43CAB

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
b'QVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 25
structure length 117
sequence length 117
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caB00
4DGVL 2R4SH 3NOIA 1XIWC 2P5WD 4MAYC 3CLEH 1QR1A 4LEXL 3DHJA 1UWEH 5F7DB 5SX5K 4EDWL 1WZ1H 4FQCH 5TF1L 4LCCC 2GSGB 1FE8L 4YPJA 3BGAA 4KROD 3BW9B 3EZ8A 3X13B 1CGUA 3IKCB 4OM1H 2QSCL 3TJHC 5F7LB 4JAMA 1JMXA 1HKLH 2GIYA 1LO0H 3TPKA 3GSRA 3E6HA 3FZUC 1G0DA 4W81A 2OP4H 5D2NA 1GC1H 5DC0A 3QEHB 1TCRA 5MP6H 1RZGA 4WW1A 3KNBA 3LH2L 1QVOA 5JW4Q 4WU5B 4HS6A 1REIA 4ZPTA 5F71A 1SEQH 3LKOA 3CPLB 4YBQD 4D9LL 3RKDD 3NN8B 1K5NA 4M9OA 3H7BA 1W2KT 5MENB 4HIHA 1T1ZA 4XNXH 4OZGF 2QADC 3RQ3A 1MFCH 4WO4A 1IAIM 1BGXL 2RCSL 3U0WH 1GGIL 4XP1L 1CFNB 1D5XA 1WF5A 1XF4A 1RU9L 5CEYA 4Y1AB 4ZFOL 4DKAA 4N8PA 1KLGB 3RNKB 5CWSA 3IU3B 5DDHB 5GRWA 1W72L 4RQQB 2DYPD 3N85H 5IV2A 1J05B 4TQEL 2L7JA 2HRPL 4GJTB 2KL6A 4QRPA 5F7MC 1U3HC 1FZJB 1JGVL 4QNPE 2EDRA 3MRLB 5DD1L 5MEOB 4I1NB 2IQ9L 4F9LA 1A6ZA 3D2UA 1IARB 4PJGA 3FO0L 5ICZA 1VSCA 4XTRC 4NQVA 2ZPKL 3TV3L 1CF8H 4KU1A 5JPNB 4KH2A 1FFNA 2FYYA 3AU1B 4KGJA 3WL9A 4QOKA 4FQLL 3HNVL 3MFFA 1X4ZA 1QA9A 2Y72A 4OQTL 5MERA 4JO1L 1T80A 1HSBA 1TTUA 5FOBB 4P9ML 3VFGL 1A9EA 4LLDA 4CVWA 3VD5A 2GK0B 3GNML 5E6IA 5GIRA 4HCRH 1MJJA 4JPKL 2XFXA 3AAZA 3C8DA 3BVNB 1FNHA 5C08B 3BPLB 1IAKA 3DSNA 3MLUL 3MRJB 4GXUM 5JO5B 3OXSA 3DMMD 3GO1H 2BC4B 3QG6B 4PBXA 5D7SL 3B2VH 4PRHD 4Y5YC 5FDWA 5GS1A 1A7NH 1FV1B 3EYOA 2VB5A 4C57C 5GS0C 1ZK9A 3OKKB 4ZFOA 4XNYL 3O6LH 4X6CA 3EDEA 1MPAL 2NR6D 1CICB 1T7ZA 4Z5RA 3RVTC 4G8FA 2P5EB 5JDSA 1W72A 4NQTA 4XP5H 2EDNA 3BUTA 4ZO8A 1QFPA 3D39E 4P23D 3I3EA 1HHKA 2PTTB 2A6KB 2QJDA 4JFDB 2BP3A 4Z8FH 5HDQH 3UZEA 5LGJB 1KT2A 4NKOB 3GSNL 3VGDA 2BRQA 3AY4A 4X80H 1GH7A 3HE7A 4MGXA 5DLML 1TFHA 3ULVL 1DBML 2APBA 3VD3A 4HKXB 3CAFA 3O0RH 1DE4B 3MRFB 3MOAH 3TM6A 1VACB 4OSUL 2YN3A 1WFNA 3OG4B 2OR7A 1C5DA 2X70B 5D2LA 5C0IA 2PF6A 4G7YH 1NCNA 4JR9L 5KOVC 2H2PC 4OQTA 4HWEH 2R1XA 4LNVA 1L0YA 1NGZA 5IHZA 1IFHH 1UM4H 3DX7B 4ZFFB 1S7UA 3JUZA 4X4MA 3SBWC 2M8XA 1DQML 4WW2F 4LEOB 2VLMD 2CIIA 4XGZB 1L7IL 2P8MB 4JFZL 2OZ4L 5B21A 2ZNWA 4WY7H 5J12C 5DQ9B 2R0WL 4QRRE 4CU6A 2B1HH 2DQJL 2VXVL 2V7HA 4OF5A 2X9XA 1F3RB 3MOQA 2H26B 1YJDC 1PG7X 2FLBT 3BUYA 1T5WB 4MVBD 2XQBL 3MODH 4PRBA 4NN6C 1IC7L 2BVUA 4PJ9B 5GGRY 3O9WC 4WGVB 2V17H 1R5IA 3WFEH 4UBDD 5FUOH 1LDPH 2P5WE 3O3UN 4JFHE 4PJFE 3GMQB 2FJFB 1VEPA 4FG6D 5IT2L 1CYGA 1AGCA 1MEXH 4K71B 4R7NB 1Y0LA 2R9HC 3GSNA 1G7JB 3BHBB 5FGBA 5T3XH 3WIFA 1MCQA 5EFIA 3IDXL 3DI3B 5DRXA 3KLAA 4LLAA 4X6BB 5D72L 1TETL 3HMWH 1A1MA 4KKLC 2OK0H 4GS7C 4UOW1 3NCJL 2C1OA 1U8JB 1IGFH 3O41A 3O45A 3FT4B 1KN2H 3MO1B 1PJ9A 5T3ZL 4EI6B 3FO2A 4XB8A 3NCYS 3G5ZA 5C0RH 2YZ1A 4K9EH 1XF3B 4Q9CA 3GMNB 4XHQA 2OZ4A 3IFLH 3VFTA 2BY3A 5BZDB 1JNHB 4MAUH 1SJXA 4MJ5B 5AZEL 4YHKH 1V7NH 1KJVB 1QEWB 3DGGB 3NFNA 2G2RB 2VXUH 1QSFA 4Z6AT 1OP3K 2X4OB 4WCYL 3U0PA 3BH9B 1KYOK 4AEEA 5IB1A 1T1WA 2WK2A 3GSUA 5ESQB 2EXYD 5EIVA 2YMXL 1NKOA 4TULL 4NQDB 4HIJA 3O4OB 1FL3B 2HLAB 3VFWB 1CIDA 1G7MA 1T5XB 2VDML 3D5OF 4FQQA 4Q9RL 3HFML 3ZE1E 4PJ7F 3O8XD 4PJXB 4CMMB 1HWGB 4RMRA 4GOSA 1RMFL 2X4NB 1IM3A 5DMGD 5A2FA 4KZEH 2HG5A 4WI6A 3H9HB 1DBKL 3F7YB 3JV6B 3LQAL 3KPSA 3GIZH 2P7TA 4I0PC 4WUUA 4ZAKD 3C6LC 5JIKA 2SEBB 1U8HB 4MD4B 3KPOB 5ERWA 2Y36H 2RR3A 4U31A 4YFLI 5FCUL 3JTSB 2FH8A 5EBWB 3FQTA 5D7KD 3P11L 4RAUA 2ESVA 4F15B 2WP3T 3IDMA 5HVHB 4C4KT 4PRIB 4XP9H 3S34L 5B8CB 3THMH 5KTEL 4H0GA 2PXYA 3WNMA 1OVZA 5BVJA 4PRHE 4WO4D 4XI5C 1EFXB 3B83A 5A2KH 3RU8H 4M93C 4X9FA 3NAAH 1PY4A 4U1IB 3C09B 3EOTH 3BP5B 4CVZA 1NEZA 1N4XH 2YZ8A 1MLBA 4HK3J 3WV0A 3VG9C 4JFEB 5E4EC 4Y5VC 2ENYA 1RZJL 3VFMA 4PRPB 5HHOD 4KFZC 5MI0B 5BW7C 2A0LD 4IIQA 5HGDB 4XVTH 2DLIA 4EIGB 4JFQA 1OD9A 4XXDA 3F62A 3EYQC 1L6XA 1I1YA 1ORQA 3MLTA 5J3HC 3H3PL 1BFVL 1UJTA 4F3FA 4P2QD 4TSAH 5DRWB 3WN5C 2EECA 3D2UD 3WEXB 5JW3H 4M3JA 5E0QA 4K3JL 3I84A 4HPYL 4FMKA 1OTSC 4P5MB 3S35X 5C09E 2DQDH 4U6TA 1X6NA 5I1HL 5E08H 5LBSL 3MC0A 4QOKD 1T83A 2DB8A 1X5KA 2G9HA 5DEFA 3VU2A 3RTQC 4ZXBA 3MROB 1RZKH 3D9AH 3UTSA 4HD9A 3TVMA 1AD0A 4BH7B 1RJZB 1T1XA 3BE1L 4OGXH 1NJ9B 5E6ID 3GI8H 4M1CC 3MRQB 4HIXL 2NNAB 2PO6B 1JWSA 5IGXH 1T0NA 4V1DB 2GT9B 3FQRB 3JWDC 4G9DA 4F33A 2XZZA 5F96H 1BOGA 2KBGA 3UYRL 3RWHB 4Y88A 1U95B 2J8UF 4NO3B 3VFUB 5EBLA 3TBVA 1XT5A 5AZ2H 3EJJX 4MXVE 1C16A 1JPTL 5DJDB 5A2LH 2NXYC 4OZHE 3ULUC 4DUVA 2QKIB 2XTLA 1KG0B 3DJ9A 2JF1A 3IGAA 3DIFA 4JPVL 3EYFA 2ADFL 3JVGC 1S7WB 1CD1A 5DWUL 3P4OA 2H3NB 4KKBC 4Y89A 4LAJH 1UKSA 3RI5F 1DEEA 4QRTB 5JHDD 1CLYH 3F5WB 4M43H 4HUNB 3RGVD 5HVGB 1QFUL 1MAML 3CCHB 4Q6IA 3VE0B 1WTGT 1P4IL 5E95B 1RI8A 1A5FL 2QSVA 5EO9A 5K33A 3VXSB 2FECL 1CT8A 4NN5B 2BXZA 5CINL 1KJ2H 3ZDXF 2XQYG 4J8RB 5CJXA 3EFDL 1CLOH 1I9EA 3FQUA 3BZFB 3M1BA 2JJTC 4DVBB 1X5GA 5KS9E 2DBLH 1XGQA 4OB5H 1X4YA 4QXTA 5SWQB 3KPRA 5EWIL 2CIKA 2VL4A 4YK4C 3T0EA 3TO4A 5JW5B 3EDFA 4H5SA 5FDYA 3HR5A 1B90A 1IC4L 4LSVH 1I3GH 1MH5B 2FZ3A 4X6DE 3BKML 1OSPL 1NGPH 4XPGL 4L4TB 5CAYB 2Q7YB 1QYGL 