1DFXA

Desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
PKHLEVYKCTHCGNIVEVLHGGGAELVCCGEPMKHMVEGSTDGAMEKHVPVIEKVDGGYLIKVGSVPHPMEEKHWIEWIELLADGRSYTKFLKPGDAPEAFFAIDASKVTAREYCNLHGHWKAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Desulfoferrodoxin Structure Determined by MAD Phasing and Refinement to 1.9 Angstroms Resolution Reveals a Unique Combination of a Tetrahedral Fes4 Centre with a Square Pyramidal Fesn4 Centre
pubmed rcsb
molecule tags Electron transport
molecule keywords DESULFOFERRODOXIN
total genus 26
structure length 125
sequence length 125
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 1997-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
A PF06397 Desulfoferrod_N Desulfoferrodoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1dfxA00
2JI3A 1VZGA 1DQKA 1DFXA 4BV1A 2JI2A 4BRVA 3QZBA 4D7PA 2AMUA 4BK8A 4BRJA 4BFKA 2HVBA 4C4BA 1DO6A 4C4UA 4BFFA 1VZHA 2JI1A 1VZIA 1DQIA 4BGLA 4BFJA 1Y07A
chains in the Genus database with same CATH superfamily
1CDIA 2DQEL 5AUMA 3TJEH 4XP6L 4XNQB 3D0VB 1AANA 1NCWH 3QG7L 3IJYB 3U6RB 3QEUA 1D7DA 5B1JC 3P4OA 3F62A 3SPIA 2C9VA 3EYQD 4G9FE 5I5MA 4XPHL 4D94A 4WU7B 1ZHBA 2EACA 3H9ZA 4JHBA 5MENE 1ZA6A 2MOVA 1E9QB 1KCUH 4M62L 2M2DA 1KJMA 4WUKL 5C8JA 3SDXA 2R0KH 3Q01A 3NAAH 3SKJH 5HVHC 1OWWA 4GIAA 4K94L 1OVZA 3MLYL 4UF7C 3WN5A 2CG9X 2NY6C 3Q48A 3O4LE 3T9WA 1INEL 1ZRUA 5IMKB 1EVUA 4TUJA 4L3AA 2NUTA 1MCPL 4GG6F 3HHSB 1U92B 3VG9B 5AVRB 3OXRA 4NFDA 1XT5A 2CDGA 2W92A 3MCKB 3UTZB 1WGVA 2D9CA 4IQHA 4QOKA 3CZSA 4DCQA 1BX2B 3FFDB 4WU5B 5IMKA 1F18A 4MRBA 5LUMA 5EN2A 4TUOA 4TLUA 5LDUA 3WLBB 5LBVA 1F58H 1TJXA 4ODHL 1L6PA 1NWPA 1MW1A 2W65B 4ORZC 5JXAL 3H3BC 1U93A 3EG9B 4MA1C 3FHAA 1Q9OB 1E9PB 3VUAA 2X1PA 1U4FA 2W8CA 2IBGA 4JKLA 4WI5A 3HI6H 2AGJH 3P69A 5AOKA 2RTTA 4GJTB 5KSUA 5L8LB 2HTLC 5KJRH 1EHLH 1YEEH 1B4LA 3I50L 2G5UA 3OJDB 4IU2B 3BZ5A 2WUBL 4PLJC 2ZAGA 1IEBA 3W0WE 4KNSA 1NGWA 2DMKA 3LS5L 2IQ9H 3MRPA 3QUML 4UOW1 5HI4D 4ZMPA 5B3SB 4KXCA 4ZMQA 5IOKA 2H32B 3B56A 5DMYA 4UAOB 3SPCA 1A4BA 4CVZA 3WUWA 5IEHB 2VERA 1UHVA 1G9NL 3QO0A 2WYHA 1U41A 3TYFB 2F0CA 3IGFA 4FFYA 2BIMA 1IGCH 2ZWYA 3W2DH 3IKKA 1VERA 3BXNA 3MYJA 1FO0L 3FU8A 4HUUA 2XTJE 3RPIA 2VXQL 5C0DB 2E75C 5EH1A 3DOHA 1DQDL 3QXUA 3BKCH 2EC9U 2BSBA 6PAZA 3WKQA 1EX0A 3TONA 4B60A 3KJ4C 4XPFL 2BPBA 3STBA 1KN4L 4WENB 5AZEL 1IGTB 2CZNA 3FT4B 3IETA 4PGEA 4P3WA 4IJTA 3JV0A 3T6QC 4OQTH 3BFQG 3CUPB 5DEFB 2YPVA 4OLWL 1U2HA 1PKQB 3VRJB 1R46A 2ICWA 3KNBA 4NOBA 1NFAA 4Y19B 2HUHA 1XGRA 3IJEB 5ANMA 4HW6A 2AK4D 4WI0B 3MLTB 4DO4A 5L4MA 4L23A 3V0WL 2F8XC 1I8MB 3VFGL 3V0AC 4WWKB 1SOSA 5IMOB 2BM3A 5FHAL 5F1NB 1XB8A 4P5MA 2P8PB 4Y2OB 2V33A 4CGTA 4XVOA 3HTLX 4HCGA 1EANA 4LCIL 4JN2A 4NSKA 3KE0A 3WFEH 5IBLD 4PRNB 3EO9H 5BS0B 1ZVSA 4NN6B 4RRPM 1SQMA 3QZOA 2BVOB 1B90A 4AYBA 3UTTD 4PS8A 2VL4A 3ARBC 1OCWH 5DJDB 1IM3D 2D03L 5J12C 1NEZG 1MCWM 1O6TA 5IGXH 5IQOA 1CG9B 5IFJB 2E56A 3DV4B 1UB5B 2AJYH 1MFNA 4P59H 4XX5A 4OVUA 4F1ZA 1TZOA 3N40F 1AGEB 3WKML 2V9RA 4LL4A 2O26U 5D1ZC 1HKLL 1V7NH 2UZIH 1YN7A 5HYSG 4AIZB 1Z7JA 3TBSA 1U8JA 3FSVA 1RVFL 2L8AA 1VEOA 3K0WA 4ENZA 5CGMA 5IQ9A 3S3PA 4MQ7B 3K3QA 4PJ8D 1I8KB 1QSFE 1T7VA 3PGFL 4KMTH 1CD1B 1XCTB 4OGAC 2NW2A 2RB8A 4D9RE 2IPTL 2X2YA 3F58H 4H8HA 2UZXB 5HVFB 4Z7WA 2FWUA 2XWBB 1KACB 1E4KC 4FADA 4F7EA 1EMTL 1JXFA 5LO7A 5ANMB 4GKNA 4OJFH 1Y6KR 2DLFL 4JRYB 4UYQA 5B1CA 2FVNA 2ZG3A 2NQCA 4G8EB 4GBXB 2EVIA 5GSVB 4HPHA 4PJDF 4N2CA 4LP8A 2K4AA 2NNRA 4XR8C 3ZDXE 4P46D 1JI2A 3ZDYF 1MIEL 5D1XB 1DDHA 5CSBA 3QQ4A 5AFAA 3N50A 2O93L 1QQDA 5C0AE 1TMQA 4AYFA 2DRUA 4QHLB 3GMLB 1NIBA 3RZCA 2A83B 4HYTB 4P57A 4UANA 4YLBA 1EAJA 2CM6A 3D4CA 1E67A 1J05B 1CLOH 1SM3L 2CJSA 3GC3A 2YA2A 4MB3A 3U0PB 3U7WL 1DLHA 2TSBA 1KCRL 2FHFA 4N5ED 4XH2B 4KK5C 4GW4A 3CSTA 4X8JB 4Y5XC 4RQQA 5LNEA 2WBKA 1FPTH 1OP9A 3EYFB 2GTWA 1X44A 1CFVL 3IMBA 4FFWD 4I0PB 3T3PB 2D03H 3FC8A 5I71C 2G9KA 4Y1AD 4Q97A 1UXSA 3P2TA 2ZNWA 5C08D 4B3EA 1E27A 4U1JB 1UXMA 4R8WL 3ALPA 1PZAA 3QHFH 4ELDA 1U0QA 1V55B 1WFNA 5C09E 1SHWA 1MNUL 3DGGB 1Z0NA 1D5BB 5K9OA 3U1QA 5IW1A 1BG9A 3H2QA 4OH2A 3VXPA 1K85A 4LLUA 4LP5A 3HZMA 4GQZA 5IBTL 1AI1L 3LV3B 3RTQC 3W3BA 3GEWB 3FCBA 3ESMA 1GYWA 4NM8H 4P4RB 4ZUVA 3TFBA 2PUQT 2KYIA 4ACTA 3H9SD 2XV2A 3B7TA 3GKWL 4AC2A 1XL4A 5I18L 2Z8WC 1C12B 2IMNA 4N86A 3S0PA 3IGLA 3FB5B 2QV4A 4X7TA 4N3UA 4YSEA 2FBOJ 4PAZA 4AWJC 4FKKA 4TTDD 4F58L 1OZUA 2XA8H 4QIRA 4FQLH 2HRGA 1VGEL 2YJLA 1SN2A 1W9XA 2L4OA 4JPIA 4YHLL 1XF5B 3PDGA 2YBRA 4PJDA 4KTGA 1YEGL 1MVYA 3KBEA 4A7VA 4CVXB 3BWAB 2OJEB 2WLZA 3LH2L 4PI2A 4H8QA 4QHNA 1V5JA 4BYHA 5D96B 1QATA 2BNUA 1HFUA 2QKIA 3GSNB 3PUCA 3E9UA 2NNXA 4UDTB 1IKFL 3LNEA 3TA4D 2BOBA 1T6WA 1IEBB 4OLXL 4E9SA 2LABA 1DFXA 3MR9B 4E9YA 1N8ZB 2YARA 2XWTA 3ATBA 4JFFD 1N5YL 3BQUB 4G7QB 4O2EA 5IR1B 4GUCA 4G83A 5HY9B 3IAPA 4KI1A 3TA3A 3QO1B 3GB7B 3TO4C 4X6FB 1MJUL 4N68A 4JVPA 1T5XB 4N0RA 3ZT6A 2CHZA 4R84A 5HI3D 4LNRA 4J5VA 5C08B 3MREA 3TASA 5GZOA 5BCAA 4EKJA 3WJJC 3GZQA 1N5AB 5CGBA 1OTSC 5DJ6A 2LR4A 4UOQA 3DVGA 1B3JA 3QR1A 3UTPD 4AV4A 1FORL 3C5ZA 5DWUL 1M53A 4B41A 4N1CA 5HD8D 4OQ1A 2GUYA 4LCUA 1MNUH 