1DFXA

Desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
PKHLEVYKCTHCGNIVEVLHGGGAELVCCGEPMKHMVEGSTDGAMEKHVPVIEKVDGGYLIKVGSVPHPMEEKHWIEWIELLADGRSYTKFLKPGDAPEAFFAIDASKVTAREYCNLHGHWKAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESULFOFERRODOXIN
publication title Desulfoferrodoxin Structure Determined by MAD Phasing and Refinement to 1.9 Angstroms Resolution Reveals a Unique Combination of a Tetrahedral Fes4 Centre with a Square Pyramidal Fesn4 Centre
pubmed rcsb
molecule tags Electron transport
total genus 26
structure length 125
sequence length 125
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 1997-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
A PF06397 Desulfoferrod_N Desulfoferrodoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1dfxA00
1VZGA 4BV1A 4C4BA 1Y07A 2HVBA 2JI1A 2JI2A 4BFKA 1DQKA 1VZHA 1DO6A 4C4UA 2AMUA 4BGLA 4BK8A 1DFXA 4BFFA 4BFJA 3QZBA 1DQIA 1VZIA 4D7PA 4BRJA 4BRVA 2JI3A
chains in the Genus database with same CATH superfamily
2FWOA 4WFEE 3BEVB 2LFEA 1CICD 3BN9C 4Q4EA 2X2HA 1NCWL 4ZYKB 2AGJL 3ATEA 1Q0YL 2EEXA 1MCQA 1EXUA 3VQMA 2W1NA 3GFUA 4G3YH 1ZE3H 1F4XL 3QJHA 2CG9X 2ICES 1JD7A 2NY4C 1NBZA 2KERA 3MJ8B 4GW1A 5I1IH 1IEHA 1MJ8L 3PWPA 4ZOEA 5AVSB 3H2WA 5F96L 3X3GL 2KL6A 2LV4A 1T5WA 1QNZL 4OCWH 4X6CE 3U9PH 1HIMH 4IU2B 4WU7B 2R23B 1JXKA 4X80H 4XT1C 1BVKA 5DUBB 4PD4K 1WFIA 5JIMA 3HUJA 4HUNB 4RISL 2UXFA 1ZA3A 4ZOCA 2OMZA 4HWBH 3DMMD 4HJJH 3A4EA 2WC7A 1DBJL 3IJHA 1OAXL 4LLDB 1VRSA 3JYCA 4MNQA 1E3ZA 3IU3A 3R8QA 1IIIA 4L5FE 4OUUA 5D4JA 3O3EB 3V5DA 1EDYA 2YS4A 5JTWA 4H26B 4L0ZA 5J6HA 3PNRB 4Z95H 1A7OH 1FJ1B 1UQSA 4D7PA 4G11A 4EAEA 3U6RA 3ARDC 4AITA 4ZZKA 5MEPA 4S2SA 2LU7A 1CD9B 4CSZA 4G83A 1P53A 5AOMA 4F57H 2HKFL 4XWOC 1KTDA 2ATPA 3SDAD 4BQ8A 3UROR 3V10A 1D5XB 5A3IC 3HLAB 5F9JA 1YNTA 3HC0B 3MLXL 2UYLB 5D2NC 1U91A 2Z4TA 4OT1L 1YEJL 3KBHE 1UATA 5GJTL 3QI9B 5A6MA 1UZ8B 3O2DA 1YDPA 3CDZA 1ID2A 4PJ5D 4RSYA 4AKQA 4U0RB 3OLEA 4S1QL 1CLZH 5GGRB 2ATKB 2QFPA 5F1IA 5IJVB 1FGVH 4GAFB 4PMEA 2E46A 1WBXB 1AP2A 3NACH 5IMLA 3RWJB 1DP0A 5B39B 4DGYL 1EAPA 4NC1E 3WUZA 3ZYJA 1NFDE 4G82A 4FNLL 4UIMB 4W6WB 1JZJA 1TVDA 1X5MA 3P3RA 4QOKD 4JUSA 4RWHA 1RZFL 3VFSB 4NN6C 5KBLA 1TQUA 5E2UL 2VDRL 5I1EL 2VR4A 5C0AB 5I2IA 2V3FA 1C9SA 4TLTA 2ZPKH 3EHBD 3QPXL 1A6UH 2ZF9A 1QI3A 4NRYB 2AHIA 3NJXA 4MHHI 2X10A 3HW7A 3SDDB 2ZXQA 2XN0A 3KPNB 3E1ZA 4HF5H 1BFSA 3NCYP 4PRPE 1MW2A 1P4IL 1MFMA 2J8UB 3MJ9A 5IFHH 3ARDA 3SKNA 4KKAD 4TQEH 3L2MA 1ACYH 4Z7QB 4ZMQA 2VDML 3Q8EA 4P99A 4JY4A 5T1KA 2QFRA 4PJXE 1U30A 2ERJB 4TVUA 3OAWA 5DRNB 5E0FA 4YE4H 5E9DD 2VDPL 4MAYA 3PE9A 4M8QB 5D2NA 1NKOA 1E2ZA 2JELL 3C5ZB 3V6OE 3CLFL 4JB9L 12E8H 2PO6C 1IM3B 2UY7A 4CN6A 2YAFA 1OAUL 3O9WC 4QGYA 1WLHA 3KS0H 4GNKB 3MJGX 4FYQA 4FLOA 3WIAA 1WZ1L 3STZB 5CSGA 2FH6A 1XF1A 4LSRH 3U4KA 4OZIA 3S5LB 1OB0A 1RZ8A 5JQ6L 1I75A 3U46A 3PP4L 2N01B 3WYRA 4ZMTA 3I6LD 3IDXH 1CLOH 2B59A 1SVCP 5F0PB 1DLFH 3DVNB 3PV7A 3FFDA 2OKMA 3MV01 3NTCH 3S36H 1BEYH 1CLYL 3HLKA 4NQVA 4Z9KB 3IFNL 4O02H 3HNSL 4UDTA 4HC1A 1AXSB 1A0QL 3DECA 1KB5H 1QEWB 3NN8A 4AJVA 3L4WA 5IUSA 3WMPA 4GAGH 3U25A 4I4WB 4Y1AE 4NO5A 3CLEL 5J12B 2UZIL 5HI5D 1ETJA 1WHPA 1KJ2B 4PVBA 3P3UA 4PRIA 1SUHA 3TV3H 3OR6A 4YDNA 1IC7H 2IWKA 3TJHD 3X14A 2AJYH 4BXVA 5GRVL 4YC2B 3DPDA 1MCSA 3GI8L 5DF0A 1XBDA 2Y3NA 3ARSA 1LMIA 3QJSB 2ORBH 4FCAA 3NMEA 4J2QA 3AVEA 2XIBA 2VW6A 4X6DE 1KZQA 3E38A 3H9ZA 3ZE0E 3D48R 3BGFC 3FK3A 4U1LA 3IDGB 4LEOB 3AACA 1GAFH 5A40E 5I18L 3MACL 5LBGA 2PO6A 2WHVA 4LSQH 4JG1L 1X7SA 3K0YA 4N2GA 4PLNC 1N4XL 3CQQA 2FX7H 5DEFA 2CBQA 4G6FB 2NY6D 5JW4N 4UOQA 3ZKXB 5CGMA 5FC9A 2R56L 4AE0A 2V17H 1IKFH 1M3IA 1ND0A 4Y9GA 3MRFB 2FL5A 3JT2A 1FH5L 2DZEA 3WFZA 1TMQA 2C7FA 2ALAA 2NY0B 4JAMB 2XACC 4BM7A 1VLXA 3ALPA 5IB4A 3MRKB 5GSVB 1B88A 2ZF8A 1Z9MA 3BUQA 3TTYA 2WINB 1WQVT 4J8RA 3ZIMA 2W0LA 1GGIL 5KW9H 4KKNA 3X2QB 1H5BA 4XCCH 4Q9RL 1NEUA 2J21A 1F18A 3B9AA 3D08A 4M3JA 1HK6A 1PZ2A 4YXKL 2NX5E 2LW3A 3QA3A 5D7KD 4YZWA 1PAZA 3PHQB 3ZYZA 4MDRA 4UDUB 1F3JB 3GLEA 3V0VA 4AVJA 3H7LA 4HJ1A 2H3KA 4DAGL 2CLZB 3IDYC 4LPYA 5BZDA 5FPIA 4XVJH 3D9AL 5ID1A 1NKRA 2KQMA 2R27A 4L29B 4UV4H 4UT7H 5I1CL 2DIBA 2BHZA 5KBKA 4UQ2A 1TJGH 3KWXA 3SOBL 1KYFA 4XPHL 4OFDA 3Q2NA 3SGKC 2FT8A 3GMMB 3D0VA 1J88A 1ZK9A 1Y1DA 1FZKA 5GJSH 1HN1A 1SXNA 4O58H 1JGEB 3GSRB 2NLJA 3VDCA 3SPJA 1AQDA 2ADFL 1JWSB 4EIZC 2A6KA 2YA2A 1S9WA 3L95A 3MNVB 5CGYD 1EANA 2IFFH 3NJFA 1ORSA 3FN0L 1YMMD 4G8FA 3LQAL 3VXOB 1KTLA 3TESA 2AI0H 2WXIA 2H6UA 5LXVA 3FC8A 1IJNA 1SN0A 3IAPA 3C2AH 2FJUB 3QCTL 4RNRA 4D0DB 5LGJB 2HFFB 3FT3B 4KO7A 2N4IA 5DJCA 4EKJA 3EJQA 3WNLA 1D9KB 4L1LA 3BZ5A 1DDHB 1PCXA 5E2JA 4R90L 3E80A 3P3TA 2R0WL 2X6AA 3O0LA 4I1RA 3FQRB 4XN2A 1FHGA 4NO0A 3TPUA 2J1YA 5KVDH 3FQNA 2ZX5A 4GIOA 4GKSB 5CFAA 1W9XA 3TNMA 3MLYH 2D7TL 1G1CA 3RNQA 3VWJC 1MZZA 4X8XA 5E4EC 3EBAA 5EEWA 3D69A 3BDBA 4GBXD 2QVMA 3SGKA 3EFDH 1GL4B 2Z8WC 2WXMA 2ZZUT 3FO0H 3LXBA 1LJMA 1NUNB 5HI5C 2FD6H 4HIIB 4PLJD 5I9QC 2P5PA 4BK5C 3MRRB 5AW5B 4APQD 5EUOB 2DBLL 4HXAL 2QHRH 1CPUA 1PEZA 2Y1ZA 1AXTH 2COQA 2J3SA 1AMYA 5BO0D 7PCYA 1KELH 2BVTA 4RFOL 4MWFB 5ACZA 5DJDA 