1BYNA

Solution structure of the calcium-bound first c2-domain of synaptotagmin i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords PROTEIN (SYNAPTOTAGMIN I)
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1998-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bynA00
1WFJA 3OAWA 2B3RA 3LJ3A 4FJYA 3HN8A 4GNKB 3PYCA 3TJPA 3APCA 4F92B 4KITB 4XE0A 5JHAA 2K45A 3SD5A 2WXRA 4F91B 2DMGA 3ENEA 3KWTA 4TS6A 4FHKA 2WXOA 4F93B 4QAMB 4IQHA 4KZCA 2CM5A 1E8ZA 3L13A 2K4AA 3QJZA 4G11A 3L08A 2WXPA 2JQZA 2A5UA 3ZW3A 3M7FB 3APFA 1CJYA 4HVBA 2R83A 2YRBA 2NCEA 1HE8A 4BFRA 1TJMA 4NPKA 4EZLA 4OVVA 3R7QA 2CM6A 2K8MA 4L1BA 4XZ4A 3ZVVA 3F00A 5T8IA 4IHBA 3S2AA 4NS0A 3PREA 5EDSA 1TJXA 5CCHE 1DJHA 1E8XA 2BWQA 2CHZA 4ICWA 4FLHA 4NPJA 3L9BA 3DPDA 3F04A 1DJWA 3B7YA 1V27A 3F05A 3OHMB 4OVUA 3NSJA 1QATA 4URKA 1DJZA 3TL5A 1RSYA 2ENPA 3ML8A 4LT7A 4TV3A 4FJZA 4FADA 2CHWA 2ENJA 3CSTA 3P2BA 3HHMA 2CJTA 3PRZA 2DMHA 4FHJA 4WEEA 3GPEA 4V11A 2NSQA 4QJ5B 3KWUA 2Y3AA 2CHDA 1DQVA 2WXLA 1RH8A 3PS6A 3L16A 4PS7A 1E7UA 1YRKA 4NP9A 2Z0UA 2WXIA 4JPSA 1W15A 3IM1A 4QJ3B 2WXQA 1UOVA 2CJSA 5G55A 4FA6A 3CSFA 3L4CA 1DJYA 2ISDA 4ANWA 2N1TE 2WXFA 4PS3A 4WWNA 4DNLA 1UGKA 2QZ5A 3FBKA 3QK0A 1E8WA 4QJ4B 3PFQA 4Y1SA 1QASA 3JZYA 4A55A 4MJJA 2WXHA 4KZ0A 5H4YA 2NQ3A 1E8YA 1UOWA 5CCJA 4EZKA 4WAFA 2FK9A 1E7VA 3IBEA 4TUUA 3RPBA 1GMIA 4AJWA 1DSYA 4LCVA 4WWOA 3N5AA 3QAQA 4LDCA 1E90A 5H4ZA 3HIZA 4L23A 1WFMA 4PS8A 3NZUA 1DJGA 1BDYA 1BCIA 4ANUA 2K3HA 2ZKMX 2WXMA 4HLEA 3RDJA 4F1SA 2WXJA 3NZSA 4GB9A 4L2YA 4J6IA 2V4LA 3F01A 3W57A 3L17A 2WXKA 4L1LA 3ZIMA 2X38A 4EZJA 2Q0ZX 3FDWA 2CHXA 1DJIA 4Y1TA 2ENQA 2EP6A 2RD0A 1RLWA 4ANVA 2A4ZA 3R7RA 1BYNA 3W56A 1A25A 2UZPA 1W16A 2YOAA 2FJUB 3APDA 2LHAA 3QARA 5G2NA 4BGDA 5JHBA 2D8KA 3QR0A 3T8MA 2KI6A 4WWPA 2QZQA 4DK5A 2WXGA 3DBSA 3MJWA 3QR1A 3L54A 4FULA 4AOFA 4ANXA 5KJ7E 1DJXA 5CCGE 3ML9A 1K5WA 2Q3XA 4ICXA 4XX5A 3TWYA 2WXNA
chains in the Genus database with same CATH superfamily
1G5AA 1HHHB 3KH4A 4PV8A 2BNRE 4O58H 1J8HE 1A8JH 4IK6A 4OD1L 1DE4A 3CG8A 4U3HA 2RA1A 1TJIL 2GBVA 1JDAA 3QORD 4FTDA 1U8NB 5IW6A 4HK3J 1LEKB 3P3YA 1X5JA 2F2HA 1LEIA 2WVTA 1LEKA 1PQZB 1TCRA 4ZUWB 3BRGC 2YC1A 4ENZA 1Q90A 2HRLA 2NY3C 4UNTA 2OMVA 2LVEA 3R06B 4DN3L 1PG7L 2V8LA 3H6AA 4FNPA 2M1KA 3T6ZA 1CB4A 1RZKC 5AW9B 4WUUD 1K4CB 4M93B 3ZQWA 3K4DA 5ICXA 1UVQA 1A3RL 1RK1A 1X5LA 3O2VH 3GSNA 4P2RA 4PJEA 5F7KC 5ITBL 5J12C 3GSNB 4QYOB 1TOXA 3DPDA 3MSPA 1M2OA 4ZW8A 2O6FA 4UIMB 3HHMA 1G7LA 1NC2B 1YEGH 2YZ8A 4W9LC 1AC6A 3S6CA 3TPKA 2ED9A 1TVBA 4YFLI 1S7RB 3MLYL 4S1RH 3V95A 4BINA 2OZNA 2OXGB 3J2PA 5I18L 3MUY1 4IIQB 1I3RB 4M4RB 3V55A 2XN0A 3W9EA 3KCPA 3RX7A 3B9KC 4ALAL 1ZT7A 1DVYA 4UU9A 2YK1L 4DERA 4QTIL 2CIIB 4ORGB 2I9TB 4KV5F 3IDNB 4DOHE 3VO0A 3N0PB 4QDGA 1BZOA 4WWOA 2E7LC 3ARDB 3PJNA 2XTLA 3PABB 2R8SH 2A6DB 1HYRC 1N5YH 3DROA 3ARBB 2HB0A 3B9KA 4ZMOA 2ZKMX 4E9VA 4P2CG 2EIMB 2PW2B 1JPSL 4PJBF 5TE6L 3MFFB 4PJIA 1VKXB 1RZGA 2GEQA 4YSUA 3KR3L 1BXVA 1HCYA 2RD0A 1UM4L 2A73B 1BHGA 2OCFD 3Q48A 4MXWL 3G5XB 1O7SA 3CDZB 4AZ8A 4QRRD 1S7XB 3MRCA 5DJZB 3V0HA 5F2FA 3TNNB 3NJHA 4HIIA 1JPFB 3VWKD 4WU5B 4ZFFB 3ZBMA 4U1NB 4ADIA 1XO8A 1OGAB 1AHWA 1JPEA 4OGYL 5T5NF 1OGAA 3PWJA 2BCKB 3B5HA 3SGJC 3VXRE 4YHPB 4QXWA 1FZOA 3CFBB 2C9RA 1DBAH 3S5LB 1UWEL 3G04B 4MA7L 3VXSB 4H88L 4N0YH 5CZVL 3G04A 2WXOA 4OGQC 1NGYB 2FGWL 4XR8C 3ELAT 4QXUH 3LN4A 1BX2A 4RWYL 1DN0A 2FH8A 2Z7UA 3QR2A 4ACPA 4GAFB 4ZUUB 4B3EA 3D7PA 3WEOA 1G4RA 5MI0C 1CGSL 2YAMA 4LGRB 3WMPA 3T0XA 1OB0A 1IBGL 4UQCA 2MHAA 4IEFB 4JPWL 1TJXA 1X5GA 1Y7VA 5DGQA 4OT1L 4ZOBA 4X6EB 1HZHH 3CHPA 3T65B 4N2IA 2QSTA 3G6JA 5DS1A 3QP3A 1NFAA 2Y25A 2IBZX 3VE0A 4AMWA 5DS8B 4QRBA 4V1DA 4HP5A 5DO2D 3PY9A 1QRND 1HNGA 3MGTA 5JA9A 4V11A 4PR5A 4HOXA 4XCEA 3GHPA 4AT6B 4UDTA 4ZMPA 2YD1A 2ZSWA 2H7WA 3NOIA 4X4YA 2ZUTA 5B1JA 1H6FA 3WGUB 3EYFB 3IDYC 1QFPA 2OLDA 4YSAA 4RAVA 4X9HA 2JI3A 1OM9A 3MLUL 4DKAA 4PRAA 4XNAA 4IOFD 2V9TA 4NO2A 2D31B 2P4AB 3CH8A 4NOBA 4OF0A 5E2JA 5C70A 4UTBL 1HXMB 4IHOA 4NCC1 3K8MA 4PJ7A 2VN6A 3WO4B 4IRZH 1MAJA 3AACA 1HOEA 1BCIA 1YQ2A 1W72A 3DMMD 3KYKL 3B5GA 3F7QA 2ADIB 1JF1B 3QUZA 2N7AA 4JFQA 5FHAL 4FC3E 4F8NA 3FZUD 2HG0A 4FNLL 2B5IC 1H9DA 1YEGL 3MUGA 3TNMB 1UJ3C 2DL9A 4PJIF 4FFWD 3ECBB 1IGIH 2VLRD 1G7MB 2HT3D 3ECBA 2X6MA 5A1AA 1WZ1L 3MMEB 3OR7A 3V2AR 5KYNA 4I85A 3VUAA 2IPUG 2OCJA 2IH8A 1ZWIB 2MCPL 4R97C 3JSSA 4F37K 4XO5A 1A4JA 4Y5XB 5E2TL 3SPVB 4L4TE 2KL6A 1MRDH 3CIAA 3D30A 3V6ZA 1L0YA 3MRQB 1R6VA 2EEAA 3VXRA 2ZWSA 3LYRA 1A1OA 3CFKA 3TZVD 4TS6A 1NCOA 5BJTA 3S8FB 4B9KC 4ZOCA 4HEMA 5I6LA 4NJ9L 4FFTA 1I3VA 4Y16B 3BT2H 5HHNB 4R3SA 5KBNC 1F3RB 3K0YA 1S3KL 3E7JA 4D0CB 5A2CA 4BH7B 2ZUXA 3H7LA 4TMPA 1Q4NX 3TBWA 1BZ9B 2Q6WB 4PBDA 3GI8L 5L4IA 1N59A 1N6QL 1J12A 3HC0B 5EOCH 1EX0A 3HHRB 4ZX6A 1DFBH 1RUKH 5C7ZA 3HAEB 3DO7A 3JWNE 2LU5A 4I3SL 1QR4A 5BNXD 3I50L 4OGXL 4Y1AB 2DTSA 4L8CA 4NIKB 3T3MB 1MFCL 3ARUA 4X8CA 2C8NA 4HMCA 4DIXA 4OFIA 1F6FB 1WFOA 4KXCA 3GK8H 2HKHH 3L5WB 2GJJA 3GDBA 4MXQC 1KCKA 5FUZL 4Y5VA 5AVYB 4EPSA 1GGIL 1IBZA 4O2FB 1W80A 3GUTA 5IF0A 4L0ZA 3VU1A 1IE4A 