1BYNA

Solution structure of the calcium-bound first c2-domain of synaptotagmin i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords PROTEIN (SYNAPTOTAGMIN I)
publication title Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?
pubmed doi rcsb
source organism Rattus norvegicus
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1998-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bynA00
1UGKA 2K4AA 3IM1A 3LJ3A 3F01A 1W15A 3ML8A 4NPKA 1TJMA 3NSJA 1E90A 3F00A 4WAFA 2WXGA 2UZPA 4OVVA 5CCGE 4KITB 2Q0ZX 3CSFA 3L4CA 2WXIA 3L16A 4FJYA 1DJYA 4KZ0A 3SD5A 4JPSA 1E7UA 3ML9A 2EP6A 2YOAA 4NPJA 3FDWA 3OHMB 4GB9A 3ZW3A 4BGDA 3F05A 4F92B 4G11A 2B3RA 4FLHA 2FK9A 4A55A 4QJ5B 4MJJA 2WXOA 2DMHA 3S2AA 3HN8A 4URKA 1GMIA 2KI6A 1DJWA 2LHAA 2WXPA 2WXNA 2ENPA 2CM5A 3PS6A 1DJHA 4XE0A 2A4ZA 2A5UA 4F1SA 1RH8A 4LT7A 2Z0UA 3MJWA 4Y1SA 1E8XA 1BCIA 2V4LA 2WXQA 2NSQA 2Q3XA 3N5AA 3B7YA 3RPBA 3KWUA 4ANVA 4WWPA 2NCEA 2NQ3A 4L1BA 2ISDA 1E8WA 3OAWA 4BFRA 5EDSA 2CM6A 1RLWA 2K45A 1QASA 2QZ5A 4FJZA 4ANWA 4J6IA 2Y3AA 2WXMA 2CJTA 3GPEA 2CHZA 4L2YA 4EZKA 4PS3A 1HE8A 3L13A 3APDA 3QARA 3QR1A 2ENQA 3KWTA 4F93B 1DQVA 4GNKB 4WWNA 3L54A 3QR0A 5JHBA 3DPDA 5JHAA 3IBEA 2D8KA 3QJZA 4PS8A 4Y1TA 2QZQA 4L23A 4XX5A 1DJIA 2K8MA 4FULA 2RD0A 1V27A 4ANUA 3FBKA 5CCHE 2JQZA 3CSTA 1W16A 5G55A 3ZIMA 1E7VA 3TWYA 2CHWA 4V11A 4LCVA 3PYCA 4ANXA 3P2BA 3ENEA 3PFQA 3L08A 2WXLA 1QATA 3R7RA 4IHBA 4EZJA 2ZKMX 4XZ4A 1K5WA 4KZCA 3PREA 1DJZA 4FADA 3R7QA 1BDYA 3APCA 4AJWA 2K3HA 2CHXA 1WFMA 2X38A 3APFA 4ICXA 5T8IA 3W57A 1DSYA 1A25A 4WEEA 4FA6A 1E8ZA 4OVUA 4F91B 4TUUA 4HVBA 1BYNA 4QJ3B 1DJGA 3L9BA 1CJYA 2N1TE 1UOVA 3DBSA 1WFJA 2FJUB 4QJ4B 4L1LA 2WXKA 3QAQA 4FHKA 2YRBA 2WXHA 5H4YA 5CCJA 1TJXA 4NP9A 1YRKA 4TS6A 2R83A 2ENJA 3ZVVA 4AOFA 5G2NA 4PS7A 5KJ7E 3RDJA 4HLEA 4TV3A 2WXFA 3NZUA 2BWQA 4FHJA 3W56A 4EZLA 3PRZA 4ICWA 2WXRA 4WWOA 1E8YA 3M7FB 3TJPA 3QK0A 3JZYA 4QAMB 1RSYA 3F04A 4IQHA 2DMGA 4LDCA 3TL5A 3HHMA 3T8MA 4DNLA 1DJXA 5H4ZA 1UOWA 2WXJA 3HIZA 4NS0A 3NZSA 2CJSA 4DK5A 3L17A 2CHDA
chains in the Genus database with same CATH superfamily
3WUZA 2C1OA 3HUJE 1PZBA 4NPYA 4YHLH 4ZJ9A 4LSQH 4ZNCD 2VZ1A 2PW2A 4KMQA 1E7UA 2PTVA 1YHPA 3FCSB 4L3CB 3VXPA 3MN8A 5FOBB 2A73B 1KYUA 5HDBF 2X2IA 3MRPB 2XN9A 3I9PA 4H2CA 5BS0E 3VFOB 3GT6A 4JHAL 1OE3A 3HE6C 3DUUB 3QG7H 2FSDA 5E51A 2YGVA 3FO9A 3BC9A 5C07B 5IR1A 1MREH 2OJ1A 5HGBA 2VAAB 4XHJC 4ZSOA 4Y1SA 4TPRH 3GLAA 4ZMWA 2Z31C 4LSPH 4HUNB 1MDAA 1OM3H 1UB5B 2VNCA 3DHPA 4FP8L 1FLRL 4WFHD 2VZOA 2SODB 4GOSA 3ZTNL 3SBPA 2ZP9A 3I6SA 2WWNA 2L4OA 3QRFM 2ZWLT 1ZT1B 3QEQB 3TGXA 3L3HB 4I89A 4XNYH 1K72A 2CG9X 2P4AB 1CBVL 1RZJL 2WZPD 5IOKA 1UH4A 4JFFD 4YHIA 4F8LA 1BVNP 3AU0A 3PXHA 4NKDB 4YXLH 4IRSD 3LKNA 1AVAA 3O4LE 3QUMB 1V3KA 2FYVA 2C3GA 5IQOA 4HUXA 1IVTA 4KTYA 2BP8B 1NM9A 2AKRB 4JRYE 5CS7A 1I53A 4GUPB 4UNVA 3AUWB 3N1PC 1KLUB 4BQ6A 3DKHA 1F3DH 2XV0A 2Y07L 3BEWB 3D5OF 1MFVA 3VXRA 3F7VB 1EAOA 2IH3A 3H2WA 4A2HA 2YRLA 1KJ3H 1QHOA 5TE7L 5AOJA 3GSUA 5KS9A 1BF5A 4PJ7B 2B2XL 4P59L 5DRZA 4R4FL 3K4AA 1QLEH 3ARBA 3CCHB 3AS3A 4E5XA 2W65B 4U1IB 5SV4A 1JFQH 1TO5A 5SX5H 1MFAL 3ILDA 3QNFA 2Z92B 4ZXBD 1R33A 4YBQD 3T3MF 3UO8B 2R83A 3EDDA 2VLMD 1TSRA 4L37B 4X9HA 3X3GL 5CLYA 1XB3A 3AWFA 1LTXA 1GOFA 3V4PH 1FA4A 4JEGB 3UCQA 1HL4A 2WNXA 5IBLC 2CE6A 3MA9H 3BDYL 4X6FA 5AVSB 4H20L 3O3BB 4Y5XC 2QMKA 2IDFA 3CDGA 3IFLH 2VDNB 5DVMA 4M03A 5FV2A 2I9LB 5GSVB 3UAEA 1OCRB 4ZMXA 4NUGL 5E6ZA 3ZX1A 5B1KA 4MJ5A 5IB1A 1OPOA 1O6SB 1ZHNB 1HAWA 4KZ0A 25C8H 3KPSE 2P80D 1Z3GH 3IDYC 4N0UE 4YDKH 4BSVA 1AIZA 2XLLA 4WW2A 1CFVH 2BVPA 2H1PH 5TDOB 3EJQA 4PI2A 1V55B 3QI9A 1KELL 5E8DL 4PVLA 3ABMB 1JZFA 4GKSA 5DK3A 5IW3A 4D8OA 1DQDH 2OBGA 1BECA 1BGXL 2ZUYA 4LPYA 1NIFA 3PGDB 3ZYOA 1DQJB 1QSZA 3CVHB 5I1GL 5DEGA 3MUGB 5GGSB 2B9BA 3CWGA 5E08L 3L3DB 1X4ZA 4AQAB 4PWIA 1ZK9A 4XPGH 2HAZA 3UJTL 1IB5A 4X4ME 1J8KA 2DDQH 2ICWB 3BGMA 3UG3A 3P73A 5A3IC 4EZKA 5C0IB 3TA3C 5KWYC 2NYYC 3IN2A 4KKBC 3BGAA 2J2ZB 3VFPB 4P2YA 4WUUE 3F65A 2JELL 4FQ1H 4X99B 3VFVB 5DHYA 1XF5B 3ETTA 2X42A 4XZUB 5FGCE 2BZ7A 5MI0B 2IEPA 3DX9B 3P0VH 5BMFL 4R9HA 2YEZB 5HJGA 3ME0A 4YDNA 3CH1B 5IQ9B 3NEXA 4N86A 2FB4L 1QRNA 5ENWA 4FDWA 3CTTA 4GI8A 4LRIC 5I74C 2QGDA 2OSXA 4DP4X 2G4EA 3BHBA 4WUKL 4DP6X 4ZX6A 4JN2A 3H85A 4XWOC 5HDOA 1YMMD 2BNUB 2ZCHL 3U2IA 1AE6L 3N0PB 3TJEH 1S5IH 1O9ZA 1KZYA 4P2OB 5D96C 3C12A 3QUXC 2EKSA 3BZ5A 4OLVL 4WHCA 4F7PA 5MEOB 3KLHC 1WFJA 2E8ZA 5ILTL 2VMCA 4KROD 2NY0C 2DQEL 3QRBA 1IBZA 3DHUA 4QRUB 3VWJC 4KXDA 2E9JA 2VABA 4LF3B 4KZEH 2CGRH 1IUZA 2WUBH 5HI4C 1K8DA 4G7SB 3RDJA 3SOBL 1XEDA 4Q0XL 4DEPB 5I18L 5J9PB 2WB1A 5CXPA 2AEPH 4JANA 5E5RB 2EDLA 2NT1A 3LDBC 1MVFA 2VXVL 2CIKB 4QHMA 4MCMA 4WLCA 2YC1A 3BZDA 4PGZA 5I5RA 1A66A 1L7TH 5FWRA 5KYUA 2XOTA 3PAZA 4ZUTA 5FHAL 5DFTA 5EZIH 4MAYB 2HB0A 2I32A 3QEGL 1WK0A 4G5ZH 4A6YB 4GBXC 5KS9F 4UV4H 5TF1H 2AXGA 3RVVC 3DVGA 4J8RA 5BRZE 4UV7H 3NBNA 1OT4A 3O4OC 4GUCA 3JXAA 3TBSB 2AFNA 2WK2A 4JFDE 4MMXA 2VR4A 3BXNA 4PP2B 3K3QA 4JE4B 4NXSA 2XBDA 5EBMA 1CUOA 3GKWH 1M53A 2W07B 2MH4A 1ERNA 1MCKA 3FCTB 3MACL 5GJTH 4CADB 1FNHA 2AVFA 