1DFXA

Desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
125
structure length
125
Chain Sequence
PKHLEVYKCTHCGNIVEVLHGGGAELVCCGEPMKHMVEGSTDGAMEKHVPVIEKVDGGYLIKVGSVPHPMEEKHWIEWIELLADGRSYTKFLKPGDAPEAFFAIDASKVTAREYCNLHGHWKAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Desulfoferrodoxin Structure Determined by MAD Phasing and Refinement to 1.9 Angstroms Resolution Reveals a Unique Combination of a Tetrahedral Fes4 Centre with a Square Pyramidal Fesn4 Centre
pubmed rcsb
molecule tags Electron transport
molecule keywords DESULFOFERRODOXIN
total genus 26
structure length 125
sequence length 125
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 1997-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
A PF06397 Desulfoferrod_N Desulfoferrodoxin, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1dfxA00
4BGLA 2JI2A 2JI1A 1VZHA 1VZGA 4D7PA 2HVBA 4BK8A 4BRVA 1DQIA 3QZBA 4BFFA 4BV1A 2JI3A 4BFJA 4C4BA 1DQKA 4C4UA 1VZIA 2AMUA 4BFKA 1Y07A 1DO6A 1DFXA 4BRJA
chains in the Genus database with same CATH superfamily
1RHHB 1EDYA 3VACA 4OCLC 1B0GA 3BVTA 4ELKA 2P4AB 4JJ5B 2OPCA 3P30L 1FV1B 3PDGA 1RUQH 4X6CA 5DYOB 3X17A 2MNJB 5CIPA 3NIGF 2AS5M 2FE0A 3HMWL 1HTYA 3V7AG 3ZHNA 4KRPD 1A7OH 4ZSOB 5FIEA 2N1KA 1Q0XL 4IHOB 4ELDA 2X10A 1GH7A 2FLMA 3DJZA 4H25B 4XCNB 5KSBE 1WGOA 3NEEA 2VXUL 5D4HA 1V7MH 3OPZL 2WMPA 1AH1A 4FTVB 2LGNA 1FJ1A 2GQHA 2DYSB 3D48R 3LXAA 3VMNA 1A6WL 1SVCP 4AYDC 2IBBA 5CKAA 4KXZH 3Q6FA 2XN9A 5JXEC 2A4ZA 5H8DA 3NA4A 5EN2A 1UM6H 2J6EL 2WZPA 3MTXA 1S4IA 1X4XA 2CHZA 2YUZA 2E4TA 5AVWB 4B5ZA 3O4LB 4BM7A 1TZHB 1NFIB 4GW5B 4O02H 1DJYA 5AZ2H 1A5FH 2FBJL 4OZGA 3NJHA 1D5IH 4XOCA 1LO5B 2FWOA 2J6EA 3BLPX 4XI5C 4BA8A 4PWFA 4U6YB 4XP1L 4LQFH 3TBTB 1DZBA 1ACYL 3DX0A 5FYKH 4M5TA 4M8RA 3C6LD 2X6AA 3DI2B 1TKWA 4I48A 1W91A 2WLIB 4UTCA 5AVUB 4OD1H 5H4YA 5C6TH 1ONQA 4F37K 1CLCA 5FM5O 2X4SA 3KR3L 4ODVH 2EXWD 2B2XH 3QDJE 4QGTA 3VTMA 4AJVA 2ICEB 4B50A 3AUWB 4KZDL 1CE1L 4G71B 1A1OB 5DCCA 2HYMA 1VJSA 3K72A 3QWQB 1QD0A 4HKXB 4UNUA 1FA4A 1TZOA 5FDWA 5KYYA 4DIXA 5CEZE 1CUOA 2VLLB 3TYFA 3MMEB 3STZA 1UC6A 1FNFA 3DX6A 1MJ7L 5JYMA 2JWYA 3SGJC 3GD1C 4RQQB 3RI5K 2H26B 3APCA 4F1SA 1IL1B 2GBAA 3KXFD 1MFEH 3GQFA 1JMXA 5JHDD 5E95B 2A0LD 2VDPH 1GJIA 5CJBA 3DI3B 1W8EA 4NQDA 3CX5K 3GHEL 2K9UA 5FKPB 1BD2D 1MFUA 3IDGA 3POCA 4NC1E 1A66A 3ARGA 1T66D 4J7RA 5EUOF 3QEQE 1SXBA 4RAVB 2OV0A 1DVYA 4YZWA 4X9BA 3VRIB 2BDNH 2XZQH 3RVWD 4L8SB 5I15H 5CN1A 4J3SA 1P1VA 1NBQA 4RNRB 5JQ6H 3D0VA 1PZAA 1Z5LA 2HA1A 4KK5D 2OJEB 1C5BL 2BZCA 1SM3L 5D7LE 2F19H 2WUBH 3BKJL 4MD0A 1Z9LA 1GGUA 4NSKA 4X8GA 2E6PA 3S97C 4HK3J 2Z1PA 5EUKA 2GJRA 3VI3B 4FQHB 4P9HC 1D5MA 1NICA 4PD4K 5AW1B 5I18H 3QO0A 32C2B 3ULAB 4JHAH 5C0CD 3S3SA 4PJEA 3QUKA 4EAEA 1IFGA 1TF4A 4ADGA 3ZK0A 3T6WA 3LZQA 4IMLB 2NY1B 4E2OA 5DJXA 4PWIA 3UIYA 1MIEL 3KPLA 4PJDA 5KS9A 3TVMD 3EFFB 3QNYA 3ULVF 1SLXA 2CKBB 3FFCB 1XAKA 3MRQB 3ZQWA 1WWWX 4OGAD 1IM9A 5IOPB 5IQ9A 4NM4H 1RZ8B 1HKLL 4NWTL 1ZTXE 4FLRA 2PXYD 2FYYA 1MJ8L 3X3FH 1DVFB 1QQDA 3THML 1TSHA 2CALA 1BX2B 3V8OA 2X7LA 3TBBA 2HMIC 2NSQA 4ZX4A 1VSCA 3UABA 1AGDA 4BKSC 2D4DA 4S0HA 4JN2B 4CC1A 3CFNA 1V54B 5HJ3B 5HYJE 1UYWL 1IC4H 3VFWA 1PZUB 2CR0A 2R0KH 1OAXL 4HP5A 4BD4A 3H7BA 4CDHA 3PWVB 3TEXA 2Y6SD 1U30A 1WCBB 3MNZB 3QORB 3AQXA 4NKDB 1GSKA 4NQCE 3VVVA 3BP4B 3CV5A 3M1BB 4HS3A 3WO4C 4JFYB 1S7RB 4AEIL 5AB0A 3VX1A 2G5BA 4E5XA 1CFSB 3TV3H 2AKRB 4A68A 4KMLB 3WGUB 3LY6A 5HHQB 2ZONA 3OAUL 2FWOB 2FYVA 3QJQB 5DMIH 3KLKA 3N85H 5DMGD 3TN0D 2HFFA 1S9KC 4K9JA 2XDHA 3PWUB 3UP6A 3W0WA 3RLSA 1U8KA 2I07B 3DHMA 3CVIH 4PP2B 1YQVH 3O2WL 4FQ1L 4GO9A 5IJCC 3A24A 3IJ9A 1D2OA 1ZCRA 4NJAH 4ZBJA 3ARBD 1YMMD 1D7CA 2WXLA 3FTSA 4L8DB 5FOBA 3TCLA 4R5TA 3L8QA 1OQOA 1QFUL 2QLVB 4PYHA 3Q8FA 5C0AA 3BCDA 1SUHA 1T2JA 5CCGE 4J6RH 1XIWA 5ID0A 6FABH 1J8RA 2V2XB 4WGVB 3TCXA 1OB1A 3DMMB 3GMLA 1IAIH 3O3UN 4WV1A 4UWQB 2FGWL 1U4FA 3CQPA 3OVUB 4PQXA 4TUOA 3SZ6A 1AQHA 1FG9C 1RUAL 3KG5A 1F58H 2QPSA 1ROCA 2ZXCA 2ADIB 4XMZA 1RZQA 3MFFA 2BSEA 4OV5A 3VG0L 1GS7A 1IZKA 1QSZA 3NJFA 4KJWC 4E36A 4J12A 1O9VA 1T7ZA 4OGYH 3UGEA 3UC0L 1ZGLB 3RWFA 1J1PH 4R7XA 4N0YH 4PPTA 5LNGA 4MA3A 1NCGA 3OQ3B 1RIHL 3D4ZA 1T83C 2DM7A 3ROOB 3UPRB 4CAGA 2X7LB 1JK8A 5HY9A 1O6TA 4PJHE 3MRKB 1BWWA 3O6ML 5B7EA 4N25A 2ZXAA 2I24N 2VDLB 2J5WA 3QO0B 4PHZA 4TS6A 1TVBB 5C0ND 2MPAL 5DZLA 4JNXA 4TLTA 3O6MH 1PJWA 3E8UH 4DZ8A 3H9SD 2R9HC 3ARFD 3RGHA 4Z9KB 2AJUH 3ESOA 1KTJA 4HFWB 1F41A 4TNFA 1RUKH 5LDUA 3CDZB 4W68A 1T5XB 3MKKA 2I07A 2OSLA 2QVTA 4Q9RH 4PJ7A 3EGSB 4TLUA 5A2JH 1MVUB 3QW9A 3QZLA 4HGMA 3CN4A 5LAXA 3C09C 1NFDE 3C5JB 3P73A 4DGYH 3JUZA 1JPST 1OP3H 1XGYL 2BWDA 5HVHB 5DQ9A 3P4MA 3UTZB 3QIBD 2A9DA 4HCGA 3BQVA 1MCFA 3BGMA 4DH2A 2HKFH 1OM3H 1RK0B 5AVTB 1LEIB 4TQIA 5HTSA 3IJ8A 3NFNA 4FXGC 1QSFA 3VFWB 5ITBL 3QDGA 2NCEA 1YEJL 4QO1B 4NUGL 5EULV 2H7WA 1SEBB 5FGRA 1I3UA 3QK0A 1G1KA 1KCSL 3BAJA 5F9WC 4AW4A 3OKDA 2BIMA 5E9DA 4ZTEA 5EOCJ 1EHLL 4N86A 3ZR5A 2VYRE 4EVNA 1IZJA 4K71B 4YUEL 3FT3B 2V5TA 1RJZB 2YRPA 4F15C 1OO2A 3P9MA 2IEPA 1JPTL 4MDIA 3NDZE 3D52A 4YQXH 3TPUA 1OE2A 4ZUUA 1CF8L 4KJYA 3VWJD 1I4FA 2HSIA 4UNTA 3ARDC 