4AIZA 4UM9B 2EVJA 3QDJD 4MJIE 4AQAA 3QHFH 3IKCA 5FECA 4L2LA 1ZA3A 3BEWB 4QJ3B 1MWAA 5EPMA 4AMKL 2VDRB 5LKNA 1E4WL 2VITB 1BGXH 4O02B 3WXWL 2WVUA 2XZQL 2VITA 1GIGL 3WFEH 3REWA 4ZQTA 3VAEA 1PX3A 4BSVA 1AO7A 1MIEL 2FBJH 3B2XA 5FR3A 5DK2A 3KH3A 4QHNB 4NO5B 3EOBB 4N5UA 7PCYA 3QDJB 3N5AA 1MCOL 3CXHK 4OT1H 1IAII 1F3JB 4XNXL 1EEQA 4E9YA 4ZMVA 3BGMB 4FF9A 2VKWA 4FERA 4GAYA 4Q97A 4MMZB 4GB9A 3T2OA 2JF1A 1RVFH 3FU7B 3JV6A 3BWUF 5DHYB 3KG5A 2C7UB 4LPWA 1KCUL 3OKMA 3LDBB 1GJWA 2HRGA 1Q0YL 2KBGA 3NRPA 2OMYA 2E75C 3DSFH 4WTZG 4YNYA 2PPFA 1KYUA 2XX1A 2XVKA 4FFYA 3AWEA 1P9MA 2JXMA 4J28A 1EVUA 7FABH 4CU6A 4P5TA 1U4FA 2K70A 2Y5TB 4FQ1H 2DTML 5IHUH 5EWIL 3K6OA 4X4KA 2VO8A 5CJOL 4MQ7B 4PWGA 4K8RH 4ODVH 1X7TA 4HH8A 4Y19E 4B9CA 5I16B 4BGDA 1YMMA 3OAWA 5J89A 3KPRB 4PJ5B 5SWZB 5KSBA 2R51A 4U33A 5E00B 3HRZA 1TTUA 2JJTA 2KQMA 5CJQH 1EAOA 2IAMD 4TNEA 4CSPA 2H32H 3MZGB 5DJYA 1XSOA 4B95C 1Q9KA 3LZNA 5IW1B 5LO7A 3DIVA 3M1CA 3T0DA 3QNYB 4OZGB 5F44A 5JW4R 2V3FA 4G11A 2EE3A 2GUYA 4ONHB 3ZX1A 4I2XA 1T04A 1TU2B 3A5VA 4HZ1A 2E5EA 5LAPA 1VZHA 4XZUA 1OTTD 2A3TA 3IVKA 4AW7A 4AL8L 2GVYA 3V52L 1MCSA 5E4EB 1WF5A 3FU6A 4OF7A 1FJ1B 1EBAA 4C56D 2QPSA 3D05A 5IMMB 1TJHH 4LCIH 1XV8A 5ICXB 3WL9B 2BWQA 4BRVA 4JANB 3DJRA 4X7TA 5LWYL 3OF6A 3KCWA 2E9IA 5DD3H 3EJYC 1KIUA 3WTUA 5L8JB 1JYWA 5G5DB 3SYOA 4JO1L 4NWTL 4AEIH 1XAKA 3CN1A 4X5WA 1Y18A 3CCHA 2FQFA 5E8EA 1E5ZA 1YUKB 2HG5A 4KO9A 4RRPM 1DBML 4R2GD 2NY6B 1IM3D 2PYFB 2I27N 3RWDB 1UM6H 2YXFA 4F7EB 5D7LE 1Q9OA 5HYEA 3HPJA 3JV5A 3JXAA 4YS4A 5BO1L 2X53A 2XVLA 4QRTA 3U2SA 5CCKH 1GZQB 2A9BA 1UENA 3MRHB 4Y4KB 1FNEA 3HPLB 4LVNB 3JBG7 4QRQA 4PMEA 4XT1C 2DI8A 3HPLA 3RVWC 4I9WE 4NCC2 3ATAA 2R9HD 4F20A 1G6RB 1U9KA 1PZUB 4HT1H 2BVOB 1VACB 4FKEA 3CFCL 3GLAA 4RMWA 3KPLA 3TN0D 3P69A 2ITCA 5AVRB 2NY0D 3RVXD 1BFOB 1FDLL 4HDIB 3CX5K 2ENQA 4TSAL 2BRRL 2NW3B 5FM5O 3ZSTA 1JXKA 5I1CH 1KDIA 1UWYA 3CDGA 4RFNB 3GMPB 2J71A 3FB8B 5ACZA 2JWYA 3BH9A 2O4EA 4FQXD 4G6KH 4MB5A 4UQBA 4HQQH 2GJ6E 4HS6B 3DBSA 1H9VA 4BV1A 2O72A 1H6UA 3CK0H 4XCCL 3T5WA 4PJ7F 2XA8H 3D0VB 2HLAB 2WBKA 5DUPL 1MCIA 1UZ6E 2PO6A 2RJMA 3FFCA 4QRSB 2QPUA 2PO6B 3FFCB 1HJCA 1KBKA 1NGPL 3NJVA 1F5WA 2BNQB 2X88A 3FU9A 4KJPD 1HL9A 1BF8A 4X6CE 3KLSA 1WCBB 3OG6B 5BQ7A 5A3IC 3LIZL 4L5FH 3NP3A 3UGUA 3K80A 4JGUA 5TJWK 5TGBA 4OGZA 5HPMB 3CFJA 3O3AB 5TGBB 3E2HC 4QHKI 5I6MA 3I75A 3KPOA 3KXFD 3BKJL 2ZKYA 4OLYL 3RTQB 4A67A 5IFAH 3L08A 1NFDE 1IM9D 1YMHA 3NIGB 5BVJB 5IFJB 5F0PB 3KPNB 3BKYL 3MI6A 3ZE0E 4DZ8A 1BLNB 2NT1A 4IOIB 4LB8A 4UIKL 5E99H 1NBYA 1ZD6A 2EDQA 3CUPB 1CK0L 1QA9A 4KTGA 1ETZA 7FABL 2DBLH 4JVWA 1KGWA 4Y4FA 3LRLA 5FYLD 3HR5B 2DTMH 3CFIC 3RBGA 5HHPA 3KLAA 4JN2B 2D7MA 2IDCA 4NZDA 2M8XA 1DVFD 3L4UA 2XXCB 5I5MA 4OJFH 4YWGL 4P3DA 4XTRC 5BCAA 5C0CA 5L2KA 2Y6TE 1IAIL 4XMVA 1UD4A 3BIKB 4OAWB 2VXSH 4AE1A 3QULA 4FG0A 1QQDA 4P9ML 5IZ7A 1JS4A 2KZWA 1DQKA 1QVOB 3QHZH 3AM8C 2VR4A 2Y06L 2UXTA 4NDMA 5GIRB 4GY4A 1L9OA 1W15A 4MSWA 2GPZA 7CGTA 3OX8A 1T5KA 1FO0B 4S1QL 4UQ3B 3GSVA 1UD8A 3PWPB 1ED3B 3CSBA 1R3IL 1PVHA 4X9IA 4EXPX 2WQ8A 4Z3TA 3GXUB 1MCDA 3TA3A 1WS8A 3FW6A 5J3HC 3V52H 1OXYA 5KYWA 1I53A 3NJJA 1NOAA 4ABWA 1A9BB 5D96C 2Z4QB 4FQXA 3T04D 3GD1C 4DCQA 3QZPA 4DVBB 4U1SB 4UYQA 4BKLA 4N22A 1G87A 1U8HB 3L5XL 3TM6A 5CWSB 3PWPD 1HCZA 1KN2H 2DLHA 4EJ1C 1KSRA 5BQDA 4CNIA 3EH2A 3L3IA 4L3CA 5I8KH 3L7FA 2DN7A 2AITA 2VN3A 1H8NA 1AHKA 3RWGA 2IWGA 3ECQA 3FB7A 3RWGB 4D2NA 1HL8A 5FFLA 4OCLC 1KB9K 2ZCHH 5E6IA 1IKFL 1QYGH 2XWZA 5FGCE 4FYQA 2VL4A 4AGMA 2OBGA 4WO4A 15C8L 1XF4A 3DX2A 1DSWA 1LP9E 1T3FA 3AMKA 4YBLC 3AUWB 2OJZL 2Z31C 2X4RA 1HCFX 5J13C 2AEQH 4KI5F 1NFKA 1ASPA 2ERJB 1AQHA 1JWMA 5FOBB 3CHQA 3MV7A 4HGMA 1B6DA 1DBJH 2B39A 2WIMA 1RZKL 3OV6A 4J3VA 1J87A 1OT2A 3LB6C 4NSKB 4S0TD 4KC3B 5AW3B 4R0LB 2VMJA 5ETUA 1I8AA 3O0RL 5E6IC 4AC4A 1ZLWH 4WY7L 1P0SE 3H3BC 1O9VA 3BGFC 1OGTA 3B4NA 2DM2A 2WXRA 2VXTL 3FSAA 4ZBJA 3SDXF 2F54D 4NN5C 4QF1A 1CBJA 3JQOB 1BXAA 2F6AA 1G9NC 4M62L 2VR9A 1ZLUK 3LKOA 1WBXB 5TE7H 2JKXA 1JTPA 4R7XA 1YEDB 4JG1L 4LRNL 2G3MA 5LGJB 4NAJA 4EOWL 4PBXA 3OXRB 2FYYB 2KLTA 1R3HA 5FYJU 4HF5H 4G3YH 3B6SA 5GGRA 1D5MA 5IWLA 4FKHA 4WGWB 1AD9A 3R19A 5AZ2H 1M9WA 1QTSA 4MKTA 5BXFB 1G7QB 4M00A 2D7NA 5IQMA 1CGYA 4BZ2A 4FQHA 2UY6A 5LUMA 1A1NB 3CC5A 1JHTB 4W68A 2APBA 3TBYB 5JW4M 1A1NA 1A6VL 4BKSC 1DBKH 3VGAC 2J1XA 2EC9U 3V4VB 1H0DA 1HQ4A 1FL6B 1VESA 1LP9B 5CINH 3TBTB 3GUTB 5IT2L 1WAAE 5E5LA 2XN2A 4ZXBD 2R29L 4Q6YA 1DJYA 1MOEA 3GSNH 3FU3A 3HNVH 5ANME 4N2EA 1PD1A 1ZT4B 3QUYB 3L95A 4QRAA 5E95B 3B9KD 3BT0A 4L1TA 2B4CL 4P5TD 2C3XA 1BFVL 2GC4C 2P8PB 4LCVA 4Q4IA 5J6GB 4MJIB 3ZZLA 2NSMA 4IU2A 1WFMA 5BZZA 5A2LH 4I5BA 3NIDF 3EFDL 3HW7A 3UDWA 5ENWA 4HU8A 2Q76A 4P5MB 1HKLH 3BAEL 1EGJA 4EN3D 2KT6A 2WWOA 3EH1A 4HWBL 3CVIL 4PJDA 4GEIA 4XNMB 2DMCA 5CLYA 1JYXA 1LO4L 3I6SA 1NCIA 3GSWB 4JKPH 1QSEB 2G5RA 4LCCB 3L2LA 4U6YA 2YPVL 4LNVA 3CXDL 3ZKND 3IFOA 4JQIH 1ZVSA 3BD4A 4LO9A 1VPOH 4G7YL 2ZCZA 3IFOB 3IDIA 2Z8RA 3RGVA 4GQZA 1AFVL 5D55A 3U4BH 1DJSA 2EVGA 3WMQA 4AVJA 1KC5L 5ADPL 5DQ9A 4Y19D 5EZLA 2FATL 5I16A 5HHME 4Y9BA 5JYMA 1KXQA 3RAJH 3FQWA 