4JANA 4OZGB 1MF2H 3B9KC 4GSDH 4I18C 3VXME 1LO3L 1MHCA 2ADJB 4LP4A 4V2BA 4K3GA 4NKMB 3IETA 4IS6A 1EAJA 4HGWB 3MJ6A 3SDAC 4CKVX 1FVCB 4ONFH 5TFSL 1G6RB 4RISL 2OJZL 4WNQB 5HY9A 4DVRH 2F5AL 3JBG7 4OLZH 2YSSB 2EIZA 1KB9J 3C60C 5EA0L 5F93C 1N5YH 5FGCB 1U2CA 1A47A 2C4XA 4L8SB 3L1OL 3GM8A 1GGCH 4JO3L 4XBEH 1T89A 4M00A 2RHEA 4PG2C 3WNOA 4C58B 4Z95L 3ULVD 2EDLA 3ARVA 4MXQC 4JREC 4ZNCD 5F6IC 3NVQA 3IJYA 1JHTB 1KJMB 1Q9OB 1F3DH 4XXCA 4ZTOL 3CFBB 2DM2A 3B43A 5D2NE 1BQHA 5KW9H 3RZCB 4JRYA 3ARBB 3L7FB 4D8PA 4L9LA 4PGEA 3K81A 3MV7A 1ZLWH 5D7KE 1XR8A 4OUUA 4XC3H 1SYSA 12E8L 1BFOA 2WV3A 4U1LA 5IG7B 2IANA 3VJ6B 4WWKA 1QBML 2WQ8A 1JFQL 3K1KC 2EEBA 2EYRA 1N7ML 3DYMA 1S9WB 3TT1L 3CFIC 2CH8A 3QUZA 4PG9B 3BZEB 5I66B 3CSBA 4NIKB 1CR9H 2YD8A 1NH6A 3KJ4C 1C8PA 5ID1A 3V0VB 3FQWB 4JN2B 4YBLC 2EDBA 1QSVA 1F4HA 3A6CH 3V5HB 4X9IA 3TBSA 4HK0A 4R96B 1RUPL 5DRZA 1AI1H 1QSFD 3HC4H 1A22B 4FMFA 5F21B 3BT2H 3LDBB 7CGTA 4NGHH 2NY0D 1NBVL 4GW1A 2R1WB 2XRAL 4KQ4L 5EC2B 3GJEB 4QRPE 2W07A 4X8JB 3V7AG 2ZUWA 1X5XA 4WGWB 5ILTH 2IBBA 5KVEH 4UINH 4P5KA 3MLRH 1G6RH 5IVZA 2V2WB 4UDUA 1IGCH 4PJGE 1XIWA 3ZT7A 4MAYA 5I1JL 1MJ8L 1XGRB 1Y6KR 5TH2A 1A7QH 2YWYA 1AXIB 4LCCA 3O11B 4QOKE 4LSTH 4Y2OA 1LK3L 2X4RB 4KJPD 1I7RB 1FPTH 2VDPH 2WLZA 4NNXB 2B8OT 2WW8A 3KPSD 2EZ0C 1LVEA 4OZ4A 3U9PL 1SHMA 5T1MA 3O6KL 1F5WA 3O2WH 2I9LA 3WBDA 5F7EL 1FG9C 3LIZL 4QXUH 1IVLA 2VDLH 4YHYC 4M6OL 1YNKH 1JGLH 4WW2B 1Z3GH 4TTGA 4G8GA 3ES6A 3KYOB 5K9OA 4EI5B 2HVJB 3R8QA 2PXYD 2H6PB 5GS2H 3LAFA 5ESVA 2BZDA 2PW1A 4RNRA 5C9KA 4TOYH 4HHAA 5KOMC 3T2NL 4X6CE 1H3TA 5DHVA 4NBXB 1UKQA 3WO4C 3TO2B 2VITB 1BAFH 5T1DL 1G7PB 2GITA 5CP7A 2BSTB 4HIEA 2NY3B 3FOLB 5IJVA 3NTCL 3RDTD 2NY5C 2YK1L 1OP5H 2AEWA 4P2RB 4DGYH 5F9AC 1T1YA 3AROA 1H8SA 1K2DB 4GBXB 1A7RL 3UPRB 2D31A 1U3HA 1DLFH 5SX4H 1ED3A 4NNPH 3HE6B 1UWEL 2AEPL 1JGDA 4OTXL 1EXUB 2IG2L 4JQXC 4OM1L 1BZ7B 5D2LE 3QJFA 3WIHL 5J4MA 1HKLL 3QIBB 4HX1B 3X3FH 1BD2B 4YXKH 3IF1A 4X4ME 4ZXBD 1J87A 3PXJA 3UTSD 4HC1H 2W0FA 2X5PA 3KDMA 4TVPH 3ARDB 4JDTH 1YN6A 1S7RA 2AW2A 3QWOA 1TJHH 1BBJB 1MWAL 1IT9H 2B2XH 5EULV 4GRWF 2CO6B 4Y4HA 2HT3C 1IAIH 1UQSB 4XNXL 3HRPA 1CL7I 1JYWA 5F89A 3U0WL 5C0AB 1ONQA 4PYGA 4LPCA 3G5YB 5J1AA 1I8IA 4P57A 2VDNH 4M62L 1P84K 4Y5YA 2I27N 4RGNC 2D3VA 4YEFA 1TZHA 3U4BH 5KJRH 3GBNL 3JWOH 4G43B 1DVFA 3N85L 4IOIA 3BPCB 4JM2D 1KPRA 1AC6A 2Q3ZA 3PL6B 4OBRA 4PTTB 1QSEB 1UEYA 3ULVE 3QIWC 4X7EC 1D5IL 2CLVB 4PJ7B 2VR4A 5EN2B 1XR9A 1IGYB 3SDYL 3HHRB 1QFWI 3WIHA 4ODXA 2DKUA 5D7IA 1I1AC 2IH3B 2VE6B 5E2VH 4DGIL 1X5ZA 3UTPD 3Q6GH 4ZUWA 4L4VA 4EVNA 1DBAH 2CUMA 3W81A 4ZNEA 4Y16C 3IVKA 1R0AH 3SBWA 1YY9C 3G08A 3CFJB 3IDYC 4RMTA 2P1YA 1WAAF 1MWAA 3ZYOA 3TO4D 4X5LA 1KV3A 5E9DA 4HS3B 4JGJA 3ULSB 3KS0J 3KVQA 3V4VL 4M1GH 3GO1L 2R2EB 1S9YB 1HHGB 3B2VL 1QSFE 3HZKA 4XPFL 3L5HA 1E4XL 1CGSL 2FR4A 1ZVSA 2ZP0T 3D3VA 2DQFA 4U1SA 4GW5B 1PQZA 4P59H 1LO2H 3NBNA 4MA1C 4R97B 5HPMB 3O6LL 4JN1L 2VRAA 2IEPA 3F12B 5DZNA 2IH1B 2WMPA 3U7YL 3MUJA 1U93A 2V5SA 9CGTA 4OFYA 3C5ZD 5CMAA 3O9WA 4XP5L 1AC0A 2DS4A 2ATKB 5DVMA 4XCEB 1BIHA 4Z8FL 1NGQH 2BK8A 4QHUA 4X7TA 3DX6A 1HHIB 1WITA 4LCYB 5L2KD 3E2HC 2IAMB 4X80L 3MBEB 2OBGA 4NP4H 3S3JA 5D93C 1YQ2A 2D7PA 5ACLA 3MOAL 1NQBA 4JG0H 3KPSE 3KPMA 4WUUE 1TZIA 4JRYD 1M71A 2VL5B 2YPVL 4Y19D 4MNHB 1T66D 2OTWA 5ALBL 5E1AA 1GL4B 4OF8A 1IFHL 3IAPA 3DROA 2G5BA 5BO1H 5T3ZE 2VKXA 2ESVE 3L5WA 4JDVB 1YEHH 4RAHA 4NO5B 4Y2DC 3G6JF 2ITCA 1ZXQA 1U92A 4YHLH 3MA7A 3U30C 3U1SH 1CFVH 2VZSA 3QO0B 3MLSH 3L95A 3QUZD 4WY7L 1ZGLA 4E41A 3ZTNL 4BH8A 2B1HL 1BFSA 1B0RB 5C1MB 2BNUB 4ELMA 3PIQA 2WP3O 5IMLB 4C4KO 2J8UB 5I1GL 1UJ3B 2GQHA 4U2YA 2DLTA 2P44B 4UZGA 3RVWD 3RWDA 3ZL4L 1QFWM 2VDKH 4KVCL 1YEEL 5GSRB 2V17L 2XKSA 3WFEL 3EDJA 5F7FA 1LDPL 1R3IL 2BJMH 3MV8B 3OKEB 4JLRA 3FHQA 2NY1D 4HBCL 1MEXL 2CKBL 3H9SB 4KI5D 3PGDB 32C2B 5ACZA 5GJTL 2PKDA 3TBTB 2DI7A 4K8RD 4XX1G 3O3EA 1FIEA 1F4AA 2X4QA 4IRZH 4KTEH 2BVPA 4HEPG 5B38A 4XCYB 4ZUVB 4HWBH 1A4JA 3PABA 1KENH 1A4KA 5D1QA 2ED8A 1CFSB 2OK0L 3UTSE 2F19H 5ACMA 5DTFB 1YEDB 2LVCA 1IGFL 3FZUD 1NKRA 3U46B 4JY4A 4I0PA 4N1HB 2DWEB 3C6LA 1KN2L 2C9AA 1K4DA 4AT6B 4CGTA 4HF5H 4S1DD 3RWEB 1OW0C 2OTUA 5IR1A 2JJSC 1C1EL 3IDGB 2P24B 4OQ1A 3U4AA 1MFEH 2C3VA 5KSUA 3FB5A 3QULA 3BWAB 4XBPA 3MLZL 2A83B 4YDIH 1T6WA 1ZLSL 3O6ML 4MAUL 3VFRB 4YHKL 3PHOA 4M6MH 4PGBA 1V7NL 2COQA 3IFPB 1NDMA 5C0FB 1NLDH 1MI5B 5DJCA 1INDL 5DUML 5K93A 5C0EB 1WBXB 4PV9A 4DW2L 4KDTA 3C5JB 1JBJA 4Y5VA 5DZLA 1NSNL 4YXLL 2UWEA 2P4AB 4X4YA 1TNMA 5GJSL 1V8HA 4QNPF 5JR1H 5IM7A 3KXFA 5EU3A 1X9QA 3ARGD 5I8EB 5J6GB 4Z0BH 4I77L 4C83B 2YPKA 4I4WA 3GMLB 4NQCA 3WUWA 4LK4A 2CKBA 4DN4H 1AR1C 5EUKA 4FABL 3TYGL 4EOWL 2JB6B 5HDOA 3D6GA 4LLUB 2OI9B 2IADB 4M4PA 4J3WA 4XTRD 5DHYB 2X4TB 3LQZB 2DI9A 1OY3B 4POZD 4HG4K 1U0QA 3GIZL 3MRKA 1AO7A 1JTOA 5B39A 3WSQH 2XKUA 2VMFA 2Y36L 4YQXH 2WBJC 2NZIA 4X4XB 3KPRE 3T0EE 4P3DA 3MGOB 3LVEA 4WI5A 4OM0L 4XNQB 5GGVY 1A0QH 4XP9L 4Y4HD 3THML 1TVHA 4LF3B 3TF7C 2AQ2A 1Q9KB 3CSPA 5HHMB 2QL1A 3OR6B 4X8XA 5AG9A 4HMCA 4FFYH 1M7DB 4NZRH 1FH5L 1NEUA 3NAAL 3GSQA 1LGVA 