2PXYB 4LU5H 1UGKA 2XWEA 3WUWA 3KDMB 2VWEC 4TLSA 4ZUSB 1H6FA 3GMOB 5ETUA 4L3EB 2NRDA 2X4UA 3GBDA 3KYOA 5EO9A 5GGTA 1OAJA 1KG0A 3ABZA 2NDGA 3EOAA 5G2NA 1EZUA 1KB9K 2DH3A 4N6RA 3VFOA 1KCUH 1L3NA 3V4PH 1B0GB 4HOWA 2CHDA 4MS8D 4P9ML 5EZIL 2XBDA 1VACA 1WA2X 2UZPA 3TJPA 1DSYA 5DVLA 4HJGA 4OFPA 1FNLA 2NUPB 4PJ7E 2LAAA 5M94B 3S36X 1UUSA 3H85A 4KKRA 4AH2B 3VWJA 1RHHB 1Q38A 1G9ML 3LD8B 2K6ZA 5CN2A 3W0WD 4OB5L 2VDOH 2XQ0A 1C5DA 4PWEA 3ILPA 5TE6L 3SBWC 4X99B 4HUUB 4R5VA 4JHZA 2DI9A 1FNGB 1TCRB 5IMKA 2ZUQC 5BQ7B 4PLKD 4N2NA 3FHEA 5I17A 2DM3A 4LGPB 3TBYA 1FYTE 4Y4KC 1W80A 5CEZH 1B9ZA 1Q0EA 5IESH 4LVNB 1N68A 4GQQA 4QRUB 5K59F 1TDQA 3I84A 4U1MA 1RLWA 3NFPB 1OT1A 1NCWH 2AGJH 1WISA 4G9DA 5E8NA 1Q0YH 3OMNB 1H3TA 4B0MB 3LNIA 1E9QA 2V5YA 3ZMEA 1IBBA 2WW8A 4QNPF 2AQ3A 1F4XH 2GY5A 1Q9KA 1DN0B 3H9SD 2WMPA 4RLDA 4G8EA 1MJ8H 2DW5A 4RGNE 1UB6B 3UEZA 5GZNC 4JHBA 3BQUC 5F96H 3X3GH 2DLFL 4CU8A 2GK0A 1QNZH 1S7WB 4EBQL 1LP9E 3KPSD 2PN5A 5AKVA 5CEYA 3KL0A 4B0MM 3FB7A 3MLRL 4RISH 5A7BA 2PCPB 1DVYA 2G4EA 3MCKA 4PGZA 1T1YA 4BD4A 2IEPA 4P4KD 5HI3D 2VERN 3MGTA 1T2JA 4RMVA 3SBWA 4NFDA 2Q0ZX 5FX3A 2ZOKB 3NJIA 2FWOB 1KTBA 5EZPA 2BP5M 2WXPA 4GUQA 2YA0A 4F1ZA 3GRWL 1UEYA 2VDNL 1EXUB 4Y4KA 4F7CA 3QJHB 4UQAA 1T1XB 4HPOL 2IMNA 4YWGL 4HBQA 3DVIA 4P3DA 4GW1B 1NBZB 4NKMA 4KGJA 3PWPB 5A2JH 2HKFH 3AG2B 3GSOB 4OBSA 1FVEA 4GSDL 3K72A 2ZWZA 4IKIA 1MWAL 2IANA 3HG2A 3UC0L 3MLXH 3B43A 4OT1H 3QFDA 1YEJH 1BVKB 5JDJA 5DD3L 5GJTH 5EU6E 3HUJB 1CG9A 1ZA3B 1FZOB 2OMZB 4S1QH 2FHCA 3DV4A 3P0VL 5AB9A 2IDTA 3IJHB 4M93B 5GZNA 4F93B 3BQUA 5HHQA 3GTVA 5HI4D 3WXVL 5GS1A 3FO1A 4AEHL 4ZFQA 3IU3B 4NQEE 4OUUB 5FO2A 3V5DB 4FXGC 4U1HA 5T1JA 3V0WL 5J6HB 4FNLH 3WFEL 3AQZA 1E28A 2C3GA 3H0TA 4JRXA 5I8KL 1FVDA 3HMXL 1RZFH 5LG6A 1UQSB 3WTXA 3GJFK 3RWCA 3TT1L 5K1VA 1PJ9A 4Y5VC 2VDRH 4LKCA 5I1EH 4A2GA 2I26N 4U1GC 2X6VA 1A6TA 3TCTA 3DX2A 4JKLA 4NBZB 1WICA 4X9IA 4LNRB 1E9OA 4GLRI 3FFOA 1KTDB 2ATPB 5L9DL 1U3JA 2P5EE 4OFVA 3IS1X 4X6BA 5F9JB 4V1DA 1YNTB 2X7LA 3AW5A 1U91B 1UWEH 4QHKJ 2X5PA 2DMCA 2BRRL 4HKXA 2OSYA 4WHYH 4D9RD 1YDPB 4BJLA 1VHPA 3CDZB 4FEMA 2AK1L 3IPFA 4DPAX 2NNAA 5F1IB 2CZNA 1YG9A 4TL4A 1AP2B 5BCAA 5IMLB 1KJVB 4Z3FA 2VDPH 3LHAA 3WBDA 5DK3A 2D03L 1LWRA 4Y89A 2JELH 1G84A 4JB9H 3QZLA 2DJMA 3TV8A 4TQPA 3Q8BA 4HU8A 5F7LB 1C5BH 1E90A 1QPKA 2WKOA 1QSEA 3H56A 1YN6B 2DQTL 3I6GA 5C08D 4ETYA 5JQ6H 4P23C 1QPXA 3IBOA 3BFOA 4ODHL 3SN6N 3PP4H 3UDWA 3S48A 1MIEL 5I0VA 4FXGA 1OF2A 5HJGA 5AAWC 5HHOE 5AW3B 2JKTM 4Y2LA 2JCCF 1RL1A 3HRZA 3IMUA 4OTXH 1CLYH 4PJ6A 3HNSH 2XVKA 2O6CA 4Y5VA 2C1OA 2XV0A 1A0QH 1ES0A 3ARDB 2MQCA 5IB1A 4H0IA 3SKNB 4JRYE 4D8PA 3M7OA 4AW4A 2NXYD 4LLWA 4FI6A 1Q8MA 2VR8A 4GINA 3CLEH 3WE1A 4JY4B 1QHPA 2JJVA 2UZIH 4PFEA 5T1KB 5A2IH 1ITCA 3RY4A 2BOLA 4HUMB 1CXIA 3P4MA 5C09E 1FSKC 4MAYB 4DUXA 1EZSA 3GC3A 4PH8A 3QIWD 5D2NB 3NDZE 4C58B 5LO7A 4OI8A 3GI8H 5JHDA 2UY7B 3HN5A 3ARFC 1FGNL 4KNTA 1Z5YD 1A1MA 3BESR 1ZK5A 4OZIB 1TFPA 3QUYB 3LMJL 1RZ8B 4G8GA 3U46B 1EZLA 5EHFA 1C5CL 1UM5L 3OKOA 5D1ZC 2HFGH 5I18H 3FFDB 3MACH 3ELQA 1N4XH 1ASQA 5E9AA 1FBIL 4NQVB 4UDTB 4XNMA 3T6WA 1SXSA 2Z8VC 2BP8A 4DUWA 3EXJA 4AV0A 4XNUL 4EZMA 2BERA 2R56H 4P23A 2UWEF 3WNIA 4NO5B 2I69A 3RJQB 1JGDA 1UCBL 7CGTA 2ZCZA 5AAWA 5I73C 1P7HL 1FH5H 4QWWD 2BMKB 5HTSA 3KMDA 4PRIB 3U2IA 4I0PD 3X14B 3RZCD 1HQRA 3HZVB 1GGIH 1DTUA 1NZRA 5D7IF 4Q9RH 2FATL 4P5SA 2AQ1A 3ROOA 3JZYA 4YXKH 4XO8A 3FSVA 3CQPA 2XTJD 3SKJL 3RX7A 4X8GA 1YEFL 4U1LB 1Q90A 4NOFA 3DX4A 4OU3A 1MCRA 1E5ZA 5C3IA 3ARFA 1TQSA 2WXGA 3RURA 1SOKA 2P48B 3OG6B 1NMBL 4HS8L 5BRQA 5I1CH 1FFRA 4KHTL 5HY9B 2ICCA 2EDHA 4N90E 5EIIB 1NKGA 3U0PA 4H1LG 3V6FA 2VQ1A 3T77A 2VR5A 1ND0B 2WBJD 3F7RA 3SOBH 2FL5B 2RHEA 5D1ZA 5FV1L 2OV0A 2ID5A 4ZMVA 5ABDE 5AAPA 3WTVA 2PWHA 2CIKA 4ANKA 1P7QD 3N40F 5IB4B 4LAJH 3LZPA 1NPJA 3NCCB 1A3RH 4NNXA 1RHFA 1IU1A 1S7TA 3MUUA 2FEDD 1CFNB 1FP5A 4PY7A 1KOAA 4J8RB 5E4AA 1NCHA 4DOHE 2HT3D 1H5BB 2PWGA 2GAZA 3UG3A 5AW7B 2ADFH 3OMIB 2NQCA 3LKSB 2GG1A 1JRHL 1BD2D 3FPYA 3QA3B 2WUBL 2Q7YA 2IPTL 4FABH 2ZT9C 1IQDA 3V0VB 1CURA 2PYEE 5JHMA 1JZEA 3L4CA 2R59A 1FHNA 1MVUA 4KY1L 3VI3E 5BZDB 4KNUA 3S88H 3QCTH 2RALA 4CKVX 5ID1B 5MENA 3T0EE 25C8L 3TZVC 1HXKA 1SN5A 1Q0XL 1WZKA 2WLJA 3BGFB 1N12A 4R90H 2JKXA 2R0WH 3TH2T 3D0VB 3IDUA 2Z8SA 5F1KC 2ESVB 4LOVA 1FZKB 5CSZA 4G8IA 4LCCC 1AC6A 1IMHC 1DJXA 1E50A 1UT1A 3TEWA 1XWVA 4HHWA 2NLJB 4JFUA 2D7TH 4NT6A 4OZ4A 5HHMB 1ZHLB 5I1DA 5IBLD 3I6KA 1KGUA 2K78A 2A6KB 4M8UA 3BH8A 5F8QC 1S9WB 3L95B 5FYLE 3BGAA 3LQMA 2FZ3A 1ORSB 2R2HA 3QDJA 4NNPH 2FQGA 3WCYA 4JQIL 4G8FB 3F7VA 1KTLB 3DXAD 2Q87A 3HVDA 4HJ0D 1GCYA 2PW2A 2BNQE 4JO1H 2N1TE 4RNRB 5T8IA 2DBLH 4HXAH 3TP4A 2ADJA 5DJCB 2ZONA 4LPUA 4F15C 1CDUA 1RUPH 3L54A 4RFOH 3ZE1B 3WFBH 2YLKA 4G8AC 5CIPH 5LDUA 1M3JA 1OF0A 2QR0B 2NYKA 5EO0A 4NO0B 3TPUB 4LCYA 3EDFA 4XBGA 4AJWA 3FQNB 3HMWL 5AB1A 1WBYA 1T21A 4O2EA 1NM9A 3TZVA 1BM3L 2K9FB 4Q6IC 3TNMB 4N2AA 1VGKA 3GT6A 3RNQB 1L7TL 3KR3L 5AOJA 1TSHA 2VT0A 2XWBA 5EZIH 5AW6B 3S35L 4YHPA 1BV8A 2VW4A 2XWJA 5EC2A 2XVGA 1PX8A 5EOCL 4ZJ9A 5I6XC 2X4SA 2APTA 3VWKD 3L8QA 4ODSL 3MV9E 4N1HB 4PRNA 1G9MH 3BRDA 3PWJB 1NANI 3RZCC 3NH7L 