V7AG 1D6VL 2C7UA 5D7SH 2FHCA 1HWHB 1T7ZA 3MRLA 4RGNE 5DLMH 1VPOL 2OZ4A 4S11A 4EXKA 2K7QA 2UYLA 3AUVA 3ZKSD 5I1EH 2GHWB 4TNWF 5IMKB 5HYSG 4MX7A 4PJGA 4O4YH 5EZJB 5HD8D 5IW1B 5HD8C 2E6JA 4LEXL 4X7EC 3BPOC 5FYLL 1GZQB 4X4XA 5GS1B 5TDPA 4NHCL 1U6AL 4X6FA 5F71A 5MP6L 3ARRA 3OB0K 2X5PA 3RNQA 4XCYA 3I6KB 4C54A 2ARJQ 5E5MB 3V7MA 4PJEE 5E5RB 1MCWW 2A73B 3TIDA 2C26A 3KPPB 4KTYA 3PHQA 1WBZA 2B0SL 2VXVL 4LLYB 4L4VB 1JE6A 4LDOB 1NGQL 1AD9B 2R0WH 3MODH 1QR4A 3ZE0E 3CUPB 3X13B 2G5BA 4UOW1 2PW1B 4GG6E 2HVKB 4GJTB 3LQAC 4U49A 2VDPL 4WHTB 4AEFA 3BZ4B 1QFHA 3NCCB 1W0VA 1FLRL 2F15A 1HHHA 1L9NA 4FG6D 4L8DA 1D5IH 4IDJH 2MFNA 4FG6C 4UTAL 5FYKU 3SBWC 3MV8B 5F44A 4Q9BA 3VD4A 5ICYB 2WNGA 2HMID 5I2IB 2HMIC 1CFTA 4ZNEE 4R90H 3VD5A 2FGZA 4I9WD 4R2GD 5KSAD 1S7TB 1B0GA 3NCEB 4R2GC 5FV1L 5KSAC 3CLFL 1I4FA 2BHYA 1CGYA 3IYLW 1N5YH 1OAQL 1MRFH 4ZPTA 1S5HA 4LSVH 2JCCA 5ACLA 4WUUB 3OJDA 1ZLVK 3HUJE 3D48R 1MVFA 1RZIB 4EUPA 1XF5B 4OJFL 3UZVB 3FB7B 1T0NA 5ANME 4LSRH 1ZLSL 1C7SA 4OGXH 5E5UB 3NZHH 2B7DT 3ZDZE 1HQ4B 1LP9A 4X7CC 1RIVH 4RCAA 5J0BA 4CNIB 5C0GA 3BOVA 3GHEL 2XT1B 4P2OA 4LLQA 4NHUB 1ONQB 3CMOL 1AXIB 1EMTH 4BQ9A 5KSBB 4PGZA 5F7LB 1OGTB 1XR8B 2PKDA 1L6ZA 4X7FC 1T4KA 5EC2B 1H5BC 3W81A 1LE9B 2COQA 4PJ5B 1VFUA 4JO3L 1NFDA 3BDBA 1OD7A 2LU4A 2OI9C 3TCXA 1AJ7L 4LCWB 2G60L 5ADPH 5DJYA 3LEVH 3MLUH 1CFBA 4LCYB 2E6PA 2W60A 2EECA 1YEIH 2ILLA 4HS3A 3WFCL 4NO0B 1L0QA 3U0TA 5M95B 3QEUA 3HAEA 3LH2H 3GBNL 4H26B 4TSBL 3BE1L 2IPTL 2VZTA 5ESAB 5BRZA 3VWJA 3RGVA 3D85B 4HDIA 3E3QE 4K9EC 4UIMA 4KHXL 3HNTH 3GMQA 3SKNB 1PSKL 5IOPA 4MCYA 2BX5A 3MXWH 4IBLT 1X7QB 5DEGA 1E4WL 4OIIH 3NIGE 5IVXB 2QSVA 5I8KH 2KQNA 4S1RH 4PRHB 4GKOA 4AQ1B 2IAMA 1P9MA 3L1OH 4OLYH 2XZCL 1U8PA 3B5HA 4NRZB 1T7WA 4JRYD 1MHEB 5GGTA 2OYPA 2F8XC 3HG1E 5JHDE 1YMMB 4UQ2A 3INUL 5C7XL 4M7KL 1FNEB 2H3NB 3V8CA 4JFPA 5D4QA 2AKRB 3KLHD 3VI3E 2GEEA 1YEEH 2H1PH 3KLHC 5EZIH 2CIKB 4LKCB 4U05A 4XXCC 3CVHA 1F42A 1JGLL 4D8PB 5TQ0L 2VXTL 3MROB 3Q3GB 1F4WL 1K4DA 4R4BA 3BH9B 3U4AA 4HUNB 3GHBL 3D2UA 3V5HB 2GJ6E 1QOKA 5EDXA 1T20B 4N8VB 5DHVA 1W2KT 5I66B 5C0DA 4PY7B 3HI1B 5E6ZA 4RX4D 3ZHLA 4CVXA 1F8TH 2MQCA 4HCRH 1ADQL 1U2HA 5GIRA 2LTQB 1BOYA 3K4ZA 2FR4A 1INDL 2Q3AA 2DQJH 3NFSL 4OZIB 1J5OH 4P2OD 1UKQA 1IAIM 3FOLA 3RA7H 1SY6L 4KK5D 1UM5L 4KVCL 4PJHF 5HVHC 5F1IA 2V2WB 4KK5C 1I3UA 4TNVF 3OG4B 1SYSB 1UWGL 3FTGB 4PRAB 3KPLA 3WIFA 1BZ9A 3V95A 4NQXA 4OLEA 4PJDE 1I3GH 5TQ2L 1BIHA 5KS9B 1D6VH 1NKOA 4U1MB 2BVEA 2R0KH 2UWEF 3DO3A 1VPOH 4JAMB 5JDSA 3U9PH 2GSIA 3GMPA 5KSVB 2G9HA 1T1XB 4JO4L 1Y6MR 5E0QA 1ZHLA 5CKGA 1HOCB 4KH2A 2OTUA 1H3GA 3UTTB 1WAAE 3U48A 12E8L 3O0RL 4LEXH 2X42A 5HHPB 4AG4H 5FYLH 1H3UA 4KKBC 1K8IB 5CUSL 1N3NB 4NHCH 3UZEA 2JB6A 5BRZD 5MP6H 3VWJD 5DURD 3LDBB 3HMWL 5CINL 2VLRA 3RGVD 4UT9L 3VWJC 1NC2A 4DVBB 3EYSL 3KXFE 3R1GL 3EGSB 5T3ZE 5FYJE 4XVTL 5E4EB 2DB8A 2B0SH 1E6JL 1T7XA 1TVBA 1JNHB 1J8HB 1GOFA 4WWKA 1EEQA 1M05A 5HJ3B 3DMMA 1P9MC 4LKXB 5IVZA 3REWB 4Q9RL 4AQOA 4WW1A 2VDPH 4X9GA 1YDPA 4XBGB 4KZDL 4BZ1L 4Q6YA 4UTAH 5FB8B 1JP5A 2XQYK 3V79C 1UM6L 3PWNA 1ZT1B 3JV0A