1BYNA

Solution structure of the calcium-bound first c2-domain of synaptotagmin i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords PROTEIN (SYNAPTOTAGMIN I)
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1998-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bynA00
4HLEA 3LJ3A 2K3HA 3PRZA 2WXPA 4FJYA 3L54A 3L9BA 4FJZA 2X38A 4AOFA 3F04A 4G11A 4FULA 3PYCA 2NCEA 3M7FB 4NPJA 1UOWA 4XX5A 3TL5A 5KJ7E 1UOVA 2CM5A 3GPEA 3R7QA 4L1LA 1BYNA 4IQHA 1BDYA 1RLWA 2CJSA 2DMHA 2K8MA 5JHBA 1K5WA 3ZW3A 2ISDA 2CHDA 3FBKA 4F92B 1W15A 1DJHA 4F93B 1E90A 2QZQA 2CJTA 2NQ3A 4TV3A 1WFMA 2CHXA 1E8YA 1BCIA 5JHAA 4PS3A 3PREA 2ZKMX 5G55A 3MJWA 1TJXA 4EZKA 4IHBA 4XZ4A 3HHMA 3SD5A 1W16A 4KZ0A 3FDWA 4FA6A 3F05A 2WXOA 3KWUA 1DJWA 3R7RA 3S2AA 3T8MA 3ZIMA 2Z0UA 4HVBA 2Q0ZX 3QAQA 4QJ3B 5H4YA 4ANXA 3HIZA 4V11A 4LCVA 2ENPA 4FADA 4WWNA 3QK0A 3ZVVA 2KI6A 3L17A 3DPDA 4OVUA 3TJPA 2WXIA 1WFJA 2FJUB 2A4ZA 3PS6A 1YRKA 1E8XA 1DSYA 2B3RA 2UZPA 3APDA 2CM6A 3IM1A 4URKA 4BFRA 2CHWA 2Y3AA 3ENEA 1DJZA 1QATA 2YOAA 4QJ4B 2WXJA 3CSTA 4PS7A 3QJZA 4WWPA 4ANWA 3APFA 3OAWA 2WXHA 4WWOA 1DJIA 4J6IA 2YRBA 3RDJA 4FHKA 1E7VA 4KZCA 4FLHA 4AJWA 1RH8A 4BGDA 4Y1TA 3NZSA 5H4ZA 2K45A 4Y1SA 2QZ5A 4XE0A 2N1TE 1V27A 2WXKA 4TUUA 3NSJA 4WAFA 3IBEA 3L08A 4JPSA 2WXFA 4ANUA 2RD0A 4FHJA 4GNKB 1A25A 1GMIA 2K4AA 4LT7A 2FK9A 4EZLA 4KITB 3L4CA 2LHAA 4QAMB 4DNLA 3HN8A 2D8KA 2ENJA 3F01A 3N5AA 4GB9A 2NSQA 3F00A 4OVVA 3NZUA 4ICWA 1DJXA 2V4LA 1E8ZA 3OHMB 1HE8A 4TS6A 1E8WA 1RSYA 4L23A 3CSFA 1CJYA 2WXNA 3ML9A 4L2YA 5CCHE 2EP6A 3KWTA 1DQVA 5G2NA 3DBSA 3W56A 1UGKA 3QARA 2JQZA 4WEEA 3ML8A 1DJGA 3W57A 2DMGA 4F1SA 4ICXA 4L1BA 4EZJA 4QJ5B 4F91B 2WXGA 1E7UA 3TWYA 3L16A 4PS8A 1QASA 1DJYA 2WXMA 4MJJA 2ENQA 4DK5A 2Q3XA 4NP9A 1TJMA 4NS0A 4NPKA 2R83A 3QR0A 4ANVA 5EDSA 3L13A 2A5UA 3RPBA 5CCGE 2BWQA 5CCJA 3P2BA 2CHZA 3B7YA 2WXQA 2WXLA 3QR1A 5T8IA 4A55A 2WXRA 3JZYA 4LDCA 3PFQA 3APCA
chains in the Genus database with same CATH superfamily
5E99H 2WQSA 1JK9B 5EFIB 2E75C 1TQTA 3NJLA 1G0DA 4FFTA 1A6VH 4GUQA 2I9LB 5TTRA 4GIAA 5B38G 5C9JB 5D93C 5EN3A 1S3KH 4YC2C 4Z0XB 3UTPE 3JWOL 4LE8A 3ARBA 4ONHA 5EA0H 2A74A 4QXTB 3G5XB 2W0KA 3VH8B 5AALA 2R9HC 4K55A 3D69B 5DC9B 4JDVB 1A6UH 1N12A 5LNEA 4WEUD 1ZTXL 4KTDL 3A0OA 2UVFA 1QI5A 4HHWA 1EH9A 1SUHA 3PXHA 2QHRL 4M1DL 4XCNB 2C4FT 4D9QE 3QNXB 1OAKL 5ALCH 2R2HA 3VTAA 5DZAA 3T71A 4DUVA 2VLMD 3J8F7 4XVUC 3VAEA 3RNQB 3WS3A 4KI1A 5BVPH 4EAEA 3GSNB 1U3NA 4KXCA 5E24E 5GS1C 3N43B 2VXUH 5C0JB 3IJYA 4ZK8A 3RL1A 5JA9A 1OB0A 2BSED 2LU4A 1MFBL 1TZGH 5DS1A 5DS8A 3JV5A 5JORB 4WW2F 1DUZA 4D3CL 4OQTH 3FPYA 2DQHH 3QEUB 2BC4B 4NQSA 5F7BA 2W0PA 3Q5TA 2HTLD 2ARJB 3US1A 3DECA 1B4JH 1KT2A 4TNVK 1GPOL 5FFOA 2A0LC 4YBLC 3X11A 3DURB 3T6XA 5HJDA 4AT6A 5E6SB 3FU3A 4H20L 5I1CL 3CBKB 3LTVA 1GZHC 1MLCB 1U92B 1BQHA 2X9YA 4KVNH 4JO4L 4ABVA 4U0RB 1K9TA 5C07A 1OP3K 5DVKA 1MF2L 3ULUC 2K78A 1VKXA 2ZPKL 1YNTA 1OAZL 2ZWSA 3CN4A 2CKBH 4XVSL 3T0BA 5JIPA 4G9DB 1XXDC 3V4PL 2BCKA 2AJVH 2WN2A 3QP3A 4HU2A 3EG9A 4HD9A 1E8ZA 4YGVA 1JZ7A 1Y1UA 4L23A 3KG5A 3ISYA 4WV1B 4Z7UB 3MJ8B 3SDYL 4HLZH 2HKAA 1SXCA 3T6QC 4FYQA 4Y4FB 1NMCC 3HW7A 1EVTC 3KW7A 4L3EB 4LCCC 5EPMA 3UAJD 4I0PA 4GAJH 4J4PA 1EXUA 3MREB 4M6OH 5FAAA 3FQUB 4OFYD 1ZHNB 1NIAA 1EHLH 1IE5A 3G08B 1GGBH 1YJDH 3ARGB 3EJTA 3ARFC 3K8KA 3H1ZA 3QJFA 3CSGA 3S8GB 1EZSA 3SBPA 4B27A 2AANA 1U6AL 3REVB 1G7MA 3NJFA 1V54B 1KIPA 1FL6A 1HHJA 4PG9B 4CMHB 4X83A 2EVHA 1QHQA 4TPRL 3WSQL 5FYKH 5C0CD 2XWBA 2WQXA 2ZUYA 5IIEA 1J5OH 2E47A 1X9QA 1AFVL 1WS8A 2N1KA 4FC3E 3P4MB 4FABL 4G8IA 1F97A 2COVD 1MFDH 3L2MA 1U8LB 1ZTMA 3DX7B 4JDVA 3MRFB 4L1TA 4AQ1A 3QUHA 1NCOA 4IHBA 4I2XE 4PJGB 4X6EA 1DE4B 1HKLH 5GSVB 1T1XB 3IDGA 3EGSA 1XGQB 5CU9A 1I85A 2XX0A 3D2UA 4MD0A 4ZTOH 3GBMH 5T1JA 1QI4A 4JQXA 2EIEA 4U3CA 5H4YA 2A6JB 3QUXB 3BUYA 4RGNE 4IMLA 3FT4B 1OWWA 1AOHA 3MV01 3BMWA 4O2CA 4PG9A 2QSCH 2J21A 4WFHD 3G6DL 5DQ9A 4GKZB 4IIQB 2ZG1A 5F7YC 5F71A 5T1DL 2NY2B 3TV3H 2CJUH 3AS0A 3HI5H 5HYEA 2AVGA 2X2HA 2EADA 3SDDA 3MLXL 4E9YA 2IWKA 2AJUL 2UYLA 4LQFH 4TLUA 3IETA 4XXWC 1XF5A 2WXHA 5EOCH 3U4AA 5SX5K 2DM7A 2RFXA 2J8UF 5AVXB 3U4EA 4HXAH 1YYMH 1KTDB 3H4HA 25C8L 4XE0A 1T0MB 3BDBA 5EIIB 4XNBA 1AD9A 5AVZB 1B4RA 4NO5B 4CGUB 2BSEA 1EAPB 5T3XH 3ECQA 4RWYH 4YSPA 5I5MA 2DIAA 1HX0A 3DVFA 5IJBC 5F3BA 3VRJB 1IX2A 3JTTA 1QFPA 5DQ9B 3M1CA 4H1LB 1SFDA 5L6YL 3L3KA 4DVBB 1MCSA 4PTUB 2IAMB 4FG2A 3B5GA 2J6EH 3CMOH 1HHIB 3MV11 43CAB 3STLB 5MENB 1ZSDA 1WAAA 1DQIA 5GS2H 1I8IA 2D7TL 1Z3RA 4YHMH 3MLSL 2KYIA 3PFUA 3VXUD 4EQ2A 1T20A 2ZD0A 1KB9J 4KY2A 4PS8A 4F20A 2DLGA 4YSDA 5CIPH 3ARBD 5JW4Q 5KANI 3ULVH 5FDWA 2ZAIA 3BP6A 4OQ1A 3T8VA 5D7EA 3WAJA 2JCCB 4D9QD 1GY2A 2QTVA 1AR2A 3TM6A 3L3KB 3FNKA 3HMWH 3LJ3A 1QTSA 1IGFL 5DRWB 3TO2A 3VYOA 1GAFL 4NUGL 1JRHI 3QQ4B 4Q2ZA 4O2EB 4PGZA 4HKXA 4TNWF 3GFUA 3IDNA 2PO6A 3CQQA 4X99A 1DQTA 1JNLL 4GG6F 5CFHA 3ABKB 1MJ8H 3DNKA 1FFNB 4ZQTA 2BXZA 4PY8I 2XNAB 1HAWA 3G5YA 5J3HC 4K2UL 3MACL 5F9WB 1K5NA 3TCXA 3FU0A 4C83A 3SHSA 1ACXA 4XX1E 3HBQA 2C1PA 5IY5B 1OSZA 4C47A 1A6ZB 2X6BA 3BPCB 4HJ0D 4YDVA 3LZPA 4HGMA 