1UB6A 5C07A 1JNJA 3S8WA 3EOTL 4J1UA 5AEAA 1FSKC 2AXHA 4N1EA 1JNNH 1A6VL 3VFNA 1DVFD 4JFXA 3V6FA 4U6HB 1JIBA 5ICYA 4Z77A 1WFOA 3MRNB 4Q2ZA 1I8LA 1MREL 3S4SG 1H9VA 1KTRL 3KYNA 4MWFB 5CLWA 3JVGA 2FEDC 3L5XH 1YQVH 4MNQA 5KN5A 4XAKD 3V6ZA 1X5LA 4TSAL 4QCIB 5JIIA 4GUPA 4IOFC 1LD9A 4J4PC 4JRYE 4FQJL 4PREA 4UDTA 3CFDA 3S4SB 1TQBC 3K2UH 3DNKA 3MV7E 2OTPA 2ERJB 4DZ8A 5E08L 4FQXB 3WYRA 4H0IA 4NUGH 4HFWA 4TVSa 2IGFH 1K85A 4L4VD 1DCLA 4UAOB 1RZKL 1URLA 3D9AL 2IANE 2F74A 3VXNA 2VC2L 3SDDB 3DUUB 1PD6A 1F42A 4TUKH 3T0VA 3FJTA 4OGXL 3UJIL 1KXQE 2FGZA 3I6GB 2J6EH 4RGMC 2LAGB 2JJTA 4OAWA 4RIRA 1JPFA 5E9DD 2Z0BA 3HTLX 3AB0C 1CGYA 2J2ZA 2VR5A 1R24B 1YNTB 3OX8A 5CJ5A 5AZ2L 3B9KA 4L4JA 4I18A 2R0KL 2CMRL 3QEUA 3N1GC 2VSCA 2AEQL 4XCCH 2RIKA 4PJFF 1ZSDA 3V4PL 1KBGL 5SWSD 5LQBH 1B4JH 1F3JB 3WLBB 4Y4KA 3QH3A 5HYJA 5A16B 5J6HA 1GGTA 1RD6A 3C60A 3MV9A 1QQDA 1T21B 2R9HD 2VISB 1CLYL 2ED7A 4JCLA 4IMKC 2A1WH 2Z93A 3RVUD 5DI8B 1KIPB 1NC4B 4Z18A 4N9GB 1LEKB 4HUUA 5EBGA 2VDOL 4N0CD 4KKLD 2ZSVB 4FZEL 1BOYA 4R3SA 4JFFB 5F88B 1QLEH 1KJ2L 4TPRL 5AWNL 2FEEI 1CLOL 3VI3E 2PR4H 4BZ2H 1LE9B 1OP3H 1JTPA 4G8GE 5IBUG 4BUHA 4KJQD 1ZEAL 3L3IA 1X3DA 1CFQA 4AM0A 5F7YC 3QUKA 1NCWL 4UNUA 4L8BB 3OKLB 1JHLL 5KSAC 1OSZA 4NRYA 4G6AC 3QZWG 3MNZB 4ZTPH 5IB4B 1JV5B 1G7HA 4GRWB 1I3GL 5IOPB 4E41D 4M9PA 3W0WA 1W0WB 4HSQA 4ENEC 5MEND 1R3KA 1MVFA 1RUMH 3OB0K 1U58A 1QTYT 1G7IB 1NGPL 4NWUH 3CH8A 2V7NA 2YBRA 4LGPB 3TIEB 1BJMA 3DO7A 1XF5B 2YD2A 2FIKA 1GYAA 2OX5A 2H2SC 4Y1AD 4G6FD 4FQ1L 4L5FL 4TUOA 3ZE1F 4U1MA 3FMGH 4JRXA 4G6MH 4U49A 5FHAL 4PLJC 3N1MC 2JELH 1OAXH 2MHAA 4MA3A 1N5YL 5KSBA 2D7TL 4L1HA 3M8OH 5C0DB 4OIIL 3ME0A 4O00A 1IE5A 2KPNA 3ZO0A 3CC5B 1PY9A 4MHHI 3Q5TA 5J9PB 2AJZA 4HUXB 4MDIB 4XNUH 4NFDA 2IFFH 3CZFB 3IU4H 4TYUA 3OKDB 4R4BA 1QBLH 3PWUB 1GAFH 2J88L 3LPGA 3QNXB 3OJDB 4KMTH 5D1QD 1IMHC 3FO1A 2YA2A 5KW9L 4ALAL 4IHOB 4IJ3B 2VO5A 3NACL 2HLFD 3ISWA 3WDIA 4CDGC 2W59A 4I0PD 5GXBB 3MYJA 4E5XA 1PG7H 1PLGH 1KJ2A 4UOW0 5HHNB 3VXUB 1LK2A 3C6SA 2DLHA 3SE3C 5D96B 3ARFC 3A6BL 4I0CC 5HHQB 2R2HB 2KH2B 1QLRA 5TPWL 5CUSL 1D5BB 1XFPA 4LDEB 4YIQB 15C8H 5E00B 4OKVB 4HKBA 1U42A 4LHQB 2NPLX 5C08D 3V4UH 1BVKB 4WHTB 3QFJB 2XN9A 4G3YH 4I2XA 3QI9C 4RFOH 4MXWL 4HWUA 1FP5A 3GK8L 4CVXA 1RK0A 5EZJB 1AI1L 4Y4FB 3HC4L 5E5MA 1AP2B 1KIUA 2P43B 3T65A 4U6YA 1JPSH 1OTUC 4FQHA 4NKIH 3WNPA 1CICD 4FOMA 2Z4QB 5KVEL 4UINL 1UH4A 2VQUA 2R23A 4PV8B 3BDYH 4XAKE 1FORH 4NQCD 3P30H 2VXQH 2XWTA 4P46C 5JUEH 5D1XB 2VLKB 4HZAA 4FNLH 2DQGH 4N90D 1FVDB 5T3XD 3Q3GA 5J13C 5IHLB 5BJTA 3HNTH 1Q72H 3ILQD 4NYLB 2QHRL 4OCYH 5D7IE 1X6LA 4JQXA 5BS0A 1OTSD 3F58L 4L4VE 1IEBB 1FPTL 2BX5A 3D69B 2VDPL 1H8NA 2DQHH 3H3BC 4ZNEE 3B3IA 3BYYA 4HUVA 1AO7D 1SJEA 3X11B 2ZCLH 4HPOH 2B20A 4HEME 1MCJA 1BIIA 1PYWB 1DUZB 5FYKL 2G75B 2ADGA 5E9DE 3AXLB 3QUXC 4E0RA 1JGLL 4P4KB 4F9PC 5F6HJ 3TWCH 1I7UB 3IRZA 3G6JB 3UEZA 2NZ9C 1AQDA 3DETC 5DUPH 4HKJA 3W82A 2I9TA 3TNMA 5LAXB 3D3VE 4MXVF 1OT1A 4F7EB 4OFDA 5I1AA 4TOYL 4Q0XL 1H3PH 1T3FA 1I3UA 1Z0MA 3QAZC 3QXVA 4MLIA 5C07D 2ZCKH 4R7DB 4OZHF 4MMZC 4O4YH 1ZTXL 5HGBB 5I16B 1NCCH 4PYHA 3BP6A 2C4FU 2OL3L 5I74C 1UH3A 3BSZL 3NA9L 2OYPA 2WIIB 4LLMA 1FGNH 1GOGA 4IRSB 2B4CC 3WDHA 4DGYL 5DK0A 1OAZH 2P47B 2IBZY 3HZVB 1VFBB 3B6SA 5ICXB 2DI8A 1DLFL 1MCKA 5JLZA 2YUVA 4MNQD 4KKBD 1PKQA 3QIWA 3HMXH 3RUGA 3UZQA 3DRTB 1KCSH 3P40A 1QBBA 1K9TA 2LAAA 1UC6A 3TYFA 3MRMB 4FQ2H 2AV7B 3GHBH 5HGHA 4QHKJ 3L3DB 5TDPB 3VWJC 1YEFH 5DJ8A 4JFOA 1I1AA 3QDJA 1NBYB 5KS9F 3QUMB 2ICWB 3UJTH 3FCTA 2C4FT 4NQXA 2GYSA 4PJ5A 4JGUA 2NW2B 4Y16A 4BFIB 2X1PA 4YDKH 1FRGH 4O58H 2E7BA 4OCLC 1TJHL 1I7TA 3HG1A 1JGEB 4D3CL 4E41E 5T1LB 4X6DF 4Z0XB 3O6FB 2EEAA 3N50A 1IAIL 4ZS6C 1J1PH 3STLB 2K3TA 1GGBH 4ELME 3IDJA 1BZ9B 1UYWL 5FECB 3MLPA 3CDYA 2EDTA 2ARWA 4MDJB 1T0MB 1FDLH 5HBBA 2C1PA 1ORSA 4Z7WA 4XWOC 1S9VB 3GSOA 1FG2A 4TNWK 4JJ5B 3I3BA 4IRJB 5IW3A 3S35H 1EGJL 3E3QC 4DN3L 4HZLA 3MR9B 2M1KA 3GGWB 3CUPB 1MIML 2OL3A 2I5YH 1T4KA 4Y4KD 5I8CA 2GUOA 3UP1A 2NX5A 4HULB 3E8UH 2ZCHH 5HYJD 5DJXA 5DFWH 5DD3L 1XMWA 3MV9D 1ULVA 5T33L 3P9LA 5K9KB 1C5CH 4NC2B 4MXQD 3TJEL 3KPPA 1KCUH 3ECBB 2AV1A 5DJZB 5DK2B 2QQLL 3PNWB 3UAJC 4MD0A 4AG4H 4BSVB 3L3HB 4R4NC 2VABA 1U8PB 5EPMB 3Q6GL 2BMKB 5B22A 1DBAL 3LKRB 1N6QL 5CILH 1GZPB 3C8HA 1C08B 1UZ8B 5BZWA 1UM6L 2J5LB 2ICEB 4AY0A 3SKJH 1KTKE 1HYRC 3KGRA 4X6EA 1HIMH 4GFTB 1IM9B 3LSOB 4LPTA 3BESR 4JHBA 1R6VA 4ZDHA 3W0WD 1DQDL 5JNYA 1RHHB 4K55A 2ZUXA 4DQOL 1D6EB 3TIDB 3DPBA 1FNFA 3D0LB 3MNVA 1O7VA 3MGTA 5DZOA 1DBJL 1N8ZA 4JZOB 4CBPA 3DVNB 1LO2L 3LN5A 5IMOB 2UWEE 1T2JA 5KG9B 4JFED 1EGJA 3B2UD 5J56B 5C71A 1E28B 5IIEA 2GJJA 1AIFA 3KXFE 4BKLB 4PRPD 3X12A 1HI6A 2CJUH 3OKNB 4UILH 1C5BH 1FBIH 3D39B 4JRXD 4NQCE 3H9ZA 4PJGF 1JP5A 1OD7A 2V9TA 3ROLA 4PJHA 1OARH 1ZT4A 3FB7A 2GY5A 3KPQA 3EIFA 4ONHB 4RFNC 2WINB 4N90E 4PJ9C 2I24N 5CEXB 3S5LA 1YYMH 4JQVC 5CZVL 3A6OA 2XA3A 4J7RA 5D71H 5JXEC 1CL7H 3IJHA 2VZ1A 2GEEA 4OKDA 4HS8H 2HMIC 1AO7E 5FM8A 4CNIB 3S98A 1A14H 2FBOJ 5IW1A 4ODUA 5FYKU 4F2MB 3IFOB 5BO1L 3MRBA 1FO0B 4QWWC 1S7QA 1RZIA 3SE4C 3DX8A 