2JV6A 3FFDA 4YQXL 5HHOB 2IIJA 3VXRE 3TBTA 4HX1A 1CMOA 2HRPL 5BZWA 1YPZE 3M1OA 1JNHB 1CBVH 3FFCE 1TIUA 2F58H 3V5KA 1YEIH 2EKSA 2EYSB 3TOPA 3UFIA 3KDPB 1CDBA 4QRPD 1DFBH 4WDIB 4MNQA 5FFGA 2VDKB 3CPLA 3CX5J 1ESOA 2APVA 1SVZA 4ZYKA 3WJJA 2VISA 2H26A 2Q2LA 1KYDA 1U8CB 5D1XD 4FFWD 1TO5A 1GMIA 1CS6A 2VKWA 4KK6D 4W9FC 3FH8A 15C8L 4JAMA 4JRFA 3TYFB 3N91A 1KB3A 4GKZA 4Y2LA 5GGRY 4S1QL 3HS0A 2DIAA 3EDFA 2EIZB 3G5ZA 3T0BA 1SHSA 4QRUA 1G4MA 3FSAA 3U1SH 5FO7B 3KMDA 2XIDA 3EYOA 2ICWB 4Y9GA 3WLBB 1RLWA 4PR5B 4YAQB 4YR6A 5FGBA 4LP8A 4DGUA 4KV5F 2XWJA 2VT0A 3DVGA 4JQVC 1SJVA 2BIQA 4BE5A 4PTUA 4QRRB 2DI7A 1HH9A 5KYUA 4XPHL 3S96B 5I5MA 2VRKA 4MMZB 3IPFA 3RWIB 5DQDL 5ANHA 2Y7QA 1NBVL 2WPGA 5MEPB 3VGBA 3SHSA 3ZTJH 5HD8D 5FM8A 2OMUA 5E6UB 4DKFL 3N2JA 2FD6L 4AY0A 3DXAB 4V1DD 3SE6A 2HXAA 4K7FA 5FHAL 5E23A 1FV1A 2NY2C 1KBVA 4JRXE 2FJGA 1NZRA 2X38A 4N2AA 4PRPD 2J6WA 4NN7B 4U0RC 4WFGD 4JZNB 3WFBL 1UA6H 5CLWA 5LJYH 3SYPA 4KKBD 4U4BA 5HHNB 3J8F7 1MHHA 2HKHL 2HX9A 1DN0B 1LE5B 3L5HA 2JK5A 2RACA 3VAEA 5LBSH 2AJZB 3GFUA 4PJ9D 2D7PA 3HB3B 3L3JB 4JQIH 4HOXA 2UYLA 1XR8A 2ICWI 5D7JB 4AEIH 2GVYA 2NY0C 1JCKA 4BFKA 1EBPA 3LKOA 5D72L 4AKPA 1L3WA 1P7KB 5EN2B 4FL4B 5KBDA 2DB8A 2G0LA 4JQIL 2XLLA 4MCZB 2XG5B 2YAOA 3FOLB 1NMBH 3WDJA 4H5SA 1YJDC 1G9ML 2X6VA 2YD8A 2EH8L 2MHAB 2WYTA 2HX8A 3FOMA 4PMFA 3FMGH 4PRHB 4YFDB 2CPCA 3ETSA 3ZDXF 3L3IB 3MLUH 3PJLA 4J4PC 3CDYA 4TUJB 4JO3H 3F7YA 2UZIH 5KN5B 4D0DB 3W0WB 5DA0B 3PV6A 1PZ5A 4KK8C 1QSFE 3DGDA 5IROC 1RZIA 3BWAB 1FBIH 1ZT1B 2CPUA 4HKBA 4HEME 5J8OA 5IFAH 2AK4B 4LQ1A 4JFYA 1QWUA 1G7JA 3QJUB 1QSEB 4F2EA 1PAZA 4MNGB 5T5FH 3P4NB 2YD3A 4FS0A 4FMKA 3WJMB 2H0JA 4KTEH 2NY3D 4NBXB 4UM9D 4PW4A 3ZQ9A 1MW2A 3MRGB 1QBLH 2NYZA 5C2UB 3IAGC 1JWUA 1GGCH 5C97A 1S78C 4Z6AT 3ATEA 4L8DA 1Z2KA 2GI0A 3RWEA 1VGEH 2DM2A 5C0IB 3EYUL 3C60B 4X6DF 4GRWE 1FZOA 4PRBA 1A6WH 1JL8A 2OCCB 1KEML 4U1HB 4LK4A 4PLOB 5DQJB 3RIFK 4LLMB 2I60H 3MRFA 1JK9B 2FX9L 4FFZA 4GINA 4J3OC 5EZIH 2NYYD 5HYJA 5EO1A 3LKQA 3QWOA 3UAJC 3WY2A 1CIDA 3DIFB 4HIJB 3LRKA 5EOQL 1U8CA 5E1AA 3Q9QA 1DQLH 1NJ9A 2EDMA 2ZF9A 1EUTA 1DJHA 2C34A 2C4FT 4WO4A 3BVNB 1CLYH 5J13C 2BHYA 3FL7A 3VU2A 2R29L 3G5ZB 2NNAB 5T5NF 4A2DA 2J1KA 2IH1A 3V4PH 1UFGA 2VLJB 1I31A 5HYEA 3MCYA 3F7LA 3NOIA 4WUUD 4FQJL 4P5MA 2NCMA 2R69A 1Y6KR 4O2EB 2JIXA 2W07A 3TWCH 1JRHL 3LIZH 4U0RB 4Z3FA 3WKYA 2X9ZA 4WQOA 4MD0B 5E5MA 2FB4L 1CD1B 3AWFA 5IREA 1YY8A 4LVNC 4Q52A 4X0KB 2XTJE 4UTBH 4M3JA 2NY6B 2XFGB 2UY7B 4P05A 3MX0A 1A4AA 4GIOA 1RURL 4KFMA 4WK2B 1ZHKA 1A65A 3EJRA 4HKJB 2ZAGA 3BRGC 4H2CA 3LKNB 3MNVB 4J3VA 4NBZB 3F2LA 3GTNA 3PFQA 2G75B 3VDCA 4G9FD 4U3CA 3MRBA 4F7KA 5BRZB 1TTFA 1T0MA 4NNPH 2WKOA 4UU9B 5H2BA 1VB9A 4XAKE 3TN0C 2ED7A 2HTLD 3IDJA 3OF6D 4QR7A 2P7TB 4YIQB 4FI6A 1A9BA 4UTAH 3G08A 3RA7H 5DUMH 3Q48A 4LXFA 1BIIB 1OW0A 2F1EA 3SDAD 5DI8A 5MEND 1WZLA 3VRLE 1F90L 2GJPA 2HWZH 4RWYH 1JF6A 4NAQA 1MFAH 4K07A 2VDMH 5IHBA 1CK0L 4RAHA 3BD3A 1EZSA 4DTGH 1RP8A 4XCFL 4X4ME 3BP6B 3MV9D 3EJZC 3LQZB 4IIZA 4JZOA 4TNWK 3WSQL 5DJAB 3W5NA 2X4OA 1YEGL 1R3KB 1O9ZA 2J88H 3PG2A 3HC4L 3SE9L 1JZ6A 2JB6A 2XQ0A 5J4MA 2GIMA 2L04A 4X9HA 3NVQA 4JKKA 4LFHD 3VE0B 2UY6B 4PGZA 3S98A 3FUNA 4RMVA 4QRFA 3ARUA 1MIEH 1JNHA 2XU9A 1M9WA 5GJSH 5FGSA 1S9WA 1BJ1H 2EXYD 5LNDA 3TF4A 3P3TA 1G7PB 4PI2A 4NHCH 2GFBA 1ZDQA 3WFCL 3GZKA 5AUMB 3VFGL 2OMZA 5D4QA 4UUJA 3WUWA 4C56D 3LKPB 1HKLH 3ZT5A 1KIQB 1DDHA 1ETA1 3EDDA 2Y72A 5EO1B 3MLWL 2Y22A 4FDWA 1UWGL 2W9DH 3LZLA 4PS8A 3K81A 2JB5H 4G6JH 3NESA 4AYID 3DO7A 3LRSB 1BVKA 4IU3B 1CXIA 1Q0EA 2G75A 3WTUA 2VZ1A 3S4SG 4F58L 3QWNA 5ACZA 3KLAA 4KAQL 2JB5L 1YPZF 1RAMA 4KTYA 3HMXL 1FVEB 4N0CD 1EV2E 5HDBF 5DEZA 4DN3H 2D2CC 1V05A 1VCBC 5DRWA 4WEUD 1UWYA 4MGXA 4ZUTA 3HUJA 4Z7VA 4NKOB 4KVCL 2OR9H 1K3ZA 2IDSA 2AW2A 1AGBA 4M29A 1PBYA 3BH8B 4HWZA 5F7DB 2J1ZA 3DX9A 4Q2ZA 4ZFZB 2B1AH 3PWJA 1U2CA 4UQIM 1RI8A 1L5GA 2WXJA 2CNYA 3QUHA 4K5PA 4AYEC 3ZMEA 4DKEL 3HI6H 2IBZY 5F21B 4K3JL 2I5YL 2ZNXA 3TT1H 3S37X 5DHYA 3VH8G 2BFVL 3HLKA 4PJAE 1YZZA 2EXWC 3RILA 3AY4A 2WLKA 1P4BL 1Q90A 3NIGE 1LEGA 5DLML 5HHNA 3W39A 1A1NB 2XV0A 2B0SH 4Y4HC 3BT2L 3W2DL 3VFOB 2HVKB 3PIQA 5I30H 4KUZH 5JPNC 4DP1X 1P4UA 2EDKA 5JR1L 3QZPA 8CGTA 2XRAL 3BGFC 5T1MB 2XXFA 2UYLB 1U93B 2K7QA 3FB8A 5IJVA 1E3ZA 1T5WB 1R3HB 1AZNA 2IPTL 4XNXL 5E94A 2FNWA 5ANME 1NBYB 5F7NC 2Z9TA 3B2UC 3RGBA 3I74A 1II4E 3FQ4A 2KH2B 1V5JA 5D55A 2CA3A 35C8H 1DBAH 4GSXA 2A73A 1QRKA 2ROXA 1BYOA 5ETUA 1WFOA 1BFOB 2XKUA 2E74C 1DZ0A 1F18A 2Y9RT 3ZRFC 4R7DB 3ESNA 1X5JA 4XGZB 5AW9B 3X11B 4M4RB 1DBAL 4N8CL 3PV6B 2AANA 2MPAH 1RFDL 1BZ9B 3CFDB 5D7LA 4XP9L 4LCWB 4Z3GA 3PL6A 3EBHA 1BLNB 1QPKA 3N1GC 2D0FA 3N1FC 1UHVA 4GPVA 4PJHF 4WTWA 4XX5A 5B22A 4WI6A 5E6IC 5ISZD 2ZUVA 3SE8L 1IILE 1QKZH 2EDBA 1KGWA 2WCSA 4GW1A 4WI8A 4X42A 1OCWH 4A7GF 1CL7I 2DQHL 5DD5L 1AYOA 5DDHA 3V5HB 4HWZB 1RZKL 3APDA 4KK8D 1MFCH 4PYGA 4A6YB 3H3KA 1KGJA 5DVMA 3MBEB 1GPOL 3MLYL 5EDSA 2EEAA 5TJWK 4PLKC 3UBXG 1Q0YL 1Q9OB 5B4MC 2VDQB 5HYSA 2WJ5A 1VAHA 2J56A 2G9KA 5BRZD 1H9DA 4JFPB 1R3JA 5AKTA 2WB7A 1GZQA 5J12C 3HC0A 3K6FA 4OD1L 1DVFA 1QQDB 4BIKA 1XV8A 3TGXA 2BHUA 3WHE0 5GS0L 4JGNA 1YNTF 3KXFB 2VR4A 5IB4A 