1BYNA

Solution structure of the calcium-bound first c2-domain of synaptotagmin i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SYNAPTOTAGMIN I)
publication title Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1998-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bynA00
5H4ZA 3HHMA 4F93B 5EDSA 1DJXA 4PS7A 4NPKA 3DBSA 2QZQA 2WXMA 3HN8A 2JQZA 3RDJA 2CJSA 2WXKA 1E8YA 4QJ4B 4ANVA 3OHMB 2ENJA 2WXOA 4FHKA 3TWYA 3IBEA 3PREA 2UZPA 3PYCA 2YOAA 4LDCA 1UOWA 1V27A 2Q3XA 1DJHA 1K5WA 1W15A 3ZIMA 4TS6A 2WXLA 2WXQA 4F92B 2EP6A 1DSYA 3CSFA 4ANWA 4Y1SA 3MJWA 3M7FB 3N5AA 5T8IA 3ZW3A 1DJGA 4TUUA 3APFA 3HIZA 4OVUA 2A4ZA 4ANUA 1DJWA 2YRBA 4HVBA 4L1LA 5G55A 1YRKA 2Q0ZX 3PFQA 2RD0A 2K8MA 4OVVA 1QASA 2LHAA 3TL5A 4KZCA 3APDA 2K45A 3DPDA 3L17A 4V11A 2WXFA 3KWTA 1BYNA 3CSTA 4TV3A 1TJMA 1UGKA 1RSYA 3S2AA 4QJ5B 4XE0A 2WXPA 3L54A 4LCVA 2CM5A 1E8WA 4FLHA 4IHBA 4NPJA 4XX5A 1UOVA 2ENPA 5JHBA 4DK5A 4NS0A 4NP9A 2WXHA 3R7RA 3GPEA 3L16A 3QARA 4G11A 2ENQA 4PS8A 2B3RA 1QATA 3NZUA 3F05A 2Z0UA 3R7QA 2A5UA 4WWNA 1GMIA 2ISDA 4L1BA 1E7UA 2CJTA 3FBKA 4WWPA 3B7YA 4FADA 3QR1A 4FA6A 1E8XA 2BWQA 2CHWA 2NCEA 4FULA 4L23A 4ANXA 3F01A 4F91B 4EZKA 3QJZA 4Y1TA 3L4CA 2WXIA 2NSQA 2WXNA 4FJYA 4GNKB 3PRZA 5H4YA 1RH8A 4BFRA 2K4AA 3IM1A 3NSJA 3SD5A 1E7VA 2R83A 2D8KA 1CJYA 1E8ZA 3QR0A 4QAMB 1TJXA 3P2BA 3PS6A 3W57A 1DJIA 2WXJA 4AJWA 4WAFA 1HE8A 4F1SA 3QK0A 3JZYA 2N1TE 3F00A 4HLEA 1BDYA 3FDWA 4ICXA 2DMHA 4WEEA 1WFJA 3ZVVA 5G2NA 2X38A 2WXGA 4ICWA 4IQHA 4AOFA 2ZKMX 5CCGE 4URKA 3W56A 2CHZA 3ENEA 2FK9A 4KZ0A 5KJ7E 1WFMA 3T8MA 2FJUB 2CM6A 3NZSA 5CCHE 3ML8A 4LT7A 4KITB 1A25A 1RLWA 5CCJA 3L13A 1DJZA 2CHDA 3LJ3A 1BCIA 4A55A 1DJYA 2DMGA 2WXRA 3APCA 3RPBA 3KWUA 4EZJA 4XZ4A 3F04A 2KI6A 4JPSA 1DQVA 4QJ3B 4FHJA 5JHAA 4L2YA 3ML9A 4J6IA 2CHXA 3QAQA 3L08A 4FJZA 4WWOA 1E90A 4EZLA 4BGDA 4PS3A 4DNLA 2Y3AA 4GB9A 1W16A 3TJPA 3L9BA 2K3HA 4MJJA 3OAWA 2NQ3A 2V4LA 2QZ5A
chains in the Genus database with same CATH superfamily
5ACMA 4F9PC 5AFAA 2F54B 5DJ0A 1E6JL 1DANU 4F7MA 3DMMD 4UQCA 4XOCA 4QGYA 4LAJH 4MS8C 4X6CF 1AHMA 1E9PA 3KLQA 3CLFH 4X80L 3CU1A 4YBQD 4PJAA 2HUEA 3TJHC 1E4WL 2IXQB 1WCBA 3I6LD 3Q8AA 4OKVA 3F7QA 1FPTH 3FUDA 2OR9H 2DYPB 4PJIA 3TEYA 5DT1H 2AHIA 4R7LA 4XXWC 1DVZA 3N5AA 2ARJB 5JUEH 4URTB 4L4VB 3RX5A 3EJZC 4WI2A 4D8PB 1T04A 4WWKC 1U8QA 2R0ZL 1AFVH 4N2GA 4IBTA 1F4XH 1Q9KA 4BV1A 1FZMB 5C09E 1BVLA 1G7MA 5IHWA 1S5HB 4YFLF 2X4RB 5IIEB 3BD3A 3T2QA 4RDBA 4RGNE 5HYJE 2FB4H 3C6LC 4K73A 4RDQF 4NFBA 5K59F 4G11A 5E2UH 3VWJB 2X53A 1KBKA 1D7BA 2XTJC 5E8DH 3VYPA 2WLKA 2XIIA 3GDBA 3TOPA 2BDNL 4IIQB 4TUJA 5CD5D 3GXNA 2QPFA 4ANXA 2OMZA 4YE0A 2Z35A 4FABH 2E27L 2K4AA 5AW3B 3VGGA 1E27A 1BYOA 1WSST 4TULH 1BVZA 1YN6B 4NZUH 4UOZA 4KZEH 3WFEL 3FCTA 3RVVD 5TPWH 3VFVA 4H26B 3PL6D 4U6XB 4LLVA 2PCXA 1YA5A 5J6HB 1Q9WB 5TQ0H 3GKWL 5E4OA 5B8CA 3QUGA 4K3JH 3ET9F 2QKIA 3CSPA 5D72L 1MXDA 4JJOA 4ENED 1N7ML 4W9ZA 3O3UN 2FHBA 1G1OA 3ZYIA 2RACA 1FG9C 1ORSA 4JRWA 3EH3B 3GNML 5T5FL 1QLFA 1K3IA 3D25A 3CMGA 4XMXA 2ZXBA 5I17A 2XQYK 2J88L 1ERNA 1BZ7B 2NW3B 5FYJH 1RPQA 4G6KH 4MAYA 4P8QA 1TTCA 4ONHA 3TS8A 5A2CA 1II4E 2C3WA 3PDOB 4FLSA 4XXDA 5LDUA 3CSYA 3ZIYA 5I1GH 3FU5A 1AGDA 5JYMA 5IVNA 5ANHA 1P7QA 1HX0A 4ZFFA 1UKTA 3BSZA 1A8ZA 4M1DH 4Z7UB 3PHOB 5IHHA 2CLRB 5CJXC 3IKCB 4MA3B 4P23A 2G3MA 4TTDC 4PGZA 3ISWA 3VFSA 3FN0L 4I1NB 2WBJB 5EEWA 3T09A 4OV5A 5E00B 3RWJB 3QSKB 5HHOB 3TZVD 2JXMB 1CXEA 3VW3H 1F4HA 1ZE3C 4UQ9A 3CZSA 1OAXL 4W93A 1RIVL 2G75A 1KDJA 2LE9A 1XCQB 4YSOA 4KTEH 4ODTL 3A4EA 5C0AB 5LBSH 1WIOA 2FJHB 4H20H 2BSRB 1KPRB 4OAWB 2R51A 4BA0A 3D3VA 4RGND 3V9EA 3DMMB 4IS6B 3MXWH 4Q56A 3BEVA 3ZDXF 4GXVH 1N2RA 3DPBB 3SDAA 4WTXA 4KTDH 4K5NA 4U31A 2J73A 4YDZA 3RZCC 5I1HL 5K9QI 1N64H 3G5YA 3SPCA 3U2JA 4P07A 2FJFA 4UTBL 3IDNB 1KGCE 2Z8VC 4KNTA 2ZWZA 2H32H 2FQEA 2ENQA 4YE4L 5DJ6A 4Y2NA 3FAWA 3QQDA 4XO9A 5L2JB 2VERA 2XX0A 2ZUQC 2HLAA 2EXSA 3HS8A 5FKAA 1B0GB 2D2CC 1T1WB 3I6KA 2G60L 1EHAA 2X4PA 5F1IA 2IH3B 2WQAA 3VI4E 5MERA 2CH8A 1KTLB 2W9EH 5JHMA 5IF0A 5JHLH 3T5WA 5ES4B 1V3MA 3C5JB 3D18A 4NKDA 2H45A 3HMWH 3VSQA 3D9AL 2XJLA 3SKMA 3QEGH 2R9HD 4QRUA 3CHRA 1EXGA 3GGWA 1P4BH 3QEHB 3MROA 4H8VA 5FO2A 2WOBA 4PV1C 3VGBA 2ADIA 3U79A 1IT9H 4NUMA 3EJYD 5E2WL 5FK9A 1KN4H 5AB1A 4NQED 1EHXA 4ZXBC 4LIQL 4PRBB 2FBJH 3ZRFC 1Q0XL 4MD5B 1V8HA 1OB1A 1TJHL 3QJFA 4XHJD 3OZLA 2OA9A 2W0PA 2D3NA 3CVIH 3NFNB 4KTGA 4URKA 3NQIA 1JF5A 1UD2A 3J8F7 5E1HB 4AE1A 3U9PL 2EXWD 4WENB 4LB8A 1TQVA 4LOVA 3V5DB 2VDKH 1NGPH 2VRAA 3QIBA 3NPSB 5KBLA 4PCKA 3ZTNH 5LUMA 4WJG3 1H3UA 3FXIC 1KT2A 4G8FA 4IKJA 1I8KA 3GI8L 2XBTA 3VMPA 4ETYA 3TNMB 5C0GB 3NIFF 1BM3L 1DQVA 3RZWA 2YO3A 4RX4A 4U0RB 2PP7A 1A9EA 1I1AD 3VFRA 3IDUA 4OZFG 3ZE1E 3P2DA 3CVHB 3PL6B 4WK0B 4OLVL 3W11D 5IV2A 2Y06H 2P5WE 1FDLH 1RZJL 5FYJD 2M8XA 5C3IA 3QIUC 1M6UA 3QO0B 4HD9A 2BW4A 5JNYB 3ECWA 1ZHKB 1KDIA 2GITA 2YEZB 3CUPA 4MWFB 1G9MC 3Q1EA 1TVHB 1OW0A 2XN9D 4AVHA 5HHPB 2Z31D 1FNSL 3CCHA 1PSKL 4YQXL 3K74B 2X4UA 1Y6MR 2XZAL 3PWPA 2V6HA 1FL5B 4AE0A 4OZIA 3VH8A 1DQQB 1OT4A 4F80A 5DMIH 5AKSA 3WV0A 3CXDH 5K39B 1D2PA 3KHQA 