4ODHH 4WI8A 2ZWZA 1FHGA 4HBCH 4HJSA 3JWDL 3RFZC 3QEQA 5E6ZA 3UG3A 4Z7WF 1E2WA 3MU3A 2EVHA 3MV7B 1KMGA 2GSIB 1G5AA 1VZHA 2YAMA 3JV5A 3TPUA 2HFFA 2A77L 3JWOH 4G8GB 4MQSB 4M7JL 4TPRH 5CCJA 5KSAA 3EGDA 2DQTL 2FJUB 3ATAA 5F70A 5IBLC 1B6DA 2A4ZA 5A1AA 5D55A 4B9IA 2A1WL 3EXLA 4R7NA 1RZKH 1TIUA 4NPYA 3GGWA 3O9WB 3QUZC 4HH9A 4WU7A 3UTQB 1YC7A 4NO3B 1KC5L 3CIAA 3BX7C 1JHKH 1IGCL 4UDTA 1I1AB 4S0TD 3VSTA 3S2CA 1GC1H 2ARJB 1F4YH 5D2NA 1FH5L 5KAQG 5HHNA 2BW5A 3PWVA 2BMKA 2YUZA 4X4KA 1ET5A 1FL3B 5H2BA 5LXVA 2YAEA 1I9IH 3HR5A 2ADGA 3HRZC 3ZL4L 4N1HB 3FONB 4RQQB 1UWEL 2PLTA 4QKTA 1YVLA 2ESVE 4JPWL 3PP3H 1SDDA 4AQAA 1PIFA 4CC1A 3EHBD 1OB1B 2ZF9A 1MCRA 1WP6A 2VH5H 3AUVA 2EEBA 3MUGB 2VR3A 4P46B 2FT8A 2AC0A 2H26A 1BXVA 5AKVA 4F7MB 4BXSV 2XG4A 1ADQH 2CPUA 3G5VB 3R19A 5FYJH 5F9JA 2YQ2A 5AOMA 1D5BA 4G8EA 2P8LA 3IFLL 3GLEA 2E8YA 2ROYA 3BP7B 5EZOL 4YBQD 4F15C 3VFUB 5GS0D 4Z5RA 4PJCF 1A9EB 3NFPA 1NKOA 2BVPA 3BDYL 3P9MA 3RGHA 1BREA 3WDHA 3VRIA 3H9HB 1A4KB 5F7UA 4CMMB 1BM7A 4Z76A 5IP4A 3KPSA 4Y2LA 5GGSY 2W60A 1O9ZA 3IGAB 1IC7L 1G7IB 3IKCB 1QYGL 2KT6A 2XY2A 1GHFL 1P84K 2VLRD 2RMNA 3TH4T 2CMRH 2DQFB 3P9MB 2ZYRA 3HG1D 4RGOL 4FFWC 5KVDE 2B9BA 3AXLB 1JVOA 4IIQB 1LO0L 4NI3A 5EOQH 2X4SA 5DC0A 4HFUH 2B0SH 2ENYA 3N04A 3UO8B 5D7EA 2X4RB 1ITBB 4X0NA 2QPEB 2R56H 1U8CB 2VDRH 3CSGA 4GAGL 4X6DB 1YJDC 2A74A 3MMEA 4M8UA 4F7CB 4ZMOA 1J8HE 2MNUA 5T3XL 4WHYG 3U0WH 1XSOA 1NGPH 2EE2A 1PLCA 3JTTB 3RGBA 4LEXH 2AV1B 3L48A 5JPNC 5EZLB 4ZYKB 3KW8A 1J11A 1OL0A 2OR7A 3LHPH 3EH4B 1TPXB 2F5AL 4M7LH 2NY1D 4X6CE 1KULA 2CDFB 4PCTA 4JFEE 2G3NA 1SBSH 2CDEB 3LKSB 3HMWL 1EVTC 1CD1A 4HKXB 3C5SB 2WO2B 5F1NA 3UTOA 4BBWA 2HFTA 1T1YA 2VDOB 3ZHDA 1I8KA 2WKGA 3VM5A 3WHE1 3IRPX 1O9VA 5JO5A 3T2OA 1ZIBA 4D9RD 5J56B 1KPRB 5L8JB 2VLKB 4AX3A 2FQDA 4GXVL 3MLTA 3EO1B 3GKZA 3QEHB 4WLCA 4IDJL 2VUOA 2FD6H 3O3BB 2D2CC 3AQDA 1UGNA 1EJ8A 1OCRB 4QHKI 4EI5A 1RPKA 4XZ4A 1KDIA 2VO5A 3U82B 3QFJA 3BDYH 1RJYB 2I5YH 4P9MH 5D71H 2AJSL 4XCNA 1SUJA 4LSSH 2XTSA 2V9TA 1BZ7A 3Q6FA 3QA3A 4XBEL 5HYQB 4PH8A 3NH7H 3DMMD 4Y9FA 4JRXE 3VXNB 2IAAC 3U0TA 2A74B 3MMEB 4F7CA 2XQBL 3QIBB 5FYKL 1GAFL 3FTWA 5F44A 5I74B 1AYOA 3II3A 1CYWA 5CEXA 4WFGD 1KEGL 3US1A 3CFJB 4CVZB 4FMFA 5IEHA 4HWNA 2DBLH 3LD8B 4R26H 3WNOA 1J0IA 2FL5A 2ISDA 3RX5A 3RNQA 3TNMB 3J7HA 2VQ1B 3CH1B 3G7TA 3L3JB 4TVPE 4YXHH 3KLKA 4M43L 4KDTA 1A3RL 3CZFA 5ISZE 5L2KA 1XCQA 3UAFA 2YD6A 2ED8A 2EDBA 2BY0A 4LLYB 1J8HA 4KHXL 1AC0A 3L3OB 5EBMB 3U0WL 2HKFL 3AACA 3V7AE 1UH4A 4YEEA 1YY8A 1NL0L 2BO0A 3OAZH 3LPPA 4U3SA 2WLJA 4WTQA 4EIBA 3BZFA 1L9PA 4HEMA 1NCOA 2J57A 2NY0D 3A6BH 2GI7A 4YHIB 4C57C 5DVLA 4X7DC 3VRLE 4PJ9B 4PGBA 1A5FH 2CKBA 3VGBA 3EO9L 1KV3A 2N1KA 3MA9L 4K7FA 5DUMH 1OTTC 3AY4A 3GM0A 3T4AC 3RNKB 3QUZD 2ERJB 2XA3A 4L8SC 1LO2H 4IU3A 4ZX3A 4R2GB 5HDWA 3RBSA 1TTUA 1A65A 4KRPB 2VDQH 3IK2A 4RMSA 1MQ8A 3ZHFA 1OE1A 3K72A 5T5NF 1CURA 4YHPB 1F0LA 2EC9T 5CZVH 3IMTA 3N2JA 3S36L 3QEQE 1E4WL 5BO1L 2GHWB 2C1OA 1FHNA 4NKQB 3HA0A 2X10A 3CXHK 3UBHA 1H0DA 4HFWB 4OBRA 3PGCA 3B9KB 4AUJA 4XMVA 4KRLB 3T4YA 4ABWA 4DHLA 4L1TA 3SDXF 5EU4A 1NDGB 1T1ZA 4GUPA 2E4FA 1U95B 5K1NA 1S7WA 5I1CL 2OQJB 4EN3C 2NTFB 5F1KC 5F3BB 2IFFH 1X3DA 1Z0MA 5B4MD 5C09B 2P48B 4HIEB 2HMID 3NSDA 4XXCA 5CKGA 3QUKB 2X6BA 2HLAA 5H35B 3SJVB 2QVKA 3QRGH 5E00B 1IGJB 5AVQB 1KCWA 3NCFB 3MX0A 3ZGHA 12E8L 3MLVL 4OZHB 2OTUA 2Y7MA 4LGRB 3C60D 3RG1C 3NZSA 3D0LB 3B43A 4I85A 3N85H 1PD1A 5KS9B 4QRQB 1XSIA 4K3DL 3T3PE 1TQUA 4XHJD 3GIVB 4KHTH 1O7DE 3WG7B 3OKEB 1TTGA 1MRFL 1NA8A 1FGNH 3WAJA 4NO0B 3OXSA 1JGVL 1P5VA 3CVCA 2MPVA 2E7DA 2XY1A 3QARA 4QRFA 1ERNA 2G75A 4M9OA 2H2SC 2K6YA 2Z9TA 3QJTB 4W93A 3K5SA 7TAAA 2LHAA 3B9VA 3TO4A 2HKHH 2XX1A 4NNPH 5FCUH 4BIKA 2DWDB 2AEWA 3G3LA 4LL9A 4YL9A 3MNWA 3KGUA 5C0BA 4R4BB 4XBGA 1MCBA 2JKRM 2FRGP 4LLAA 3KR3L 4NO5B 4W9CC 5BW7A 3DVNB 5HXMA 1JZ5A 2I7OA 4I3RL 4BK5A 4FQHA 3MXWH 1MCOH 1JGUH 1E40A 4HWZA 4ODSH 5D93C 3T77A 1HNGA 4B95C 4YAQB 4DESA 4MAUL 2Y1AA 1QQDB 4XP6H 1HKFA 4ERSL 1WO2A 1P6FA 4WFEE 2O30A 4UQ9A 1UA3A 3HHRB 1QSVA 4BKSC 3NJIA 3WDJA 5CEYA 4UT6H 4N6RB 1JV2B 1CFSB 2FWOB 4GP8B 5IKCA 3TA3B 4XB3A 3H6JA 5FUZH 5AW9B 1CDCA 4QTIH 5JORA 2AZAA 1CGXA 3FUEA 3PPEA 4XCYA 3VXME 4XCCL 4X7FC 4ODUB 3MXVL 3AU0A 3QIUB 4WNQB 2Q0ZX 5KSAC 2E7BA 2K3HA 4JPVH 5KS9F 3VG0L 4ZO6A 4U6XA 1QLRA 5CIPH 5CJXC 5CZRA 3TEYA 1Z3GL 1NC2B 4MJIB 5DA0B 5SWSD 3RVWC 4WK2B 5DHEA 4JRXD 4HVBA 4RMBA 4Y8DC 1WV7T 2WTPA 2PTTB 3DROA 5EZOH 3W39A 2L04A 2H9GB 1J8SA 5HDBB 3GIVA 4PREA 5JZ7C 1A6ZB 2M8XA 4F3FA 2BCKA 4PJCE 1U8IA 5B3NA 3HMWH 3PV7A 4L4VB 5FDWB 5K39B 1NCCL 3JV6B 4GW1A 1CGVA 4Q6IA 1U3HA 3LH2H 1RK0B 4QJ5B 4N2BA 2CO6A 2FB4L 4F57L 4UV4L 3MNZB 5SV4A 1OARH 3VH8B 2W07B 2P28B 3KJ6H 1PLBA 3MRMA 4PGCA 5ETUA 4XN4A 2H5UA 3BIKA 5AKSA 4EOWH 5D4QA 5IK3B 4HJGA 1ZVSB 3TPKA 2FEJA 1TJHL 2Q2LA 3BZ4B 2QGEA 1BZQK 3TV3H 4N2FA 4ICXA 4EDWL 3KVQA 3ARRA 4P48A 4IMKA 5EUOB 4K8RL 3CZNA 3RTQB 2R56L 4G7RB 4PJBA 3SKMA 1M56B 2IWKA 2ZUYA 1CXIA 4AVKA 1KCSH 3R06B 2FL5B 4PV8B 3QFJD 3DBXB 5D2LE 5C0IB 4EIGB 4M6AA 4PHXA 3T3PF 1P4IH 1EHKB 2PYEA 3EDDA 3BVXA 4N8CL 1KFAL 2HJLB 1Q9WA 1T22A 5EF0A 4KBPA 5DD3H 2WQUA 2VRAA 2ICWB 4ZTOL 5KWYC 