The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
26
|
sequence length |
125
|
structure length |
125
|
Chain Sequence |
PKHLEVYKCTHCGNIVEVLHGGGAELVCCGEPMKHMVEGSTDGAMEKHVPVIEKVDGGYLIKVGSVPHPMEEKHWIEWIELLADGRSYTKFLKPGDAPEAFFAIDASKVTAREYCNLHGHWKAEN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
DESULFOFERRODOXIN
|
| publication title |
Desulfoferrodoxin Structure Determined by MAD Phasing and Refinement to 1.9 Angstroms Resolution Reveals a Unique Combination of a Tetrahedral Fes4 Centre with a Square Pyramidal Fesn4 Centre
pubmed rcsb |
| molecule tags |
Electron transport
|
| total genus |
26
|
| structure length |
125
|
| sequence length |
125
|
| ec nomenclature |
ec
1.15.1.2: Superoxide reductase. |
| pdb deposition date | 1997-09-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01880 | Desulfoferrodox | Desulfoferrodoxin |
| A | PF06397 | Desulfoferrod_N | Desulfoferrodoxin, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like |