4FRWA 5TE6H 5DS1A 4E68A 1Z32X 4P59L 3R06A 5ACZB 5DJDB 3AWEA 4QRBA 3PYCA 4U05A 5CD3A 1PF3A 1J86A 2PKDA 3VB9A 4F9PA 3WUWB 1CUOA 1TG8A 4YJZL 5FAAA 4NKDA 3QT2A 4MKTA 5ETUB 5GRYA 2VMJA 2D7MA 2X4UB 3KYOB 4CAGA 1KG0B 4YDKL 3EOAB 3PL6D 4N25A 4NZRH 4HLJA 4N6RB 4QF1A 3US9A 3JXAA 2D2CC 2XWCA 4P06A 1DVQA 5GQBA 3VFOB 3G6AB 1FORH 1J8KA 2GEEA 4PRBB 1DFBH 2VLKA 2YPVH 1VACB 4ISVB 4HJGB 4WQOA 2VL4A 4JFFA 3D2UB 1KJ2L 2BY0A 5KBNC 1TUPA 4Q6IA 1DJZA 2ZG2A 3RY5A 3VWJB 1PLCA 1PW3A 3CIAA 1YC7A 3HN8A 1C5DB 4LBEA 3ILPB 2VH5H 3KLLA 4EBQH 2YN3A 3ARGC 4FEIA 4K07A 1EJOH 1PSKL 4CW1A 2BLFA 3F3HA 5I17B 3MLRH 5D55A 4G42A 3TBYB 5IHBA 4QHLA 2B9BA 1WVZA 1O6TA 3U9UA 1T83C 3CFNA 3EUDA 3G5WA 3JV4A 2EC8A 2EDLA 5K1JA 3LXCA 4U1MB 3IWVA 4EZLA 2OULB 3NJLA 3ZU8A 2APBA 5F72S 1FRGL 1JK8A 4G9DB 3GRWH 4YHMH 5E8NB 2VDNH 4Z7VF 1E9QB 4LSPL 3TBVB 4Z3IA 4UMGA 4OFIA 2WXKA 1Q9KB 4HPOH 2WMPB 1RCYA 4AYFA 3KLAA 4G8EB 3WS3A 1DQLL 1GOHA 1JMXA 3E6HA 4GSDH 1MUJA 1MWAH 3MXVL 4ES9A 1L6ZA 1HNFA 2GK0B 1SLVA 3HC4H 3UC0H 4HUCA 4LLYA 4GXVH 2VLME 3H1ZA 3GEFA 4DK3A 2O5NA 4RA3A 5CEYB 5JHLL 5DD3H 3FB7B 3OX8A 4XMUA 1OSPL 2IIJA 4F2ME 1IO4C 4HOXA 1A1NA 2QQQA 3MCKB 1T1YB 4F37K 3RG1C 3MGTB 1S9VA 4JFHE 2M2DA 2OX5A 3WXVH 4AEHH 1XCXA 3LQZA 1FLRL 5ERWA 4HIXL 3BJLA 1BLIA 3ARGA 4MMYA 5AL8A 4Y1AD 3V0WH 2E7BA 3GGWA 3WFEH 5I8KH 3HMXH 2QGDA 3ARYA 4Y4KB 3TT1H 3IF1A 3FO2A 4OGZA 4F7CB 1T83A 4OZFH 1HTYA 1UHVA 2R2EA 4J3OG 4P3DB 1UENA 4NKMB 3TVMC 3RX8A 5DURD 1ZLWH 5L9DH 1FVEB 3K72B 2H41A 5I0DA 4QI3A 3T1FA 5FB8A 1JF6A 5C0EA 4FFZA 5ADPL 1BXVA 3QFDB 2Y5EA 1W2KT 2BRRH 1R5IB 4OD1H 4YBLC 4KTEL 5KWYC 3PF2A 5A6LA 3NT0A 2JCWA 4RGOL 1CG9B 4HG4K 4LDLB 1SXZA 3DV4B 2KYIA 4Z0XA 1CVRA 1Z9NA 3BQUB 5DCCA 5GS1B 4WW2F 2QSTA 4E41E 3MCG1 4J7RA 3QULA 4C55A 4C8XA 4FNRA 2D03H 4WTXA 5C9KA 4ERSL 1NBQA 2JK5A 1E28B 3L9BA 3H0TB 4JRXB 1QI5A 1FVDB 4XO9A 3RWCB 3LOWA 1KWGA 4LKCB 4FXLA 3ZKQD 3OLGA 1NMAL 4ODHH 1E9OB 4FTVD 1MIEH 4X6BB 3SE6A 2CO1A 1F3DH 4V1DB 3GMPA 5EBLA 1EVUA 5AVXB 2X7LB 2C5DC 5SWZE 1IC1A 4M1GL 2NX5D 4HKXB 4O00A 1P5VA 3VU2A 4F37F 1J87A 5C3TA 4K2UL 1OT2A 3TVMA 2NNAB 2BIOA 1U36A 3CSPA 1MY5A 1TF4A 3JTSA 4XTRD 4DT2A 5IV2A 1UFGA 4XMKL 4KMLB 3QFJA 4NC1C 2X6MA 3N44F 3NRQA 4G6KH 4JFQA 4TUOB 3UG5A 4PJFF 2UY6A 4RMUA 3V0AC 3ZDXE 3WMQA 2WWKT 1XFPA 1SMDA 3EO1A 5KUKA 1EXHA 4Q6YA 1FGNH 2EC9T 3T2LA 2EYTA 3BVNA 4PJAF 3GEWB 1QSEB 4R4FL 1F00I 2EE3A 2PP7A 3I6GB 3LMJH 4Q52A 3MV7D 5CINL 5BS0E 2X4NA 4FXGB 1OF2B 1C5CH 1UM5H 2R29L 2JKRM 3V0FA 3HRZB 3IJEA 1TETL 3WJLC 4UTBA 3Q2VA 2DPKA 2C1OB 5KVDE 1ES0B 4D8PB 5IB1B 3M8OL 3L9RA 4LLWB 3VTTA 3KLHD 1ETA1 3RVUC 1UCBH 2NQDA 4L3AA 4H2CA 3GM8A 1W72A 3EFFA 3LN5A 1IAII 1MHPL 3P4MB 3VFGL 3V6OC 3WDHA 4HK3N 2XICA 4HX1A 4Y9BA 1CLVA 1NCDL 5JHDB 1PFOA 5C9JA 3ECQA 1CS6A 1A1MB 2FATH 2Z93A 4M5ZL 4QTHA 5KVFH 1F4WL 4OJAA 1QO3A 1TR7A 3SKJH 4G8GB 1EDQA 4UCFA 1YEFH 2CCLA 3GPEA 4IEFA 5HSFA 2EIZA 3GXIA 3KLSA 3OKOB 4EE2A 3L5XL 1SHSA 3QIUD 5L4IA 2ZCHL 3DROA 5KG9A 1SNRA 4HK3J 4KXDA 2ODIA 4XNMB 4J3BA 2BP8B 5I26A 1NMBH 3PS6A 4NZUH 2A9BA 5I0WA 2ENJA 3IJYA 3BAIA 2VMCA 4KHTH 4P23B 1KTRL 2KZ1B 3ZHKA 15C8L 2ICWJ 1FDLL 1AS8A 1M7XA 1J05A 1JGDB 5B22A 7TAAA 2QPDB 3FONA 5ISZE 3FFCE 3CVBA 4DHLA 4YSCA 1IC0A 3MSPA 2V0AA 2DS4A 2K6WA 3WJLA 3GK8L 3MA9L 5D9SA 1RPUA 3UGUA 2VSMB 4M43L 1HQRB 2XTSA 3ES6A 2NY1B 4GQRA 2D7QA 2YXMA 1NC2A 4F33A 4JFZL 3MRGA 4XHJD 3ROOB 3JZ7A 4GT0A 1JRHH 1ACZA 1FSKB 1INEH 3EJCA 2IPTH 1TQBC 1W91A 3O3UN 5C0RH 4ZODA 3RKPA 5DR5L 2MSPA 5CZXD 1TJHL 4BZYA 3TCLA 1NL0L 4MJ4A 3LKNB 4KY1H 3ARFB 2Z31C 1D3CA 1QNIA 1LWJA 4OJEH 2C9UA 25C8H 4B9FA 5CEZE 3L3DA 3HI6L 5CUSL 1J0YA 2HB0A 3CFBA 1HS6A 3V6FB 2VQ1B 3T77B 4L9LC 4P46A 1QG3A 2CIKB 3LZFL 1KT2A 4XODA 5JQIB 3TA3B 4A7QA 1DVFB 4NNXB 5B1AB 1S7TB 1I7ZA 4OCLC 4PY7B 3T3ME 4JHUA 2BSRA 4FKEA 2X70A 2GAZB 3II3A 3NCBB 4XMXA 2CR3A 1FYTD 4C4KO 2ZWKA 4H1LA 5SX4I 5I73B 4ZTOL 3DBXA 2AJSH 2QV4A 2CPUA 4RCAA 2EILB 4ELME 3GD1C 2VZTA 5F2FA 5C0BD 4JQIH 1UGNA 4GH7B 3LKOB 4LQFH 3BUDA 5AYTA 1NIDA 3U1SL 4POUB 1AG6A 5MENB 2VIRB 3IS0X 5IQOA 3OBAA 1NINA 3HIZA 1TTFA 3ATFA 5JR1L 2O5YL 1IM9D 1WF5A 3QVAA 1IGCL 2WV3A 1AO7E 3K4DA 1YQVL 3LNHA 3ULUL 1VPOL 5C07D 2HMIC 3PHAA 2KZBA 3APMA 4JPIA 5CSZB 2Q7NA 5JW3L 1FNEA 3L9EA 2Z31A 4G8IB 4J3OD 2KLRA 5AW8B 5AW4B 1EFXA 1AKJD 4A7UA 2VXQL 3GDBA 3VUAA 1Q1PA 1VZHA 2E3VA 4NT6B 4OZ4B 4AMKL 1L7TH 1EHLL 3KR3H 3P54A 1UZ6F 5I1DB 1AZRA 1YRKA 2WQSA 4FQJL 4EN3D 3I6KB 3O2DL 4HIQA 1YEHH 3S35H 4L9LA 3BH8B 3PFQA 3UL4A 3GS4A 3HBZA 5FV2A 3VX1A 4ANWA 3J8F7 3H8NA 2FZ3B 3KLHC 2R2HB 3QDJB 3CVCA 5ANME 3F7VB 4E5XG 5EOCH 2M83A 3B2VL 1ZLSL 2FGWL 2MRYA 3GBEA 3DVFA 4ODSH 3PJNA 1QRND 3BZFB 2ADJB 5KOMC 3NH7H 2OS7A 4JN1L 4X5LA 3QIBD 1T20A 3S3SA 4XX1E 4P59H 3KLQA 4I8DA 2Y0SA 1VERA 4MZ3A 3TO4D 2WVSA 1AKPA 5EO0B 4LCYB 5CMAA 4XBGB 1IEBA 1WBYB 2IH3A 2Y2YA 3NCXA 4O2EB 1MRCL 3LTVA 3TZVB 3UERA 4YDKH 3WKQA 1GGCL 4GKLA 2Q76A 1TZ8A 1A6PA 1FFTB 1WIOA 2G5BA 3HG0A 2I9TB 4JFXA 3MJ9L 4FZ8L 2I5YL 2XWBB 1W0WA 4YHPB 1JVOA 2XWJB 5EC2B 2EJ1A 5AEAA 1QLRA 3DWTA 5E2VL 1KJ2H 4NQED 1MW0A 5IFAL 2X4SB 3U4EA 2Z7UA 1URIA 3BKML 4HKBA 1PAMA 1K3IA 4PRNB 4DQOL 1NGQH 2CRZA 2Q8AH 4IGBB 1CGSL 3DSFL 