3CC5B 4H1LA 3RKPA 1F58H 1CTOA 1F4YH 1MWAB 3CPUA 3SE6A 3BPOB 3MRIA 4LKXB 4PTTA 3WO4C 3IYLW 2R56H 4PIBA 1BVNT 3L5HA 3LKSB 4I0CC 4HCRA 4PHXA 2WUCH 1WFUA 3IDMB 1O6VA 1UWFA 1G87A 3ZE1B 3TO4B 3BKJL 5D1XD 3F12B 2E7HA 5DJ6A 2BSED 1C8PA 3KGRA 4JR9L 4ISVA 3MZGB 1DZBA 1F4XL 4FXLA 2OX5A 4NX0A 2WMPA 4UIKL 4WI4A 2FL5A 1LEIB 5J1SC 4ELKB 5ADOH 2R29A 1NDMB 3QJHB 3BRFA 4JY4A 3SPGA 4M6NH 5I6XB 1W6WA 1YN7A 3WHXB 1YC7A 2AJZB 1JNNH 3C6EA 5GSRB 4A67A 3FUIA 3CN4A 4FTVB 3ARFD 3ASOB 5EF2A 2F8VA 1RK1A 3MFFA 4QRPD 4A66A 4WW2F 1OTUD 2ADFL 3GJEB 4RLDA 4XPFL 4PGDB 3O6FA 3UBGA 4X6CB 2HT4D 4QOKB 4HWEH 4JKWA 4YC2B 4NUMA 1J5OL 2FAUA 4I2XA 4NO2B 2IG2H 3D06A 4ZK8A 2CIIA 3IGLA 1W2KT 3D34A 1Z2KA 3DNKA 4LOVA 3R7QA 4R97C 1OCOB 4AJWA 3CZJA 3LYRA 5FYKD 4PG9A 1BXVA 5DC9B 4Z7NF 5I73B 2J6EH 5ICYA 1EHNA 4ZO7A 4FXTA 5K39B 4HH9A 4G8FA 2H0JA 3CC1A 1W80A 1HXMB 5JQ6L 3HBZA 2N1TE 2R2BA 3MV7A 5EUOB 2DW5A 2HPTA 1FVCB 1HCZA 3DIVA 3QAQA 5E23A 3Q05A 4DN3L 5CUSL 2NY1B 3WE6A 1TJIH 2Z34A 4DH2A 1XSIA 2F53E 5D1ZA 1G6RA 4M6OL 4HCRL 3GGWA 4MLIA 3IF1B 4OF3A 3CPLA 2EO1A 3EYOA 1BLNA 4I48B 5CJOH 3T6VA 4L8SA 4LDCA 5KSBE 3MNMA 3GBEA 4KK6C 3OLEA 1WBZA 2TAAA 3QUZC 4DGVL 3C6LB 2VXQH 1QI3A 3IWVA 4PGBB 1GW6A 1WCQA 1S4IA 1QFWL 3T6QC 1SPDA 2CMRL 1HYSC 3BAWA 5C0BB 1T0NB 2J43A 2EDWA 4DPRA 1I1AD 3VXSD 2IBBA 3GBDA 4ZFFA 1MSPA 4N9GB 5I71C 3QYNA 1Q0YH 3RVXD 3SCMA 4BZ1L 1KIPA 4U2YA 3C9NB 1TITA 2JH2A 4NQEB 1GMIA 3CK0L 4LAQH 4O2EA 2JIXD 3UMTA 1QW9A 2VRAA 1FLTX 2EDFA 2HFFB 2ZAGA 4W6WB 2VC2L 3I6GB 1JGVL 4X5PA 2CPCA 2D0GA 1XZWA 4UQEA 1L5GB 1NC2D 4W6XB 4HEPG 3NMEA 4MCYA 1ZTXH 5H35A 4NZRL 4K9EH 2FX9H 2QQLH 3V4LA 1EO8L 2EXYD 2V7HA 4ILDA 2BFGA 5CLWA 1TNNA 2WBJB 3W81A 4O2CB 3OXRA 5E9NA 5ABDE 1XMEB 4RX4D 3PHQB 4YHOL 3DPDA 4M8VA 3FFDB 3MCG1 4U6HB 5B39G 3SPCA 4J4PD 4XP5H 5TDNA 4LVOC 1HWGB 5KVFE 2W9EH 3QT2A 1QBMH 4K23L 1UXMA 2WNWA 3O81A 2J8UB 5F7EL 3ESOA 1ZA3B 1G6RL 1VLXA 5IKCB 1QEWB 4HPOH 4U6YB 4PJFE 4UU9B 2CDEB 1B9ZA 1T66C 5E70A 5FF6A 4N68A 4QYOB 4Z7VB 3QCTL 3T0DA 5T1DH 2OR7A 1HDMB 4UNUA 1KTDA 2AJ3B 4G6AD 5EIIB 3VVVA 3HC0A 2YMTA 4JO2L 4RWYH 2Q2EB 1QLRB 2DQIH 1QOKA 2I27N 1KGJA 2EVJA 1PY0A 3L5XH 2APFA 3LNEA 1G7LA 1N2RB 4YXHL 2VDLB 3ZL4L 4FI7A 3EOBB 2HTKC 4RZCB 4QHUA 1DVFC 1IKNA 1U8JB 3VTTA 1MHEA 3HG1A 5BVPL 5DD1L 4LL9A 4XRCA 2EDBA 1A7NL 4NZDA 3PRZA 4NOBA 4OUUB 3THML 2ITCA 4UQAA 4BH7A 2JQMA 1IGYB 3WTYA 3IJSA 5CLTA 4YVUA 4TUOA 2IGFH 2Z4QA 3LN4B 1EJOH 5BZWA 1MF2H 3S8FB 3O6MH 3MXVL 1UJ3A 5EH1A 1JV5A 1RUKL 3EYVA 4YSAA 4HIJA 1WFIA 4R26H 4M1DH 3B6SB 1JGLH 4QXGH 1NEZB 4Z9KB 2HT3D 4F7CB 5LO7A 1IQDA 1L7IL 3UYPA 3ZYJA 4JY6A 1BLIA 4P23A 1CYWA 1AXSA 4ZDHB 2APBA 4PJGE 3U82B 4P46D 1ED3A 4TVPE 4D0DB 2GY5A 5DZLA 1VSCA 2CAKA 3LB6C 3PF2A 4G80B 4H8QA 2VXTH 2MIZA 4ZPVB 4RNRB 2WXPA 4FC3E 1TQSA 4DP1X 1TZIB 3MLRL 3QEUB 4ORGA 1FL6B 1SOXA 4NWUH 1YECL 5DGQA 4JAMB 2N3JA 1TQVA 4G82A 4O58H 3CFNA 3T2LA 2B1OA 4I8DA 3DXAD 1TU2B 1JPFB 4KO5A 2P5EA 4FYQA 5IHUL 3KVQA 3PWLA 3QQ9C 5GRUH 1INQA 2NY2C 4YLCA 2XFXB 3PHOB 4PS3A 2Z8RA 3ULAB 4L3CA 5FOBA 2A73A 1H19A 2CDFA 4IDJL 3MRPA 4X6BB 1FYTE 3BUIA 4Z77B 1NEPA 2RQ8A 4HMCA 3VFOA 3RZCC 2F7PA 4IBUA 4JMNA 3U6XA 3FHQA 1GGYA 3DUUA 1I85A 4FQQB 2EECA 3JWOC 3SKJL 5MEPA 1PD6A 4W4NA 2JQZA 2VAAA 4CUCA 4NQCD 1NANH 4Q97A 5DI8B 5DLML 3ZIMA 5ITFA 2NY5C 1E27B 5C2BL 4XH2A 1UB5A 3X12B 1QATA 2H32H 3WFZA 4BXVA 5T1LD 4HIEA 4UIMB 2ARJB 1KN4H 2VDKB 3L3HA 3NZHL 3WNMA 3V0FA 1SY6H 1XGPB 2OS7A 4NKDA 3V4VB 1ITCA 1U0QA 4DP8X 1WBYB 3UP1A 1YMHA 3B2VH 2LOEA 5KBPA 2AKRA 2DJUA 12E8L 3QQ4A 2CSPA 2GJZA 3FRUB 4O51B 2BNQB 4WY7L 1Z9SA 2WQRA 3APMA 4RISL 3UO1L 5EEWA 3PWPB 2C5DC 2VSCA 2DQGL 1I7UB 4I9WD 3PL6C 1KCSH 2IAMA 2GIXA 1UTDA 3BEWA 5AW4B 1P4LB 4V2BA 4FAAB 3MA7B 3CBJB 4IOIA 4X9FA 4ZYKB 5CMAB 2K3TA 4UBDC 2OMYB 1OALA 4WKXA 3VM7A 1Z5YD 5FO7B 4DK5A 5I17A 4WHDA 2VM4A 5IG7B 2ZCLH 5T5FL 2A83B 3BAEL 1SJEA 3FT3B 1IL1B 3CFCL 3CCHA 2O61B 4IBTA 2DKUA 5I1EH 1UWGL 1UATA 4X7CC 2XNAB 1HXYB 1XH1A 4F7MA 5DWUL 2Z92A 1AKJD 2E6JA 4IOFC 4MJJA 1J8SA 3GRBA 2D7NA 3T6WA 3TN0C 4I9XA 4AMKL 5A40E 1BZ7A 4UT9A 4HJSA 4HIXH 2OK0L 1WWWX 1TOXA 3WKPA 5ICUA 3GMOA 4R84A 3V8CA 1Y0LA 1X7QB 1EO5A 3KDPB 2HFGL 3O3BA 2CO4A 5JXAL 3UGUA 1RUPH 3J7HA 3X3FL 3BH4A 2WQAA 3P9MB 3C08L 2FGWH 1SF5A 2K45A 1KNOB 1FNEA 3VD0A 4B9JA 4XO5A 1JYWA 2FT8A 4LIQH 4WFHE 1RXLA 3VFSB 4ZTEA 4KVPA 2KZWA 2QVFB 4M1GH 2ED7A 1AGBB 3QEHA 4RGND 2VDQL 2DQDL 5TDOA 4F2FA 1A7BA 2MFNA 4KVNL 4JFFE 2MCPH 2F8OA 3GI8H 2BRRH 5JHDB 2NR6C 4OCLC 3PAVA 3S8WA 15C8H 1RJZB 1U9KA 1HVXA 1Z9LA 2YKLL 3DOSB 4OZGB 4JHVA 5CEZL 5T1JA 4YFLF 2HLAA 1EAPB 3MV9D 3PGDA 5F21B 5DYFA 2YBRA 3CVHA 3C5SB 5GGSA 3B9AA 5EEZA 3VMOA 1XGQB 5H2BB 3DJTA 4G1MB 5L6YL 1L0YA 5HGHA 5KVGH 1D5XA 3LRGA 4XBMA 5C0DA 3H42L 3LIZA 1H8OA 5C0IA 4ZT1A 3OLDA 3B5TA 2H45A 3EJZD 4ZMPA 3GSNA 5D7KD 1KFGA 5IVXE 1XF5A 4FLSA 4XZUA 3L81A 3VSUA 3DX9A 2RACA 3P4OA 2YEZA 1BAFL 1R5VA 2QVMA 4JFZL 3B7SA 1K4DB 4JKMA 4XVSH 2NNCA 4LVEA 3RY5A 1QPKA 1E8YA 4WO4A 2WV3A 2VLME 4PY8J 2R8SH 3QH3B 3UJIL 4BM7A 4DNLA 1CE1L 4P9HH 1NICA 4HEMA 2BNUA 3F7LA 5B8CC 3F58L 1MVYA 3GK8H 1OGSA 3KAAA 2YJLA 4MWFB 4P2RD 4L4VD 4P2OA 4H8WL 