4E9YA 1CXFA 1MUJB 4G8IB 1C5BL 4K9EL 2RCSH 1AGCA 1C08B 2AABL 2ZUXA 3FQXA 3H55A 4PJ7B 4PJCA 1JMZA 4Y4KA 1P4LB 2UVFA 2WC7A 3K3QA 1AY1L 5AW7B 1FFTB 1IEBA 2H0JA 3GB7A 5A2JH 2AJXL 4EOWH 4PEEA 1RZIB 1CD0A 1SJHA 1FIGH 3VXNB 5F3BB 4PJAE 2X6UA 3FZUD 4GQRA 1ZRUA 3LXUX 1RMFL 4L5FH 4RMBA 1T7WA 1KGCD 4XR8C 3T65A 3KWTA 3SKOA 4NSKB 1BM7A 4TTGA 3L54A 3FTGB 2WZ0A 4D9QD 2X40A 4M7KL 5BCAA 4AYSA 1N59A 1J1PL 1WPCA 3TZVB 1XL6A 4XCFL 4EUPH 3EJCA 2XT1B 3K2UL 3GUFA 1IKFL 4DP4X 2QFPA 2H6PA 2C1OA 4L5FE 5EC2B 2YXVA 4FADA 3L3OB 3QJSB 1IC5L 3KLSA 3OQRA 3K71B 5BO0D 4A2MA 3ZE0F 3KHOA 4GNKB 4M6NH 1FVCB 2XIDA 2VN6A 1RZQA 4RGNB 4N2OA 1JRHL 2D8KA 2EAEA 4LF3B 4YHIA 4OZHF 2VM4A 1QSED 1SJMA 3LKRA 4J2QA 5DJDB 5C0FA 1Y07A 2XPZA 3DUSA 3MRHB 1E6OH 2NY3D 2YD7A 1Y6KR 2J2ZB 3R4RA 1SLVA 2O6EA 2RFXB 4NOBA 2JVUA 2WGXA 1BQRA 1Q9OB 4LE8A 1DN0A 1GYAA 5MEQA 1YQVH 5B4MD 5DUJA 4IOFC 4WK4B 1JXJA 1W8NA 1XIWC 5AZUA 4BSWA 3WFBH 3IWUA 4Y5VA 2J4WH 4NHUB 4HT1H 1T1XA 1JGUH 2WYTA 1PU0A 2P5WD 4LLDB 4XBPA 4R7NA 5I8CA 5EULV 1UHVA 1OCOB 3AREC 2SEBA 3I9IA 3LKNA 2LV4A 4X6DF 3IFNH 4W4NA 3WY2A 4NQEB 3KM2A 4L3EA 4MYWB 4OUUB 1BFOB 1ICTA 2I9TB 3ORJA 5EA0L 4M5ZH 4W6XB 5FYKE 1NBVL 4M61A 2VISB 1AC0A 5C2BL 4P4KA 2ICEB 2NY2C 3UMNA 5H8DA 4ZJ9A 2JKJA 3POCA 2X2YA 1Q72H 2PCPB 1KTDA 5EU7C 3FCBA 3MYZA 2AAAA 4E9QA 4UNIA 5MHSE 5EOCH 3VXQA 5DD6A 1WFIA 1T6BX 1IBYA 3B9VA 1NEZA 1YJDC 4UDUB 4CNIB 1I1AB 2FECI 4H8WC 5TE7H 5I26A 2UWEA 3MDJA 8FABA 1I8MB 3SBWA 5DD0L 4HIXH 4C55A 2V9RA 3EYUL 5FYLL 4UQAA 2JTYA 2OI9C 4PPTA 5A2KH 1DDHA 3ZMEA 3UZVB 4DESA 3VMNA 5IJDC 2BS9A 2OJEA 4OVVA 3S5ZA 2XN9B 3Q13A 4JDTL 1KCKA 1XT5A 1HU8A 2Z31B 3SGDI 2YPVA 5HHXH 4YK4B 5ISZA 3FKUS 2V7NB 4LNRA 2O61B 1AP2B 2NW2B 3EF7A 4TV3A 2H26B 2ORBH 3MNVB 1KYAA 1MNNA 1MFBL 3O2WL 3BWUC 4OV6F 5DGRA 5HSFA 1F4YH 1GGUA 2ICWB 1PNDA 4M6AA 4RGOL 3FB6A 2NSXA 1THAA 3RJOA 3SDXA 3UTZB 5GGSB 3MLVL 1AO7A 3F58L 4HUVB 4BWUA 3WIFA 4JO4H 1GJWA 1XQ4A 4UINH 5IJBC 4QRQB 1UC6A 1E28A 1T6WA 1MKFA 3DVGB 1WAPA 4NAJA 3LHAA 5I74B 3HC3L 1KGXA 4QAMB 5EUOE 4U3SB 3U6RA 1ZE3H 3MBWB 5I9QC 3CZEA 3TJHD 1D5IL 3HUJA 3JTTA 4F57H 4MLSA 2H6OA 4XAWH 4W9JC 2Y07H 3VI4B 5T5NF 1T83C 3BH9B 2CO6B 4XNDA 1FORL 4OIAA 1PZDA 2H32B 4A37A 4K5OA 4ONGH 1A7QH 2ILLA 3D85A 2VXTH 3EJZD 3T3PE 5IQ9A 1J9QA 4WWKD 4QOKA 3JV5A 1NAML 1KTRL 3ZX1A 43CAB 1WS8A 3VSVA 1BXUA 4G7SB 2VUYA 2WLLB 4U4BA 3IMVA 5IWLA 1OAKL 2CO2A 4OCLC 1WWBX 2EIEA 4IU3B 1LXMA 5KSUB 3MO1B 3V5KA 4J8RB 4KY2A 1QSEB 1FSKB 5KEZA 2Q76A 1HOEA 1J5OH 2VZUA 1I3UA 3RPIB 4Y5YA 5JA8B 2NY3B 1CLCA 4M5TA 2XTJD 4B27A 3UBXB 1A4KA 1F1AA 2BHYA 2ZCKH 1AZRA 3CFQA 3FFCA 4LSPH 5C07A 4MDJB 2ZP8A 5ESQA 1A9BB 2AZUA 3VYNA 3CHOA 1OAJA 2DTML 4F2FA 5KWYC 5MHSD 1HSAA 1AOHA 5SX4H 5CIPA 3KBHE 1I9IL 4OCRH 4LVNC 3VG9C 4MMXC 4APQC 1BF2A 4QXUH 3RGBA 3LPPA 1KYOJ 3FB7B 2YBRA 3WNOA 4PCSA 2RMNA 3WHXB 1MH5A 2FHCA 3N85L 4UDTA 1CDJA 1NIFA 1P5UA 1X5LA 5DU7A 5EFIA 1L9OA 1IGMH 2P5WB 2VDKB 5EH1A 2UZXB 3BYYA 2JKTM 1D7CA 3QQ3B 4PRPD 3U9WA 4L3FA 5LNGA 3WJMA 4F58H 1GMEA 4E0RB 3MBEC 4KPHH 4PB0H 1FJ1A 1XH3A 4R7DA 1OE3A 3OF6D 4ZQKA 4OZIE 4I87A 1MPAH 3T6QC 5IOKA 3D06A 4FQHB 3BH8B 3MV8E 3UG3A 1JVOA 3DO7A 1WLHA 2XZCH 1P7KB 3PE9A 3JWDC 4NFDA 3NH7L 3GSQB 2VUKA 3PJNA 4A7QA 1K2DA 2CA3A 4JY4B 4M6OH 4P3DB 4V11A 3T9WA 5I1LB 5JR1H 1KXTA 5G4OA 1MWAH 2E5EA 2AJYL 2O26U 3K80A 4TSCH 4MQ7B 3ZR5A 2FDBP 2Q5BA 3D4CA 4KZDL 5I66B 1EUTA 2CIIB 1JPFB 1WAAA 5BXFB 1G9MH 1AYRA 3GJFH 3TYGL 3WKQA 2A73A 1XGZA 3SN6N 5E6RB 5I1CL 5J12C 2VOTA 2JH2A 2AVGA 3W3BA 4ESKA 5K9QG 3MLUH 4GQQA 3AWGA 1OZTG 1BFTA 4DEUA 1I85C 4B9GA 1UB5A 5KVGL 4J5VA 4S1QL 1ID2A 1KPUB 3GEWB 3H9HB 4X50A 5EIQA 3ZYOA 5A6MA 1T22A 4UIKH 5F6IC 3DHPA 4NKIH 4Q2ZA 4UTAH 5I28A 1M9SA 4U1LA 5T33H 3QQ4B 5LAXA 3OZ9L 1W8EA 4BUGA 5C8JB 2AI0H 3IRZA 2DIEA 3RAJH 4CW1B 2W0KA 1H3PL 1PYWA 4OZGA 1QNZH 1R1CA 4PRIA 4ELMB 3AXLA 2G5BB 4D9RE 1UATA 1IKNC 4EUPB 1J1OL 5CN1A 2FUTA 4MGXA 2E3VA 4IU2A 3UPCA 5BVJB 1KJMA 1UM6H 2FNWA 1A7OH 3PIQA 4ZX3A 2XX1A 2QQQA 3E2HC 4HWZA 1P6AB 4FQJH 4AL8L 1NTDA 1DJZA 1WWAX 2ZF8A 1FNGB 1V55B 4EQ3A 5HPMA 2OFQA 1I31A 4Z0XB 2GK0B 1MVFA 1W0WA 3GUTB 3TONA 1VFBA 2V17L 2FO8A 1DBKH 3ECQA 2R2BB 1U33A 3UJJH 4I89A 4EMZA 3HI5L 3OJMB 1AJ7H 4CVXA 3GTNA 4LLWA 5LGKA 1TT6A 3MRFB 3UG4A 2PW1B 3X11A 1AHWC 4KNSA 4WWKB 2BNUA 3V0DA 5DA0B 2JJUA 1YMMA 1U8JA 2NTSP 5CFAA 4TPRH 4L3EE 2DDQH 2J57A 2IQ9H 4WHDA 2D3JA 3K8MA 4XMWA 3ZL1A 2FYVA 5HD8C 3LH2H 5J13C 1P9MA 4P9ML 4ALAL 3MKGA 3MMEA 2J43A 5KVDH 1LO0H 2AK1L 3MV8D 3TIDB 3KPRE 2CRZA 3PGDA 3QRFM 1NFAA 1QZ1A 4BXSV 1V54B 1CCZA 3VCLA 4ZXBD 3DIVA 2XTJB 4P2OD 2Z4QB 4AEHL 4HKZB 5INDB 3OAZH 3OR7A 2AV7B 2EKSB 1UH3A 1DANT 2MTPA 2X1PA 2BWDA 4IBLT 3VYOA 2UWEE 1EPFA 5E08H 1OGTA 1CXIA 4N2DA 4UI2A 4IRZA 4TVSa 5K9OA 3WTXA 1JAEA 4GUCA 3S2AA 1MCSA 1E8WA 4E41D 2G2RB 2JSFA 4P2QE 3WEMA 3PJSB 3R06A 1ZTXL 4BFKA 5CBEB 4PRPB 1BVKB 2Z7WA 2F5BL 2UY7A 4IDJL 2WSPA 2YA0A 1OSEA 3QUYC 4TQEL 1RZ7H 2FATL 4KJPD 3FT9A 1D7FA 5ISZE 5F0JB 4F5CE 2YZ1A 1U9KA 2IV9A 3K8KA 4GO8A 3I74A 2ITDA 1RV6X 4OCWH 3TJEL 2FWOA 1CURA 3DX9B 4PUBL 3T2OA 4I0PA 3VE0B 4A7VA 1MY7A 4UMGA 1PIFA 1AO7E 