1PY9A 3NJHA 3O6KH 2F5BL 3QUYA 3O2WH 3FKUS 2ZYIA 4ZODA 4AIOA 2QQNH 4LL4A 4QHKJ 1DLFH 5F9OL 2BZCA 4D0BB 3L3HA 4Y4HB 4HUVA 4PRNA 1NKGA 3DX7A 1HFUA 3HTLX 4PWHA 2FQDA 2HFTA 1Z3GH 2YC1B 1DEEA 2DQCL 4Z7VA 1T1WB 2V7NB 1MNUH 3DA0A 3TT3L 1VEOA 4UM9D 2ADIA 1YEJL 1UD6A 3D39A 3ETBF 1ASOA 2PW1A 2ZYSA 2QPFA 3BZ5A 1MRDL 3SGDI 1CYWA 3T8XA 1URIA 2NYZA 5F7MC 4WEBH 5A43C 1OSZB 3MI6A 5ECGA 1NGXB 3ARQA 5IFHL 1OPGH 4X6DA 5D7IA 5LGKA 4GLRI 4PJ6A 1GGTA 5AB2A 3WKQA 3EADA 4XP1L 3OPZL 4G7QB 4I9WE 5E4EC 4BV1A 3ECVA 2P5ED 4HHAB 1P7QB 4TRPL 1H6TA 1FZMB 2EIZB 2VL5B 1DFBL 5HGAA 3CZSA 2Y23A 3QIWC 2WTRA 1OK0A 3H9SA 1G7HA 2X40A 3VTTA 1ASQA 3WEBA 2NY5C 2OQJA 4NNYB 3FT0A 4XCCL 3RVTC 4FQIL 4I87A 4LSRL 4DNLA 5GGVH 1QLFA 4N5ED 3D3VE 1JOIA 4G6JL 4A37A 3PV7A 3E80A 4JUSA 1HS6A 4L8DA 3TT1L 1TZAA 2KZBA 1E50A 1U8LA 3O6LH 2I07B 3STZB 1Q0YH 1G7LB 2EH8H 1GIGH 3HZVA 4X6DB 4NQCE 1MCWW 1VZGA 5DJDA 1DUYB 4F3FA 4FTDA 1RXLA 3ET9F 2BSRA 4L3ED 3MRGA 4ZXBC 3L3JB 1ZDSA 5JW4N 1IBGL 3U7WL 4Q6KA 1QASA 3PWVA 1JXKA 5HTSA 3W5NA 1TTCA 2A5UA 1G7HB 1CXFA 3W9DB 3ESPA 3NSXA 5B39A 2R29A 3MRNB 3NPSC 4Y9EA 2DYPB 5EO9A 5C0BB 2R0ZH 3SPVA 4EQ3A 1PKQE 1RSFA 1MFUA 2JJSC 5D5MB 3BP6B 4AUUA 5C6TL 2X4OB 5HHNB 3NIFE 4M00A 1SRDA 4J27A 3UJIH 2WVUA 4KRLB 2JKXA 2YA1A 4G8EA 4HV8B 4LEXL 1IC0A 4APQB 2VAAA 1GYWA 2ZXBA 4NIKB 3DHJA 5K39B 3O6FA 5JLZB 4B9KC 3SDCD 1NIFA 5I1EL 1NLBH 2YN5A 4IGBD 3IYLW 2YIHA 1XIWB 3CQFA 1BLNA 3LYRA 4GMSL 4YSSA 2DWDB 1M7IB 2PWGA 4UM8A 5A16B 4AL8L 5JYLA 3QQDA 3D06A 4JZJC 2X10A 4CKVX 4JDTL 4X5QA 3BWZA 1KWGA 1NJ9A 5CCKH 4OF6A 2HX8A 3KYAA 3ATAA 3OXRA 2WBXA 2QHRH 4JPIA 4M1DH 5F1IA 3F7RA 2R27A 2CLVB 3QDAA 3DPDA 2IBBA 5TK4A 3TONA 4WW2A 3KPPB 2VDNB 3GRGA 2KPWA 3CFEB 3WI9A 4PY8J 3CFMA 2Z31D 3KLKA 1KEML 1YEIL 5DD6A 1T89C 4Z7WB 2BCMA 1ZANH 3BN3B 2L3BA 1X7TA 2YQ2A 3FTVA 2Q1EA 2H2SD 3T6WA 5DYFA 3TO2B 5BV7H 2EEBA 3BQUA 4X5WB 3S3JA 1JYWA 3NIFB 3Q8FA 3FO0H 3OGCB 4DP5X 3ZE0E 1U91B 1AQKL 1G9EA 2IGTA 2W65A 2YSSA 3TX4A 4ZNCD 1A65A 4HDIB 1E28A 2I7SA 3VD4A 4APXA 4G82A 3N9GH 5C0IA 2DQEH 1L4IA 4ZTEA 5CN1A 4LLYB 2Z91B 5FO7B 2BIOA 1IMHC 3CFEA 1ZHBA 3HUJE 1WYJA 2FBJH 4LVEA 4N20A 3VVVA 5MEND 4KI5D 3EDJA 3OHMB 1HL9A 3PL6D 1EZUA 1QLFB 3B2VH 4ZMAT 3RVVC 1OLLA 3LRHA 3Q44A 3KCPB 5K93A 3RPIB 5TPWL 2E7HA 4MJID 4XO5A 2DMKA 3U0TB 4MQXD 5CKGA 3OAZH 1NSNH 4NHUB 4DQOH 2X12A 3DX6A 1IGML 3GM0A 4G1MB 1A6WL 3ZYIA 3INOA 3MZTA 4OZFA 2EDMA 2DN7A 1XF2B 1MFNA 3RTQB 4B95C 3DSNA 3HR5A 4IKIA 4GSDH 5F7DA 2P5EB 1N5AA 4JFTA 4P46B 1DTUA 4G6AD 1HN1A 4LLUA 5IJVA 4WK2B 1WAEA 4Y16D 2W0FB 5HYJA 1ZHBB 4FMVA 4EIGB 3FQNA 3MOAH 3K6FA 5EUOA 2P45B 4L3FA 5EMYA 5FYJH 2DWSA 2GY5A 2OX5A 3SPVB 5E8OA 1XB6A 2BSCA 4U4IA 1NL0H 5BUPA 5LXGH 5D5MA 3W2DL 4Q74A 3GINA 3I02A 2K8MA 3I6LE 35C8L 1C8QA 4NDMA 5FGRA 5KYUA 2OS7A 3FBKA 1QVOB 1A4JB 4KMTH 1RZ7L 1S3KL 3SBWA 4WY7L 4K94H 5JDSB 1RUQL 4FYTA 5AWNH 3DJSA 5LBVA 4LSRH 4AQEB 3FTUA 5EHFA 4HK3J 4KKBD 1TCRA 4RGND 3DARA 1X5ZA 3D0LA 4QY8A 1OCRB 2AJYL 1FFQA 3QQNA 5IREA 2IXQA 3IFNH 3E2HB 3L3DA 4XP9H 3QXDA 1HXMB 4AGLA 5KYYB 5TH2B 3P30L 4U6TA 3HS0C 5HYJB 6CGTA 2WQ8A 1YEFH 3BOVA 1KPRB 3OKDB 4NQDE 1L0YA 1Q9OA 4JKKA 4O02H 3IXAA 5CP3H 5HI5D 4U1SA 4M6ML 3UG3A 3P0VH 4H7VA 1MRDH 3F7VB 3JVFC 4W9HC 1EFXA 5CBEA 4HIIA 4ZDHA 2VXSH 3MUZ1 2KS0A 4LBAA 3CCHB 5JDSA 5HYSA 1SOXA 1ZA3B 1TZIA 4D9RE 4K7PY 3T0WA 3IDYB 3AY4C 4Y5XC 1DDHA 3QHZH 1A1NB 3ESVF 1GSMA 2GB2A 5TJWK 1CIUA 3Q8BA 3KPRE 4Q9QL 4UM9A 4MYWB 5AZ2L 5EEZA 4XPAH 1CURA 1QOKA 2B59B 4I4WA 4PREB 5CSZB 3VXOA 5D2NC 3EKCA 3L2LA 3NZ8B 2AXJA 4H88L 4XWGL 2VZOA 5D7LE 1MWOA 4HKJB 5IVZA 4PJ8C 2DWXA 3FRPA 3WMPA 4R7NB 4N8VA 5TF1L 3EO1B 4F8PA 4GKLA 4OM1H 1YEEH 2XFGB 3UZEA 3M17A 2WWMC 3WHE1 1A0QL 4WU5B 3WNPA 4PJHF 2FYYA 2CLRB 2Y1YA 2R0WL 3MLWH 1BOYA 3N85L 4GSQA 1IU1A 1CXHA 1T1ZB 5ISZA 1X4ZA 1V05A 2WOYA 3PGCB 2DQTL 4IMKC 5AZEL 5EU5B 4IRSB 1JI2A 1TZOA 3WKML 4BUQA 4MJJA 5JPNB 2A9ML 3VFPA 1A14H 2AJXL 1OTUC 3QDJB 5DJ8B 4GAGL 2I9LA 3ABLB 3V5DB 1PPIA 1RQ5A 4L0PB 4Q8BA 2PN5A 2QADC 1MNUL 2QSVA 2QR0B 3K2UL 5DEFB 4PJDA 1M2VB 1ADQH 3HLAA 2CJUL 3HI5L 3LMJH 2Y7LA 2MFNA 4IS6A 4JL1A 1NOAA 5EZLA 2XN1A 3OM3B 3MNVB 1MHCA 4UT9L 1N6UA 5JHDD 3C2AH 5E6IC 4JFXA 1UASA 1O6VA 5MEOA 3VFWA 1ET5A 1COBA 5IQMA 5AD0B 4AGQA 1AD0B 3G6JE 3BP4A 4KGLA 5DRZB 1UD5A 3JTSB 3WGVB 1MW1A 1MIEL 2BK8A 1BVNP 3BWUF 4ENZA 1N2RA 4LPUA 3DSFL 1CFVH 1FSKC 4H25A 4NOBA 5K5YA 3HA0A 1XEDA 2XXMB 5IHBA 1HSBA 4KK9C 3FRUA 3HRZA 3P9LA 5INCB 1XH2A 2OSXA 5HDOA 4ANXA 3LN5A 5E1GA 4CBPA 5I1IH 1Q1JH 5I66B 4CSSA 4JCWA 4AKPA 5I0ZA 1T6BX 3RL2B 4FQJL 3ZT7A 1C16B 3L3DB 3WFCL 1AIFA 1E27B 3MBXL 5EZIH 5I8EA 4C4BA 1KJ2L 3GSUA 1MWAA 2GT9A 4WSKA 4U1KB 4Z7QB 4FQXB 4OCSL 3FN0H 1NANH 3SDAA 2C9UA 2GJJA 1T5XB 5KYWA 3GKZA 5IFJA 1ZEAH 4FJ6A 2E6JA 1FE8H 4FHKA 2MPVA 3ULAB 4WENB 4LL1A 2P8MB 4EEEA 2V5RA 2DJ4A 2JELL 2H6PB 5DZVA 2XA8H 3P3TA 1L9NA 2N7BA 1TQBC 5DD1H 4DOHB 2DY2A 2YAFA 1G7QA 5IJKC 5CD5D 1YMHA 1Q9KB 2HWZL 5KVFH 2AFNA 2H26B 2UUDH 3VB9A 4UQ3B 3FS9A 5AFAA 2FHCA 2G60H 3LNIA 4F7PB 1KTJA 5CMAB 2VDQL 4GKOA 2H1LM 4XVOA 4DSYA 4N6QA 4LLQA 3WIHL 4DKEH 3SYPA 5AEAA 3MLZL 4RDQF 1A3RL 1I1AB 