1BYNA

Solution structure of the calcium-bound first c2-domain of synaptotagmin i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
b'EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SYNAPTOTAGMIN I)
publication title Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1998-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1bynA00
4NP9A 2WXRA 2WXGA 4GB9A 4OVUA 4WAFA 4XZ4A 4EZLA 2WXQA 4URKA 5JHAA 3F05A 2WXIA 4PS7A 2ENQA 2JQZA 4DK5A 3GPEA 1E8YA 4LDCA 4IHBA 3JZYA 2CHXA 4MJJA 4Y1TA 1RLWA 2N1TE 3L9BA 1BYNA 3TWYA 1UOWA 4PS3A 4KITB 4A55A 4KZCA 2WXOA 5H4ZA 1DJWA 2BWQA 1E8ZA 2Z0UA 4WEEA 1DJHA 2NSQA 3QK0A 1RH8A 4XX5A 3PREA 2WXJA 4V11A 3HHMA 2RD0A 1TJMA 1WFJA 2Q3XA 3SD5A 1BDYA 4NS0A 1UOVA 3PFQA 3NZSA 2CHZA 3L08A 1DSYA 1E7VA 1WFMA 4QJ4B 2CM5A 3FDWA 4FLHA 4QJ3B 3M7FB 3ZVVA 5KJ7E 2FJUB 5G2NA 2QZQA 4ANVA 2WXFA 2V4LA 3LJ3A 4L1BA 4F92B 2WXKA 1RSYA 3PS6A 4J6IA 2ISDA 1E8WA 2K3HA 3T8MA 4HVBA 3CSFA 4NPKA 3KWUA 2Q0ZX 4G11A 2ENPA 2A4ZA 4TV3A 4ANXA 3ML8A 3PYCA 3S2AA 2WXNA 4NPJA 4TUUA 5H4YA 4EZKA 4FJYA 3B7YA 4TS6A 2ENJA 3DBSA 1DJZA 1V27A 1W16A 4L1LA 3KWTA 2WXHA 2K8MA 4ICXA 4JPSA 3W57A 4F93B 3APFA 2A5UA 1W15A 2D8KA 2ZKMX 3L4CA 4KZ0A 4L23A 1DQVA 3L17A 4QJ5B 4L2YA 4EZJA 2CHDA 3FBKA 4ANUA 3F01A 1E90A 3DPDA 3QR0A 3L13A 4Y1SA 3ENEA 3QJZA 1YRKA 3F00A 4BFRA 3PRZA 1HE8A 2CM6A 3CSTA 3OAWA 3F04A 4WWNA 4XE0A 3L54A 1GMIA 3OHMB 2X38A 3QARA 3HIZA 1BCIA 1TJXA 1A25A 4OVVA 4F91B 1UGKA 4FHKA 4IQHA 2B3RA 3HN8A 2R83A 2WXPA 1DJGA 3TJPA 3IM1A 3N5AA 2CJSA 4LT7A 4AJWA 1CJYA 2CJTA 2QZ5A 2WXMA 2K45A 1DJYA 3RPBA 4GNKB 1K5WA 4LCVA 2DMGA 5CCJA 4QAMB 4F1SA 4PS8A 3L16A 3W56A 3MJWA 5T8IA 1DJXA 2KI6A 4FADA 3TL5A 2YOAA 5CCGE 2LHAA 2EP6A 1QATA 2FK9A 2YRBA 3NSJA 3NZUA 4FHJA 4ICWA 2K4AA 4AOFA 3ZW3A 4ANWA 2Y3AA 1QASA 3IBEA 1DJIA 3QR1A 4WWOA 1E8XA 3APCA 3QAQA 5CCHE 3P2BA 1E7UA 3ML9A 3R7QA 4BGDA 3R7RA 5JHBA 2DMHA 4DNLA 2NCEA 5EDSA 2CHWA 2UZPA 3APDA 2NQ3A 3ZIMA 2WXLA 4WWPA 4HLEA 4FA6A 4FJZA 5G55A 4FULA 3RDJA
chains in the Genus database with same CATH superfamily