5C0RL 2X6AA 1U3YA 3IXTB 2DQDL 3SYAA 4WUKH 3RJQB 4C83B 3EJPA 4I48A 1E65A 1P7QB 3LXCA 3RWCA 1OB1A 1QACA 4DO4A 1L9QA 3CVDA 1X7QA 3RWCB 5LQBH 3WG7B 2Y4SA 2IEPA 3PV6A 1HHJB 3MV8B 3BIAX 3GS0A 2DJMA 4WWKC 3C6LC 3N3EA 3T0EE 2FR4B 3CZUB 3IKKA 3QZNA 5TD4A 4KKLD 4CA4A 1G7PB 3LHPH 3OLGA 4AYFA 3ULUL 4YBQC 3ECUA 4HFUH 4CVWA 1T6BX 1YNKH 2Y69B 3Q13A 4HJSA 3L9BA 5IJDC 1MJUH 4PWKA 3LPWA 2Y72A 3N1QC 4WY7H 3F7VB 5IK3B 1E4KC 1M56B 4NPYA 1ND0B 3MN8A 3VVVA 1RZPA 3RP1A 1ND0A 2JJUA 3D50A 1OIOA 4X5WB 5HD8D 4C57C 3M1BA 4JY6A 2P9RA 4V1DE 2HTKC 2OMBA 1D2PA 2YGQA 4J8RB 4X6DE 1AOHA 5B21A 4JFTA 5CGBA 2FWSA 3KBFA 1KLUA 2GQHA 3KYMB 5H37A 3OB8A 3Q1EA 5KN5A 3OAZH 3NCBB 3RB5A 3PL6D 4A39A 2DQGH 3BWZA 4A55A 4KRLB 4HK0A 3AT8A 1E8YA 3BVWA 1F4WL 5M94B 1D6EA 4PS4L 3BWAB 1GZQA 5HJGA 1G7LB 3MUZ1 4CW1B 1I7ZB 5KAQG 1FNSH 3MV8E 3ZDYF 1VZGA 2CJUL 1N0LA 1RV6X 3C87A 3ZDZF 3FAWA 1DVFA 4AJVA 1F45A 1OCCB 2VLKA 3MDJA 3N42F 2DQUH 4LOUC 3NAAL 3ELQA 1A6VH 3QXDA 2VZSA 1U3HD 2V9QA 1PY9A 4HKJB 4N0CC 4FQCH 2AV7A 2NZ9D 2PR4L 3FJTA 1J8HD 3DGGA 1W0VB 3QEQB 1NIDA 3WFCL 2DQJH 5DSCA 2D9CA 1NJ9A 1PYWA 5DSCB 5AYUH 1YPZB 5I9QB 4UMSA 4NFBA 1U8NA 5IW6B 2WKLA 4IRZA 2GJ6D 2H2PD 4XVTL 2ZUYA 3V0AC 5EN2B 3ZK0A 2Y3NA 3OSVA 4JJ5B 3BPLB 5AVZB 5IFHH 1GS7A 1A6PA 4L3EA 4GMSH 2YD4A 2KLSA 1U33A 4MJ2A 1LGVA 3VI3A 4LK4A 1CDIA 3BP6B 5E9DB 3VFGL 4Z7VA 5DQJA 2CXKA 3VWKB 3ME0A 1TXKA 1M1XA 4KPHL 4QYOA 5T1MA 1IZKA 2UVEA 4JLRA 1F4HA 1EJOL 3ZKXB 3M17A 1U8CA 1BQSA 1QUNB 1JRHI 2YAPA 2DBJA 4OV5B 5T5FH 3JUYA 1MHEA 4I4WB 1J1PH 2BFVH 4GH7B 3TN0A 1I4FA 5AZUA 5B8CA 4OFYA 2QSQA 4AE0A 1I8LA 4XH2A 4O2EA 2DYPA 3ZMRA 3HR5A 3A3YB 3TWCH 4Z7OE 3LKQA 3AG4B 3I6KB 1TFPA 4PWIA 4YDJB 3OHMB 3TZVC 3MA7A 4AG4H 5I75C 4U6VH 1LO3L 3H85A 1JPST 1WDAA 3MA7B 4L1SA 4BK8A 4EUPB 1BVKA 4KMTH 2B14A 1SJVA 4PJBB 1VEMA 2D2CC 1HSAB 3S4SB 4DEPB 1D5IL 2GABA 2OXHB 4UT6H 1CGTA 1MH5B 3IRPX 5DJCA 2MPVA 3GJFH 5EG6C 2VJ8A 2IH1B 3WHE0 5FO8B 2WXQA 5D1XA 1YEKH 2IH1A 3IETB 2Y6SC 1J0YA 1N68A 4X6EA 3ZKQD 3VFOB 1X4ZA 4Q6IC 1JZHA 4DN3H 3P9LA 2Q9OA 3EGXA 3HI1B 1SUJA 1KN4L 4BEIA 3LHPL 1A9BA 2NX5A 4GBXC 4QWWC 4FXGB 1WRFA 1SMDA 2GCYB 4NZRH 4YHLH 3QXAA 3SE3A 5DEFA 3IFLL 3IF1A 4HH9B 1U8MB 5K59F 1FFRA 3S35H 5L9DL 3D06A 5HYFA 2EJ1A 3I85A 4MWFB 3SE4A 4C56A 1DVSA 1RP8A 2C3WA 5E5RB 2IH3B 3HHSB 1XR8B 5LBVA 4GRMB 5IJKC 3F7YB 3GSXA 3GBEA 3VYPA 5A40E 1E6OL 1NCUA 3AWGA 1UJ3B 3L5IA 1DZ0A 1G7HB 1N64H 2DLTA 1VRSA 1CFBA 4FXKB 2F58H 1AH1A 1FHGA 3VXNA 1LLAA 3VFVA 1KTJA 1NBCA 2AXHA 4NUQA 2ZPKL 2IAMA 2J4WL 1F4YL 1SYVB 3QZOA 3SGEI 2WGNB 1F4WH 3CZEA 4YDKL 9CGTA 4JBSA 1G9NL 3WO4C 2BSSB 3KPSD 2V2XA 4YXHL 2ED8A 5ID0B 1S5IH 1PF3A 5E8NA 4Y9CA 3WUWB 4OZHF 3MKKA 3ETBJ 4PY7B 4RZCB 2IOMA 1KZYA 5E4OA 4ZJ9A 3VXOA 4DPCX 1IEHA 3BPCA 4PJXA 4FL4B 3ILEA 4MBOA 2J5LB 4Z78B 3EF4A 3L13A 2AXFB 3E3QE 3UZEA 3VFPA 1KCSL 4W70A 4OFKA 3VFPB 2XIDA 5FGRA 3PWVB 2DQHH 3IJ9A 4Y2OB 4AM0A 3LS5H 2CXGA 3CAFA 3TEWA 1JNLL 5CKGA 1JZEA 5GHWH 3I6GA 3MX0A 4YQXL 1F3DH 1F42A 2ID5A 2ALWA 2CRZA 2MOVA 3JYBA 4RAVB 4A6YL 4ZTPH 5EF3A 3LZFH 5I73C 4PLJC 4WK2B 2GJPA 5IFHL 3K2UH 4RGNB 4TUOA 3O4LB 2F19H 3HG0A 1I7TB 2DMHA 2GSIB 1N8OE 1XGTB 3LS4L 4KVCL 4ZS7H 1DLFH 1YDPB 3EF7A 3AY4C 2H2PC 1HQ4B 4EBQH 3W0WB 1ZA6A 1Q1JL 3DOHA 2HCZX 5I6XC 2O5YL 3SQBA 3L4CA 4RIRA 3W3BA 3MNMA 2HN7B 5I8CA 4OZHA 3UJIH 1G94A 3QJQB 5DYOB 4OF5A 4LLVB 1E4XL 4PVMA 3V0GA 43CAB 4DPBX 5F3BA 1I8LC 4YHYB 1E9OA 4UT7H 5KVGL 4HS3B 1V54B 4OD1H 1S9VA 3CSYB 4B60A 4W9GC 1XVSA 4FMVA 5F7NC 2OJ1A 3NPSB 3PAYA 5AW2B 4K15A 4PCYA 2CO3A 2VDKL 3IWVA 5JIKA 2QDWA 3OLEA 3VCLB 2D3VA 5CZRA 2B7DT 4Y2LA 3VJ6B 1FE8H 1RXLA 5ACMA 1RLWA 4PJAF 4RQQB 4JZNB 4MX7A 5C0BE 5I1GL 1AGEB 1D5IH 4UT6L 2CBMA 4G8FB 4LKCB 3WAKA 1T1XA 3MLZL 5F7BA 4H8PA 4XX1E 3UZVA 2G60L 3DX7B 4FQ2L 4JRXA 2CCLA 4KHTL 2Q7AA 3O2VL 4Y4FD 4JY5H 2CBPA 4EIGB 2NY6C 4LL9A 2MPAL 1OT1A 5T3XL 2ITDA 2NY1C 4IRJD 3AM8A 1MFVA 4XO8A 1I7RB 4N8UA 3GI9H 1E5CA 4NN7C 3TT3H 2EIBA 1PS3A 3NCJH 3QWRA 4FA8A 1RUQH 4I3RH 1KFAL 3KYKH 2VERA 2XA3A 3MJ8A 5MEQA 5GS3A 5AL0A 4ODWB 4L1DA 4KVPA 5F7DA 1RJLA 4DO5A 3L4ZA 3QDME 5JPMA 1KGUA 3TURA 3RNQA 2V2WA 1S7QB 5JPMB 3IMTA 1RZQA 1U3HC 2O5ZH 3RNQB 3OWRA 1U3HB 1BQRA 1YEFL 1IGIL 1YHPA 3BWSA 4JFOB 1SY6L 1D5BA 4UM9A 4BK5C 3U83A 5DJYB 5JW4Q 3U6RB 2WAHA 4EDXB 1E8XA 2EIZA 1TZOA 2AVGA 1YC8A 4WFGD 5I1LB 5DXWA 3UG3A 3NK4A 4WFGE 5BUPA 1EK3A 1NWOA 4MJHA 5J12B 3FFOA 3WKPA 1JWUA 5IQNA 3APMA 4XPTL 5BOZG 4X0KA 1GGYA 1TU2A 5C0EA 5KBMA 2VZOA 3PL6C 3RWIA 4ZG1A 4G70B 5IK3A 1NGWB 2VLKD 3L8QA 4LOUD 1NGWA 5ANMB 1VFBB 1I7UB 2WBJB 1KYFA 4M1GL 1ZAGA 3A67L 2QMKA 1WZAA 3BI9X 4D8OA 1MN4A 2NTFA 3NGBC 4PBWD 3QFJA 5KOVC 2NTFB 2UYLA 3VXUD 4GS7C 5HY9A 1S7TB 4ABVA 3UBXA 2YFNA 4XN8A 4YXKH 3OKLB 1QLFA 4AEHL 4QKXB 3TESA 3FU7A 3JV6B 3HZMB 3PL6A 5DHYA 5KYYB 3MRRB 1OSYA 1BQUA 4XXCA 2WWMC 3VSTA 2WCSA 5JMRA 1CTMA 1MWOA 4AENB 1DDHA 3ZGIA 1MJ8H 1SXCA 5CXPA 3FRPG 2F7QA 3PIQA 2VAAA 1XGUB 4LPCA 1RUML 1CBVL 1JVOA 3QCUH 2W94A 4W4OA 4GSRA 4MAYA 1HXKA 5C0AA 5LN8A 4XWGH 4M4RA 1D9KB 3GBNL 3AREC 4BQBA 4Y16D 4RWYH 2Y2YA 2V4LA 3EYUH 4I0PC 3EBGA 3WUZA 4ZS7L 2DZEA 4WSGA 3STLA 