4FMKA 1H6TA 2BS9A 3RWGA 5EC1B 2QQNL 3D2TA 4FXGA 4H5SB 5HHQB 1A6AB 5CUSL 3OV6A 3WY2A 2HRPL 2WCSA 1DVFB 5JW3L 3BH8B 1U8PA 3ARPA 2I24N 4GAAA 3MTRA 3NACH 4UBDD 5BMFL 4B9KC 2NY0C 3NCEB 4OT1H 3DK0A 3DKHA 5GISL 4RAUB 5ABDE 4YDIH 1DUZB 1QTPA 4OZ4B 2IJ0C 3KBFA 4DGUA 5EMYA 3S3DB 3DPBA 3L6FB 3QQ9C 4GFTB 4K9EH 1CFBA 3PL6B 2WJ7A 3KL0A 2RQEA 2H6UA 1EUUA 2F7PA 1N9PA 3M8OL 3VXSE 1FO0B 3L4YA 1H6FA 2M26A 3W1ZA 2PCPB 3EDFA 4GG8A 3ZKMC 3C6LB 3MJ8A 2QLVB 4TQIA 3WKYA 3HVNA 1T4WA 5CWSA 5I23A 3WE6A 1J0YA 3D50A 5E8NB 4PJ7A 3ULAB 2J1KA 3FT3B 1I9IL 3LDBB 5C3IA 4P0DA 5E0FA 4AG4L 3GDCA 4AIZA 4YX2H 3WD5H 4AQ8A 2LGNA 3HFFA 4JGUA 1MG2C 1BCIA 2R4RH 3GHEH 2WAHA 3IU3B 3QFDA 5D7JA 3QNFA 1QVOB 2C3WA 1L6ZA 2FJSA 3HS0A 3K7UA 5FYJU 3QVAA 2F5BL 5AVTB 4U33A 1LLAA 4B9ZA 1U8QB 4NQED 5GJTL 3S7GA 4BSWA 4Z78A 2Z93B 2NY7H 1NAMB 2BJML 3T8MA 1NBCA 3WMQA 1QLEH 3CWGA 2OM5A 1IIIA 5D1ZB 3COOA 2G2NA 1GTNA 1E8ZA 4TUKH 2W9LA 4U1GB 3NA4A 3BE1L 3LNHA 2G0LA 2DLEA 4XHJC 1EJFA 3K8MA 4XMKH 5EO0A 5L4JA 3IXTA 2I27N 3ML8A 3ME0B 3OKDA 1OSZA 5MENB 5EU5A 2KLRA 4Q58C 2VIRB 4GQ9L 4PJXB 2D7PA 3V7AG 1MLCA 5GSRB 2H2PC 1MCDA 3C2SA 5L88H 2GCYB 1CDHA 2FLBT 4GAJH 1I3GH 5D1XE 3S5ZA 4CU6A 1EMTH 3VE0B 1DQLL 5FUCC 3UAJD 4AYID 5FB8B 3F04A 4WHTA 4WI0A 4A2DA 2VDMH 3DYOA 5IB3B 3W0WA 1HE8A 2XZCH 1ZTXL 3DHJA 1I4FA 3BAWA 3X3FL 2BZDA 2OSLB 2BOCA 3QEUB 3DVFA 4KDTC 4YAQA 4OLZL 4NQVB 5IB2B 3NA9H 3PS6A 5DLML 5EIIA 3MGTB 4X9HA 2WANA 1NLBH 4DVRH 5CR1A 3IXAB 3RA7H 3VSUA 4PRHD 3QRBA 5J1AB 1IO4C 3RIKA 1KB5A 5D2LF 4P2OD 5L7XL 1V3KA 2EIKB 4A6YH 1HJCA 3KPLA 5ALCH 4JFQA 3WL9B 4PRPE 1OPGH 4OU3A 5C0FB 3EJUA 3IDYC 3LXUX 5E5LA 1L0YA 3RB7A 4PW3A 1EEZB 4X6CF 4QY8B 5KVGE 3BP4B 1KT2A 1DVUA 4XNYL 4KZ0A 2YZ8A 3WU1A 1S9WB 2N7AA 3GMOA 1Y0LB 5DD3L 2OZ4L 4ODVL 3N5AA 3FCSB 1M71B 1DR9A 4AE1A 1KN4H 3JTSA 2JKIS 5D7HA 3B9AA 4KUZL 2QMKA 4YHZL 1YYLL 3QUKA 1F3RB 4YDKL 3S9DB 4I2XE 5JZ7D 3KPOA 1ADQA 1P1ZA 1QFWL 3MX0B 4XE5B 1KJ2L 3X1FA 4K71B 5F93C 1ZJAA 1BFTA 1CT8A 5KVGL 3CPLB 3OKOA 4ELME 2J56A 3RVUD 4Z7VF 3GKWH 4Z3EA 1HHHA 2YEQA 3ZE2F 4UU9B 2BSCA 3Q8EA 4J6IA 4NRYA 43CAA 2Y1ZA 3MV7A 3NCWA 1RMFL 2E7LC 4XCFH 3AVEA 3VXUB 3WGVB 2IFGA 2C1OB 4FTVA 3KGTA 1AZCA 4A2EA 2FQFA 4LU5L 3BAEL 3MODH 3QC6X 5KG9B 5KSBB 5KS9E 3E3QE 4M7KH 4XMUA 4BH7B 4F57H 5IHWA 2XZCL 1OGTA 3V52L 4NUMA 3W57A 4DN3L 1KXTB 1MCNA 3LZFL 3DX6B 4L2YA 4OCYL 4HS8L 1SYVA 4KNTA 2CLVA 1LO3L 5DEJA 3VSQA 1FP5A 1QBLL 1J9CT 2P52A 3EUUA 1L7TH 4PVLA 4HD9A 4OI8A 4PM1A 2ZICA 4LAJH 1QLFA 1AGCA 2ZOUA 3ECUA 4KV5E 3MYZA 3VXNA 5I75C 1IT9H 3BAJA 2PETA 1CVSC 5PAZA 4M1CD 3FSOA 1Z3GH 4Q4EA 4X6DF 4N26A 4Y4KA 5C08E 1HXMA 1EDYA 2O6PA 1MRDL 4PRPA 5BQDA 2YSSA 1R4XA 5JW5B 4LEOB 3SKNB 1KIPA 1UC6A 3REWB 1KYAA 1CFTB 1I9RH 1X4XA 1AQMA 2Y3AA 3HG2A 2YGPA 4MAYA 1Q0EA 2DLFH 4RA0C 5LCVA 4APXB 2WCPA 2APSA 5DS1A 4LLYA 1D9KD 2IDFA 1YPZA 5IIEA 2ZCHH 2XZQH 2MNWA 4X5PA 4ZAKD 3S3BB 3HI6L 4OZIB 4FYQA 1NBVL 5IQ7L 3WIAA 4QO1B 2VXUH 1MY5A 3HKZA 2P3YA 3T8VA 1KJ2H 2H6OA 3TEZA 1I31A 5FO7A 3D52A 4H88L 1C12A 1OSPL 4JJHA 3ZKMD 1RCYA 1ZWIA 3QDGB 5D7IF 3GUTA 4GRWF 2Y7NA 2XQ0A 4DTGL 1NM4A 5ESVB 4FNTA 2EXSA 2Y72A 3CMOL 4GS7C 1WDAA 4Y9GA 4YO0B 2E86A 4I88A 2FEEL 2YC1B 2ZUTA 5I6MA 3MFFA 3RB5A 1T2QL 4Y2NA 1WIUA 3HPLB 2NY3B 4XX1E 4V1DA 1I8LC 2H3KA 5D1QC 5E56A 2PNDA 2YRPA 1UADC 1OGAD 1UWXH 2Y06L 1T2XA 4LZKA 4RFNB 3SE3C 1QSFD 3VXSA 4M5SA 5E4EB 4AUYA 2XXMB 5J13C 1CFVH 5LBGA 3D4GA 3WJMA 5FV1L 2YQ3A 2V7HA 2Q8AH 3T6VA 1CU4L 1RJZA 12E8H 1R17A 3MLVH 2YAPA 4O9HL 1RURL 3VXRB 2BK8A 3OAUL 2XKNB 1JGLL 3QWOA 1AGDB 2V9QA 3UAJA 4QCIA 3L9RA 4MMZC 1SLVA 1FCCA 3KPQB 2B1OA 3ZKQD 5LCVL 2YPLA 2FATH 2VRQA 3ARDC 1BBJA 3DK2A 4G9FB 5HHVL 3JTTA 4QF1A 3L1EA 4XXWC 3VFGH 4OFPA 4PJIE 4Z5RB 1ZV5A 4OV5A 3BH8A 5L2JB 3WTUA 1SJMA 4PJCB 5FHAH 1L9MA 2W0FB 5TE6L 5HHQA 3VFRA 2DZEA 2X05A 1S7RA 2Y5TB 3LV3A 3FU5A 2UXVA 1CBJA 3IFNH 3CQFA 5I1JH 4JN1H 1BM3L 4GRWB 2WIIA 4P2OA 2Z8SA 4DGWC 4ZFOL 1OGTB 4GKNB 1GGCL 1PL3A 2MOGA 4NNYB 1CDYA 2Y6TE 1UKQA 1QPPA 4BH8B 3PG2A 3H3KA 4EUPG 2DWEB 3ATFA 4RBPH 2NLJA 4JFEB 2OTWA 1NCAH 1U8OA 3IF1A 5EF1A 4PJGF 4HXBL 1R9FA 1QHQA 1X5AA 5AW4B 3KPSD 1BIIA 5T1DH 4KOCA 3T65B 1HC1A 3NCXA 1VLXA 4L3ED 4F9PC 5C0NC 3CDGA 5IHBA 2XICA 1FYTB 5FXCH 3HR5B 2P5WE 3WIIH 3EYVB 5E8PB 4PRPB 3ZR6A 4PBVC 2H6PA 5DS8B 1OP5K 5E2TL 1TSHA 2H8PA 1QFWM 2IALB 2KQMA 5HJ3A 1HQ4B 3VXMB 1L0XA 4NN5C 3SKOA 2JK5B 1YEFL 4B50A 4E42A 2GSGA 4PJ5A 3FO9A 2LTQB 2CD0A 5CLXA 2A9DA 5GQBA 1EZVX 5FOBA 5IBTH 5E4EC 3MJGX 2V5MA 4POUB 3FCSA 4BQ6A 3SCMD 2DM7A 1N3NA 4MNGB 2IC2A 2Y24A 4GRLA 3LH9A 5D7JD 3FBKA 5JQ6H 1OW0C 3O4OB 3QH3A 4ZX4A 5FA4B 1GW0A 4NQUA 1AO7E 3AADB 4F7MA 1YEIH 2YD7A 4EZMA 3MUGA 4GO6B 4XAKD 5IUCA 1FL6A 1QZ1A 3SCMA 4QRUB 1IAIH 1FG2B 2ZX5A 3DIFA 1PG7X 4WHCA 3RVUC 4I77H 4PJIA 5E94B 4JK0D 4NRYB 43CAB 2FHCA 2BINA 3T0VA 2XPGB 4ZMTA 1IRAY 3P0VL 5J9PB 3TWYA 5JOFB 3WIFB 2DKMA 3O0RH 4L5FE 1OAJA 2DPKA 4PJGB 4JFYA 4CJ0A 2VZSA 3AB0C 2IGTA 1KJ3L 2XPYA 3MJ9H 3N41B 2XTJC 1N6QH 3L4VA 3CCHB 4E5XG 3GJFK 1F11B 1AGEA 1ETJA 4KDWA 2QKIC 4PUBH 4Z95L 2ALAA 5EBWA 1XFPA 1UOKA 2OCFD 2ICWJ 3MRLB 4MZRA 3FQWB 2BFVL 2MKWA 1MDAA 3QO1A 2AJSH 3ZYIA 4TNVK 3PABB 5CP7A 1L9TA 4O2EB 