1O9WA 1KBVA 1MF2H 4JDTH 3VI3A 3SZKC 3FHEA 3FO9A 1DQVA 1I3RB 3MBWB 3PQYB 3TZVA 3UBXI 3WIIL 1A02N 5LQBH 1ODAA 2DL9A 4F1SA 2J1YA 3NUKA 5F6IB 2B77A 2E7LA 4WW1B 1CLZL 4ILDA 1A1MA 5D93B 3GNML 3T2LA 4H8UA 4RAHA 2AV1B 3ULVE 3IMWA 1ZHKA 3GLEA 2M83A 3NK3A 1CG9B 3P2BA 4OCLC 1RHHA 1KBKA 2K9UA 3GJFA 5T8IA 2D7MA 2EYRA 2NXYD 4YO0A 2UWEB 3L7EB 1HOCB 1T66C 3N06B 2RQ8A 1MPAH 2Y3NA 4LHUB 1T1YA 2EDEA 4ELMA 4OIAA 4PJFE 1NEZB 1P6FA 3BAXA 1TVHB 3HE7A 2IQ9L 4YLQT 2VXUL 3I6SA 3K6OA 3MRDA 3T0EE 1PLGH 1J8HB 3W2DH 3PDOB 1OT1A 2DMHA 2HVKA 3KYMA 4M9PA 4PRIA 1TEFA 3LD8B 5D1XC 3SN6N 5DMIH 4JGNA 4F93B 1JZJA 3O3AA 4Y9CA 5D7JC 3U9WA 3S88L 1OK8A 4ZSOE 2R8SL 2QQKH 3WOVA 2CO7B 2FBJL 3SGJA 2BSSA 2XDHA 5CEZL 5B38A 4JGMA 3KH3A 3ALXA 4RZCA 3US9A 3ZE1F 3O9WB 5FGBC 1PYWA 4FP8L 1EHAA 1GMEA 1GGUA 1X5IA 2CLRA 3LEXB 4JFUA 2VXQH 1NMBL 3L17A 2PCFB 4GS7B 5DXWA 1MCRA 1FAIH 1YNTB 4NQXB 4QXTA 5D7LA 5IHHA 3ZUCA 1RURH 3GSRB 5CGMA 1FG9C 4RX4A 4DP9X 5HHPA 1R3KA 5EU6A 3N55A 3QDGE 1KCWA 4XP4L 2ZXDA 4ZYKA 2ZCZA 3V5DA 4M03A 2NR6D 4DN4L 3MCLH 3OC5A 3UYRH 4L5FL 4OUUA 3W81A 5CM1A 2OSWA 5DU7A 1RH8A 2YA2A 5DC4B 3GIZH 4OM0H 1RZJL 1WGVA 3VCLA 4G80B 2O61A 4OCRH 1WHPA 3BDYL 4OFVA 4A39A 4QCIA 3RTLA 3OWRA 3AB0C 1XHHA 1XXFC 2YUVA 3BESR 2YKLH 4PWJA 1RV6X 2XVLA 3EFFA 2H32H 3FH8A 5IFAH 1HXYA 1Y18A 3WNJA 2PTTA 5I17B 5FLVA 3T2PA 3AWFA 1MI5D 4WVRA 4DKDC 3D34A 3QS2A 4AQAA 5BV7L 1VGEL 4JRXD 4N0CD 3S96B 4UQ9A 2IAAC 5T1KA 2QLVB 5J13C 4TL4A 2FUQA 5HVWA 4ZS7L 3NEOA 5FUZL 4ONGL 3BEVB 4K3EH 4RMWA 3KNBB 2DQDL 2XVBA 1KCVH 1CE1L 5JW3H 2F8IA 5K33A 5GSRB 3DUUB 1J1OH 3IPEA 3L1OH 4Y88A 4DEUA 1FNSH 5G2NA 1WWAX 1U8IB 3RGHA 2R69L 4EDWL 3GSXB 1JGEB 3DIVA 1BQ5A 2PABA 3O2WL 2YMXH 1QW8A 3UH8A 1AXSA 3ILPB 4PRDA 3L16A 4JRYE 1OALA 5AOMA 5FA3B 3V4LA 2RALA 2NQCA 4UOW1 3RE0A 3SGEH 2ZP9A 3QQ4A 4KZEH 3STBA 2FBRA 3MJ8A 5CEYA 3UMTA 2OTUB 5ACMA 4DZ8B 2JJTA 3BVTA 1CDHA 4WJ5A 5GRYA 2PKDA 4N6RA 3HUJF 2IOIA 3A6BH 1VFAB 3SO3B 1JD9A 4IMLB 1J7VR 4L8CA 2J6WA 2VXTH 1KLUB 1HCZA 1UWFA 2EXYC 5F9JA 2QGBA 5AUMB 1MJ7L 5DYOA 1KTKE 2JXMB 2EDOA 3V0GA 1MOEA 3EYVA 2IMNA 2X6VA 1IC1A 3ERXA 2NY1D 4QLWA 1A7QH 1SYVA 4HEMA 2D4FA 1Q9KA 3JYBA 4QRBA 5C09D 4BK8A 1HEHC 1NDMB 3QUXC 4M7ZC 3SPGA 5IVOA 1XF5B 1ZHNA 5DHEA 3NMEA 4RESB 4XPHL 1BCIA 2IQAA 2VDQH 2ZJSL 5EEUA 4HOZA 3PDOA 2X2YA 4NXKA 4IIQC 1LO3L 1JAEA 4HWZA 2ADGA 3MR9A 4PJ9A 1EK3A 3D0AA 3WAKA 2J12B 4L0YA 3D3VB 5EOQL 4HWEH 5J9PA 1P7QD 4GINA 3AITA 2PW2B 3D48R 4L3EE 4NT6B 4OFPA 4XN4A 3MGOB 3TBBA 4BM7A 5I1GH 4M8QB 4JO3L 4ODBD 4Y2LA 1NFDE 5CSGA 3KWWA 3RRQA 1JGDA 4XNQB 3BH9A 1BJ1J 4BQCA 1NDMA 2R1XA 4XNAA 2YBGA 5KSVA 3IU4L 4XNXL 2FSDA 2IG2L 3KVDD 1R34A 2DOCA 5EH1A 2VH5L 4M93B 4RAUA 2O5XH 3U46B 5DQJB 5H94A 2ADGB 2Z4TA 5BOZG 4QRQB 2QZ5A 1JZFA 5D4JA 2GC7C 3OR6B 4PG2C 4Z3TA 2XPGA 1LMKA 5IF0A 4KDVA 2BVOA 1MJUH 2FGWL 1G1OA 2CAKA 5EORH 3OKLA 2CH8A 1TVBB 4GW5B 2XZQH 2OMUA 2RHEA 4EIBA 3BGAA 1BEYL 2OTWB 2VDKH 3QXVA 1DQKA 4KUCF 3ZDXE 1WFOA 4FEMA 4F15B 3X14B 4E41A 4RIRA 4O2EA 3VGAC 1OPGL 1FDLL 4F57H 4Y1AA 7CGTA 2C26A 3ARED 1MCLA 1DCEA 5DD0L 5GGUA 1YMMD 3EYQD 3B2PA 3MRHB 5CWSB 2Y07L 4I88A 2UXTA 2YEZA 3G5YB 2EEFA 1HDMB 4XP5H 3E3QC 1WT5C 3ILEA 4KVPA 2WVVB 5ALBL 3V52H 2J55A 1K6QH 3BIKB 7FABH 5JZ7D 3UX9B 2ARJQ 1Q0XL 1G7JB 1HKFA 4WRLA 1FN4B 2CK0H 2MEJB 4N5UA 1QEWB 1KC5H 3CXFA 1UQSB 2ZCLH 2BWQA 3B6SB 2G2RB 5ABAA 1LEGA 5I1KL 2A73A 1SY6L 3JZYA 1GS7A 4PVLA 1DR9A 3LZFL 3ZHNA 4NENA 4Y1AE 3WMQA 1FPTH 2VO5A 2VH5H 1HCFX 4OF8A 3OMAB 2A38A 4PW4A 5FB8A 3Q2NA 4XC3H 1JUFB 2AJUH 4RDQG 2ODHA 4DZ8A 3RPKA 2ZOWA 4A7VA 5I1AB 4MNHB 1K2DB 4PJ8B 3QUKB 5TDNA 2E9GA 3FUFA 2AEQH 2QSCL 2RAMA 2ZCHH 2ICEB 2WK2A 4J3OG 1CK0L 1FNGA 4PIBA 4L1DA 5CIPA 4HKXB 4RCAA 1QEWA 2HAZA 4XXDB 3WFDH 1MCNA 3R18A 2NXZD 2IANA 2XT1B 4G9DA 5JHLA 1FZMA 4WW2B 1KG0A 4PLNC 1FVEA 4PJFF 3IFPA 3GYRA 4L4VE 8FABB 3QORD 2W95A 2R0LL 3PWUB 3DX4A 3UGEA 1OAQH 5IB1A 1Z9PA 5TE4L 3TJHD 2Y06H 4Y5XA 4L48A 5BS0B 1ZPLA 3O4OC 3QXAB 4I0PB 2DIJA 5GS0L 1S2EA 2DD8H 3VXQA 5TDNB 4JFFD 2W59A 5C92A 2K0RA 5DUML 4MXWL 5FWRA 1NCHA 5BJTB 2GFBB 2JWYA 5IG7B 3VFNA 3RZCC 2B7DT 5AW6B 2CDGB 2AV7B 4NM8H 3I50L 4DIXA 1HH6B 4QIRA 5FX3A 5KVEL 1ZTXE 3TF7C 1C8PA 1R6VA 2P5EE 3KEDA 4JHWL 2PCPB 1L7IL 2JKWA 5E2VH 2X7LB 5IESH 5CR8A 1UWXH 4MLSA 4E2OA 3F84A 2ZTBA 3QUMB 1JV5A 3G5WA 5KBKA 3EOBB 2X6CA 4OQTL 2XWBB 3DO4A 2R4SL 1XGTA 2G4GA 2VDLB 25C8H 3DK0A 2H9GA 4KPHL 1H9DA 3R1GL 3MGAA 4GH7B 4P2OA 2JIXA 1D5MA 2XTSA 3KLAA 3FT9A 4AXWA 2YFOA 3NGBB 3H2QA 4V2CB 2VQ1A 1G6VK 1QRNA 3SKOB 1M42A 2J88L 1S7WA 3GO1L 4LPVA 3U0WH 2AJ3B 1RIHH 1UM4H 4KTYA 1NFDB 3FOLA 4JZNA 2VLKA 2OCCB 3CHOA 4PWKA 1P2CA 5CJOH 1VGEH 3MMEA 3EYSL 1XT5A 2ITCA 4UV4H 1TJIL 1G7MB 1NANI 3NT0A 4IOSD 5I6KA 1ODUA 2UZIH 4Y4KC 5CO1A 1KV7A 4PJFB 3GS0A 2WYIA 2VNCA 5F7NC 3HE6D 4BFBD 3WJJA 3D39D 4OY9A 5ESQA 2YMTA 3L7FA 3V4VH 4LDCA 2GIMA 3APCA 4OW6A 4NQVB 1UT9A 4L5FH 4E42A 1PG7L 2ZOLB 3V4UH 1U58A 4XCYA 3ZRFC 4ELMF 5I15L 4JRXE 1BVLB 1A4CA 4ETQB 2F74A 1HWGB 1CZ8L 1JRHL 1NFDA 3AU1A 4JZNB 3S48A 2WYTA 4NKDB 5I5IA 1BVNT 4JE0A 2AEWA 1OB1A 2ED9A 2NY1B 2YUXA 4FXLA 5CFAA 1MFBH 4N2MA 1DBKH 