2HRLA 2VLLB 2C9PA 4ZUWB 4BHUA 3DLQR 2DLFL 5MEOA 2P8PA 4PLKC 5C6WH 5C70A 6FABH 2AJYL 3ZUCA 2O5YH 3CHPA 4K71C 1IGMH 4LF3A 3RHWF 1UG9A 5BOZG 2H6PB 4YX2H 5J9PA 2D3JA 1DDHA 5EUKB 3TT3H 4EN3A 5L4IA 4Z3IA 3LRSB 3X2QB 2CIKA 4AVHA 4NAQA 1OD7A 4Y16D 2BVEA 3OMZA 2A6DB 2WVTA 3T0EC 3VFGH 1YY9D 4S1DD 3RWJA 2UZXA 1KV3A 1SNRA 5DC0A 4ZAKA 3ZTNH 3TH2T 2ZOUA 3X11B 3I9IA 4G6MH 4L3FA 3TBSA 1A9EA 3BN9D 3OC5A 1RZJH 3GSNL 3JTTB 4CC0A 4N0FB 2FLRT 1MDTA 3HR5B 2IO5A 4KO9A 1G9ML 3WIIH 1SYVB 2H8PB 4MS6A 3IFOB 1JZ4A 2W9DL 4R96A 3FCTA 3L5WB 8PAZA 1AP2B 4CADA 1V7MH 4N1CA 4JQVC 4Z7WE 1P0SE 3ULVC 1MWAA 5EOQL 3TTYA 4RCAA 1E7VA 3AADB 4R5XA 1S9YB 1VERA 5IB2A 1UWEL 2Y07H 3IDMA 3BKMH 2GC7C 1FI8C 4LLQB 3TO4A 5IMOA 1KJ2L 2P26A 1OSZA 4AQOA 3G5XB 1UQSB 1IJNA 4AM0A 5BVJA 1VB9A 2C9SA 4N25A 1ITBB 2Q8BL 3KYNB 2VRQA 4UQ2B 1KBGL 2J5LB 3S3DB 3ZTJH 1ZGLM 3SN6N 3LHPL 4TL5A 1J5HA 1KLFA 1DFXA 2R1WA 3ZHFA 4ELKA 4RFOL 1NDMA 4LEXH 4KUZL 2WYTA 5GGQL 1CVRA 3NCBB 1FHNA 4PVNA 4L8BB 1I9JL 3WHXA 4MB3A 1CDBA 2AJZA 3CDZA 5GSRA 1IM9A 4EZMA 4JRYB 4JHBA 1LVEA 1HEHC 1MCJA 1CICB 5HHOD 5FK9A 5A6LA 1MFAH 1N8ZB 4HUMB 1GL4B 4AOFA 3QG6B 3P1VA 1FZJB 3V5HB 1CT8B 2ATPA 3GJEA 3KPNA 1G9MC 4PGDA 4QOKA 4AC2A 1MWOA 4LP5A 3ZDXE 1EHKB 3MRFB 4PJ9C 3S5ZA 1KBWA 2DB8A 1OAQH 1JF5A 3LNGA 3L3OA 2NW2A 3L3JB 2JXMA 4KXBA 3OHXA 1OTSC 5CBAB 1I3UA 5AEAA 4ZOEA 2JB6B 1KPRB 4HMDA 3MX0B 3BIBX 3PV6A 4LQFL 1I82A 4PR5B 1UT9A 3DX4A 3ML9A 1A7OL 1JN6B 2NXYB 4GKOA 5FYLL 4H26B 5EUOA 2KBGA 4JG5A 1CTMA 2PMZA 1YQ2A 5E6SB 3CV5A 4XC3H 4W9ZA 1X5MA 3MCLL 5DUBB 2WXOA 3LKRA 3O3UN 4ADIA 1NCDH 3KL3A 2ZX8A 2IH9A 4XB7A 2XIDA 3VWKD 4DPCX 5LGJB 4TTDC 1F8TH 3K8KA 2B7DT 5G5DB 3IF1A 2IMMA 2W91A 5D5MA 1CLYL 2RTTA 2IFGA 4EI5D 4JPVL 4L0ZA 1AJ7H 5F1SA 2ESVB 3C6LA 4PAZA 3VACA 4YHMH 4P3DA 4PGBA 2KKQA 4W9HC 3SDDD 3I9GL 5CP3A 3IRZA 5D1XE 5GRYA 4HEPA 5C0BA 4OFPA 5AD0A 1JBJA 4X5XB 5IFJA 5KBKA 4OCXH 4D9QE 4N9GA 3T04D 2NX5E 3TT1L 1RUAH 3RBGA 2OW7A 1JVKA 3C9NA 4Q2ZB 4NQEA 1AI1H 4IKKA 2GB2A 5D4HA 3TBBA 3QIBD 2HFFA 3NK4A 4P5TA 5DMKB 5IW6B 1UASA 1EBPA 1I7RB 2XY1A 2R4SH 2QSVA 5TH2A 1X6NA 4QRPE 3PFQA 2O5NA 2ODIA 2R51A 4PJAA 2YPVA 3DETD 3KBEA 3RWFA 4H25B 2HUHA 3PWUB 4N9OB 4ZNEE 5IP4A 3NJGA 4MHHI 1MRDH 1B4TA 2HT2C 2PXYD 4PGEB 3SQOH 2WBJA 4O2CA 4WWKB 1A4JB 5JMRA 3IU3B 3MLSL 2WTOA 5FGCB 1KPUA 2D3LA 3DSNB 4U6HA 4HAKA 5FYKE 3ZE0B 3L95A 2YGPA 4NRZA 5F9OH 3SPJA 2VH5L 4Y4KB 4ETYA 5JXEA 4UMGA 4RDBA 1GSMA 2DQEH 1BM7A 1X9LA 3LXUX 3NYKA 4GRLC 5I1KH 1H5BC 4L0PB 2J8UA 5DS8B 4PRHB 1ZA3A 2YA0A 1IM3D 3GNML 5IKCA 1QEWA 5I18H 3QQNA 4M4PA 4U1MA 1KFAL 5E7FA 1TT6A 2GCYB 5FFLA 2DQCH 1M7XA 4FRWA 4HP5A 5C7XL 3MV8D 3MKGA 4JCWA 2YJQA 3ZE1F 1G7JA 2WBXA 3PFUA 4AQ8C 4Z7VA 2YUWA 2PTTB 2UYLB 4GG6F 5FHAH 2RB8A 2WPGA 3MDJA 2VGLM 4WI0B 1P5UB 4CSPA 1YCSA 4WSGA 1GYUA 1RURL 1PZ2A 1TZGH 4CC1A 1ZS8B 2CO7B 2QMJA 1N2RA 4KK9D 4UT6A 2ZSVB 1AH1A 5ITBL 5IVNA 1A7RH 1JZEA 3MRLB 3MBEC 1NMCB 1U8JA 4YHZL 3O6LL 4WJG3 4RA0C 4UM9B 1ET8A 1E65A 2WVVB 4AEFA 4TYUA 2XTSA 3VXSE 4JDEB 4ACPA 1C5BH 5KSVB 4OUUA 4R90L 1IGYA 4JFVA 2IALB 1CDUA 5JPNB 3NCJH 4EMZA 3LN4A 2UUDH 4FA8A 1BX2B 4LCCB 3OQ3B 4EI0A 1KEML 1U3ZA 4D3CL 3SE8H 1N6QL 2IC2A 3QNXB 1WWBX 1V7NH 3D3VB 4N85A 5TK2A 1T89A 2VLKD 1HHHA 1NEZA 3OJ2C 5DVNA 1TVHB 3C2SA 2MJWA 2KZKA 3NIGE 3OJVC 4GAYB 3QPXL 4F7CA 3W11D 4POYA 2HRHA 4RH4A 3UZVB 5FO8A 2AQSA 4FEMA 3H9SD 3W39A 5EUOF 4U0RC 4ZDHA 3VD7A 2GSGB 4C59B 4A04A 2WTPA 4HALA 3KDMA 2ICES 4ZPVA 1J0KA 1GS8A 2P5WD 4BIKA 2PN5A 2ADFH 2HLFC 3QEUA 3A4DA 1KACB 4PVMA 2YQGA 3SO3C 1J88A 3P2BA 3BVNB 3LPOA 1TU2A 4B0MB 1JPFA 2YMOA 3NESA 3Q0HA 4LARL 4XBGB 1ESOA 5D5MF 3WIHA 1BVKA 1XCWA 4V1DD 1LE5B 1MJ8H 2XFXA 3PHOA 4RETB 1KF9B 4KPHL 1D9KD 3DPBA 4UTBA 5IROA 4X6BA 4GQRA 4YEFA 1Q9WB 1JWMB 5D70L 3V10A 4AG4L 1MNUH 2ADYA 4XBPB 2FT7A 3MRQA 5IWLA 5L2KD 3MRRB 5E99H 1YEFL 4FQQA 5C08D 2BSDA 3QUYC 4UDUB 3KGUA 4H1LH 3UFIA 3BDBA 4TNEA 5AZEL 4HCRH 3CDYA 3QORD 4A1RA 1AQ8A 3EH1A 4ZTPL 1TTFA 3G6JF 1JHLL 3MNVB 4G1EA 3W2DH 1BQSA 4BKLB 5JW3L 4PJAF 4UIMA 2ARJA 3C8KB 1E3ZA 3VFTB 2CGZA 2AGJL 3GO1L 4O00A 3WN5B 3U7WH 4KITB 4ZX3A 1XGPA 1SEQH 1U8OA 4OD1H 5LDSA 1REIA 3IMBA 3BPLC 2R29H 4MCZB 2CMRH 3G08B 4NPJA 1OEZW 4HIIB 5E9DB 2IJ0C 2BVQA 3QULB 1WBYA 4PJ8D 3T4AA 2X6BA 2ZPKH 1KBBA 2XWTB 2J88H 2Y22A 2Z35B 3HE7A 1DCLA 2JKJA 3NJHA 3O9WA 1QW8A 4O51A 2BNQA 1IBFA 2OMUA 3L5IA 1A9BA 2ZSWA 3O6KL 4MB4A 2PO6A 3C60D 1I7UA 3EADA 1IRAY 4Z7QB 3CK0H 4DVBB 1WC7A 3JUZA 1QBLL 1P4LA 1PX8A 1P5VB 4ATWA 1SHSA 4JM2D 4XWGH 2BPBA 1GTFA 1A5FL 1GC1H 4IIZA 1QTPA 2VC2H 4QWWD 4ZYKA 3BP4B 3NJFA 3FT4B 2E5EA 3OAZH 1DLHB 2OMYA 5LB1A 1DJSA 3ZHLA 3RTQC 2A83A 4NZRH 4Z7VF 3VB8A 2O61A 3IGUA 4XNXL 3CSGA 5I1CL 3IFPA 5IUSA 5J12B 5BUPA 3DXAE 5E03A 4D0BB 1JGUL 1SVZA 4UTBL 4JW3A 2XNAA 1HXYA 1PAMA 3G5YA 4FQXA 1X5FA 3SYAA 3QBTB 4YHOH 2OI9B 4UDTB 1ZEAH 2NLJB 3FFCB 4N0CC 5LVEA 4GSUA 2JJSA 4Y19B 5CHNA 1E9OA 4I0PB 4NXKA 2HYMA 2RQEA 5HDQH 2WCSA 3L4WA 1R3HB 3T3PF 4DO5A 1PLAA 3D05A 1G6RH 2D7PA 1B0RB 2PYED 1IFGA 1CQKA 1UD6A 2GT9A 3P9MA 5C92A 3OAYH 1AD0B 3C5ZD 4LLWB 2QVIA 3ZZLA 1JZ8A 4NQCE 4MXQD 1J0YA 4A2FA 5AG8A 2JV6A 3IDJB 3I02A 3PLYA 