1PNCA 5EZOH 3PS6A 4JKPL 1I3VA 1S7TB 1DVSA 3LS5H 1EVTC 3VU2A 5KJRL 1FL6B 1OCWH 2EUVA 4I77H 2VLKE 4PLKC 1G9NC 1X5ZA 1YNTB 4HKBB 4QRBA 5CBAA 1ETA1 3AVEA 4FXGB 1M57B 2D73A 4OH2A 3V52L 4DETA 2GHZA 3LHPH 1LDSA 5EWIH 3CFBB 4J2XA 2D3LA 3FRUA 3EDDA 2W07A 2HTKD 3FOLA 3ME0B 1P4IH 4JGMA 4GW5A 4UIMA 1KC5L 3PPSA 3OXRA 1L7IH 1DBAH 5EUOB 4FFWD 2B1AL 3HUJE 4AT6A 4OF3A 3C8HA 4Q6KA 4WNSA 2FLMA 4EIUA 1RLWA 4I3RH 3TO4A 1QTSA 1W72A 2YIHA 4PRDB 4UQBA 2WQRA 4YL4A 4G5ZH 1YMHA 4GRMA 4R3SB 5FUOL 3UL4A 1WT5C 2A38A 4ZOAA 5I0WA 3LQMA 5CJQL 4CSZA 1PAMA 3LTVA 4PREB 2FLBT 5JOPD 4ZTOL 3EBGA 4KJYA 5ABZA 3NJGA 5F0LB 4GKSA 2D7PA 2YUXA 4OBSA 2VXQA 4UAOC 2CSPA 3WO4C 4BSJA 4F33A 5KBNC 3WBDA 1GW0A 4HLZG 4HU8A 4TNWK 4M5YH 1J0ZA 4OFQA 5L2KA 1PFCA 2CMRH 3GJEB 3QYCA 2AQRA 4NBZB 4OSUL 5DJCB 4BFIA 3RDJA 4R9HA 2DJUA 1NCJA 1KG0B 3DURB 3F7YB 3KPRD 5C07E 3FFCE 4BDVA 3H42L 3UOAB 1KIRB 1CLOL 1ZLDA 4RLDA 2WB1A 3G5VB 2M26A 5LBVA 5I30H 4LLUA 1Z2KA 3FB5B 4FNLL 1J1XL 4NO2B 4NO3A 2FGWH 1T7YA 1XR9B 3BUIA 5CO1A 4XGZA 3ZMRA 1K8DA 4IKLA 1M6OB 5EOQH 4F37F 2ZUQB 4LBEA 4P5KA 1IE5A 3PP4H 1HEZA 3CE1A 3WENA 4L1DA 4IOFD 2UXTA 2KZWA 3AUWB 1MFDH 3I2CH 1JGEA 5E1AB 4P2QD 4YHMH 4L4TA 3OGCA 3C9NB 1BYNA 4IK7A 1O5PA 2GW5A 4ORZC 1S7XA 1RIHL 1LDPH 4WEBH 3ARED 5G4NA 1U8HA 3MV8B 1I7TB 2MQ0A 3BKYL 4PCYA 2CKBA 1SHSA 4J4PC 4X8CA 4ZXBB 4OLUH 4P2OB 4LLMB 4D8PA 3GS7A 1BVNP 3WY4A 5DJ2B 4LDLB 2NY2D 1HHGB 3QHTC 5CILL 4Q0XL 2W95A 2J1ZA 4HUXA 2VLKD 1WAAE 3DGGA 5D2LA 1T5WA 1JZHA 5HVWA 2Z91B 5JXAH 4OIIL 1HJBC 3HE6A 4OM1H 1WFOA 4F8TA 2D4FA 3BQUC 5ETUB 3WHE1 4E41B 2QPDB 3LKOB 3VWJA 3WE6A 2XZZA 2Y6SC 4C4KO 2XRAH 3VI4F 3F00A 4RAVA 1MWAB 5KYXA 2PR9A 2WJ5A 3JWDH 2X38A 4XH2B 4JDZB 5EOTA 2HRLA 1ZGLM 1MJUL 3GJFB 4NWUH 5D7JA 1CPUA 3AS1A 3KL3A 3QEUB 2AEPL 2VN5A 3ASWA 4QRPE 3L6FB 3QVAA 5AOMA 4HOXA 2FEJA 4KFZC 5AVSB 4LSTL 32C2B 3WSQL 3QRGL 5I24A 1T66C 1N5AB 4OZGE 4PRIE 5MEOB 5BMFL 4H26A 1UJTA 2HWZH 4U6XA 5EHFA 4LAQL 1EXUB 1IEAA 2IALA 2K7QA 3V6OE 4TNWF 2IQAA 1GGIH 1PZ5B 2EDBA 4XC1L 5DYOB 1KEML 3W9EB 3M88A 1WHOA 5GS0C 1WICA 1LD9A 3UZEC 3NGBC 4WHYG 1ZXKA 3BRDA 1YN7A 5I82A 5GZOD 3ZE1F 2ATPA 2XA8L 3QUML 3QA3A 3CDYA 3QG7H 1I7UB 1RUKL 3W37A 1UZ8B 2GY7B 1MVUA 2WKGA 4MHHI 5DZVA 5LCVL 4LDCA 3BVTA 1OSZA 4KVNH 5D7EA 1J0JA 2JB5H 4K3EH 1YMME 5AOZA 1ZA3A 5KN5A 4FN0A 5CHNB 3HBGA 2G30A 2RR3A 5FC9A 3HZYB 3VXOB 1BQHA 3GC3A 3UEQA 4Z18A 3ATEA 3LQZB 5IB5A 1XTLA 1LQSR 3SPVB 1ZLSL 1CIDA 5I1EH 4PD4K 5GJSL 1FBIH 1DEEA 4G8GA 3VFWB 4YNYA 3S7GA 3UP6A 4B3EA 3PNWB 4KKNA 4UZGA 4CU8A 3C8KB 3KPOA 3KPRB 2NY6C 2OAAA 2J7LA 5DEFB 1HKLH 1BG1A 3MRBA 1MHPL 5EN3A 1CS6A 4ZMWA 4PJAF 1HAWA 4ENZA 3TP4A 5C0EA 3VXPB 5EC1A 3ULSA 4NWTH 4U7SA 5IROA 3CFMA 1YPZA 3B5GA 4OAWA 4G6MH 3JWOC 3SE6A 4O9HL 3A4FA 5DRZA 2ADJA 4IS6A 4OLZH 4Z5RA 4MD4A 3VXTB 4BH8B 2BRRH 1Z9SB 4P2QB 5AYQA 3T3MB 4X5WA 2ZXDA 4K2UL 2COQA 5C6TL 5DQDL 2XICA 3GO1H 2OM5A 5SWZA 1GHFL 1JPTH 4NLAA 1UXMA 1DLHA 4PWJA 1HXYA 3AREB 1J5IA 4PYGA 4ZBJA 1X6LA 2GC7C 3D09A 1HQ4A 3MBED 5ANMA 3MLYH 1M2VB 4LPYA 4WEEA 1BP3B 2VAAB 3GLDA 1OAQL 1SVCP 4AZ8A 2WCPA 1MLCB 4DF9A 4PGBA 2NY2B 5KANI 1PF3A 3GSUB 3OKLB 1NGXA 3NZSA 4HUWB 4ETQB 4Z78A 3C5JA 4U1NB 5ACZA 1JSYA 3P73A 1C9SA 4Z7WA 2DIAA 3V5HB 2VLKB 1A2YA 5KSAC 4XPFL 2PYED 4BZ2L 4EE2A 3IU4L 3EYVB 2F61A 2RHEA 4S1RH 5IK3A 4C83B 4IOSD 2DQJH 2YN3A 4G1MB 4WO0A 2WAQA 4R4ND 4HK0A 4O2EA 2UY6A 2HVKA 3MRIA 1QI4A 2OI9B 1LE5B 2Q3AA 2W80C 5D93C 3Q5OA 5F9OH 2PTVA 2NY5L 5FO9B 4MMZC 1HIML 3V4VH 3UTTD 2FZ3A 4Q4EA 2WXKA 1PCSA 2NY7H 3CSGA 4HUCA 4RQQA 2YUVA 3TT3H 1J5CA 5C0GA 1BZOA 3T71A 3CV5A 4N8UA 4OGAC 3EUDA 2IAMA 4GP8B 2YOAA 4P5MB 1A6WL 5L2KE 3T4YA 3L5JA 1WK0A 2NX5D 2P26A 4NRXB 1CTOA 3G5WA 5DXWA 1A3ZA 2LU3A 3M86A 2DWEA 1E5CA 3F7RA 4ZRGA 3TF4A 2VXVH 1MY5A 4JDVB 4Z95L 3PNRB 4XODA 3TA3C 4NKQB 3TU6A 4DGYH 4DWHA 1BEXA 2F9BT 1GOHA 1EO8H 4LLQA 1S9VB 1IC4H 1CFSB 4DO6A 2B7DT 4IK6A 1T2QH 3GSOA 4QKTA 3EBHA 1DUZB 1XMWA 3NZ8A 1KB9J 4X6FB 3L9EA 2PCFB 2F6AA 2OMWA 3PDDA 4Q7DA 3LX9A 2UUDH 3L1OL 4HIHB 2HP4A 3DJRA 2Y9RT 4YX2L 5C97A 5I1AB 1P4LA 5FM5M 2XV2A 3MRCB 4FG0A 1QW9A 4JFEE 3CVHL 5B7FA 1RIUH 3WKMH 1P0SE 4BHUA 4L4TE 2N0MA 5EN2B 1WITA 2YAEA 3JUZA 3MI6A 1S9YA 4FA6A 2ADGB 5ICXB 2EYRA 3W38A 4LLAA 1U8IA 1KJ3H 2OKMA 2L04A 4ZMAT 4ZOEA 1CE6A 4WO4A 4HGWA 1EMTL 5HD8D 3WXWL 3WTUA 4RNRB 3SGJC 2FWUA 1LP9A 4DKDC 5DZLA 4F24A 4WUUA 1NIDA 5ADOL 1HTYA 5SWQB 4HXBH 5JZ7C 3FU9A 5EBGA 3CDFA 5F7LB 3L2NA 1U3ZA 2VMFA 5GRXG 3K71A 3T8XB 2H1PH 3CDZB 4BZ1H 5D5MA 1A1MB 1S7VB 3DV6B 4FFYH 2J1XA 5EUOF 1I8IB 4XX1G 5TDNB 4LVNB 2CUAA 3GPSA 3S35L 1PY0A 5HGHA 3VG9B 1O9VA 5ID1B 3GJFK 3L13A 2DBLL 3NTCL 4MJID 3LS4H 1IJ9A 2PTTB 4FHJA 2Z6FA 1KZQA 3T3PF 4R7XA 3RDTC 1RJYA 3QUYD 4NUGH 3M8OH 4XMTA 1CLZL 4NZFA 1YG9A 2WQXA 3C2AH 5CMAA 1ZS8A 3MBEB 1PZBA 2MOGA 5L4JA 1ETJA 1JDCA 3ZHNA 1TZAA 1TZIB 2X7LA 3MREA 4MCZA 4ZI8A 3ATBA 1FPTL 2QADC 4NRZA 4Z76A 1DDTA 5ADPH 3KBEA 4NHUA 3IMUA 5DMYA 2KS0A 5JUEL 1R47A 4ANVA 3MLSH 1EV2E 1ZEAH 4Y4HA 4C56A 3T0EC 4AW4A 2PYEB 1PTZA 1S7WA 5F1KC 3WD5L 4FTVD 3W82A 2UYLB 1TZHB 1WFTA 2O93L 3NCXA 4YO0B 2QV2A 2VJ0A 1Y6NR 4PLKD 2WIMA 5I8OL 