1P7QD 4ZUSA 1IBYA 4Q6IB 4PJGF 1B2YA 3PF2A 4PJ9C 4NN6B 3AGWA 5E9DE 4CSZA 5HJ3A 4PGEB 5KVGL 5F1IB 4HUMB 3KLHC 4OJDH 3PPSA 4OUOA 3ZQXA 5HXMA 2Z31C 3VRIA 4EXPX 1THAA 4YHKH 2BSBA 3CZLA 4N1CA 5CBEA 4L5FL 3SKMB 4AM0Q 1EXUB 2Y25A 3B9EA 2YD4A 2B7DT 5BOZG 1G7HA 2W9EL 2FUQA 1MAKA 1ZTMA 1CTMA 1D5XB 1K4CA 4KRPB 1T7VA 1ZIAA 2B1HH 2ZSVA 5FHBH 3W3BA 4BZYA 1E65A 5EIVA 1ES0A 2DDQH 4OD2B 5GRUL 1N7ML 4MQXC 3GJFH 1PKQB 2BVEA 3KJ6H 1NPUA 4NAMA 3WCYA 4GIPD 4P46B 4BZ1L 3SYOA 4I0PA 3CXDH 4OZIB 1FAKT 5AVQB 3KLQA 4HBCL 1I8LC 3HG1E 3IMRA 5IB2B 4HGWA 4JHZA 2MSPA 3U36A 2VSDA 1KB5H 1DQMH 4N1EA 4O58H 2XN0A 1SY6H 5E5RB 1J8KA 1LTXA 5GRXG 1YQ2A 3KYOA 2GAZA 2HZHA 4WO4C 2CLRA 2EE6A 4JY5H 3O4LD 1UWXK 3K74B 4FYSA 1CLZL 4MJ2A 1EEUA 2XZAH 3OTTA 4NC0B 3KWTA 1L9NA 1KIRA 3NT0A 3OZ9H 5H35B 5IVOA 4JB9L 5GS1B 3S8GB 1ECZA 1BIIA 2EADA 2GY5A 3DHUA 3IEAA 3QDHA 4KNQA 5GIRB 4MAUH 3HBZA 2AVFA 3FU0A 3UTSA 3FUMA 3BO8B 1SVBA 3GSUB 4UU9A 1JV2A 4GUPB 4X83A 2EDJA 3RBSA 1JGEA 1C7SA 1SJHB 2RALA 1ZLWH 5DVOA 5IM7A 5T5FA 2PPFA 3FT0A 3OJDA 5KZCB 4DN4L 5CU9A 3WLWD 2VCOA 1J0YA 4G9FB 5I1JH 5IFHL 5KBPA 3IDIA 4G6KL 1UXMA 5MENA 5AVYB 2QSVA 1TVBA 1TU2A 2WVTA 2X4QA 4WFGE 4PG9B 2IXQB 1I8UA 3CDGB 3CPUA 1TVHA 5HDQH 2W1NA 1BQKA 3O3BB 3CZNA 2Y3AA 4FFZH 5BVJA 3ZYJA 1R5WB 3IGAA 5JW4Q 2DBJA 5EBWA 4X9YA 1UWXH 1KIPA 3QIUB 4BH7B 3JQOB 4YJZL 2VM9A 2E27L 2VXVL 1B0RA 2WANA 3QPXL 4S11A 4XPGL 3ZHLA 3MV9B 4N8VG 5DEFA 1U8HA 3BCFA 3UZQA 1QNIA 4CN1A 2FJHA 3P4NA 3FULA 3REVA 4ZPTA 1Y1UA 2Y2WA 3H2WA 5C0AB 3WHE1 3AMLA 3PWLA 4B5EA 4LGSB 4JE0A 1N4XH 2MPVA 2WSPA 3QQ4B 4G43A 3RUGE 3FQWB 2B20A 3QC6X 2XN9E 3FT2B 1M7IA 3VXNB 1QW8A 3GSNA 1G1YA 2FHCA 4TV3A 1N4XL 1NUFA 1YPZB 5KW9H 1T4WA 3QFJD 3QA3A 1IGIH 1ZJBA 3N41B 4XO8A 3DYPA 4CBZA 2ODHA 4F20A 1A6UH 1DCEA 2I5YH 3FU8A 3MRRB 3QWOB 1CG9B 2XWDA 5JW5A 4FFYA 4KQ3H 3HRZA 4GJTB 1T22B 2CUMA 2XACC 1Q9LA 1IAKB 3HEIB 3NQKA 5I1AA 3FB7B 5G2NA 2IGLA 1P69B 1X7TA 3GSNH 4BFFA 3AABA 1DLHA 5DLMH 4C4BA 2NSMA 4PJ8B 1IV8A 3LPWA 2EECA 4MMYA 4S0SD 3ZZLA 2E7HA 5DHVB 1ZGLP 2B4CC 5D2LA 1UH2A 3QFDB 1A4KB 1QP1A 2XRAH 3BP5B 3CVHL 4OGXH 1CDGA 1QR1B 1IAOB 1RVFL 1WTLA 4DW2L 4LCIH 1ET5A 1V27A 3N43F 5CGTA 1YO4A 2QV2A 3QQNA 5DUJA 1MLBB 2IV9A 1QOKA 2XJLA 1NGZA 4GEJA 3VXRD 4JFXB 1KUMA 4X7EC 5TE7H 1AC6A 4JCWA 5IQMA 2R1WB 4OF7A 4XPFL 4OM0H 3QSKB 2VXQL 3IGAB 4XO4A 3VX0A 4C83A 2C9SA 2EVFA 4HJIA 2OX5B 3DO4A 3WEXA 1HQRB 2WXGA 3L3KA 4J4PD 5KSBF 1FZJA 1Y07A 3CQFA 4YHLH 3PIQB 1MI5B 5TE4L 3E2HC 1DQQB 3OHXA 3ME0A 5DFAA 1CYWA 2WZ6A 2GY7B 1MN4A 3PFUA 3QEQA 2IPUK 2X41A 4I4WA 3O6LL 4HUUB 4PBXA 4U1MB 5B21A 2AXJA 1FGVL 1HHGA 2B08A 1FNGB 3ZW3A 4AENB 1PG7L 5TQ0H 3TBSA 3VXNA 2OL3A 2CGRL 4D0BA 3WL9B 1UOKA 4KVNH 5DJDA 3V7MA 1TXKA 4OI8A 1E9QA 5K93A 2F0CA 4ATWA 2G5BB 1QEXA 4K94L 2Q8BH 3ZUCA 2Q2EB 4X98A 3RYMA 1BMZA 5MEPA 5L9DH 4TSBL 2ZCZA 3BZDA 2A9MH 4LHJB 2WLHA 2ZWZA 3EZJB 2HTKD 3DK0A 3HFMH 5C2BH 2BVQA 2Q8BL 4Y2NA 1VADA 4H88H 5BZXA 5DS8A 5GRJH 5MI0C 3TPUB 4QLWA 3BPLB 4NCC1 1CI3M 3V5KB 3B8YA 3B7SA 4PRPA 1GZHC 3KPRB 3SPIA 1S7QA 2GT9A 2IALB 3TH3T 5AOMA 4LAJH 2NY5L 3IGFA 4JJOA 4P07A 3IT8D 4N24A 3V6ZB 4Y2DD 4PJFF 4PU2A 1S7VB 1UCBH 5DUML 1AOHA 4OCYL 4UQ2A 4PJ5A 4LSVH 2D7TH 2V2TA 2DQCL 2OMWA 1AY1L 2F2HA 2IQAA 4Z3JA 1AR1B 2V3DA 2P48B 5T8IA 3KW7A 2OMZB 4BFIB 4J8RB 1QSEE 4JDZB 1E30A 3S7GA 1KXTB 3OKEB 3VD5A 3WSQH 4XO9A 3VXPA 4APQC 1HOEA 3PE9A 4UDTB 3GGWA 4LOFA 1DFBL 1X7QA 2AQ1A 2NNCA 3VXOA 4EI5B 2CM6A 3HE6C 4HV8A 1KB5L 1E4WH 2N0KA 4WK0B 1HE7A 1KENL 2FSDA 3VDBA 1E3FA 4TPRL 5D7IB 1CLZH 3WFZA 4JDVA 4N26A 1EEYB 3TYGH 5BOJA 4S1RH 1X7SA 4PG2A 1WBXA 2YPKB 2Q3ZA 4OKDA 4ZFGL 3LNIA 4JFHD 4OD2A 4ENED 4RIRA 3UPCA 2Z3FA 3LDBC 3ABKB 3BISA 4M56A 5LGKA 4DZBB 4MDJA 1BJMA 5EOTA 4R6UA 2ETWA 3FRUA 4K7PY 3MA7A 4N2HA 2K78A 1EGJL 4Z7AA 2PW2A 2NTFB 4CU8A 1UFUA 3S35H 7FABL 3DX6B 5TPWH 4DN4H 2X4RB 3L48A 3FHEA 5FXCH 4PJ8D 1S5IL 3HB3D 4J5VA 3NACL 5FFOA 4GI6A 4DN3L 2QQNL 5BJTB 2BRRH 5DT1H 3FUFA 4NXKA 1QUPA 3VU1A 5JZ7C 1JYNA 3CE1A 3ATDA 4LU5L 1HL9A 3S5ZA 2JMRA 5C0JA 1SYVB 5G4MA 5C70A 2VDOL 5E9DD 2ITFA 2NR6C 3ZY7A 2AQRA 4P48A 4Q9CA 1T1ZB 1TJHH 1F1GA 1FG2B 1HHGB 3L54A 3WFHB 4YDLB 1MLCA 3RWGB 1N3NB 2NDGA 2FQEA 2DI9A 4P2OB 5E5MB 4ZMLA 3A4FA 3VYNA 3L5IA 3S9DB 1TDQA 2C9PA 4PY7A 1RJYB 4WWKA 1QUNA 4WVRA 1PG7W 2EICA 5D7SH 5D72H 5DUPL 3UL4A 1BQ5A 1E9QB 4JMNA 4F3FB 4ZOCA 3HC2A 1BZ7B 4LNVA 4KHXL 5D7LB 4UB0H 5AB9A 3H6AA 1YEEH 1A25A 1NCHA 1T89A 2HUEA 3ZHFA 1FDLH 1DUZA 4HCRL 3M8OH 4F7CA 3ATFA 4IRJD 4KHXH 4PIBA 3VFRA 4K5OA 5KJRL 4WU5B 4OUUA 4Q8BA 3KHQA 2ZUWA 5D1ZD 1HXMB 2CMRH 3BZFA 1FDLL 3WJMA 2XZCL 3VNYA 5G5DB 4LLMA 3PNRB 5KOMC 2ARJQ 2W59A 3AJ7A 3LCYA 3UMNA 3DGCR 5GGSY 1OHQA 1EVUA 1GJUA 1U92B 4X7TA 5GGVY 1CXLA 1IM3B 3CFBA 4P4RB 4UDUA 4LLWA 2WQAA 3BYYA 2NRDA 3QH3B 3OAZK 4RETB 3T1FB 3PGCB 1Y0LB 2VIRB 3SQOL 4ENZA 4G5ZL 4QXTA 2BK8A 2BNUA 2FIRT 4XX1G 3RNKB 5FUZH 4CVUA 4HJGB 3EBGA 1YEFH 3VI4F 3ZO9A 5H37G 4LEXL 4E41D 1KTDA 3WIHH 5C0EA 3NN8A 2AK1L 1SLWA 3E3QE 5HHPB 3ARFB 3IFOA 3UG5A 4XO3A 4RGMB 5IW1B 2C3HA 2VLRD 3BGFB 1U8KB 2HJKA 2EYTB 1A0QL 1PLGL 3IJEB 4X6BA 3DDGA 5TQ2H 4MNHA 1LNUA 3BW9A 4N2LA 1ZPLA 2IAMD 2VB5A 4O9HL 2H32H 4KKRA 5E8NA 4UNIA 4FZ8H 