2C4FU 1DO5A 5LGHL 2BOBB 1WAAE 4MNGE 4JO4L 5K33A 1L7IL 3R06B 5CD3B 1T4KB 2R1WB 1JPSL 4YGAB 1PSKH 2EXWD 4Q9QL 2E9BA 5CN1A 3L5WA 2XPZA 3ASNB 1OTUD 2BY3A 2MOVA 2P5ED 2Q3XA 4NKDB 5ICUA 3U0TA 5L2KA 1I1CA 4QF1B 1Q72L 1S9YA 4CC1A 4CVXA 4HC1L 4ZBJA 3ZBMA 3ZMRA 5DQJB 4PJIF 3K2KA 3Q48A 2ISDA 4F3FA 3ZO0A 2YMXH 3J07A 2K0RA 3AUWB 4OAWA 4JFFB 4UNUA 3X13A 4Q6IB 3NCWA 1ASPA 2X4PA 3LIZA 3QXDA 1DQLH 4BSJA 5IJCC 4LHUG 4EDWL 3DJSA 2NY3C 4H40A 2QVKA 4LBEB 3MXVH 1XDTT 4JKPH 3IGUA 5ICXA 1KBPA 5JHLH 3BZEA 4YHLL 4F27A 1BMZA 2JCCA 3HHMA 4AEFA 3TASA 5ICYA 1OSPH 4G42B 4Y8DC 4QHLB 4X7SL 1W0YT 2X44D 5HHOD 1YLBB 3QB7C 3U9UB 1IBDA 5KYXA 3OWRA 3K5RA 1IFRA 1KFAH 2FNWA 3JV4B 3T2NL 3WY4A 5ESVA 2CJUL 1BQLH 4FFVD 1FLRH 3SKOA 3BJ91 4F8PA 1S7RB 2COVD 3HI1A 4MVBC 5CP7A 1WD9A 3VGBA 5BW7C 3T6QC 4D0BA 3V0EA 1AZNA 1EAOA 2HA1A 1VGEL 3GJFA 4GO9A 2PP9A 4DGIL 2ZUXA 1OE2A 3ATAA 5C09D 5JOFA 4RGNC 1RJLA 1HCZA 4AYFB 3KLAB 2BJML 3UTOA 3WS3B 3REVB 4J3OC 1X5JA 2KPWA 3E6HB 3DVGA 1NC4D 2CCVA 4WV1C 1F1DA 2FNBA 1MUJB 3F64A 3BISA 4BFRA 4LLYB 4YIQA 5ADPH 4LL9A 2WP3O 1QKZL 3QQ4A 4OSUL 4WKXA 1XCWA 5IQ9A 5AAMC 4KTEH 4OY9A 2UXTA 3OX8B 4RGOH 1EWHA 1CLCA 3G08A 5FYKD 2IAMD 5CD5D 2UWEA 1F3RB 2BSEA 3KJ4C 3DC0A 1NBYA 3FJTA 2VJXA 2OX5B 3MLWL 4CNIA 5IFJA 4HAFA 3ARGB 4MMYB 1RUAL 3D85A 4ERSH 2WYIA 1THCA 3GGWB 1T89A 5FDWB 5E2TL 3II2A 3LNFA 3IF1B 3FO2B 4DN3L 4Y16A 3QH3B 1GYVA 4JM2D 2R2EB 4LQ1A 3SGJC 3UTZA 6PAZA 1RZGA 4L8CA 3DGCR 2BHUA 4LCIL 1ROCA 4MXQC 1OCZB 1CTNA 2BINA 3QUZD 1SF3A 4KTDL 4NBXB 3RL1A 2WXOA 4N8VG 2WUCH 3T1FB 5C0EB 4P2RA 2V3EA 2CHNA 4M1GH 2G2PA 4CN1A 2ZUUA 5HYJE 2B5IB 1AFVL 1FWXA 4ORZC 4ZI8A 4YSAA 3RQ3A 5CKAA 4P5KA 4XMKH 2LOEA 2H0PA 4YVNA 3QULB 1PKQE 3S35X 2JK5B 2ROXA 3VGEA 1FCGA 2YMOA 4IRSD 2NQ3A 4L1DA 5TQ2L 4ZXBD 2HLFD 3WE6A 1XXFC 3U6XS 3WFDH 1E42A 3MJWA 1HU8A 3U4BL 5CINH 5C0ND 2FK9A 2JH2A 2CXKA 1CBJA 2EADA 5IHLB 1R3LA 2R29H 3NCYS 4AZ8A 2ZXCA 3C5JA 3GMPB 5EBLB 3SPCA 5L2JA 5DRXA 4M7ZC 4EJ1C 4FFWC 4IK6A 4A7VA 2MFNA 2X9YA 4CGTA 1P5VB 5ADOL 2XQYK 2YA1A 3M8OH 4H8WC 4LLUB 3SGJA 3TVMB 2PYED 1YJDC 2BVQA 3B5GA 1WUZA 3H53A 3V7AE 3JTSB 4AUUA 5IV2B 2O72A 2CLVA 2DF3A 1MHPH 1MI5E 3QFJB 3VFGH 3T0ED 3ML9A 3LSOA 5EU6A 2UY6B 1W0VA 4JK0D 4YBLB 5DLML 2UZYB 3QQ9D 1NCDH 2MOQA 3EO1B 4FLQA 3T71A 4URTB 2X9WA 5GPRA 3BVNB 4X7FC 3AU0A 4WTZG 1UXSA 4M5ZH 1H3WM 4PRDA 1M05A 1F4WH 5FUZL 2AQTA 4MS6A 3AM8A 4FNUA 3DX8B 1IUZA 4JZJC 1A4JA 4BH7A 1A6WL 2Z7ZA 5DVKA 5L88L 5GGTL 3G7TA 3L5XH 2VMDA 3M6DA 1VJSA 3WIFA 4MA7L 3O45A 3IJEB 4OFYA 3RDTD 2AP2A 5FYLD 2IVFC 1CICA 3AXHA 2EEBA 4KK5C 3L9RB 4PJEF 4XRCA 15C8H 1FDLH 2XRAL 4PSPA 5BRZE 3T6XA 2GJJA 1PX4A 4YPJA 1W72B 3EFFB 3LN5B 4HX1B 3GK8H 2D3LA 3FB8A 4PIBA 1HC1A 4A2HA 4M43H 4NQSA 2ZWLT 4LVHB 3P2BA 1PLAA 4RRPM 3X17A 3RVVD 4JFZH 3IMVA 5AVVB 2ZX8A 4AUYA 2Z93B 1WGOA 5HGGS 5IJBC 4QTHB 1MZYA 2ODHA 5F7WC 1QO3B 2QZ5A 4IEFB 2OYLA 3N91A 2EIZB 1TYEB 2IPUK 1NICA 1XIWB 1MFUA 4U4IA 1BSIA 5DR5H 1TJHH 5KG9B 2Y9RT 3DROB 2V4LA 1NL0H 1REIA 4WDIA 1OGAE 4JFYB 4A37A 1HESA 4E9VA 4OD3L 2NR6D 2F54E 3OXRA 5CUSH 4AX3A 1CI3M 1E30A 3E2HC 1TYRA 4JZJA 3UJJL 4Z7NF 1J05B 1CL7I 3FONB 5GXBB 3MV9D 2YD6A 3UTSE 1YEEL 2IDFA 3LZFH 3RGBA 4KAQH 5C71A 5D9SB 4JFEA 4FNQA 5F6IC 5BVJA 3D09A 3ES6B 3G9VA 2WZ0A 1CGWA 1NC2B 4F33B 3L6FA 3UCQA 3MRGB 2AEIT 4ZTOH 4KU1A 3GZQA 2PMZA 3JTBA 4OZGE 3WKML 3QFGA 4JFDB 4JPKL 3S8GB 5T3ZL 1RIVL 1S7QA 5LDSA 1IGTA 3TCLB 3QR0A 2YOCA 3U1SH 5I5MA 2PTTA 2R0KL 3QWRD 2EDNA 4K3EL 3T0BA 3KPMA 3CPLA 2OJEA 3L3DB 4WFFD 5IKCA 4DO6A 2O4EA 5JR1H 2O5YH 4UNVA 4HCRA 3NJHA 1KYOK 3CFBB 5E5RB 4NPYA 1IGCH 2J8HA 1EBPA 4QOKA 3NVQA 1YQVH 3DX7A 3ERXA 3ULUH 1VPOH 4P46B 4TXVB 4I2XB 1KT2B 5C0NC 4XH2A 4OI7A 5JW3H 2EEAA 1C12B 2ZSWA 2CR6A 3II1A 1IC4H 1I7ZB 1JDDA 2BP0B 1DVTA 2VXQH 1E7UA 3D07A 4AMKH 4J3SA 2X70B 1EHLH 4NKOA 4FQJH 1O7VA 1OCCB 2HVBA 3O2DH 2E76C 1GVIA 1KPRA 3NP3A 3DBXB 2IDCA 4H1LB 4MJHA 5D71H 4WJ5A 3FF7A 3MR9A 2OJ1A 3MLTA 3EGSA 1TQCC 2F58H 2YRLA 2ZTBA 4JEGB 5IB5B 1VKXA 3REWA 4MA1B 3B2VH 1R5WA 5DHVA 2JKJA 4ABUA 2IOIA 5HDRA 3FO9A 1KJ3L 4M48H 2OXGA 1IAOA 1ERNA 3AQXA 3K8LA 3ECWA 2FQFA 3D18A 3B7YA 4PJ8D 1RD6A 5DD5L 2AJVH 1KCVL 1B4TA 1TQBB 4WW2C 1NA8A 3WEBA 3APFA 2P24A 3V52L 4JPIB 3VD7A 1FVCA 2B8OT 1FNEB 1ZE3C 2Z31B 4G7YL 1MRCH 1EFXB 1DL7L 3VD5A 1C7TA 5G5DA 4O9HL 1GGCH 2BVUA 1UA3A 4GUCA 2ZWYA 2CLRA 3AUVA 4FZ8H 2ZXWB 3QJRB 3I3EA 5I6PA 2I5YH 4L9LB 5I1HL 3EJJX 3VTAA 2GJ6E 2DM7A 2XXCB 4JFHD 2FQDA 4IOSD 1KTJA 1QYGL 1SZNA 2OMXA 5IFAH 2H1XA 3HEIB 2VLRB 4DQOH 4J3WA 4JFOA 1CGSH 1ETB1 3DSFH 2X28A 2VCOA 2W94A 4ATWA 4JO4H 5LXGL 1L7IH 2EUVA 1I8MA 1T7ZA 3KZ8A 1S7SA 3PREA 4GEJA 4L4VD 4MJID 2R2BA 2Z64C 4PY8J 4Q9QH 3A0OA 4E5XA 5CMAB 5L0QC 3RP1A 1IEBB 2IH3B 1KCRH 4JQVA 5ACMA 2IQ9L 1JGLL 2Q76B 3S3DB 1Q72H 4QKTA 1QFWI 2FO1A 3GLZA 1A4BA 2G5BB 3FZUD 1GXEA 1IZKA 4JFXB 3EBIA 4ODTH 4PGCA 4WW2A 2LLGA 5DJ2A 3HFFA 2A5UA 2YUZA 4B3EA 3FRUA 1W0WB 1H6TA 3QORD 1QLRB 4Z18A 1NFKA 4ATTA 1EEZA 4JVUA 4FJYA 1F02I 2FUQA 3PNWA 3U4EB 1X5YA 3EYUL 2CIIA 4XX1G 5I6KA 2CDGA 1P84J 1XSIA 1EZVY 2OR8A 2OFQA 4W9ZA 1S7UA 5CO1A 4HA1A 4N9GA 4WEBL 4JL1A 3B4NA 2CCWA 3L3IA 5E6IC 2VISA 3NAAH 2AQPA 2HZHA 1OKEA 5A16B 3G5YA 