4H8HA 2Q3XA 4D94A 2WXLA 2I9TA 1MFCL 1SDDB 1FG2A 5GGTH 1QAWA 2X42A 1XO8A 4XMLH 5IJKC 2C8NA 5DVMA 3MUY1 3MUZ1 2ICEA 4A7SA 5CGMA 1JGVH 3FQNB 1JL8A 5E2UL 4N8VB 1UXSB 5AOIA 2PCPA 4TL5A 4KHTH 4ADGA 4EDWH 4EVNA 3UTTB 5FYJU 3JBG7 4U1IB 5AVZB 4D2NA 4JAMA 4XNYL 2AGJH 1GS6X 4N22A 2IWEA 4JFED 4FQ2L 1AQHA 4OZIF 4CN1A 1I1AA 4DHLA 4PIRF 4OLYH 4Y5XC 4LKCB 1IKOP 3BUTA 3RNKA 4HWEL 4U2ZA 4TRPL 5GS0H 2NX5B 3IDIA 1DVFC 4NZUL 2X44D 3C5ZA 3GBDA 1YYMH 1CBVL 5T3ZE 2E76C 1IX2A 4PGEB 2GJ6E 2EZ0C 2XN9A 3BW9B 3FQYA 1XR8A 4X5PA 5TQ0L 4O51A 1UD4A 5DDHA 2YC1B 3WXVL 3TPUA 4XNMB 3D4YA 3MJ8B 1X5KA 3U2SB 1JK8A 1YPZE 4ZW3A 3OAZK 1H15A 3LEYH 3H9SD 1DJIA 4KROC 2IDFA 2VC2H 1FC1A 2JFCA 4YIQB 3H0TB 3QYMA 4K5PA 1WRFA 4CJ1A 2DI7A 2H7WA 2UZIH 4C54A 2X1QA 1YY9C 1VKXA 2BW5A 5SWZE 4JRXE 5BO1H 1QWUA 5L7XH 1AHWB 4M7JH 3QUKA 4ZTPL 4IYKA 1XV8A 3OHXA 3BKCH 1KWKA 2IGTA 2GPZA 4K23L 5E95B 5I1GL 3V0JA 2E4FA 4UOQA 2JKSA 4WTZA 5ANME 4GIOA 4M1DL 4ZMZA 1AZZC 1Z9PA 3D50A 5DUPL 4X4ZA 5AVVB 4QTHA 4QLWA 1AOZA 4PRHA 2K7PA 1NZRA 2ZKXA 3FU7B 5EO1B 3EJTA 2EYSA 3BXNA 4BGDA 2IGFH 3JWOH 2CO6A 4LHUG 1SXAA 4R26L 1I1YA 3AADB 4NNPL 1MQKH 5IR1A 1QSFE 1G7LB 2R8SH 4UQIM 4ZYKA 4I13B 1IVLA 2J56A 3APMA 3F7PC 3NSDA 2DQHH 5E8OA 3KD4A 1A6UL 5E1IA 1UACL 4MCNA 3LNEA 4ZD3L 5EBMA 4H20L 1HZHH 4L3CA 4YL9A 4MJIB 5DEJA 3SDYH 3N55A 5LWYL 3BQUD 1KENH 1MDAA 1V27A 5GSRB 3OKEA 2YPKA 5DHDA 3QUYB 5HDBB 4ZNEA 1X4ZA 5CUSH 2JV6A 2BS71 2VCOA 5EEUA 1C8QA 3WLBB 5GRYA 3MJ9A 2DN7A 3TURA 3GMRB 2ZZUT 5E5MB 4MHHG 3V4LA 5L88L 1YRKA 1IBDA 4RWYL 2HYMA 3VRIB 3JYCA 1C16A 4JFTA 1ZXQA 3QORD 5FDYA 1GTFA 4MQSB 3ZYJA 4OT1H 1T66D 4HHAA 3UJIH 3V4VB 2FBOJ 2W9EL 4FTVB 3B7TA 4JFVA 4BK4A 2P24A 4HCIA 5JHLL 2WXHA 4GEJA 2GJ6D 5KS9A 4ZZFA 4B95C 5FUCC 2UWEF 1F3DJ 3HMWL 1DYZA 4CVWA 2DLGA 3WFCH 1ZT4B 3BH8A 4KKCC 3Q3GA 5GS0D 4G1EA 3L5XL 1QZNA 2KT6A 1IT9L 4RMSA 2VSKB 2YXFA 3ARZA 1QI3A 3K2MC 5L0QB 2EDNA 3EH4B 4NIKB 4X7EC 3F12B 4JQVC 4LU5L 2RALA 5D4JA 5DFWH 4ZFQA 1R9FA 4WU7B 1AI1L 1VLXA 2C34A 2WCSA 3MAWA 3TTYA 4WI9A 2ICCA 1ULVA 5TFSH 4JFEB 1KCUL 5HI4C 1ZVHA 1CWVA 3KDMA 4PJ9C 3ZHDA 3I9GL 1NEUA 5IT2H 1J8HD 4HW6A 1GOGA 4XTRC 4X7TB 2H8PA 2KHAA 2M2DA 3GBNL 3HRZC 3L3IB 3KL5A 4HH8A 4UAOB 5DD1H 4PGDA 3WO4B 1SEBA 1M1XA 2E86A 4DN3L 2X4SB 1FNHA 1BOGB 4FMFA 5F7BA 3VXRE 5IVXB 2WANA 1B0RB 5D1QC 4NBYB 3VM7A 3NRFA 1JPSL 5AAWC 5I1JH 4MD0B 1BMGA 1QSFD 2DICA 3H9SB 3NACL 3QQ4A 3K0WA 3L4TA 4RDQG 3EG9B 2E7LA 3D05A 3S48A 1N68A 3HUJF 4M4RB 5KANG 2OYMA 1CFVH 1GIGL 2APTA 3CH1A 4HJ0D 3AT0A 5FWQA 4YLBA 1JK9B 3NCYP 5E8NB 4YGVA 4DZ8B 1LO4H 4XBGB 3VU1A 5EU5B 4Q8BA 5E9DA 1TLMA 3RE0A 1E8YA 4MZ3A 4UB0H 5EORL 3RTQC 3O45B 3BPNC 3HHSA 4IMLA 2XNAB 3NN8B 2GJZB 2ZWYA 2D9CA 3U1SL 2Q86B 4ERSL 2A9CA 4AZUA 4N0YH 4L5FL 4D8OA 4FFZA 3ZIMA 1LNUB 1HEHC 3MNZB 4NB7A 5E8EA 4JFFD 1UXWA 5HI3C 3FRPA 3FTVA 4C56E 3PGFH 5C9JA 2PPAA 3ILPA 2GTQA 3O6LL 1NH6A 1YYLL 2R0LL 2WD0A 4CSSA 1BLNB 1UWGL 2XQ0A 4PG9B 5A3IC 4ODXB 4GAYA 2BP8B 3VO0A 4H5SA 1H9VA 1GGTA 3L17A 3VGHA 1OP4A 1XH0A 2DLFL 3CC5B 4H0LC 4OIFA 4LVHC 4YSRA 2WMPB 3C6LA 1TF4A 3FHAA 5F6HJ 4HCFA 3TIDA 1T1ZA 4W9IC 1NC2D 3SE4A 2BSSA 2DQUL 5DS1A 5JMRA 2WNKA 5D6DC 5TDOB 1JUFA 3CZLA 1KCVH 1JE6A 2AQQA 2LQRA 2IPKA 3SGEI 4PJ6A 5IBLC 5F7EH 1E6OL 2BWQA 5FO8A 1IGJA 2QQLH 1MJ8L 4QLRA 4XN7A 5H4YA 4BFRA 1PVHA 1DQMH 3HNSH 1ACCA 1EDQA 2PW2A 3QORB 5CZVH 3ESUF 5L6YL 3ILQD 5ECGA 3KEDA 2VXUH 2FUQA 4OGAD 3PJSA 1U36A 1BFVL 1MREL 3ZDYB 1BVKA 1SHMA 1OCZB 5C0BA 5AUMB 3FO1A 2XN0A 3GIZL 3GZQA 1U41A 2GJ6B 3DK0A 4QGTA 3FQWA 4Z3TA 1IU1A 3MLZH 5FYKL 1JGUL 4D0DA 2DL9A 2YKLL 3OKMA 4LEXL 3EXJA 1OLZA 4WF7A 1WAAF 3TA3D 1B0IA 2Z3FA 2JCCA 4XP5L 5AVUB 3NGBB 4M7LT 2W94A 2O6DA 3EFOB 1IQWL 1NCOA 2YRPA 3CAFA 3ECUA 1LEIB 3QHZL 1AR2A 2RA1A 4LSUH 4PS4L 4TVPL 1FVEA 4AITA 4Y2OA 2MPAH 3QIWA 3KXFD 3CDGB 3BZ5A 3RPBA 2JQMA 3BKJL 1A6VL 2VLLB 3E9TA 4ZUTB 5GSVB 4GUPA 5SX5H 2DD8H 2ZWLT 3QCUL 2R1XB 2IADA 1M7IB 3D2UA 1J8HB 2DKUA 4P5TD 1QTYT 4Z3JA 2VLJE 2VC2B 2O5ZL 4ZDHA 1DL7L 5BRZA 2EC8A 5TE7L 4OZGF 1CE1L 4HIQA 3V6FB 1EFQA 4LCCB 4R2GC 3EJUA 3MLTA 5J4MA 4PRHE 3FSZA 3HW7A 1BAFL 1ZIAA 1LK2A 5B1JA 4PCTA 2QV4A 3ROLA 4XNUH 2HX9A 3KW8A 3GLZA 3STZB 4QD2E 1CVSC 4J3OG 1U6AL 4G80A 2GTWA 3CN4A 3HPLA 3PGCA 2A4CA 5IMLB 1QSFB 1J9SA 1H0DA 1H8OA 3NT0A 4G7VH 4K7PX 4ORGB 4X2UA 5I2IA 1IL1A 4AQ8A 3LXAA 1HOCB 1S5IL 5JZ7D 1S9WB 1VPOH 3N9GH 1D5BA 4PLOB 2WSKA 2WUBH 4B9FA 5LNDA 1F4YL 1K6QH 3MN8A 1OARH 4X7SH 3UXFA 4X98A 2XQYG 3ILDA 1P5VB 3DURA 4ZNEE 1PLAA 3AY4C 4S2SB 3VFUB 2EIBA 1L9TA 2VDNL 1G1YA 3RZCA 3G5VA 5FB8A 4MXWH 3QG6A 3QXTA 4JL1A 3M46A 2YMOA 2KZKA 3NABH 1R5WB 3FO0H 4XRCB 3RY4A 4R84A 3BP4B 2X09A 4HEPG 3IFLL 5DHMC 1EEZB 1G4RA 3TCLA 3B9DA 2EVIA 1RJLA 4JFFB 4LLYB 5GJTH 3VXMA 4JG0H 2P8LB 2VJXA 2W60A 1CICC 1LE9B 3FONB 4LOUC 2JKIS 1J88A 3TBTA 4APXA 4BHUI 4HOWA 2EEDA 1HHJA 5AENA 5KS9E 5CWSB 4N0UB 1ZANL 4KHXL 4KRPC 1ZSDA 1EEYB 4LEOB 1FZKA 4MDIB 4L9LB 5D7IE 4RAUB 1O5DT 2K6WA 4E5XB 1IFHH 1QBMH 4W4OC 4AGOA 1NC2B 3WOVA 2ZKHH 5T3XL 3FB8B 2ITEA 3FO9A 1PZSA 1TNMA 3E3QC 3JXAA 1BBDH 5DS8A 4KQ3L 2GKIA 2XYCA 4Y7MA 5AZ2H 4ECNA 5D93B 2VR8A 1IIIA 5DRXB 