4JFPA 1X5YA 4QRSA 3ZMRA 1FZKA 4ZUTB 4O51B 2DL9A 2P46B 2FX9H 2YD5A 1FL5B 2PO6D 1CFVL 2FL5B 3OJMB 3CX2A 5DUBB 4V1DD 1E4KC 5EIIA 2WAHA 1YDPA 1FNAA 3UPAA 4QRRB 2W92A 5JORB 3G9AB 4X6CF 2ZUVA 1RUKH 5C07E 4GMSH 5GZOC 1KFAH 3VXQA 2XN9D 4GKZA 4OLVH 2HH0L 4I8DA 4BFEA 4M6AA 4PP2B 1PZ5B 3HUJA 5FYJU 4MCZB 4MMXC 1OCWH 4NSKB 3ULUE 4QRQB 1QFWH 1NGYB 4ZOAA 4P49A 2VDKL 3BDXA 3GDBA 1JZ6A 2XZAL 2P5WB 4PJFB 3UDWC 5I1DB 4ODVL 1T2QH 3G6AB 1K3IA 4MNQE 5IB3B 1NFIA 2Y06H 2E9WA 4LARH 4U6XB 2EKSB 4UT9H 1MCBA 4KROB 3VI4E 5D2LF 4LSPL 3DURA 3FFCA 4QTIH 3H7LA 5DJYB 4KTEL 5HJ3A 1EZVY 3DUSA 2R56H 1L6ZA 1LO5B 2HYMA 3ZKXB 5BS0D 1KENL 2YOCA 4K94C 1ITCA 4G8IB 2XA8L 4NNYB 1F8TH 1EEYA 3Q1SH 4HJJH 1RUAH 3VXSD 5KVDH 3V6OC 1XH3A 4M7LT 4EDXB 3CK0H 3TZVA 1FO0H 1DQJB 2WBJA 5KBNC 4ODWA 2WM0A 3WD5L 3NFPA 1JYVA 1MFEL 1ZANL 4H25A 2J4WH 5HVHC 4M6ML 4AENB 4L4TD 3S9DB 2Z91B 1D5ZA 1DLHB 5DRNB 1E4WH 4FHBD 1D5MA 3KR3H 2DYPB 5I73B 5ID0B 3OB8A 1LO4H 1RIVL 3O2DH 4HUKB 2YD3A 2IF7A 2VAAA 4WFHD 1N59A 1NGXB 2XTJC 4JPWH 2CLZB 3PP3K 5JR1L 3RWIA 5HYJE 5K59E 5EH1A 3DBXB 4XPBL 3ULVF 3EOAB 2HWZL 1CDYA 2I07B 2JCCA 3MV9E 4Z0BL 1IRAY 3NPSB 3FN0H 4DN4L 3TCLB 1Z5LA 3LS5H 2JKXA 2Q76A 3LQMA 1YUHA 1KTDA 5E8PB 3V5DA 3ZYZA 1UT9A 5L88H 5L6YH 3TBWB 3RHWK 3P4NB 3UTZA 1I9JH 1I8KA 5FO7B 5K9JH 5F9OH 3T2OA 2XICA 3LN9A 1FNSH 1X5AA 4X6FB 4YC2B 3RZCD 4APQC 1SVZA 4FP8H 1NFDA 4XHJD 4OIBA 4PJ5D 3GMMA 4KKCC 1Q9WB 5A3IC 3G5XA 3HG1D 1YY9D 4JGMA 3DMMB 1A0QL 3W0WE 3GB7B 1GIGH 3UO1H 5BVPL 5CP3H 4PRHB 4JKPH 1QPXA 3T2PA 1FZMA 5GGRA 2DQUH 1G7LB 3GMOB 4ZPVB 2FECI 6CGTA 4P2OC 5FF6A 4OZIA 4NT6B 4UMGA 1I8MA 1P4LA 2O5XH 2J3SA 5E2TL 2HTLD 1LE5B 1UXWB 4QYOB 2WSKA 2A6IB 2EKJA 1KCVH 4I13B 3RVXC 5H8DA 3VFSB 4P23B 1AXSB 4JRXE 2Z35B 2HFEB 2XPGA 1ND0A 1ZHKB 5KSBE 3SKMB 4QTHB 3NCYP 5H35A 4GMTH 3T4YB 4NCC1 4KTYA 4ISVA 1IZJA 1RZ7L 4RAVB 1KLFA 4EKXA 1G1YA 3ZKSD 3G5VA 5EO1B 5F3HB 4AIZB 5C09B 3M17B 1S7XA 4LPWA 1U8QB 1X5JA 2X44D 4YR6A 4JHWL 3BKYH 5H94B 3L3GB 4WFED 4F7PB 1A6TB 2IGFL 5J11B 2HTKD 4K7PH 1OGTA 4TNWF 1CLZL 5I9QB 1WBZA 3VFOB 3WKMH 5GGTL 5D7JA 4YX2H 4TVPD 4OT1H 5INDB 5EU4A 1AHWA 2DRUA 4OCXH 3T3ME 2J6EL 4NN5C 4BK5A 1VDGA 1NC2A 1A9BB 4UTAL 1F4XH 1MRFL 4HFUH 4X83A 3HI1A 5C9JB 2GW5A 4WI3A 1U8NA 2XN9E 4I2XE 3FTGA 2L7UA 4Q9BA 4XNZB 2D9CA 3SGJA 4WI4A 2W9LA 4WHYG 3UYOD 2H8PB 4GLRI 4YNYB 1YY8A 4HKZB 1ZAGA 5FO9B 5KAQF 2Q20A 1DSFL 4TNVF 5FHBH 3WDJA 2BOCB 1KCRH 4UB0L 4YHZL 5INCB 4OZHB 1SJHA 4KKAD 3HZYB 4PJEA 1UXSA 5LQBL 2AKRA 4M8QA 4OD2A 3I9GL 4UV7L 5FK9B 4G42B 4M5YH 5EU5B 1U8LB 3TBYB 4P2RD 3Q5OA 4YWGH 3MUGA 4RA3A 1AY1L 4GBXD 3HE6D 5BS0E 4DUWA 2ED9A 3OKOA 4RDQF 4LHUG 3VRIB 4WI8A 3TH2T 1JPGB 4P4RA 5E8OA 1WCBB 3ILPB 1BWMA 4P48A 4NJAL 1BD2D 3OXRB 4LOUC 4E42B 2XKNB 3MCKA 1FQ9C 1EK3A 2BHUA 2WBKA 3DOSA 4NHUA 4OIAA 2E7CA 2HN7B 4CADB 4BZ2L 5IEHB 3ARBC 5GGTA 5KS9B 3HPJB 3ARFA 3ARDD 3RNQB 5DT1H 2V6HA 1DFBL 2JE8A 4KUZL 4LPYA 4PGDB 4B0MM 3GZKA 3DYPA 2VQTA 4HH9B 1JN6B 4FFZH 1A21A 4X6DB 4LSRL 3LKNB 2QBWA 3ELAT 2Q86B 4NWUL 2W65A 2BY1A 4NKQB 3VXMB 1A64A 4RGNE 4YAQB 5IVXA 2Z31C 2EC8A 3S37H 1EEZA 1I1RA 4U0RB 4WFHE 4JM2F 1GSMA 1FNLA 4D0DB 1UZ6E 1Q0YH 4WHYH 1F90L 3CSYA 4I3GA 4HQQH 3VA2C 2V2TA 3FMGL 4RMVA 2JELL 5EIQA 1QR1B 1OAXL 5IEKA 4G6JH 5A40E 1PKQE 3RUGE 4RWHA 4GW4A 5D1ZC 5CD5D 2A9NH 4LU5L 4JAMB 5C8JA 2Y6SC 1QO3A 1F6LL 3GSRB 3UCRA 3E6HB 2IFFL 4XP6L 1CG9A 4LPXA 5D2NB 1UVQA 4G5ZL 3QDJE 3TGXA 5IFHH 1T03H 1RZGB 4WW1B 3KNBB 3V52H 5DJAA 4OCSH 5ENWA 1QVOB 2APVA 4HS6B 5JHLL 4PJ5E 2OCFD 4ZPTB 3BW9A 1PBYA 5FYKE 3LKOB 4HXBH 3HG1E 3BQUC 3TZVD 1I9RH 3SGKC 1K5NB 3H7BB 2WBJD 4HJ0C 3T0XA 4HIHB 5J7CC 4PP1D 1KN4H 4HT1H 4MHHG 3RWGA 4UUJA 2DTSA 3QUXA 4WO4B 4F9PA 3QO1A 3T2QA 15C8L 2NY7H 4ZQKA 1D5XB 1NMAH 2IPUK 1XF4B 2R0ZL 1INEH 3V4UL 1CFTA 5GQBA 5CEYB 5I0DA 1K4CA 4Z7WE 2PTUA 5CWSB 3V5KA 5HHOB 4NCDA 4I9WD 5IV2B 4S1RH 1J10A 1JPSL 3I6KA 4UNVA 2E9BA 4ETQA 5JA8B 2NX5E 4QRPB 5F97E 4NFCA 3QCUL 4R8WH 5SWZA 4NJ9H 1RJLA 4KK9D 3T4AA 1A6ZB 1ZMYA 2NY3C 3D2UB 4PJGB 5ICZB 4JO4L 2DDQL 2N56A 5FOJA 2GFBA 4NQVB 1H3WM 3NIDE 2DQGL 3RL1A 1FFNB 2FYYB 2UZIH 2AXFA 3WL9B 3BPNC 4LVOC 4QOKB 3HNTL 4U7MA 3QPXL 3MFFB 2VDRH 1EVUA 1QA9B 1N5AA 5MERB 3U9UA 2FB4H 4WFEE 4IOFD 4PJDA 1HSBB 3K74B 1XF2A 2FO4A 1A9EB 3GMRA 4LLDB 2EE3A 2DQHL 2BXYA 4RGOH 1IGIH 3K46A 3H2WA 1NCUA 4XVUC 3U2SA 5E6IB 3VWJA 5GIRB 4PTUA 1MJJB 2ZCLL 1D7FA 2XFXB 4FFWC 1CK0H 2FHBA 3AAZB 1OB1A 4LDLB 5GRJL 4OD1H 4WUKH 5JPNA 4MJ6A 1ZVYA 1KPUA 5JIHA 1MCOH 1IAKB 3OAZK 1AFVH 3OXSB 3NH7L 3JWNC 1B0GA 3N9GL 2VUYA 5B4MC 5FDWB 5GS1B 1ERNA 3EYOB 5IF0A 2AJ3A 1MJ7H 2DMKA 4ZFOB 1ZT1A 4X6CB 1IC1A 1FJ1A 2ZCKL 4Z5RB 4G8FB 1VGKA 4O4YL 1W72B 5JDSB 3S88H 5GPRA 3QZWA 1PGRB 4BZYA 4LNRA 1OM3L 5EZOL 3LKSA 5LGHH 2YD6A 1HHKB 4FXKA 2W38A 2DQTH 4X99A 4PJHE 4U1GC 2AJSH 3SDCA 1KT2B 4DGVH 3HE7B 4M7ZC 1WT5C 3MRRA 4RCAA 3MV8D 3FL7A 4EUPA 1E4XI 3C8KA 1B9ZA 5TF1H 3AREC 1FE8H 2EXWC 3I02A 3HMXL 1CS6A 3PP4H 3WNLA 2QSCH 1AKJA 3PL6C 4MCYA 1QACA 1C5DB 5D2LB 4ZSOA 2R1XB 1NGZB 4YDLC 5IHZB 4KJWD 4NKOA 1S7UB 3VI3F 1YEFL 3LH2H 1PKOA 3QHTC 2ZUUA 3UJTL 3EJZC 2CIIB 