5HYIA 1PDKA 1ZT1A 3MUJA 3N43F 2BNQA 4FQ2L 2A74B 3L5WB 2X9ZA 4X7SH 4BELD 4DKDC 5I8OL 5EULV 4J6RL 1OLZA 4BWTA 2BHYA 5L2KB 4JLRA 5FKAA 2HT4C 7FABL 5SWZD 2QSVA 4W6XB 2CJUH 1S9YB 2XIIA 4OGQC 4DPCX 1IAIM 3QDGE 3KPQA 3F8UB 5FKPA 4EVNA 3QRFM 4HCFA 4WHYG 4F3FB 1IQWL 4R7NA 3TGXA 4DP8X 1I9IL 3LH8A 1VGEH 4OAWB 3X13B 4DGIH 4B5EA 1J5IA 3WAKA 4PJAA 4DKTA 2X4PB 5D2LF 2BJMH 2NYYC 2ED8A 2HN7A 3FCUB 3OM3B 3NIGF 3WS6C 3NSJA 3WU1A 5ICXB 1NCBH 2XJKA 4PYHA 3RWHA 3BZEB 1QKZH 3NUKA 5ICZA 2JCCB 4BFBD 4XPFL 5BS0D 3SYPA 4HPHA 3T04D 5ICYB 1PYWA 4PRHE 4WI8A 1HXYA 3Q05A 5BO1H 1N2RA 5KYXB 3WLWC 2IGFL 1IKNC 1AANA 2JIXA 4LHUA 3MLWH 5ESVB 4KI5E 2AEWA 1Y18A 3SKOB 2APFA 1RUAH 3HI1B 5CP7B 1R9FA 5BOJA 1KYDA 35C8L 4D0BB 1AS6A 1KLUB 2X0VA 4R96A 4S11A 1YEIL 3FRPB 5E2TH 4HOMA 4S0HA 3GJFB 4U3XA 3ZKND 5JOFB 4PCYA 2XQYG 1RJLB 1SJEB 2F7OA 5F7NC 2CJ3A 4N0CC 4HJIA 1TMCB 2MNWA 3AZUA 1ZLWK 3LB6D 4HHAA 5J1AA 4LCIH 3DVGB 3MRHA 2GSGA 2NSQA 4NZDA 1OT4A 4KVPA 2DQMA 4TNGA 4YIQB 3P9MA 2L0DA 2XVLA 3HHRB 4NGHL 2P42B 5IQ9B 1A5FL 1IAMA 3PV6A 1BF8A 5EF0A 1AFVH 1FLTX 1NQBA 2BX5A 3G08B 1MCLA 2QBWA 3A47A 1NPUA 3Q01A 1UJ3A 2R0ZL 2UWEB 3IGFA 1WYJA 3WS6A 4XZ4A 1NBYB 5EU3A 1HILA 3WIIL 1SF5A 3QC6X 4CNIB 3EH5B 3P0YH 5IFJB 2H45A 3VXRE 4TUUA 3D85B 4PJCE 4GSRA 3ISRA 1WFNA 1XHHA 1FQ9C 5ISZD 3FFCD 3KJ6L 1IKNA 1SHMA 5TQ2H 4Y16B 5D7IB 3BWSA 1UCTA 4AMWA 3RTQD 1MH5B 1EAQA 3UTZB 2RBLA 3VGAB 4L8CB 1O6SA 4LHQB 2WBKA 5FGCB 5T1MA 4MCNA 2C26A 3VD9A 5HHVH 1U8LA 2P5WB 1I1YA 3KGTA 4NQDD 4LPCA 3C6LA 2D0HA 1D5ZA 3RL1B 3ZKMC 1N59B 3K8MA 1F11A 4P2RB 3VDBA 1IGIH 5LQBL 3VRIB 2WQWA 1NWPA 5BPPA 5ADOH 1R1CA 1LK2B 5DZNA 4IBYA 5DUPH 4ZW8A 2QZQA 5CU5A 2K9UA 4WO4C 1IE5A 4P5KB 5IOPA 3ILQC 1NCIA 4UQEA 5HGHA 2IPUG 4N8VA 5DLMH 1UXWB 3RGVD 5J6GA 3GKWL 1SEBA 2YEQA 4R4NC 2J73A 2CNYA 2UV3A 3WE6B 5EN2A 5FUZH 3PU7A 1WZLA 1X6NA 2J20A 1TJIH 1GA2A 3HA0A 1A6WH 4JQXA 3RY6C 3PAVA 2RTTA 1R3LB 4G6MH 5GGTH 5JXAL 2J7LA 5L88H 1LYQA 4AZ8B 3C5JB 5C0AE 5A43C 3RKDC 4MA7H 5L2JB 3HJEA 2AANA 3EZ8A 2GC4C 3V8CA 1U8MA 3FW6A 1S5HA 3ZT7A 3ZR6A 2GJZB 2XWZA 3CFDA 3R4RA 4AYEC 1IL1A 4X4KA 2ZXBA 1XGYL 2XRAH 2BVQB 3W2DL 2IOOA 2JI2A 3QEQA 2J8UE 2CLVB 2ALWA 1SHWA 3FQTA 2AKRA 5H2BA 2EUZA 5KZCD 1MAKA 1W0VB 4WIQA 5GRXG 2OAAA 5ALBL 4Z7QE 1OVZA 3PWLB 4Q6KA 4BSWA 3CQFA 1AO7D 1JNLL 1FG9C 1R46A 4C59B 1UXSB 2VDLB 3K5SA 4WO4A 4PRDB 5ACLA 1E27A 2OP4H 3N42F 3GLDA 3HS9A 2Y69B 3PXHA 4BH7B 1A4JB 3OAZH 4XB7A 1MRDL 4XB8A 3WIFB 2DWDA 1TPXC 3O45B 1X5GA 4NAJA 4P3CL 5DZPA 4QRSA 3MGAA 4RVBA 3V7AG 3MNDA 2MCPL 3TXAA 3PQYA 1CICB 3W81A 4NN7C 1AVAA 4XRCB 3T3PF 2RCSL 1L0YA 4ONGL 1T1ZA 3RY6A 3UJJH 3QDHA 4YEEA 2DEWX 2Q7AA 1GKEA 5B4MC 4IM8A 3LKQA 4IRJC 1ZLVH 3ATBA 1MJ7H 1KCBA 2YXVA 3FB8B 3MNMA 4M7ZB 4YFEA 4NQSB 5J1SC 4DP5X 1IGYA 4G72B 3D8MA 4ETQB 1L5GA 5C70A 3DYMA 3GMLA 1QTPA 3ALXA 4PU2A 1OTTC 1BOGA 1NAKL 3F7PC 2LE9A 3ZHDA 1TJXA 2IPKA 3WKMH 3KPLA 4BQ9A 2BXZA 4JPKH 5IJDC 3A6OA 3CHPA 2A73A 5T3ZH 4AIEA 3ARTA 2JE8A 3VFUA 1HWGB 1RIVH 2EDOA 5DI8B 2ZKYA 2MIZA 2R0KH 3CBJB 4EKXA 5K9KB 1OSZB 4WDIB 4K3EH 5DMGD 3S4SA 4G9FD 2ICEA 2V5RA 2VLJA 3OXRB 4QHMA 1C1EL 3AT9A 5A2CA 5HD8D 1IFHL 1T22A 4N0YL 3OQ3B 4OQTA 3TIDA 3UYOD 2OW7A 1H3XA 3BDYH 2ZUWA 4JFEB 4OFKA 4XGZA 4OLYL 5DA4A 5BVJB 2CDEA 2BOCA 1XXDC 3WSQL 2VXVL 4K3JH 3GSUA 3PIQA 3L6FB 4U2ZA 4U33A 3WGUB 4P57A 3IU4L 3GSWA 4U1IB 2DQEH 1JNNH 3T2QA 4PJIA 4AK1A 3RFZC 4B60A 3VD2A 2D9QB 4IRJA 4LCUA 4AVKA 1HZLA 1ZPLA 3ZRCC 1S7QB 1IGTB 1JZ2A 4KH9A 1ZDSA 2PTTB 4K23L 5D1XC 3ETBJ 4IQHA 1KJ3H 3KPMB 2W07A 2OJEB 3CPLB 5IKCB 3VMNA 1C16A 4ZW3A 1MREL 4MD5A 4M7LT 4JHAL 4LIQH 4NPYB 4CILA 4QOKB 3PPSA 4AVIA 3LVTA 4KHXH 1D5BA 3MNWB 4GXUM 2IQAA 4AQOA 3V52H 2AZAA 3BAWA 4XH2B 4J2XA 2ZSWB 3C6EA 4G7YH 3L7EA 4K5MA 3ELAT 1DL7H 4NOBA 4YXLL 2A4ZA 4FFZL 3E2HB 3OQRA 4XXWC 4NKOB 4EOWL 1HHKA 2HTLD 2H5UA 1Z3RA 3LKRA 4M5YH 5GGSA 2BSCA 4FERA 3L4UA 5A7EA 5I1HH 4WJ5B 4XVTL 3MR9B 1OTSC 3L2NA 2X2YA 4RX4D 43CAA 3MLTB 4BQCA 1QYGH 1PY4A 3EGSB 4XVUC 1VKXB 5F6IB 3E6FA 2BRQA 3REWB 1R5WB 2NXZD 5DHVB 4YHKL 1U9KA 3FO9B 2XA8L 5HDBF 2OXGB 1IAOB 2A2QT 4YPGA 2JJTA 3BX7C 3LCYA 3RFZA 2BZDA 5LXGH 5IIEB 2G3NA 4YVUA 2RAMA 2ZCLL 4DZBB 1I1AA 2P24B 3C5XA 3HHSA 4IJ3C 3WJJA 5SWQA 4DVRL 2GBVA 4GQPH 1H8LA 4Y4HD 5D1XA 5MEOA 1NTDA 3QHTC 3WV0A 3ABGA 5DZAA 5G5DB 1J11A 1JGLH 2IQ9H 3Q06A 4JDZB 2Y7SA 1U3HC 4ODXB 1CYXA 2CLRB 2CWRA 2WXJA 1JTPA 2XWTA 4MCMA 3MFGB 4UQIM 1ZVNA 3V7MA 3F12A 2ZWNA 4NC2B 4N20A 2OMXB 1EBAA 3EYUH 1TITA 2H3XC 4W68A 5I1LA 4XXWA 4JFOB 4JW3A 4FLSA 4Y19D 1AS7A 5KSAC 1KBGL 2PCFA 1I8MB 4QHKI 1BIIA 1S7SB 1PZBA 2R2BB 1L9SA 4E5XB 4OZFG 5I8OH 5IQ7L 2QADD 4I87A 4J6RH 1GTNA 3MC0A 4KZ0A 4X83A 7FABH 1W8OA 3ML8A 1AJ7L 3R4DA 5HYJD 2WM0A 4UTBL 4YHZL 3V4VA 4WW2B 4LKXA 1NDGA 4XN1A 4PGCB 4DEPC 1LE5A 3FULA 2P47B 4L3EE 4HEMA 1M7DA 3FH8A 1W8EA 5TTRA 1IQWH 4XO4A 3RRQA 1GPOL 1EEZB 1W72L 2C7UA 3FMGL 1YECL 3PNWB 1FH2A 1Z9LA 4BRJA 2CIIB 4G43A 2CDGB 2EYRA 3MUHL 1S7UB 1MVFA 1U3HA 4N9GB 5J89A 3VD0A 3HN3A 3DGGA 3E9UA 3L3IB 1HKLH 2VISB 1P7QA 5CLYA 1PDKB 1ZT1B 3NCFB 3CFUA 1V7NL 3KE0A 4KX7A 4XPFH 2XLLA 5F9AC 4I88A 2HVKA 5GS2H 2IGFH 4YZFE 3C60D 1TZOA 2J2ZA 2I85A 1IB5A 4JLRB 2W0FA 5KSAA 