2P49B 4JEGB 1INDL 4NZTL 5LDUA 3SKUD 4PHZA 1E40A 1QFUL 3QEHA 1OGSA 2DF3A 3UBHA 5MP6L 1BF5A 2GSIA 3KBFA 1RHFA 2CPCA 2YRZA 4OGXH 2X41A 3CVHB 5FYKD 1F8TH 4R2GD 4M48L 3L5JA 1NL0L 4ZS7H 2E7MA 1JD7A 3ASNB 1T6WA 5IV2A 2RGSA 1LDPL 4NKMB 3X3GL 2RBLA 5KOVC 3WHXB 2DWYA 1XSJA 4KNUA 3POHA 1CD0A 1TG8A 1FF5A 2B14A 4DTGL 3FUHA 3EHBB 4JO4H 3ETBJ 1C9SA 2XJLA 1GA2A 4TNWK 4EIUA 4WSJA 1J8HD 1J9QA 1XTLA 2UZPA 2QVMA 3WKPA 2HXAA 3IXTB 2F54A 1H3XA 1H3VA 5DFTA 4YDJB 3RWJA 1MXGA 3LQAL 3QXAA 1S6NA 4P3CL 4PJ7A 3UTTD 4B9YA 1LQBC 1IGTA 4N90D 4YHPA 2NY4C 3MOBL 4YXKL 3B2VL 4ZMTA 3DJTA 1JPGA 3V0VA 3NP4A 5DEGB 4QYOB 4G1MA 3CX5J 4M62H 3VJ6A 3UPCA 4NN7B 4XH2A 1N4XH 3OLGA 1FL3B 3TNMA 1Q9WB 3AAZB 4PLKC 4JJ5A 5EZIL 1P6AB 3Q6FB 4W9LC 3FUJA 4OLXH 4FZEL 2D7OA 2A9NH 1XSKA 3BWAB 1W80A 2AJSL 4JPWL 2O5YH 5CLYA 5GRUL 1AQKH 3FO1A 3VXTB 5MHSE 2IVFC 1N8OE 1UJTA 2ZZUT 3MRQA 4L8SC 4YE4H 1BFOA 3UTSD 4OZHB 3INUH 4GG8A 1PD0A 4YHLL 5C0IB 2MNJB 4XBEL 5DK3A 3UJIL 4UIKH 4OD3H 4MCYA 5I19L 1WPCA 4LDEB 1I4FA 4OCYL 5D7KD 4HEPG 4OCWL 1NCUA 3VYPA 4BXVA 5K9KB 4EKXA 3GRWH 3SDDD 1V3JA 3UTQA 5DD5L 1MFCL 4XXWA 2ICWJ 4F37F 4WU7A 1S9VB 1TITA 5DR5H 3TIEB 4M61A 4G8GA 2W92A 1EHKB 3REWA 5BVPL 3PRZA 5I8OL 2E9BA 3NN8B 2G3XA 2ZX6A 2Q8AL 4X8XA 4BYHA 1EERB 3D2UD 4ACTA 5FO9A 4AV5A 1G9NL 2QGCA 2BOBB 5AOLA 4XTRD 1EZVX 4N2KA 4JNXA 3QPXL 4U1SB 4RWHA 2JQMA 1RAMA 4ECNA 5FO8A 1HSAB 1HH9A 4ZDHB 4Z7OF 4PRBB 1AANA 4PGEA 4A04A 3FONA 4GY4A 2VLKE 1LGVA 5GRVL 2X70A 3PWPB 4KTEH 2ZKMX 3K4AA 3FC8A 4MS8D 4NHCH 4QAWA 3SD5A 2VITB 2ZKHH 4PJHA 1QABA 3D52A 5B4MD 4AI7A 2PWFA 1AGEA 3T3PF 3DV4A 3T8XB 4OGQC 2ZNXA 4JO2H 1ND0B 2E9IA 1Z9NA 4PRPD 5B1JC 1S9YA 3RWHB 4V11A 5EU3B 1H8OA 3EFDL 4N0YH 3W5MA 5SWZD 2J6EA 1THAA 1DUYA 1NCDL 4NKMA 1J9SA 4F3FB 1HYSC 1PKQB 4NO3A 5GIRB 3KL5A 1MLBB 2HRGA 3ABZA 1JWMB 1TOXA 2DQUL 2ROYA 4MZ2A 5EUKA 1HQRB 3QIBC 1I53A 3ZZ1A 2VDPB 1NM4A 3Q06A 1XSOA 2CD0A 1A2YB 1YDPB 4N2HA 4P4KD 2F5AL 5E4IA 3WEAA 1CF8L 4XPTH 4B7IA 1AH1A 4PCYA 5B39B 1WISA 3EGXA 2WWKT 3IMBA 1F6AA 3IPFA 1CFQA 3IGLA 2XZAH 2FO1A 5EO0B 5GHWL 3FB5A 3JYCA 4WJG3 1L5GB 4X98A 3UTZB 1BPLB 1BVLA 1A8ZA 1EFXB 1PU0A 3IBEA 4AMKL 2JKTM 4E9RA 1BAFH 5LBGA 3CD4A 4NZTH 4W93A 4DGVH 4MB1A 1QBAA 4M6MH 2XVKA 1BFVL 1QSEA 1I1AA 3G6JB 3HN3A 5CZRA 1KJ2A 1OW0A 4ADJA 1BHGA 1CMOA 3VXSE 4LF3A 3FULA 1U2HA 2AQPA 4OAWA 4PRHA 3VFSB 3DKHA 3K4DA 1NKRA 5E2VL 1UACL 5FUOL 1BXAA 1ZEAL 4M43L 3LKOA 3BKCH 4ORZC 4WDIA 1BF8A 2CDFA 5FW8A 3HCVB 2CO2A 3FFDB 3KEHA 5AVUB 2AI0H 1L3NA 4KRPB 3N1MC 2VDRB 4TSCL 3M1BA 2B1AH 5DFWH 3P77B 1VFMA 2AKRA 4XVUD 3PP4L 1UJ3A 2GIXA 3ARXA 4E5XB 4HQQH 2OMYB 3UP1A 4K8RC 1L9SA 3UO8B 2ATKA 2LE9A 3QG7H 1DDTA 3DDFA 4GBXC 4HK0B 3UYPA 3HAEB 4DEPB 2W9LA 4U05A 2XIDA 3P4OB 4ZFOL 2YPLD 2A9BA 4PJEA 4HLEA 3N43F 4R8WH 4LZKA 2MWCA 3EJRA 1P5UA 1D5RA 2KC0A 4HH8A 3T0EC 4LCIL 2H3XC 2I85A 4QT5B 2YZ1A 1PLCA 2GUOA 3AWGA 1F90H 4UQAA 4Q9RH 3HRZC 1KCRL 4FQXA 3VGAB 1RZIB 2YSSB 2VDMH 2R29H 1JPFA 2WQWA 4P23C 2VL4A 4OGAC 4YSCA 5KUKA 2B0SL 1IM3D 2OSYA 1RLBA 5E0FA 3MNVA 3WFEL 5JOPE 3KYNA 1S78D 2EAEA 4Y19A 5ICYA 4FQXC 2EDFA 2E7CA 1U41A 2FEEI 2K70A 4EBQH 5HYQB 3JVGC 3QEQD 3VGHA 1PD6A 1BFVH 2B9AA 2HT2C 2Q5BA 5GGSY 3BJ91 3FB7A 4EIZC 1O6TA 4ZW6A 3EJQA 1T7ZA 4XPAL 3QRBA 3WUWA 5DURB 4FLQA 2D4DA 2X6MA 2XY1A 4MD4A 3LRSB 4GRLB 1TQBB 1MJJA 2WTPA 5MEOB 5K9QI 2ZSVA 4FNQA 3TWCH 4S1SH 2VLRA 1RK1B 4PWGA 4A2HA 2AAVA 3KLQA 2P44B 4JO3H 4KOCA 2HUHA 4DP6X 1GC1H 3WJMB 2NY6B 3FFOA 1OL0A 2R0KH 4NKOB 2CKBA 3QDMD 4XN8A 3APNA 3HB3C 3P0VL 4H26B 2EYTB 4E9XA 3BUPA 4OCXH 3RZWA 2NUPB 4U0QB 1A7BA 5L0QC 1MQ8A 5GJTH 1PZBA 4EOWH 1BZOA 4NO2A 1EHNA 3U2JA 1U3HD 5IM7B 2NOYA 3HNVH 3VH8G 1G0XA 5I1JH 1WV7T 1HILA 3IFOB 4ZUTA 1OARH 3JWNG 1NCCL 3OG4B 4Z78A 3NZUA 4PRPB 1NIBA 1UM5L 3KPOB 1ZT1B 4UTAL 1BD2E 1G4MA 3HE7B 4L8SA 2B5IB 2BVQB 2EINB 4PGCB 4UT9A 4WI2A 1NAKH 4GLRH 4LF3B 4Y16B 1CTOA 1KXTA 1EV2E 3FTGA 3B4NA 1UGKA 5T3ZH 1EO5A 2DQMA 5FGCE 1K8DB 2N01B 2YS4A 4OD2A 1PCSA 2DLIA 5ID1A 5FCUL 3N44B 3HCVA 4ZS6C 4UV7H 3ZZSA 3LH2L 4UQ3A 2QDWA 5E9DE 1JFQH 4R6UA 2GKIA 1DVSA 1TJGH 1TTFA 2VM9A 3VXRA 1UJ3B 2X4RB 4NI3A 2BMKA 1VAHA 5HJGA 1IJ9A 5I2IB 2WJ5A 4HF5H 4KQ3H 4PRPA 1FDLH 2ODIA 4DH2A 4ZTOL 4PEEA 1EIBA 1L7TH 1TQUA 4F8NA 4PD4J 5A2CA 4BZ2H 3IT8D 4NQXA 5D7LB 4M4RB 5E9DD 2ENYA 5GZND 4HAKA 3U2SB 3RDTD 3SCMD 1PTZA 4WUUB 4Q97A 4AJYV 4N24A 5HJBA 1SBBA 3JUZA 1KWKA 1EJ6A 3K8LA 4EZKA 1CLYH 3ULSB 2Q76A 3QW9A 3QZMA 2A99A 4XMUA 2WB1A 5EN2B 2EVGA 5EC1A 2WUBH 3QQ3A 4HH9A 1N9PA 3QPQC 3BVVA 4LOUC 3RB7A 4L4VD 4N1EA 5BRQA 1X9LA 5FM4A 4XPFH 1JNJA 4J3BA 4QXUH 2FIKB 4YGAB 3GSVA 3WNKA 3M86A 3X1NA 3FCUB 4AQAB 4IOFC 4Y7MA 5H37H 4PGDA 1CTMA 3PF2A 1GYUA 2QPUA 4HJTA 1ZXQA 3QEQE 5C3IA 2OP4H 3ZYZA 4HWEL 3APFA 1U8NB 4MQ7B 2OKMA 2J3SA 4DPBX 2OM5A 2P52A 1W72A 3NACH 3TIDA 2J56A 4X0NA 1G1CA 5J13B 1CE1H 1NC4A 1PEZA 2DBJA 3MA9L 3MROB 3CFTA 2Y5EA 4BFIA 4AEHL 1JVKA 4MXQC 3TFKD 2IWFA 1IM3B 5IP4A 5FK9A 4G7YH 3X2QB 1HI6A 1SMDA 3L4XA 5F88B 4MB5A 1CC3A 2CGRL 3EOAB 3GMOA 5GRVK 2OTUA 4GW4A 1I8IB 4FFVC 5IHWA 1EA9C 3AQDA 1OF2A 2PYEE 5JIQA 3F12A 2V33A 5G5DA 5L2KA 1ZANL 2ARJA 1HE7A 1PG7W 