1PGRB 3PP4L 1XIWC 1CR9H 1AC6A 4YHYB 5HVHB 4HGMA 2O5ZL 3UTTA 4AC4A 4GO6B 4M5SA 3V6FB 1JHKL 3VW3L 1YSOA 3BKCL 1AGBA 4PSPA 5AW5B 1NMBH 4OLYL 5AG9A 2YMXH 1B3IA 3F64A 5K9QG 1PJ9A 4AEHL 5EZLB 1A1NB 3N41F 2LFEA 4NKOA 2A6JA 3HC4L 4TLUA 3RDTB 1E43A 5KSUB 1RJZA 2ZT9C 1UZ6F 1ZJBA 3DOSA 3NJJA 4OZGA 5DJ0B 1ZK5A 1N7MH 3KS0J 4OJEH 3M7FB 2NY7H 1QI4A 3A47A 4MLSA 1AYRA 3P69A 4I9WE 4G1MA 1TKWB 3E7JA 5HVGB 2VITB 3VMPA 2G4GA 4LLAA 4YZFF 1WS8A 5DCCA 2Y1VA 5LWYH 2KC0A 1T1YA 3OAUH 1FNSL 4KOBA 2YD7A 4Y2LA 2RMNA 2WWMC 3DMMC 3T77A 5JW4Q 2E4TA 4GEIA 1VPOL 3L45A 5EU7C 4WI6A 1F1DA 1X7SA 5D7JA 2K70A 4PJIE 3HE6D 4JVWA 1TQCB 3DX8B 4FFWC 4HU8A 3TX4A 1RZQA 5I1IH 4ONGH 1NCCH 1X5ZA 3GQFA 1BXUA 3POCA 4XHJD 1J1XH 3BWAB 2GSIB 1SOKA 2XRAL 2Z31D 4DGYH 1Q0XL 5HYFA 1ETZB 4ES9A 4MYPA 1DEDA 2KDYA 3QH3A 4YHKL 3NN8B 2FATL 2KYIA 4Q8BA 3ROLB 3WEAA 4E9QA 4Q9RH 3LNHA 1TDQA 4MA1B 3OR7B 5AVUB 2KMWA 1P7QD 1KXTA 4HS3B 4HXBL 3GRWA 4MVBC 1UVQA 3APDA 2VLLA 2CJUL 1HINL 4ZUWA 4KNSA 2Y06H 4Z0XB 3AS0A 2BSRB 1Z1WA 2YQBA 4AYID 4M3KB 3MLVL 3PGCB 5B7EA 1DUYB 4DZBB 2YOCA 3VNYA 4YSPA 2KPWA 1P6WA 3IPEA 4HA1A 3IFNL 3NTCL 2H6PA 1OZUA 5DHVB 3SKJH 3MLXH 2YLHA 1CFNB 3Q8EA 4RGNE 3H9YA 4LQ1A 4XXWC 3DIFB 1FBIH 3FO2B 2CO2A 5FUZH 4NKMB 5ALCH 3HR6A 3VXMB 2O26U 3HUJA 5FLVA 3P11H 1QSFD 4AIXA 1J9TA 3F7YA 4R2GC 3NJKA 3QIWC 5AYQA 2X4UA 2ALAA 4P2QD 3VQ1C 1K8IB 3MV9E 5FUCC 2WM0A 3X11A 3EO9H 2FHBA 3OR6A 3WS6A 1FZMB 5GGUA 5E2TL 3ZOAA 4XN2A 4BQCA 4JFYA 5C0FB 3D48R 1IFHL 5I1DA 4GT7A 3U9PL 4ZMLA 3JTTA 4JBSA 1R3IL 3HR5A 4N6RB 2VN6A 2H8PA 2KL6A 4ZO6A 1FGVL 3IFOA 4KJQC 4XPHL 4QJ4B 3OF6D 5IM7B 3BQUC 3TU6A 2B59B 1AP2A 1NINA 2R7EA 4KKCC 2ORBL 4TS6A 4UWQB 1ZPUA 5D7KE 1P4IL 12E8H 4R7DB 4XCFL 2C9VA 2R0KL 2LQRA 5LAPA 4P4KB 5IFHL 2DWXA 2OFQA 3FJTA 3O3AA 1CGUA 2DV6A 5D9SB 3WFEL 1X5YA 1S9YA 2ZWZA 4P9HC 1NSNH 4JRXB 5KG9A 3KR3H 4M93B 3B9KB 1UQSA 1FVEB 4YXKL 2XN1A 2RA1A 3U6RA 4UQ2A 3HJEA 4YDMA 5EF1A 1O75A 2K4AA 1UACH 3VFUB 1Z3RA 3MRBB 4S1SL 4TN9A 1U58A 4HD9A 1GOHA 5E8PB 3CFCH 1ZHBB 4YHNB 1MG2C 1TFHA 4GO8A 1QFWM 2Z91B 2YRPA 2GVYA 2FR4A 3ESMA 4PB9L 4XOAA 4JRYA 1ZANL 5DYOB 3CFUA 4P2RE 3KGSA 3MKKA 4L4VE 1R5IB 1ACCA 2Q8AH 3HI5L 3QP3A 4KI5C 4LDOB 1FZJA 2I5YH 4RFNC 4RMWA 4OBSA 3MUY1 5L4FA 4Z0BH 1JPSL 4CVXB 3H6AA 5F6IC 4NZ8A 1KGIA 2D0HA 4PP1C 2R9HC 2ZP8A 3R1GL 5DJ8A 3MRFA 5FA3B 4K55A 3K0YA 1DSFL 2HFGH 2E74C 1R6VA 4K5LA 1CD8A 3BGFB 3U25A 1QPPA 4WI3A 5F97E 3AWEA 2AP2A 2JB6A 5A3ID 2YQ3A 4XPTL 3TA3D 2NYYD 2WSDA 3CLWA 1MJUH 1MAJA 1ZHKA 4KKBD 2Z93A 5CEXB 3LCYA 1MCPH 1RULH 4ZPTB 4FMFA 1M56B 4PJEB 4RAVA 5ANMB 2OJEA 1M7DB 1J05B 2F08A 3ARQA 3RUGE 5DLLA 1D6EB 5K93A 3WKYA 2YAHA 4OGXH 4KNTA 5IIEB 3SQBA 1PD0A 5LGJA 3KWWA 1XMWA 3IDGB 3V8OA 5G5DA 4OZFB 4HJGA 1BQUA 3Q06A 4R3SA 2JVUA 2LE9A 3DX6B 4LCVA 4XWOD 5AW7B 2UWEE 2X40A 5I6OA 4M5ZL 4QLWA 5L6YH 1OCCB 1UA6H 2XQBH 1FWXA 2ODHA 2Y1YA 4H0IA 3QUXD 1PY9A 3KPSA 5JDSA 2CLRB 4APQB 5JNYB 5LG6A 2DI8A 3OGCA 4N0UA 3UZEA 4FD0A 3QHFH 4UQBA 3KLHD 1CGSH 2NY0D 1OM9A 4NSKA 3O45B 4IOSD 4OJFH 4OW6A 4X5XA 5ECJE 3F85A 5BV7C 3VWJD 1MAML 4OF8A 4XXDA 2IPKB 2EJ1A 3CLEH 4B9KC 1VFUA 1B4JL 5HI4D 1T7ZA 2ZD0A 4BD4A 2CDGA 2NUTB 4ZMZA 4AVIA 2AQTA 3QA3A 3FSOA 4HPHA 2XZZA 2B16A 3N43B 5E2VL 5DMKA 1T83A 4UT9H 5HHOE 4HG4K 4JL2A 2VZSA 2OM5A 3F2LA 5AKVA 1CC3A 3ECBA 4X4MA 2VDNH 3A0OA 4OR1A 4NS0A 1JK9A 1CE1H 4GBXD 3LPWA 3HUJF 1MLCB 2K8QA 1DQLH 2ADIA 3INUL 4LNRA 1I3GL 4R7XA 1IBGL 3RVVD 4YE4H 3D07A 3ARSA 3AG4B 4YDIL 3S34L 5F0JB 1KYOK 5IVXB 4WUUA 1A4JA 1SXBA 3FO0L 3RIFF 5DMIH 3PJNA 4H8WH 3DSNA 5AVXB 4HJJL 2VR6A 2E86A 1RMFL 1HOCB 2DLFH 2XWRA 3CBRA 4Y4KA 3WKNA 5LNDA 1A8JH 2DICA 3ARVA 2AJYH 3N1GC 5ESQB 1SHMA 2Z8WC 5K59E 5DS8A 3V0JA 2WW8A 1E4JA 5AALA 3IMUA 2K4WA 4BQBA 4DETA 2ROXA 2AJVL 3B7RL 5FKPB 1DN0B 1L3NA 2WB7A 2GCYA 1T0PB 2PW1B 3IK2A 5D71L 5IGXH 5ISZD 4M8QB 3CVHH 3S3PA 2WLZA 4J12A 3VSTA 3PUUA 2PTTA 2UYLA 3DX3A 1JXDA 4B9YA 4UUJB 5EMYA 5JUEL 4OUOA 2Y0SA 3EJUA 3U0TB 3X13A 3LIZH 4BSWA 4J3UA 2CO7A 4WJ5B 1I3RB 3H9HB 4MXWH 3NZ8A 3GSNH 2PP9A 2ZSVA 1AQHA 5F71A 1EXUA 4I3GA 2CRZA 3MRLA 1KB5B 1HNYA 5T3XL 4NRYA 1NIAA 4H0GA 2PABA 2VRKA 2ZYHA 1GRWA 3N42B 4FZEH 2CPUA 4JDEA 1TZ8A 2WGXA 4PCTA 3U48A 5KSVA 4HZ1A 4XO3A 3FSWA 2O1AA 2IALA 4NYLB 3TLRA 5JPNA 4CMHC 5PCYA 3KHOA 4KXZH 4V11A 1AAJA 3GBML 1R3LB 2P49B 3EFFB 3KXFD 1P6AB 1BX2A 5GRXG 3TNNB 4TF4A 5D2NE 5SWSD 3PJSA 1X5AA 3CGTA 4NZTH 5DQJA 2DTSA 3QJTB 5BRZA 4I3SH 4LCYB 1BOGA 1W0YT 4XVTL 2VLRB 2EE6A 1SGKA 2LFGA 1J12A 4L9LB 4ZMQA 2VDML 4JFDA 2NUPB 4ONOA 1SDYA 3MXWL 2A74B 1SDDB 4GAYA 1BBJB 3U1SL 1HI6B 1PLGL 4U6TA 5E6IC 4TULL 2FJHA 2AK4D 3UZVA 1SM3L 1QAWA 1T0MA 4OLXH 1PG7L 2GSGA 1NFDB 5GHWL 4JE0A 2IBZX 2ICEB 3BUPA 4NI3A 3VRIA 1CTNA 1PBYA 2J71A 4ODBD 4X5WB 3COOA 3CFTA 3GSRA 4PS7A 1ZLSH 3RX7A 4AYBA 3U0PA 4FZ8L 2K7QA 3DUSB 2JKWA 1LO3L 3FMGL 4X5QA 2BNRD 5F7WC 4IMLB 3L4VA 5CEYB 4BGLA 2G75B 4KK6D 4JDVB 4BA8A 3QUZD 1MNNA 4AYDC 4W70A 3MRNB 5C09B 1Z5LA 2FO4B 3VMNA 1M3JA 5DVPA 2XTLA 2G5UA 1QUPA 1Q94A 1IGJB 3CHRA 4I1RA 4I3RL 2CKBA 1PZ5B 1HYSD 3ASWA 3LH9A 2HFEB 4A6YH 3N55A 2KERA 3MV8E 2IDQA 4JPQA 2B0SL 2X05A 1KIQA 1WRFA 3BE1L 4PJHB 