2UZYB 5B39B 1MQ8A 4DGWC 3D0VB 4L8CA 3NFPA 1JRHH 3LIZL 3OLEA 5EN3A 4FNSA 4OF5A 4BQBA 5HJDA 3VQMA 1U95B 1YMMA 4PRID 1EJOL 2DQFA 5JDSA 4OIBA 4D3CL 5D1QB 3HZ3A 5F7EH 2WWMC 3GC3A 4KDTC 1MCKA 3NK4A 3NCEB 4W9EC 3VGEA 3S36H 3MHZA 4QHKI 3QUYA 1LP9B 4NNXB 1LYQA 4JO1L 5EU4B 4ONOA 1JPSH 2DJSA 2WM0A 2FQFA 3BXNA 5L4MA 4XXCC 2QVMA 2DD8L 3GMOB 2YC1B 2RTTA 1TTBA 3OR7A 4R26H 4YIQA 2VGLM 1A6ZA 3EFFA 2A9ML 3BP6A 1AP2A 5ICZA 3RVTC 2ATKB 4AGLA 5IW3A 4E41A 3RB7A 1R19A 2IGFL 4CMHC 1VDGA 5SX5K 4X99A 1CI5A 1NMCC 4TQHA 2XBDA 2X4UA 4LL1A 3OMZA 4OZIA 1E2VA 3BPLC 5IBUB 3ZDZB 2WNKA 4PJIB 2H2SC 4UV7L 1W0VA 2NY5H 4RRPG 4LF3B 2ENQA 1JF5A 4FXGB 4O51B 1TKWB 2ATPB 5L4FA 3CFMA 1N9PA 2D7TL 1ZPUA 1WZMA 3DUSA 1KOAA 4UV7H 1OGTA 2YBRB 8FABA 2NY1D 1CF8H 2GT9B 3O9WD 2ENPA 3ZKQD 3SKJH 2F54B 1HI6B 1XGQA 3GB7A 3NCFB 4WEBL 4X9GA 1XR9A 2EUZA 4JFFB 3U9UB 3SD2A 5I5IA 5D1ZA 2WINA 3RFRA 1UZ8B 4IJ3C 1TQBC 1R5VB 1CC3A 3DGGA 3LVEA 4F9PC 2JCCF 4MCNA 2XTJD 3PUCA 4AKOA 2HVJB 4QNPF 2XKSA 4FKHA 2C4XA 4LLVB 5LO7A 4Y1SA 1GKOA 1M3JA 2H2PD 1WFIA 4JO2H 3U9WA 1WHOA 1S3KL 1NFDB 3C5ZB 1KCLA 2IOOA 3DIFA 1IFRA 3FUJA 2DTMH 2QJDA 1EAOA 4HIJA 4WHTB 4LDLB 4XNBA 5T3ZH 5EEZA 4NT6B 3L3HA 4GLRI 5EBLB 1UD5A 2A9CA 3P2DA 4MSWB 4S1RL 3RIAK 4IQHA 2YGPA 1UWGH 4CVXA 3ARGD 2Y7SA 1JI2A 1UXSA 4EIZC 3FAWA 2OM5A 3TO4C 3QUZB 4NWTH 3EOAA 4HLZH 4F3FA 1MJ8H 2YSTA 3VFMA 1LNUB 3BW9B 1DHKA 2PR4L 2E46A 3OKYA 5CILH 1KTLA 3W9EB 2WSKA 1OGPA 3NJNA 3UDWA 4PRNB 1YY8B 4AQOA 4F7EB 2J3SA 4Z7NF 4PCTA 3S35L 7FABH 2HT2D 5AFAA 4KX7A 4XPGH 2R7EB 5EU7E 5IP4A 4M4RA 4IDJL 2LE9A 2ZT9C 3JWDC 3NACH 1Y7VA 4PJ8A 1PY4A 5I0WA 1ZANL 4PJ5E 3LPFA 4F80A 1YEDA 3EF7A 5JHBA 3RE0A 1PW3A 1WFTA 2J43A 2WYZA 1BBDH 2MFNA 4B9CA 3HAEB 3HE6A 5DRNB 5JO5A 3TVMB 1FH2A 5LGJA 5GHWL 1UADC 5D7EA 4MVBC 3ISYA 1QSFD 4O5LH 2QMJA 1ZLWK 1S7TB 2JQMA 3QDMD 3QISA 1U3YA 3GXPA 4HF5H 4QRRE 5AVVB 3N40P 4KZEH 2WXRA 4S1DD 3KBEA 5LBSL 4HWBA 2I27N 3C8KB 3D51A 3Q6FB 3B3BA 4HXAL 4X6FA 3CSYA 5LBSA 3PJSA 2BFGA 1N68A 4FTVA 5ABAA 3FH5A 1T4KA 4PJXB 1BLNA 6PAZA 1TZGL 1ID5I 2AQTA 4E9YA 3O6KH 5CUSH 1EHKB 2R83A 3MV7D 4NGHL 5ISZA 4UT6H 2XZCH 2UWEB 5IHLB 3GKZA 3D1MC 5IR1A 2IQ9H 1UH3A 1MDTA 1AYRA 5KSAB 2FBRA 1I85A 3E9TA 1QNZH 2FQDA 4UIKL 2F68X 5KS9F 1ACXA 2GUOA 4K3EL 4UQ3A 4QXUH 5ISZE 2E9BA 2YLKA 3IAPA 2IQ9L 1KYOJ 1XIWB 4PJEF 1RZ7H 3FN3A 1I3GL 4HKBB 2VJXA 3D7PA 2BO0A 3ZYZA 2EDRA 2OK0H 1WWCA 1SEQL 2PYEB 1JS4A 1XXDC 3EOBA 4XP6H 5IQ7H 2J2ZB 3DDFA 1DSFH 2OMBA 1JPFA 4GBXD 1X9LA 3ARZA 3LNEA 5I9QB 3BZFB 4JGJA 4WWNA 1IU1A 5DJCB 4OLYL 3GRWH 1EZLA 1R33A 2WBXA 1VACA 2ICWJ 4Y9EA 4PJEE 2CBQA 1WS7A 2OYLA 3FOLA 4RWHA 3HG2A 5J6HA 3C5XA 1OQXA 4CSPA 1DQVA 4YHMH 1NAKL 1YUHA 4N22A 3MRPB 5DHXB 3VCLB 4XN1A 2GG1A 2C9UA 3K46A 4M6ML 5IMOB 1CGUA 1NCWH 5KVEL 4M8UA 3NH7L 5FS5A 5FYKL 5E6YA 4YHML 2IG2L 1AIZA 3RWDB 3NZHL 2DAVA 4JRWA 3L13A 4U7MA 2P5ED 3KS0J 4K55A 5KUKA 2Z1KA 1T1YB 5GGSA 2Z0BA 2XX1A 3ZIMA 1OCOB 1KIUB 2B5IB 2WBJD 2E7LA 1EMTL 1KTLB 3V79C 1UWEL 4OLUL 2WN3A 1QA9B 4ZQTA 3TN0A 4CA4A 1G7QB 1NC2D 3N55A 1VZGA 4EQ2A 3MACH 3V6BR 5TH2B 5L0QC 1M6OB 3L95B 2K6ZA 3FQUB 1PKQA 3D2TA 4GAGL 2W9EH 4PCKA 4XCCL 2GAZB 3R4DA 1D5BB 4OVVA 3O2DH 1MCWM 3ZZQA 4FFVD 4LSVL 4ZG1A 4FYRA 4IMLA 3B6SB 1SYSB 3UEZA 1BEYL 1J1OL 4HGWB 1BQUA 4A37A 1IFHL 3FQNA 5HYSG 4AMKL 3IDXL 4CJ1A 4M5ZH 3BPNB 4Z7OE 4FQHA 2FGZA 1W72H 3MREA 4ONGH 5F7UA 1USZA 3BO8A 4X9IA 4XMLH 2P7TA 1I7TA 4KVPA 5TDNA 2F15A 1TJIH 1SOSA 4OZGF 4NO5A 2XZQL 3LXUX 5DA4A 3PS6A 4UCFA 1AMXA 2K45A 4N85A 4G3YH 1HS6A 2NT0A 1I9RH 4CADB 3DPBA 3ECQA 4JB9H 1ILSA 4ODWA 1F90H 1UB5B 3EYQD 2SEBA 4HEPA 4NN7C 2E9WA 2ZKYA 5AW5B 3L7EB 3QCVL 3QG6B 4JDVB 1ADWA 2OSYA 4OFPA 4XNYH 1ZLSL 4DTGL 1S7XA 3SJVB 5C0CA 3OJMB 2AJ3B 2ZCHL 2YQBA 3O3AB 4FXKC 4Y4FB 5DHDA 3DXAD 1CDJA 3A23A 5GZNA 2F54A 3L45A 3CDFA 1NFIA 2HT3C 4XXCA 3OV6A 4RRPA 1Q9OA 2R2HA 4YXHL 1OGAA 1QBAA 4BHUA 1XH2A 3QXWA 1GOHA 3A3YB 4JY6A 4KJYB 4WTZG 5HI3D 1NMCB 4ZXBA 5CBAB 3UZVA 5CEZH 1M6OA 3L95A 1CFVL 1O7VA 3QZMA 1UEYA 4YXHH 3WBDA 4ZTPH 5HGHB 3OHXB 4FA6A 3C2AL 5KYYB 2BXZA 3KXFA 5IB4B 3UYRH 3ZKMD 3VXMA 4HUKB 5HYIA 1XF4A 2FT8A 2V9RA 3SBPA 3MRNB 4PV8A 3VWJB 3FN0H 2NZIA 2X4PB 2WP3T 5ENWB 3VXMD 1AD0A 3C2AH 3BJ91 4R96A 3DYOA 4U7KA 5FYKD 1M7XA 2B3RA 2BNUB 5DS1A 3WL9A 3L9RB 3FN0L 3QAQA 4MJHA 1Q9LB 4XPTL 4EE2A 3H4FA 2QKIC 2Y06L 3IMWA 3SY6A 3BT0A 4ALAC 3BSZA 5I6XB 1D3CA 1BFSA 4IIQA 4XNQB 1HYSD 3QA3B 1C1EH 4PV1C 1F4XH 3KJ4B 2XY1A 1JSYA 1KCBA 4HUXB 4NJAL 4DF9A 4QHMB 3QULA 2GKIA 4ZQKA 2PCPA 4R4FL 1EEZB 3ML8A 1OAKH 5GHWH 3TBSB 2DH2A 1M7DA 3IJ7A 3QUXB 1S9YA 4MJID 1NBZB 4LSSH 1MY5A 1JK8B 5HY9B 3UYOD 4AW7A 1IGYB 4GQ9H 3WY3A 3IJHB 4RMRA 3TM6A 4AG4H 5E8PA 2NMSA 4RX4D 2F5BH 3SJVD 2LVEA 1R3LA 4MX7A 2B9BA 4OLWH 3RVXD 1MG3C 2MWCA 2EDLA 3L3KB 2JJUA 1INQA 2D7NA 3QH3A 2R9HD 3ARFC 4K7FB 3PWNB 5K33A 3KWVA 4BZ2H 1A7PL 2AJZA 1WA1X 1FPTH 1RSFA 4LRIC 4ABVA 5JW4M 3MUY1 3T8VA 1BDYA 4HWEL 1MIMH 3MO1A 2Q6WA 4HQQL 3U82B 3ZLQC 4D7BA 1O75A 3OKOA 3ARED 1NAMA 4XP5L 4M6OH 4OZIE 1XSKA 4JJ5A 5CUSL 4TOYL 2HTLC 3F58L 4PRAB 5IWLC 4P46D 1WFUA 5ICXB 5A16B 4HWEH 2C9QA 4WJ5B 1TO4A 2XA3A 3GXFA 4ZOAA 1N6VA 4HJ0C 4HZLB 4BBWA 1SXZA 1K8IB 1ZHNB 4I0KA 1KN2L 