4UDTA 3EIFA 3BGFC 4N2IA 3KGTA 4I77H 3WS6C 4IDJH 2ATAA 1QFUH 4HCRA 2QV2A 4KRPD 4UNTA 5MI0B 5DEFA 1GPOH 1SM3H 4MMZC 4HW6A 1KCUL 2C1OB 3C9NA 1B4TA 2DTSA 1YUHB 1M2OA 2H32A 2IAMD 2J25A 3SE3C 2Z9TA 4PJBE 4BSVB 1NMBH 2VXQL 3MQIA 1JVLA 3QO1B 4NN7C 4Q7DA 4E68A 1AD0A 4MZRA 4XMLL 1HEJC 2OJEA 4PVNA 3U4KA 1JZ2A 5EG6C 3KJ4C 3DX8B 3PWPE 5LHDA 4P9ML 4YUEH 3D25B 4JG1H 5BZWA 2MIZA 2YAHA 3C6SB 2QVFB 3IJSB 1IL1A 4MA1C 4FQQA 3I74A 3RVWC 1VADB 5KSBE 1WIUA 3GRBA 1NGQL 1NCCH 2EDXA 1MHEB 5DO2C 1Z3GL 2Q6WA 5KSVB 5AKSA 3RX7A 1G84A 1J1PH 1OEZW 4I9WD 3SD2A 2WBWB 2GI7A 5J5EA 3QIWD 1AY1H 3FCBA 4P48A 3B9VA 1SY6A 2QGEA 4YDKH 1PAZA 8PAZA 1KDJA 2J1WA 2G2PA 4LCYA 1ZS2A 3O6FC 4KO9A 4YX2H 4P9HC 4L37B 3VXMB 2BSBA 2XA8L 2NYYC 3JBG7 2EABA 1VFAA 5EZJA 2HG5B 4P59L 4RMBA 4UOW0 1NFDF 4G8IB 5D4HA 2Z7ZA 4M93C 3JV6B 3QEGH 4LLAA 3QNYB 5L2JB 5ICZA 3HE6A 4NQCB 2QEJA 3B9KA 2QKSA 3GXDA 3MR9B 4JY6B 1FGNL 4PJCB 1JF1B 3HPJA 3LH2H 1CU4H 3O0RL 4L8BA 4QJ4B 4MCZB 5JOFB 3HG0A 4F33B 4OLWL 3FB8A 4Y1AB 2FJHA 4O4YH 1NCBL 3MV7D 3T3ME 2L7UA 4UYPA 4HPHA 1BMWA 1KJ3H 5H35B 3MDJA 4WWKA 1HHJB 2J8UA 2VLKD 1VFUA 4LOVA 2P5WD 4FQIH 1UTDA 1HOEA 2ED8A 3DETD 4UCFA 4MJ2A 3RUGF 1F02I 1U3HB 3LQZA 4PB0H 3ZR6A 3QHFL 4HWUA 2IADB 1WBZB 4CVUA 3QFDA 4RSYA 1QTYT 4NZFA 4LAQH 3M46A 1YCSA 4JY6A 4RZKA 3BQUC 4MRBA 1AS6A 3OXSA 3N41B 1EQWA 2NY3B 4JM4L 4K4KA 3I3DA 2VDOL 5BZDA 4MMYA 3RZCA 1KYUA 4P4KB 4TUKL 3GMPB 2A9AA 4EN3D 5ABZA 1ZPUA 3C5ZB 1CK0H 1LO5A 4HULB 1RJYA 3NCFB 1TKWA 4G71B 4MNGA 5I6LA 3HMXH 5D72H 3BUTA 2F68X 1DBAH 5DEZA 4L9LA 2YO3A 3LKSB 1FLTX 5DC2A 3DROB 1CR9L 1PX8A 2FGWH 3MYJB 4UV7L 3UIYA 2FIKA 5C08D 5FUCC 1TJMA 4HG4J 1Z9MA 3BP7B 4FQ1H 4N86A 3BRGC 1QNZH 1Z0NA 3NIDB 4A55A 5CEZD 3WSQH 2NUTB 1BFSA 1RZGB 3L3OA 4YWGL 2YLKA 2HJKB 2JNZA 1T20B 4K5NA 4R3SB 4R5XA 3R4RA 4PGJA 3P3SA 4HFWA 5I6PA 4F37K 2OMXB 4W70A 3DMMC 2V0AA 4NP4L 4PJXA 5GRJL 2IAND 4EPSA 4ABQA 1JHTA 3WN5A 2AEPH 1G5GA 1RLWA 3P2DA 1HHKB 4U1NB 1W6LA 1WEJL 5CZKA 1HESA 5DT1L 1UATA 2GBTA 2CDEB 4DVRL 3RL1B 4G8FB 4U1GB 5BJTA 2X4NA 4UQ2A 2FAUA 1ZSDB 1AXTL 4IK6A 1XGUB 4QI3A 3O4OB 4JPIB 3SDXF 4DGVL 1GW0A 4AIZA 3CFNA 4BWWA 6PAZA 5EBLB 2B3IA 5DRWA 4QGTA 1JMZA 3O8XD 5EWIL 5FYLH 4NQED 3QAQA 5F3HB 4NQEE 5J89A 1XMWA 5CIPB 3LHPL 5ITBL 1U42A 3LB6D 4LCYB 4TNEA 4FNPA 1PW3A 3VXMA 5HDLA 4G6FD 2EE6A 2JCCA 1GR7A 1ZSHA 3A67L 4BINA 2A6DB 1WT5A 3U6XA 1FIGL 4GI8A 4HUWB 3MODL 1NCBH 4IJ3C 2W07A 4N90E 3PWUA 1U6AH 2DJSA 2VJ8A 1C12B 4XODA 4G5AA 2PLTA 4H8VA 5T1KB 1D5ZB 2WUCH 2Q20A 1MDTA 2AJZA 3DVGB 4JO2L 3BH8B 3GUTA 2JJWA 1JNNH 4LRIC 3BWAA 2APBA 3ME0A 2YC1A 4LT7A 2ITDA 5IR1B 1BXUA 2GFBA 1F4HA 4KITB 3HG1E 1RL1A 4IRZH 5CEZE 3GBML 1FZOB 1ZWIB 2FECI 4PG2A 3PHAA 1FFOB 4DKTA 3NESA 5KSUB 2WBJC 4F2EA 1JPSL 1BJMA 1KBWA 4AMKH 4UOZA 1HKLL 2OI9C 1NICA 2XC8A 3NK4A 4NQDD 1ITCA 4LO9A 3MLUL 2W07B 5TGBB 1SHXA 5GZOD 3I6GA 5CLTA 4BFJA 3D2UB 4UU9A 2LTQB 2GUYA 1H9VA 2F0CA 3S36L 4L1HA 2PW2A 4A2FA 2X4UA 4QRTA 5SWSA 5ADOL 3LNEA 1KCSL 6FABL 2ZAGA 1MCCA 2VLKB 2N59A 3K46A 4K3DL 4HX1B 2PP8A 2F15A 4EI0A 5L9DH 3MRGB 4K8RH 1P7QA 3I84A 4XP9L 4FULA 4HP5A 5HVFB 4AW7A 4JS7A 1KCKA 3MRFA 3ZKSD 4XBEH 2OA9A 2YXWA 3Q2WA 4PJ9D 1CUOA 4S0SD 3UCQA 2X4PB 2O1AA 3CFCH 3UPAA 1SJVA 2WNXA 1MHPL 1UC6A 1SN5A 2AK4A 3GPSA 1PNCA 1OCCB 4FCHA 3VGEA 4BK4A 5I1HH 3BD3A 3Q1EA 3HE7C 4OT1H 3CHPA 4GXVL 2CK2A 1XGYL 3SDYH 3T2QA 4UAOB 4GAYB 1EANA 1JPST 4PJBF 4QR7A 3PDGA 3WEXA 4JZOA 3FQXB 5J6SA 2OXHB 1ZVYA 4QD2E 1U4FA 2FTAA 1W16A 1N4XL 1BX2A 2PXYA 3KWWB 1G4RA 4FXKB 5GISH 1PMYA 4S1RH 3FUIA 4CADB 1PZSA 2LU7A 4WFEE 5ANMA 3NSFA 4JG0L 4E42B 2ICWA 3W82A 1UJ3C 4JJHA 4ETQA 1HWWA 2X4PA 2VDRL 2HT4C 3CFKB 2OJZH 3HLKA 4OM0L 1S5HA 3ARFA 3H6JA 3WL9A 2LQRA 3FU5A 5FYJD 2PWDA 4JN1L 4ODUA 4ZSOA 3WEXB 2ZKHL 5IBUB 5FFLA 5FWQA 2XA3A 4M02A 4YHYB 5HHXH 4PTUA 3INUL 4Y1SA 2BY1A 1QZNA 4JHVA 2YPVL 1II4E 1QSEB 1MY7A 2OMVA 4H0HB 5G4OA 1UZ6E 1J0YA 4DJMA 3GRWA 4S1QH 3WNNA 3KGRA 2NNAB 4ZFFB 1CLZH 1YNKL 1K2DA 1TTUA 2DLFH 5GGRY 2LLNA 3U36B 5HD8C 5TK2A 3C08L 4JFEE 3T3PB 4JHZA 5D4IA 1C1EH 2XKSA 1GS6X 3S9DB 4UUJB 4Y2OB 1OPOA 3ILQC 4JRYB 3VMNA 4NKQB 2IO5A 5D71H 2X3AA 4DEWA 2BZDA 1BZDA 4ZD3H 3WU1A 1T0OA 5I8OH 1FFOA 4IRSA 3D7PA 3FTXA 1Z5LB 3DOSA 3MOBH 4RBPH 1LEGB 2VMJA 5CP3A 5D1QC 3MRCA 4Q9CA 1IV8A 2VKXA 4GSDL 5IZ7A 4WNJA 4HPOH 1MQKL 5ADPL 4O02B 2HA1A 1AKJB 3GSWA 4FYSA 2BERA 3QJOA 2IFFL 5EV7A 1MELA 3HLAB 1PZCA 1RMFH 3EF4A 4WI6A 3TO4C 1CQYA 2C9PA 5DD1L 2CHZA 4JJ5B 4OD3L 4U2YA 4N8CL 5E99L 5IBTH 3CDZB 3BSZH 5T1LA 1ZJAA 3L54A 5L4JA 1QX1A 2J2ZB 2HKHL 1JN6A 3MCYA 4A2LA 1KEGH 4PQXA 1UOWA 4HJUA 4DO6A 4P5KB 2YEQA 3TBSA 1UOVA 4RFEB 2IANB 1FWXA 2JB5L 3W0WB 2DDQH 2EKSB 5C0DA 1ETA1 2ZX9A 3WFBH 3OQRA 4CDHA 1XB8A 3Q3GB 4J3WA 3BP5A 5D55A 3NN8A 1JXDA 2IDTA 1UKQA 1G7PB 2ZKXA 2YPVH 5DRNA 4JW3A 4NPYA 1THCA 1NCWH 4P57A 4KJWD 4RETB 5D1ZD 2VQTA 4FOMA 3L95A 5AVWB 3EBHA 4A6YB 4OZHE 4YSTA 1ONQA 3NABH 4HWBA 1PX3A 3STZA 4JHWH 3WO4B 2J2ZA 2IGLA 4KRNA 2FJGA 1LE5B 3D09A 4PJGA 4X6EB 3S5LG 4BH7A 5ICXA 5EU7E 4POYA 5CEXB 5IMLB 1QYGH 1SMOA 3APMA 2H2PD 2W38A 4KNTA 4OLUL 4LNVA 5C2BH 1QRKA 3RNKA 4QRFA 3DSNB 5DLLA 5ADOH 