2UUDK 1DVQA 1O6VA 3QDMA 4MMZB 1F4WH 1CDUA 4XCCL 1ZHBA 4LSPL 3V0VA 2JMRA 4XOBA 5FA3A 4O2CA 4YHLL 3TWCH 1RKRA 3R18A 3V2AR 4E41A 1ZT1B 3KWUA 5HXMA 3L1GA 1FNAA 4JPSA 3BAEH 4K71C 3SQBB 1ACYH 2EIZB 3IJ7A 2AITA 1IGCH 2YWZA 3GWJA 1DVFD 1R3HB 1P84K 3IU3B 4BFFA 3SOTA 4Y2LA 3QIUA 4BWWA 2F1BA 3TA3B 2HTLC 2FEDC 3RFZC 5DF0A 2EZ0D 1MFEH 4F58L 4YBLC 1B88A 1K4CA 3OXSA 4X9BA 2EDOA 4I3SH 4DGUA 4BA8A 2BNRA 2VYRE 4DZBB 2D7TH 4B7LA 1N5AA 4G9FD 4C8XA 3KXFB 5AD0B 1Z0NA 1CDBA 3S96A 4N90D 5DUMH 4J6RH 2ZXWB 4M6OL 4NQCD 2QVFB 4GKZA 1RZ8A 4DVBA 5E8PB 1R0AL 5E9DE 4MJ5A 3ARYA 4P5TB 3QPXH 4JQXC 2PO6C 1YY9D 1COBA 2JKXA 3G04A 3K46A 4ANUA 3NRPA 1KV3A 3QWRA 4XCYB 3X3GH 2F58L 4AEEA 2VR7A 4QTIH 4DW2L 4AG4H 2RGSA 2HH0H 4IMKC 2XKNB 1KACB 3FSOA 3DSNA 1NLBL 1OM9A 1ZS2A 3EO1B 4NJ9H 5AZEH 3NCJL 5J56B 2BIIA 3P2TA 3WMSA 4P2RA 3PABA 4WSKA 3ARBA 3EYOA 4HJIA 1L0XA 5I16A 1INQA 4EIGB 4EDXA 1PKOA 3BVNB 2OYPA 4OF6A 1JWSA 3BDYL 3GXIA 2B9BA 1HCZA 2DQEH 4EBQH 3GMNB 4UV7H 2AI0L 2JJTC 5GRZA 2OCCB 2C9VA 4RMRA 1MCIA 1Y18B 2A7BA 1QNZL 3B56A 4ODUB 4E42A 1CI3M 2B8OT 5HJ3A 1CD8A 3CHXA 1PQZB 3FF8A 1TEGA 2UXFA 3WIHA 4OQTH 1TU2A 5DJ8B 1FO0L 1MAMH 2OSLA 1KJ2H 2OW6A 4P4RB 4GSUA 4WW2C 4AGLA 4QY8A 3FT4B 4FQCH 4JHWH 5DK0B 4OLWH 2G2NA 2ZWNA 2ICWI 2Y25A 2X6AA 2VSDA 4XO4A 3TXAA 1DBKL 1AZNA 1XF2B 4J27A 4O58H 1XIWA 5JIMA 2YARA 5C0BE 1N4XH 5ICZA 1A6ZB 2X28A 5ERWB 1SRDA 3PU7A 4DUVA 3LH9A 5EPMA 2Q7YB 1PZAA 4YDJA 2JCCE 2JLLA 1WD9A 3OX8A 1XSOA 4KJQD 4ZO6A 2F2HA 3ZHFA 4B9JA 4QTFA 1ZGLP 2DDQL 3EDKA 3QJRB 4TLSA 3LZFH 2X2UA 5DSCB 4KKCD 2AQ2A 2Q3ZA 4PJHA 5KYYA 1INDL 3JV0A 3OLEA 4QRTA 5FHBH 1LO0L 3TJPA 2VDOH 1K4DB 4E9VA 3P9MB 1QATA 2BIOA 1S7QB 2VL4A 2VZ1A 4MKTA 3QJXA 4U1HA 4DVRL 5JDJA 4JR9H 4CU6A 3HCVB 4QJ4B 2DH3A 2R29H 3JV6B 1HL4A 1FCCA 2OULB 2W91A 5CP3A 1RQ5A 1SXZA 5HI4D 5BRZE 4QHNA 4OM0H 2VABA 1JGLH 2YPVL 4PJ9D 4Y5XB 1FVDB 2K8QA 3QRLA 1DVFB 1EO7A 5KYWA 3ZL4H 5J9PA 2YR3A 5C0DA 3MLWH 1UEYA 3NJHA 1FLTX 2NUTB 2VDMH 3UBXI 5C0CA 4PB9L 2ODHA 4R90H 4BFBD 5IG7B 5JTWA 1WS7A 5DMJB 5IB2B 5IFHH 4JFYA 3TEWA 2H3KA 1MLBA 4PM1A 3ZUNC 4G9FB 2BFVH 3E80A 5D1QD 2ZP9A 4JO3H 4QJ5B 4ABWA 2CBQA 3OR6B 1JPGB 3P0YL 4Y9EA 5T1LD 2VLME 4NQCB 1JHLH 4Z7QB 1OF0A 2GTZB 3CD4A 1EZVY 4K94L 5SWSD 4GMTL 4MA7H 3MYJA 3TT1L 4U7MA 2CHWA 4GBXC 2WBXA 2Y7MA 1DUZA 3F7VA 1YEIL 2AXGA 3MUGA 4RGMC 3RTQD 2PCFA 4OZ4B 4YSTA 3ZK0A 4D0BB 3EH2A 1CU4H 2ZX6A 1L7IL 2R1YB 3WTTA 1T89C 1B2WH 1P1VA 5CJOL 5BVPH 1V10A 1NDMB 3MJ7A 1EWHA 1FL3B 3Q05A 2GAZB 1GZPB 4JO5A 5D1ZA 3U36A 1ZY9A 5HI3D 3UO1H 3B6SB 4JRFA 1YPZF 3ENEA 1S9XA 2BP5M 4ZMNA 5I18L 2FD6H 4RSVA 2IWGA 2WLIB 5A3ID 2CM6A 3EGXB 5D7IB 4FZEL 1OAZL 2R39A 3KLKA 5B39B 4PBVC 3ARGC 4XWGH 5I75C 3QS3A 3NFPB 3TN0C 2E75C 1N26A 2GT9B 2CMRL 3MA7A 4WFHE 5KUMA 1JWUA 3QDME 4FQIH 2CHXA 2R4SL 3OGOE 2DIJA 3L1FA 4B3VA 2CBMA 1T0NB 1RXLA 4K7FA 5JW5B 3K1DA 4NQDA 4U1KA 4NX0A 2YK1L 1WIUA 4G8EA 4FQXC 4MMXA 3I85A 4APQA 1XZ0B 4E9LA 4YEEA 5CR8A 1J0HA 1WZMA 2HFGL 1Q8MA 5EU4B 4DTGL 2KDGA 1VZGA 4WFFD 4H8PA 4AEIH 4N4YB 2QVTA 2N1KA 1BAWA 3TEXA 3IRCA 4UV4L 1OM3L 4L8BA 4HKXB 4PLNC 1LDPL 3MJWA 4OJFH 5AOKA 2A9BA 2CKNA 3BP7A 3QJTB 2IWFA 1XGQA 2I85A 1NBZA 3D0LA 3FSWA 4OLUL 1NCAL 2PCYA 3B2XA 1NGYA 2EDYA 5E9AA 6FABL 3A6CH 3QQNA 1QLEH 3EW3B 4UT6A 4HHWA 2WAHA 4U1MA 4M62H 2ENPA 4PJ9B 4GMSL 2AC0A 3DRTB 3FTSA 3UAJA 1JNHA 4WLCA 1C5CL 1JTPA 1XFPA 2D03L 4HS6B 1WWCA 4AYID 2F15A 3HRZB 3BEWA 2XG5B 2XVBA 3HBZA 1RULH 3ZTEA 4R2GD 3DUUB 4TXVB 4KKBC 1SVZA 1MCBA 5B38B 1AGEA 2ADFL 1YNKL 1DEDA 2EE6A 4RZCB 5F3HA 1NCWL 3UTSA 4OCNC 4X99A 1KIPA 4HCRA 5D1QB 4AJWA 3FT1A 3HI6H 3SDDC 5T1LB 1QMUA 5ACLA 4QRFA 1CFTB 4KDTA 5ESAB 4UU9B 1IKNA 1L6PA 2DWSA 1H5BA 4CGUB 4KV5E 5SWSB 1EA9C 5CSZA 4NGHH 3QWOB 1SJVA 2DKSA 4PLJD 2X89D 4R5VA 3ZE2E 4QHKI 1L9QA 4WFHD 1AXSB 4KFMA 1GC1L 2FSEA 1T2JA 3MJ8A 3RTQB 1H3VA 3LXBA 2COVD 3BPNB 3EYSH 4RFEB 2CGRH 4WNQA 2CLVB 1KCRH 2ZAHA 5EUKA 3KYNB 3O3AA 2A6KB 3MRRA 3GSVA 1YDPB 4JRLA 1PPIA 1HL9A 1KFAH 3CLEH 1J5HA 1OPGH 1YCSA 4RRPG 1U8PB 4XC3H 2BVPA 4N6QA 3WEXA 2C3HA 1KJ2B 1WDAA 2X87A 4KJWD 1J05A 1F90H 1QLRA 3HHMA 1CICD 3WFHB 4LOUD 2WIIB 3LZRA 1LWRA 3CFKA 4KRPD 5F9JA 3T08A 4Z1PA 2I07A 4NP4H 3LNDA 4LVHB 2ZICA 4PJHE 3V0WH 4U0QB 2OL3H 3ATAA 4IRZL 3P54A 1BGXL 3E0GA 3P30L 4X42A 3VFPB 4NZJA 3V55A 4ZFOA 3L4WA 2O5YL 1MF2L 1R19A 2R69H 3LRSA 1I4FA 5SX5K 1YECL 2BY3A 2ED7A 5J0BA 1VCBC 1DN2A 4NQVB 1G87A 4NT6A 4AGMA 4YEFA 3OM3B 2VDOB 1XGRA 4HBCL 3TTSA 3T6VA 1PW3A 4N2CA 5JYLA 3IGFA 4G6ML 4N20A 2VDPH 4YHYC 2VL5A 2AJ3A 3BC9A 1C7SA 1G6VK 5EU3A 3OZKA 2BRRL 2WQVA 4R5XA 5C0CE 1XGUA 4WEMB 1CF1A 2K6ZA 5D9SB 3PHQA 4NP9A 4O5LL 4U1SA 3VMOA 3L16A 4CL7A 1RFDH 3F8UB 2A77H 1AC6A 4PV8B 3WLBA 5KBDA 1JPTL 4NQSA 2J8UA 4LCYA 3VTTA 5I1KL 5TQ2H 2FH8A 4MQXC 3AY2A 2JIXA 2A1WL 3FULA 2QSVA 3UCQA 3O2DA 5IJVA 1MJ7L 2H5UA 2V2WA 2CUIA 3NIGE 2VDMB 1X5MA 2ZX8A 3BI9X 1O0VA 4KI5E 5CGBA 2YAOA 4G6JH 5CGYC 2H3XC 2P80D 4UQDA 4JREB 4ZUUB 3RILA 3RWHB 1MIMH 2CDEB 1GAFH 5SX4I 3VG0H 1AGBB 1SOSA 1QRNA 2BLFA 4HPYL 1W72L 1KYOK 2E6QA 3ATDA 3QO1A 2XFGB 4QCIA 3OBAA 2V2XB 2PO6D 2GIYA 4U3CA 4OD3H 4R2GB 2GBAA 2NLJB 1OK0A 