1OANA 3II2A 4J3VA 2Y07L 1OP3K 3T1WA 4XC1L 5F7EH 3HUJB 3P73A 1LK2B 3GYRA 1F5WA 5K9QG 2XWXA 2JFCA 4WTZG 3UJTH 4LKCA 2JKNA 4Y1AE 1LMIA 3G04B 4OD1L 3TBCA 1RURH 2WNKA 1C1EH 3M7FB 1EUTA 3OHXA 4QRQA 4KPHL 4G9DB 5INCB 1AQ8A 3H42L 4N22A 3Q13A 5DT1L 2MQ0A 4U6VL 4HSAC 1E5CA 3BSGA 3QUGA 3DVGB 5CMAA 4BFOA 3BMWA 4U1NB 1YEHH 2X4UA 3MJWA 3FH8A 2L3BA 1HOCB 5FWRA 3HRPA 2FR4B 1PKQA 1IAMA 4YE4L 3D85B 3N1PC 5JIIA 1S7TA 3QUHA 1UFUA 3GXIA 3LVTA 3P9LA 4YBLB 4JN1L 4LSRL 1D9KA 3GI9H 1XD1A 5FS5A 3QWQB 4K4KA 5I16B 2FK9A 3IN2A 4OGXL 3HIZA 3HZYA 1VPOL 4JDZA 4KY1H 5DJCB 1LO0H 1J48A 1DLFL 5D1QD 4WI4A 1ZHNA 2OJEA 5CSZA 1FFTB 2EDNA 3O3DB 5GRWA 4XOBA 4JDZB 4RGOH 3BLKA 3QXAB 4KDVA 3FB8B 3WNPA 5ICYA 4OZHA 5T3ZD 3O45A 3ZOAA 4NAMA 4G7YH 1IGJA 4XODA 1MFAH 1URIA 3FOMA 3O81A 4M5YL 4OJAA 3HG4A 3JWNC 2HPTA 2OSWA 5F7DB 4H5SA 1G0DA 4PQXA 1WBYA 3BKML 1VZGA 4HG4K 2C4FU 2QHLA 4H25A 5H37A 4XRCA 1YLBB 4XPFH 2BWQA 5BZZA 3RGVA 1MCSA 3WFCL 3DTXA 4Z77A 5AYUL 4EF3A 2W91A 3MUUA 3OKLA 5HYJA 5LXGH 4AKOA 2FJGB 4JB9L 1G1YA 2E46A 3MUHL 5HHVH 2EXWD 4WU5A 1A9BA 3UERA 2KPWA 2OSXA 3H55A 1XO8A 2Y23A 3GNMH 2GC7C 4E0RA 1FL5B 4RMQA 2DQDH 3A23A 3H2WA 3ILPA 4GNKB 5EU6B 1KYDA 4NN5B 4X8JA 3F12A 1E9OA 3DX3A 4GAYA 5ETUB 3CFEA 2CGRH 1PZ2A 1N64L 1NMCB 4DUVA 4K7FB 3ULSB 1YMHB 2X0VA 1DEEA 2BS71 4K9EC 1WBZB 1NAKL 1OQOA 1U58B 2J43A 4DGVL 4DT2A 4RLDA 3PQYE 5IQMA 2Y06H 3L5XL 2QELA 3RWEA 3ZL4H 2X4QB 4Y5VA 3OG4B 4NC1E 1MH5A 1ZHBB 3V0VA 4F7TA 2ICEA 3O3AA 4RGNC 4LGPB 3STLB 1NCBL 5JUEL 4IK7A 3BAIA 3AT9A 2O6EA 2WTRA 3B5TA 1DJHA 1J8HB 5L2KE 5EDXA 3GSRA 1FVDA 3S37L 1LDPH 4WJ5B 5DC9B 5FKPB 1BPVA 1WQVT 3TJHD 3LKOA 1ZCRA 1OGAB 2YD0A 4HKJB 5HHOD 3CFDA 1S3RA 1X5FA 2WLLB 4YXHL 3DBSA 1Y7VA 3V4VL 1QWHA 1SMAA 1HI6B 1TSRA 2EDLA 2NY5L 3Q8BA 5J6HA 2OXHA 4ODWB 4ZSOA 5ICZB 2WXJA 3EBIA 2QFPA 5EA0H 3NZ8B 2W0PA 4XB8A 4I2XB 4WI9A 1LDSA 4XO8A 4MHHI 3RWHB 1DBAL 1N8OE 4JM2D 5D1QA 4UZGA 1I1RA 3CLFL 3KVDD 3PHQA 1L4IA 1RK0A 2ZF8A 3GJEB 4JCWA 3ZE1F 1P7QB 4U1SA 1IBDA 2R7EB 4Y19A 3SE3A 5J1TC 3UTSE 2XVLA 2BSEA 5DF0A 4EI5B 1BZ9B 2P5EA 3SE4A 2WLHA 2AJ3B 4A66A 4CL7A 1B0RA 4HUWA 1GHFH 1LK3H 1E2ZA 5KBMA 1FVCA 4IBLT 4HCRA 5E2VL 1I7UA 3K6SB 4NO5A 3EBHA 2A73A 2PR9A 4WIQA 2WXGA 3O6KL 2DWDA 4O00A 3P9WB 4P3DA 1XZ0B 4BZ1A 3MLZL 4I9XA 1Q72L 4N1EA 4ZO7A 4ZUUB 2VC2L 3W11C 3J8F7 2IDTA 2OX5A 2PPAA 1WEJL 1FFRA 1IT9L 1RK7A 2CRZA 5DVPA 4NBXB 5SWZB 1N59B 4PB0H 4OFIA 5AB0A 3IGAA 4P23C 4JG1L 4BDVB 2BIQA 1QFPA 4I3SH 4R4FH 3G6JE 4FLRA 3MQIA 3TC9A 2W59A 4NXKA 3S37X 2GITB 3KYNA 3KYKL 1HL8A 5KS9A 1I7RB 1A4CA 2Z91A 4JANB 4UUJA 4N6RA 1FV1B 4F2ME 2AQRA 2PR4H 3HAEH 1EHAA 2YXMA 4A67A 5JMOC 3MVSA 1U8CA 4FLHA 1OCZB 4B9GA 4WEEA 3VFRB 1D5ZB 1ZLVK 3UEQA 4HULB 1IBHA 4MMYB 1CTOA 5L2JA 2XZQL 5C0CA 2C34A 2QMJA 3EOTH 2PPCA 5E2WL 4QF1B 3W9DA 1N6VA 5BUGA 4PJEA 4P4KB 1TQBB 4F9PA 1OWRM 5CINH 4H8VA 1UEYA 1UZ6E 4V11A 2FNBA 1CGWA 4Y2DB 5F7NC 2WOBA 5AW8B 5EN2B 5IJBC 4PLOB 4E9VA 1SDAB 3D08A 1KTCA 3LMJL 4OI7A 1U8NB 2BP3A 2XN9B 3QDJB 3SOBL 1AY1L 2J71A 4FNLL 5EBGA 2DMBA 3V7MA 4NUPA 3GBLA 1HCFX 3V5HB 2X4TB 4O2CA 1P5UC 1TOXA 4JJ5A 3P4MB 2VO8A 3EUDA 3QJFA 1CZ8L 1CLYL 1NIAA 3CVHA 2ZNXA 4K5LA 4P49A 2O61A 1KOAA 4HH8A 2HRHA 4PY8J 2XXFA 2C9PA 4DZBB 1YYMH 3ABZA 2DKUA 1UT2A 4HF5H 1KGIA 4PP1D 1YY9C 5FM5O 4QY8A 4TS6A 1GIGL 2APVA 5IJCC 5CGYC 7FABH 4KKRA 1UD5A 5F9DC 3VFWA 2F68X 4BZ2A 1LDPL 2ZJSL 3T2PA 1CN4A 2Z4TA 2XCMC 5IOPB 5CR8A 4OQTA 1RUKH 4PRIB 2VDLH 1UVQB 3HLAA 4HEPA 1TVBA 2QSQA 1PLAA 2PW1A 3INUH 4P06A 5TDOB 2EXWC 4ZS7L 2VZUA 4XMKL 2W1NA 5LG6A 2H41A 5DZJA 2DEWX 3U83A 5F9OH 2ZAHA 5FECA 2UY6B 1MFDL 3OGCA 1UM6L 4IBZA 5ICUA 4EZLA 5JR1L 4N0FA 3D39D 2VDKB 3QJRB 1NCTA 3GGWB 4FFYH 3HR6A 2UX6A 3K8LA 3QE5A 5DQDL 2OZ4A 1N2RB 2E0PA 3VD7A 1X7QA 4PJDE 4OFDA 1R3IL 4HKZB 4FULA 3QJFB 1JWMB 5HYJE 1KCUL 1TXKA 2JKTM 4BK5C 4YFEA 1E4XL 3R8QA 1DN0B 1CFQA 4WTXA 2G30A 1J0HA 3D0VA 4RGND 6CGTA 2NUPA 2QKIB 4Z7UA 5IUSA 2EE9A 3S34H 1M9WA 3CZFB 2C5DC 4O58H 2ZQKA 1A14H 4ZJ9A 1UYWH 1FH5H 1ZT7A 1ACZA 3RNQB 3TNMA 2B4CH 3AB0B 3U7AA 4BSWB 4Z78B 3SBRA 4QUOA 2Y6SC 1I82A 1KBGH 1XB3A 6FABL 1CXLA 2P80D 4IK6A 5AW3B 3VXUD 4BXVA 4RNRA 1OKEA 1OTUD 1T5XA 3WS6C 3FQYA 4LLQB 4PVMA 4YS4A 5M94B 1XIWA 2W38A 3IFOB 4NHUA 2J3SA 2X7LA 2VMEA 1EXHA 3ZZQA 2VDLB 1BD2A 1B3IA 4K9EL 1YMME 2UWEF 3MA7A 4YHOH 3EOYG 3OGOE 4KRPC 2GT9A 2HKHL 2VDLL 1AHWB 1MIML 1DVZA 1OARL 2ERJC 4L8SB 4M29A 1ZEAH 2BNRB 1OM3L 4E41B 1PEZA 1R3JA 4W6WB 5CBEA 2X4TA 2OZNA 3QCTH 2K6WA 3LQAC 1NH6A 2VDKH 4U6YA 1NDMB 4I3RH 5GPRA 4PJ9C 1YC8A 1U3HC 4M5ZH 2DTML 2LTQC 2NY4C 1QSFB 3IKCA 4WO4C 4Z7WE 1AO7A 1ZLSL 3LQAL 4YVUA 1FBIL 2JLPA 4FQ2H 3VWKC 4Y19D 1U8HB 5TH2A 3CZGA 3FB6A 2WXRA 4PY7B 4QNPF 2B2XH 4EI6A 5IV2A 4GXUN 1PQZA 4TXVB 3TT3L 1E28B 3FTSA 1KIUA 4HHWA 2HB0A 1ESOA 1DLHB 4G7VL 3EYSH 4MYWB 3VH8G 5DMKB 2KDYA 2N59A 3V4LA 3KMDA 3QDAA 5C2BL 2XZAH 1A2YA 2GIXA 1L5GB 1CLYH 1BHGA 2Q6WB 4LT7A 2VISB 4MJHA 4AK2A 3QHFL 2UXGA 4G8FA 3GMNB 3IDXH 2WINA 3UYOD 5I5IA 3TO2A 3VDAA 4CMHC 2IDUA 2PXYA 3QZWA 5B7MA 4X6DA 4OD3H 2ATAA 5IQNA 3UBXB 4KPHH 4L1HA 4JKPH 4BZYA 4U31A 3WEBA 3PL6C 1T6BX 2VDRL 4GAGH 2LLLA 3L5JA 1JYXA 1HX0A 1ROCA 2GTZB 2EUVA 1OB1A 2DYRB 4KKQA 