4D9LH 2AGJL 5D7JD 5ALCH 1UH2A 1FRGL 3HNSL 2BRRH 4LLQA 3V0WL 1NC2D 2YD1A 4YDJA 2V7HB 4P5TC 2RCSH 2VSDA 2V5TA 1BECA 1GGIH 1J1PL 2B5IB 2ZUYA 3QDAA 1WWCA 2X6MA 4NM8L 1QOKA 3MCG1 1GGBL 1I9IL 3BUYB 3HUJE 3VWKC 1JYNA 3INUL 5A1AA 4X98B 4PRBB 2O61A 4LBEA 4K7PY 3RWJA 5DR5L 1W72H 1R5IB 2OSLA 1A6PA 1AXTH 2D2OA 2VWEE 4ESKA 2H2SD 3QUYA 4TQEH 2HRPH 2AK4A 4CUCA 1AGCB 4O2CA 1Y0LB 3E0GA 1JGVH 3GSNB 2ICCA 3WIFB 5DD1H 2EICA 2IQAA 2IQ9H 5EFIB 2CGRH 3FFCE 4R2GB 4YHNA 1AE6L 5DRXB 3KLAB 2AXJA 1WK0A 5FYLL 3HMXA 2ZPKH 4PLKC 1A1MB 3TV3H 1C5CL 1ZA6A 4JQVA 2C1OB 3O41B 3O45B 3IRPX 4FQLH 5TE4H 4JO1H 2VOTA 3MBEC 4K94L 2NY4D 1G7JA 1OPGH 1O0VA 1HILA 2IPTL 3TNNA 1RZFL 3FO2B 1P7KA 4NKDA 3G5ZB 3QIUC 3GNMH 5F1OB 4JPKH 4J23A 1L9MA 3CJJA 3SE4A 3VFTB 4S1QH 1CDGA 1ZGLM 2YXMA 3NFNB 2MOVA 5E70A 1E4KA 4K3EH 5CKGA 3VGHA 5D6CA 1LEIB 1QSFB 2K1MA 5HHMD 1S8DA 4K2UL 3U0PB 5IB1B 2UYLA 4GXVL 2NY0B 1T1WB 1WWWX 4XNYH 3GSUB 3B5GA 1P9MC 4HIJB 1G7MB 4JVUA 1OTUD 4FQQB 3W5MA 4F8QA 2YUXA 4X7DC 2B0SL 2CJUL 1C5BL 2JCCE 1FBIL 4MNGA 2YR3A 2XG5A 3UDWA 4KVNL 3QXWA 2X1WL 5DLMH 1DBMH 1Q9LA 1IM3B 5DGQA 4LP5A 5D7IF 5A43C 2HG5B 5D9SA 3SGEI 4OSUH 4Q6YA 5BQ7A 3KPSB 5D71L 2P7TB 1P7QA 4WUUB 2ARJQ 5DMIL 2EDQA 4CW1A 2VH5H 5IB5A 5ERWB 1NFDE 3FQTB 4J2XA 4RAUB 2XZCH 3E1F1 2ESVB 2X4PB 3UMTA 3IDMB 3VGFA 1NEZG 4JZNA 1L7IH 4JFZH 3T0BA 2OZ4H 2PXYB 5BVJB 2FX9L 5EO0A 4WENB 3LEYL 4PR5A 4X7CC 2R0WH 4F7CA 2VXVH 4OZIE 3DETD 1RUKL 3BPOB 4CVZB 1NEZB 1W0VA 2PN5A 1KFAL 1MLBB 2F9BT 1JNLL 1H15A 5GRUL 1L0XA 2J8OA 4FZ8H 3VFMB 3WFHA 2MMXA 4IIQB 4JEGB 1OCWL 1IC7H 4Q97A 4L8DA 2NLJA 4WDIA 3RDTB 3BMVA 1ZKAA 3L3KA 4JFQB 1HYSD 4XXDB 5F44A 1I1YB 1ORQB 5SWZD 5J57B 3MLTB 3UJJH 5IT2H 4F3FB 4IOSD 1Y6NR 2HVKA 2FH6A 2Q7NA 2DF3A 2Y06L 4LARL 2LFGA 2WWKT 5CIPA 1TPXB 1FYTA 1NBZA 3IDXH 3CFEA 4FFVD 4JY6A 5D72H 1JZ3A 4TRPL 2G9HB 2R56L 5DEFB 4ZXBB 3NCJH 2A9ML 2ZKHL 4KZDL 1NC4D 3UTSB 3TVMB 1JTTA 1F8TL 1AD0B 1HKFA 4XX1E 1T1XB 3SQOL 2BVEA 2E9IA 5HI5C 1RUAL 2DQIL 5T3ZH 4APQA 1JWSB 5GISH 1T0NB 2G60L 1VADA 2QQQA 4M61A 3HS0A 4F33B 4G9DB 1EO7A 5E7BA 3TFKD 2YA0A 5JMOC 3K2MC 3QQ4A 1BOGB 5CZKA 4ELMF 1YC7A 3BGFB 5DURD 5AZEH 2YPLA 4DKFL 5EBLB 2LQRA 4F7MA 4ZO6A 1C16B 3VW3L 4P2OA 4WCYH 4PRDA 2XNAA 1WBYA 4PJEE 4O5LL 1JYXA 4BSWA 1EBAA 1LO4L 2EDFA 5JXAH 3IGAB 3O2DL 4TN9A 4TULH 1CGXA 3DIFB 1RVFH 3RY6C 3EYFB 2WQRA 1RK1A 3AVEA 4JM2B 2VDMH 5HD8D 1CD1B 3SDCD 3P4OB 5CJOH 4YJZL 4Q9RH 4OGYL 1PDKA 2Z8VC 4UIKH 1DEEB 5BXFA 3T09A 4K7FA 5FUCC 3R1GH 4Q6IB 2KKQA 3LS5L 1YMHA 2CDEA 2R4RL 4O2FA 1AKJD 5EO9B 2MJWA 5L6YL 5ANMA 2AJUH 1DBKH 1CT8B 1R5VA 3I2CL 2Y07L 3LQAH 4Q58C 5I75B 5K9JL 1GZQA 1KGCD 3VXOA 3QHFH 5FCUH 4FS0A 3FQUB 2LE9A 3KLHD 3BH8A 3LS4L 3M1BB 1IKFL 3CCHA 4A6YH 4UTBL 3P11H 1XGQB 4QXTB 2ERJC 3KPRB 3T0EB 2CIKB 4ORGA 4FQXC 3TO4B 4H5SB 4DEPB 3HR5B 4BQBA 3S34H 4ZUSA 4UT7L 5KTEH 2EYTA 2FZ3B 4WEBL 2YRZA 5F9WB 1S7TA 3B4NA 3PE9A 1GIGL 3LB6C 2MWCA 2VLLA 4JANB 5L0QB 1UG9A 1RZ8A 4JKPL 3QFDA 1VEMA 2E7HA 1WZLA 4CDHA 4LVHC 5IVXE 1MHCB 3FONA 3V6BR 3U83A 4J12A 1OQOA 2UWEF 3IETB 3O3AA 4IS6B 2ZOKA 3RRQA 1RZJH 5J1SC 3IDIA 1OWRM 3U7WL 3O2DA 4DKDC 3QUYD 2XQYK 2EIZB 3VMOA 4AMKL 1BX2A 4L3AA 4NKMA 1OWWA 3QCTL 4XCNB 5IBLD 4YXHL 3P0YL 4GRLA 2DM3A 3IJYB 3PGFL 4K3JH 2VKWA 3ET9F 4HPYH 1BQHB 1JF5A 3ETBF 4JRYB 5I1HH 5F1SA 5LBSH 4L9LB 4D8PB 4ERSH 4PGEB 3MV7B 3FT3A 1JVKA 4HLJA 5GGVL 1XR8B 4OUUB 1MCWW 1SYSB 1BFOB 5C7XH 4BQ6A 4U1LB 2IANB 4WWKB 3EHBC 4XMKL 3P2TA 2EYRB 1KJMA 4HIXH 1XF1A 4JB9L 1ACYL 5EC1A 4HAFA 4QWWD 1K8DA 1HEZA 3VRLE 4YX2L 3QUZB 4OT1L 2UVFA 3OJVC 3BD3A 1BP3B 5H37G 1UB5A 3MZTA 5I71C 3T0AA 5ID1B 4ELKA 3GIVA 2FJHA 3TBSB 4R90L 4HK0B 4OGAD 2MCPL 5DRZB 4I5BA 1QZ1A 3UROR 2HT2D 2ZZUT 2IWGA 5GZOD 2HFTA 3QXAA 3NGBC 1JPTH 4GW1B 2OM5A 4X5WA 5C0GA 4MSWA 3T77A 2Z31A 4MX7A 4YO0A 2R1YA 5SWZE 4P5KB 1B0WA 2EH7H 1A1OA 1HQ4A 4JPVH 5IVZB 2NY1B 2Q3AA 4UDUB 2ADFH 2EO9A 1XIWB 5DWUH 4MAYB 1P6FA 3VI4F 5TH2B 4J3VA 4LCCB 5D1ZA 1S9XA 1QFUH 1F6FB 1MAMH 1MFNA 2GTWA 4PJDE 5D8JH 2CRZA 4CJ1A 1P4IH 5F8QC 3GSWA 1A5FH 4PS4L 1P1ZA 1WIOA 5TGBA 5HPOA 4OZ4B 5T1MB 2I9LB 5DFVC 2O5ZL 5CINH 1CXLA 1XCTA 1XGYL 4WWID 2Z8SA 4BA8A 3EFDH 2QQNL 4P3WA 2CRIA 4KPHL 1N2RA 3MA9L 3V0AC 3CH1A 4G8GB 3ES6B 3BQUA 5K9OB 3SGKA 5EWIH 3WNNA 5EG6C 4XH2A 1IC4H 2CXGA 4EN3C 3DYOA 1GOHA 4DFIA 3OHXA 3MJ8A 5ESVB 4RNRB 2PW1B 3PP3H 4CN6A 3O6FD 1ES0A 4HHAB 4P2CG 4NZUL 5I1EH 3WLWC 1YN7A 5K9QI 5DHVB 1ZHBA 2NY6D 3RY4A 1LO3H 3H8NA 4DUXA 2GITB 5CP7B 2E9JA 5H37H 4HIEB 5DQDL 3E3QE 1Z9SA 2Z92A 5IJVB 5FKPA 5K59F 1BHGA 4B50A 5TFSH 1T1YB 2OJZH 4A2LA 4Y4FC 1JJUA 2DJSA 3MV11 4HQQL 4YLQT 2F5AH 5HI3C 2D31B 1U3HB 5E2WH 1ED3B 4YH6A 1OL0A 3L1OH 4JO3H 1JGDB 3ARZA 1FYTD 1MCHA 3VH8A 3ESVF 1LWRA 1MJUH 3QJFB 5JA9A 3AS2A 4ZSOE 5F72S 1CD0A 4YHOH 4ZTOH 3IF1B 1KGCE 3VFVA 2W0FB 5IFHL 1T03L 4GLRH 3AS0A 5CCKH 3V52L 12E8H 3KDMB 4MA7H 4IDLA 1YN6B 1S7RB 3QWOB 4R6UA 4ZO9A 3MBXL 3QP3A 4PLNC 3LKQA 1QBMH 4N0YH 4Y4HB 1WUNT 3TT1H 2CQVA 5CLTA 4LCWA 1TMCB 5F89B 1ONQB 2NY7L 1J11A 1QKZL 1IM9D 5I1LA 1NMAL 3NCCB 4X0KA 2YPLD 3O3BA 1G9NC 5J1AB 1I8IB 1INEL 4P57B 4P4KC 1FCGA 