3TESA 4GSDL 1Q9WA 1JWMA 4BRJA 2FECI 4XBPA 1LO2L 3ZE2E 1MFCL 1OKEA 1BD2B 3MRRA 3DJRA 5D1QE 3ZK0A 4K94H 4BQ8A 1KCKA 2E56A 2FEEL 3U9UA 4TUJB 3WTSA 2EEDA 4JN1L 5K9JH 3S8GB 4UDUA 2WLHA 1MFEL 1MWAH 3ZZQA 4E9RA 4KTEL 2CD0A 1U3HC 1RIVL 4XP6H 4NNPL 3US1A 1A7PH 4HDIB 3SZ6A 3U4BH 4Y5YA 1EZVX 1CLYH 1G9NC 1BFVH 3MNVA 2Q7AA 4YIQB 5E7BA 1G84A 5C0EB 3HMWH 4ANWA 3HBPA 4AH2B 1EH9A 1OWRM 4XMVA 2VR8A 1PPIA 3VFWB 2ZNXA 3ZDZB 4TNVK 4K3EL 4MCZA 5FW7A 1E5YA 3K4DA 2DI7A 4L1SA 4GMTH 1YDPB 1JDAA 1N5AB 4HIIA 4NUQA 5I8EA 3NK3A 2VLKE 4YQXH 4G7VL 2XWTA 4WVRA 2Z35A 3BP7B 2F53A 5GIRB 1P6FA 4HUVB 5FDWB 3H9SE 4E9SA 1U30A 5KSBA 5LNGA 3TM6A 1T66D 4HUCA 1PX4A 2EEFA 5F0PB 3BP4A 3T0WA 1FH5H 2P5WE 3FT4A 1DLHA 5I1LB 1LO0L 3N85L 4TSBL 3GXPA 3SE9H 1INEL 3BRGC 1RJLA 4MJHA 4QR7A 4HBCH 3RIKA 4D0BA 4Z7OE 4MMXC 3QWNA 1JRHH 2XSKA 2X28A 2NX5B 1RP8A 1YEHL 2HTKD 2MMXA 2WN3A 4V1DE 5I76B 1DVFD 4JJOA 4UDTA 1DBAL 4CU7A 2Y7QB 4CW1A 4O2FB 1A3LH 4H5SB 5EOCH 1TETH 1SJXA 1A6PA 1BHGA 1MHPH 1U2HA 3LH2L 3RJDA 3BMVA 3ABLB 2VR3A 4TV3A 2F5AL 3KEHA 4JL1A 4R4BB 1R3HA 1MY5A 3VI4E 4A2LA 3HNTH 4QCIA 2ATKA 3FULA 4JRLA 3A6CH 2XJLA 3ZKQD 4M7LH 1EUUA 5C08E 3UTOA 4LPTA 4EKJA 1WEJH 2VWEE 4AY0A 5EBWA 1IBHA 3EOTH 3F3HA 3MGAA 3V6OE 5I0XA 2PR4H 2CGYA 4LVNC 3F00A 4LOEA 2DS4A 3ZKSD 4LGSB 5BJTA 5CP3H 3BIKA 1VADB 2UZYB 3V6FA 4GKLA 4AGLA 3LVTA 4CKVX 3DRTB 3WTXA 4EBQH 3LB6D 4AGPA 2OZNA 4Y9BA 4AYFB 5FFGA 1C08A 5C71A 2PNDA 1H3XA 4YHZH 3O6FC 3RDTA 5KSUA 3DJZA 4KZDH 2A9DA 3HVDA 4PJFA 3GMNB 2N7BA 2QFPA 1H9DA 1GC1C 1URLA 4TUKL 4BJLA 1UB6B 2AQQA 4X4YA 5CBEA 4MJ4A 3NAAL 3LD8C 1SN2A 3MLYH 3GXTA 4XB3A 1J8HE 3QQ9D 3NGBC 4U33A 3L3GB 1TKWA 3RI5K 2NY2D 2IWFA 2YPVH 5DO8A 4Q7DA 2B3IA 3QCVH 1KEMH 5TDPB 5CU9A 1E4WH 1WITA 3TO2B 4I87A 4JQXA 4JO1H 3QNZB 2Y69B 3I3EA 2JJWA 3AU1B 4Y4HA 1OGAD 3II2A 5DU7A 3RZCD 3EYFB 1MW3A 3ZKMC 1F90L 1OP9A 1U8HA 4PRBB 3ZZSA 1TO4A 2YD3A 2Z7YA 3GTTA 2VMJA 4LCUB 2PWGA 1ECYA 5FGBA 2LAAA 5I0YA 2Q6WB 1RFDH 4N2EA 4XBEH 1F42A 1DZ0A 1XH3A 5JHLA 2GSIA 3Q8CA 2I25N 3CXDL 1N8OE 5F7DB 4BKSC 4OJYA 4L8SC 1ETZA 2Z0BA 4IM8A 4WKZB 4XHQA 2ZF9A 1NAMB 3PYCA 2MCAA 1A6AB 3QDAA 3GDCA 4UQ9A 2J57A 4Y4FA 3B8YA 2GI7A 3QZMA 4KX8A 1NBYB 2MPAL 3CD4A 4HX1B 3LNFA 3O41B 4LMQI 4MNQB 4E0RB 2FYYA 2PYEE 4FOMA 4HS3A 3VXQB 5CGMA 2QR0B 2JNZA 4QRTA 3AABA 3NFSH 4KPHH 3X1FA 3LV3A 4U1KB 2FD6H 2BSRA 1KCUH 2JCCE 4U3CA 4ZFGL 4G6KL 5KVFL 1GGBL 3SCMC 3MRCA 2VDLH 5D7SH 4UT6H 4KMLB 4B7LA 2H9GA 3S88H 3S0PA 1VKXB 1BMZA 3PL6D 3MLWL 2IADB 3N1MC 1O7SA 2IPTH 4XTRC 1CFNA 2X4RB 1DVSA 2ZX9A 3FTXA 1ZA6B 5F3FA 3TFBA 3DIFA 5KSBF 1LO5B 3TVMB 1NIDA 3D39D 3FO2A 1BXAA 3MV11 4UBDD 3KL0A 4L8DB 1FPTL 1FRGH 1FL5B 1FE8L 3FQTA 4ZTPH 5DD5L 1MQ8A 3S3JA 1JHLH 5FUOH 1E4KC 1CF1A 1HQ4A 1K8IA 1ZWIA 3L17A 3EOAA 3Q6FB 2YWZA 3ML8A 1W15A 1FZMA 5J5EA 1FYTA 1NEUA 5DJYB 2JLLA 1H0DB 5M7QA 2DD8H 2ATAA 1RZKL 4IOFD 3BD4A 4N2OA 3TN0D 2O30A 4WCYL 4AUUA 3ARGB 4R7DA 2GBAA 1YNTB 4P4KA 1CD9B 2QADC 5J4MA 3L3IB 3AFLA 4TSAL 4EOWH 2Y24A 5JIIA 3ATFA 1WD9A 4AK1A 2V2WB 1UM6H 4WHYG 3WN6A 3RPBA 1FVEA 5FM5M 3NCYP 3M88A 1TQBB 3OAWA 4NO3B 1EA9C 3WIHH 2VKXA 3NIFE 1G7QA 4PRID 4LSVL 2DM7A 2GIMA 3HRZB 4M7KL 4PUBL 4YHNA 2W38A 1IGTA 2R69A 4LRNL 3UC0H 4DAGL 1MH5A 1AFVL 2ENQA 4UTBH 1DQVA 3CIQA 1FG2A 1B2WH 1IKNC 2A0LC 3BVVA 5DYOA 1IAMA 2NCMA 1R5IA 3E6FA 5ICZA 4YSEA 1GKOA 2NR6D 4P5SA 2E9IA 4L5FE 1I9IH 3ZGHA 3GHBL 4HCGA 3FB7B 4LL4A 4NQSB 3OPZL 1AHWB 2AXHA 4PJFF 3OKDB 5FA3A 5T3ZD 2FHFA 4MA3B 3TZVC 4DP9X 2HTLD 4WGVB 4WK2B 5TQ2L 4OM1H 3F6LA 3HKZA 5HXMA 5AUMB 1LDSA 3K6NA 4KZCA 1UM4H 4FLOA 2PPAA 2W88A 4OD3L 1VFOA 2P43B 2HVKA 3PP4H 5C7ZA 3KYMB 3VO0A 1X5KA 2VDKH 3BFQG 1ZVYA 3PJLA 2IDUA 1OANA 2DQTL 1ZVHA 1QSFE 4ZPTA 5C86A 3I74A 1BBDL 2UY6B 4PJEA 3IDIB 3KNBA 5ANMA 5HPOA 4LKCB 1A7QL 1M7DA 3I75B 4P2QE 4P23C 4ECNA 4M4RB 2DM2A 4ODWB 3FH8A 2B20A 3HHSB 4M48H 4AYGA 2FQFA 3W0WD 1OE1A 2QL1A 2V2XB 1E4HA 2EIDA 4AEHH 3MR9B 5C0NC 3SD2A 2FQGA 2WZ0A 4R0LB 2HMIC 2EC8A 2NNFA 3MMEB 2IBGA 2D31A 3DX6A 5LQBL 4IHOA 1IGIH 1YG9A 1NFIB 2AQ2A 2M8XA 2DQJH 3SDAB 5A16A 3QUML 1UZ8A 2YXVA 2NNAA 1HEZB 4MXVE 1MI5D 1UGKA 3UIZA 1P7KA 2CLRA 1H3PH 4QGYA 3NFPB 4APQA 2X0WA 2ZONA 5C0RL 1XSOA 3SD5A 4PLKD 3QHZH 4EIBA 3D85B 4QHKI 4X9BA 3W5MA 4LHUB 1S3RA 2WZPA 3LEXB 2WSKA 3VE0A 4PJGF 1E9QB 2IPKA 2WCGA 3ATBA 4JFFA 3EXJA 5IMLB 1C1EL 4JM0A 4KY2A 5EU6D 3GMMA 4FI6A 2NUTA 2NYZA 1OL0A 5AB1A 4X8JB 4GRMB 2HJFB 2F7IA 2EE0A 2YHGA 5DEFA 3G9AB 2C9RA 2OR8A 3EJPA 4S1QL 3VGEA 5AAWA 1T0OA 2EYRB 2JMRA 2XRAH 3HMXL 3T0ED 3QWRA 4XPBL 4F8NA 4MD5A 1IAIL 1FL3B 3HI6L 2FATH 2Y36L 2CM6A 2JE8A 3LNIA 4FFVC 4BFIB 1RPQA 1X4YA 3CFMA 3NFNA 4MB5A 4M7LT 5IVXA 1NCHA 5FLUA 4HIHA 5TE6L 1YEDB 2JI2A 4U7SA 4ZW7A 1XFPA 3S4SG 3G6AA 2L0DA 4G6JL 4LSUH 4N0YL 4Q6IA 4G83A 3SBWA 5HPMA 5AYUH 3WELA 2AV1B 2Q3AA 3ULVD 3WD5H 4AV4A 4E68A 1WGOA 4H0LC 4LOUC 5ESQA 5GS2H 4ZXBA 2GJ6D 3E6HB 1HC1A 3IFNH 3FH5A 5FKPA 3RU8L 4AZUA 5CZVH 1DN0A 3PNWA 2X41A 2X4TB 1WA2X 2RH0A 4DZ8A 4F33A 4PJCE 1JJUA 1HCYA 5C0JB 2YUVA 2I7OA 4OIAA 3KLKA 4M62H 1BDYA 2OTUB 4UUJA 4P3CL 3UAJC 2WLIA 2FNWA 3U0TA 1S7VB 1XGRA 1Z6JT 2Z8SA 1HE7A 2FX7L 4WJ5A 3S97C 1X5HA 