3A22A 4NN5C 3HOGA 3UAJC 4QTIL 3Q1EA 3KVDD 5F7KC 4NUPA 1XEUA 1A47A 1SJHA 4MDIA 3N44B 3KPQB 1WFUA 1J0ZA 4L1BA 3Q43A 5FKPB 4EVNB 1C08A 1ZT7A 1LL1A 4P8QA 35C8H 4R7NB 5L0QB 2WZPA 1YEIH 4F80A 1V5JA 1MCPL 1ZTXL 4ZW5A 5LCVA 4DCQA 2JKWA 4PJAB 1J12A 2OMNA 1OIOA 5F9OL 3C8KA 3P40A 2JKNA 3IJSA 1OXYA 3DHPA 2HN7B 4WZ9A 2G0KA 3FL7A 5E8DL 2XSKA 2CAKA 1BG1A 3IRCA 1W15A 1ZA6B 1JXDA 3MFFA 3IXTA 1MKFA 3IKKA 3RWHB 1LHZA 3ULVD 4NGHH 2DWXA 5ICZB 1A5FH 1FA4A 1KIRA 3L48A 4PUBL 4FYTA 2EVIA 1PYWB 5EZJA 1UACL 1F41A 3JV5A 1HXYB 4N2FA 1SJVA 1N2RB 1NEZA 1UT9A 1UKQA 4ZS6D 4PJEA 2JIXB 5EC1B 3RWIA 1KGWA 3VXPA 4LHUB 4WK0B 3WIIH 3QHZL 4Y2OA 3GXPA 1F8TL 3VW3L 3DXAA 1P6WA 1JPTL 1F6AB 3QRBA 3C8HA 3OTTA 4UILH 4WI3A 3M88A 4L37A 4XI5D 3VFWA 5BRZD 4PI0A 2O5ZL 4HUXA 4IBTA 4KJYB 4PQXA 4UTCA 4MQSB 3RUGF 5DD6A 4PCSA 1OV8A 1JK9B 1QFOA 4XNBA 1MSPA 1RFDL 5JXEC 2ZJSL 4OD2A 3UPCA 4EI5C 1ZS8A 2WZ5A 5JUEL 5TDNA 4HHAB 3UAJA 4Y4HC 4RFEB 1DQQB 5J1AB 2ED9A 4GRMB 4KKBD 4UV7L 5FA3A 3MRHB 2GSGB 4MQXD 4GLRH 1TOXA 1GZHA 2XFXA 4R7XA 5JORA 5G4OA 2DD8L 2FRGP 3QE5A 3U83A 3PWPE 2A4EA 3PGFL 3PV6B 1P7KA 2WWMD 3Q5OA 2GFBA 1E6OL 4XO5A 5CCJA 2ZE0A 4BDVA 1UJ3B 5F3HA 1SPDA 2BWDA 3K2MC 2FIRT 4XX5A 1E4KC 4LDCA 5EU3B 3FT2A 1DANT 1HILB 3B9KC 3BAXA 3HUJE 1OGAD 5IWLC 4YSPA 2HCZX 5CJXC 4JKNA 4IKNA 1WUNT 1J7VR 2EDEA 3OXSA 1NGWA 1B90A 4MAZA 1SXAA 4A2DA 3GKWH 3OV6A 3L5IA 3SHSA 4K7FA 2VERA 2J55A 4MAUL 1R17A 1F42A 4LP4A 3HPJA 4NZTL 3RI5K 1T7VA 4KJQC 2AXWA 1O6SB 2AXHA 1CR9L 4PS3A 5F7EL 4AL8L 4OKVB 5T1MB 4YDLB 2I60H 5E6SB 1U8LB 1BOYA 1I1YB 4K5LA 5DTFA 2ADGA 3C6LB 3CHSA 4DP7X 4R2GC 1D5ZB 4R8WL 2QQKL 1GC1C 4HLEA 1F11B 3AREC 3ULUE 1KEML 2YAQA 4M6ML 1P5UB 1S2EA 3D51A 3O6ML 3I50L 3UACA 5JXEA 4IOIA 3U2JA 1QUPA 3W2DH 4PREA 3V9FA 4ZPVA 2ARJA 5IOPB 4ZFZA 3RGHA 3KGSA 4QT5A 4KGLA 5HGHB 5ALBH 4NWUL 2DL2A 2B14A 4PP1C 5J6GB 2V6HA 5E08H 5DYOA 1SEBB 1QTYT 1JNLH 4N0UA 3FN3A 3MRNB 5EN2B 1E4KA 1TO4A 3MCLL 3N55A 5E8OA 3B9KA 5F1NA 3QCUL 1TZAA 1Z7JA 5CJXA 2CH8A 1AE6L 2DQCL 4ZMWA 1JF5A 3WKPA 2JXMA 3O0RL 3ARQA 1OARL 4QLRA 3IRZA 1S5HB 5KBPA 2MCPH 4NQQA 1J1XL 3CFDB 5EDXA 4F91B 1AYOA 1IL1B 4ONGH 4I1PA 5CBAB 3TFKD 1CXEA 3QEQB 3RZWA 4LSSL 4AEEA 1U6AL 2ZX6A 3FQTB 4PJHF 2A0LD 5KTEL 4KZCA 2AKRB 5H2BB 4I9WE 3SGDI 3FTGA 4KXAA 1ZVYA 1IAIL 4KRPC 5D96B 3GYRA 5B39G 4HDIA 4NZFA 2WCSA 4HMDA 4E9QA 1RUKL 2E86A 1QW9A 1X4YA 3KPRA 4WO4B 3PHOA 5D2NE 1QFWM 2F8XC 4WWOA 1E27B 3KPSB 3FB5A 2WWNA 1RXLA 1HOEA 5CZVL 4ZS6C 1RJZA 2X38A 1JL8A 3LN9A 1TEFA 2DWDB 3NP4A 3CX5J 4K7PH 5EPMB 4QRSB 1SY6A 3T4AA 4EI0A 3OGOE 2GJ6D 2DDQL 4JCMA 1KMGA 3PQYB 4ZUVA 2IAAC 4RZKA 1C1EH 1XB3A 3ILEA 4FS0A 1T1ZB 2WZAA 4N0YH 1GYAA 1NLBL 4FHBD 3LIZL 4HXBL 2DWEA 5KYUA 1ZMYA 2GIYA 3LKQB 2EQDA 1HYSD 5IVOA 2W8CA 4ECNA 1IGYB 5I8CA 1UKTA 3WSQH 1L5GB 5TK2A 3VXMA 3GMLB 4PRIE 2WN2A 1MI5A 2WJ5A 3U7WL 1BOGB 1CFBA 3INOA 3FKUS 4YBHA 4C56D 1L9MA 3IU4H 4G71B 1UKSA 4JGMA 4JDEA 2IPKB 2QMJA 1JTTA 3FCSA 3KPLB 3S5LG 2DQHH 5DVOA 1VIWA 1S3RA 2A73B 3ZQXA 1YNLH 3W5MA 1DZ0A 3VFUB 2GITA 3LV3A 2Z35A 5A2KH 3VGHA 2BIMA 4K23H 5DFWH 3S4SB 3BPNB 1SHXA 5I5JA 4FG6C 2ICEB 2DYSB 2VLJB 5AOKA 5FYKU 2CRMA 4QHMB 5DVNA 3VACA 1NCGA 5BXFA 1B0WA 1KBBA 5JO5A 4PJDF 5F9DC 5CIPA 2WLHA 2IWGA 3RHWK 4W1TA 1YYLL 3TIDB 4PJ9A 3KNBA 1KDIA 4OI9A 4W9KC 3AS0A 1AD9A 1V3MA 2O6EA 5L8LB 4XGZB 5E2WH 2ZWSA 1T2QL 3N41F 2BOCB 1VAHA 2QGBA 5DQ9B 4YXLH 3GSUB 4KQ3L 4JFSA 2NZ1A 4FFZH 4NN7B 2X4OA 2WNKA 4KK6D 5D70H 4EOWH 4P57B 5I0XA 3GSWB 4LFHG 4XVTH 4PJIB 3UIZA 4LE8A 2ZG1A 4IRJB 4LCUB 3BUIA 2CJTA 4AWJC 1EAJA 2JV6A 4KQ0A 3QDGD 4KV5F 2Z65C 5IEHB 4YHKH 2XPGA 4MXWL 2ZP9A 2XA8H 3RNKB 5D2LA 4TRPH 2W07B 4IOFD 2VGLM 3R7QA 1JHKL 4BCYA 1ZGLB 4KDTC 1C16B 2EZ0C 3B5TA 3KL5A 4KZEH 4FQXD 2B4CL 2ZCLH 3KH4A 4AT6A 1D5BB 1NGXA 4N86A 1I9JL 3O41A 4ZUTB 4DVRH 2XZQL 2ETWA 4NNYA 5E51A 4L48A 5C6TL 5E6ZA 1DUZA 3L7EB 4HH9A 4XCNA 4JRWA 2PW1A 1DJHA 3ZO9A 2IBBA 5L4JA 2ESVE 4RQQA 4I3SL 4NP4L 5DK0A 3UTSA 1HHKB 1ZGLM 2J6WA 4HULB 3LKRB 5GGSB 5ECJE 2YPVA 4HWNA 1EQWA 4YAQA 4X9GA 2FB4L 2RFXA 3V55A 43CAB 3OKNA 2X09A 5HHME 1SJMA 2VRKA 1IRAY 3E6FB 4KI5D 5DA0B 5E1GA 1N8OE 2XHNA 5EU5A 2J1XA 3C2SA 4H0LC 1L3WA 1LD9A 3BWAA 4WI6A 1UG9A 1JERA 4FA8A 2AXGA 2VDOB 5T1LD 4YPGB 1CYGA 3D3VD 1ID5I 1HCYA 1KBGH 4JCWA 4MNHA 1KGIA 3QIWB 3RFZB 3OJMB 3BFQG 1NANH 3B2UD 2YKKA 4IBQA 4ODBD 3GTTA 3IRPX 2E7DA 4OGYL 5T33L 1I1AB 3HHSB 4IBSA 5DHXB 2MPAL 5SWQB 1CT8A 2A6IA 4GIPD 5MEOB 5D1XB 5IQ7H 4FHKA 3DRQA 4FHJA 3ZE1E 2EUXA 3DSNA 4KDTA 1A6ZA 1AJ7H 4MCYA 5D7LA 1I3GL 4YHZH 4OF3A 3SQRA 5ALCL 3KM2A 2A6JA 4B97A 4JGUA 5HDWA 3ZSTA 4OGAD 3CFCL 4S10A 3WD5L 3B2MA 2GT9A 3QAQA 3M86A 2VYRE 3GZPA 1GPOH 1YMHA 1W72H 3FMGH 1YECH 4OIAA 4DSYA 4QEGA 5I1LB 1HYSC 2OR9H 4LCWA 2MWCA 4ZQTA 2ROYA 2PCFB 2ZP8A 4I0PB 4DO4A 2OYPA 1KNOA 1V7NH 1BIIB 2VDLL 3NEEA 1RPKA 2UXVA 3C9NA 3EO9L 2A9CA 4JPQA 4NSKB 4OCNC 4X5XA 5TPWL 3BWUF 1G9EA 3VFRA 3AB0B 1ECZA 4QYOA 3FQYA 5J4MA 1YUKB 1TTUA 1OGPA 1JZIA 4BZ1A 3ETSA 1UEMA 1G7QA 4MZRA 2RR3A 3V4VB 2P26A 1NDGB 1WH0A 4KO6A 4QRQA 2CNZA 3N40P 4AYSA 1LE5B 3EZJB 3HAEA 4IJ3B 1DSWA 3TIEA 3FN9A 3MO1B 3QI9D 1MCPH 4OZFA 5HDOA 2C7UB 1ZTXH 4PIRF 3INUL 4K7PX 3VYOA 2JLLA 4POZD 