3DWTA 4QJ3B 4NKMA 3QWRA 1T1XB 4M56A 1U8KB 2XQYA 1TCMA 1AGDA 1M7IB 2GK0B 5D7SH 3FZUD 1BQLL 2FZ3A 3GEFA 1DVFC 5E1GA 3ARDB 3F6IA 3S5LG 3STZB 2LFEA 2VDNB 3EOTL 3MRMB 4NKMB 5CBEB 5I6LA 3BZDA 1H8OA 2ICEC 3ZXAC 4MDJB 5FW6A 5A2KH 4FG2A 2COVD 1ZSDB 1KJVB 4M6NH 4QHLA 5BV7L 1J5IA 1FZJB 1NGXA 3ZVVA 1WD8A 3GXPA 1IGYB 4MD0A 4MJ2A 1MREL 4Z9KB 4QRPA 4L4VA 3HPLA 1T4KB 3VTMA 2GSMB 2JKJA 2YGOA 4H0LC 1CK0L 4P9HC 4DKDC 5DJDA 1X4YA 4Z7NF 4N6QA 3ATEA 4RFNC 1IBGL 2Z92B 1KTJA 4NQCB 1PKQE 2W9DL 3HFML 4ZD3L 4HHAB 2NY3C 4FQIH 1A22B 5E8NA 1VCAA 2OKMA 3N42B 5B1BB 1NLDL 3K8KA 4QYOA 1GL4B 1E3ZA 5BRZB 4AQ8C 3U2SB 4AEHH 2AJVH 2EDHA 1F86A 3L9RB 5GGUB 4JFDD 2BX5A 4YXKL 1OGAA 4HKJA 5C2BH 3IM1A 3QWOB 1OLLA 5JA9A 1TQWA 1IU1A 3CHRA 4PJAB 4XCYB 4Z7UB 3CQQA 1UCBH 4WJ5A 1LM8V 1N4XH 2B1AL 3OJVC 3WFCH 3UZQB 3G5XB 2PO6C 5IHLB 4K7PY 2MCG1 5LAXB 3LRMA 3L17A 3KNBB 4ZS6D 3JWDH 1QKZH 2VAJA 4TQHA 3L7EA 4Q2ZB 1UT9A 4G3YL 1XGRB 2CM5A 3IJEA 2AVFA 1AZRA 4HJJH 5INDB 4L1LA 3MNVA 1AO7D 5TFSH 1CXEA 2P24A 3B1TA 5E4AA 3RGVB 3CK0L 2NZ1A 3FHEA 2B20A 3P02A 4YIQA 4FGMA 4WNSA 4ELKB 1UXWA 3CX5K 1HILA 2A6IA 3TZVC 3FF7A 1KXHA 3NRFA 4NENB 3OB0H 4PJIF 1HINH 1NIFA 3ROLB 3GBNL 5K93A 4HU8A 4ILDA 5C86A 5FECB 4NGHL 4H44C 2VW7A 3NDYE 5I1IL 3QIWC 4OCXL 5M95B 4F7PA 3L3KA 4UI2A 2J1XA 4KQ3L 5BQ7A 3DECA 2HTLD 2KS0A 1I8IB 5EFIB 1AH1A 1NBYA 1WFMA 5T3ZH 2UZYB 4Y2DD 4M4PA 1T1WA 3ILPB 2YIHA 4ZMYA 1EZUA 1KB3A 1F3DJ 3NCYP 4G5ZH 4PLJD 5F9AC 3ZUNC 4DKFH 1C16B 4PGJA 1V7ML 2R8SL 1NCBH 1TJGH 3SGKC 3AS1A 1Y1DA 3ZKXC 2YPLE 3MOQA 1N12A 3CFTA 3DA0A 3NGBB 4JRXB 4M7KL 4ORGA 5DD1H 4PSPA 5BZWA 1NGWB 3MRPB 5D93B 3R7QA 3RU8H 4L0PB 4K15A 2HZHA 4Y88A 2BIHA 4Z0XB 2AP2A 4P5TD 2NXYC 4FFVD 4LSPH 5I1KH 2X88A 3N3EA 3SPVA 1JWUA 1HK6A 3KDPB 3MRRA 2BDNH 4HFUL 3RPBA 1IGTA 1QG3A 4H25B 2AJXH 2V4LA 2R2CA 4LOVA 5EU6E 2AK4A 1OTUC 3NRPA 4W68A 5IW1B 2XLLA 3SYQA 4ZUWA 2B59A 2CJTA 1OV8A 1LL1A 1AZUA 1E27B 2H1PL 3N43B 2CIKA 3BGMB 2LFGA 4K71C 3AABA 1RZJL 3DX9A 5INCA 5A2CA 3SE8L 1SVZA 4FQJH 4MWFB 2VW4A 3POHA 4A2LA 1I3GL 4G3YH 3N0PB 3UTTB 2E76C 4ZXBD 1QHOA 4X98A 4GXFA 5CCHE 5TFSL 3A21A 1CDGA 4UCFA 2CIIA 3IJHA 4JHZA 3K2KA 2WLIB 1JRHH 4OB5L 4PJ9D 4YHOL 1U3HD 1N0LB 5GRXG 4DTGH 5IMLA 3IRZA 3ECVA 3G6JB 5I15H 2O6CA 1MOEA 3KHQA 2HJFB 2IV8A 4CDGC 1PSKH 2VZ1A 1RHFA 4MXVE 1X5LA 3FQWA 5BZXA 3U4EA 2X9YA 4F92B 5F72S 2C1PA 4P2QB 1L7TL 5EBWB 3RE0A 2QQLH 3U1SH 3L3GA 3ZKXB 4BKLA 3B9KC 5L4FA 1M6OA 3ARBD 3QXTA 4A6YL 2OSLA 4FJZA 1GGTA 4ONHB 3GPSA 1I3UA 4PGDB 3CVHB 4ICWA 3KLAA 3KGRA 3S2AA 5AVSB 3U6XA 3U25A 1NFIA 2GIMA 1TJGL 1JPFA 3EADA 3SGDH 3U2IA 2NY5C 2VR5A 5DFTA 4K7PH 4PN6A 3KLHD 5D1ZD 5D70L 4GG6A 4OZHF 4BDVA 1K5WA 1QFUH 3CC5A 1FVEB 4H26A 1OPOA 3BDBA 3PL6D 4MQXD 2X42A 3TBTA 5EO1A 2YAFA 1XF2B 4ALAC 2Z6FA 4TSCH 1ZLWH 2ZG1A 2DICA 3AG4B 1SUHA 3WN5B 4WHYH 4ZZFA 4FQXD 2R23A 2WQWA 5D6DA 1YEKH 1OHQA 3FYIB 3QNZA 4GRLB 4D8OA 5F1IB 3MOBH 1F4XL 4RVBA 3DNKA 4M7JH 4TPRL 3NVQA 2B14A 4XN5A 2PW2A 1R3LB 3FRPA 1XAUA 1S3KL 1JHLL 1T89A 2WB1A 1XIWD 1M1SA 3B8YA 3C9NA 4RH4A 5KN5B 5F89A 3OF6D 4X8GA 5GSVA 1I4FB 3QZNA 4PRBB 1DVXA 4G6FB 3F7LA 3LD8C 1J9QA 1OAKL 1BVNP 2VL5B 5IB3A 5LAPA 4KRMB 1T2QH 1AE6H 2QQKH 1JRHL 4OB5H 3OLGA 3QIBC 2XXGA 4DAGH 2MQGA 4J4PA 1XSKA 2QLYA 5F7MC 2CU9A 3NK4A 5DZ9A 3ARYA 3QR0A 4S11A 4XN1A 4DNLA 3QRLA 3QORC 3PGCB 3GXTA 4K5MA 1KPVB 4TL5A 4WTZA 4KKZA 5KYWB 1KCKA 4XBPA 3PIQB 3SGEH 3L8QA 3NAAL 5GZOD 4KQ4H 3QEGL 2IQAA 3WNLA 3CVHH 4PEEA 1DANT 1JVLA 3MGOB 3TV3L 3B9DA 3SO5A 3OMIB 4AV5A 3A6CL 3HZ3A 3QDMD 5EG6C 1A7QL 2OYPA 1PF3A 2CLRA 2VAAA 2ICEB 4WSJA 3GSRB 3D39E 1H3WM 3CFCL 1HSBA 3GXMA 3LB6D 3T2NL 3IBOA 4R4ND 3K2UL 3S8FB 2P4AB 4ZS6C 4I0PC 4UOW0 2AXHA 4AQZA 5J0BA 5FWQA 4YDLB 1TZHA 2D3JA 1G7QB 3IU4L 4KJYA 4FHBD 3QJZA 3VXMA 1M05A 3TTYA 2YD8A 4ZS7H 4KVCL 1A6AA 4MMZA 2EEAA 2PXYD 1L9NA 2QQNH 3SDCC 5T1LB 5CUSH 1C8PA 1UZGA 3TZVD 1DCLA 1M7IA 4ZMWA 3N0AA 3UADA 3CFEB 1U42A 5DVNA 1RU9H 4LASH 4XVSH 5EEWA 1DSWA 1DE4B 1JPTL 4FZEH 3WBDA 3QYMA 3BD3A 2ZWNA 1FJ1B 3EBGA 4CMHB 25C8L 4WWKA 3CMOH 5HVGB 2G2RA 1WT5A 2I9TB 3D8MA 4L8DB 1WLHA 2TRYA 4YHNA 5DDHB 5JW4N 1OEZW 2Y22A 3E8UL 4NDMA 4W6XB 1C5DA 4KVNL 3LTVA 2EUZA 3NJMA 2R4SL 3BIKB 4CNIB 3QUMH 4TTGA 5FGCE 5EU7C 1CQKA 1R5VB 1XF4B 2DQIL 5DD5L 1GS8A 1QA9B 3PREA 2E6PA 4KKCC 3O6ML 5DMKA 2GJJA 3NEEA 4NJAH 1PJ9A 2NY4B 2HA1A 1ZTMA 4UQIM 2B7DT 3SBQA 4G5AA 1HSBB 1MI5A 3AJ7A 2F7OA 1UM4L 5FV2A 3OZ9H 2WWMD 4DCQB 1SJHA 4WK0B 5D1XD 3QXAA 1SBSL 5H94A 2H9GA 3NMEA 4FG6C 1OF0A 2Z1KA 1ETA1 1F3JB 1NFDB 1OTSD 2DQGH 2WYZA 1SXAA 3S5YA 2QGBA 4JRYD 3OB0K 3OLEA 5J12B 1T1YB 4GRLC 1NFDE 4BINA 5HD8C 3VNYA 4OD2B 5IHUH 2CDEA 3TIDB 1V8HA 1I1YB 2O5YL 3VGDA 5CN2A 1N2RA 2XRAL 5KSUB 4MNQB 4GT0A 4UQAA 2X7LB 1WZAA 1FYHB 1HNFA 3QCUH 4M00A 2VM3A 2IANB 5KSAB 3LZQA 2EXYD 2CRYA 3VU2A 2P1YA 3QG6A 1JPTH 1I53A 4G6FD 1J0KA 4X4YB 5DR5H 3HRZB 3TT3H 5KTEH 3B9KD 5EORH 1ZDQA 3L4XA 4N0CC 4RIRB 5AEAA 4ADIA 3I3EA 3UH8A 2BSTA 1MLBA 5AYQA 1TZIB 3LPWA 1W72H 4XPGL 3NUKA 5LLIC 3PGDA 4P05A 1QNZL 2MSPA 2BSRA 1L7IL 1Z9NA 4HWBA 1N18A 1T1WB 5H4YA 2VWEC 1SJEA 4J12A 1U92A 1B0WA 3OKNB 1LEKB 1N5YH 1IX2A 4XC3L 1GH7A 4FG4A 1GGBH 4OSUH 4LDOB 4BWWA 4AJ0A 32C2A 3ETBF 