3VGFA 3H9HA 3CVIH 1A6UH 1E2WA 3VRJB 3ARPA 2J4WH 4KVCL 1FGVH 1NJ9A 5I5IA 1C5CL 4ZBJA 1BJ1H 2OULB 2Y6SC 4R7NB 3WTVA 1MJJB 2WO3B 1M3IA 4KTDH 1IC5H 4PJ9D 1AGCB 3BZFA 3I6KA 4UNTA 4ALAH 1U8LB 4DVRL 3NG5A 1U8PB 1OTSD 1YNKL 1R3LA 4HAGA 4C4BA 2FWUA 1RSYA 1I7TB 3QRGH 3TNNA 1EEYB 2ARWA 1D5BB 1RCYA 2DEWX 5CZXC 1BJ8A 4W9GC 4LCYA 4RRPA 4HZLB 4L9LA 4M7ZB 5I66B 4JO3H 4TQHA 4E41B 3HPJA 2NUPA 3QXUA 2Y7NA 2GJPA 2VOTA 4YZWA 2A74A 1BBJA 1ZVNA 3GRWH 4X7SH 1HI6A 2KLTA 2OSLB 4P5MA 2XZQL 1XH0A 4FQHB 2L7UA 2HH0L 5A2JH 1NFDA 4Z7WA 2PPEA 2ICEA 4NCC2 1ZANH 5HHPA 3FK3A 1GGUA 4X5WA 5AAPA 2CBMA 1MIEH 2VR7A 4TTDD 5A1AA 1U91A 4FNLL 4F8PA 1DBJH 5DHMC 4YSDA 3LVEA 3O0RL 4X6DE 1V05A 3EH3B 5CEYA 4XNMB 3PE9A 4YBLB 4DW2H 5FCUL 1XF3B 3MRNA 3R1GH 1T7WA 4KGLA 1DBKL 3LKQB 4YGAB 4LSDA 3T0VA 2FO4A 3UADA 4DP0X 4YS4A 4U3SA 1AACA 3TS8A 1OK0A 2ZOTA 4PWGA 4GS7B 4MD0A 5GISL 1XR9B 1PZ5A 5INDA 4Y1AE 3S6CA 2HFEA 2MEJB 3ILEA 4XPTH 4G9DB 5INCB 4Y5VA 1F4WL 5ISZE 2DL9A 2PWDA 2ITDB 4QT5B 4M29A 4OZIE 2I9TA 2VQTA 2ZG2A 1PZAA 3UAAA 4GNKB 5MI0C 2VTFA 2BP3A 3JTSB 1YEIL 2X4PA 1CMOA 2Q76B 5FYLD 4JLRB 5L88L 1SZNA 4XPAL 2XZAL 4TUJA 1BMWA 3Q2WA 4JFEB 1EMTH 3I85A 5AB0A 5E8OB 4DN4L 4X50A 3SSGA 2OCFD 3CMOL 3S96A 5E4AA 4G8AC 1A14H 2P24B 4OV6F 1NDGB 4XP4L 2ADJB 5FHBL 5HJ3A 5DO2C 3MNWA 4FFZA 2HT2D 1VZGA 4U1GB 4L1HA 4UAHA 5C0EA 1NANI 5IOPB 4AH2A 1MHCB 4P2OC 2W0FB 5J11B 1N19A 3EYSH 5ESVB 2X89D 3LZQA 5IVXF 1U8CA 1OW0A 1DJGA 1YDPA 4NHCL 4QF1A 5DJZB 4Z18A 3KLDA 2G3ZA 1CDJA 4GRLD 3DX0A 1UXLA 5EB9A 4JVPA 3T65B 1A21A 4MA7H 4AL8L 3OKMB 4DEPC 5HVFB 4TSCL 2C3HA 4MNHB 3TIDA 1NLBL 5GIRA 3RJQB 2AK4E 4HUVA 4NQUA 3LKPB 3SGDH 5GGVL 5EA0L 3WJJA 1QUNA 4TVSa 1C7TA 5F7UA 1BIIB 3CX5K 1EGJL 1UEYA 5I0DA 3EDEA 3UEQA 3B4NA 3HHMA 1DVTA 4ZQTA 2L7JA 3QDGD 1JE6A 2BNRE 3MGTA 4QRAA 5D1XA 2APWA 2BSEA 2BY2A 3D4YA 4G8IB 5JLZB 1W91A 3D9AL 1IBGH 4F2MB 3PIQB 1INDH 2G9KA 1FFQA 3LS4L 4FKKA 1WTLA 2Y5QA 2NX5A 2RAMA 5I76A 3DURA 4TOYL 4K5OA 1XT5A 2DF3A 1MIMH 3MBED 3P77B 4QYAA 4Y2DB 1OCWL 2Y7QA 3GHPA 3VXUB 1JZ3A 1G0DA 3DGDA 5GZOC 4UANA 3PPSA 4H5SA 1MFDH 3QDMB 3BPOC 4QXWA 1YUHB 4NJ9L 1VENA 4QTHB 3ZDWA 3E1ZA 5IJKA 2F19L 2X9ZA 2W94A 1X44A 3N42F 4R4BA 4IRZA 4ORZC 2HP4A 1BPVA 1DO5A 5E2UH 3TO4C 3GUFA 2CWRA 1S7UB 5BOJA 3BVDB 4R8WL 3VD1A 4OGYL 3E1F1 3WY2A 1UD8A 2GJRA 3JWNC 2EYSA 2R1YB 5K69A 2VJXA 3FZUC 3SY0A 2R2EB 2NY6B 2Y3AA 4TNVF 2EYTB 5FX3A 4N8CL 4X98B 5IV2B 3WMQA 3TEZA 5I6XC 1BQKA 2HN7B 2AHIA 2IOOA 3GBNL 3OWRA 2F2HA 5GS0H 1W72B 4DPAX 3ULUC 2LLLA 3DRTA 4GRWE 2YARA 5F7HA 3RL1B 3K6IA 4P0DA 3ULSB 1V8HA 4AYFA 2F8XC 4Z7WF 5KYYA 1PKQB 3K91A 2HLFD 1QQDB 5E5UB 5AZ2L 4YC2C 1Q72L 2VLJD 5TPWL 5F3HB 4BFFA 2QGBA 2ZWYA 4JPWL 4GY4A 1O7DE 3RNQA 4JO4H 2YD9A 3L3GA 5I73C 5G4MA 1L9QA 5EF3A 5MERA 2F58L 4HXAH 2E59A 5TDPA 3TO2A 4MRCA 1TYJA 2ZKXA 2B4CL 4GQPH 1DANT 4G3YH 5CJ5A 1ZOXA 4LCUA 1NKGA 4KMTL 2NY1C 3VXSA 4E2OA 2AXFB 2YPKB 2WQWA 4IU2A 3ZVVA 2FH6A 2K0RA 3T6XA 3BSHA 3ZDXF 2G2PA 1S78C 2WXRA 3FMGH 2OXGB 4G6FD 4FKHA 4WKZA 1MXDA 3I2CL 1QSEB 1A6AA 2WO4A 3C6LC 3JZYA 4LEBA 3MJ7B 1F56A 3MOBH 1NBYA 3WFDL 3FTSA 3PUCA 4HX1A 2V7NB 4N3TA 5ERWB 5GGTL 1GIGH 1RZ7L 5L7XH 1UXSB 2EKJA 3SDCB 4XE5B 1IC7L 2XG4B 2V8MA 1EANA 3NJVA 4RMRA 4FJ6A 3BSGA 2QR0A 4XMLL 4ZOAA 2XY2A 3IETB 2FLMA 3N9GL 1XR8A 5FYKL 2RCSH 2WXGA 2E75C 2E47A 4Z6AT 4U1KA 3GB7B 2EABA 3ES6B 1KN2L 3GBLA 3M8OH 4WHTB 4AE1A 2XDHA 3HFFA 1JK8A 1PTZA 1A6ZB 4M6AA 5T1MB 2MCMA 3BE1H 1PZ3A 4KKAC 3SE3A 3GSXA 2QEJA 2B4CC 3LQAL 3GDBA 3L9RB 4OB5L 3DOIA 1HYRC 5GRWA 1ZE3C 2QVTA 3SDXE 5GGSY 3EXLA 2X4RA 1RUMH 3D25B 4PJBB 1HIML 5DFVC 3EH2A 4L8DA 1TENA 2P8LB 3RTQD 3MRJA 1DN2A 2CA3A 1YAZA 2XYBA 1KENL 4OCWH 4I1NB 2EIMB 2EACA 1RZ8A 2WBJC 3FUMA 3Q6FA 4L3ED 3MI6A 3RJOA 3WEBA 2VDRL 1WCBA 1KCRH 4X9IA 1G7HA 3U4KA 3QDJD 2AK1H 5CAYB 5D1QB 5GRVL 5JXEC 1NLDL 4OFDA 4MMYA 4BEIA 4JHWH 4G7VH 5IBUB 1F97A 1EJFA 1OGAE 2WQ8A 3E0GA 3FU5A 3MJ9L 1HN1A 3CDFA 3PHSA 2NZ1A 1AGDA 3WEXA 3BUTA 1ZLVK 3WUWG 1UOKA 2KHAA 3UJJH 3QRLA 4NKIL 2KZBA 5FECA 2DBLL 3HZVB 4FLRA 2NY4B 3IJ8A 1NCJA 1XIWD 1QKZH 1ZPLA 4XAWL 4MJ6A 1T3FB 1CFTA 2UZIL 3QQ3B 5L9DL 4LVHC 1OF0A 3MOAL 4PIRF 3S35H 5CFAA 1UHVA 2CKBH 3MLTB 3UZQB 4F91B 3HRZA 3DO7B 4JG0H 1A4KB 5AL0A 2ETWA 1TTAA 4LLDA 3ISWA 5I6LA 5EEUA 1TTCA 1JPGA 1N12A 3FUNA 4QTIH 3STZA 1IQWH 4HK3N 5KN5A 3AQDA 1CK0L 4K73A 1A6VL 1TVDA 3NSXA 2D0FA 3H3BC 1G5AA 4OZ4A 3FB7A 5DK2B 4PRPB 3Q43A 2QQNL 2X2HA 3K6DA 4TQEH 1M9WA 2X4OB 1CZ8L 5FA4A 4ZX4A 3OKDA 3FN0H 2YFNA 3J8F7 2ERJB 1XGYH 3NRPA 1DLFL 2CA4A 1F0LA 2OMTA 5AUMA 3WXWH 1JF1A 4NQDB 2WXJA 3HIZA 1K4CB 5SWZD 1CYGA 1N0XL 2H41A 2ZOKB 3Q1EA 4K4KA 1THAA 3D39E 3L1OL 4EQ2A 3KYMA 4PJ5D 1KB9J 3DMMD 1XCTB 2F6AA 2WWMD 3JT2A 3NRFA 3QZBA 5DVOA 4ZFZA 4F27A 5I8OH 2UY6A 3IDIA 2VQ1B 4DGIL 2OSWA 1FJ1B 3I75A 1I1YA 2Y2YA 1A3RH 3EYUL 3KPMA 1JNLH 5F1IB 4FFWD 3FT9A 4BZ2A 1IKFL 4AQEB 2H4EA 4OQTA 3HHSA 2GK0B 1QYGL 4PJDB 5IY5B 1JOIA 3VAEA 4GPVA 4YAQB 2V2XA 5IFAH 2E7MA 4LO9A 3NIDE 5GGRA 3T2NH 4H7VA 2A9NL 4R0LA 2XI9A 3CN2A 1NGWB 3RWEA 1O9WA 2AANA 1AQKL 1MW2A 2A5UA 4LT7A 4DTGH 2LR4A 4NQCA 3WFBL 2BHUA 4NGHH 3HG4A 3SDAA 5CINL 2P47B 1WV7T 5D8JH 