3CVHL 3S3PA 1UWYA 3VXUB 1MKFA 4S10A 1TR7A 4ORGB 1RULL 4TQPA 4TUOB 1SDDA 5AG9A 3D18B 3OAWA 1C7TA 1CGUA 1KPVB 2J72A 4GKZA 1KACB 3QUZA 1GCYA 3AQZA 3SDXE 1JGUH 2FX7L 2OW7A 3F62A 2F18A 1D5IL 6PCYA 2SODB 3D5OF 4KVCL 3LKQB 4HUUA 2A77L 2PYED 5J6HA 2DS4A 3VXMD 1KN4L 3TT1H 2NXYC 2YD2A 3CFJB 4DT2A 2OMYA 3TYFB 4CRPA 2JKRM 2A9MH 4U1LA 1KPRA 1KTDA 4DGIH 2VAAB 4B0MB 1E4HA 2CRZA 3GJEA 3O8XA 4Z7NB 1DANU 1YQ2A 3IAQA 3IS1X 3LV3A 4PLJC 4XHJD 1TCRB 3TFBA 3LH9A 3VDAA 4OUOA 4ZFFA 3PQYA 4FLRA 1UXLA 2LR4A 3DJZA 4JBSA 5FO2A 4P3DB 4LESA 3QO0A 4ZOCA 3DYMA 2GQHA 3BAYA 1KPVA 3L5HA 3BD5A 4H1LA 4MJ4A 4A7QA 1AQMA 1IFHL 3OF6D 2DB8A 2PXYB 1B4LA 1BX2B 3L7FB 5IJKA 4G7VH 2G5BB 5IFHH 1A3QA 3TOPA 2APFA 5C0FA 3PL6B 4GSXA 4UTBL 1BD2D 1U3ZA 4EI5C 3ZL1A 4JFHE 4Y4HD 3EW3B 3E2HC 3G5VA 1WAPA 3I3BA 4JQIA 5D2LF 5JIDA 4TSBL 1U4EA 3L13A 2Y5TA 3HS0B 5FA4A 3QWRD 2E27L 5DHDA 3RY5A 2FLBT 4P4RB 5L88L 1JGUL 4BQ9A 3PYCA 3P4LA 4WEMB 5L4FA 1IIIA 1BIIB 4ZMZA 1AO7D 1N0LB 1RFDL 3BQUB 4X5WA 4XBPA 5CILL 3VFUB 3T4AA 3WFDL 1F3DJ 4D0CA 3NP3A 4JRYD 5EO1A 2VWEC 3L5XH 1F6LL 4J1UB 1B6DA 4OD1H 1RZKL 1DQMH 4HGKC 3TBSB 2D31B 1BF2A 2E74C 5EC1B 4KKAC 3WLBA 2E7BA 2Y5TB 2UXVA 3HS0A 4FMKA 2APXA 2DQGL 5DWUL 2ZWZA 2VUKA 1XBRA 5A2JH 1P7KB 4YDVB 2UZYA 1XX9C 2G5RA 1QR1B 3TN0C 2B4CH 2DEWX 43C9B 1NBQA 2VW4A 2ZX7A 1SY6H 4W4NA 3KYOB 2ORBL 4JVUA 1UA7A 4ZYKB 3HB3B 3OKEB 4BHUI 5JOPD 3OLEA 5L0QB 5D8JL 1JHLH 4J23A 5BUGA 2W8CA 4HWBH 4AE0A 4KY1H 5LN8A 5CS7A 1QQDB 3HG1B 1QFWL 1BWWA 1UB6A 3O9WD 3V0FA 1PDKB 4Z7UE 3B9KD 3T6VA 2C3WA 5JOEA 2F5BH 4JFXB 1ZLUK 5HBBA 1IC7H 4A7SA 3MRQB 2L04A 4KUCD 3AMKA 1BG1A 4AGPA 4H4NA 2EXYD 4XNUH 1I4FB 1OTSD 1MFDL 4FERA 5E8PA 4JK0D 2HRPL 4NHUA 2R56H 2QV4A 3C5SB 1LEIB 1K3IA 3H9SB 4PJGE 3SDAB 2WKLA 3SDCB 3PIQA 3V4PB 1I1CA 5D2NA 4Z3FA 3PWPA 2EH7L 4AIEA 1USZA 5I82A 3VW3H 5DUPH 1A6TA 4NN6B 1I7RA 3Q9PA 4O5LL 4Z0BH 3TEZA 5EC2A 1JTTA 2W9DH 3E1F1 3LXCA 4J3OF 3S35X 1QWNA 5DFVC 3VSTA 5I1KH 3TTYA 5I1DB 4QRRA 1G7IB 1ONQB 2DMGA 1FO0L 5J0BA 2E6QA 3V9FA 4IJ3B 3AY4A 4FFYH 3THMH 3SE8H 4H0IA 2I26N 3N1PC 5IM7A 1BQLL 3N1GC 3U4BL 3O81A 5KS9B 3I2CH 4WNQB 4TF4A 1P84J 2H0JA 2RA1A 3CDYA 3WN5C 5IBTL 1FL6B 3E6FA 5C7XH 2FO8A 4OF3A 5HPMB 4MKMA 1HZHL 5IIEB 1VPOH 1DBBH 1LNUB 4HIJB 4M5TA 5F7KC 1KFAL 4XWOD 4OBSA 4N0YL 2WBJB 1F4XH 4HCRL 4HJIA 4E9QA 2BY0A 4Y5YC 1MRFH 1RKRA 3NAAH 5TE6L 3VQLA 1KN2H 1O0VA 4ZAKA 3WTXA 1T3FA 2BMKB 4G8EB 3LXBA 2NQ3A 1ED3B 2MOQA 1XCTA 1JJUA 1B2WH 5C71A 3TA3A 3FRPG 4WK4B 1L0XA 3CPUA 2F19L 1W0WA 3A4DA 2DM4A 4NT6A 4YXLH 4L4TB 5TE7L 4TLSA 3L6FA 1FORL 4N2OA 3BKYH 1R9FA 3EJZD 2HX9A 4Y8AA 1NLDL 5HYJD 4YSUA 4NFDA 1A4AA 3BH9B 1RIVH 5C6WH 2GYSA 1ZHKB 2DQFA 5CNHA 4BKTC 3L5IA 4XNZC 3GQFA 5ERWA 4HETA 2HH0H 5I75B 4FFZA 5DGRA 4N2LA 3LKNB 1AD9B 2CKNA 5A2LH 4E9TA 4LARH 3UABA 3B7RL 3LEVH 2ICES 3HAEA 4JY4B 4XNYL 1M6UA 4XVTL 3PPEA 3TA3B 1A7OL 5FYKU 4WF7A 2UXGA 1ZLWH 4JFDD 1A7OH 2JVUA 4ES8A 2OJZL 2VMEA 4NRXB 4URTB 2M8XA 4ANKA 4FG4A 5KW9L 1JZ8A 3CVCA 2R2EB 2X5PA 1DZ0A 4R4FH 4DP2X 3RILA 2WXFA 2K8QA 2Z0BA 1HHIA 2NW2B 2I9TA 1KXQE 3GGWB 4L4VA 4UOJA 3MJ7A 3S3BB 2YQGA 3OGCA 4J2XA 3DO7B 1MZZA 2D3LA 1WFTA 1RZJC 3X12A 3VFMA 3LSOB 2VKWA 4HOXA 1UZGA 5TF0A 4AG4L 4KGJA 2VUOA 3TASA 3WY1A 1A6UL 1HE8A 2OMTA 3CXHK 1N3NB 5LN4A 1CDGA 3EXLA 2BM3A 2NZ1A 3GHEH 3Q6GH 4LU5H 4ZRGA 3F2LA 2YPLB 5JNYA 4MAYD 1ZHLA 4PJDB 4DW2H 1LM8V 2O72A 2YGOA 4JFYB 4KOBA 5IEKB 2JKSA 2V5YA 1KJVA 3SQRA 5LGJB 4PW3A 3QR0A 2DQHL 3LDBB 4XO4A 3S34L 5CF3A 4Z7UA 4K94C 5AVTB 3DURA 3V0EA 1ZDQA 2QFRA 2A6KA 3FO2B 3MVSA 3VXRD 4HZAA 3RURA 1S7VB 2IH3A 3S0PA 5FA3A 5JUEH 1CGXA 3VRLF 3FSOA 2M2DA 4W9GC 4MVBC 3GHBH 3WYRA 1P69B 5DZNA 1D5BA 5BNXD 2P5WE 3OTTA 4L9LC 3UG5A 1NBZB 2Q2LA 4HIJA 4U4BA 1LDPH 1OD9A 4R4BB 3X3GH 1ETZB 3GKWH 4OSUH 3FB8B 3TGXA 1HINH 4IGBA 5D1QB 1FV1B 4R0LC 2JTDA 1V8HA 1DHKA 1AHKA 1KG0B 3MJ9A 3WEMA 3AVEA 4ZZKA 5E8PB 3SYQA 4LMQI 1BPVA 5JHLH 3MV9A 3NCCB 4K9EL 4M7JL 5IB1B 4UQCA 1DJWA 5DUPL 2QVTA 2VLRB 1AXSB 2YD3A 3ILPA 4HT1H 2WOBA 3EUUA 3LQZB 1WTGT 1U33A 3L45A 3RU8H 3NDYE 2KI6A 5J56B 2HMID 2NPLX 4D3CH 1WEJH 1ROWA 1PG7H 3GMMA 3V4UL 1YECH 5I15H 2EDJA 5KS9F 5KVEH 3QDMA 1IRAY 4NM8L 2AV7A 1DJZA 4U6XA 3T3MF 3MRMB 3W11D 1S7UB 3QJSB 1I7TB 5DJ2A 3GMPA 1FO0H 1CICD 1MFEL 1R3HB 1IGFH 1H15B 3HG1D 3ZDZB 5JPMB 2HUEA 3A67H 4IKLA 5D7SL 1U93B 1IGCL 4Q52A 1W6WA 4X6DE 2HN7A 2TAAA 1GHFH 3H9YA 3EYOA 1WQVT 1T1YB 4ELMB 1Z1WA 1NEZA 3QULA 4G3YH 4WIQA 5KN5A 1V55B 1ZMYA 2HG5A 1PLAA 3L1GA 4M4PA 1KLGB 4EZLA 4JFPB 3LNHA 5C09B 3GO1H 2NUTA 2MCG1 4ENEC 4OU3A 3V0AC 3IDGB 3H9SD 1H3PL 2B1HH 3ARWA 5T3ZD 2OZ4H 2GHZA 1J0KA 1IC7L 4PP1D 5F96H 5L4MA 5KBPA 5DHVB 4FXGB 1I8LA 1LEKB 4P3WA 4M7ZB 2ZG2A 3WS3B 4U6YA 4NWUL 5H37G 4PJAF 4N0FB 4IIQA 3VRIA 4DVBA 1VHPA 3BVNB 5E2WH 4YPGB 3GNMH 4LPTA 3P11H 2R1XB 2FT7A 2ED7A 3B7UX 3OB0H 1DEDA 1KJ2H 4FQPA 4LOFA 4R26L 2FNWA 1KJMB 1DUZB 3E0GA 4IRSC 4X9GA 1E4KC 1SF5A 3X1FA 3NQKA 4U2ZA 3CN0A 2JLLA 3ZJAA 1WAAE 3ZMEA 2WXPA 4MXVF 1Q8MA 1MAKA 2F53D 4UTAH 5K39A 2AK4B 4NCC2 1IB5A 5T5NG 1S9WB 5IF0B 1DO5A 3QUYC 1AE6L 4FFZH 2VERA 1IM9B 3WD5H 3CLEH 3QUML 5H2BA 1NC4B 3RY6C 2K7QA 