2F5BL 4AZ8A 1RUPH 4Y5YB 5DHVH 1VHPA 1YMMA 2YD9A 2Q8AL 5JZ7C 1TZHB 1RIHL 2H9GA 1JGUL 3ARSA 4YGAB 4LSSL 4YEEA 2EH8L 2EDEA 1DVFB 5HXMA 3B5HA 4KQ4H 4LQ1A 1V3JA 2AK4E 5EOCJ 5KSBF 4IOIB 5C0ND 4PRAA 5F8RC 3MV01 1KPRB 5E94A 3UC0L 2FWOA 5CKAA 2ATPA 1CTNA 3HC3H 1MQ8A 3GSXA 1MJ8H 2FSEA 3QDHA 1WT5A 4G43A 4IRSC 3JV4B 1XR9B 4XT1C 3KYAA 3AREA 5I19H 4ODXB 1FGVH 1LK3H 5D7IB 3GMPA 3PL6A 4ZUWB 4L4VB 4EVNB 2A73A 3O6KH 3R4DA 3IVKB 4NM4L 2F58L 4OFPA 5F7EH 3LIZH 3G08B 5GZND 1FCCA 3S3SA 4KAQL 2BSSA 2YD4A 4M6OH 3OGCA 3T3MF 1MWAB 4ZFGL 1KTLA 3NFSL 1P2CA 2CLRA 3TT3L 4WUKL 4XNMA 4LHUA 5E9DB 2YUWA 5FEBA 2F53A 4LIQL 2IJ0C 3QNZA 4LCUA 3VGAC 1EDQA 3HZKB 1YZZA 4P5TA 4MA8H 3VDAA 3ROOA 2FR4B 1ZVSB 3D3VB 4QRRD 1BJ1J 3MRIA 2DQFB 4U1SB 1PQZB 1U41A 1MJ7L 2X1OA 3CXHK 1HNGA 4JKMA 5IHUH 5T1DH 3VWKA 1Q1JH 5GS0H 1TNNA 1MFAH 3S88L 1U93B 4YHMH 3W39A 5CMAB 3O9WB 1X4XA 1EEUA 5LGHL 3NTCH 4LLVA 3I3DA 2DQTL 4MNGE 1T22A 1JF1A 4QHUB 4LSQH 4KRPD 3DX6B 4HUWA 4X7TB 2WZPD 4NC1C 1A7RH 4JFHD 4LVNB 4AIOA 3EOBA 2IPUG 2AEPH 3U6RA 4PUBL 1T0PB 5FYLE 4M7JL 4GRLD 3CFKA 4OTXH 3TN0C 1S7SA 2BDNL 3MTRA 2IG2H 2KQNA 1TZIB 3PP4L 4GRMA 4PJ8A 1W8NA 3WIHH 4CJ0A 5AG8A 1M71B 3KHOA 1OAUL 3GHEH 4IM8A 1AGEA 4XCEA 2Q8BL 2OTWB 5E1AB 2UVEA 3DROB 2G5BB 3X3GH 3L5WB 2J1KA 5HI4D 3REWA 2ITCB 1OHQA 1U92B 1XEDA 1WEJL 3MA7B 3QIUA 1MWAH 2VR9A 5ALCL 5JDJA 3L95B 2NY2D 2BRRL 4E41B 3CIQA 5JTWA 1M4KA 4BH8B 2VIRA 5J1TC 5F1NA 3QQNA 1E27A 1V3KA 4ELMB 3PIQB 3BKCL 5ESAA 3MLYH 3QNYA 4M62H 3VDCA 4W6WB 1HE7A 5IFJA 5MHSD 1U8MA 4PD4J 1YJDH 3MRCA 4G6FB 1QRNA 3RWDB 3MLVL 1TDQA 2E7MA 1UZ6F 2WLYA 4OI7A 1MCLA 3GBNH 2Z31D 1Y6MR 4WTXA 3RWFA 3W11C 1AXTL 5B38G 2XTJE 5CS7A 4JLRB 4UNTA 3RUGF 4K3DH 1VESA 5ACZB 1FYTE 3B9AA 1D5IH 4U1NB 3O3EB 2X4QB 2CGRL 2BVPB 4XMPL 5B38B 3BP4A 4MQXC 1G9EA 1KB5H 2DIAA 4L3CB 1A4JB 4RMWA 3PABB 1A4KB 4RFEA 5D1QB 3SDYH 1HINL 4NN7C 1Y18A 2Y6SD 1XCQA 1KXVC 4LSUL 3PWPA 4DKEH 5TE4L 4DGIH 4JY4B 4I0PB 3GUTA 3C6LB 1K4DB 3L7EB 1OPGL 2ENSA 1MIEH 2WWKO 4J3OC 3REVA 2W91A 5IK3A 3ZDZE 1WIUA 2OTUB 1G0YR 3FOMA 2IMNA 5IR1B 3QSKB 1A6WH 1B6UA 5CSZA 3VG0H 2C3VB 3BQUD 5KSUB 3FB5B 3BMWA 3QULB 4G9FA 4XBPB 4S1QL 4HJ0D 2I60L 2YPLE 3K4DA 4U1JA 1VA9A 3V4VH 3PHOB 4PGBB 4UU9A 5AD0A 3L3OA 4Z7WF 1NDMB 4N8VA 4UT6H 4K3EL 1NCBL 4XPFH 1E4XH 1CGSH 5CZXC 4LSDA 5DJCB 3MJ7A 1HQRA 5BOZG 3WUWG 3IDGA 5E4EB 3MXVL 4Y5VB 4PY7A 4JN1H 3IDUA 2UWEB 5D7LA 1E6JL 3U7YH 4FQIL 3I50L 5IM7B 3KXFB 3O3DA 5EU3B 5CGTA 5HGGS 1OAQL 2YPKB 1MCSA 4I4WB 4NQCB 1G7QA 3WUWB 3BX7C 1ZWIA 1J12A 2CKBB 3GM0A 5EUKB 4MS8C 3BKJL 3NIDF 5CBEA 5B39G 2IPKA 43CAA 3CX5J 1JCKA 1UFUA 5ANME 4PJBA 1ZGLP 3OAZH 1J0JA 4OCRL 1CGVA 4N0FA 1JZ2A 3MRKB 1AO7B 5C09D 2YPVH 3K4ZA 2VH5L 5B39B 5KVMC 5ALBH 1EAPA 5D6DC 1CDJA 3OWEA 4U05A 3ALWA 3VGEA 3MUY1 2XZCL 4P3DB 3ZKXC 1JWUA 4JPIA 3HI5L 3KG5A 1Q0XL 2X4TA 1IZKA 1TVHB 3L3JA 1QBAA 4GQ9H 3ZTNH 4YBQC 4ODSH 2V2XB 1FZOA 1JK8A 3GSQB 1UB6B 5C07B 1CDHA 2YEZA 4J1UB 1SVCP 5IB2A 3LCYA 5I1GH 2D7OA 4FZ8L 2X41A 4HDIA 4JFXB 3V6FB 3ZL4H 4PJHF 3L9RA 5ICYB 4KVCH 4Z77B 3T1FA 5DVKA 1YEEH 1F6AA 2QLVB 4Q2ZB 3RY6A 1R3IH 3V8OA 3ZE2E 4NDMA 3JTTA 2N7BA 2BVTA 1BREA 3UJJL 1PX4A 5I73C 3UZVB 2Y4SA 3WHXA 4MNQB 5KN5B 4HBCH 5DVNA 1V3LA 2CKBH 2HKFL 3V6ZB 2I26N 5GJTH 4XBGA 3P73A 2QEJA 1DUYA 1EO8H 4GUPB 1LD9B 1EZVX 4PREB 4UDTB 5C0CA 3CFDB 1WVZA 2B1AL 4DZ8B 4DAGH 5HHVH 4HFWB 3EGSA 3LV3A 1ZA3A 3U0TA 3KPLA 4JFYA 5BV7C 2ZSWA 3KYKL 5I8KH 1YYLL 2F74B 3VXNB 3LEXA 1T7YA 3IXTA 5I17B 4QF1A 5GISL 1CVRA 3GKWH 4OAWB 1YECL 4RIRB 1JPFB 1C1EH 4LHUD 4YK4B 3AUVA 4LPVA 4YC2C 3FQNB 3JWDH 4KC3B 4AQOA 3K7UA 3MLZH 1QD0A 1ZLSH 5HYSG 3O6MH 1CXFA 2BOBA 4PB0L 1DBBL 3OX8B 5MHSE 2YWZA 1JUFA 3MOBL 3B9KB 1UWGL 4I18B 4Y7MA 3EO9L 3QEUB 2NTSP 1INDH 5DUMH 3VWKD 3SGEH 4AH2B 3VXMD 2IBGA 1ZSDB 3UTTA 4DW2H 3SKUD 3ULUH 1NSNH 4YXLH 4PJIA 1SY6L 5JXAL 5GJSH 2X10A 4Y4KB 1RVFL 2BSED 2NR6C 1MFBH 3QH3B 4NOBA 3D0VA 1RV6X 5HYJB 2VN4A 5J6HB 1SBSL 1CU4L 5CJOL 2WUCH 4I77H 3C60B 4F7TA 3MV9B 4UIKL 1QQDB 3BRGC 4P23C 3PV6A 5E56A 3S6CA 4YGVA 4YZFE 4AJ0A 1TCMA 3R1GL 4FABH 2Z93B 3PDGA 4JREB 4YDVA 5F6IB 3CX5K 4HK3N 4UV4H 3TYGH 4EOWH 4PJ8D 1FN4A 4HUUB 5JW4N 4XPHH 4M5ZL 2FX7L 5MEQA 4R3SB 2AJUL 1KELL 4Z78A 3MMEA 3HLAA 1MELA 2EDJA 1J7VR 1D3CA 3MUHL 1H8OA 3QXDA 5LXGH 3QHFL 1R5WA 2HA1A 4PJAA 3L3IB 3FB8A 1CFQB 4OFVA 5F1IA 2LV4A 3QUKB 4A6YL 4AM0B 1NMCC 1XGPA 3RZWA 4OV6F 2BFVL 3QIUD 1OSZB 4NRYB 4OM0H 2GJ6A 43C9A 1DN0A 1T6VN 1G7HB 3W0WB 1R3KB 1U58B 3HN3A 3QR2A 1CDBA 2V7NB 2YBRB 4NQEA 1FH5H 2YN5A 5C0BA 3DO7B 4Q7DA 1A3QA 2DJ4A 3ARYA 3NCFB 4PGCA 4B41A 2BSRA 2FIKB 4R0LC 5F1KC 3BRFA 1QRND 2E6JA 4MJIA 2M26A 1NAKH 4TUOB 1A6VH 4KY1H 4JE4B 4U1MB 2JCCF 3OG6B 4JRXB 1SY6A 3WXVL 4H8WC 2R15A 2MHAB 2IC2A 3N06B 1RFDL 4MA3B 4MJ4A 5KSBB 1MAJA 1MREH 2D4DA 2BNQA 4QRPD 1KJ3H 1I85C 4UBDC 3A67H 3SDXA 2AJZB 4FG6C 4G8EA 3TPUA 3DVFA 3FO9B 4FQJH 4POUB 3R06A 3FO1B 5IESH 5F3BA 2VAJA 1NFDF 4ERSL 3PWPD 1PEWA 3MYJB 4E5XB 1K8IA 1KJ2B 4RRPA 5D5MA 5C7XL 1LK2B 3C6SB 3TLRA 2VC2H 2YA1A 3QHZL 4HUXA 5GRVL 3UJIH 1QLRB 1D9KA 4OLYL 4XPTL 1G0XA 4A6YA 1H3XA 4LCWE 1J88A 4ZS7L 