5CZKA 5SWZE 5TF1H 4DW2L 3BUDA 5E00A 3C5SB 3WE6A 2D3JA 3EOAA 1FGNL 4Y19B 3FTXA 4LCUA 1W16A 1VGKA 1KIRA 3EJZC 5JXAL 3A4AA 5F7MC 4KGJA 2VLJA 3D69B 4I0CC 1BQLH 1VHPA 1F11A 3F12A 4ZMYA 4JM2B 4DF9A 1NC4B 4EQ2A 2NY0B 3HS0B 4JM2A 4HZLA 4YN3A 2AP2A 3K2MC 2ITCB 4TVSa 3WTTA 1VKXA 1EIBA 1NMCB 4Y7MA 4JJ5A 2LABA 2R2CA 5KWYC 2JIXD 1UA7A 3L9RB 4RAUA 3SD2A 2EZ0D 1SVBA 2WVVA 4Y4HD 3BAWA 2WVVB 1XF3A 2TRHA 1J5HA 1ONQB 3G6AB 3FB8A 1A6UH 3QT2A 4Y4KC 3RY5A 1I31A 4DP7X 3VWKA 1KIPA 2CM5A 4ZMZA 2JQMA 2NR6C 4M7KH 2AXWA 2AK1H 4H5SA 2ZOLA 1RVFL 3D0VA 1ADQA 2JQZA 2EYRA 1GS8A 3CE1A 1TETL 4IIZA 4KI5E 4KY1H 3ARGB 5AG8A 3HVDA 2LFEA 4N6QA 2LV4A 5C0NC 5MERA 4KKCD 5L4JA 4KUCD 3U25A 1X44A 1H5BC 3KEDA 3LNFA 4N0UB 4PJFE 3WLWC 5E24E 4JO4H 1OF0A 5GISH 1VADB 4G80B 2ZUQB 1YNLL 4K8RL 5CBAB 3CPLB 1JXDA 4PTTB 3FZUC 1L9SA 2X41A 4GW5B 3SIKA 4Z5RA 5JHMA 2Q7YB 4PG2A 4KK6C 5KVMC 4YHOH 4QNPF 5KSAA 4ZUSB 4TQHA 4QRQB 1QA9B 2D7QA 1RZFH 1K8IA 4NQQA 4Z8FL 3OZ9L 4YSDA 1IMHC 3GLDA 3UEZA 1KB5B 5FYLE 5J8OA 1KB5A 1EDHA 4LAJH 1WZ1H 3NN8A 3WJMA 1D7CA 5FKAA 2JQAA 1S3RA 3FT3A 1HVXA 2PCYA 1DUYA 3AWFA 3ES6B 4YK4B 1QRNE 1MRDL 2GC7C 1INQA 1ZHLB 3OJ2C 1UHVA 4KFMA 1NDGB 1R46A 2UXGA 3GC3A 2FLRT 4JO8A 2ZG3A 3CDGB 2YPLA 2YFOA 2Q7NA 4CADB 1FN4B 3ULUC 4KDTA 4X8XA 4G71B 4ZFZB 1W8NA 4F80A 4P8QA 3KDMA 3H42L 2GCYA 1JPFA 5DURB 3IGAB 4LSUL 4NKDA 4YR6B 4X80H 1ID5I 1A14L 1ED3A 4ZO8A 2AEIT 1OHQA 2OFQA 2WGXA 1ORQA 1S3KH 5DVMA 5I8EB 4WF7A 1ORQB 2K7PA 5I74B 3WGVB 4XP1L 3HCVA 2A4ZA 4PJDF 1QLEB 3NABH 1WCBA 4UZGA 4ODTH 1DLHA 3HMXH 4P5RA 5DUML 3QARA 3X1FA 3X12A 4F15C 1XMEB 4FTVD 2LAAA 4NB7A 5I5JA 5I82A 1X5XA 5CWSA 5C3TA 1KBBA 3FCTB 3U4EA 3LZQA 1J5CA 4XCYB 2Q87A 2Q2EB 3FCTA 3U4EB 4XXCC 3RPIB 2QTEA 1SPDA 3FMGH 3I50H 4OGXH 4PD4K 3VXNB 1H19A 1LO2H 5KJ7E 1N3NB 1YMHB 4BWUA 1CCZA 5CCKL 4JFDE 2NNAA 1MW1A 3MBEA 1IC0A 1PSKL 5DRZB 3D5OF 4R90L 4PV9A 3WHE1 3FFCE 3TNMA 4BCYA 1RUMH 3DVIA 4UQ2B 4KTEL 5IW3A 4UQ2A 4KKAC 4PJCB 4Y4FB 1HAUA 2QHLA 4BZYA 2XPGA 2Z34A 1I1AB 2QQKH 3F2LA 1Q94A 3CFCH 3OR7B 1QUPA 3P4MB 4PW4A 3U7YL 4K3JL 2VZUA 3GIVA 3MHZA 4IRJB 5DWUL 1C5BH 2FE0A 4BZ2H 2AXFA 2MTAA 4LASL 4CDHA 3APFA 4QTHB 1T1YA 2VH5H 2FIKB 5C0IA 2E7LA 1FGNH 2WO4A 4B6ZA 2NR6D 2N01B 4QRPE 1MFDL 4RX4D 4IKIA 4AY0A 5I5IA 3NJFA 2BW5A 5HDBE 2V37A 2N0MA 4X7SL 3RTLA 1OAQL 4R8WH 3HN3A 4OZHE 5CCHE 5IOPA 2ARJB 2X2IA 3FSZA 4KQ3L 5CR8A 3L3KB 3A4FA 3WU1A 4Z23A 1CI5A 2WQAA 2F53E 1X4XA 3V4PB 4FADA 2CBQA 3HB3B 3CFDB 4BE6A 3RU8H 3IMVA 4YC2C 1WA0X 4I0PB 4PRNA 5CNHA 1DQVA 3BRFA 5IWLC 2BM3A 3OQRA 5CGYD 1MFBH 3QFDA 2VXQH 5DHVB 1D5MB 2ZYRA 4NQCB 2V17H 3POCA 4WEMB 1GOGA 2AW2A 1T1ZA 1DQDL 2BOBA 3L5HA 2YXWA 1MIML 4JFQB 2GITA 1FV1B 3L5WA 4NHCL 3US0A 2DIEA 3NJLA 1DVFC 2WTRB 1NGXB 1QAWA 4AIZB 2BCMA 4U2ZA 2FT8A 3ZHKA 3PHQB 5H4ZA 4J3TA 2YPLE 1EEYA 4X4XB 1E2VA 4YBHA 4F8TA 1CG9A 4I13B 2FQGA 4RMVA 1OD9A 3IDGA 3JYCA 2D3LA 2ZYHA 4J2XA 4F9PA 4I77H 4LIQL 4Y1TA 1ZT4A 3QUYA 4ANVA 2YQGA 3AY2A 3H9ZA 2H1PH 1RZFL 1EO5A 3CFKB 4Z8FH 4A2LA 4S1QH 2D8KA 1PIFA 3T8MA 3S8GB 3LH9A 3FONA 2X4OA 5JOPE 1FL3A 2NRDA 4JFXB 4XMWA 1KTKE 2FL5A 5LVEA 1RU9H 1UWGH 2BSTB 3WIFA 4WIQA 3VFWB 3D18B 2PR9A 5D1QA 1C1EL 3LEXA 4HFWB 3U46B 2FNBA 4KJYB 5IVXE 3IRZA 2H5UA 4GSQA 4XXWC 1LQSR 5E1IA 2YPVA 5FA4B 3WFBH 1E3XA 2UV3A 2P28B 2ZE0A 1XAUA 2X2UA 3BSHA 3FQ4A 4F57L 2XQBH 4OCYH 2ZWZA 2EDNA 4ODHL 4DFIA 2X05A 3HNSH 4U1KB 4PRPA 4YDIH 5CP7A 4F2EA 2E27H 2O30A 1LP9A 3HRZB 2I07A 2F7RA 5TQ0L 4X5LA 2ZP8A 4X7EC 3X11A 1I9IL 2QQNH 3MXWL 4OM0H 3N85L 3W1ZA 3DYPA 4H20L 1A4KA 2ATPA 4JFYB 1RZKH 4WO0A 4OCSH 3GSRB 4P07A 5FO7A 5FDWA 5J9PB 1MJJB 3NFNA 3P2BA 4R90H 3MBWB 4N2AA 5I1AA 1Y6MR 2BOCB 4PRIE 1KGIA 3DBXB 2XNAB 2AJZA 2XNAA 5E1GA 3IDMA 4KKBC 4NRYB 1L9MA 4N2MA 2VE6A 5AQ0A 2HLFC 2R0ZL 3ZO9A 5K9JH 1P7KB 5CN2A 1GW0A 5IB3A 3W2DH 4Z77A 5HJDA 3UBXB 2BVQB 4LLQB 3RPKA 3ZQXA 4PJDB 4TSCH 3ULVE 3K1DA 5IESH 5I8OH 1OAUH 1EUTA 1JYVA 4H26A 3LN5A 4XO4A 5M95B 4XMLL 3JT0A 5BRZA 3NCMA 2JIXA 2BS8A 3VSVA 1HQRA 1R5VB 5C7XL 1OK0A 4JFHE 5E8DH 2W8CA 3DVNA 3CDYA 2R39A 3GTVA 1AZNA 3QNZB 1F4AA 4HXAH 4HCGA 4P9HL 5C09D 5FX3A 4NUJB 3CTTA 5CHNB 4RISH 1Q72H 4LNRA 5AOLA 5IOKA 3JTSA 1DANU 3OPZH 3K3QA 3GFUA 4U3SA 3ESVF 5CINL 1E28B 3VTAA 1A25A 4F9PC 4ZMLA 1PD0A 1PJWA 1OCRB 1Y07A 4PJ6A 1Z0MA 1TEGA 3L3HA 1ECYA 1KIRB 2UZXB 3B7SA 4Z3EA 1JSYA 3DX3A 3CJJA 3H2PA 4OZGA 4GP4B 4XP9H 3KM2A 1JTTA 2ZSVB 2NY2B 4KX7A 5F7LB 2WLIA 3ZUCA 3EJSA 5I1KH 3ABKB 3T0EC 1A3LL 4NHCH 1CFNB 3WFHB 1KWGA 4MFHA 2EE0A 5K59E 2AAAA 2APSA 2WSKA 5IHLB 1JNJA 3DRQB 5A7BA 1RULH 4IBVA 4Z7UE 1U8KA 3FT2B 1G7PA 4AYFB 3QFGA 5FCUL 1WFIA 3GM0A 1U92B 3FO2B 3CLEH 1M6UA 1MI5B 3BH9B 5IKCA 4G7VH 3MPCA 4WDIB 3BVVA 2EABA 2K4AA 3TJEH 1P1ZB 2WUBH 3CVIH 1JNNH 1IEAA 4N87A 4Z95H 5GS1A 2NY4D 2WNXA 3JWOH 4MMXA 4RFNC 1R19A 3ALPA 2R83A 2XWTB 1DHKA 4K5PA 4V2CB 2XYCA 1RHFA 5DJ6A 4LCYB 3WNKA 1S7VB 4W4NA 5DJ6B 5T8IA 5D4IA 2AJUH 3BP6A 3QIWD 2ZG2A 3CFJB 4O5LL 3VRJA 1BXXA 2B9BA 2F7OA 3UAJC 4XC1L 4PJ9D 4GMTH 4UIMA 2OTPA 4TV3A 4ZMNA 1XH3B 3FU8A 3U2SB 3A6CH 1IBFA 1JGEA 3BH4A 5KSAB 3EH3B 1FLTX 3TBVA 1F6AA 3F3HA 3CPUA 4KJWD 4IOSD 5EORH 3VFMA 