3UAFA 1KCLA 3ARDD 2WVVA 4XNMB 3UFIA 2CHDA 3QFJD 1DQML 3E38A 5E7FA 4DCQB 2Y07H 3GMQB 4NZ8A 1EJOH 4ONFH 5LBSH 3DI2B 4QO1B 1PFOA 2WAQA 5C6PB 1FNHA 4O9HH 3ZZQA 1RFDH 1TLMA 4XZ4A 4M1GL 3MNWA 2X1WL 1R5IA 1GC1L 1DCLA 1V7NL 3AREB 3BE1H 1WZLA 4LCIH 1EO8H 3V0IA 4ZX4A 1FSKB 1A7PL 1J1PL 1T7WA 2KH2B 2Z8SA 3LX9A 3RKDD 3WTTA 2AXFB 5FYKE 5FPIA 3FH5A 3FRUB 5DD6B 1HNYA 2CBOA 4E9LA 1WFJA 3V6BR 2VMFA 4KNQA 3D85B 4RMRA 5F7LB 2V9RA 4WCYH 3DXAE 5HYFA 4KRMB 4R2GB 5KOMC 3CZJA 1FVCA 4BZ1H 1E5CA 4MMXB 4WGWB 1A3LH 3LRGA 5DD3L 5E70A 1LWRA 5I9QB 4Q2ZB 3OHXA 1I8KA 5B7FA 2WANA 4LSUL 3Q5YA 5IMOB 4QMEA 4U6XB 2YGQA 2FD6L 4WI4A 1CU4L 5J6GA 4M5YL 2YAOA 3KGUA 4Z7UF 3IKKA 2N1TE 1FYTB 3HBZA 2R1YA 4NZDA 3ZDYB 1T03H 2B0SH 3HMXL 5D72L 3UCRA 1BA9A 1GZQA 3FH7A 4FKHA 3L08A 3KNBA 5F9JB 1XH0A 1SEBB 4ZFQA 4JPVL 3ZMRA 3UBXA 4XX1G 1R3IL 1RCYA 3L4CA 1B9KA 2LHAA 1I85C 3LQMA 5KVGH 1UFUA 4TYUA 4H0GA 2JF1A 4OZHA 3HN8A 1EDHA 4R4BA 2YKKA 5AWNL 5B7MA 1FNSL 3OMNB 3W0WE 4EDWH 1ZT4B 2H0PA 4UT6A 2G3MA 3QJVB 3ZTJG 2CSPA 4JO1L 4J28A 1IQWL 2ICEC 1IAMA 4IRJD 3U6RA 4PV9B 3MGTA 3OJMB 2AQ2A 4RMUA 4OSUL 1CLOH 3EOBA 5BOPA 2VR7A 1BZ7A 2CKBL 1OLZA 3DX1A 3MX0B 4QRPD 1KELH 1OE2A 5HDBE 1OE3A 2E46A 4MS8C 1OP5H 1EWHA 1SJEB 3VXQB 3O3UN 1UOKA 5T3XD 2W60A 4ERSL 1KLUA 2O5XL 2VDMB 3T77A 3T2NL 4C4KO 2NTSP 2BY2A 1SEBA 1UH3A 2FT6A 3GTVA 5F89B 2P28B 2Z35A 3EGSB 2GI0A 3MRMA 3DTDA 1BMZA 2IPTH 4UNVA 3MCLL 2F7QA 1OKEA 3L9EA 3QIBD 1KF9B 2RFXB 2YGVA 3KVQA 4MHHG 2UWEA 3ULUE 4NUMA 5AW0B 2XXGA 3LH8A 5IT2H 4E36A 3NH7H 2F61A 4WHTB 3OPUA 4B9GA 3D4GA 4NN6C 3E6HA 1J1OL 2WQAA 4FA7B 3FT4A 5J1SC 1NOLA 2ATPB 4O2CB 5DDHA 1WZ1H 5LWYL 4PRIB 1P4BL 4KZ0A 4YHNA 3UP6A 1CIDA 3IXAB 3HC2A 1LWHA 4X9FA 3T8MA 5J11C 3KDMA 4G2AA 3BWSA 1EGJA 2V2TA 2EE3A 2HP4A 3GXPA 4G42B 4U3SB 1AG0A 5HI4C 3AU1B 5B38B 4I18B 3QYMA 3DIFA 4G43A 1IGIL 1R46A 4NAJA 3Q5OA 5BO1L 3IU3B 4NQVA 1C5CL 3FZUD 2X0VA 3K4ZA 3MLYH 4ODWB 1JF6A 4I0PD 4ODXB 3UAJA 4CN6A 2IADA 2F1EA 3CHSA 4KKCC 4KQ4H 4JZOB 1SJHB 2A1WL 4YHLH 2Q7YB 3R8BB 3WXVH 2VN5A 4A6YL 2AQRA 5LJYH 1RU9L 1SM3L 2VR8A 4JRFA 2F08A 4GT0A 3U9PH 5GRUH 1OY3B 1HEZA 1TO5A 3QEHB 2ZOTA 4JL2A 4BZ1A 4HGWA 1XR9A 4I13B 5FCUH 1FFNA 3VA2C 1RJYB 3IN0A 2HSIA 5I74B 2VO8A 2GBVA 4ODUB 3H8NA 3BKMH 4RBPK 3GMQA 3O11A 3Q0HA 1UVQB 2QQKL 4IKKA 4A2EA 5LCVL 2FJFA 2C8NA 3IWUA 3CH1B 3VD0A 3QFJA 1GS8A 3SSGA 1GYVA 4S2SA 1I8MB 4LRIA 1MZYA 5KYXB 4QJ5B 3CMGA 1KXQA 1S78C 3EGDA 1OAYH 1IGJB 2MHAA 3SGDH 1L7TL 1F4YL 1T4KA 2JFCA 4PBDA 4YIQB 1JHKH 1P5UB 4MD5B 2PW1B 1JHTB 4F80A 5F7WC 4LLMA 2PR4L 1EXUB 3MREA 2CCWA 2ICEA 3B9AA 3U7WH 3C5JA 1SVBA 3L3IB 2ZQKA 3DUHA 2IGFL 4ELKA 1BQLH 1F58L 1BSIA 2E0PA 3V0HA 4EXPX 3VRLE 1QRNE 4OV6F 1G9HA 1T83A 2DH2A 3IJ7A 4N25A 4AIZB 2CHNA 3IMVA 4L1LA 4PJAE 3SO3C 4LVOC 4PJBA 2F58H 3BO8B 4S2SB 3F6JA 5DUJA 1XD0A 2X7LA 3EDDA 5F6HJ 1IQDB 1FVEB 1YYLH 3GXIA 1NAKL 1V3LA 4TUJA 1KEGL 1NWOA 2FH8A 4ZMVA 2R8SH 2X09A 3M6DA 3P9LB 1MFMA 4J3VA 3S88H 1Q38A 2BIPA 2VABA 3BN9D 5K9OA 4L1SA 1ZVSA 3QXUA 2WLLA 5JO5B 5IQ7L 4A63A 1E27A 4N68A 4M3HA 2FB4H 4JRWA 4QTFA 1OHQA 4OJFL 3RGVC 4B41A 1KLFB 3Q9QA 5LO7A 1CD8A 2IPKA 3QORB 2G75B 2OV0A 3QIUB 1OV8A 2NY0B 5SWQB 5KZCB 3B2UD 3VM7A 3VD1A 3SQOL 4Z7OE 2BJMH 2EXWC 2J1KA 4BFRA 2Y3AA 3GUTB 3WCYA 5CP7A 3NJNA 4ALAH 2MJWA 5AVYB 2BWIA 4RGOH 4YSAA 3HC3H 4G70B 2UWEE 4PGEB 4DP0X 1O6SA 3UGXA 3C09B 3GI9H 5AVRB 4XNDA 3FCSB 5GISL 3UJTL 2X4TB 1JYXA 4UDUA 4XB8A 4FFYL 4NO2B 3KPSA 3O4LD 1MCFA 3ARYA 4CU7A 2Z1KA 3IETB 1M1XB 3OJDB 3X3FH 2DMBA 4ODWA 1HVXA 5F9AC 4HIHA 3V9EA 4UNUA 1XH1A 5F21B 5A3IC 1OT4A 3H9HA 3RWCA 1KLFA 1CFNB 4JO5A 3ZSTA 5H94B 5EU3A 2IPKB 3QORA 4GRLD 1ZA3A 3K6IA 1P4IH 2DYPA 3BYYA 1TZHB 4P2CG 4TTDC 4B3EA 4X4YA 2CIIA 2CQVA 2JE8A 1TLKA 2FWOB 2R2BB 3DUSA 4ZMOA 5ESVB 3DSFH 3RA7H 1MIEH 3VFGL 4MA8H 4QKXB 3QXWA 1UA6L 1YAIA 4XC1H 2XOTA 3OZLA 3SBRA 1EDQA 4M7LL 4AZUA 4Z7WF 3OPZH 2HCZX 1INEH 1JMXA 2APSA 5C0GB 1OQOA 32C2A 4K3JH 1MXDA 2BNUB 2JQZA 4LEOA 3SE9L 3W57A 4MXWH 4PI2A 4EZJA 1I3GL 1V10A 1FL5B 2E56A 1XDTT 2FJFB 5GGSA 1HHGA 2X1OA 2JJSA 2X4OA 2ZXAA 1CL7I 4P2AA 2R0KL 4YO0B 2PPCA 5E00B 4ERSH 3CBRA 3QPQD 4LOUD 3WLBB 3HG4A 1QUNB 1MI5E 5GS0H 2NT1A 1KELL 1PAMA 4IHOB 2VRKA 1NINA 5IK3A 1JWUB 1AC6A 4ZW8A 1H3UA 4ZUWA 3S5ZA 3KVPA 4POZC 4X0KA 5EO0A 4F7CB 1AGCA 2FL5B 2YSTA 3MBXH 1MCPH 4MD5A 1UM6H 5EWIH 1MFAH 5HVHC 1X5FA 1LO4L 3QQXA 4I89A 3TC9A 2J43A 4WO4C 4W6YB 3SE3A 1KIQA 2EIJB 3K2IA 3BQVA 4UTBH 5D6DC 3SODB 2WP3T 3GI8H 5E51A 2G5BA 5IROA 5IW1B 4JPVH 4H8HA 5IEHB 1QKZL 1YMMA 1PSKL 5D96C 4R90L 5B8CA 2FATH 2XPYA 4TN9A 3CIQA 2WIIB 2ATKB 4N8VG 4E41D 5DTFB 4RFNB 4HD5A 4FLSA 2Z7UA 1IBBA 5CGYD 4DP8X 2EIBA 2J57A 5T5NF 3TH3T 4KJPD 4XWGH 1C5BL 2CXGA 4HC1L 4C4UA 2Y6SC 2OZ4L 1BBDL 1WP6A 4LLWB 3ULVD 2EE2A 3RDTB 4PJIF 3SCMB 4M9OA 3QNFA 3EZJB 5H37A 3N04A 5DQDH 5M95B 1KC5L 4QOKD 1KNOA 1CLOL 4KRPC 4Z7VB 1FNLA 2NTFA 3FU6A 4RMVA 4TVPE 4ACPA 1HU8A 4TL5A 4APXB 3GIVB 4UQIM 2VOTA 4EO5A 1I31A 3RL2A 3BAIA 1RUKL 4LSSL 2FX9H 3U0TA 4ELDA 2IAMC 4GUOA 5I6OA 2OBGA 4CN1A 4GBXB 4NO0B 4QYAA 1OAJA 4PHXA 3SDCC 4GXFA 4X5RA 4U1MB 5EUOB 4MMZA 4R5VA 1T21B 4OZFB 2OX5B 3KPSB 