4U6XB 1AD0B 1NC4B 1LM8V 3JXAA 5TTRA 4OKVB 4PJBE 2X2UA 1HSAB 4ATTA 3MRHA 4L0PB 4EI0A 1XF5A 1AHMA 1CT8A 1CDCA 3ZE0F 1U3NA 3HMWH 3A6BH 1M56B 1V7NH 1NLDH 2IANE 3OJVC 4DQOL 1NSNL 1I8MA 1KZQA 4HC1H 2WBJA 4N2KA 3GSVA 5T3ZD 3L5WB 4P5SA 1TFHA 3A0OA 1IX2A 4IIQB 5HHOE 1VKXB 3OPZH 1PTZA 4Z76B 3SCMB 1YMME 3WEOA 3T2OA 1JV5B 4JFQA 5BVPH 1NFAA 2DQHH 3D4GA 3Q7JA 5DD5H 5C09A 4BFGA 1WIPA 2D7OA 5LGYA 5I17B 2P47B 1D6VH 5L9DL 2IDUA 3AAZB 5IEHA 3E9UA 4M9OA 2K8QA 1G7MA 1HSBA 2WXKA 5GPRA 4UTBL 3MJGX 1Q4NX 3D85B 3K2KA 1BZEA 3PWLB 1WITA 3F04A 2YQGA 2GTZB 2GJJA 2FLBT 7PCYA 1KLUB 1KJ2B 4P9MH 2AF2A 4LIQL 2VISB 2VABB 1XL6A 4KI5F 4XX1E 3NDYE 3HG4A 5G4OA 2ZYRA 3LH9A 3BWUF 4JFEA 3AQDA 3DGGB 1Q72L 4CSSA 1IBGH 2IGFH 2R23B 1SYVA 3ARQA 2XIBA 5JZ7D 2YA2A 1BHGA 3FTYA 2NPLX 3LKPA 3QT2A 3QFGA 4J3OD 5EV7A 3RDJA 2BOCA 3NSDA 4TULL 1FFRA 4UIMA 2CUAA 2Y6SC 5DJ8A 5E1GA 3SOBH 2R2EB 2JJWA 4XNUH 1JVOA 1RUMH 3VXPB 2VN6A 2FEEI 4W9GC 2F61A 1PPIA 4AK2A 4NO2A 1I1YA 4O51A 4GKZB 4KZDH 3V4UH 2XHNA 3QXDA 3VWKC 1A7BA 4JGMA 3W37A 4R97B 1EANA 1TUPA 4OQTA 1MI5E 3DX1A 4AEEA 4LSPL 4FNQA 1QYGL 2VDNB 1G7LB 2E6QA 1I3RA 2WTPA 4G83A 1UD3A 4MXQC 3UTPD 2I9TB 3ZE0E 2X4OB 5CP3A 2PR9A 4E0RA 4J27A 3DHJA 2DQIL 4FFWC 5F70A 2XKNB 3DKHA 1RUPH 4H2AA 3QDMA 3TBCA 1MAJA 2E59A 1TJGH 4HS8H 4O58L 2X1PA 4POZD 3DOSA 4MB5A 3ZU8A 4LOUC 4RSYA 1KBGL 4ZUSB 5HGGS 4G1MB 5TDNB 3C6SA 4CC4A 5F88A 5AYTA 5EZJB 4JHWL 2L0DA 4JM2F 4OJFH 3D39E 3VQ1C 3WDIA 2EACA 2NZ9D 4QRPB 2OJ1A 1HSBB 1BMGA 5IVZB 1FFNB 4X5QA 3WIFA 3LOWA 2WBWB 1BG9A 4FNLH 3UROR 4OZFG 3SE4A 4YHIB 3RL2A 1X9UA 2AXFA 4JPVH 1BD2E 1MH5B 3I6KB 3U4AA 3ULVH 2A1WL 1Z7JA 4H25A 4KKBC 3I2CH 3VFTA 5C0EB 3CMOH 1K6QH 4L23A 2ILLA 1J9QA 3DX4A 3QEQB 4XWOC 4P4KA 4Z3EA 4MKMA 5DT1L 3I2CL 1CL7L 1YMHB 1RPKA 5ESQA 3P3UA 8PAZA 1XCWA 2NY2D 2L7QA 3LNFA 1FN4A 1ZVYA 2CZNA 4CC0A 4CW1B 2WGXA 4NUMA 2IPKA 1OSYA 3QE5A 4IRSC 4XGZA 3UYRL 4OZGB 1BBDL 5PCYA 5JIPA 1UUSA 3HVNA 3TJPA 2FO4B 1USQA 2IANA 3CDZA 4JFOA 4R5XA 3IMSA 2SODB 5D5MF 3L3OB 2HVKA 3QZNA 5EG6C 1L9PA 3V6OC 1S7WB 1FZKA 1A3ZA 4ZJ9A 1AFVH 3II1A 2C7FA 3T6ZA 3VUAA 3O3EA 2FEDD 4ZPVB 3UTPE 4YHZL 1NCBH 3OLIA 2D3NA 4C4UA 4FA8A 2JKIS 4LAQL 1M7IB 3D4YA 4M1GH 3ZKSD 3X13A 2J2ZA 3BHBB 5I1KH 1I1CA 3RWEB 4JG5A 3CUPB 2HUHA 2P5WA 1TVDA 3MLUL 2J8UF 4KJPC 4ONFH 4XVSL 1MHCA 4R7NB 4AVKA 1HAUA 2H6PB 1IEAA 4HCFA 4XMVA 2YS4A 3NJIA 2B16A 1SUJA 5EMYA 3Q3GA 1EAPA 2JXMB 1P6WA 1EZVY 3P77B 1TPXB 2HLAB 3GSNB 4LEOA 3QRLA 2QSCH 4YL9A 2PCPB 1ET8A 2UUDH 2Z34A 3RJOA 3B1TA 2PPEA 2WSDA 3ILQD 5CAYB 2IV8A 4KTEL 5BVJB 3VWJC 3B3IA 2EIBA 2QDWA 4TRPL 1NKRA 1TQTA 1CQKA 3PWVA 3CZFB 1KGUA 1F58L 1GGCL 2FO8A 3UTOA 1SEQH 4XP6L 5E24E 1HCFX 1MIML 2J72A 3WNMA 3KLHD 4EUPH 4F9LC 4L1HA 4DW2H 1Z1WA 2A74B 4EUPB 5MEQB 3D12B 3JTSA 3MPCA 5B1KA 4J3OF 3VFPB 4YDZA 4PJIF 2FWSA 5J7CC 4PY8J 4MDJB 3QR1A 4W9JC 5EOQH 1C8PA 4KWUA 3RVXC 1ORQB 2BRQA 5BRPA 3ABZA 4XVUC 2GIYA 3L3HB 3ZHDA 3BAIA 4ZX5A 4DVBA 2F8OA 5ES4B 5DJZB 5D7IF 3UTQB 3BUDA 4UMGA 4JVWA 1J88A 3Q5OA 1NH6A 4G1EA 4H8UA 5KVEH 1NLDL 3UO8B 4DQOH 4H8WC 3ZRSA 5JXED 3LKOB 4WUUA 3ZL2A 3K2UL 4JFFE 5B1CA 2ESVB 1QPXA 4P23C 2N3JA 3WN5A 1R75A 1F3RB 1FGVH 2IGTA 2WVSA 1N18A 3GSUA 1HYRC 5CJOL 1I8IB 1D6VL 2NW2A 4IKIA 4LPVA 4PJHB 1OIOA 5FA3B 3RWJA 2N59A 1IM3D 1T1ZA 4DGYL 2EVIA 2QMKA 4MRBA 4DPBX 2QADB 2VZUA 1TT6A 4MQSB 4ONHB 1MAMH 1PJ9A 2DI8A 3UJIH 5ALCL 5IKCA 1WVZA 4TSBH 1FRGL 4HETA 5DU7A 4R3SA 2WD0A 4RMQA 4ZMNA 1IGJB 4M5ZL 1KBWA 1AZRA 3BUYB 4N68A 1TEFA 4NS0A 1T03L 5AG9A 3GK8H 4YPJA 2XYBA 3MNWA 5MHSD 3CDGA 2BNQD 2FL5A 3RUGF 5I66A 3CFQA 3P9LB 3ZT7A 5FO8B 2WKGA 4JFVA 4I0PB 1OTUD 4KKCD 4PVMA 4N9GB 2PABA 3GK8L 3D85D 2VLRB 1EUUA 4NLAA 4AC4A 4EO5A 2IQAB 3QQ9C 3CC5A 1RZFL 1G9HA 4RMSA 3VTTA 2VDPB 3RI5F 1ZMYA 4QYOA 2BP8A 4BSVA 1MRDH 4AGPA 4BH8A 3MJ9A 2YHGA 3MGTB 3QG6A 2P5WD 4YE4L 3QIUC 3K6SA 3PAUA 1WC7A 2NY6C 4ECNA 5C86A 3QDAA 4OCMC 5F1OB 3V9EA 3PHAA 3OKLB 3DYMA 3SDYH 3EBIA 4RBPK 5C71A 3VYPA 1EZVX 2VM4A 5K9QG 2L7UA 1YECH 2FZ3A 3JUYA 3QJZA 2BCKB 3UJTL 4GT0A 4F33A 1KEGL 2YMXH 4M6NL 4NKMA 4Y19A 2NXZB 1OZUA 3U0PB 3AT9A 4UV4H 3VXOB 5TDPB 5IVXA 2IDFA 5GS2D 4UAOB 4K8RH 4PJ9A 3MUHL 5L7XH 1JDCA 4C4KT 3WAKA 3SBQA 2R2CA 2XWXA 4JQXA 1IBZA 4L0YA 3VSQA 1HK6A 2IALA 4UV4L 4L8CB 3RDTC 5AWNL 4GLRH 5FKAA 5D1ZI 5JMRA 1JIBA 2W9DL 4Z7WF 5EFIB 2DTSA 3B83A 3EJPA 1OF0A 3D3VA 3FAXA 3DTDA 1YA5A 5E8NB 5ALBL 5IKCB 3IJYB 3KGUA 3LKSB 1DBJH 1OAJA 2ZQKA 1HE8A 5IMKA 2V5RA 4V1DA 1UACH 2VLRE 4FNUA 4HKZB 4R83A 1WUZA 4KKAD 5BRQA 1RERA 2Z7YA 4W6YB 1NBYA 4KNTA 2ZX5A 4OD3L 4XOAA 5DD6B 2F5AH 5D1QA 4EZKA 5GZOA 2R1WA 2AMUA 3NSXA 4X6CB 3WO4B 1BM3H 2QADC 2YUWA 3E1ZA 5EBGA 4NZDA 5KBNC 1M9SA 2WO3B 4NQSA 1AVAA 3HRZB 2CBPA 4Y5VB 2PPCA 2BOBA 4O5LL 3ERXA 4HJJL 1HZKA 1N0XH 2W65A 3HN5A 4LSUH 3ECBA 5DJYB 4G7QB 3EJQA 1DVXA 4XC3H 4ZD3H 2ZTBA 5A2KH 1ZLEA 2W07B 5T3XD 4J1UA 5EIIG 4K5NA 4R4BA 1AI1H 2C3GA 3A4EA 3QJRB 4HWNA 4ZOBA 2OR8A 2XICA 2APXA 4Y7OC 3W82A 1NGQH 2JKNA 2RCSH 4XMTA 4IBZA 4GUCA 3UAEA 3ZL1A 4OLWL 2HFFB 4Y4FC 1NCUA 1G84A 5I30L 1P4LA 4M7LL 3SE4C 4A6YA 2APBA 5C0DB 5F3BA 1GW6A 3GUTA 1BVZA 1HC1A 1YUKB 2A7BA 2DQDL 3BP4A 1RL1A 4KH2A 1SMOA 2ZOKB 5DUBB 3EYQC 3BUBA 2OXHA 