3N9GH 4L3ED 4L4VA 4FRWA 2ISDA 5IP4A 3LKQB 5IEKA 1X5HA 1AYOA 2AFNA 4TL4A 1QBMH 1G5GA 2BS9A 3M6DA 3NFSL 5HYQA 2ARJQ 2RGSA 3ZU8A 2D7TH 3M86A 2E27L 4Q6IB 1F4XH 1FGVH 2YOCA 5T5FA 3EXJA 3O41A 4NQCD 1FNGB 1GJIA 1VCAA 1FG2B 3VRIB 2H26A 4XAKD 4UI2A 1P6FA 1MH5A 3MV7E 4ZFZA 3PXHA 1V55B 2R1WB 2RQ8A 4RESB 1BWWA 4AYDC 3C5ZA 1TTCA 3O6KL 1RMFL 2FJFB 3BE1L 5E5UB 2BHYA 5J5EA 2HVKA 2X1PA 1ES0B 4GBXA 2AABH 2D4DA 3PDOA 5GJTH 4LSRH 4O4YL 5F1NA 2IH9A 3UERA 4BFNA 5JPMC 1ITBB 2XFXA 5FGCB 5IEHB 1X6NA 5MEND 2UWEA 2YN5A 4CVZA 5JIIA 3IAQA 1V5JA 5K9JL 3RJDA 4HAFA 5EU3A 4G8GA 5SV3A 4G8GB 4JKNA 1B0RB 1WH0A 2F74B 4W9HC 5AOJA 4DN4L 3AVEA 4U6XB 1QABA 1CLOL 3MRKA 4N2BA 1TZHA 2XKNB 4GRMA 1E2ZA 1S7WB 2OL3L 3OGCA 5SX5H 1HNYA 1GW6A 4TQEL 2E6PA 1TQBC 5C7XH 4L18A 1Q0XL 2BIHA 3BZ4A 3FS9A 3KPRD 4HXAL 4PJ5D 3I6KA 3QRLA 4YDJA 1V7MH 3DRTB 2VLRB 1CFTA 5HHMB 4AQ1B 3O4OC 1BMGA 5D72H 2IAMB 4UNIA 1T7YA 5JIQA 2ZNWA 4HYTB 4YL9A 1BVKB 1FIGL 4HIJB 5T1KD 2NY4C 3E1ZA 2XRAH 5LJYH 3CMOL 3HG5A 4J6RL 2GUOB 5KS9F 2GUOA 4KO6A 3TEYA 4YDVA 1O7DE 3TBBA 1M42A 4L0YA 1C8PA 2EDBA 2VXQA 2VW6A 5BV7C 4XNYL 4XVTH 4ZS6C 4HUNB 2CHZA 2X1WL 3EJCA 4N3UA 3WTXA 1CD0A 4GBXD 4S0HA 1I82A 3ARDD 3TXAA 1OP3K 1OVZA 4OSUL 3SKMA 1TEYA 1HKLL 2GJZA 1XZ0B 2KLRA 2VW4A 1P4LB 1RULL 1CUOA 4Y2OA 3HUJA 3MC0A 3I6LE 5D7HA 5HHOD 4QJ5B 3H4HA 4MMYB 3IDXL 1XFPA 1FFOA 4L8BA 4OZIE 1HTYA 2X2YA 4NQCA 4HG4K 1CDGA 1CDCA 3ZDZB 3IN2A 1ZTXH 3TPUA 1KT2A 2X4SA 3A6BL 4JDTL 4WLCA 3O6MH 4MWFA 3JWOL 3EHBC 5MP6H 1DQTA 3U4BL 3D1MC 3BCDA 4LOVA 4J23A 1FV1A 3QFJE 3X14B 4IK7A 3FL7A 3T3PE 3AY4A 2FATH 2XG5B 3RNKB 4KXZH 2DYRB 3THMH 3UYPA 4OZ4B 2BC4A 1G84A 3D3VB 4WUKL 3SQBB 1NAML 3A4EA 5KS9A 4HAGA 1GYCA 4RNRB 4WSKA 3NZSA 3G5YB 3ZE1E 3ET9F 4GG6F 2Z93A 1KXTA 2VUKA 4K7PX 3HEIB 4DKFH 3LKSB 4F7CB 5JZ7D 3QJUB 2OR9L 1YAZA 1HILA 3D51A 4NZ8A 3UAEA 5C86A 2CR6A 2KI6A 1INEL 4EUPG 1JWSA 3AJ7A 3P11L 1A21A 1SJMA 1ZHNB 4I5BB 1ZPLA 2IADB 2Z35B 3IXAA 5D7EA 5KVFL 2IGFH 3CU1A 1X9LA 2I5YL 2IF7A 1FZKB 3F6LA 4FEMA 2VDLB 1FGVL 4LEXH 4XNUL 3WIFB 1O6SA 3F84A 4JZNA 4MX7B 3O6FA 2BIOA 2NQDA 3EYQD 4ONGH 5FA3A 5ILTH 3D0LB 3KWTA 2W88A 1HHIB 1Q0EA 2QR0B 3WLWD 2F5AL 1EMTL 1CXKA 1PG7W 1U6AL 5F7UA 1AC0A 2JJSA 5B1CA 2P5PA 4QTFA 3TA3C 1KDJA 1R3JB 2UY6B 2XQYK 2WO2B 3N1FC 4HWZA 2Z7WA 3DTXA 2FECL 3AQYA 4BQ9A 4CN6A 3X3FH 5D7SH 2EVIA 4WWKD 4LLDB 1E6OH 1ILUA 4PJBE 3PXJA 3L6FA 1T22B 3AS0A 3BH8A 2NXYB 5EU6D 5EOQH 5IMOA 3ZKXC 4A38A 5FM8A 1XQ4A 2R8SL 1N5YL 2EADA 2OULB 3BKMH 4XMKH 2ED7A 2NZ9C 5IMLB 2CDGA 2ENPA 2VDRL 5FO7B 2B59B 4ZK8A 2BPBA 3RKPA 3S9DB 4O02L 2VNCA 3T6VA 3MBWA 4LVHB 4F8LA 2NY0C 3HS0C 3RVXC 5I1AB 2CLZA 3BP4A 3LNDA 3ARED 4NM8L 4Y8AA 1QI4A 4MXWH 5CJ5A 3CSYA 5AW4B 1DYZA 4QY8B 4DEPC 2HTKD 4PCSA 1G4MA 1NL0H 4H0HB 3VWJD 2AS5M 2VE6B 1VF5C 4KRPD 1C16A 4QJ4B 5HGDB 2P8LB 1LK2A 4JEGB 5F97E 3ARXA 2DIAA 5DRNA 4HPOL 4JPKL 2VMEA 3RWIB 3QQXA 3CH1B 5ABZA 2GFBB 1J1XL 1G9HA 1NLBH 1GMIA 1HDMA 1NH6A 1U8PB 4M1DH 3QDMB 1HDMB 3VWJC 1OQXA 4JRXB 1IX2A 3GJEA 1F6LL 2W80C 1SLXA 4R9HA 1FVEB 3LZFL 1A47A 1FFNB 1R5WA 4JKLA 4X83A 5CU5A 2A77H 5I71B 4PRPE 4AKOA 5CFAA 1IC1A 3AZUA 3SGKA 3EJYD 1SOKA 4G72B 2EXWD 4X7DC 3IDXH 5KBKA 2MQCA 3DX8B 3GXMA 1NBVH 4PG2C 1D6VH 2UX6A 4NERA 3U9PL 2WWKT 5GQBA 4L37B 5TH2A 3A6BH 4JDTH 2VLKB 4M3HA 1CDJA 4UQDA 2DW5A 3DXAB 5MP6L 3VFRA 5EBWB 3VDBA 1HN1A 3C2AH 5HDQH 1FNFA 1MY5A 3ZHNA 1CFNA 3WFHA 3LJ3A 3T4AB 3BVTA 3SGEH 1HHHA 1N2RA 4PV8B 5EIVA 1FVCB 3NIDB 1SOQA 3ZKNC 5DJ2A 2XDHA 1JGLH 4X42A 3CBKB 1HOCA 3TVMC 2VISA 1QFWI 1NC4A 4KKQA 5ALCH 4OJYA 5BRZE 1AZRA 1YN6A 3TA3D 2GJRA 4UTAA 5FW6A 1DBBH 1Y0LA 1MLCB 1NANH 2IG2L 4J8RA 1WSST 3P11H 5F3FA 3WXVH 5JHLA 5LG1A 4N2FA 4AC2A 1AKJB 1KB5H 1KV3A 3P4OB 2VSMB 2MPAH 5T3XH 1QEXA 3BUBA 3E8UH 5DT1H 1SDDB 5JDSB 3T3ME 4M8RA 1BFTA 4JRYE 3V4PL 1P4BL 2BY1A 3A24A 4G8GD 1U42A 1H3VA 3K4AA 5MEOB 2NPLX 3QUZC 4QIRA 1YYMH 4XB7A 4DK3A 2VAAB 3BZDA 3H56A 4UAOB 4Q9RH 5CF3A 4TVPL 3JWNG 5F3HB 3IFPA 3UACA 2OAAA 2OXGA 5F3HA 1CS6A 3FQRB 4LL4A 2BP0A 2EVHA 4M6MH 1CYWA 3ZL4L 1T4KA 3HPJB 5FYKE 3LCYA 1PPIA 2WTOA 4J3OG 4RMBA 5HHOB 4LLMB 4CN4A 2I9TA 1ACZA 3STLB 1LILA 1CI3M 1MFAL 1RIVL 1UOWA 1YEFH 3MO1B 4HU2A 5JQIB 1AD0A 3LV3A 4HHAB 1I85C 3EHBD 3EKCA 2YAEA 4F37F 1NEUA 4YXHH 3MJ6A 5LLIC 2R1XB 4XMZA 4I9WD 4P59H 1JDCA 3SDXA 5AD0A 1IM9A 4ZO7A 3TYFA 3U4KA 5EOQL 4GQ9H 3DROB 1G6RA 1CO1A 5EEUA 1U8OB 4NJ9H 2GIYA 3KBEA 1GJUA 5JMOC 4QI3A 2EE2A 4YSOA 1IC7H 1RIHL 5FKAB 3DETD 3HS0A 4IGBA 2FUTA 1W72H 3EO0A 5AL8A 1OKEA 1FRGH 1B2WH 4K9EC 2B15A 2NXZB 3TBCA 2ZYIA 2XN1A 1PDKB 1S7XA 5D7IE 3HZYA 1WAPA 2FIRT 2X09A 4EN3B 1ONQA 4U4IA 1DVUA 3FO9A 1LWHA 4JL1A 3KDMB 4LQ1A 3CXHJ 4JDVA 5DI8A 3IF1B 5D2LF 4KAQL 4JDVB 1GRWA 5DI8B 1NSNL 4K94H 4YXLH 3EYQC 4Y5XC 1ODAA 1NANI 2BCKA 3U1QA 2DLFL 1QPPA 2X9YA 1E4KA 2Z6FA 4XX5A 4XN9A 2P47B 3AU0A 5GRYA 4Z76B 2BNQA 1J1XH 2NW2B 5F9WC 1G9ML 2NW2A 4NM4H 1DVZA 5FUZH 1YECH 4IMLA 4YHYC 1OSZA 3P30L 2GTZB 4MNQA 1UD2A 2JCCE 2AI0H 5KUMA 1VADA 4G80A 3BZ4B 3KPRE 3JZ7A 4PJ5E 4Q8BA 2WNGA 5DVLA 3C5XA 4ZUUA 1J05A 2CLVB 2XZQH 1NBZA 1NQBA 3MLXL 4DW2H 1T5WA 5H35B 3UZEC 1J1OH 1J9RA 3HE6B 4LPVA 