3SBRA 5FW6A 1BX2A 4G43B 2EO1A 1Y1UA 3NBNA 2IJ0C 2CBOA 3DGGB 2WQUA 1JXFA 5E8DH 1DCEA 1P7QB 3GDCA 4H8WL 3BD4A 5EU4B 2ARWA 2D7OA 3RDJA 3S2AA 1WTLA 1U2YA 1MRFL 1YJDL 3UTTD 3ARVA 2J72A 3C75A 4Y4FC 4PUBH 1LE9A 1UACH 3DA0A 2EVGA 4LGSB 5HPMA 2M1KA 3ZX1A 2J2ZB 4MMZB 2W0FB 2R4RL 2VZVA 3QJUB 2VB5A 3QHZH 3V9EA 1F8TH 1ZY9A 3SDDD 1JPTH 1SJHB 2J1WA 3IXAA 3KYMA 2CK2A 1E3FA 4IOFC 4MDIB 1RSYA 4IBVA 1C08B 1ZT7B 1INDL 3VU1A 3BKCL 5FUOL 3CAFA 5DZLA 4GI6A 1P2CA 3LPGA 1BZ9A 2NDFA 1NDMA 1EXGA 2HSIA 3HI5L 1CDYA 1RFDH 4NFBA 2ZJSH 5FYJL 2DB8A 1BQSA 1CXLA 5JUEH 1KXVA 5IF0A 4YHOH 3IJSB 1X5ZA 1U8JA 1MN4A 4UV7H 4XN8A 4JM4L 3MPCA 5FHBH 1SN2A 3MFFB 2DD8H 1AKJA 3BUYA 3IXTB 2H2PD 3C5ZD 4IKJA 3W56A 1CCZA 1KIRB 2BWQA 1IM3D 3MGOA 3PGFH 5T5NG 5TH2A 1E6OH 5EZJB 1AXIB 4QJ5B 1NEZB 2ICWI 4PJEB 3LAFA 3RWIB 3VXPB 1JZGA 4CGUB 4HUWA 2B9AA 4Y2OB 1K5WA 3B6SB 2ZOUA 2QKIC 4JFVA 3DXAB 3T08A 3IFLH 4HPYL 4TQIA 5CN3A 1H8NA 4Y4FA 1QRNA 4L37B 3VFWB 5T3ZE 4HCRL 3X11B 5JOPE 2ZX9A 1WJ3A 4HUXB 4ZNEA 3M17A 3W38A 5L7XH 4Z76A 5DD6B 1LO0H 3STLB 4OD2B 4NZTH 3TJEL 1ZS8B 3DTDA 3L3HA 3TLRA 1WCQA 4GAJL 5TDNB 1Y7VA 1CR9H 1FN4B 5F7EH 4AL8H 5FA3B 2MCG1 2E27L 2AEPL 3V4UL 2GTZA 3R19A 4P2OD 4PVMA 1JPFA 3CMGA 3DBSA 3GXNA 1JNHA 3ARZA 2XFXB 3G9AB 2O26U 4HUKB 4Y0GA 4DK6A 1A7RL 2QQKH 5JORB 3EKCA 3CHXA 1KEMH 2IH1A 3HFMH 4M6MH 1P7KB 4XWGL 1JFQL 4G7QB 3O6MH 3I50H 4X4MA 4YSOA 3TX4A 4BDVB 1HAUA 4LFHD 5F3HB 4Z7NB 1AR2A 2RMNA 3FT2B 4PS8A 2E6QA 4UM9A 1L0QA 3HNTL 3SKMA 1TFHA 2HFTA 1J5HA 4NWUH 3OXSB 3VWKB 3MTXA 1NGWB 3CD4A 3DX9B 1AHMA 4BZ2A 4F8NA 1AMXA 2J43A 4G6FD 1S5IL 3Q9QA 4K7FB 1YN7A 1P7BA 1D2OA 2FT7A 3MCLH 1NIAA 3QCUH 4AJYV 1BZOA 4JRXE 2GBAA 1HSAA 1QSZA 2OK0L 2VQUA 5DTFB 2WBXA 2ADGB 2DQCH 2KDGA 5I6LA 4C83A 3O0RH 4NBYB 1OARH 3PL6B 2YZ8A 3B9EA 4BFEA 1AYRA 1BFTA 1HXMA 1F6FB 1J1XH 4NQCA 1BM7A 4IOIB 4ZPVB 2ARJB 2XT1B 4U0RC 1U6AH 4ZFZB 1UOVA 1HDMA 4XO3A 5TF1L 5KTEH 2WD0A 4OLWL 4YDZA 3U30B 3K4AA 1YUHA 1H3VA 1IAIH 4GS7B 4LNVA 1RUQH 2NZ9D 3LNDA 4I48A 1ZSDA 5L8JB 5DUBA 2X42A 2R23A 5DYOB 1LEKA 1RUKH 2WKLA 4N0UB 5FA4A 3ECUA 2XZCL 5F1NB 3B9KB 2VR6A 3OAZK 3VXRA 3IE9A 3VQ2C 2WQVA 4PJCA 3JWDL 1GMEA 4GO6B 4U6YA 1R34A 3MLUL 1NMCB 1JGUL 2CDFB 2FEJA 4U7SA 1QSEE 1A9EA 1HL8A 2FX9L 3O3EA 4OKDA 5CJBA 4YSQA 2JXMB 2HKAA 4H26A 4WFGE 4RAUB 2DDQH 3GHBL 5JW5A 2K6YA 4G3YL 3QG7H 1GSKA 5F70A 2WWKO 1YAZA 4S1DD 1A02N 1NLBH 5I71B 3LIZH 4HXBH 4R2GB 4PW3A 1ZLVK 5ID0A 2G60L 3MBED 3FTGB 1D5XA 1ECYA 2MTPA 1A6AA 4OBRA 1Q9WA 4HDIB 4OCWL 5HDLA 4X80L 3IDJA 1FNSH 1X4XA 2EO7A 2QVFB 1BMGA 3KPRB 3PHOB 3U7WH 4AM0Q 3H4HA 3FB5B 5JHDE 5GGRA 1PY9A 1EO5A 1AHKA 2TRHA 1RJZB 5IR1A 3FUIA 1WBXA 4MZIA 3LH2L 2IO5A 5D7JC 3BXNA 3IM1A 4G8GE 4HZ1A 4U6XA 3T4AB 4Z95L 2CRIA 5SWSA 4ZUVB 3QBTB 1BWWA 5K9JL 3JWNH 4LPXA 3GJFH 4LL4A 1JP5A 1T6BX 4GRLC 5C0AA 2V5SA 1YYLH 3ARXA 4EN2A 2DWEB 4F57L 1CL7L 5KYUB 5J12C 2DJSA 3OF6D 1N5AA 3OKYA 1T2QH 5JIKA 4JY5L 5I8CB 2BC4A 4LGRB 3WNOA 2OQJA 4JO2L 3VXMB 4KQ3H 4WTWA 2ZXGA 2EEDA 2JJSC 3SOTA 4YC2C 5KUMA 5CZKA 5IMOA 4ZO9A 3SBQA 3TNNA 5JHBA 4J3XA 4JDEB 3FCSB 1MDAA 3S5ZA 5SX4H 2PXYD 1G7IA 4KRPB 3QO0A 2GITB 3LV3B 2Z35B 3NACL 3QZOA 2UVEA 1FL3B 2L7QA 1JSYA 4J23A 1QWUA 3S5YA 4LHJB 3FUDA 5KN5B 2AABL 4N6QA 4TNEA 4MXWH 4AJ0A 5DJ0B 4IBZA 3RYMA 5LWYL 1JHKH 2I27N 3PGCB 3ZRFC 4WI2A 3SODB 1OQXA 1TEYA 3QJZA 2ADYA 2C4XA 3ARBD 5JO5B 1ZLUH 3KLDA 4HETA 5CIPB 2B4CH 3ZKXC 3S5LA 3H9HB 1G7MA 5AG8A 4U7KA 1A3QA 4PJ9B 1E67A 2YXFA 1I9JH 3KNBB 2GSMB 5D7JA 4KJWD 4PV9A 2V3DA 2L3BA 2W80C 4PJBF 4QXGH 1E8XA 5C6TH 5KYNA 2EKSA 3HG1A 2NY0C 4AQ1C 1RV6X 4QYAA 5FCSH 3NQKA 3N0PB 4K15A 5B1CA 3MV8E 2X53A 2X89A 3E7JA 4O2CA 4CMHC 1SLXA 5BMFH 4NP4H 4DGVL 4GRLA 5IFHL 1P69B 2I7OA 1ACYL 2VXTL 2FB4H 4M1CD 1G7JA 1N10A 4FDWA 3Q1SH 4CC4C 1Z0MA 2OSLB 4YE4L 5EEVA 4GXUN 5DJXA 3S3BB 1ILSA 2JJSA 5D2LB 2XYBA 2NZ9C 5C6WH 4HLZH 4ILDA 1BPVA 1FZMA 3I9AA 4WF7A 3NIGB 2F19L 4KK8D 3LDBC 1CB4A 3P3YA 5EIIG 3PXLA 5MENE 5T33H 3FNKA 4AT6B 1NGXB 3HB3B 3O41B 3IDXL 1AAJA 1DUZB 4HH9B 4XCNB 5E56A 5EEUA 3MV7B 1NIEA 2VZSA 5FFLA 2YJLA 2PW1B 2G3XA 4RQQB 1I3GH 4DEWA 2AJZA 3UTSB 5ALCH 2LU5A 2FSEA 3KW7A 1GHFL 4H8HA 3ULVF 4GAGL 4UQ3A 2H2SD 3CFCH 4FA6A 3WD5H 2WJ7A 1NWOA 2JLPA 3OKNB 3SYOA 4BV1A 1F86A 4AQ1A 5HP5A 1Q94A 3C09C 3RUGA 4A1RA 3OB0H 1IC7L 1LD9B 2JWYA 3BWAB 4YQXL 1R24A 2O1AA 2AXGB 2WINA 5CLXA 2YEZB 3QDJE 5F7MC 2XIDA 3EH4B 4MNHB 4HIHA 1PNDA 2Z7YA 3S7GA 2ORBL 4N2IA 4X9YA 5LNEA 5ABAA 3GNML 3HE6D 1PGRB 3CIQA 3L45A 3VNYA 1D9KC 1JZ7A 4CC4A 3IKCB 5TPWH 5D6CA 3Q8AA 3K6NA 4XBEL 3U36A 1CT8B 4AQZA 2A6IB 1GGTA 3A21A 4KVNL 4UDUA 5AB2A 1WS8A 3DRQB 2C9VA 4M00A 3DSNB 2CKNA 4TSBH 1A6ZB 3PWPD 5D7LB 4GG6F 3QR1A 3ZXAC 3MX0A 2XKSA 3QIUB 2A6JB 4UUJA 2KT6A 4WHDA 3PDDA 1EHKB 1QFWL 2CO7B 2HPOA 2V17L 5TQ0L 2J6EA 2GT9B 1FYHB 1B4RA 5D7SL 3INUH 1RZJC 1OHZA 2GKIA 1D5MA 3HBPA 1J0KA 3QDMA 3ARWA 4W4NA 4OLXL 4LCWB 1BXXA 4JL2A 5KW9L 3IDNA 4MNQD 4K55A 4H8WH 4IBLT 4AK2A 5KAQF 4BQ6A 1MRFH 1YJDH 1KNOB 4MMXA 4X6FA 4GRWF 1UB5A 2LLNA 3I9PA 3C9NB 3NQIA 5ES4B 4X5XB 5CEXA 4QJ3B 3FUJA 1EEUA 3TBSA 2RB8A 2KI6A 3ULUD 3U4AA 5D93C 1G4MA 2R4RH 3DETD 3RPKA 1QRKA 4XVJL 1G7QB 4UT6A 3BN9D 3FT3A 1G6RA 4MHHG 4QRQB 4HW6A 