1DQJB 1QVOB 4NM4H 2F53D 2ZCLH 4MVBC 1FE8L 3N2JA 1T20A 1A6PA 5HJDA 4ZUSB 4XZ4A 1UWEH 5D4HA 1OGAE 2KBGA 2NY7L 1F18A 4JCLA 4JB9H 3ZBMA 1LK3H 1S3RA 1HHKA 3TEUA 1A4CA 4QYOA 2BJMH 4Y9BA 1ZHNB 3T1FB 2CDFB 2P42B 3IF1B 3VFNB 3GHEL 1JN6A 2W9DL 3GMQB 4KKAD 2AMUA 3RU8H 1KIUB 4CMMA 4WGWB 2VXVL 1EGJH 5JOFA 3L8QA 1QFUH 3VX1A 3OHMB 1HNYA 4H88H 5F93C 2VR5A 1CD1A 4JDEA 4IBUA 4KC3B 3RWDA 1T2QL 1ASQA 3GRWL 2CLZB 4LPVA 4NQDE 2CXKA 3ZPDA 3K4ZA 4J1UA 4R4BA 2HKFL 4A2GA 1GZQB 1FRGH 4NYLA 1QNIA 5DQJB 4AXWB 4ELKA 5H35A 2WLZA 4DZ8A 4A7GA 1BZ9B 4KMLB 1NL0L 5FX3A 4LOEA 4YZWA 4BFNA 4BZ1A 4R8WH 2CKBL 2YD1A 3L5HA 3T0EA 1CICB 4PJDA 2CDGA 4AVIA 4F2EA 1M7DA 4YHOH 3ZZQA 4KRPB 5IMMA 5BRPA 1I8AA 1FZJB 3BE1L 4YWGH 5JDSA 3WUWA 3LVTA 3ZTJH 2NNAB 3U83A 5DYFA 1KJ3L 2R1WB 3TO2A 4HXAH 1QUNB 4BXVA 3IXTA 3UBXG 5D7SH 3RL1A 4I8DA 1RZJC 4J4PA 3MNZA 4PS8A 3ZDZE 1GGBH 5GGRA 2FR4A 4QF1B 5FA4B 4H2CA 5DZ9A 5A6IA 3QR1A 3T4AC 4NC1E 1MXGA 2B16A 4HXBL 4CVZA 3RNQA 2E8ZA 3US9A 2QVKA 2NSQA 4FJYA 5JQ6L 2XXMB 5KVFH 4DEWA 1IGFH 5F44A 3AS3A 3QXWA 1NOFA 3CN3A 4QEGA 4EAEA 3J07A 3LSOB 1I3RB 5MEND 3BQUA 3O0RL 4K9EC 5DHVH 5F9AC 3HBPA 1ES0A 3N41B 3U4EB 2C7UA 3BPLB 4L8DA 3PJLA 4I1RA 3KBFA 5AL8A 1QLEB 5KVFE 1N8ZA 3SJVA 5CEYA 3IS1X 4QPEA 1AACA 3LS4L 2EDDA 5KS9F 1R33A 2VQ1A 1A14L 2IDCA 1BJ1H 4XB3A 3UTSE 3ETSA 3VRJA 1LWJA 1E4KA 1J9CT 4N2FA 3M8OL 4MNGA 5D7IF 4YBLB 2PWGA 2DQGL 1MIEL 3MLRH 2BRQA 5IB3B 1TZGL 1OGAD 1KXVC 2BZDA 3O3BA 1NMCC 1CTMA 1MCWW 4Y16A 5TDPA 4ZMVA 1R24B 1CR9H 3VFOA 4WDIB 1EHNA 4I2XA 4JFDE 2JI2A 5C2UB 2XPGA 1S7RB 3BZFB 5T1DH 2WOYA 3TC9A 4ZFZA 1U8KB 3HE7C 4Z7VB 5FW6A 4HDIB 4AMKH 1KBBA 3EFFB 1E6JH 1ZEAL 4W9FC 3ZE2B 1MFUA 3FUIA 1U93B 5B3NA 2PO6B 2EILB 3HN5A 4Y19D 4L23A 2A6JB 12E8H 5IKCA 2VTFA 1WWWX 4KVCL 4X80H 1Q1PA 4GBXD 2PKDA 2MRYA 2X4QB 3CVDA 2ZXCA 1E4WH 4FQPA 5AAPA 1TTUA 1A5FH 4LDEB 1FA4A 5TE6L 5ENWB 2F53B 4JRYA 1DHKA 1VADB 1YEEL 3IJ9A 3KCPA 5MP6H 5F88B 1KFGA 4JPIB 2E74C 4WGVB 4XN1A 3V8OA 1Q94B 1J8HA 2CIKB 2W65A 5T3ZL 2R0ZH 4HOMA 5LG6A 2OR8A 2XWRA 4EUPG 1CO1A 2YLKA 3HZVB 3QJVB 2OJZL 3EO0A 4LCUB 3V6FA 4WJ5A 5HY9B 4KUCD 2FLRT 2EE2A 4E68A 4WW1A 2ZWKA 3RURA 3WN5C 3Q1SH 1RUQH 5FGCB 4JO2L 4X0KA 2BDNH 3J27A 1VGKB 3U0PB 1NPUA 3LZNA 4WW2B 2PUQT 1S9WA 1WBYA 2I7SA 2E27H 2QVIA 2OL3B 3QC5X 3FCSB 1EAPB 1A1OA 5T1KA 3FJTA 4F1ZA 4X4XB 3L7EA 5DO2C 2Q8BH 4DKEL 1G7HB 3OKOB 4KK8C 1FLRL 4GKOA 3AB0C 1E7VA 4DSYA 1JF1A 1LO5B 2FNBA 2JELL 2OMTA 4EIZC 4MA1C 2J8UE 3KWWA 2CBOA 3A5VA 2HX7A 5D72H 1U91B 2HVBA 1F6AB 3KGRA 1N7MH 4FMVA 4YAQA 2VDPB 3I3BA 1JZGA 1DQLL 4GW1A 1PL3A 3L3JB 2E9GA 1F3DH 3V4PA 4MXVE 2HMID 3L5WA 5T5FH 4L3AA 3AS0A 1U92B 3TBVB 2P5ED 1O75A 5B21A 5HDRA 4FA8A 5F7KC 1T7VA 3W56A 4J3TA 1CQKA 2VGLM 4JFDD 4ES8A 2J88H 2FSDA 2ALAA 3Q06A 2Y23A 3FU3A 5KSAA 5DTFB 2CU9A 4HP5A 2V3FA 5HI5D 25C8L 3EAKA 2R23B 5JPNC 1R3LB 1BMZA 1S7SB 5MENB 4LVOC 4ANKA 1O7DE 4J23A 3WNPA 3P9LA 5KBPA 3G6JA 2EUZA 1IM3D 2NNRA 4OD1L 1ADQA 1NWPA 4KTYA 2DQFB 2X10A 3BUPA 1CIUA 3DXAE 4N0RA 2ZCHL 2PXYA 3FN0H 4KKBD 2JCCF 2QZ5A 4FRWA 4B0MB 1DJXA 4PP1D 2VIRB 4G7YH 5DQ9A 2GJJA 3KJ6H 3CZFB 1OGAB 1X7QB 4N8CH 3EHBC 1TIUA 3MNMA 1OAXH 3V7AG 3SQBA 1HT6A 1QR1B 1NFDA 1RIVH 4M43L 3EOAA 1R3KA 5E9NA 4DFHA 4U1JB 3SDDD 4XP9L 4JJ5B 3AWEA 3NCCB 4R0LC 3DGCR 3COOA 2AW2A 1MI5D 3ZN6A 2A0LC 1I8LA 5AG8A 4Y19B 2WZPD 1U8NB 3DHMA 4CKQA 5I1HH 5JQHC 4GBXB 4DZBA 1WAEA 1AKJD 5D70H 3S5LA 3WFCL 3QFGA 4G9DB 2EDWA 5DC0A 4UTBH 4RGMB 2MJWA 3FFOA 4YE4H 3LB6C 3DETC 3VQ1C 3TVMC 2CGZA 4EN2A 2ZOKB 3AABA 3VA2C 1ESOA 4P46D 2G60H 3Q6FA 3T0EE 4PJDE 1VIWA 4Z7NE 2DBJA 3B3IB 1MHCB 2A74A 1UTDA 4PJXE 1GMIA 4MASA 1IUZA 3BUQA 3KPLB 4WFEE 4YSAA 2Y1VA 3IMRA 5IT2L 3FU8A 2OZ4A 4H1LH 5BOPA 1J0KA 4FXKA 5DK3A 1TJGH 4Y4FC 4YR6A 3ZZLA 1X5GA 5E2WH 4BKLA 1TQBC 4AQZA 4OFYA 1BPLB 3JV4B 5HYIA 3SGJA 1ZVNA 4LIQH 3ZDZB 1M3IA 2IH1A 4BRJA 1GW6A 1TJHH 4HFUL 5LXVA 1BXAA 4MNHA 1U8MA 3SE9L 5IHZB 1VF5C 1Y7VA 3U9PH 1ZV9A 4F9LC 4FG6C 1LEKA 2TRYA 3THMH 4H8UA 3QUHA 1W2KT 5MEPB 3G08B 4PRNB 3GI8H 3DDFA 2XQBL 3BPCB 3VWKC 1BM3H 2P47B 4PRAA 1SJEA 1WA0X 3SJVE 3QJQB 1EFXD 4B9IA 5EBWB 1DTUA 3V0AC 2X2HA 4LSRH 2WN2A 1LO4L 3U48A 5I1DA 1KPVB 1T1YB 1RZJH 3QCTL 5J89A 1RZKL 1IAIM 3RDTA 2EYTB 3DXAD 4MNGE 4JFHE 3QNYB 3RWIA 1CL7I 2WKOF 2AKRA 4JFZL 5DHVB 2EACA 2IAND 4ZS6D 3ZJAA 4DGVH 4GT7A 1FNSH 4YQXH 4DFIA 2XZAH 2B5IB 4PG2C 3E6FB 3CZJA 4I2XE 4MQXD 2P5EB 1XGPA 4GO6B 2BOCB 2O6CA 2MFNA 4JFDB 2MKLC 4JMXA 2IBZY 2WB7A 4OGQC 3NJFA 4EI5C 4GG6A 1URLA 2KL6A 1C5BH 4K9EH 2AABH 3D39D 4LVEA 1TQSA 2CCVA 3DX8B 4B9ZA 2VZSA 4FYSA 3EOBB 4UNUA 5CGYD 4DUWA 3KPPB 2AJXH 2LU4A 4TQIA 3RL2A 1WCQA 3CBKB 3O6ML 1UOWA 1IM3B 4G71B 4R96A 3IGAA 1TQUA 4EN3C 4PBXA 4CBZA 4A2EA 2Y1ZA 3VXUA 2UV3A 1RMFH 2R7EB 2HFFA 4I5BA 3HLAA 5DHXB 1BD2D 1ED3A 2VLRA 4XOAA 4W9EC 5JW4M 4DKTA 2Q0ZX 4IRSD 5JHDE 4NKMA 4M7KH 4AL8C 5ILTL 3MV11 4YXLH 4GP4B 1J1PH 4ADJA 4XCFH 1F58L 3MRLB 3K2UH 4BCZA 4MVBD 4PY7B 1IKFH 3MU3A 3CSTA 4AQEA 3QFJE 2KPWA 5CKAA 4XO3A 4DAGL 1AS7A 1P1ZA 2L8AA 2R56L 4OCMC 3AMLA 5EIVA 1IC5H 4PVLA 2GUYA 4WFED 3SDDB 4UYQA 3T6ZA 4LCWA 2XTSA 4JFUA 2YD0A 2O6PA 2NT1A 4PWIA 