3V5DB 4P5KA 2J73A 3HMXA 4CC4A 1HE7A 4NBZB 5KVGH 5HHPB 2IDTA 3JWDC 3KPQB 4TOYL 3WN5A 5KJRH 3PGDA 2XG4A 1UZGA 2KH2B 1XX9C 5DDHA 4N90E 4NOFA 1J8RA 1QQDB 1QWHA 1FE8L 1OARH 3D87B 3IFNL 4GXVH 4UDTB 4NQUA 2BW4A 2VKXA 2WXLA 2Q3ZA 4KUCF 1BEYL 5KS9E 1A66A 3OHXB 3KW8A 4NJAH 1SVZA 2QVMA 5ESQA 2OMZB 4A6YA 5JXEC 2FEEL 3V0FA 1RFDL 4MVBC 4KY1L 1QX1A 4KZ0A 3QNXB 4MCMA 3SE4C 3UBGA 3BESR 4MRCA 4WWKA 1XGZA 3MRLB 1DP0A 5CD3A 2P48B 4P57A 4Z7UB 3Q8FA 4FN0A 4DP2X 1FORH 3O3EB 3BX7C 1TEFA 4NAMA 5BS0E 5JDJA 1RUQL 4FXKA 2G0KA 4I3RL 5JIHA 1OTSD 1KNOB 5D9SA 2E3VA 3FHQA 4N68A 4QHUA 4DP9X 3ARZA 3KWWB 43CAA 4CGTA 12E8H 1F90L 4ZPTB 2O5ZL 3IJEA 4RA0C 2SEBA 3LKSA 4F7CA 4ZPTA 5A7EA 1EPFA 4QT5A 1CL7I 4GPVA 2GBTA 5INCB 2GG1A 3K91A 3LEYH 5HYJB 1KF9B 2XPGB 1SN0A 3AREB 4QOKE 4HCRL 3NK3A 2IBBA 3P0GB 2P52A 4GUCA 1HAWA 1ZHNA 3FTVA 3HI5H 3SCMA 1S9WB 2KMWA 4J7RA 4Z1PA 1ZWIA 4J12A 2YJQA 5DZNA 4QTIH 1BG9A 3VXPB 3U1PA 5DD3L 1X5AA 3BZFB 3ISWA 3RWHB 1PNCA 5TF0A 1KBGL 1U91B 3ZTNH 1IGTA 4JFUA 3HC3H 5BJTB 4I2XE 5LBGA 1QTPA 4KQ4L 1L0PA 2CHNA 4N26A 2VZ3A 4D3CL 4U6HA 2EZ0C 4PVBA 1JPSH 2CO7B 3IJHB 4GW4B 1QSED 3WKML 5JOPD 1M71B 3MREA 3PUCA 4E41B 3Q1SH 4Q9QL 4KH9A 4M5YH 3KR3H 5E9AA 5D5ME 1QKZL 1EFXA 4YXKL 2GBAA 1BZ9A 4JRFA 1EFXB 2VSCA 4F7MB 4IKJA 3S96B 5JUEH 1ZLWK 4Y2DA 3WIHA 3UTTE 1LNUA 3FUMA 4WW2A 5CIPA 4KMQA 3HFMH 4LLUB 4YXLL 5EOCJ 4LLUA 3DVGB 1HFUA 2QELA 4DP4X 3QUML 1V27A 3L2NA 3UTZB 1N5AB 2VC2B 4D0BA 3STZB 3U0TA 4TSBL 2F8XC 1CGWA 1GHFH 1MCPL 1S7QA 4OD2B 3L48A 3UTOA 5EZJA 4P0DA 1CE6B 1VA9A 5DQDH 4YLBA 5I24A 2VZ1A 1KBPA 1FZJA 4LARL 4P2QE 4K3JH 4TVPE 5D2NE 5BMFL 3NCFB 4G6KL 1XH0A 2CA4A 1EH9A 2PP9A 4J27A 3CZLA 1UGKA 1K8DB 4Y1SA 5I1IH 3DGCR 4RZKA 3SDAA 5DUPH 1II4E 1XL6A 3HI6H 4NO3A 4X6CB 3UAJD 1NGPH 1MLBB 3CH1A 4L48A 3WNIA 4X7SH 1BZEA 1I7UA 5J4MA 5F9OL 3SQRA 1U8PA 2ZT9C 4IU2B 3SDDA 3HG1E 3LIZH 4L5FL 4G8AC 3FULA 3OKNA 3HG1D 1CD8A 2H3NB 1ZV5A 4TN9A 5T1LB 4ZZFA 4ZT1A 1XWVA 3RYMA 3OKLA 4N86A 1U8JA 3LRHA 1XDTT 4R4BA 3QH3A 2VB5A 2DQFB 2YWZA 3LN5B 5LDUA 4N2DA 4WCYL 2YKLH 1FL5B 3FN9A 5GRWA 4F9LC 4RFOH 1UGNA 4H1LB 2A4CA 5GRUL 2QVTA 1BAWA 1PL3A 3DX6B 2UWEE 1HI6A 3WUWG 4Z6AT 1JK8A 5KSBB 3F5WA 4U1KA 1BD2A 1WICA 2BSRA 3HN5A 4IMKC 4XP6H 5JHDB 1KTDB 2H6PB 4BYHA 2PWHA 3DGDA 3QHZL 2Y7LA 4NX0A 2CDEB 3A22A 1CXEA 3MRGB 5ADOL 1OB1B 5GGSY 4EDWH 2FTAA 3FSOA 3QIBD 5L4FA 1WVZA 1TZ8A 3K4ZA 1OZUA 5FDWB 5J9PA 3GXDA 5FDYA 2NY1D 3CN2A 1SFHA 4IRJC 5ESVB 3C8HA 3FUHA 3S98A 1VZIA 2RB8A 4GEJA 1CZ8L 3FPYA 4Y4FC 2OP4L 5HVWA 1KXVC 3MOQA 3NEEA 1K9TA 2WHVA 1JERA 1RPUA 4PBVC 4WKXA 1RK1B 3H42H 1N8ZA 3WL9A 1F1GA 4OBSA 5LGHL 1KN2L 4OIBA 3D39B 4FXLA 4KMLB 4LSTL 3S88L 3O8XB 3F7VA 2AANA 4XP4L 2Y1VA 2BP8A 3VDAA 4Y1AD 2ITEA 4L9LA 4K5OA 1C1EH 5C0GA 5LN4A 5MEOA 4FE9A 3M1BB 4QUOA 1WC7A 2DQMA 2JB6A 2X4NA 3S3SA 1NC2A 3O4LD 1UZ6F 5GGVH 4GINA 2C4XA 2Y7NA 4ES9A 4PJXE 1K5NA 1E67A 1KJMB 1LD9A 1NCBH 2HH0L 4GP8B 4M3KB 2WYZA 4LP8A 4DP0X 3LQAL 3GMRA 1LO2L 3PP3H 1E9QA 1M6OB 3PG2A 5IB4A 2A74A 4QRTB 5D6DA 1PSKH 4C4KT 3OKEA 2A74B 4ORGA 2F8VA 3CIQA 4N2LA 2E47A 3IJ7A 1B90A 1QSFA 3SYQA 3V0DA 4FJ6A 3OXSB 2J55A 3SPGA 2IWFA 3VG0H 4PS8A 3OXSA 5D1ZI 5HVFB 1JGDB 3T2QA 2VDOB 1OAZH 3TT1H 2YIHA 3OVUB 2QV4A 2WLIB 4MXQD 4UZSA 3U7WH 3T1FA 3EFFA 4NHUB 3GKWL 5TE7L 2Y24A 5TDOB 3QI9C 2QLVB 3UTPE 1HEJC 3LPOA 5TDOA 5T33L 3EJQA 2W1NA 3IGKA 2VH5L 4N85A 4U1GC 3G5XA 1U92A 1OAXL 2OX5B 2XN9E 2F5BL 2A2QT 3NCXA 3FT4A 4BH8A 4I1NB 4ETQB 5KSAD 2AK4E 2LW3A 3IMUA 4AOFA 5I1IL 1R17A 3CZSA 3O9WB 1MIEH 3ALXA 3OG4B 2Q3XA 4KK5C 3PWJB 1NCTA 2W9DL 1OP5H 4L3EB 4WEBH 3A4DA 4RVBA 2XC8A 2HVKB 4HIXH 1ILSA 4GNKB 4HEPG 5JHAA 4W6WB 3NG5A 3L9YA 4NC1C 2UX7A 1M7DB 1MCOH 3ESNA 3FCBA 3FSVA 3RIAF 4AQOA 5E7BA 1MCWW 1P4UA 1QLRB 4IQHA 3CXFA 3GJFA 3LQZB 4PM1A 3P3UA 2BNRB 3MRBA 2FT6A 1WV7T 3V9FA 3V6BR 4MJ5A 4AM0Q 1B0RA 4POUB 4KROD 3PDGA 1XEUA 1EHLH 5E0FA 4HHWA 1NM9A 3GMNB 4QHKJ 1DVTA 5IFJA 4BUHA 3KPNA 3UH8A 2HKAA 4Q9BA 8FABA 4RGMC 3DMMC 5C6TL 1B9ZA 3CVBA 1BFVH 2LTQB 1AZBA 4O2EB 1HH6A 3KLAB 4H2AA 4JN2A 2FB4L 3GMOB 4IEFA 4L4VB 4ZD3H 1TITA 4DHLA 2FDBP 1CE1L 1XGPA 4H0LC 5C0CB 1KLGB 5L2KB 1YCSA 2Y7QA 3VE0B 3UIZA 4LP5A 2X70A 3NJXA 1AHWC 5D7IA 5LAXB 1RZIA 3D08A 3WBDA 4DZBB 2WIIB 1ZHLA 1CWVA 5DWPA 3UJTH 3MGTB 4GW1A 3SKJL 4HUUA 4TNVF 5CJQL 4KX9A 1U95B 4GAGL 4NQVB 2R2BA 3Q9PA 3H2WA 3VRIA 1CU4L 3DI2B 1WZMA 1KWKA 1XF2B 3N42B 2CO6A 4OH2A 4FXGC 3PWPA 5HXMA 4FA6A 1FO0A 4X98A 1TO4A 3RA7L 4YSTA 1XGQA 3L4VA 4WWNA 5J56B 1P2CB 3FBKA 4NXKA 3HTLX 4NFCA 5EZIH 1UZ8A 4MDIB 4J3WA 4AL8H 1PZ5A 4JHWL 1PZ5B 1EXGA 1V3LA 5EH1A 3VRLE 1DLHB 2YUWA 1U8HA 3S34L 4HOMA 1SM3H 5H2BB 1LXMA 4DTGL 3SE6A 4XCYA 4J3BA 2BVPB 3KJ4C 5EU5A 3QCTH 1XH1A 4ZW3A 4HW6A 1T20A 2JI1A 4LSTH 3S88H 1BJ8A 1MRFH 1U8IA 1FA4A 3A6CL 3QUZB 1EVTC 5LQBL 1AXTL 2XBZA 4WTXA 4A7SA 3BCFA 3WLBB 3TASA 3TVMA 4PJAE 3GSXB 4HC1H 4A2DA 3FB7B 4ODHH 4R0LC 1WGOA 1K3ZA 4ZI8A 5BO0D 4FABH 4RGND 5JOFB 4WUUB 3SSGA 3GB7B 4Z7WE 3ULUH 1XF4B 5JIMA 5HGHA 2ROYA 4YUEL 4F7PB 4OM0L 2WC7A 1QBML 5C0FA 3VFNB 4YE0A 2W91A 3QUZD 3MV7B 4YHNA 3VGDA 3KPPB 2PUQT 4R0LA 3VXPA 3QIBA 3FYIB 4KJQD 3ZYOA 