4ETYA 4G9FD 4QT5A 4HKBB 4OZIF 3U7AA 2DD8H 1EERB 4EN3A 2XN9B 4I2XB 3BFOA 1H3GA 3VXUA 5HHNA 4CVXB 1YMME 4H88L 4P2YA 1RK0B 4WFGD 5HHXL 3L6FA 1JE6A 2DWDA 5E5MB 5EUOA 3M45A 4BQCA 3WO4B 3T65B 3QJHA 5IMMA 2R0KH 2CMRH 3EW3B 4KUCF 4FQHB 2KZWA 2AEQH 1J8HA 4FTVA 8FABA 3V4PH 1KBGH 2H32A 5DJ2A 1CXKA 5T1KA 2D0FA 5EZLA 1IJ9A 2EH7L 2R23B 1MAKA 2C3HA 2EXYC 3WCYA 2XWTB 2DKSA 1OT2A 1AGBA 1EBPA 4GAGH 1J9CT 3Q3GB 3HE7D 4GKNA 4KK8D 5BJTB 2HAZA 2LU4A 4HMEA 3O8XC 1J1OL 5BS0B 3IFNL 2XWJA 5D8JL 2FX8L 3SPVA 3B3IB 4HUVB 1QNZL 2VDOH 1SJEB 5DMGC 5E8EA 4FZEH 2VLKA 1BIIB 4NO0A 1TTFA 4TPRH 5AWNH 2HJFA 2IALA 2ADGB 4E0RB 4WHCA 2DJUA 4ZAKC 3OPZL 4C56A 5F9JA 1ZEAH 2Y9RT 1NCTA 1NCWH 4J3XA 4XMLL 2F53E 1JHLH 3JUYA 1AQDB 4HKJB 2I9TB 4DZBA 3TNMB 2VTFA 2CDGA 5FM5M 5I1AB 2A2QT 3SE8L 2A77L 3FHAA 1T3FB 5I1EL 3DX9A 2DM4A 1KACB 4Z76A 4WO4C 3MLWH 3PWVA 4PJEF 4RGNB 1S5HA 3SCMA 4FQ1H 4NWTL 1F58H 4L5FH 3T3PE 2VNCA 5HGAA 3SN6N 3B8YA 4LLMB 4Z7UA 1QRKA 5LAXA 5F7KC 2N4IA 5DK0B 3IB4A 1TVBA 5FHAH 2NY5H 3B6SB 3HAEA 4I48A 5E2WL 5JLZB 3QCVL 2D7TH 5T5NG 1GOFA 5K9QG 1PKQB 3QIWB 2HJKA 4LFHG 3RUGB 3RVVD 3VXTA 4OIIH 3TA3A 3V79C 3STZA 3PJSA 1IL1A 4IMLB 4R2GD 1MJUL 4Z9KB 4LHJB 3TYFB 2EDOA 4YHOL 1A1NA 2J88H 5HGHB 4XRCB 4ALAH 4N68A 5DJ8B 4BJLA 1VFBA 4JFOB 1I1AB 2GK2A 2QR0A 3NACH 3FCTB 1YEGL 3IJSA 1HXMA 5CCKL 1WGOA 4ZMAT 4NQXB 4MA7L 4PJ5B 4Y16B 3DRTA 2VLJA 1NUGA 1I7TB 3HG1B 3A6BH 3QEQA 4QGYA 4N0YL 3IDYB 1QLFA 5IBTH 3BXNA 4FQPA 4M6NL 5CUSH 5TPWH 3SY0A 4LIQE 1MNUL 5E6IC 3IDJB 2WNGA 5C0JA 2DLEA 3LB6D 1T2XA 1PX3A 4MXWH 5AYQA 2C1PB 1ORSB 3S7GA 1QRNE 3DSFL 2FHFA 3GK8H 3ZHDA 4Z7WB 3WNKA 3GSOB 1FG2B 5AYUH 2N1KA 3BO8A 1FFPA 4HZLB 3UTTD 2OL3B 2Q87A 5GS1C 3RY5A 3KPNA 4YFLF 1T4KB 3VFPA 1V7ML 5I8CB 2GUOB 2NX5B 1ACZA 5I30L 4QHMA 2AK1L 3NABL 4BQ8A 2A6JA 3K8MA 1LP9A 1R3JA 2BVYA 3WFDL 3WS3A 3P9LB 2K9UA 2V9QA 3E2HB 3HC3L 4UQ3A 2KQMA 2OMNA 1SM3L 2EDKA 4U3XA 4AL8H 2RBLA 5D93B 2GCYA 4IDJH 1WZMA 3KPPB 1CDIA 3TN0A 3C08H 2AV1B 3PWPE 5I19L 2QHRH 2ITDA 1FGVL 3F58H 4MD0B 4DOHE 1NUNB 2VABB 1U3JA 3RGVC 4Y0GA 1TQCC 2WWMD 2JK5A 4C54A 4WUUD 3QDGA 5BZWB 1CBVH 1FFOA 3VRLF 2H1PH 4G7VL 2ZUQB 1NMBL 3RFZC 5FYKH 4X6EB 4G9FE 3ZKMD 5T3ZD 4MD5A 2W60A 2ESVD 5ECJE 8CGTA 2GJ6D 4NQUA 4KV5F 5L2JA 5BMFH 3VDBA 5JNYB 2B7DT 3NZHH 5FA4A 4WFGE 2BVQA 4MA8L 3MNVB 2F8XC 3MGTB 4Q0XH 1N8ZB 4NRZA 3BISA 2CK0H 3LN5B 5D7LE 1ZTXH 3EAKA 5IHUL 4KRLB 4MJID 1Q1JL 5GS0L 1TVDA 2B5IC 1MFAL 1VERA 4HGMA 1AIFB 5IIEB 3U79A 4JHAL 3S5LG 5KVGH 2OL3H 3X12B 1HI6B 3VGGA 4U1KA 5FYJH 4YHML 3BSZH 3NA9H 2P8PA 3G04A 3ROLB 4FXLA 1WWAX 4PJHB 1AGDA 5I6XB 1ZT4B 4NHCL 3FB7B 3KPQB 4NO2A 1Q94A 2BNQD 2V5MA 4LSQL 3BEVA 3LOWA 1EIBA 1QP1A 1RJCA 1KB9K 3QT2A 2V5RA 3S5LB 2K7PA 4Q74A 2JLLA 2VZUA 1NDGB 4O9HL 2A74A 4PJBE 4PJDF 2UZYB 4C59B 1KC5H 3IJHB 1F02I 4OF6A 2KZ1B 3BWUC 4FXGA 3UBXA 1OGAA 3ARQA 3IKKA 3ULVC 4E9LA 3MRGA 3GHEL 5IW1B 4ODUB 2XY2A 5KSVA 1IKNC 4GAFB 5I1IH 3UX9B 3MRBB 3X3GL 2ADIA 1S7QB 1RZIB 3DV4A 4U3HA 3DX8B 4JFPB 4QRSB 3TVMD 1GCFA 1FZKB 3H9YA 1FIGL 2W9EL 1D9KD 5T5FL 5EIIB 4D3CH 1YDPB 4LLYA 2D7MA 5JW4M 5JPMA 3F7PC 4ZUUA 5DMKA 4Z7VA 2DQCL 5DHXB 3VXQB 4EN3D 4GKZB 2LTQB 3CMOL 1UYWH 1BLNA 3MLYL 4K7PX 4WEUD 1Z2KA 5EU7C 3O4LA 1YJDL 3RGHA 2FL5A 5F7UA 1EGJH 4DN3H 2E5EA 1MIMH 1RY7B 5T1KD 2EDXA 3RL2A 2VZTA 3HRZA 4PJCA 4F80A 1NANH 5CJQL 3KYMA 1NFIB 1GXEA 4K3DL 1M6OA 1S78C 4LL9A 5DD3H 1H5BC 1HH6A 1N6UA 3DURB 3F6IA 5C0CE 1OAYH 3FFCB 5T33H 3SHSA 2C5DC 2DL2A 5HJ3B 4BFGA 1KB5L 2VXSH 4WJ5A 1M7XA 3RX8A 3TJEH 1KPVA 2E8YA 4S1SH 3PGCA 1FFQA 1SYVA 1EEYB 2QQLH 4DKEL 1CCZA 5BV7L 4LGSB 1XH3B 1HHJA 1N6QH 1MUJA 4NO0D 1NGWA 1U8IA 3FT2A 4KK6C 1MIEL 3TZVB 2CDFA 5D6DA 4ONOA 4X7SL 2WBJB 1UM6H 1JWMA 5E03A 3FAWA 4TTDC 4C56D 4ODWB 3BP7A 1A6WL 3VG0L 3QQ9D 2E6QA 3KPRD 3T0ED 3PWNA 4LQFL 1ZLVK 1YEJH 2APTA 4H25B 1DQDH 5CHNA 4DQOH 4UT6L 4YUEL 1D5ZB 3K8KA 3MNWA 2PCPA 1BM3L 1D5MB 2NYYD 3RPIA 1GPOL 3UTTE 1DBJH 5IMKB 1P69B 3B8SA 4PJIE 3SCMD 1JI1A 2VAAB 1N59B 1S3KL 3OBAA 2ZUSA 3RWIB 1MCDA 1UKTA 4M1DL 3K0WA 4Y5XC 2FBJH 2CSPA 3V9FA 2JCCB 2X4UA 3FFDB 3RDTC 1LEGA 1Z5LB 3TA3D 1TTGA 2Q76B 4R26H 1YUHB 1KTDB 3V5DB 4W4NA 4JJHA 4OGZA 3S37X 5D4QA 1ETZA 5CZVH 1KB5A 1HDMA 3UTZB 3C2SA 1I8KB 1KIRA 1TQBB 5E8NA 3CVIL 4KXZI 3ZKND 3MV7D 3EO1A 4PJAE 1NFDB 4WV1C 2XYCA 3SO3C 1BJ8A 4NQSA 3GMMB 1E0OB 2BY0A 3VRJA 5DEGA 5MEPA 5E8PA 2GJ6E 3G5XB 2IAND 4WWKD 3MCLL 3FQXA 3TEUA 3WXWH 1CXEA 1FYHB 4GQ9L 4H1LA 1Z9MA 1FZMB 3AB0B 4NQEE 5GGRB 1A7PH 1J1XH 5C0BE 5FF6B 1DL7H 4B7LA 4ODSL 4OZIB 1I8MB 1CZ8L 1P4LB 4D9RD 3CU1A 2HH0H 4MJIE 3EJYC 4P9HC 1NAMH 4LCIL 5B3JE 4URTB 1EHAA 5FFLA 2AABH 2PYFA 2R2CA 2XPGB 3KPTA 1ND0B 1RSFA 5GGSA 3LEVL 2FCBA 2BNQE 2XZAH 3HCVA 2P45B 4NT6A 4H8WL 4ODVH 5GRYA 1KEML 4X5XA 5H35B 3SDXE 5TDNA 4DCQA 1A8JH 1XIWD 3QA3A 4ISVB 4HV8A 4MAYD 4JM2C 3KWWA 1CE1H 2MKWA 4LSPH 1EO8L 3G5VB 3BGMA 1YEKH 3AGVA 1S7XB 4LKCA 3TN0D 5IQ9A 4DAGL 4YR6B 1LDSA 2DQEL 5HHVL 5LGKA 3SKMA 3TJHD 5D5ME 4ODTH 5TQ0H 1U2HA 2XA8H 2QQKL 1BQLH 4Q6IC 1OGTB 5I8KL 1WBZB 1XGTA 1Q38A 2XZQH 4J6RL 3QPQC 5D7JB 2CUHA 5EU4B 3T08A 1AHWB 5F3HA 4AIZA 3GKWL 