1MI5B 1JRHH 2CO7A 4AQ1A 4WV1C 3RWCB 1DUYB 5HYSB 4QXGL 2E7CA 5A40E 1AKJB 5AAMC 3DV4A 3A4AA 1UQSB 1PMYA 5C6PB 1KB5A 5CKGA 2ZXGA 4AMWA 2KPNA 3P0VH 4M6ML 2Y22A 2DRUA 4KAQL 4GSDL 4ALAC 5DJXB 2J6EA 3WUZA 1AAJA 4P46B 1AR1C 1AD9B 3FN3A 1AD0A 1CFBA 3NSXA 3MOQA 4ICXA 3CLWA 3OJ2C 3SBPA 1CN4A 1SPDA 1AZVA 2NR6A 4XPBL 4RA0C 3MQIA 3K0YA 4POUB 1QO3B 2A6IA 1J48A 1KIQA 1U3HD 5DVNA 1JNJA 2BP3A 2EO7A 4OB5H 3ZKXC 1OV8A 3W0WA 1OSPL 2FL5A 3INUH 1HKFA 2ZX7A 1J0IA 3I9PA 1KN2L 4P3WA 4KV5F 2NOYA 4HS3B 3O11B 5EA0H 1WBZB 5DZOA 1NDMA 5J3HC 4BIKA 2WM0A 2R2HA 3ZE2F 5C2BH 7TAAA 5ICYB 2H2SC 5HYQB 4CMHC 1KB9K 4BKSC 1ZT7A 1PG7H 3NEXA 3KYAA 4IKNA 3CPLB 1KEGH 3IMSA 2ODIA 2Z64C 5F7AA 3BP5B 3FC8A 4CBPA 3LCYA 5G5DA 3MJ9L 1SYVA 4GI6A 1EFXB 3HOGA 5DJYB 5DD0H 5KYNA 4OCYL 2XSKA 5HGGS 3EYUH 4YHYB 4AJVA 5FYLH 5DR5H 3E6HB 1URIA 3TFBA 5FM4A 3DXAB 4NENB 2OMYA 1A6AB 2IANB 2WXQA 2WNWA 3NUKA 5JHDD 1W0VB 1INEL 3JTSA 3RWEB 3U9UA 3FO0L 5IGXL 5EZIL 5T8IA 4YS4A 3LIZH 4PJHF 1NFDE 4XPHL 1N0LA 4PVNA 1ET7A 4XPTL 1MFBH 3ZO0A 3QFJD 1S78C 4NIYE 4P04A 3D39B 1NKOA 4CU7A 4RGOH 4JG0L 4S10A 1HS6A 3MLVH 4HFWB 3WJLC 4ODHL 3F58H 1S2EA 4OZFA 3D8MA 5HGDA 4ZPVA 1RP8A 1V7NL 2OTUA 3QPQC 2OMNA 3HZMA 1G0DA 5JIHA 4AYFB 4Q74A 5HHME 3AU0A 3FQ1A 1BD2B 3X13B 3FBKA 1QBML 3HC3H 4CRPA 5I6KA 1BF8A 1UB6B 3MX0B 4D0CA 2ETWA 4IRSB 1CDYA 2CG9X 1BBDL 1D5IH 5D7KD 5HDOA 3UYPA 1HI6B 1XB8A 3UTPD 3HG3A 4ZUWA 4NUJB 4JZOB 4N0FB 1NLDH 2Z65C 1FORH 4PJXB 3DRTA 1E5AA 5D4IA 2WTRB 3ESMA 2IPTL 4QRRD 3SO3B 3F2LA 4UM9A 2APVA 5IW6B 3G9VA 4U49A 1NAMH 3NIGF 4J3SA 1D6EA 3PUUA 4X4YB 1NSNL 2EUXA 4L9DA 4NM8L 1ACYL 2NT0A 3B2PA 2WN3A 3DUUA 4ICWA 4UUJB 2VDQH 4KI5F 5ID0B 1MAJA 1E9OB 1OAKH 1NCGA 2IDUA 1HQRA 4QO1A 3VXSA 4WI0A 3QNZB 3MRNB 1L0PA 4H1LB 5AAWA 4AV4A 1MFEL 3ISYA 4ZX4A 2ZG1A 3HJ0A 4ZMLA 3P77B 3C12A 5IBUB 4EJ1C 2DTMH 3OD3A 3TBSB 1A3LL 3IJSB 5F7DB 2ROXA 1I9IH 4KX9A 1Z66A 4X6EB 4YDNA 4S0SD 2MQ3A 1UZGA 5C70A 3D08A 4FFZL 4I4WA 1RK0A 4DO5A 5DO2D 3KNBA 3V0FA 2DEWX 1NGZA 2QEJA 3STLB 1U3HB 4KK8D 2OMUB 3ARXA 3SDCA 4EZMA 5EF1A 4POZC 4NKOA 1XGTB 3U7WH 3UX9B 4N87A 2W38A 1L0YA 1P6FA 2AQTA 3QUXC 1FNEB 3LEXA 5HHQA 4FFVC 1G1CA 4AG4L 1TENA 3IDGB 1E4JA 4HJSA 4GG6E 1L6ZA 5C0RH 5FYLD 1AQ8A 3FCGA 3VI3B 5E2TL 5AZEL 3VVVA 2QFRA 4G7RB 3NH7H 1AMXA 4CSPA 4ZPTB 3AAZB 4JL2A 3LN9A 4A2FA 3IPFA 5H37H 4JQIH 5C08A 3PQYD 4HV8B 3UERA 2BXZA 1FFOB 2VZTA 3QDGA 2AJYH 5A2FA 3KYMB 1CGUA 1V7ML 3NK3A 3U4AA 3VXUE 1NFKA 3F83A 2LVCA 3IETB 4KK9D 3HC2A 2VLRE 1ZHLA 3LZLA 4KRNA 4TUOA 3ESPA 5BZZA 4OGXL 5I1CH 5AKTA 3KPSD 4A7TA 2NUPB 3QNFA 1U95B 1YY8A 4LRIA 2HPTA 8PAZA 4IKKA 5DI8B 2B59A 2P46B 5CINL 5KAQF 3IJHB 4I48B 2XG4B 4WTQA 5JHDB 2BVQB 2H3NA 4IIQC 5KVGH 4S1QH 4KUCF 1PZ2A 1KCSL 1U8OB 3BESR 2OJ1A 4W9GC 3QXDB 3WEAA 4NQVA 1CK0L 2CE6A 1DQIA 5LXGL 3QFJB 3UH8A 2F19L 2FX7L 2WYZA 1IAOA 1NMCB 3P1VA 3OZ9H 4LCWE 5EV7A 1M71A 3HNVH 1F4AA 1UD6A 3EHBD 4H25A 2EDKA 3DX6A 3MRKA 2NY1C 2HLFD 5D7LA 3VD3A 3P2BA 1S4IA 1H3PH 3W57A 3L3KA 2H9GA 1ZVSA 3FK3A 3L3GA 1TEYA 3P40A 1NUDA 1J1OH 2ZYRA 2BMKB 1G5GA 4LMQI 3CFDA 5DFAA 1WBXA 3KLDA 4N8VG 4AL8H 5KJ4A 3DIFA 1IE4A 1SM3L 3V9CA 2WVTA 1NKRA 2OMVA 3MKKA 4XMPL 2XVGA 4Y1AE 3C08L 2BSTA 4IBVA 5FUZL 4IGBA 1BW8A 4R97C 4G42A 3LB6D 3DETD 1Z5LA 3PF2A 3RWFB 3HI5H 3TBWA 3TVMD 1E42A 2KI6A 4QJ3B 4DEPC 1UM5L 2VM9A 4QRRB 4PJ8C 2LFEA 4GFTB 5BRQA 3W0WE 3EGSA 2JI3A 5D1XA 4JE0A 2ZOLB 1JGLL 3P11L 3VB8A 2OZNA 3P69A 4FLQA 3Q8FA 3NFSH 2EIDA 4JZNA 3ZL4L 3GMOB 4XI5C 3O6FC 4P9MH 1AIFB 2B4CH 3OAUL 4Y4FD 2AK1H 3X3FL 5CGTA 1VEOA 3WN5B 3EBAA 4WHTB 15C8L 3RB5A 1YUHB 4ZUSA 2WBJC 3PWUA 3FQRA 1UJ3A 3S4SB 3IBEA 1Q38A 1Y0LA 2OMXA 2E56A 4AEHH 1TQCB 2P4AB 4GT0A 3V4UL 2N4IA 3CXHJ 4JN2A 4UF7C 1BIHA 4FG6D 4TQ8A 5TK4A 3BN9C 4ZAKA 5DRWB 5JOEA 3FQ2A 4XXCC 4FQLL 4MNQE 2ZX9A 3VWKD 1Y1DA 3T2PA 4ODVL 4AYMC 1WV7T 3AY4A 3FQUB 1XF4B 1ZTXH 4NCC1 1RSFA 3AB0B 1PD6A 3IFPB 4IDJH 1BQKA 4TQEH 1JF6A 2FATH 2Y7QB 2JKRM 4MA1B 4YBQC 5GXBB 1NBQA 3OPZH 1NUNB 4XMZA 1YEDA 5JIPA 3RGVD 1ZV2A 3G5ZB 2DWDB 3LNGA 1MCJA 3CZKA 3TJEH 4U6YA 4MAZA 1UG9A 4PUBH 3IKKA 4HBQA 5DJZB 5AVWB 3U46A 3SGKC 2GBVA 3ZZSA 2NY5C 4YHPB 2EIKB 2ZXQA 3QDJD 2IWKA 1C12A 1E9QA 3DSFH 3MOBL 1XL4A 4U6HB 5IW1A 1Q90A 4JKPH 4EI5D 3PQYB 2JB6A 3IDXL 5FLVA 2YMXL 5F89A 4UQ3A 4OFIA 2B3IA 2QJDA 3BWSA 3UO1L 4LFHD 2WVUA 3DX3A 4GH7B 4HAFA 4PGCA 5JPNB 3HAEH 5B7MA 4Q6IA 3V52H 4K3HA 4LVOB 4W4OA 5FECA 1RURL 3KPSB 4EN3D 2A6DA 1KC5H 1IAIL 4PJBE 5FA4A 2B1AH 3GMPB 1MHHB 4JCWA 4WI3A 4Y1AD 2XVLA 2J8UF 2ATKB 3NJIA 4TL4A 5EO9A 5B1CA 3WL9A 1EZSA 1CDIA 1E3FA 3G6AB 3ULVE 1XXDC 2SODB 5FUOH 1OT2A 3T6XA 1D3CA 3D51A 1JWMA 1R3IL 3L95A 4EI6A 1YNLL 4HCGA 4MXVF 3EHBB 4JCMA 4XBEH 1O6SB 3OJDA 4X6CB 1NC4D 3QFDA 1F11B 4U0RC 5IB4B 1Q9LB 1RUML 3FSVA 4L8SA 4M29A 1WGOA 4PJ5E 5F70A 1IM9A 4KDVA 3B9KA 4R0LB 3SYQA 4FQQA 3VXSE 4AC4A 1HHIA 3FAXA 4HQQH 5FXCH 2WO2B 3RFZA 4ZT1A 5C92A 3B7UX 5AW5B 4AEIL 4JPKH 4OF5A 4YSPA 5GS2H 1KBGL 1MCWM 3H42H 4V1DD 1CLOH 1NAMB 2J25A 1K8IB 5IB3A 1A7NL 4QHUA 1XCWA 3HR5B 4FNLH 4OJFL 1J1XH 2VDQB 4WDIA 2H41A 2F7OA 4TYUA 1AQDB 4M03A 3S37H 4PV9A 3ESNA 4MJHA 3QULA 4ONOA 3TVMB 3IDJB 