3D06A 3UZQB 4F7TA 5CCKH 1FZMB 4XBEH 3VH8A 5IB5A 5BW7A 3QZBA 4KJQD 2K9FB 1Z6JT 3ROLB 4MZ2A 4JMXA 2DQGL 3GI9H 2ZXBA 1ZTXH 4Y5VC 1HINH 3M07A 2Y5QA 5SX5H 4RBPH 5JNYA 3FH7A 2IPUG 3CAFA 2IBZX 2XWZA 4TUOB 4JHBA 1LE9A 5MEOA 3BN9D 3GJEB 1NGZB 2DQGH 3GI9L 5C0NC 1LO2H 1QBBA 4WW2C 2F74B 4WSKA 4JPIB 4V1DB 4MD5A 2XFXB 4NN5B 4OV6F 2Y5TA 1U8QA 3SDCB 5KANG 2UX6A 2CCVA 4DP6X 4G6FB 4N0UA 3K8MA 2YKKA 3CUPA 3FUIA 1KJMA 1I1AD 5CCHE 1ORSB 3B9KD 4HFUL 4OLYH 3T65A 1W15A 4FQXA 2ADGA 4ALAH 2OBGA 2WWOA 1UB6B 3QHZL 1WD9A 4HZ1A 4PRNA 4WGWB 4DPCX 4F91B 2I26N 2KPNA 4LEXH 5JPNB 1SFHA 1YHPA 4JRXA 1GPOH 3MLYH 4N8VB 3WJJC 1CWVA 4GUQA 2MCAA 4ZOEA 3BZEA 3BSZL 4POYA 3N0AA 2Q8AH 2HFEA 3K6DA 5EFIA 1XGTB 1V3JA 4M43L 2F8VA 2H2PC 1L7IH 2PNDA 1KELH 3EO9H 1NCCH 4FZEL 4UNVA 3C5ZC 3HMXA 2XJKA 3JVGC 3QQDB 4X4KA 2XXMB 5BS0B 32C2A 3EFOA 4X8JA 2NX5B 3WIIL 1A6PA 2IFFL 3OR6A 4TL4A 1L7IL 1UEMA 5KJ7E 1CGXA 3F05A 3FCSB 2O61B 4OI7A 2EZ0D 5T5NG 3V4PL 5IESL 3T2NL 3W38A 2LTQB 3WIIH 4GY4A 3LRSA 3KR3H 5IROA 1OT2A 5IMKB 2MQCA 2JI2A 4OCWH 3VXRA 4AL8H 2FB4H 2JJSC 3LHPH 1RUML 1FVEA 1DQIA 5CU5A 2CJUH 5BQ7B 3CFCH 1MELA 4MXWL 4ODWB 5E6ID 2FR4A 4BUGA 1JPSL 4DP2X 3O8XA 3HNSH 4A2GA 5I1CH 3OJDB 1OTTD 5EDXA 1AG0A 3UBXB 1MJ7H 3AU1B 1A9EB 3NCMA 1F2XK 1TZIA 4LOVA 1KF9B 3U2SB 1C9SA 3VFSA 3UBFA 5SX4I 1E2WA 3HNSL 3LKRB 4J8RA 4ICXA 1YNTA 3C5SB 4PWEA 1A6ZB 1WD8A 5JHLA 1KLFB 2NY4D 3B8SA 3LN4B 5D1QE 4L1SA 4NQVA 3MVSA 3UGUA 3D2UB 4GH7B 5B38A 3BH9B 5DZPA 1BAGA 3SJVA 1AXSB 1G9NL 4OGQC 5SWZB 3HRPA 2NW2B 4IDLA 4MCYB 4XAWH 3TNMB 1MFVA 4HV8B 3TJHD 5HI5C 2O5YH 3LS5L 3OZ9L 3MLVH 5GSVA 5BO0D 1M2OA 3FNKA 3QUMH 1UASA 4ADJA 5KVFL 3BE1H 1OD7A 5BZWB 2YLHA 1A21A 1DFXA 5I1DA 2WW8A 4U1SB 3MLVL 3HG1D 2F1AA 3L08A 1KB9K 1I4FB 4HT1L 3Q0HA 2X05A 4R8WH 3O11A 1CTNA 2BIHA 3FO1A 3P4OA 3TEZA 1PU0A 2FEJA 5IV2A 3GPSA 4JFFA 4KHTH 2A83A 2IH3B 3O9WC 1WC7B 4PRDB 2VL5A 3S0PA 2V8LA 1XD0A 4P46C 3LQMA 2XBZA 3ES6A 4UBDC 3RQ3A 2UXFA 1E4KC 1GHFH 2R51A 3HUJE 1JF1B 3EFDL 3VD7A 4XXDA 3G08B 4K3HA 4A38A 3D25A 2QQLL 4L2YA 1YEKH 4FQIH 3IDJB 4J3WA 3MMEA 1T04B 3MV8A 3CU7A 4U1IB 2GCYA 3HCVA 3NJXA 5IB1A 1NUNB 3FBQA 1ANUA 2Z6FA 2RR3A 4KJQC 1QRNB 2W94A 4XXWA 1BCIA 1RZJL 3JV4B 4PD4J 2HT2C 5ALBH 4ZXBD 1CXFA 2FTAA 4KKAC 1CYXA 1RIUH 3ZTCC 2H32B 5T3XL 1C5CL 2OMXB 3FU5A 3MODL 1MEXH 4U6XA 1IM9D 1BG1A 3GMNB 4GW5A 2ZWKA 1AS8A 3DVNA 5IEKB 3B9AA 4HMDA 4QHLB 1RK1A 2VQ1B 5HYSB 4N5UA 3U4BL 2LT9A 2ZOLB 3OAUH 4ETQB 1CD1A 5F0JB 5JUEH 1KLUA 1HHIB 1NEZB 5E8PB 4M1GL 4BRVA 1HDMB 1KGCD 2MJWA 5IY5B 4EDXA 1NA8A 1KB5A 3H42L 1PG7X 2OMVB 5GGVH 4JY4A 4HUWB 5MP6H 3VM5A 2YQ2A 4C54A 1PYWB 1GAFL 2FX8L 5CO1A 2FJSA 4N2MA 4BK4A 1K8IA 3BP7B 2MOVA 1VHPA 5FYJU 4FTDA 3GSNL 4X8CA 3ECBB 1FSKB 4LCUB 3GYRA 5LCVL 4OIFA 3MOAH 2XXCB 3DLQR 3PP4L 4YPGB 1EFXD 4JQIA 3IU4L 4G6AD 3T4AA 2IJ0C 2J1WA 2NR6D 3BPOB 2P43B 2ZF8A 5FV2A 5BMFL 5LDSA 1FNAA 4FQ2H 1QO3B 3FQRA 3VD1A 4XNDA 5DC0A 2IAMB 2ZAIA 4A2FA 4QRPE 5FK9B 5HI4D 4EKJA 4DPAX 4I0PD 2DQUL 1HX0A 1KYUA 1HILB 1MFDL 4P2OA 4YHYC 1XSIA 5FYJD 4G8GB 4FHKA 1JWSB 3WXWH 2VXQH 4TSCH 1WK0A 4Z7VB 3MLSL 5IFJB 3DJTA 4MNGA 3DV4B 2H0EA 1CGVA 2MNWA 2XETA 4BH7A 3O4OC 2G5UA 2I9LB 2J4WL 2UWEA 1CZ8L 2CLVB 5ERWA 1PLGH 2E9GA 2ZSWB 3Q5TA 3VQ2C 3S3BB 3RVVC 5GISL 2WXIA 2EDEA 1CBJA 2QQKH 2VMDA 3LV3A 4NB7A 3MN8A 5C9JA 4KC3B 4GI8A 3GBEA 4K0OA 2CKBA 4OUUB 1RFDH 1LEGB 3SOTA 1U8PB 4Y1AB 1TETH 2CIKA 2CGRH 3FO1B 2NQ3A 3K6OA 2VSCA 3WUWB 1GRWA 4BK5A 1TJMA 4LSTH 5MERA 3NZUA 3M7FB 3BWZA 4R2GD 3HI1A 3HN8A 5IHUH 5IGXL 2MNUA 5I6OA 1HFUA 2QPUA 4M43H 3M86A 3QQ9D 3P2TA 4KDTA 1E6JH 1E5UI 3IKCB 3J7HA 4DOHE 3AADB 1A3RL 4NKMB 4K5LA 1L7TL 4Y19B 4A66A 3PHOA 5DD0H 1HHHB 5BO1H 1W8NA 5IG7A 1JYWA 4YFLI 2GJ6A 2ATPA 4I85A 3HCVB 5BV7B 1EPFA 3SO5A 1F4AA 1E6JL 1RK1B 2ENYA 4LVOC 4P4KB 2E5EA 4UTAA 5DK2A 5I1HL 4ODSH 2VMFA 3T4YA 3NZ8A 3P0GB 5K39B 1ECYA 1XR9B 3LTVA 5KWYC 2OMUB 1JPTH 4UQBA 4UINH 4DP9X 1JHKH 2VW6A 3PDOB 5T1DH 1SF5A 4G8EA 3APFA 3I75B 3U30B 3BGAA 2Q7YA 3BJLA 4XCCH 3U4EB 3WOVA 3X14B 4BFRA 3MNVA 1XGRA 4UTBA 5KUMA 4DO4A 1CE1H 2Z31B 5CSBA 1UURA 1J1OH 1NFDA 1R17A 3R0MA 3RTQD 5CFHA 4QXWA 3FQ2A 2BVPB 2J5LC 1AANA 4AQEB 5K1JA 4JK0D 1A7NH 3K2IA 5FR3A 3P0YH 4K8RD 4PCSA 2IADA 3KJ6L 1IB5A 3DX7A 4BZ1H 1E4WL 1AS6A 4XO5A 2ATKA 2VDNH 3OXSB 1J87A 4GNKB 4CADA 2NSXA 3SQBB 4RZKA 4PUBH 2FWUA 1MVUA 4JO2L 3JYBA 1SFDA 3R8BB 1IE4A 3IFLH 3BXNB 4K3DL 4EN3D 3MLXL 3P0VL 5IHWA 3KYKL 4NO5B 1I9RL 3NIFF 1HL5A 1N5AB 5C0CB 5GSRA 4XMPL 4DVRL 2VC2B 4KH9A 4LF3A 2KBGA 4FQXD 4BQ9A 1EWHA 1YCSA 1UB5A 2DL2A 2UV3A 3L1GA 5AAPA 1FO0L 4FF9A 4ESKA 3U0TB 1Q8MA 3HNVH 3ZDZE 3VXUB 1NIFA 2YBRA 4GQPH 4MJ5B 3TO4A 2H6UA 5C09B 1J05A 4Z7QE 3BH9A 4R90H 1E4KA 1NIDA 1AG6A 2BINA 5B38G 3F84A 3T09A 4P46A 2B59A 1UXLA 4HJUA 5CJXA 4PW9A 5DR5L 3AREA 5EZOL 1XTLA 4G8IB 3FS9A 4OD3H 2QVIA 3PABA 3AITA 3GTVA 4GG8B 2NXYD 1JG9A 4RLDA 1S7VA 3C87A 1JUFA 3P40A 5ESAA 5C08B 1OLLA 2VABA 3FXIC 4UT7L 5IF0A 1N6UA 3BUTA 1QSEA 9PCYA 3GJEA 5EZOH 2XA8L 1LWHA 2NR6A 1F3JB 2HT3D 3DIVA 4NRZA 1P1ZB 5HI4C 3PAZA 4LPCA 1ZHBB 3VA2C 4PJ8C 1LQBC 1IAII 4LASL 4AJ0A 3EGSA 3OWEA 5DWUH 3THMH 3BEVB 4RX4A 4YSAA 1HEZB 1K3IA 3H54A 5IT2L 4WV1B 1EAPB 2JXMA 2YRBA 