4A38A 4MA8H 1EZLA 3D2UB 2X7LA 4UM8B 1HEZA 3FONA 4MVBD 1G7PB 3UDWC 3C8DA 3JVFC 1OD9A 5T1LA 1CLZL 3FT0A 2EH7H 3IGAB 1G1CA 5IROC 2C26A 3LEVL 4GJTB 3NIGF 5FYKU 1BAWA 3D85A 5TFSL 3M1OA 3S5LB 1ZGLB 5IWLC 4PRIE 5IHZB 3QB7C 3QC6X 5IMLA 1N6UA 3CN3A 4Y0GA 1XCQA 4A2GA 4GRMA 4TRPL 1SUHA 3QSKB 4H88H 3S4SA 4ABQA 4EIGB 3AB0B 5IVZA 5MP6H 4N2CA 4PD4J 4QRFA 3WXVL 2FJGA 4M7JL 5IMMA 5F89A 3OV6A 3CXDH 5FWQA 1J8HB 4N8UA 2HWZL 4HKJB 1A3QA 3KPOB 2O6DA 2VN3A 3MV01 3WEOA 3QIWD 2BXZA 3P2DA 3PQYB 4EZJA 4G42B 1N4XH 4HS8L 4BFIA 1W0VB 1Y18B 1VFAB 2B1HL 5T3ZE 2DAVA 4HT1L 5AAMA 3T71A 3FBQA 3QXAA 3UBXI 4PJIA 3UYOD 3O2VH 2OXHB 4KJQD 1CE6A 4DSYA 2DYPB 3LXAA 2VM3A 1VFBB 1J0IA 3DX2A 2AV1A 4HD5A 2BP5M 4OQTL 5KVFH 1U21A 1TTUA 1BQRA 1OSPH 5CN1A 5EC2A 1K6QH 4J27A 6PAZA 1BIHA 2MQ0A 3FQRB 3WY4A 1IZKA 2OV0A 1XD0A 4YDVA 4CJ0A 1P2CA 4AIZA 2X4TA 3W0WE 2I07B 4L05A 3U36A 1LK2B 3ARDB 4OF6A 3CFEB 4KU1A 2P5PA 3WFCL 1Q4NX 1RVFL 3K6SA 2QHRH 1I4FB 2K78A 1XD1A 5CR8A 1PZUB 3B1UA 3FSAA 5E00B 1ORSA 1ORQB 4EUPB 5CEZE 1S7VA 2I69A 2GTWA 4A7VA 2E46A 3REVB 4ETQB 4JFQA 1AO7E 4JPSA 3M07A 2QSTA 4J3SA 3MREB 1YYLH 4KI5D 4QHLA 1FO0B 4J3VA 2DLIA 2YLKA 5DXWA 4LCWB 4R7NA 5HDBB 1W0WB 1BW8A 1PDKA 2GABA 2JB5H 4JREB 4X6EB 3UGXA 3E8UL 1EERB 2OMXA 2J20A 4PP1D 4YR6B 2R9HD 4L4TD 5JHLH 2D9QB 3BWUF 1I31A 5EU6E 5C0AD 1U8PA 5ICXA 1Q1JH 2CRYA 1I7TA 2IANB 5JR1L 2QTEA 4KQ3L 4UILL 1EEYA 1WE5A 3MV9A 3QXVA 3FOMB 3MRKB 2AZAA 3RA7H 2NY3B 3CLFL 1NOLA 2NTSP 4LLYB 3T0EE 1NMAH 4E41A 1QX1A 4UYPA 3NCCB 1RZIB 3SBQA 5ETUB 3DV4B 35C8H 2V5TA 2OSLA 1J1OH 4PU2A 1WFNA 5I8CB 2YPLD 4FQHA 2GTZB 4OAWA 4P57B 3TWCH 5JHBA 3R4RA 4URTB 4R2GB 3KYKH 1DQMH 4TVPH 3ZSTA 1GYAA 1XF2A 2EXWC 2WN2A 1R3KB 5E6UB 2H2PC 3KPPA 5F9JA 5EZOL 3B7TA 4C4UA 4LMQE 3KGTA 5LBSL 4XNMA 2VXUL 3ULVE 1JWUB 4KOCA 5IHWA 3R4DA 1XF3A 2CR3A 1N70A 4OCNC 3NP3A 5E8NB 3LKQA 3AMKA 3BQUB 4NO0B 2GJ6E 3AS2A 4C56E 5T5NG 1C5DB 4E9TA 1OF2B 4XCCL 4KJPC 5IQ7L 2HVJB 1S8DB 1UUNA 5E6RB 4B3VA 4QD2E 2PPDA 1I7ZB 4J2QA 1FAIH 2ITDA 3WMPA 3VH8B 4MMZA 4P2RA 4L4VA 1BBDH 3NJIA 1BYPA 2RJMA 1B0GB 5IQLA 1RP9A 2H1XA 3JTSA 1FH2A 2XWCA 2O6FA 2Q76A 4RFEB 4CVZB 4JLRA 3HS0B 2BOBA 1AOZA 4NC0B 2Y2WA 4M61B 2E27L 4JFEA 1FP5A 4HKZA 5E4IA 4KKNA 5E8OA 4HLEA 5DJ2B 4KDVA 1ICTA 4LHQB 3T3MB 3SGEH 2P24A 1NDGA 4UCFA 5GPRA 1ZXKA 2VE6B 2W0PA 3BUDA 3NACL 4G9FB 4K15A 5ACMA 1DQTA 5D7LB 1MHCA 4W9EC 2W0FA 3TOPA 3HS8A 3RUGA 4OSUH 5DJZA 2R69H 1BVZA 4PJIF 2AQ3A 2VSDA 4UQ3B 3EJTA 4OTXL 3ZHDA 3T65A 2D03H 2W60B 3FCGA 4RGOH 3OKMA 2LGNA 1I1CA 1M7UA 2X9YA 4MNHA 4WI7A 4Y7MA 4N24A 2GUOB 2YR3A 3LRMA 5AOZA 4HC1A 5FC9A 4N8PA 4RIRB 3AG3B 5FCSH 4GSQA 2XFGB 3W9DA 5IB3A 3Q8BA 1JHTB 1KG0B 2UWEA 3KBFA 4FQJL 4LHJB 4U3HA 4YN3A 5IHHA 4N1EA 2WXQA 4XPBH 5KZCB 1HILB 3Q2LA 1RERA 1MVUB 5KANG 1CIUA 4X80L 2NW3B 3HI6H 3V0HA 2YK1H 3WS6C 5JLZA 4J3XA 2V9TA 2W80C 2XX0A 4TKWA 4WI9A 3RWDA 3EAKA 3MLZL 3QCUL 3L5JA 1DBBL 1MCOH 4Y2DA 3RGVB 2DQHL 3MFGB 3CUPA 1LP9E 3D6GA 5TE6H 4G70B 4NPYB 4OLWL 3T8XA 2AABL 4N0YH 3AQXA 1KY7A 4U1HB 4JPKH 5CILL 4GMSL 3QDMA 4AENB 3O2DA 4QTHA 3SJVD 3VXPB 1Z9PA 3FU9A 4PY7B 1NWPA 4OCRL 2XN9B 2GTQA 3AT9A 3ISRA 5I19L 1RKRA 4D94A 1PKOA 1N59A 4MNGE 5FYLE 3VGAB 2BHYA 3NSCA 4OZFH 1WT5A 4M43L 4JRFA 3W37A 1D5IL 3BW9B 1GHFH 2K6ZA 2OR9L 3C5JB 4JHUA 2X53A 1LK3L 2J5LC 2R4RL 1HSBB 4N26A 4PQXA 5IR1B 2O6PA 5HGBB 4DOHB 1A4AA 2R1YA 4GINA 1BG9A 1P84J 3CX2A 4ZW3A 3OPUA 3SODB 3HNSH 1AYOA 2EYTA 1D2PA 2J56A 2L3BA 4X98A 5E6ID 4HG4J 5IV2A 3UXFA 2HN7A 5KVEL 4G7YL 1ZV2A 1W72A 4Z8FL 1NGQH 2M2DA 2BO0A 5CSZA 1CICC 1PCXA 4DO4A 2LV4A 4U2ZA 3RL1A 4XP9L 3P3TA 1S3KL 5KTEL 5CCJA 1QQDA 1TTGA 4YHIB 1CS6A 3GPSA 1GR7A 2J8OA 2PUQT 2ZE0A 3BT2L 3LKNB 5EBLA 5DS1A 4HFUH 3VWKA 4RMQA 4DVRH 4F9LA 1UKSA 1YNKH 2EC9T 2QV4A 2NYKA 3L9EA 3IRCA 4EI5A 2R15A 3LMJL 4KDWA 4ONHA 3VXRB 2NXYC 2QV2A 3SDDA 2IH3B 2MHAA 4ODSL 4IBSA 3BPCB 1G7MB 3GSUB 4PCYA 3AM8C 2MQ3A 1FORH 3QJSB 3ARBB 1QRND 2YPKA 1ROCA 3MU3A 1RIUH 1TZHA 1U3HD 3AAZA 1SEBB 4R7LA 5ECGA 4FNLH 2X9WA 4Y88A 1PYWB 3O0RH 2OXGA 2HG5B 1SJMA 1ID2A 4BK4A 3ASNB 5D2NA 3QIBA 2F74A 3AREB 1IMHC 1U8IA 5CU5A 4ZS7L 1ZTXE 2NQ3A 5I6MA 2N7SA 4X6FB 3VXNA 2MNJB 4AEIH 1UXSA 1LD9B 2IF7A 2VL5A 2XG4A 3UZEC 4UOW0 2IWKA 3PGFH 1AR1B 3IETA 5GS0C 4GG8B 4EXKA 3CDGB 2D7OA 4LGPB 4RDQG 5DT1H 1A6ZA 3PDGA 3RUGF 1ZAGA 2V37A 4E9VA 2ZIDA 2Q86A 1PSKH 3Q48A 1YEIH 2HKAA 2OP4L 1KB5H 4NWTL 5DA4A 1FZKB 2WQVA 2ZKHL 3SDYH 1QFPA 1T83C 3TC9A 2XTJB 2E7CA 2Q9OA 2CCLA 5ADPL 3D25A 3QWOB 5I75B 2P45B 3EGSB 4PJBA 1E4XI 2CXKA 5G55A 4PB0H 4WW2B 5TQ0L 3KYOB 2UWEF 5I8KL 3QI9B 1KGXA 3ZTDC 1N5YL 2QLVB 4Y1AB 4FADA 1JXJA 3MV8A 4WWKC 2DZEA 2GQHA 4W9JC 3FQYA 1XVSA 1EZSA 5DEGB 4ZODA 3ZHKA 3L6FA 4A63A 3IKKA 5D1QA 2EDEA 4Y4KC 2ZWNA 3B3BA 4Z7NB 5BXFB 1EXHA 2DIAA 4CSTA 3CFBB 4Q6YA 4NHCH 4KJWC 1I8LC 4B97A 3BGMB 1N64H 3P73B 2RALA 3TXAA 3A22A 2E8YA 3GSVA 4TLSA 2G60H 2C7FA 3EGXA 3K8LA 1GH7A 4TSCH 3EHBB 4NZUH 2Y7MA 5CJ8A 1CL7H 4RA3A 5GGVH 1BEXA 2GUYA 4W6YB 3ROOB 5CJQL 3QZWG 3HW7A 3HZVA 3OBAA 7PAZA 4O02L 3U7YH 3ME0B 1MHHB 4IRJB 1T3FA 4ODXA 3LH8A 4BDVB 1JMXA 1P5UC 4YFLI 5ENWB 4RSYA 3MLTA 3UZQA 3DO7A 5IESL 1ZMYA 3FQWA 1A65A 