2R2HA 3O6MH 3QDGE 3LKRB 3BFWA 3V8OA 3CC5B 3WEXB 5FAAA 5DJAB 5C0AB 5C0EA 5C97A 3AGVA 2H3NA 1WBXA 3FJTA 2YD5A 1DQJB 3B7RL 5DTFB 1JXGA 3BCDA 4UZUA 1QO3B 3GLZA 3RFZB 1HJBC 3CX2A 4OZGF 4LLWB 1Z9PA 2JKWA 4J3OF 5KVMC 1I1AD 4X83A 5INDA 4D3CH 4XXDA 5SX5K 4GMTL 2UWEA 3LRLA 3EJQA 1NDTA 4XWGL 3WIFA 3SGKA 5JW4M 3RUGE 4F8LA 1QX1A 3PJSB 1RUPL 4JFYB 4LGSB 4PRIA 2AERT 4ZMZA 5ESAA 3UMTA 2CRMA 5C7XL 4YBQC 1ZMYA 1JZ3A 2NX5B 5GRZA 1LNUB 5GS0C 4PJHB 4JFSA 4B6ZA 2IH1B 1TZGL 2YJQA 4MA1B 5E9DE 4E68A 1FL6B 5KVGH 4MRCA 4H20H 5I0ZA 4ODBD 5TQ0H 4DP7X 4KJPC 5E94A 1KBKA 2P80A 1DJGA 3VXUA 5BO0D 3F6JA 5GRUL 1ZT1A 25C8H 3DURA 4D8PB 4H2AA 3HJEA 3UZEA 1AXSA 3DV6B 4JY6B 4PPTA 5TE4H 1PZ5B 2X2UA 4DZBA 1H8LA 4PWGA 4DKTA 4DERA 3BUTA 1W72B 3PAZA 3TF4A 4RWYL 4HIXH 2IF7A 3CMGA 4PJ5B 4P9HH 4ECNA 4A1RA 4W9GC 1E65A 4DF9A 5D7IE 1O9WA 1ZLWK 2NY6D 3TYGL 4ANXA 1RHHB 2JI2A 1DQJA 4W9HC 2F1AA 4GRWE 1T80A 4PG9B 4E36A 4WWOA 2F8OA 2VYRE 3MRRB 3OD3A 5TDPA 4LCYA 4M6MH 4FQCH 5BXFA 4BFGA 2G4GA 1I9JL 3WL9A 4P4KC 5HDRA 4LF3A 4S2SA 4QXTB 2EQDA 3CK0H 1Q90A 1F4XH 2VABB 3LZNA 4NRZB 4U2YA 3WEOA 3ME0A 3F7YB 4PI0A 5LGYA 3MJ7A 1SPDA 2Y36L 2GBTA 4MA7L 1KTDB 2FLMA 3RGVC 5DUBB 4PS4H 4WW1A 2V2XA 1JK8B 3OG6B 5EEYA 1LNUA 2I69A 2AK1L 4KZEH 1MZYA 2G60H 2OR9H 5AYTA 1THAA 3L3OC 1XV8A 3MROA 1E8YA 3RIFK 1XGPB 2XRAH 3HNTH 1KIQB 4Y16C 5K59F 1OD9A 4WHTB 4I4WA 3OR7A 3OLIA 2IH9A 5IB4B 4FABH 1JD9A 2WWNA 4P23B 1YJDH 4JFXA 1LP9E 3KH3A 1DQIA 4KTEH 2P7TB 3ABKB 3E6HB 1MCJA 3GRWA 1Q72H 5CIPB 5HI4C 4BFRA 5BUPA 3G6DL 2OULB 1SRDA 2P42B 2H47C 3KYMB 3P3TA 4OKVA 4XCNB 5I74C 4OTXH 1J0ZA 1CL7I 1MWAA 1KIUB 2APBA 1FNHA 2B8OT 5M7QA 5D6DC 3VACA 4FTVE 1RUAL 4JG1H 4PD4J 4XCEA 5FA3B 2VDOH 4FKHA 2XN2A 5F0PB 4PBWD 4HXAH 3DMMC 3QJXA 3GSNA 3JT2A 4N2KA 3ZTJG 2AQQA 4HUXA 2PABA 1ID5I 2BNRD 5GGTA 1T89C 4XO5A 2HN7A 2QADB 2BSRB 5D1XC 5HDOA 2WOYA 3LPGA 4DFIA 4OZIE 2AI0H 2ZCKL 2VQ1A 3CH1A 3L3JA 2W0KA 3WHXB 3QFDB 3HPJA 4GBXC 5FYLE 2Z93A 2JQAA 1DSFH 4YHYC 1GZQA 4NAQA 3MA7B 3FRPG 3FOLB 3QAQA 4IRSC 4MD5B 2PR4L 4WY7H 4XP1H 5C71A 1BD2B 4GRLD 4WI3A 1S7RB 4PJEE 2J6WA 3RQ3A 3T3ME 3FO1A 3VM7A 1MJ8H 4LLVA 2AMUA 4DP2X 2AV1A 1D2OA 4ZUVB 5GZNA 5B8CA 4O51A 4Z3HA 1IFHL 3QORB 1UB6A 4NKOA 5F88B 3N1MC 3FOLA 5JDJA 3GXDA 4AGPA 1P53A 1TPXC 1MHHA 2R0WH 5T1JA 1VA9A 2PCPA 5JPNB 2EXYC 4GRWH 4MD0B 2DQCH 2GJ6E 2P8PA 3JWOL 5IIEB 5HHXL 2OR9L 4KI5C 2NX5D 4QO1A 2B4CC 4J2XA 1KG0A 3EGXA 1MCFA 4R9HA 1KCRH 3P3RA 3E2HB 3D3VD 5FF6B 3L5XH 3S5LA 2Z4QA 1PS3A 5A6MA 5IJKA 4H20L 2WLNA 1VCBC 4GLRI 1HDMB 2JCCF 1G7IA 4DKEL 5AVWB 1VFUA 5DVMA 4PJFF 1UGKA 1CE6A 3KYOB 4N2EA 2X6MA 3KPSB 4IIQC 2BHYA 2PCFB 3Q3GB 1EZSA 1E8WA 3F64A 2HVKB 4J8RA 1MAKA 2E9IA 3EDEA 2WQAA 3NTCL 1B2WL 5JIDA 1J05A 3T0WA 1F4YL 1MWAH 3L5IA 4YR6B 4KKBC 5ADOL 2H1XA 3GBMH 2WN3A 2LLGA 3GSVA 3G5ZB 3M1CA 5GRJL 3QSKB 5GGSB 4H1LA 1K72A 4FFZH 3SDAD 1MCEA 4O4YL 3HC2A 3MRFA 3LKPB 1QHPA 1IQWL 2DF3A 1RULL 2OYLA 4KKAC 4K94H 2O4EA 3TF7C 4XP9H 3PP4H 4OGAD 4WWKC 3EOAA 1WT5C 2HJLA 1DJIA 4M3JA 5F7BA 2YZ1A 3DJZA 2MCMA 3BYYA 5GGRB 4MXQC 2J6EH 3WFZA 4HJIA 3U9PH 3RHWF 4U0QB 1JGEA 4G9FD 4Q56A 4FOMA 4JS7A 5FK9B 1G9ML 3GIZL 4NLAA 5AAWC 4IBWA 2DLHA 4JRYE 3W5MA 1FCGA 5DJYB 4EI0A 5I6XB 1LGVA 3NJKA 2VMJA 1FUNA 2ZWSA 4P46C 3SKUD 2V3FA 3BKYH 4L9DA 4JMNA 3VH8A 2BSDA 2BVUA 5IK3A 1G1OA 4G6MH 4JKKA 1A7RH 5ESAB 2JXMB 5DZOA 4DK3A 3WTWA 1E9PA 3NRQA 4KVPA 3ABMB 4KXZI 1Y18B 4YHKH 4I77L 4MJ6B 3JVGA 3VFVA 2ITEA 3EGSB 1HOCA 5FYKD 3L5WA 1RZ8B 3CPLA 3OKOB 5CF3A 2BNRA 2FGWH 4X4XA 3O0LA 3EXJA 2WW8A 1B4JL 2EDOA 2GJ6A 3VD2A 3IGUA 4WKZA 1MQKL 3N42F 2BC4B 2WO3B 4GRMB 2VJ8A 3MRJB 4RA3A 3DXAD 2JI3A 4HLZG 3GSQB 5J8OA 1BFOA 1TQCB 1YQ2A 5BJTB 1XQ4A 4W81A 1H6EA 2VXSL 5IG7B 3FNKA 5JXED 4JO2L 4K3JH 1CICA 3BCFA 1M2VA 4GO9A 2EICA 4DFHA 3U4BL 3LKQB 4HXAL 4LVOB 5E4IA 3DHMA 4M93C 1TO4A 2RALA 4N5UA 5D5ME 3R4RA 1BVZA 5DVOA 5HJDA 4UTCA 4AM0A 1G9NC 2XIBA 4LDEB 3UYRH 4WNQA 1ZT7B 2P8MA 1G4MA 2NXYB 1H15B 2KLSA 4W70A 4TNEA 2DI8A 1UXLA 3WTTA 4MNQD 2FIKB 2CR0A 3D85A 1YO4A 5HDBE 1KELH 2OMTB 5IY5B 4WY7L 4XP1L 2Q9OA 3O2VL 3ZTJH 2WXLA 3Q5YA 4ZX6A 3KXFD 5LCVH 4NFCA 4WUUD 4ZW3A 5CMAB 4FDWA 4TTDC 5DK2A 2XJLA 2Z31A 1MDTA 3VG9C 3K1KC 4ADGA 1J12A 2XN9D 3TH2T 5F71A 4FXKB 4POYA 4LSQL 3JWNE 3FB7B 5T33H 3VFPB 4PJXA 3W81A 4L8CB 2EZ0C 2R15A 3QIWB 1HINL 1FG2A 2JCCE 4FAAB 1H9VA 3RVVC 2YO3A 5HPMA 2O6DA 4J3BA 3QULA 4Y4HA 1CXHA 5SWZA 3HMXH 3UJJL 1W6WA 2WBJD 4I9WE 2OX5B 3SE9H 3VGHA 1J8RA 2GJPA 2XTJB 4HHGA 4R0LB 2MTAA 3BSZL 4GIPD 5KOMC 3IXAA 2BW4A 1F56A 1D3CA 4HXBH 3TO4D 4NJ9L 5EWIH 2VDPH 3ZHLA 4OBSA 5JHBA 3WV0A 4QDGA 4XNUH 3US9A 1ND0B 4GSUA 2B59B 3H4HA 2PO6B 4ZX5A 4HIEA 1B4RA 3VFSA 1NPUA 4KROB 1CMOA 2C9XA 2WGXA 5IVZA 1WICA 1A1OB 2DBLL 1PGRB 4LKXA 1U95A 4NS0A 5FO9A 4LRNH 5D5MA 2ILLA 1UJTA 1LE5B 3ZT7A 4Y1AA 4UTAA 2WQVA 2P8MB 2IOMA 2AV7A 4L1BA 3PP4L 1YYCA 4AEIH 4NZJA 4I5BB 3CNKA 2RFXB 2AJUH 1HQRA 1D2PA 4WW2A 2X0UA 5C0JB 4LPUA 1GCFA 3B1UA 4K5OA 3U79A 4F37F 1DN2A 2VDKL 3IRCA 3T2QA 5JHDB 5DHMC 3PWUA 2XU9A 2D4DA 3FFCE 1J1PH 2CH8A 4EBQH 3K6FA 1GZHA 4FQ1L 4JR9H 4QRPE 1FO0A 4A04A 1KBVA 3ENEA 3PYCA 4X5WA 4OZ4A 5BQ7B 1BFVH 2Y5TA 2Q76B 3WNMA 4LQFL 4JPIB 3H8NA 2CMRL 