4GSRA 4RAVB 3ARRA 5KS9A 2EIZA 2YD7A 4YH6A 5KWYC 4R90H 5I26A 1GW6A 3LRSA 3POCA 4GRLA 2NY2D 1KNOB 1RJLA 3T4AC 4WGVB 3HRZB 5DHYB 3VFVB 3QJUB 3DPBB 4L3CA 2YXFA 5C0EB 1XF2A 1XQ4A 4IDLA 1WTLA 1YYML 4WY7H 5DRXB 1DVTA 1OTTD 1A21A 3QWOB 4TSAH 4KV5F 1X4XA 1ES0B 2AQ1A 2GEQA 5HHOD 1F4AA 1EZVY 2Y1AA 4MMXC 1FYTD 4N3UA 3C5SA 2NUPA 3AT9A 4IBLT 2BXYA 3GSUB 2K7PA 2OW6A 4PJEF 2Z31C 2XX1A 5BOJA 5C3TA 2YD1A 2CGYA 1CFBA 5JIIA 3N42B 3S37H 5J4MA 1FFPA 2NYKA 4U6HB 4YHOL 1LYQA 4YUEL 5AUMA 3CN1A 4TUOA 2D7NA 1J0IA 2A6IA 2E8ZA 3H53A 1X5MA 3VGGA 4WHYG 4P3CH 5BW7A 2X70B 4KROB 3TF4A 2NCEA 3FCSA 4G8GE 3NIGF 5DRNB 2A2QT 4UT7L 3B37A 5FHAH 3FFCA 5ADPH 3WTVA 3UC2A 1YEDB 3FT3A 4RQQB 5JHBA 4HUXB 3UEQA 5GPRA 5KJRL 3E6FB 1UT2A 4MWFA 5KVMC 1AE6H 5JXEC 5EF2A 1XB3A 3DETC 3PWPD 4KTEL 3BFQG 4RH4A 4JFFE 5FYKL 3W39A 2MNUA 3G5XA 3OZKA 3H9ZA 3VMPA 4G59C 1G1KA 1PS3A 4BIKA 1P5VA 1ID5I 2A9DA 2V9UA 1T3FB 1JWSA 4QOKE 2PF6A 2CDFB 4GUPB 3VWJB 4S0HA 5D6DA 3FFDA 3UTOA 2IOMA 3NZ8A 3BW9B 5CZXC 4MB4A 2B5IC 1MUJB 1Y6KR 4AE1A 4K9EC 4KJQD 3FOMA 4UQEA 5EU5A 4KX7A 1IEHA 5E6RB 1JSYA 3OR6A 2CCLA 4WU5A 3S3SA 4FLHA 3ULSA 3CFBA 2C7UB 4MSWB 4X6CB 5K1JA 1KPUB 1M2VA 2E4TA 3ZKND 3HG5A 1KENL 3MFGB 1GTNA 1WBZA 3UDWC 5D7LD 1IIKA 1Q72H 3NFNB 1X7QA 5B3NA 1BVOA 1DSFH 3ARGC 4E41B 2W0LA 5TDOB 5DEGA 3RIAK 4Z3HA 2Y9RT 2AHIA 5T1MA 1RI8A 2AJSH 3LNGA 1X6NA 3NIDE 3MHZA 3QQ3B 3K72B 3U0WL 4IBUA 5DTFA 4XE5B 5MERB 3B34A 1AZBA 4H20H 4Y19B 3V0JA 5JQHC 4LKXB 4NWTH 4L4VB 5I30L 3IVKA 1BAGA 4QOKB 4DETA 1NBZA 4JFZL 3RWEB 2YPVA 15C8L 1J9CT 1IE4A 1DJYA 2EILB 2FUTA 4LBEA 5B1AB 5DZLA 4NP9A 3EH3B 5E1AB 4KHTL 4LL9A 2WKOA 3P9MA 4MX7B 3RPBA 4MD4B 3L48A 5GSRA 3Q7JA 3ZHDA 3QR1A 5ETUA 2H3KA 4MJ5B 3LB6C 5B1CA 4YBQC 4FJYA 1KGYE 1T2QL 2V5SA 4XAKD 1D6VH 2QBWA 2C3GA 4P46A 1NGQH 3OKOA 4K15A 5DK0B 4XI5C 2G9KA 4M6NL 1VERA 1P9MA 3IVKB 5F1SA 1IBHA 3O2DL 5F8QC 5JNYB 5AKTA 2WLNA 4I5BB 1E90A 1WA1X 3BGMA 4G6KH 5F0PB 4AEEA 4U31A 5A2KH 3VE0B 1F8TL 1T0NB 3C5XA 2R51A 4NERA 1KENH 3RAJL 4RQQA 4BDVB 2WSKA 4FL4C 4ZUTB 8FABA 4MCMA 4QXVA 1KTCA 4NUPA 1D5BB 1TT6A 4PRBA 4XVTH 5I1EH 2Q7NA 5E94A 5KVGL 4KJYA 2OMWA 4LLVB 2BVUA 4FAAB 2FDBP 4Y2DB 3RWIB 2GJRA 1GZHA 2ENPA 5KS9E 1FRGH 1YQVH 4H26A 3MACH 2OTPA 4XPBL 3QUZC 4F2MB 1E4XH 1W72L 5F1KC 4NZRL 5MI0C 3KL3A 2OZ4A 2ERJC 1S8DB 4P9HL 4KROD 4V33A 4EOWL 2ZP0T 2ZWLT 1A7NL 4IGBB 4C58B 1UZ8A 2OR8A 2AXGA 1G9MC 4ODHH 1JCVA 4Z0BL 3SDAD 1PY4A 1KGWA 3DBXB 4LSVL 3GMMB 5E6ZA 2ZT9C 3C6SA 1A2YA 1YDPA 4F1ZA 2KLTA 1A9EB 1ZT1A 3IGAB 2WN3A 2QQQA 2A0LD 3FU7B 5FECB 3ZYJA 1GGIH 1I3VA 2HT3C 1H6EA 1F5WA 3PP3K 1S5IL 3BVUA 3QRGL 4NSKA 3OQ3B 1IILE 1OP4A 2HN7B 4W9EC 2ZCKL 2HWZH 4I3SL 1K8IA 3I6GB 3SPCA 5LGHH 3QXTA 4MA1B 5IT2L 4F57L 4FNTA 1HZHH 4R4ND 4PD4K 4XB7A 1JIBA 2V7HA 1WG3A 3SKNB 1QFWH 1EJOL 5BZZA 5DJZB 1H8LA 3LCYA 4HFUH 5DI8A 2BVPB 1TJGL 4S1DC 2GJZB 2X3CA 4LP4A 4XN1A 2UUDK 4F2FA 5ESQB 3MC0A 1NIEA 3HPLA 4TNGA 1PF3A 3FU7A 5BO0D 4P5TC 4NEHB 2MCAA 1NIDA 1E2ZA 4O2FB 1LP9F 3UAJC 3TBTB 1JZGA 5AZUA 5T1LD 1UCBH 1Q94A 1YN6A 2X2UA 1L9OA 3TCLA 2F19H 3U4EB 3BIKA 3H42L 1NGYA 2M26A 4QRQA 2YA0A 1CVSC 1AO7E 1FH5H 2EDNA 2YPKA 3FUEA 3O3DA 4RZCB 3VW3L 1ANUA 3H7BA 4ZFGL 4P8QA 1QFOA 4B5ZA 4JQXC 2EZ0C 5B3SB 2EJ1A 2NY6D 2MKLC 5D2LB 1MW3A 3GXTA 3HNVL 1FZKB 4ZPVB 2VDML 3NCWA 3PV6A 2EE9A 2H1PH 1U8CA 5TDOA 5FF6A 1YO4A 4H8PA 4MMYB 2E5EA 5IMOA 1W8EA 4JFHD 4PJXE 2J8OA 3KPRA 4P23B 3RTQD 3KLHD 4I5BA 3BAEH 4D0DA 2WXOA 4YDIH 1IEAB 1S7QB 3FUDA 2ZCHL 4P46D 4CAGA 1M6OA 4EN3B 1JFQL 1F3JB 3CGTA 1RJCA 3ZZLA 2ZKWA 1MJ8L 2ZXWB 3HZ3A 3II1A 4JFDB 3ILQD 1LD9A 2FO4A 1E5YA 5T3XL 5LGYA 5IOKA 4PJIE 3CZKA 5LUMA 4H2AA 1M4KA 1XGRA 2AQQA 5E94B 1TQVA 1TFPA 5L8JB 5IEKA 3IJHB 3T08A 2CJ3A 3LN5B 1HJCA 3P0YL 4UT6H 3CG8A 3L3OB 3VI3F 3OJVC 4OJAA 2C3XA 1VDGA 4N1CA 1XTMA 2IDUA 4KZCA 4AJWA 4Z7QF 1MFVA 3E3QE 1Y0LB 4TTGA 4LSPH 5EPMB 3X12B 1JBJA 3RFZB 1A7PH 3LSOA 3BJLA 4JJOA 3CQPA 4PR5B 4OI9A 5D1XD 1M6OB 4KZEL 5IQNA 2UY6B 5JIMA 4Z76B 2APVA 3EJJX 4L9DA 4KXAA 3FQ1A 3FUMA 2HJLB 2FO4B 3SQOH 2QELA 4YX2L 5DS8B 2W9EH 3VGBA 4DKFL 1H5BB 5PCYA 3BT2H 2GBUA 4DFHA 3CLFL 3E9UA 3AY2A 1IAKB 1BM3H 3QJXA 5EU4B 1ADQL 2R1WA 1U8KB 5I76B 3QUMA 4U1GC 4C54A 4X80L 3FUKA 2GVYA 4LEBA 3VD7A 4NQTA 4NNXA 1J8RA 2VT0A 4L1BA 4D8PA 2BIMA 1DN0A 3MXVL 5D1ZC 3HFFA 3OKKB 4TQIA 4TULH 2VC2L 2WZ6A 3D6GA 5EDSA 5C07B 3OSKA 4ADIA 1AGBA 3Q48A 5EEXA 4NJAH 1K8DA 2BP8A 3HZMA 3FOLB 5E6IB 1NQBA 4NUJB 4QGYA 3F8UB 3VFNB 5ID1B 2I5YL 2WSPA 1I9JH 3BFOA 4FNUA 1X4YA 4FTVE 1YEHL 1MIMH 4HHAA 3U30B 1CDCA 1D5ZA 1UADC 3OX8A 3AUWB 2GK0B 1MN4A 1UA6H 2VSDA 2Q8AH 3ULUF 5EEYA 2YWYA 5HHMD 4G7RB 3NIGE 4GP4B 3UYOD 5GS1A 3MV9D 1NCWL 1JV5B 2PR4H 1KCRH 5F89A 4AUJA 1UYWL 2GSGB 5FHBL 5C0RL 1E9OA 4M1CC 2YGNA 3QIUD 3SKMA 3S8WA 4MJIA 4F92B 1SJEA 2XWCA 4IDJL 4UANA 3BEWA 2IDSA 4NQDA 5F44A 4PS3A 5BRZD 4BEIA 4ZW7A 2EUXA 3K6SB 2KPNA 1NOFA 3U0PB 4I18C 5J3HD 4I3GA 4WTZG 2F7IA 2G75A 4R83A 1KOAA 1MCKA 1IVLA 3SYCA 1WS7A 1CICB 1GHFL 3O41B 2ZXEB 4NBXB 5GGUB 1VFOA 3GHBL 4LCVA 1MJ7H 4JPWH 3HRPA 4LLDB 2IPUG 1I1FA 2EC8A 5SX4I 2OYKA 1PZ5A 4YHKL 4RNRA 5E6YA 1T0MA 1D7DA 2GCYA 5F2FA 3ENEA