4IRSB 1JYVA 2XV2A 3SDXE 1DLFL 2AQ2A 5HPMB 1MVFA 3FO0L 5BZZA 3HNTL 1X5AA 2WWKT 4WY7L 3REWB 2RCSL 5E4EB 2XPGB 3MZGB 3TA3C 2A9AA 4HF5L 5I73B 1JDAA 4PJCA 2VSMB 5B8CC 3QNXB 4BSJA 1AGFA 2XVKA 3DJ9A 4DOHB 3FO0H 3OKKB 2HJKB 2VZTA 2BSSB 3ZDWA 3EH5B 3TA3A 1NUDA 1BF5A 3MUJA 1L0YA 3M17A 3U48A 4BZ2A 3H0TA 2J73A 2DMGA 4M8VA 2WNGA 2LU4A 1U2YA 3O9WA 3ULUE 3QNZB 3L5XL 4FQLH 1KB9J 3ETBF 1ASOA 2MKLC 2BVTA 2VC2H 3QO1B 4ADIA 1NAMH 2FECI 4R0LA 3IWVA 2HFGL 3RY5A 1WHPA 1JGVH 4NKIL 1ZHLA 3MV9A 5DEFB 2ODIA 5FB8A 1M7DB 1OAYL 4RGND 4HIPA 3ZKNC 3OF6A 1KC5L 1INEH 2GSMB 3FSOA 1GYAA 1PX4A 1IQDB 3APMA 3C60A 3IF1B 1OSPL 2LVCA 1F86A 2Z35B 5IVNA 1YC8A 4FXLA 1MHEA 5CIPB 4ZFOA 1F0LA 1INEL 3GO1L 1XGPB 4JG1H 4LL9A 1VGKB 3MYJA 4FQ2L 4OFVA 2G4EA 4LDOB 4A04A 1IM9B 4N6QA 5C08A 4U33A 3UG3A 2KQNA 1I7ZA 3FRPA 2DQUH 5EZPA 1VFOA 3O3DA 2HLFD 2DBLH 3H9YA 3U1QA 4ODXA 4U4IA 4JLRB 1CFMA 2H1PH 3QUMA 4P5KB 5JPMA 2CDGB 2D0HA 3QYCA 2WVVB 2J21A 3MR9A 3QEGH 1ITBB 4XCYB 2XOTA 3ARPA 3OAWA 4U6VL 4PGJA 5IMMA 3RFZC 1EEZA 3ZRCC 2Q8AL 3AM8C 3D33A 1Z5HA 2V33A 3EOTL 3L3JA 3L6FA 4PB0H 5ACMA 2VR7A 3LNGA 3V6OA 3OKNA 5FA4A 1E67A 3B34A 4FZEH 2PYFB 1AC0A 2G3XA 1DBBH 1H3PH 3ULUH 1JXDA 4YHLL 3RJDA 2PW1B 5EU6B 2X2IA 3WLBA 4WKZB 4BGDA 4BQ8A 1H3VA 3QIBC 3ZMNA 1A14L 4GMSL 3DK2A 4KMTL 4RESB 4XB3A 4J3TA 4BFOA 1LP9F 5F8QC 5CGYC 4Z7UA 2BP0B 2Y36L 4URKA 2H2SD 4I1RA 3UGXA 1S5HB 3DTXB 4WO4D 5C0GA 3UO1L 5BVPL 5IVXB 4CN6A 4XOBA 4Y1TA 3EYVA 5ALCH 4Q6KA 2W81C 3TJHC 3PLYA 4YO0B 1I9IL 4E41E 5I1DB 4AI7A 3GJFA 2W92A 4UM9A 4XTRD 4OQTH 1XEUA 4XTRC 1P1ZA 3ZDYB 1FL6B 1JHLH 3D08A 3LRMA 2Z64C 1YEJH 1URZA 4CMMB 5GRJL 5L2KA 5L4JA 3RA7L 3SDXB 4LFHG 4CKVX 5GS0C 1YYMH 3J27A 3ESVF 3QYNA 5DZ9A 1SY6A 3BIKA 3UBHA 2GC4C 5B1AB 1JRHI 3ARXA 2AEQL 1P6AB 3OZLA 4IU2B 3F7QA 4XE5B 1BM7A 2R1YB 5BS0E 5E0QA 2P5EA 2FQGA 1ES0B 2VN7A 1ZE3C 5FDYA 5GGRB 3LH2L 4QY8A 5EEVA 2X4NB 4NIYE 2OXGA 2AEQH 4QRUB 3CSBA 3PHOB 1AIFA 1LK3L 5AOLA 1MZZA 4JZJA 1QTSA 4Z7NE 1F4HA 2OZ4H 2A6DA 4LP5A 1QHPA 2EDXA 5C08E 4E0RB 3TP4A 1AZBA 2YD7A 4HT1H 4U6TA 5TFSL 4LHUD 3KWUA 1MFMA 4NYLB 3X2QB 3ZJAA 2P24A 3OMNB 5F9JA 3O11B 2HRPH 1G7QA 3G6JE 4XB8A 4NQTA 3KPRE 3RHWK 1W80A 2OFQA 3AS2A 4D9QE 2ZPKH 4N1HB 1D5ZA 2OQJB 3GEWB 5KSUA 3HHMA 5DJZA 1L6PA 1TPXC 1ZE3H 1U8JB 5DZOA 5T1KB 5DURB 2Z31A 3H3PH 3V2AR 4RA3A 4MJIB 4GYBA 4FNRA 3TIEA 5I71B 3ORJA 1H6EA 2WUBL 3BKJH 4TXVB 4UZGA 3TYGL 1I1FA 4X4YA 3F01A 3WEXB 4EJ1C 2WVVA 4NRYA 4YDVA 2XIIA 3B9KC 3PGFL 2N7SA 2WLMA 1UG9A 2NY3B 3MTRA 4KGLA 4X4MA 2V7HB 5AALA 1FVCB 3U1SL 1WQVT 3ALPA 3L4YA 5H2BB 1K8DB 3NIFB 1K6QL 2ERJC 3CHXA 4RGNC 5DJ6A 5F7BA 2A9NL 4YWGH 2UWEE 1OF2A 3HHRB 4M61A 4EVNB 3T1WA 4PMEA 3KL3A 4XCYA 5DK0B 2VAAA 2CH8A 1U8IB 4KO6A 1BZ9A 1T6BX 3CFDA 5DMKB 3OG4B 1CL7H 1EAJA 4KKLD 3RZCD 2GPZA 1ZHNA 1FFTB 2OAAA 4HJJH 1WA0X 4R5VA 4I89A 2P5WE 2X1WL 4OCRL 4WFFE 3SDDC 2UY7A 2JQZA 3MRMA 3NFPB 3QDME 2Q0ZX 4TUJA 3Q5YA 4GRLD 1WJ3A 5F3HA 2AABH 1ZT4A 3IXAA 4U05A 2JKJA 5AOJA 3CVCA 4OCRH 1OP5K 1IC4L 4QD2E 1UATA 4I3RL 3LPPA 3DRTA 4XN2A 4WUUE 1FE8H 3ZIYA 5F1NA 1NBZA 1MCCA 4Z95H 3NP3A 5EZLB 1U93A 3HNTH 5IBUG 5IJVB 2UXVA 5CSZA 4G11A 3JWNH 1DQJB 2QHLA 2WXHA 4LHQB 2AXGA 3S2AA 3GM0A 5F6IC 2RH0A 3DA0A 3O3EB 2A38A 1GGYA 5LKNA 3APNA 3REVB 2JKLA 3D9AH 1GMEA 5D7JD 1EO7A 2H3NB 3HZVB 5T1LB 1QFWM 3NA9L 1JWMA 2RA1A 3KCPB 3U7AA 1T0NA 1QSED 2VZOA 3MRFB 5CWSB 3J2PA 1XF5B 4M7JL 1SXCA 4PB9H 1NEZG 2EH8H 2P8MB 3FT2A 4XP5H 4P5TD 3F58H 3K91A 3FO9B 1MCJA 3NRPA 2QQQA 2ARWA 4B3VA 4QXUL 1QW9A 2XPGA 1V3LA 1MCQA 5I1IH 5IUCA 1MLCB 3K5RA 2DLIA 5DJ6B 2JLLA 2OK0L 4FN0A 1PIFA 2R2BB 3MV7B 3HUJB 1KBKA 1IAOA 3QZWG 4NP4H 5C07B 4ZNCD 1IGCH 3OPUA 3QXUA 3UTTD 5FOBB 1Y1DA 1BZOA 2D7MA 2VDRL 4NC2B 4KRNA 1N8ZB 1DL7H 4K9EL 4GSQA 1UM4H 4X5WB 2OL3H 4OVUA 2EUWA 1YEFL 5I8KL 4IBWA 1EDQA 3GDCA 4TMPA 3UBXI 2J6EH 2WZ5A 5IQOA 3CHPA 4B60A 4B9KC 1JFHA 5E70A 4L3EA 1KV3A 3UC2A 2D31A 1OCZB 4R7NA 5A7EA 3MA7B 4XH2B 4GRLC 2RGSA 4LCCB 5IZ7A 1JF1A 2CUIA 5GS0D 2WV3A 4F15B 4GRWH 4KK9C 3BKML 1H6FA 1DBBL 2ZXGA 2NYKA 5CSZB 4FTVE 1Q1JH 2X5PA 2ZG1A 5FYKE 2VO8A 2PETA 5DF0A 2FSEB 4DK5A 1ZKAA 1RZGB 1U3HC 2JK5B 2GJ6E 1C5DA 4AT6A 4ERSL 3MLTB 3UTSB 5C1MB 1I85C 3R1GH 3SB3A 3L1OL 4A39A 2J55A 5FO9A 1AXSA 5IQ9B 4HVBA 2M83A 4OAWB 5J12B 2D7QA 3HPLB 2CO6A 4ORGA 5CJOH 5TF0A 4PRPE 2F7RA 1ZV9A 2NDFA 3DVNB 1JGLL 4LRNH 5L2JA 3L7EA 1VPOL 2O6PA 1URIA 1FGNL 4XP4L 5JIDA 2AK4E 3SPCA 4V1DE 4EI6B 5EC2B 3RAJH 3C09B 2Y7OA 5C0FA 4X6CE 3ZSTA 1A8ZA 5JA8B 1JZFA 1NKGA 5CINH 1UXWB 5H37H 3S5LG 1AQKL 4YSEA 3NUKA 2QR0A 4LKCA 5IBLD 4GQRA 5DJ2A 4XNAA 3BEWB 4ZSOE 4MBOA 1BVOA 4UT6A 4L29A 1J1XH 4HHGA 4CVWA 3QUYD 4BKTC 2X2YA 3RFZA 5TK2A 3NAAL 1JZHA 4OTXH 4IBTA 1I82A 5I8CA 3NFSH 4NWUL 3JTTA 4J23A 3S8FB 1RULL 1J0ZA 4GAYB 4OSUL 5DGRA 3TBYB 1BQSA 5KVDL 3I6KA 3CFTA 2P5EE 3DOIA 4NQXA 3X1NA 1VIWA 1NCTA 2WOBA 3RPIA 3RTQB 3ZDYF 3EXJA 5E99H 4BUQA 4LLDA 2G2RB 3NEOA 1KCRH 2YO3A 4NM8H 4OJAA 4MAUL 4P3WA 3QJFA 1U4EA 4HJSA 5DO8A 5GJTL 3ZKXC 5C0AD 1INDL 3SY0A 3WKPA 5HVFB 1HJBC 4P2QB 1WSST 4EBQL 4WO4B 3CPLB 2H1XA 1RPQA 1UJ3C 4GBXC 3ARBA 4UOW0 3BFQG 3MJ9H 3HR5B 4F2MA 2E9IA 3ABGA 1OSEA 2CDEA 1KACB 4LE8A 4RDQF 4HIQA 4IOSD 3FU7B 4L4TE 3IXTA 