3GMQA 3MBED 5C9JA 1FGVH 1MAJA 4WDIA 1ZLEA 2ZXCA 1NAML 4Y9BA 3X1EA 3B83A 1MJJB 3EGSA 3F7QA 3O6FB 4JL1A 1Q94A 1CLOL 2XBZA 4X8CA 2V0AA 4HSCX 3IE9A 2X89D 1WZKA 2CO3A 4BFKA 1ZS2A 5K9OB 1WIOA 3EHBC 5DJXA 3ZUCA 3L3OA 4OKDA 3DGGA 4KKAD 4U4BA 4BFIA 1FO0H 1KV7A 1S7SA 3AM8C 4B53A 4DIXA 5LDSA 2AJVL 4OV6F 5C07D 1IAII 4WWKD 3Q6GL 3BRDA 1DL7H 4ZPTB 3VGEA 5JTWA 1KFAH 3ZRSA 5A6LA 1ETZA 2TAAA 5CEZL 5I8OL 1RULH 4GMTH 2NSMA 4AGLA 3BVDB 1M4KA 4ZUTA 4XMPH 2NT0A 4TVUA 4WFFD 5E6IC 4CN4A 5E7BA 3O41A 2JMRA 1LO5B 3ESPA 5C7XH 1KLUA 3ULUC 1G7PA 1GVIA 3V4PB 2NCEA 5CD5D 1KNOA 3VWKB 2PYFA 4O51B 4LLVB 3JWNH 4X80L 1F90L 4U6TA 3TXAA 1S2EA 1YECH 1UG9A 4GEIA 3CBJB 4QRPB 1U3HB 3GMQB 5C9JB 1MSPA 3FU7A 4M7ZC 5E2UH 5DGRA 1FZJA 2CUMA 1QLEB 3DJSA 2BIPA 4O02B 4AXWA 4ERSH 2YFOA 3EO0A 4RGNB 5CSZB 3NIDE 3O3BA 1LQSR 3OKKA 4RWYH 2XVKA 4L8BB 5LBSA 4XMXA 1EK3A 1EO8H 1TJIL 1KG0B 4JPQA 5FKAB 4PJBB 3NT0A 2QPUA 3MGOA 1VACA 5FPIA 1CR9L 2NQ3A 5JXEC 1IM9D 3L5HA 4N28A 4I18A 2WZ0A 1QTYT 3QIUA 7CGTA 3FSWA 3U2SA 5B8CC 3ARBB 5K9QI 5ENWA 5JIPA 5LQBL 1T21A 2KPNA 4KQ4L 1FVEA 3VQLA 2GTZA 2QDVA 4NN6C 4PBXA 1II4E 1TETL 1QRNA 4TMPA 1QPKA 2WLKA 1CFSA 3CXDH 1X5KA 5F7FA 2X70A 3HC3H 1F42A 3MRBB 2PO6A 5GS1A 1IGFL 1LYQA 1SXNA 1YNLH 4RMRA 5K39A 5E23A 5FDWA 2HJKB 2PMZA 5DEFA 1EEQA 2WBJB 3CDZA 2VDNL 3GK8L 4IHOB 4B7IA 3IETB 1DYZA 1YEWA 3MFGB 3NJLA 1R3LA 3FRPB 4MJJA 2Q87A 2KHAA 2B1HH 3O2DA 4Y4FA 4AOFA 2AQNA 3V4PH 3QPXH 5IMMA 4LXFA 3ISRA 3M17B 4P3CH 5KBKA 2HKAA 5I6OA 1HZHL 2KH2B 3I9PA 3F12B 3K1DA 3LEXA 4GAYB 4JFOA 2HCZX 2ENJA 4DEPC 4DP8X 1JE6A 3RVVD 3L45A 1EFXB 5I75B 1NDMA 2R8SH 3QIWA 2VDQB 3KXFB 1TT6A 4NKIL 2VN5A 3C75A 4O2FA 1A9EA 3NFPB 3ZDZF 2AEIT 1QPXA 2IWEA 1BXAA 1JPFB 2CGRL 5F6HJ 5FW8A 4ONOA 3EH3B 5KEZA 4WKZB 3L4ZA 3WXWH 4OFVA 3SEPA 3E8UH 2OAAA 3U7WH 1P84J 4OCMC 2IG2H 4JZNB 3P4LA 3UPRA 2ZCLH 3SYOA 3VAEA 1CTMA 2OLDA 3GMNA 4LK4A 4NZRH 4HSQA 1UD4A 1Q0XH 3HCVB 4KRNA 4MJ4A 2DEYX 1EFXD 4LPYA 5KZCD 2DJSA 4LCCA 2P26A 1HEHC 1RKRA 4M1CC 3O45B 5CU9A 1ZDSA 4BWTA 5EU4B 2GAZB 3MJ7B 4HJJL 4DK5A 5CN3A 4HT1L 4XMTA 4NCC2 4NI6A 1PNCA 2DQJL 3X13A 3KDMA 3TBVA 4HS6A 3GS7A 2JF1A 4MWFA 2OZ4H 4ODVH 4MHHG 4Z7QB 1OP4A 3UXFA 4YSAA 5IJDC 1S3KH 1P7BA 1EZVY 1HAUA 2YFNA 2DQGL 3MLUL 4U6YB 1K2DB 4YC2B 3ZL2A 1G7JB 1O5DT 3D9AL 1JXDA 5AW6B 3D2UA 1G0XA 3WCYA 5I1IH 4A7SA 5C0CE 3UMNA 1WFTA 1A4JA 3QIUD 2RAMA 3HMXA 4NWTH 1DBAH 4ISVB 3PU7A 1PLGL 2BVTA 1A66A 3QPXL 1EBPA 5DYFA 4V1DD 5HHOA 3DOIA 4X42A 3ZDZB 3X1NA 3UJJH 3NJXA 2C9QA 2NY6B 3T3MF 1HL5A 2NNAA 2PTVA 1VDGA 3BQUA 4XZUA 5F7WC 2QGCA 5LWYL 4IW4C 4JKMA 4MB1A 5A16A 4X6EA 3CFQA 4WNJA 3CVIH 5EC2B 4OLVH 1RUML 3LIUA 5D2LA 3BAEH 3MODL 3TEXA 4PJFA 3C5JB 4MNQE 3Q2VA 4UQ2A 5ACLA 3S5LB 5D70H 2DY2A 3I6SA 4H0IA 1LEKA 1N19A 1HYSC 2A0LC 3CZJA 2ZUSA 4M61B 2J1ZA 2XN1A 3CH8A 1UOLA 4NCDA 4EN2A 4FQXB 4DPAX 1WZMA 2PYEE 2EH8H 1ECYA 3MUJA 3WS3A 3S88L 3ULVD 1N5AA 2R1YA 2BP0B 4XPBL 1KPUA 4KJWD 3HW7A 2HSIA 1M3JA 5DJ6B 3K2IA 1S8DA 2APTA 3P73B 3HC4H 3ELQA 3MV9A 4TQEH 5J6GA 4F2FA 4TLTA 3U9PL 5BRQA 3VI3B 5B8CB 1WRFA 3CBKB 4AW7A 4H1LB 2WXFA 3ZQ9A 3QI9A 5JIKA 3PY9A 4ELKA 4GFXA 2HVBA 3RY6C 4NENA 1JJUA 1JK9B 2AJZA 3DYMA 3HZMB 4LOUD 4HBQA 3S35X 2YPLB 1C5CL 5A3ID 5I1DB 5AVXB 1TFPA 4NRXA 3KPQA 5CD5C 4PWHA 5K59E 1QBML 2D7NA 4JFZL 2VLRB 2FLRT 1YNKH 1I1YA 4KJQC 1G7JA 2E7MA 4ZFGL 5TF1L 2VSKB 4PWEA 3LCYA 4M7ZB 5DFWH 3QEHA 3IVKA 1JD7A 1CJYA 4MXWH 3B7UX 4S1SH 2PW1B 5B3JE 3RWJB 5FF6A 3VD5A 1AJ7H 4AGQA 3EO0B 1IMHC 1BA9A 1NC4B 4A38A 4PJDB 4JQIL 2GTWB 5K1VA 1DBKH 1C7SA 4B97A 4Z7OE 1KCLA 5ERWA 5EEXA 3QIBA 2VSMB 4HUVB 5BRZA 3QG6B 3TEUA 1NGYA 1KCSL 15C8H 5B38G 3MPCA 1A64A 4AJWA 5FFGA 3UTSA 1KN2H 1IC0A 1BZ7B 3ERXA 2A9AA 3H9YA 3Q6FB 4NWUL 4XPAH 5E6IB 4ETQA 4LMQI 1EEYA 2FX7L 5DURD 4YOKA 4HJ1A 5F21B 5FO2A 4NZ8A 1IL1B 3F65A 5BS0D 3HE7C 3EH1A 4K07A 5C3LD 2WINB 4IKNA 1F41A 3N55A 5SX4H 3QUXA 5HGHB 1OY3B 2VKWA 4Z7UE 3SKOB 2ATKA 2D7QA 1F6AB 4HK3J 2DQ6A 2B08A 5I0YA 3T0BA 1A7OL 2MQ3A 3MV9E 4C56D 3HC4L 4TQEL 1JP5A 3O6FC 2NW2B 4PJ8A 1GR7A 2AQPA 4Q9CA 1JZ2A 4AYMC 1K3IA 1R24B 3VCLA 2C3GA 1IGFH 1YNLL 2FZ3B 2ITDB 3S35H 2LAAA 4MMZB 1MHCB 1GJIA 3VW3L 2IAMC 4NUQA 3UG5A 4CMMA 1QEXA 2X3BA 5TK4A 1EGJH 1HHGB 1NMCC 4AH2B 2D0FA 4UNVA 5D7IA 3KYMA 4OKVB 3LEVH 1NMAL 2W88A 4F9LC 3E6HA 4F20A 3EYOA 4LPVA 1IGML 3RZCB 4CW1B 2ADIB 2R4SH 4WEMB 2E5EA 3DX8A 3AM8A 4IBUA 1GC1L 1PLGH 1U33A 1X9UA 2OMXA 2A9ML 1FWXA 3UC0L 4UB0H 3VX1A 4EQ3A 5LBSL 1XGTA 5CJ8A 1TQSA 3NJFA 2JWYA 1EEYB 3VI4F 1AR2A 4BCXA 2F1BA 4DP4X 5FR3A 1NCGA 3TNNB 1S9XA 1UFGA 1PD0A 2GEQA 1TNNA 4EI6B 3V6BR 1Q1JL 2V7NB 1E4WH 2ZXDA 1QBLH 3BFOA 1MFUA 2XWRA 15C8L 3QAZB 1ECZA 1KTLA 1UENA 4CVWA 2XJKA 1UM5L 2IDSA 1XCTA 1EAOA 5C6TH 1PZBA 2HX7A 4XNXL 1IKOP 1DDTA 5IKCB 2X3CA 5AL0A 4V2CB 2ITCB 1RZQA 3L7FB 5CEYB 3QBTB 1U8MB 2NYZA 2OMYB 2BXYA 1K6QL 3FN3A 1DFBH 3TCXA 2AANA 4PG9A 1MFVA 3FTXA 3SQOL 1A25A 4OAWB 2DYSB 4RFEB 3L95B 1H5BB 2I26N 2RBLA 4LPCA 2C9UA 4MNGE 3C9NB 1QW9A 4YK4C 4FZ8H 5KN5A 5IB1A 3CUPA 5I5RA 5TDNA 2VJ0A 4RMWA 3QCUL 5CEZD 1TMCB 4OZFH 2XG4B 3MNWB 1NOAA 4LB8A 1KZQA 1BFVL 2ZWKA 3QIUC 1IARB 2EIBA 4R7NB 3OC5A 5SX5H 1YNKL 4YBLC 5IT2L 2P5WA 3GRWH 1NGYB 3QULB 