4LT7A 1RK1A 3HAEB 4YHNA 4D8OA 1PD1A 1UWXH 3FT4A 4N2BA 3TIEB 5D7EA 3EFOA 2XVBA 2MPVA 1JYWA 2IH8A 3HI5H 5GJSL 1RERA 5FYJH 1E8ZA 1SLUA 2NY4D 2VR3A 1BX2B 4U6TA 4HKJA 2ZXDA 3CC1A 1T5KA 5F97E 1BVNT 1AR1B 3T5WA 3O3BB 2X2JA 2AVGA 4JFFE 2HG5A 4B53A 4JM4H 4XP9L 3ZYIA 1QBMH 1ZIAA 3LD8C 3L7FA 3ZE2F 2G4GA 4YHYC 2BP3A 3EF7A 1LE9B 5KVGL 5CXPA 5HPMB 4ZS7L 3KXFA 1Q4NX 4IU3B 2P52A 1EUTA 3OGCA 4N85A 5CGTA 4EQ2A 2Y6SC 2Y1AA 3MQIA 3RA7H 4B96A 1XB6A 1XGPA 3S0PA 2OMVA 5C0BB 2QQLL 4BXSV 3BRGC 1G0DA 3IXAB 3KYMB 4HPYH 4PJHA 2WAHA 3UGXA 3ETBF 4NEHB 4HCRH 1P2CB 5F6HJ 3OHXC 2NTSP 1BZ9B 3ARDD 1NDMB 3KDMA 4OQTL 2ZUVA 1OAQH 3B37A 3BO8A 4GAJH 2Q3ZA 2YK1L 4L3EA 4XWOD 5IF0B 5T1KD 4B5ZA 1U8JB 5C07B 1U33A 3N42B 4Y1TA 2AEPH 5T5FH 3VCLA 5A3ID 4B9IA 3UBXI 4BRVA 4OJYA 2AV1A 4MAYD 4F8TA 1A7RH 5IHWA 1AKJB 3BUYB 3EFDL 4WWNA 3X1FA 5TH2B 3MGOB 2H2SC 1JFQH 5AALA 4RZCA 3FO0L 2FHBA 4EN3B 4OZHF 4PSRA 3ZK0A 1D6VL 1NUGA 3T3PB 3L08A 1TKWA 3LRKA 4K71B 4TLKA 5DHVH 3AY2A 4HUWB 4AH2A 1U8KA 1RHHA 3U1PA 4XR8C 5MI0B 3HNTH 4JE0A 2QHRL 4AV4A 1MNUL 2Z6FA 1AXTL 4Y4FB 2P4AB 2ZNXA 3M7FB 1QRNB 5IROC 1OCRB 1A7PL 5GRJH 5HHPA 5B7MA 2KLTA 3PAZA 4OLUL 2KDYA 2KHAA 3CHOA 4Z76B 3JQOB 4WSKA 2DQJH 3R1GH 2A1WL 5HGBB 3L3HB 3SO3C 1X5IA 1WFOA 4MJIA 4FA7B 4I0KA 3K91A 2OK0H 1MCWM 2GTZB 1JPFB 1WBZA 1JNHB 2E56A 2WKGA 3PWUA 5GGRY 4PG9A 5I6NA 2IH1B 3KM1A 3OHXA 5IHUH 3RL2B 2BVOB 1BBDH 1RVFL 2XUWA 4D0CB 2H3NA 1DQIA 2DLEA 2NY7L 3WNJA 4QTFA 2MKLC 1BGXL 1PG7W 4PJDA 4RGMB 5TF1H 3SKMB 3LZLA 2PPFA 1YPZF 4OLWH 4JZNA 2VDOL 2R9HC 3O6FC 4Q9BA 2PO6D 3FU0A 2DN7A 2DMHA 4ODUA 1S7WA 3ZHLA 3O9WD 5LKNA 1ZXQA 2N56A 3BYYA 3MYJA 4DO5A 3V6ZA 1HCFX 4TOYL 1YN7B 4FQ1H 4WHTA 5F8RC 3FYIB 1MCKA 2XZCH 4WI5A 4UOZA 2EIJB 3NRPA 3OZ9H 1ITBB 3AABA 1YY9D 3JWDH 3O8XC 1HSAB 1CQYA 1VFBA 3VXNA 1G7PA 4N26A 3ULUC 1JGUH 3U82B 4UTAA 3UAFA 1WG3A 3K6OA 3X1BA 5IROA 4F7EA 1CJYA 3FBKA 2FX9H 4AGNA 4C83B 3AITA 3MV11 3E3QE 3CH1A 2BFVH 1HXMB 4MA8L 3GHBH 4NQCB 4O5LH 2BNRA 3BKYL 1GS6X 3ABKB 1SM3L 5EWIH 1T1XA 2RACA 4ORGB 3SIKA 3FT1A 3JUYA 1HDMB 4HKZA 5EF1A 2G60H 3GSOA 3V0JA 2GCYA 3H9YA 1YUHB 4I48B 1ZSDB 2HTKC 2G3MA 3QYMA 4KJPC 1LEKB 3QFJE 1H3UA 3SD2A 2NY5L 2D0GA 3UTPE 2DOCA 4DF9A 5FA4B 2EH7L 3QXVA 1QMUA 4NS0A 3GIVB 1FZOA 3VXRB 3NK3A 4K94L 4PJCB 1D5IL 4U6YB 4JE4B 3O6FA 4NUQA 3F7KA 3LH2H 1A9EB 2YD0A 4K5PA 2GUOA 3QUMA 5DJZB 3V4VL 3OKDA 5DJYA 4PJGF 1T66C 3BWUC 3OLDA 4WI7A 3B1TA 4GI8A 4FLRA 5HDBB 5JW5B 5HHMD 4DKEH 1NFAA 5K9JH 2BSTA 2OZ4H 3C08L 3O8XA 2BS9A 3KHOA 3Q0HA 4PY8I 4Y2NA 3S3CB 4J12A 4LNRA 4QRFA 1CL7H 1M1SA 5ID0B 1WWAX 1XGQA 3LYRA 1A6AB 4JY5H 2VXQA 1Q9WB 4XC1L 1N64H 4MAYC 3F2LA 4JO2H 3IDJB 1QZ1A 5AOZA 5E23A 5LJYH 3NZSA 1FAIL 2J4WH 1H8OA 4TNWF 3JT0A 2P43B 4P04A 1T4WA 3H2PA 4G6AC 3QUYC 3WO4B 5IR1B 2VUKA 5EEZA 4NO0D 2C3WA 1KJVA 3BXNB 4Z7IA 2AABH 2VKWA 4L23A 2LABA 4Z3TA 4U6XB 5SWSB 4KQ4L 4N28A 4RETB 5LWYH 1LO5A 3DJZA 3OKMA 2AAVA 2C9SA 4WK2B 3DIFA 3MZGB 5TE4H 1YN6A 2JNZA 5LCVL 4JMXA 4YEFA 1Z5LA 2HLEB 4W9LC 3WMSA 4P07A 1UJTA 3VD4A 1JIBA 1N5AB 3P4NA 5CBEA 3WELA 5L6YH 1CVSC 1V3LA 2BC4B 4XBPA 5F88B 1ZTXE 2OQJB 1UWEL 3NPZB 4N8PA 1J5CA 1T04B 4JGNA 4DGVH 1N67A 5IMOB 3TNNB 1DJIA 2DLGA 2VXTH 1G7IB 2ED6A 4L8BA 3QO0B 4BGDA 1USQA 5EG6C 2WLYA 2YARA 4OIIL 1K3ZA 3JV6A 1UFUA 4JFDE 2V7HA 4M61A 3FQUB 4MDJA 4XPBL 3R8BB 4KITB 4U1NA 1ICTA 3IVKA 3TYFA 1KZYA 4Z3HA 3AT0A 1C5BL 1LQBC 2BIPA 3NZUA 2F19H 3KAAA 4PEEA 3QUYA 1G7MB 3DOIA 4E0RA 4IRSB 3O6KH 2HJLA 3WN5B 5HVFB 4WU5A 5KYYA 5D7JB 4PV9B 2L7UA 1YY9C 4JR9L 2AVFA 2H1PL 4FAAB 4KK9C 5EIQA 2EKSB 3HG1B 2YBRA 2AK4D 3QQDA 3CPUA 1PG7X 4OTXL 3VWJD 2VDKB 2A77L 4I2XE 4Y7OC 4O2CB 3D87B 4ODVL 1XVSA 4RDQG 4GRLB 5B38A 1GHFH 2FJFA 2WQAA 1H5BC 1CE6A 1N6UA 3FHAA 4ES8A 1G7JB 2ZXEB 5K59E 2BMKA 3P73A 2VDQH 5H94A 5DJXB 5B7EA 2HH0H 5CWSB 4YQXH 2CUAA 3HZVA 1KENH 4EF3A 1FZMB 3SE8L 4KROB 4QNPE 3NABL 2J8OA 2IV8A 3GNMH 2BWIA 1VESA 3V0GA 4XBEH 4N5EC 1OD7A 3T0VA 2R4SL 3ZTNH 4KVNH 3GUTA 4Z78A 1GYUA 2HFGL 1SOQA 3ESPA 1OZTG 2Y2WA 5FGSA 4AYGA 4OF7A 3CDCA 1JOIA 4Y5YA 4M8RA 3VD3A 3W9DA 5IW6A 2B16A 2AJZB 2D2OA 2FSEB 5HY9A 1QFWH 2LT9A 4UQ3B 2NTFA 3L17A 5EIIA 5TQ0H 4JRLA 3QUHA 1ZV2A 3F83A 5D7SH 4AQ1B 5HYFA 5I1JH 4WUUD 5KJ7E 3V0HA 1Q94B 3RUGB 4I1NB 4PYGA 4QRPD 2RJMA 4LOUC 4OLXH 4CMHB 1R24B 3MRMA 5T3ZD 5EU7C 2B39A 1CFNA 3DJ9A 2R69H 4G5ZL 4AEIH 5JOPD 2X4RB 2E47A 3ILDA 4HIHB 1DUYA 3LS4H 5B1KA 3LKSA 2VLRE 4OJFL 4W9FC 2WQRA 4DFIA 1U42A 2DQ6A 1WE5A 1WITA 5D6CB 1A4KA 2P80A 4DPRA 2WNXA 4M7KL 4Y4KD 1X5HA 2NW2A 5F7FA 3U36B 2R7EA 1A7QH 4YSDA 1I9RL 3NGBC 4PGJA 2IMMA 1SQ2N 4FGMA 3CXHJ 1OM9A 1N9PA 4PW9A 1XF4A 5JIIA 4L0YA 3VGGA 1U2CA 2PPDA 3MX0B 1E65A 3B9DA 3LDBB 3MKGA 1R3KB 4UUJB 2IAND 1UD2A 4UINH 2G3ZA 1XB8A 3UPRA 4QY8A 3QS3A 4G9FA 3D5OF 2K4WA 2AV7A 2PETA 2EXSA 2ESVA 2AAAA 3KL3A 1D5MB 3QDMB 1GC1L 3MHZA 1P4UA 1OCOB 4AVHA 1A3RL 3ZMNA 2VR7A 2Y36H 5GZND 5KSVA 3BQUD 4YUEL 1KXHA 2BDNL 3IDNB 3QO1B 3I9IA 4GFXA 4XP9H 1ZHLA 4U31A 1RZ7L 2F2HA 2H4EA 3D12B 2GBUA 4X6FB 2EE6A 1OL0A 4MMXB 1UB5B 2PR4L 3DUSB 1PZSA 1KCLA 4JRXD 3C09B 5CEXB 5HPOA 3QUXC 2HWZL 3BAJA 4ZS7H 3V9CA 4ABWA 4FABL 5KVGH 1XCQA 2LLLA 4NRZA 3TBSB 2D3NA 2RH0A 1ML0A 1WIUA 4TL5A <