4Y5YB 1LO5A 3UAJD 3IU3A 5EA0H 3B2PA 2XY2A 3BPCB 4M93C 4NQED 7CGTA 5F7LB 5E1QA 1N64H 1S3KH 4IK7A 1SDDA 1UB6A 1AKJB 4WUKL 5F8RC 3ZL4H 3QP3A 3ULSB 3FZUC 2E7BA 1N8ZA 3S2CA 3DO3A 4C56E 1NDGA 2Y07L 4I9WD 4Y5XC 3UJJL 3FQYA 1F11B 2Y7MA 3GF8A 5I75C 1J10A 2AJVH 2C9XA 4A2EA 1TCMA 1RIUL 3HI5L 2FT6A 4GW1B 5D9SB 2NY7L 4QRQA 5EORL 2V9UA 1F6FB 4XNZC 5KSVB 3EDEA 4P3CH 2VWEE 1GIGH 2P8PA 3IGKA 1NCIA 5KYNA 1QR1A 2AJVL 5CZXC 4QWWC 2HG0A 3VD2A 4JR9H 4Z3TA 4JVUA 3QORD 5EORH 4JO8A 1E4XH 2C8NA 4OIAA 4FLSA 1G0DA 3CZJA 4FXTA 2VDLL 4P3DB 1TNNA 2ZKHH 1INQB 1Z9OA 2FJUB 3DROB 3BAEH 5A16A 3K8LA 2PWHA 4PVNA 4OIIH 5J1TC 1OP5H 3ARYA 1WBYA 2VOTA 3QUYB 4H7VA 1N19A 1BM3L 4YN3A 4LT7A 1P7HL 5E94B 3C5JA 3MKGA 2IMNA 1PLBA 1U9KA 1CQYA 3UTSE 4RFOH 2WMPB 5I76A 1GR7A 3GMQA 3O4LA 2HLFC 4LVHC 4PGCA 3US0A 2RJMA 3P2BA 1E7VA 4D9RD 2MOQA 1AI1L 4NQCB 3UYPB 2E0PA 1I8KA 4MCMA 4TQEH 3CC1A 4R7DA 1VFAB 2VDOB 3CFJA 4H5SB 4KROC 2QTEA 1LD9A 3B56A 2DQMA 2WLYA 3TT1L 1KXQE 3LZOA 4H26A 4WI9A 4GXUM 2DYPB 3W9DB 3MA9L 4GAAA 3GBDA 1JTOA 3GLZA 4CGUB 3IBOA 3NZSA 1HCYA 4G9FE 2X40A 4MXVE 5I0VA 1AO7B 2CWRA 1IUZA 4XBMA 5D70H 3MA9H 3VO0A 3WIHA 3N40F 4A6YH 1ULVA 4FQXC 1DN0A 1LE5A 4AL8C 4PAZA 1YYCA 1QBML 1BBJA 3ARGC 1CE6B 4LBEA 4P4KD 4GG6B 1JE6A 3WS3B 1SF3A 1WLHA 4Z7QB 3TXAA 1EIBA 3AG3B 4MMXA 3Q05A 4RFEB 2ZUXA 4IIQC 4YDKH 4WF7A 5J13B 3WUWG 5JNYB 3EOTH 2EE2A 3BAKA 2HT4D 4X7TB 1XF3A 4R4NC 3GI8H 4CILA 4E9QA 1SDYA 1UWFA 1XF4B 4JPKH 4UILL 1BZDA 1RUQL 3CG8A 5BXFA 3FF7A 3QJOA 3DO7B 2XWRA 3BPCA 5FLUA 4HFUH 1FAIH 3EYUH 5MENB 3C6LA 1IGMH 3QUGA 4JPKL 3KLLA 5IHUL 1XH3A 4V2CB 5C0DA 3HC3H 3ZE0B 2C7UA 4QPEA 1Z5LB 2CKBL 5DC9B 3T0DA 2A4CA 2B1OA 2FZ3B 5E2WH 3WG7B 1D6EA 1KDJA 4HD5A 5IW6A 2KHAA 3HE7D 3HZKB 2ZXDA 4HAFA 3RX9A 3VI3A 1I9IH 2NXYC 1SJEA 2C3VB 4TNVK 5C2BL 2WCPA 1DE4B 4M00A 1EEYA 3NCWA 1X9RA 4X8XA 5D7LD 2I9TA 1UGKA 3MROB 4NJ9L 3P11L 4NQCD 1A5FL 2FBJH 4G1MA 2BNRE 2QKIB 4ODSL 1CLVA 1YYLL 2X12A 4HLEA 3NGBB 5JLZA 1BQHA 2EDHA 3TWCL 1T03H 4BFIA 3T4AC 4EDWL 1ZXQA 3T0EE 1W9XA 4XBGB 2BIIA 4I7ZC 4QKTA 4AKQA 4YDVB 5C07D 3BIKB 3QXTA 5EHFA 5AAMC 4N3UA 3CZSA 1TLKA 3V4PB 4AM0A 1DEEA 1VPOH 1KGYE 3KEDA 1AZCA 4LSPH 3D69B 2IH8A 4EIGB 2VXTL 4FGMA 4OCXH 5IVZA 2COQA 5CINL 4FRWA 1QATA 4C57C 1M42A 3BAWA 4MBRA 5CGYD 3MLZL 4LO9A 3V9FA 3HHSB 3VFTB 5L8LB 4ONGL 4GOSA 3U7WH 4M02A 5I5RA 1UXWA 1TSRA 4RIRB 3AC0A 4G7YL 3SDCC 1IGJA 2E7DA 1D5BA 4ELME 3M1CA 2RHEA 2KYIA 2HJFA 4QHKJ 1DVZA 2RIKA 4JRXD 4MHHG 4G3YL 3VFNB 2CHWA 1FO0H 4J3OG 3B2VH 2D8KA 5F89B 2DM4A 3BE1L 4GBXA 1R5VA 4PJXF 3BVVA 4UQCA 1VKXA 5TD4A 2X1XR 2AGJL 1T1WB 2EUVA 2J8HA 5AW4B 2EYRB 1WISA 5DVPA 4G42B 4P59H 1R3IH 1CGWA 1XGQB 4NQXB 1MI5A 2C3WA 4LSDA 1GYCA 4LCYB 3Q8AA 3HIZA 1AJ7H 1DCLA 2AGJH 2H3XC 4KRLB 3LVTA 1XGUB 4L1TA 5DR5H 3UBXA 3NBNA 2R56H 5I74C 4Z7VE 1GGTA 3K4ZA 1FO0A 2CDGA 5BUPA 4B9IA 3RRQA 5CLYA 2BOCB 5I82A 2CR3A 3BWSA 4KROD 1N64L 4HXBH 4RRPM 3GMMA 3EHBC 3PQYA 2A3TA 2P28B 5CEXA 1GHFL 3OKNB 4JFEB 5FA4B 1KXVC 4HHAB 5D6DA 4QXGL 4Y4KC 4I77H 5IG7B 3E3QC 3MZTA 1DVSA 1XH0A 3PY9A 4MZIA 4PS3A 2V4LA 4PHXA 4CDGC 4UIMB 3QS3A 4JL1A 1BFVL 4DEPB 4N0UB 1DLFH 5DK2B 1PZ5B 3HZKA 1TQBB 4LSUL 5DJDB 2WXNA 4CC4C 2O5XH 1OARL 2P42B 1ZGLA 3ABMB 5EF0A 4I48B 5ESVB 1T20B 4MB4A 3QQXA 5I19L 2PPDA 1FLTX 2WYHA 1R4XA 4JM4L 1DJSA 3STLA 1XZWA 5CF3A 1WDAA 43C9B 1MCLA 3QFDA 2HPOA 1JXKA 4F2ME 3BWAA 5I1KL 4QGYA 5EU5B 2W88A 3QUXA 3RVVD 4DSYA 2OSLB 3QQDA 3C2SA 3EJSA 2XUWA 5B39A 5DMIL 3V6FB 4LHUB 1UQSA 3AQYA 3F65A 3EADA 2O72A 5FCSH 2R15A 4QKXB 4JO3L 4Q89A 3MRGA 4M7JH 4PB9L 5JO5B 3TT3H 5E4IA 4E9RA 2ZCLH 3C8KA 4Y5XB 4I1NB 3BWUC 3WFDL 1HAWA 3AW5A 4QRBA 1F5WA 4Y5VA 5E03A 3OZKA 1R24B 4ELKB 5I8OH 1X4ZA 2OMVA 3TU6A 3R8QA 4WTQA 4Z3IA 2XWEA 3JV5A 4TRPH 6FABL 1DDTA 5F7FA 4HOMA 1J18A 1AGDB 1OTTC 4XAKD 4I5BA 1J7VR 3N1QC 5E8EB 3V0WH 1X5LA 4BWWA 4FKEA 2YRLA 3DUUA 2X4PA 5ENWA 3JZ7A 3L4CA 5BZDA 4PP1D 4U1KA 5DZNA 2C1PA 4BZ2L 4NO0A 2J1YA 2X4QB 1E42A 1H5BC 3PJSB 1TCRA 4OZFB 3ZXAC 1G7IB 1OGAD 4FMVA 2W0PA 4JN2A 1FFOB 3HAEG 2I60L 2B59B 5HDOA 3V52L 3WXWL 4ZTOL 1JOIA 3HPJA 1J12A 2YD2A 2ZG2A 3SSGA 3T2QA 1NCAL 3KS0H 4BEIA 4HIXH 2AQ3A 4JGUA 5DTFA 2J4WH 5KYXA 1V55B 3RY6C 1U3ZA 3B9VA 1A7OL 4KUCF 4GRMA 3GUFA 1A6AB 4M6AA 4ANWA 5IQNA 2ZOOA 3SPJA 2YEZB 3H9SE 1REIA 2HCZX 1U6AH 5T3ZE 4ANKA 2OR7A 1SLVA 1ASQA 2KLTA 4O2CA 5IBLC 2DMKA 3FHAA 4CN4A 3T0XA 3FT9A 5HDLA 2KQMA 4L3CA 2YWYA 3LEVH 3R1GL 4I3SL 4IHBA 4OT1H 1J9SA 3V0VA 1RD6A 4P9HL 2CKBH 4U1GC 4YH6A 4PBDA 4BFNA 2OCJA 4FI8A 3MQIA 4NO3A 3HR5A 1RZKC 5EWIH 1CVSC 2NNXA 5K9OA 1ETZB 5DRXA 3H7BB 5B38B 1YNKH 4HHAA 1OHZA 4FJYA 1PY9A 1XGYH 4I87A 4N28A 3QARA 2D73A 3BLBA 1ZSDA 4NCDA 1JNLH 5HHMB 4EI5A 5CZRA 3MDJA 4CVXB 3BEWA 4XT1C 3VFSB 1Q72H 4WKXA 5FO7A 3NPZB 2R29A 5TF1L 1M7UA 2WLLA 1VESA 2Y7QB 1S7SB 1CR9L 4KK9D 1TZ8A 1H3UA 5TDOB 2B2XL 1NC2A 2CR6A 4YSDA 4QRQB 5HYQA 3S3CB 2XWJB 1JNNL 1RULH 4OSUH 1WBXB 3RWCB 3VE0A 1JZ7A 1P2CB 1LK3H 2HJLB 4ZMYA 1ZLVK 4B0MM 4Q0XH 2K3HA 1DJZA 2YSSA 5CHNB 4BE6A 2DH3A 4F93B 4DWHA 4Y4FD 4YZFE 4UYPA 3GBML 3K80A 3TJEL 3MROA 5DEGB 1KMGA 4FP8H 3B6SA 1H6TA 2XWBA 5BCAA 2XKNA 1OL0A 1U8JA 4YXKL 2Z65C 4G7RB 4ZODA 4HPHA 1OALA 1U95A 1YMMB 3GMRB