1NC2B 1UA6H 1CQYA 4H20L 4KHXL 4P99A 4KMLB 3HI1B 3WD5H 1IAOA 4G8GD 3KAAA 1U8NB 4XC1L 3FTGB 3JWDL 5EOCH 1O5DT 3VXUE 2X9YA 2Y1VA 2NXZC 1ZANH 2QADD 2EIBA 2YD7A 5EORL 3GFUA 5EUOE 3TO4C 5LWYL 1YY8B 4HW6A 5E8DL 3ESUF 1LHZA 2AJVL 1J8HE 4ZOCA 4FTVE 2C3XA 4R0LA 3MJGX 1SJHB 4O2EA 1RIVH 4PJEB 1UXSB 3MRPA 4EBQL 3CXDH 2AKRB 4M8QB 4OD2B 3ULUL 5BW7A 3SE9L 4Z7NE 1MFBL 4XPBH 4YNYA 1ZV5A 2HWZH 3MUGB 4F8TA 2WUCL 3DI2B 3NCBB 4YHPA 3C5ZC 1X7QA 1U3HD 1I85A 4YPGA 3GBML 5EU6A 3OKOB 3FRPG 4L8CA 3WN5A 1EJOH 4MQXD 4P4RB 4UV4L 5E8OB 3SJVA 4M7KL 3LKPA 2V5YA 4XPHL 2NY4B 5IVOA 5ISZA 2VLKE 3ZDZF 4JZJC 3MCKB 4NHUB 2O5YL 4XCFL 4KJYA 5LXGL 2DM7A 3RTQA 4C56E 4CN4A 1KIQA 3P0VL 4AEFA 5CFHA 1WTLA 1WLHA 3ARFB 1V05A 2UUDH 1T66C 2R2BA 2X7LA 5BVPH 1BQSA 2AXGB 3FRUB 1HCVA 3OR7A 4HUMB 2W65B 3BDBA 3QUZC 5IVXB 1EEZB 5E2TH 2W0KA 3RBSA 1Q8MA 4JKLA 4Z7UE 5CJ8A 1UM5L 1FNGA 4RWYH 5TE7L 5GS0D 3W2DL 1IQDA 1N26A 4QO1A 1NAKL 3CSYB 4P3CH 4KY1L 2V2TB 3RVTD 3LN4A 5FO8A 5IEKB 4GW4B 1A6UL 2JIXA 1KJ3L 3A67L 1EMTL 4G6KL 3KLSA 5GHWH 2XV6B 1RZ7H 2ORBL 2NY1C 3OF6A 4KDVA 1CG9B 4KI5C 1UVQB 3PDDA 3O8XA 5IESL 4K8RC 4BZ1H 1KOAA 2Y5TA 5DJAB 5ENWB 1MLCA 3CGTA 4JHWH 2RFXA 4PY8J 4IEFB 2VLJE 4M4RA 4U6VL 2AVGA 1MHEA 5C2UB 3QEQE 5I76A 1CLZH 2H2PD 2HFGL 1FVEA 5GGTH 3RWGB 4UUJB 3QUXB 4ZAKA 3QO1B 4ZQKB 4GG8A 4UTAH 1MRFH 4S1DC 5ADPH 1G9MC 4D9RE 1CFTB 5IKCA 2DD8L 3KJ6L 4KK5C 1K4CB 3RJDA 5C6WH 1KNOA 3V5KB 25C8L 4TUJA 3QAZB 3D3VD 1DSFH 3TESA 4UB0H 3I6KB 4OLXL 4YHZH 3IAQA 4ETQB 3RBGA 6FABH 5I74B 1N0XH 3HZMA 1PSKL 5HYSA 5SWZB 3ZE2F 4WTWA 5FKAA 4OFYD 3I9GH 3SDAA 1RJLB 3O9WD 4UV7H 3T4AB 5TDOA 3EYUH 1LP9E 4NC1E 5HHOA 5CEZL 5DD0L 3V95A 2HJLA 2GFBB 1P7HL 1AY1H 2VXTL 4GAGL 1CD9B 3RL1B 5HYFA 5FA3A 3ARGC 1AJ7H 2AXFB 1FFRA 5TQ2H 4PG2A 1N5AB 2XT1B 3U9UB 4N9OB 4PJDB 4RMQA 1XF2B 4OCWH 2FO4B 3IAGC 3GMRB 5GGQH 4P2QA 4JRWA 3I85A 3QDGE 1KUMA 3U2SB 5E6YA 5ITFA 4LKXA 3VWJB 4PTUB 5EBMA 4NJAH 3KHQA 5IW6A 2DBJA 4QGTA 1OB1B 1WZKA 1BWWA 2JTDA 4POZC 5EZIL 1J5OL 4MJ6B 1KPUB 1EX0A 5JQ6H 1H0DA 1UWXK 1B0GB 1TJIL 1DFBH 1G1CA 5DURB 4KUZH 1HSAA 3D1MC 5HVWA 5JOEA 5JQHC 4LSRH 5IF0B 2AJ3B 3AS3A 4M03A 4Y4HC 1ZT1B 4CU7A 1FJ1B 5IBUB 1AQKH 1P4BH 3RI5K 1WFTA 2ICES 3ZT6A 5TJWK 1VGKB 3MLWL 1LMKA 3HC0A 4RX4A 4IBLT 3QZWB 3RJQB 4LNRB 4EUPG 3LKSB 4FXKB 3LRGA 4N5UA 1F58L 4OF3A 4X99B 1R3HA 3JV5A 3SDCB 5DC9B 1F90H 3MXWL 4HWZA 1KYOJ 2B4CH 1L7TL 1SMOA 2NY5L 2UY6A 3MRRB 1NCAL 4YZFF 1DVFC 4EUPB 3C8KB 4QKXB 4U7SA 3I02B 1RAMA 2Y7QA 4LU5H 3PQYA 3P9MA 4CU8A 1AKJB 1OGAE 4MCYB 4NBYB 2GTZA 5I15H 4ZSOB 2GAZB 4XP6H 3MLXH 1B2WL 4G5ZH 5JHDA 4R4FL 4JY5H 3RGVA 1MY7A 3H0TA 5JHLH 3QYCA 3C6LD 3ALPA 3EYVA 3GJFA 1JHKL 1IC5H 1EHLL 4LLQB 4GKSA 1IEAA 1UEMA 4NUJA 4V2CB 1CTOA 1GC1C 1WFUA 3EYSL 4YDJB 5IBTL 3Q2CA 2GKIA 4Z7VE 4JO2L 4YE4L 3T8XA 3RA7H 2AI0H 1T04A 4QLRA 3CDFA 2EE2A 2R0ZH 2MKLC 2VQ1A 4XI5D 1X5FA 4QHLA 4L1DA 3O4LE 1EJ6A 5DVLA 2O61B 4LBEB 3RWJB 3MACL 5C3LD 1MVUA 1LNUB 2OSLB 5AYUL 3PWJA 4LRIC 3CVHL 3QUYB 4PJCE 2AK4B 3PHQA 4O2CB 1KEGL 3QCUH 4QY8A 3DRQA 3KXFD 2IQAB 4LMQE 4X98A 1F00I 2AERT 5FB8A 4YHNB 4MQ7A 2OJEA 3EYQD 4RFNB 4EUPH 5I18H 7FABL 2CO7B 1MCPL 4JM4L 4JO4H 4YHIA 2DDQH 1MRCL 3EFFA 5J3HD 4L3EA 5EU6D 3LZFH 1CFBA 3ZHKA 2VDQL 4AL8L 1ZA6B 4IDJL 1F4YL 4CVUA 5LKNA 4YFDB 3QPXH 3C08L 3SJVD 4LVNC 4OF0A 4QXGH 3V8CA 2PW2A 5DVOA 5ISZD 1HILB 3TNNB 5ETUA 3RVUC 1P7KB 4NKDB 1IKNA 1UACL 1CBVL 5TE6L 3RTQD 1MY5A 4PY8I 2H1PL 3FN3A 4N0CC 2C7UA 3D85A 5GRJH 2VZOA 3F7VA 2GJZB 5DMJB 2BY2A 5DEZA 4KGLA 1ZHNA 2BVOA 3HPLA 4M1CD 1T20A 3NH7H 2Y23A 4LRNH 5BMFL 3N9GH 4OJFH 4KJQC 3NZHL 5D6CB 3QB7C 3CZJA 1S8DB 3VXPA 4XAWH 4WEMB 5E99L 3NA4A 3W9EA 5ADOH 2P8LA 2UYLB 2BCKA 5DA4A 1FAKT 2CK0L 2DICA 4AEIL 3MRHA 2OQJA 1OTTC 5LCVL 3PWLA 3EDDA 3U4EA 1DTUA 1OM3H 4PBWD 3CVHA 2GHWB 5EZOH 5KVGL 4XZUA 2NXYD 5FYJL 1AR2A 4EZMA 3ULUD 1LEIA 4MNGB 4A2MA 5JOFA 1ODAA 4M7LL 5DSCA 3IYLW 2JIXD 3ZZ1A 2ZOLA 1Q9LB 1UCTA 3QDMA 4U7KA 5D9SB 1H5BA 5EOTA 4OLWH 3UPCA 1TITA 5BQ7B 3OF6D 1P7QB 1KC5L 5F7WC 4M3KB 4O02H 4KRMB 4CW1B 3BYTA 4MJ2A 5IB5B 4ZFZA 3U36A 5HDBE 5I1IL 5J8OA 4D0BB 1AH1A 5D1QC 3SKOA 4JZNB 4N0UA 4KWUA 2AGJH 2HLFC 3HNSH 3FB6A 5EO0B 1MSPA 4JDZA 4PR5B 2R29L 4OZFA 3V0WH 4F7CB 2MCG1 5I1KH 4PRNA 1WC7B 4NM8H 1W0VB 2GSIA 2NY6B 2X4PA 1I9IH 1H15B 2NW3A 3P4MA 5JOPD 1J0IA 1WCQA 3BIKA 3INUH 3WFHB 3T3PF 2XWBA 3UTOA 3B9KD 3BPLC 5SV4A 3DV6A 3BZ4B 4P9HL 5M7QA 4L8DB 2NLJB 4WDIB 5DR5H 3L3KB 1U8OA 4OV5A 1VENA 3AMKA 5DYOA 4W6YB 3G6DL 2XTJB 3SDAD 3X14A 4RBPK 4KDTC 2HVKB 4L29A 1UCBL 4Y5XA 1CICC 1S7VA 5HHPA 5CIPB 1FYTB 1NBZB 4HIIA 1AE6H 3C60D 3CFEB 3RDTA 3Q6FB 1OAYL 4JY6B 1CE6A 4DK3A 1UENA 5FYLH 1B88A 5DS8A 2VXSL 1HK6A 1A6AA 1EEQA 2DTMH 3DLQR 4S1SL 5FGRA 1C7TA 4OI8A 4K94H 3ILQC 5DO2C 2IPTH 1HH9A 1RZFH 4APQB 4BFBD 3I6LD 1TJGL 1VADB 4M61B 3HS0B 4WV1A 5H2BA 3S96A 5D70L 1NCDL 3QQ4B 4Q9QH 4W4OC 4Y2DA 2VLME 4ZD3H 2DLFL 1YEJL 2YPLB 4F7MB 1AD9A 2AEIT 4POYA 1FAIL 5L7XH 4K9EC 4P2OB 4K2UH 1Z6JT 3OGOE 4PRDB 2XNAB 4GXVH 1GHFL 1QG3A 4RX4D 1WBYB 3C9NA 4BSWB 4WI7A 1HHHA 1W0YT 2RQ8A 3IDNA 1RK1B 4F37K 2A6DA 2ICWJ 1HXYA 1BBDL 2B0SH