2NDGA 3X11B 1SOKA 2ZD0A 2HLFC 3MNDA 1W6LA 2H7WA 4OZIA 3MLRH 2YPVL 1XR8A 1HNYA 2I85A 1MCCA 4HIJA 1FAIH 4TLKA 1G7LA 4G59C 5DHVB 3BWZA 1NICA 2FWOA 1Z66A 35C8L 1G5GA 1R33A 1UWFA 1TQVA 2IWGA 1A6TB 3ZTNL 5J1SC 5ALCL 3SDYH 1HIML 2AF2A 5FKPA 4LFHG 3IGKA 1OAQH 3C5JA 2ZKHH 5JOPE 3KEHA 1CD0A 5E95B 1U6AL 2Q8BH 2HG0A 4JFPA 3FT2A 3WY1A 1CI3M 3IDGB 1GSMA 1CGTA 1AR1B 1INQB 1X7SA 3HI5H 3NTCH 5C08A 1HXMB 2DOCA 4P5KA 1IIKA 2CCLA 4HK0B 3TA3D 1BVKB 2FSDA 2H3NB 3IYLW 3AWGA 3QNZB 1N26A 2BWDA 3DDGA 4KX7A 3BKCL 4QHPA 4NQDB 4EE2A 2UV3A 4JVUA 4ZW6A 5EUKB 2VLJD 3GZPA 1TENA 2A6JA 4X5LA 1OGAE 3CFIC 1WAAA 2C9SA 4L4JA 4FQCL 3VI3A 3LN4B 4POZD 3OKDB 5ITBL 1CQYA 4YSTA 3BEWA 5A3IC 3TBTB 1BX2A 3KAAA 5IHHA 3IJHB 4WW2F 5DJ2B 4PLKC 5DMIL 1NGZB 1FN4B 4X50A 1B2YA 2YBRB 3MCLH 2IGLA 3JWNG 4WRLA 4UT7L 3BEWB 5B7EA 5I24A 3JZYA 3VWJA 4IYKA 3Q05A 3AWEA 4KTEL 4Y2DA 4GRMA 1HHJB 4JZOA 2KKQA 5C92A 4QRSB 4XMZA 2GJ6B 1M6OB 3VA2C 4AK1A 1M3IA 3FO0H 3HNTL 2XACC 3L3GB 4BKLB 1ODAA 2MMXA 2V17L 1OF2A 5HI5D 1LO3H 2Q86B 2CNYA 4NM4H 1ACYL 3AQZA 5IW6A 4LE8A 3LVEA 5GGQH 5IM7B 1NDGA 1PD6A 1T1ZB 4RRPA 2O61B 3FT2B 4LARL 2K9FB 4UB0L 3PNRB 4XPTH 1QSED 4NZTL 1A47A 1JAEA 4M8VA 4JPWH 4A63A 5EPMB 1IBGH 1IKNC 3O4OC 2V2WA 3X3GL 2ZSVB 1DO6A 2YOAA 1J0JA 3HE7D 4NBYB 1I7RA 3B2VH 3O9WD 3QJVB 1TVDA 3GMOB 4PMFA 2FE0A 1G9NH 4R0LA 4U1JA 3LQMA 2E9GA 5DUPL 3U30B 2ESVD 1T0NB 1NKGA 2CXGA 3QNYB 3U4BH 1EEZA 4DZ8A 1SF5A 3V9FA 3EOAB 4WI6A 1RXLA 4K7PL 2BVQA 3TJHC 3X13B 3HUJA 3QJUB 3LZLA 4W9ZA 4BRVA 3SBPA 3QXVA 1HILB 2A6JB 1PG7H 5I1LB 2WGNB 2EDWA 2PN5A 2F19L 3B3IB 1BOYA 1ZLDA 2ZX9A 3HNSH 3QFGA 4N8VA 2WXQA 5JR1H 2Z31B 1G87A 1NUDA 3VQ1C 4MXWL 1BBDL 2YK1L 4YQXH 43C9B 1QRNE 2FGZA 2NSXA 3TOPA 5GISH 4JM2C 5AUMB 3TU6A 3KPTA 2X89A 2VDRB 5E0QA 4GP5B 1FZKA 5GIRB 3U9WA 3IJYA 4TM9A 4GUQA 1JF1A 1RERA 3MBWA 2VZTA 1VGKA 3VE0A 5FB8A 5J6SA 4Y16A 1A6TA 3ECQA 1VFAB 3KM1A 3SD2A 1K8DB 4Z3FA 3TWCL 4F37K 1AZZC 3PAUA 2DD8H 3C09B 1N64H 3LX9A 1OK0A 4IBSA 2JB6A 1W8OA 1R47A 4Y4HD 1GPOL 3BP5A 3W11D 3V6OA 2D7TH 3IJ7A 1N0XL 1EDHA 3B2UD 1XGUB 4PJBF 3DRQB 1TU2A 3IDNB 4HWBL 1FDLL 4JY5H 4MAYD 4P23D 4CRPA 3C6LC 1UD3A 4XP5H 5FYKE 5GRYA 4NZTH 4PJ5E 4K94C 3QDMB 2YN3A 3DC0A 2E47A 2O5XL 4DW2L 1MCWW 4F2MB 2IH3A 3BAYA 2OYMA 1BPLB 4GPVA 1X5JA 4MB5A 2G0KA 3FO9B 1WWBX 4NQEB 4OZGA 1QWUA 2H0PA 4XNXH 3C12A 3L95A 1A6ZA 1D7FA 3RWHA 3DI3B 2DM2A 3VO0A 1G9MH 4JRYA 4PWKA 1VFMA 4Q6KA 1UACH 3HC0A 4JUTA 2NOYA 3UZQA 2NY0B 3MLPA 2P43B 2C7FA 3RI5K 4UINH 1QACA 1CUOA 1G9HA 4CC4A 3FS9A 4Q7DA 4K55A 1JVKA 3FPYA 4O5LH 3VMPA 3H9HA 1LQBC 4NNPL 5FCUL 2QFRA 4GS7B 2MHAA 3LN5A 2J2ZA 2V5YA 4YGVB 1VKXB 3WFEL 4AE0A 2H4EA 2OTWB 4AIOA 1WFJA 1JGEB 2DWYA 4JQVC 1X9LA 4E0RB 4Y16B 8FABA 3HE7A 2YRLA 4LRIC 3RVTC 4P9ML 1QI3A 2OJZL 2QL1A 1VFAA 3MBWB 4CADA 2JIXA 3QUXC 4X7EC 3RX7A 1TZAA 4LSSL 4NHCH 3OKKB 3DX2A 4XO4A 1J87A 5E6RB 3L1OL 4CW1A 3U36A 3KJ6L 3MN8A 2OMXB 4CU8A 3FU7B 3GS0A 3CN3A 5IFAL 4XMLH 3F5WA 2L7JA 4CU7A 3O3AB 1ZVYA 2Y2WA 3GSNL 4E42B 4DP9X 1WGOA 3D34A 1E28A 3ZDWA 1U58A 4YR6A 4LARH 1QR4A 3UTSB 1EGJA 2EJ1A 3FB6B 4PY7A 3RWCA 1MFAL 3WENA 4U1MA 1JTPA 3ES6A 1L0PA 2R27A 1SDDB 2WZ6A 2OP4L 4AQAB 4ENED 3PV6B 4HUUB 4QCIB 2VSDA 3FFCA 1JNHA 2XKNA 2FT6A 4BCYA 1MJUH 2IDCA 2UZPA 3F7YA 1U3NA 5T1KB 1V7NL 2ADGB 1BGXH 2IPKA 2UZIL 1XH1A 4NO2A 5D5MF 4S2SB 5DVKA 5G4OA 3THMH 1PY0A 1GYCA 2ADFL 4ZUTB 4OUUB 4HLZH 4EVNB 3ULUE 4UOZA 1F6AA 1S7VA 3BD5A 3IWUA 4N25A 3Q2LA 4Q0XL 4XOEA 2R2EA 3D39A 4E41A 4DSYA 4JZJA 4Y4KD 1JF1B 1XTMA 2WIIB 3GNML 4N85A 4C59B 3C08L 5JMRA 4I5BA 4A39A 2XYCA 1TFHA 4AYSA 3G9AB 5KJRL 2XSKA 1L9OA 4S0SD 5DRXB 3D0AA 1WAEA 5C0AD 3F00A 4LNVA 1A6VH 2O5YH 3LY6A 4PVNA 4LCWD 3WEMA 1S7TB 5CINL 5K9JL 3ZN6A 1X5XA 2Y0SA 4FCAA 1Q9LB 4EI5D 1S7UA 1PQZB 2GSIA 2J20A 4NQDE 2CALA 5L6YL 5F7YC 5HDQH 3G6JA 2F18A 1P7QD 3JVGC 2J73A 4WGWB 3X1GA 4TF4A 3SDYL 2IOOA 4FQQA 3FH5A 4XWOD 1BEXA 3FONA 4GINA 1U6AH 2E6QA 4JO3L 3I02B 4L4TB 3K91A 3WS3B 1NC4A 5D6CA 1W16A 4I9WD 1C5BL 1BLNB 2EYTA 2VN7A 4YHPA 1DN0A 1ZA3A 1IKFH 1RK1B 2K0RA 1NEUA 3O9WC 3QUZB 3MOAL 2LQRA 2Y7LA 1CICC 3GJFA 4TUJB 1IE5A 3NIGB 1ES0B 1WS8A 3RWDB 3AREA 1ZVHA 5DQJB 4WSGA 2WVVB 4QGTA 1AOZA 4MX7B 2Y6SD 1K9TA 5DTFA 1DTUA 2OP4H 4P5KB 4J6RH 4L37B 4YN3A 1QRND 4YHIA 3B8SA 4FL4C 2YD4A 3Q5OA 5EA0L 1V3LA 3L3DA 3FAWA 1GY2A 1B9ZA 4X99B 3SY0B 3R7RA 5IVZB 2FQEA 2X1QA 4FJYA 5AW2B 5AVZB 5CD3B 1FRGL 3KYAA 1W0VB 1NJ9A 5AKTA 4G9DA 3M8OH 5T33L 2GPZA 1P4LB 4PP2A 1JTTA 1YPZF 3E1F1 3RIAF 1TYJA 1V54B 2B5IC 2X4NA 4ZDHA 4WI7A 4XWGH 2F7RA 5I1GL 1JV5B 2XI9A 4EN3B 1G7LB 5DHVA 3DUUA 4APQC 3TO4B 3FB5A 3OAYH 3QZMA 1QMUA 2OFQA 3MBEA 3NCJH 1NUFA 1W0YT 4A2FA 4ZQKA 3JUYA 3WNIA 5HPMB 3DSFH 1RZKL 4LHUA 5JDSB 3QA3B 5ACZB 4Y4HC 5EWIL 3MRLA 5HYQA 1VSCA 5JIMA 3UAAA 2ZUUA 5DS2A 4PU2A 3B2UC 1L0QA 2XG5B 1QOKA 4G1MB 4ZK8A 3FCTB 3TBBA 3U4AA 1SNRA 2H45A 3MZTA 5TE4L 4L3EB 2VC2H 3ZDYE 1P6WA 1INQA 3ZDXF 2UXFA 5SWSE 3ZYOA 2COQA 2N7SA 5ICXB 4BKTC 2DLIA 4NQDD 4GKOA 4R2GC 1C5BH 1X9RA 4B7LA 3HVDA 2G5RA 1KLFA 4FLQA 2WYIA 4TUKL 3P30H 2IBBA 4NJAL 4HS6B 3D39B 5LAXA 5LGJA 5DS8A 1F3JA 2ZKXA 4XP5L 1S5HA 4Z7QF 4JEGB 1RZJH 2DAVA 1KPRA 2DTSA 1SZNA 1FF5A 4P2CG 3FUMA 5C0GA 4B5ZA