1OGTB 4ZMAT 3NESA 1EZVX 1NC4D 4M5TA 4WI8A 1J9TA 1IGTB 1R3LB 2Z31D 5FLUA 3NSYA 1R3LA 4AK2A 4QF1B 1PLGH 3OQ3B 5F7YC 4Z0BL 2K6YA 2QQQA 2GT9A 3SKMB 1FDLH 1KY6A 3AU1A 1AGFA 2H9GA 2CKBA 1KCBA 4DP6X 4BD4A 1O5PA 4I0PA 1BZ7B 4LSRL 4O4YH 4PRNB 5IESL 3S96A 2FYYA 4JAMB 4HJ0C 3ZKMD 3QORC 3DMMA 1K3IA 1ZVHA 1IEBA 3QISA 3QJSB 5C08E 1VFUA 5ES4B 4Y4HC 5C97A 2YSSB 4ONFL 1XSJA 4APXA 3TCXA 2E8ZA 3US1A 2PXYA 3NAAH 2BP3A 5C71A 2F1AA 3QRGH 5T3ZH 1MFEH 2IANE 5HHVL 3UOAB 3KGRA 2AGJL 2QFRA 3FCSB 3EUUA 4I0PD 4IGBC 3HG1A 5J13B 2UZIH 1ORSB 1NGXA 2WTRA 5BRPA 4K73A 5B7FA 3HLAA 3ATFA 1CE6A 4W1TA 3W82A 2MKLC 1IBYA 4K9EL 4ZXBB 3MRMB 2PW1A 1F58L 4PUBL 1O9WA 5HD8C 3RVWD 4WW1B 3BP7A 2P5WD 3ZT5A 2J12B 1MI5D 1ETJA 2ADGB 2J8UB 4XP9L 3NRFA 1MI5E 2FX7L 5DYOA 2NR6A 4XN5A 2XRAL 5DJ0B 3QEUB 1ZT1A 5HPOA 5C6TH 1GYWA 3QO0B 2DWDA 1KV7A 5F0JB 1MG2C 5E51A 3OAUH 3FONB 3QJOA 3VWJB 1EGJL 4HUMB 2Q76B 1N6UA 4OSUH 3SPHA 4GAJL 3MLTA 4ZOEA 2R69A 1T83C 2PYED 3W57A 1TVDA 3DKHA 4FFVD 3LRGA 4W81A 1DQIA 3QXUA 2R4SL 1IV8A 3TVMD 1L9NA 3BIBX 1CFQB 4U6YB 2OTWB 3I9IA 3RZCC 5JHBA 4YBQD 4MCZB 2C3VA 4WU7A 4Y4KD 3SODB 4WTQA 1A9VA 3V7AE 3GJEB 5D93B 4A63A 5A3ID 3RGVB 2X4PA 5DJXB 5AOKA 4FFZH 5CCGE 4FTVB 2OTUA 4ODXB 5CHNA 2H8PB 2WXNA 2EDYA 4DOHB 3UJJL 2FQEA 3F85A 2KDGA 1BYPA 2CE6A 4U49A 2NDFA 4XE0A 4HZAA 3DPBA 3QIBC 2OM5A 1U8QA 2NDGA 2QQLL 3NSXA 5FPIA 3EJZD 5MEQB 2DWYA 1UXWA 2VMDA 1IC5L 5IGXH 3WY2A 3BWUC 4FI8A 3F6IA 4ONHA 2WQSA 4GFXA 4N8CH 4BELD 2H41A 2D7TL 2G2RB 4YGVA 1D5BB 4NQDE 2E6QA 2CLRB 4AV5A 1MREH 4K3EL 3TGXA 2WO3B 2JFCA 4XPGL 2PTTB 2DH2A 4NRYA 1A64A 3D34A 4K3GA 3TONA 3IFLH 3X1EA 4EEEA 1QW8A 2VISB 2VRAA 1TCRB 4ZUWA 3KVQA 1PFOA 1RSYA 5C0EB 5L9DH 5IJVA 1PGRB 1FNAA 1I3GH 2VLKE 5J11C 1T0MB 1T0MA 1AZCA 1MXGA 4WTZA 3B1TA 4JHVA 2MEJB 3QVAA 4EQ3A 1KCLA 2YQ3A 2ZXEB 2Q8AL 1FBIL 2YMXH 3QIUD 1ACXA 1BF2A 4RGNC 1ZV2A 2F58L 2Z8SA 4F7EA 3T77A 2ZKWA 5DMKA 4XMPL 4JCLA 3C60A 3EDJA 4RETB 5GGSA 4RMUA 3QORA 1KY7A 4PHZA 4YDKH 3IMRA 4G2AA 3RX8A 3W81A 2E4FA 4XXWA 1Y1UA 3NGBB 2FD6H 4IDLA 5C0AB 2OW7A 1ZHBA 3GO1H 1MAMH 1UEMA 4L3EE 4I87A 1YMME 2CO4A 3QXDB 2FJSA 3N1GC 3QRGL 1MWAH 2PABA 4GKSA 1MF2L 1OTTC 1RPKA 2WPGA 3QZLA 4NKOA 1DBKL 5EO9B 5F1OB 1JD9A 5HHOA 3ATEA 4X6CF 4HD5A 3V79C 2ORBH 3C5ZC 4KKRA 3CBRA 3GIZH 4MA8H 1W0VA 3WE6B 2DF3A 1R0AL 3LV3B 2BZDA 4HHAA 4P4RA 5FF6B 3WJJC 1VGKB 2BDNL 4P4RB 4L4TB 2CGRL 2V9RA 2JLLA 2VIRB 3B7TA 3O6LH 4FG6D 4K9EH 2YBRB 4L4TA 2ZUWA 5I19H 3JWNC 1U2HA 5DHMC 4GXFA 2YBGA 3U9UA 2FNWA 3FT4B 3C8KB 4Y2DC 1A7QL 3L1FA 5FGSA 4W9DC 4ABQA 3EOTH 3O2DH 1J0ZA 2E4TA 3KWXA 4NGHL 1HT6A 2OMVB 2JE8A 3FHEA 1XH2A 2F19L 4G9FB 3PYCA 3L4YA 2DYPD 3QG6B 4NT6A 2QVIA 3ZDXF 3LS4H 2QGBA 4KVCH 3HZYB 3N40F 4NN5B 4FHKA 4WEUD 4Z7VB 1E5AA 4XX1G 4EBQL 4ZS6D 4KKAD 4WI2A 4HV8A 3I9AA 5IBTH 4U1IA 5KSUA 2VJXA 1WHOA 4NWUL 5DMJB 3BFWA 1XR9B 3BN3B 1FG9C 4UANA 2DKSA 4ODSH 2EYSB 1WEJH 3K5RA 3FRUB 4MAYC 1WZKA 3REVB 4AH2A 1VFAB 4PJ8B 5GRVK 2NY3B 1A2YB 2F74A 4G6ML 1VFAA 4FCHA 1IKNA 4U1GB 2G9HB 5ALBH 1IQWH 2IAAC 1BQHA 4L8DB 5CSZA 5DFAA 1NBYB 2ZF8A 4P2OD 3QI9B 3THML 1WBZB 4N0UA 4Z7VF 4JQIL 3KPTA 1WBZA 3RFZA 5IB2A 3KPMB 3ZE2B 1MCKA 2XI9A 1XMWA 3E6HB 1AFVH 2VLRA 1KG0A 5FYKD 2NX5E 4GW5A 4C59B 1RZ8A 3ML8A 1OAKL 1J05B 3G6DL 2Y7QB 2P1YA 4Q6IA 1AD0B 2NSQA 4LBEA 4OAWA 1COBA 3RDTB 2XXFA 1P84K 3SDXB 5AD0B 5I1GH 3DI3B 3ROOB 1I9JH 4HSQA 1SHWA 2NY7L 5GS0H 1KLFA 3NN8B 3WJMB 1F2XK 2YA0A 4RGOL 3G9VA 4UQ3A 1INEH 1AVAA 4FFWC 1ROWA 3I2CL 1CFVL 1KPVA 3ZR5A 3GRWA 4PJCE 3ABGA 2BHUA 4GI8A 4WENB 3ETSA 2J21A 4BFKA 4LEOA 5M7QA 3MCKA 3TIDA 4OFVA 4Z7WA 3UL4A 1MREL 3PDOB 25C8L 4JO3H 5I74C 3ZTCC 2YEZA 5IEHA 2VQ1B 5KUKA 3TT3L 4GIOA 4U1SA 5CEYA 1LDPL 2R9HC 4HKXA 2P5WB 3H9HB 2F5AH 3OHXA 2EDRA 3GXIA 1NCDH 3EYFA 2D0FA 1NAKH 3E8UL 4MMXC 4WRLA 4ZFOA 4ELMA 1UH2A 3SDAD 3PV7A 3C8DA 5EF0A 1IBBA 3BQUA 2IH3A 2WB7A 3HHSA 5D7SL 3S5LA 3AROA 4PJ9C 3DVFA 4ISVB 4NZUL 5FKPB 5GS2H 2VZVA 2X6BA 2ZD0A 3PP4L 4MNQB 1BA9A 4GT0A 4A1RA 4JO2L 4KKCC 5IB1B 3FOMA 3WE1A 2DQGL 4RNRA 5GRJL 1J0JA 5F96H 1PG7X 4J3OD 2ICEC 5DRZA 1UD6A 4KK5D 4PS4H 3D4GA 1IFHH 4AQ8C 3QJRB 4P59L 4AV4A 4U0QB 4JCMA 2NUTB 2CJUH 1AI1L 2GYSA 3BJLA 1XIWA 3MR9A 4XC3H 4U1JA 1IKOP 1SEQH 2WWKO 4FQXC 4PGCA 4AITA 1Q94B 2AKRB 4WV1A 1AQKH 4Z7WF 1A8ZA 3KPQA 3DURB 4G6JL 1M05B 4MJ4A 1UA6H 2XG4B 1W72L 2Z35A 3IXAB 1Z3GH 3GHBH 1O6VA 4CMMA 4AM0B 2X89D 1N67A 4B7IA 2XVGA 2BDNH 4HPOH 3ARGC 4JPKH 4E9QA 3IAGC 1GVIA 3VI4F 3N55A 5ISZE 5I19L 1R3HB 3BHBA 1JMXA 4M1DL 1CBVH 3L3KA 1Y6NR 2DLFH 3RIAK 4QCIB 1E5YA 2P45B 4N0UE 1DQQA 2W65B 4POZD 5EEVA 3MLVL 1SVCP 3ARYA 2CAKA 4BCZA 5FS5A 1V05A 1SJHB 1YDPA 1HXMA 4OZ4A 1LQBC 3VFGH 1FLRL 1ORSA 4OFDA 3I3DA 6PCYA 2AF2A 4LVNC 1TYJA 5KW9L 4KJWC 3VD0A 3ZMEA 2CMRL 3NH7H 1NFIB 2FJGA 3ESOA 2PWGA 3TLRA 1TTAA 2M2DA 3EFOB 3MV11 4CGUB 1F1AA 1IJ9A 1YAIA 3CVHL 1OZTG 5ALBL 3ZHDA 1MHPL 1XZWA 1D5ZB 1IGYA 3MLWH 1MJ7H 3MACL 4O58L 3L4WA 5JW5A 4Y4HB 4CRPA 2DQCL 3HKFA 1HHKB 3PQYB 3ZE0F 3AREA 1UCTA 4KKBD 4AG4L 5DEJA 5T1DH 2WXMA 3W0WE 3W0WD 4RMTA 1KULA 4PW9A 2X38A 1AKJD 4HC1A 1TQCC 2YA1A 4LAQL 4NNYB 1UKQA 5IQLA 1O6SB 3VXME 3TEUA 4Z7NB 