4CRPA 4H4NA 4HWNA 1EQWA 1SN5A 2VLKA 4JN2B 3KH4A 4ZS6C 1NMCC 4P06A 5D72L 2B1AL 2WP3T 3H7LA 3TFKC 3DK2A 2WIIB 3O6FD 3EUDA 1OCWH 2HPOA 3H9SA 1SRDA 1E5AA 4XP1L 2DEYX 2EKSB 2DPKA 2NT0A 5B1JC 4MDIA 4F7PB 2GAZB 5JPNC 4X0NA 3HKFA 2F19H 3GZKA 1MG3C 3NQIA 4M6ML 3ZYIA 2EUZA 2VABB 3GIZL 4LCCC 3UERA 4PG2C 4CGUB 2FJFA 3AG2B 5F6HJ 1KC5L 1K8DB 5T1KB 5I1JH 2UXVA 1K4CA 1H3WM 1TJGL 1IAIM 1CD1A 2ZOKA 5I2IB 4FFZH 1SUJA 2UX6A 1H15B 4V1DA 3GTVA 5E5MB 3ZKMD 5KYUB 2VQ1A 1D9KA 2CUMA 4CN6A 1ET5A 2DIJA 4JM4H 3GBNH 3TYGH 3H3PL 1ZVSA 1DFBH 2GK0A 2AXGB 2XWJA 1NCBH 3DVGB 3QDJE 4LBEB 1AS6A 1TXKA 1PEZA 3VI4A 5CN3A 2HX8A 1KCVL 3UTPD 5FAAA 5AZ2H 3OKKA 3WLBB 1NGWA 1KV7A 5C08A 3O3EB 3HAEG 4ODVL 1FDLL 3K5RA 5I24A 3LZFL 1RIHL 4H1LB 3PDDA 3V6OA 4XODA 3QORA 3MRIB 3KHQA 2ZKMX 4PTTB 3JT0A 4L9DA 3D2UA 2NQCA 1GAFH 4PS4H 1Y07A 1G7PA 2VIRB 4O9HH 4UQIM 5T8IA 3II3A 3GRGA 2V8LA 5IEHA 2C8NA 5HI5C 2F5BH 4EJ1C 1CG9A 1R4XA 5DJ6B 2C7UB 5BOPA 2GKIA 2E7BA 1J9RA 3S5LA 3SCMD 5MENE 3K2UH 2YAQA 2YZ1A 3KBPA 4ISVB 2HVBA 5IHZA 3VM5A 2OX5B 4GQ9H 4LSRH 1SJHB 2XZCH 3ALWA 1I3VA 4XTRD 4NM4H 4KHXL 4XMXA 4G43A 4KMTH 4PJ8A 5H4YA 4RAUB 1TCRA 4NP9A 3V0WH 3IAGC 4FFYA 1OGTA 1MEXL 3X1BA 1NBZB 2X3CA 3WJLC 2IOMA 5LG1A 4BK8A 1YN7B 5CD5C 5JW4R 5KJRH 4MZIA 1CU4H 4S1RL 2VMEA 1QO3B 5EO9A 3TV8A 1J8HA 3MRGB 3C60A 4IRZH 2AQRA 4PJBF 4EDWH 1IBYA 5LHDA 4K3DL 4JM2A 3PQYA 4G42A 4LEOB 5F8QC 3WKMH 4DQOL 3WFDH 3WN5C 5AW9B 5ACLA 4K3JH 5I1HL 2VC2B 4I2XB 3M1BA 2AI0L 1TZAA 1NTDA 3W3BA 5C3IA 2Q3ZA 2XKUA 5FYKH 4DWHA 5AWNL 3DX1A 5SWZE 2BDNH 2MOQA 3ZE2F 4ERSL 1KN2H 3MJ6A 4PG9B 3LEYH 1VFBA 3FDWA 4PJ5E 5ICYB 1N26A 2G2RB 3KWXA 3F05A 5EU7E 1E6JH 1SBSH 3TCLA 4HH9B 3Q2VA 1SDAB 3V79C 2QADD 1TQUA 1KXHA 2HKFH 2QFRA 1GYWA 2EDDA 3MV7B 1RZFH 5DMGC 3FUEA 2P8MB 4F58H 2D7TH 1F11B 4LAJH 4YO0B 2OL3L 3S36L 1BXXA 1HHJA 1M1SA 3ARDA 5F7AA 1ADQA 1KWKA 3K71B 3CFEA 2ZTBA 2YD8A 4HJIA 2PYEA 3DI3B 4JMXA 4Q9BA 1JXFA 1B88A 5D1ZB 1G6RB 5J12C 3EW3B 3BJLA 4EUPA 3CPLB 2VUKA 3JWDH 5CJBA 1CDCA 2JCCA 1J9QA 1CDGA 1EFXD 2HRPH 4W4OA 3FB6B 2OI9C 3RPIB 2A0LD 3AGWA 3O3DA 2FBOJ 3LPFA 4I4WA 4XVUC 1YY8B 1U41A 1FO0A 2E9GA 3EKCA 3CZGA 3NSFA 2F54E 2J8HA 3O8XB 4I0PC 4PS8A 1P9MC 1W0WA 3SGJA 4X6EA 2ZQKA 1BZ9B 2BRQA 5EWIH 2K8MA 3D33A 4FFYL 3VRLF 2WGNB 1FGNH 3I3BA 4KWUA 3TZVD 3UTSD 5CR1A 2FHCA 1ADWA 1YQVL 1UYWH 3X14B 2EIEA 2NTFA 4HKBA 5KVDE 1KIPB 2WP3O 1USZA 5DGRA 3MRKA 3T08A 4O2EB 4G7RB 2QSCL 5CCKL 4YHYC 4XAWH 5HVHC 3NABL 4LLYA 3TNMB 4KXZI 5IB5B 1RZIA 2CALA 5JA9A 4Z7OF 5ETUA 5D2LE 4J3OH 4P23D 3M6DA 1SLWA 5FUCE 4HVBA 4MCYB 3FQ2A 3EYQC 3HNVH 5FO2A 5I8CA 5H35B 2GTZA 4P57A 4L18A 3CU1A 3TTSA 4ABVA 2I85A 5DR5H 4B5EA 3CFJA 3RWCA 3N50A 4I85A 4WDIB 1R3KA 3CXHJ 3OXRB 3RDTC 3QFJD 4IU3B 2FIKB 4B95C 1AY1L 5C0ND 1OQOA 1AIFB 5HHMB 2JKLA 3VX1A 2HMID 1XBDA 3VI4F 5ANHA 2H3NA 1JWUA 4FQIH 1OLZA 1Z5HA 3B1TA 4HOXA 3BH9B 2Z31A 4Z7UE 2FIRT 3WNKA 2D9CA 3PXLA 2A9MH 3K1DA 4JS7A 4J3TA 1LMKA 3SY6A 4DKEH 4JQXC 1OF2A 2ZXQA 4UAOB 5LBVA 1H3UA 2AQNA 4UINL 1I7ZA 4CU8A 5LBGA 5FF6B 2UZPA 4LOFA 1P7QA 3V5KA 1TQCC 3P9LB 4HWBL 2QPSA 1LLAA 3OHMB 1UD3A 5D6DA 4RFEA 5E9AA 5C07D 2AJUL 2BH0A 4CVZA 4F37K 3HC0B 1YN6A 4A2MA 3LIUA 1Y6KR 2E7DA 3NA9H 4F57H 3GIVB 2P52A 2YRZA 3PWVA 3NH7H 3ZU8A 4KI5E 2LHAA 4QXUL 1YJDL 1IEBB 4MDJA 4PRNA 1HNFA 3CN0A 4NQQA 3SPVB 5HHXH 4L8CB 4F9PA 2HZHA 1KIUA 4QNPE 1S6NA 3HG1B 1MFBH 1AQKH 2VE6A 4FFVD 1Z66A 3QEQD 4G9FA 4L4TE 3WFBH 4MA1C 4POUB 1C12A 4JM2F 5C0AE 4BH7B 1QSFA 1A1MA 3IJ7A 3IJSB 4OT1H 4GH7B 3DA0A 3ILQC 4KK5C 2IGTA 2VMDA 3LOWA 1K3ZA 4P2QA 4FL4B 3SKMB 2CHZA 1CLZH 5F93C 1UJ3B 5L0QB 1JV5B 3LEVH 2WYZA 1UCTA 3LX9A 4XOEA 2Z1PA 3D8MA 1HAUA 1GYCA 3EYVB 4HIJB 4LOUD 3Q1SL 3CSPA 3OX8A 4GAJH 3OF6A 2GUOA 4CC4C 4JKPL 2D3NA 2XA8L 4RIRA 4FABH 5LXGL 5EEVA 1IQDB 1OAYH 3FBKA 1JPTH 2X44D 3FQXB 3UYPB 1NGPL 4JY6B 1JHTA 1AXSB 2AAAA 2CBOA 3BKYH 1ED3B 5GXBB 2AJSL 3B2MA 3EJYC 1XX9C 4Y5XA 2HWZH 1HILA 3ET9F 1AG0A 5E8EA 3BI9X 4LSSL 4JDTH 1M6OB 2NW3A 3UAJD 1YJDC 3OSVA 1FFOB 4ORGB 1YZZA 4GAGL 3P40A 4HT1H 2VN7A 1GCFA 2ZP0T 3UYRH 1KEGH 3MGOA 2C3VB 4IS6A 2JCCF 4ZZFA 2P5EB 4XCNB 3PWLB 4QHNA 5CD3B 3OMIB 4F7EA 3QFGA 1KJVB 1INQB 2Y6SD 4L5FL 5F0LB 4BZ2H 3MUZ1 1OAKL 1BZOA 4U1HA 5CP7A 4UZGA 4AENA 1TR7A 4P4KC 4OQ1A 4PJXE 1JRHI 1EX0A 3FS9A 1RL1A 2CDFB 4PY7A 2FX8L 2X0VA 1UD2A 2NRDA 5AB9A 2R0WL 3NPSB 3QS2A 4OLZL 2OMWB 4M93C 4C54A 4CN4A 1ZT7A 1CF8L 3B9KC 4PYHA 4ZSOE 5J57B 1FCCA 3BW9A 5CZXD 3OKNA 3DROB 3C5JA 5MEPB 2X1WL 2WWKT 1HSBA 4GI6A 3WFCH 2DQUL 5ITFB 3L1FA 2A77H 3S37H 1O6TA 2OQJB 4ODTH 4XH2B 1AMXA 2BIQA 3TA3A 2ID5A 4GKZB 4WAFA 3NSYA 2CBTA 2V5MA 1JZ6A 1QZ1A 4NJAL 5T5NF 1JG9A 4BRVA 4HIEB 3VQLA 2HKHH 3ZXAC 3BP6B 3NP4A 5AZUA 4PGCA 4GAAA 4ONFH 1AMYA 2MOGA 1OCZB 1UGNA 3RWGA 5DD0L 1ZS2A 3ORJA 1YMHB 4AYMC 3BGFC 1HH9B 3ERXA 4LRIA 4PJCA 4U1LB 2ZXEB 1VACA 2FUQA 1WLHA 3QQ4B 2GJZB 4OCSH 4KKZA 2V4LA 1TFPA 1Z9SB 3Q13A 4DO6A 5DC4B 4UILH 2EDOA 3NIFF 4LASL 4L0YA 2IAMB 4OCYL 4A68A 4DKFH 2EO9A 1AO7B 1IGFL 4IOIB 4L2YA 1CXEA 2WYIA 4ZUUA 1HE8A 3BPCA 1R0AL 1G7MA 5I17B 1XGUB 2D7QA 4F3FB 1SJEB 2BS8A 1S9WB 5CF3A 1FVDB 1YEJL 2C4FU 4K8RL 3UG4A 3VWJA 4JFWA 4UYQA