4QRSB 4PJGA 1AR1D 3QUZA 1I1FA 1FH2A 4MNQD 1VZIA 2I9LB 3IFOB 1ECYA 2L7JA 3WY3A 4M62L 3PWVB 1CMOA 4YDVA 3X14B 2IPUK 2F5AL 3ARPA 2CRMA 2X4QA 4L4JA 3QEQD 2VKWA 2GUOA 4LOFA 1CGWA 4XZUA 1ND0A 4Y4FB 4EF3A 3BLBA 3CFIC 3RLSA 1MW3A 1RULL 1TQBB 3BKYH 3E8VA 3GXUB 3SPJA 1Z6JT 1RSYA 3H7BA 3CFEB 1R5IA 3TZVC 2OTWB 5J3HD 5C08E 3PWJB 1P2CB 4KDWA 2QHRL 2EC9U 2H2SD 3BUDA 5CILH 3UZQB 4Q0XH 5F7FA 3WIHL 1ID5I 3L3OC 2F8IA 5JLZB 2F74B 4KH9A 1YEKL 4OIIH 1UCBL 4YN3A 1RY7B 3VWKB 3ZL2A 3PRZA 4RGNC 3IE4A 3DTXA 4PJDF 5AOLA 1RK1A 4Z7NF 3L4UA 3EOTH 3OTTA 4F2MA 3NJLA 4NGHL 3KLAB 3LN5A 5E5UB 2AJUL 3W2DH 4HUUA 4ONFL 2WXJA 3RGVB 5I76A 2GFBA 1MJUH 7PCYA 4D7PA 4OGYL 4JFQB 3CHSA 3EYSL 5IB1A 1WP6A 2CGRL 4X9HA 4WSGA 2AEPH 2D0FA 3FFDB 2AJZB 1GY2A 3QDJB 4LSTH 3QPKA 3WSQH 3QRGH 3VGDA 3AG1B 3LN4B 4EI5B 5BMFH 2DMBA 1S78D 3BAYA 4XC3L 1WZ1L 4LAQH 1NM9A 4KITB 3MR9A 3REWB 1B4JL 5E4IA 1F90L 4XC1H 3NYKA 3BFOA 3APCA 1KEMH 2NSMA 5TGBB 1RI8A 3LV3A 4JE4B 2C3VA 3HPJA 1IBHA 4UM8A 3L3JA 3TIEB 5DEGB 2H4EA 3KE0A 4FNPA 4OD2A 1MRDL 3W9DA 4H8WL 3U2IA 2E9WA 4Y1AB 3MRMB 1UFUA 2XA8H 3QUMH 1S8DA 2NYYC 3L3DA 1RUKH 5AVTB 1CGTA 3Q2WA 1QA9B 4F3FB 2GCYB 2FQDA 4A38A 5LCVH 1J12A 2FEEL 5GS2D 2DQDL 4HJGA 2HRPL 1Z3RA 3BVWA 2WVVB 5D1XE 1N3NA 3LVEA 4I0CC 3ZDXB 1NC4B 1X5FA 2EEBA 4ISVB 1V5JA 5C3LD 3M1OA 2DMCA 4HIJB 4CC1A 2FAUA 1ZLSH 3AQYA 2Q6WB 2EDTA 2Y1YA 5GJSH 1TQTA 4GO9A 3W39A 4ZODA 3WNNA 1D2OA 1XF3B 5C0JA 1AS8A 1LQBC 5I0XA 4IRJC 1QFOA 4JM2A 3U0TB 1DBML 1YEWA 2DTSA 3LXCA 4WV1B 1KGJA 4V1DB 4CA4A 3TESA 1DE4B 4IW4C 5TQ2L 3ZGHA 1Z32X 5CD3B 5IESL 1HH6B 5A2LH 5EEVA 5HHNA 3QE5A 3CMOL 3OB0H 4LARL 4G6AC 4GSQA 2PYFA 4NPYA 1AR1B 4MNQB 4O9HH 2NCMA 1RD6A 4NC0B 2AANA 3ARUA 4ZMTA 2Y7SA 2C5DC 1CLVA 3D69A 3RY6C 2OXHB 4K2UH 5C6TH 4GRLA 4ZO9A 3CZUB 4JZJA 2QLYA 5DQDH 1J7VR 2RTTA 1EAOA 3SE3A 1EEUA 1GHFH 3WMQA 3VACA 3QEQB 3DARA 4POZD 3ZKXB 4A39A 2BSED 5IVZB 2WLYA 1SLXA 1EJ8A 5F1OB 3QUXD 2BOBA 4OD3L 1T89A 4FFVD 1E5BA 4KBPA 5FFLA 3HS0A 1SXNA 2Y5TB 3NIFB 1U21A 3MTXA 2HA1A 3HC4L 4NM4L 1H3TA 2JK5B 3DWTA 5FFOA 2DB8A 2MEJB 2BK8A 3QT2A 1WZAA 4CMHB 2KUTA 2WNXA 1Z1WA 1OTSD 1SN5A 4L8CA 1KLGB 3PUCA 3BGMB 4Q14A 4JB9L 4XPFH 1LK3L 4XVTL 4ZOCA 4ZW6A 3REVB 4BZ2H 4AIZB 3MCLH 1OQXA 4E9TA 1PS3A 2JJWA 3IU4H 5BUPA 2DYSB 1G7JA 3ARGA 1SN2A 1WTGT 1PKQE 3TN0A 1A25A 3H53A 1WUZA 4EEEA 1IQDA 4KXDA 1Z3GL 4PJBB 1I7ZA 2YD9A 3RU8L 2IV8A 2HJLB 3QNXB 1XSKA 1FSKC 5IHZA 4M7ZC 5DUBB 4HG4K 2NY5H 1CG9B 3HAEB 3FUNA 1HIMH 2XWTB 4PS3A 3PY9A 1IGYB 3GFUA 1FP5A 2AK4A 2BNQE 2OPCA 3O4OB 1S9KC 1ILUA 2ZSVB 4FQXA 3C6SA 5BJTB 2P8PA 4HZAA 1F97A 4YPGA 1FRGL 4MSWA 4A2DA 2WYHA 1VSCA 1XVSA 2X1OA 3GSNH 5E94A 2RH0A 4JHZA 1E4HA 3FT2A 2NY1D 4R8WL 2OX5B 4E5XG 3V6ZA 4Z95H 5BS0D 5CEXA 3S97C 2H2PC 4JY6A 1KLFB 4N3UA 5DMKB 1RPUA 4RMQA 3RJQB 3G6JF 3LKQA 4A6YA 1JGDB 3SBQA 4UT6L 4QT5A 4YWGL 5AW1B 1D5XB 5IMKB 2DWTA 4HC1L 5IFAL 4NDMB 1GA2A 1ZK9A 3UPRB 5LGJB 3L1OH 1BREA 2AFNA 1SHWA 5ESVA 4YX2H 4F8PA 5AW9B 2IO5A 2Z9TA 4IEFA 3IJEA 4PWEA 2Z7YA 5KSBA 1M05A 5KVFL 5I5JA 2WQWA 4W9HC 4YGAB 1AE6L 1NFDF 2YRLA 4M3HA 1IGFL 3V9FA 1JTOA 4OZHB 2HSIA 43C9B 3LNFA 4PJ8D 5CM1A 4HCRL 2R7EA 3VQLA 3S88L 2ZSWA 1KGWA 1XGYL 2Z4TA 1R5VB 3F05A 3O2VH 4AENB 4RFOL 4NLHA 2Z92B 1E2VA 1E8XA 3WHE0 1EMTH 4YXHL 3RWGA 3WXWH 5FF6A 3SODB 1PY9A 3O6FD 2CHNA 4NO0A 3JWNH 3NSJA 1CGYA 5GS1A 3I02A 4WWID 5JORA 1EJOL 5ADOH 1VENA 3LD8C 3ZRCC 1T5KA 1WA2X 1NBYA 2EDQA 3EIFA 3MRGA 4KUZL 5BUAA 1JYWA 2DJ4A 3HA0A 2DM4A 2WGNB 4MX7A 1NDGB 4LPWA 5AWNL 4PJEA 3HC0A 4Y2DD 3RBSA 5DEZA 4NXSA 4JBSA 3JWNE 3S35H 2LW3A 4EI0A 3BN9D 5EF0A 1JHKL 4BSVB 4KO6A 4F2ME 3PP3H 4KXZH 3L1EA 3NTCH 1JBJA 4AMKL 3LIUA 1CYXA 2AXFB 1VFAA 4LPCA 2QVMA 2ESVA 4IBZA 5J6GA 4J12A 2UZYB 1I9RL 4Z3FA 5GRVL 1BX2B 3EJRA 3TYFA 2DWYA 12E8L 1CLZH 5B1BB 3QUXB 4GXUN 2BNQD 3QCVL 1IILE 2QELA 2YSSA 3VUAA 1A5FL 4O2FB 1LJMA 3BDXA 3N40P 3RYMA 2EDHA 3DVNA 3WS6A 1KSRA 3KMDA 3B9EA 5MP6L 2D31A 4XPGL 4Q4IA 1Q1JL 5B8CC 5CLYA 2EJ1A 2QKIC 3O41A 4F8LA 2J5WA 4ZFOL 3WD5H 1OVZA 3VSUA 1OF2A 3MGTB 5I8OH 1BPVA 1Q0EA 4ZMYA 2HN7B 1E4XL 1MFCH 1SOXA 3TBYB 5F9WB 1S7UB 3PREA 1ZA6A 2W9LA 3DOHA 6PCYA 1WTLA 2GI0A 2WBKA 4UQ2B 3B9AA 1TCRA 2XXFA 3ABZA 3Q1SL 4WRLA 1RUQL 3CSFA 3PXHA 3KLLA 4NRYB 3HI1B 3B1UA 3EJJX 3O4LE 3M7FB 4XNYH 5EBLA 3QJHA 1DJGA 3ZW3A 3S9DB 4FQ2H 4QHLA 3V0EA 2AQ3A 1UASA 2BO0A 1N6QL 3L4XA 4PWKA 2NTFB 4B9KC 3QUMB 1MJJB 5D2NE 4GG6F 1JV5B 4HWEH 1SZNA 4TRPH 5A2AA 1NANH 2GBTA 2NY1B 2Q8BL 3MGOA 3FNKA 4N6RA 5CP7B 3SY0A 1B3JA 1ZV5A 3HFML 1CBVH 3BLKA 2AEQH 5IOPB 4LK4A 5BS0B 3KYOA 1F0LA 3KPMB 2VERN 3S8GB 3SKNA 3WXVH 2ERJC 2GIXA 3BWZA 1A4JB 4FP8L 4N2BA 1KJVA 5T1MB 4G5AA 3LPFA 1UA6L 2A2QT 5ALCH 2X05A 4GLRI 3KPQB 5GS3A 3N1PC 3KS0J 2MMXA 5F2FA 1PIGA 1QPXA 4AKOA 1USZA 2ZQKA 4R97B 3HG1E 1EHKB 3BRGC 1JZDC 3HJEA 3T77B 4DEPB 1DSFL 2PR4L 3SDAC 3U0WL 2X4NA 2QQKL 4ZTPH 4PJFA 4PJ8B 1NGWA 3AU1A 5GIRB 4FXGC 2DMHA 2VDRL 4K23H 4J39A 5DK2B 1WFJA 3K6NA 1UB6A 2WXGA 4NQXB 3RVUC 3IAGC 4LHQB 5KVMC 2CHZA 2X4TB 5MI0C 1GZHC 5DUPH 3O6FB 3ZKQD 2C1PB 1QEWA 3MCG1 2XFXB 3BZEB 2X70B 3MFGB 1MW2A 2XN2A 1AZBA 1EIBA 3MRPB 4ODWA 3GBML 4U05A 2R2EB