4ZW5A 3WTVA 1K85A 4H7VA 4JFEE 4DUXA 5EUOE 4OM1L 4UINH 3DSNA 1I9JL 2AV1A 2B2XH 1EEZA 3WHXA 5F1IA 2A6JA 3H0TB 1EEZB 3WHXB 4MMZC 3P2DA 2D4FA 3UYRL 5A2FA 5ITBH 1S8DB 1QZ1A 5SWQA 3RBSA 3GGWA 1VIWA 4FAAB 3QZMA 4JFPB 3FT0A 1OT4A 1U8JB 5HVHC 2EDWA 1VLXA 1KN4H 1PZDA 4FHBD 5D1QB 2VR7A 2LGNA 4JO3L 5DQ9B 2WLLA 1I7RA 3UFIA 4IJTA 3C08H 4DGVH 2BWIA 2WLLB 5AVUB 1JV5A 4PB9L 5EB9A 3F62A 2FLBT 3VWKC 4F5CA 1ZLEA 4J3SA 4IS6A 2WZAA 3QJTB 3PLYA 2B0SH 2ZUUA 5A6IA 3KPSB 3QUMB 5F89B 5I18H 2UZYB 1QNZL 3MJ8B 5FHAH 1QHQA 2ZX8A 3GBMH 2AERT 3E8VA 1SBSL 4YE4H 2C3HA 3VGFA 4B0MB 2YEQA 2G75A 2WCGA 3F64A 3FQYA 3QSKB 3T4YA 4HUXA 3QUGA 2OS7A 2Y1ZA 1HE8A 2I07B 2YK1H 5FIEA 3EJTA 4F3FB 1L0XA 2VDOL 4G59C 3QWQB 2YD5A 4JDZB 1YNTF 3BO8B 4DQAA 2AC0A 3TS8A 2EIZB 1OM3L 5JO5B 2VYRE 2IDFA 3BUPA 1GOHA 1V3JA 4MCYB 2ZP0T 5TE6H 3DX1A 3FB5A 4KK8D 1NIAA 1HYSD 3N50A 1JWUB 3P3RA 4MNGB 3ZOAA 3HC3L 1B2WL 2A9DA 1XCWA 4YBLB 5IIEA 1YN6B 1KXVA 1NPJA 1T4WA 3UCRA 4EI0A 3DHMA 3H2QA 4QR7A 1MLCA 3CFMA 3SPCA 3FN0L 4DKEH 4ZUVB 1KEMH 2Y23A 2QPDB 4PIBA 2E9JA 4WFHD 4X0NA 4U1MA 2W60B 4KAQH 2C4FU 2CDFB 1P9MC 3FUJA 3RKDD 4NP4H 4PVLA 3ZZQA 2G2NA 3T77B 5FB8B 1ASOA 1O6TA 2WW8A 3VFSA 2DQ6A 1KIUB 4I89A 4EUPH 2DB8A 2MCMA 5I71C 5JUEL 3T3MF 4ZX4A 1N7ML 1N0XH 3L3OA 4IBQA 4KTEH 5EC1A 2FVNA 4O9HL 1M2VA 1SN5A 3LPFA 5HP5A 4IIQA 2UUDK 3QUMH 3FQRA 5C09E 2W95A 1AY1H 2R69H 3DV4A 4J6IA 1USQA 2NUPA 5I1EL 1XCTB 4X9FA 1PY4A 3IK2A 4PLJD 3D3VD 3TCTA 3P1VA 3HJ0A 5IB4B 1DLFL 1I9RH 3HUJE 1E28A 3D3VE 4OQTA 3AITA 1TDQA 4R7DA 4UTBA 1RI8A 3Q6GH 2WB1A 3V7AG 3DHUA 5CUSH 1P1VA 2VDPB 5IW1A 3MRGA 1GTNA 4OJEH 2IIJA 2K8QA 5J6SA 2G9KA 3ORJA 4HULB 1VACA 3U82B 2RMNA 2V7HB 5C0DA 2PP7A 1ULVA 1NICA 1TFHA 4CILA 1WAAF 3ZTJH 4F1SA 3QO1B 5MEPA 1OCZB 4UT7L 4D7PA 2P5EB 5F9OH 2J44A 4GG6B 4HWEH 2WV3A 3MRCB 5DJZA 5AWNL 4F8OA 1MUJA 2VXQL 2XN9D 4N2CA 4FZ8L 4Z3GA 4PLKC 1X9RA 4ETQA 1M1XB 4B9FA 1KTRL 1S5HB 2HJLA 3A6OA 3PPSA 4CSSA 4OI9A 1PZBA 3FQNA 4GLRH 5G4OA 1XF5B 1KCUH 4PP1C 2EYRB 2ZOOA 3K6SB 3TF4A 5G4MA 4Y1AE 3IDUA 4EN3C 4LSDA 2CRYA 3KJ6H 5HDWA 5I1HH 4WFFD 2QFPA 2H32B 1NPUA 2BZCA 2JB6B 3OKDA 4FQ2H 4XRCA 5K9QG 3O4LE 5DUBB 3J27A 5BZXA 3QPXH 5BOPA 1NGYA 3M45A 1MAKA 3PGFL 4KHTH 1CPUA 2W92A 2X4QB 3UC0H 3W9DA 3KCPB 4TLKA 3P9WB 4CBPA 1J8KA 1EA9C 1DJZA 2OL3A 4LPXA 3BVXA 5JZ7C 5L8LB 5EBMA 1WAEA 1D5RA 4XPBH 2WMPA 3SDCB 1T5WB 5H35A 2RAMA 4DPRA 1GGCH 4LGSB 1F6AB 4Q7DA 1AXSB 5GXBB 3JWDH 1IM9B 4Q74A 3MNVA 4DQOL 1KFAH 4E5XG 2WBWB 2WXIA 1BFSA 5BZDA 4P23A 3VI4A 3CHOA 4NQSB 5AG9A 3AG3B 3EGSB 3B9KB 4JFFB 1JP5A 2R15A 4HCRH 1G1OA 2PW2A 3T65A 2WBJD 3SGDH 2E46A 2VQUA 1A65A 4LDOB 4LVHC 5DO2C 2GK2A 4GT7A 5HI5C 1CZ8H 1RU9L 5IQ9A 4PG9B 4PR5B 4K5MA 2A73A 4RA3A 2OMTA 4PLOB 4YZFF 4QRRE 1CGXA 1EFXD 1TJHL 2H26B 4LCIL 4X9BA 1C12B 5T1KB 5CR1A 4FXGA 4U05A 2OX5A 3QEGL 3TNNA 4QXGH 4B9IA 1AANA 2OYKA 2VDKB 3GSVB 4Q0XL 3VFUB 5JIDA 3NJNA 1DL7L 4NNXB 4B9JA 4EI5A 3AUVA 4MD5A 1PW3A 1L0QA 2IANB 2J6EL 3DXAE 4YHPA 1I9EA 1XEDA 1WUZA 4GRWF 4GBXB 1E4HA 4GKOA 2VOTA 4GRWE 3VA6A 4UQEA 5GZOD 4NLAA 3BQUB 2Z4QA 1UB5B 4M1GH 4K94C 4HMEA 5CD3B 3FU0A 1UJ3A 2Q2LA 2CUAA 2H1LM 1I9IH 3OKOB 1C7SA 3V4UL 1OW0A 4I3SH 3ULAB 3ROLB 2ESVD 2WYIA 3N85H 5LNGA 3SJVB 4G8EA 3APNA 1WPCA 2EDOA 2VDML 2W0FB 3OF6D 3KLQA 3ZJAA 1MKFA 2BXYA 1MJ8L 4UOW1 5E4AA 5HYIA 3D2UD 4OQTH 4F92B 1CDUA 3B2VH 3C9NB 3T4AC 3H6JA 3L3JB 3C9NA 4WI0A 3F65A 3NUKA 3EBIA 5E4EC 4F93B 4G6AD 1S6NA 2MCG1 2BOLA 4LARH 1I1AA 2BIIA 4F8PA 1JWMB 2Y5EA 3MJ9L 1KLGA 2WK2A 2PMZA 4TNGA 3D85A 5C0BA 3TTSA 2CSPA 4ANKA 2XWBA 1QFUL 4LSVL 1ZVNA 1PBYA 4KGLA 2YRBA 2L0DA 5EO1A 3RWHA 3V5KB 1QR1A 4D8PB 5C2UB 1MPAL 1X6LA 3OC5A 4IYKA 3A21A 5B4MC 4BFIA 3VW3H 4NS0A 2H3KA 1AGDA 5D6CB 2VLJD 5HYJE 4H25A 2CO7A 4GW4A 3F04A 4YHMH 1QSEE 4GI9A 3RUGA 2EICA 2IPUK 2F53D 4TNVK 4QCIA 5HI4D 1ACYH 2N7SA 5AAMC 4B9GA 4YLCA 5GGQL 4Y2NA 1RLBA 4G1EB 4KI1A 4O2CA 1LE5B 1R9FA 5IQOA 4RISL 2L04A 2DIBA 4DCQB 1DR9A 1OPOA 1JZDC 3Q01A 2P24B 4OBRA 3NQKA 3K7UA 1LNUB 4XPAH 1TQWA 4FZ8H 3DX0A 1U3ZA 4XBPA 5TFSL 4DAGL 5FAAA 4NN6C 1IC4H 1EHLL 1TIUA 4KO7A 1NFIA 2FJGB 5CJ8A 3CC5B 2O6PA 3OMNB 5INDA 4NI6A 4IW4C 3EH4B 5EBLB 1G0YR 4K3HA 1FL6A 4JM2F 3QPXL 3SN6N 2WQXA 1RK0B 4N6RB 1N18A 1WWAX 3PHQA 5DMYA 1EZSA 2YGOA 1UCBH 3MNWA 5F7AA 1M7XA 1TLKA 2YMOA 4MNQD 2VWEC 2IV9A 5ADOH 1S9WA 4EDWL 5I0YA 1AACA 1EDQA 2YWYA 4N2KA 1AXIB 3SCMC 2E8YA 1WD8A 1AO7B 1GMEA 2EUWA 3BZFA 4GAGH 3FTWA 4AGQA 2KKQA 4ONOA 4Z18A 4OCMC 3QUXC 1FYTA 5PAZA 4UQAA 4N24A 4MBRA 1UFUA 1QOKA 3FT1A 4WI7A 2EYTA 2EIDA 4OGAD 2ZONA 4RAHA 1D3CA 2VLME 1ZLUH 5ACLA 1J9QA 3LKOB 4JKMA 4KJPC 4E5XA 4UAHA 3NBNA 3QB7C 5D7JA 4JHWH 1IQDB 1P6AB 4GMTL 1YLBB 3QXVA 4NQTA 1YEEH 3QPKA 4ZYKA 3HE6D 1WD9A 3OKMB 5LGJA 1HNFA 4LDEB 4OLUL 4R4BB 4JO1H 3L5XH 1AP2A 4NWTH 4AEIL 2QR0A 2GAZB 4DGYL 3AADB 4BIKA 2AQSA 43C9A 4TRPH 1AD9B 3N91A 5GRXG 5I17A 3DUSA 1FIEA 1AZZC 1DL7H 4Q52A 5DFWH 4X80L 2C26A 4JJOA 1IM3B 2VC2L 3QG7L 2ZQKA 4MZRA 3UX9B 2HFGH 2GB2A 1LMKA 1RJLB 3IDJA 5E8PB 5IMKA 3ZW3A 4HC1L 1AOZA 1A7PH 1J8HA 4ENEC 5JA8B 2ZCHL 5EZJB 4U6TA 4F33B 3KPRA 4PJ5A 3L6FB 1CLZH 3Q9QA 1F4XL 1U3HA 2XN9B 2N59A