5F7DB 4W9KC 3EXLA 4JRXD 3U36B 1OAQH 3IMBA 1NBCA 3C08H 4I88A 5ICUA 3C09C 1J9CT 5D1QC 1E27A 1DCEA 2Y06L 1AIFB 3F6JA 2NUTA 1UZ6E 3G5ZA 4OBRA 5I0XA 2KLTA 3IS0X 2ZKHH 3DXAD 1IFGA 3Q9QA 3L4WA 5DO8A 3MRFA 4EOWL 1GGBL 4Z7IA 4PS3A 1MCEA 1PIGA 4KJYB 4BA8A 3TX4A 4AGMA 1KEML 1JZJA 2NSQA 4WNQB 3QWOA 3H3BC 4TUOB 1RVFH 1FFPB 2FIKA 3K5RA 4WEBL 4FHBD 4EE2A 3ZE2F 2A1WL 3BPOB 4V1DD 3PGCB 2HKFL 1KTDB 2XWTB 4KMLB 4H8VA 3ELQA 2OYMA 1HINL 3CU7A 3ZE1E 4EI5B 3FFDA 2OX5A 2YAMA 2YKLH 3C9NB 2L4OA 2NMSA 1CD1B 3D39E 4JFOA 2PTUA 4RGMB 3SDYH 3AVEA 3VWKA 4B7IA 1H8NA 4L8CB 2OMVB 3PAYA 4DESA 1SHSA 2EZ0C 1MFDL 5HI5C 2AP2A 2R2BB 2GI7A 3D25A 3SODB 4RBPK 1ZA3A 3OVUB 4NPYA 2XY2A 4GSXA 4NN7C 1RIUH 2XI9A 5HYSB 4GOSA 1WK0A 5FO2A 4ODBD 4L4TE 1PQZB 4FFZL 2QV2A 5CD5C 2DQTL 4HFWB 5C0DB 3D18A 2WWKO 5CJBA 1YJDL 2YMOA 1MF2H 4L0ZA 1J18A 2X4RA 1S9KC 4XAWH 1QPKA 4YDKL 1DBJL 1RZIA 2BO0A 3L81A 4Y5VB 1OCOB 2FJFB 4X0NA 4DW2H 1QTSA 5CBAA 2DQCL 3ILEA 3UDWC 1AGEA 5DC4B 4JBSA 2LFEA 4GP4B 1TJXA 4AVKA 4R0LC 1PS3A 5GISH 4CW1B 3BKCL 2OMYA 3WUWA 5I75C 1DJGA 2QLYA 4QXTA 3EYUL 3QO1B 1MI5A 1EFXB 3IJ9A 4DFIA 1X5XA 3PLYA 3WG7B 2DMGA 2MCMA 5BJTA 2X6UA 4K7FA 3B7SA 3FB8A 3ECVA 4ZMAT 5FO9A 4M8QB 4YEFA 2W94A 1LEKA 1ACZA 4H8UA 2WM0A 4R7LA 4G71B 4JO3H 5GGQH 5J3HD 5DJYA 3OWEA 5ELIA 3GBDA 3QXDB 2ZQKA 4WFED 3BRDA 5EU6D 3T1WA 2Z1KA 4CN6A 5D1XC 1G7LA 4I3SL 1WWWX 4ZOCA 2QADB 1T1XA 1CWVA 4Y9CA 4OZGE 4HW6A 3T2PA 2JQMA 3AXHA 3H2WA 3MV01 1RU9H 2BP0A 5G55A 4PLKD 4YHOL 2Y22A 4Q4EA 1RIVH 3O6ML 5K9OA 4L8SA 1HXYB 3LIZA 2J2ZA 2ZD0A 3KPSE 4X4ZA 4L1DA 1ROCA 1U92B 1FFRA 2VM4A 1KPUA 3RVWC 2WVSA 2EVIA 1EPFA 5HPOA 1ASPA 1FBIL 3ULVF 1L6PA 4LKXA 3VSUA 1UC6A 2AXWA 2NY4C 2VXQL 2YQ3A 1MH5B 1KLUA 2E7LA 1UA6L 2I60H 3GC3A 4P57B 1JVLA 1YAIA 3VQLA 1QEWA 4PS4L 5SWQB 3O6FC 1J5HA 4A38A 3LPPA 2OP4H 2MH4A 4GQ9H 3VXUE 3M7OA 5CIPA 4KJQC 1R24B 2MRYA 1OL0A 2BJMH 3AXLB 3D2UA 4KTDH 4EN3B 4ZTPH 2E5EA 5I8OH 3HOGA 2XBDA 1HILB 3L2LA 3QWRA 4KPHH 43CAB 4LHJB 3T4YA 5DI8B 4Z9KB 3W82A 2EDFA 4QRUA 3DDGA 5SWZE 3RWIA 2ZE0A 3NABL 3ISWA 4YX2H 3EFFA 5EU5A 1H9VA 1K4CA 1NCIA 1OF0A 2ZX8A 5FGSA 5F9OL 5BW7A 5E51A 2GUYA 3SGKA 3UYRL 4M61B 1AD9B 3APFA 4P59H 2P43B 1HCZA 2AJ3A 3QCVL 3FFCD 5DQDL 1IQWH 2W0FA 3KD4A 4NT6A 5AVQB 3RX5A 3D6GA 2BXYA 4MVBD 5TDPA 4I4WB 1RURH 3C6SB 5JORB 4J8QA 4OM0H 4PJDB 5ICZB 2AS5M 2QQKH 3MLVH 4HSAC 1JZEA 2TSBA 4G1EB 3EG9A 2CJSA 5KSBE 3P40A 3UTQB 2JNZA 3MHZA 4LZKA 3EO1B 4ZW5A 2NUTB 4AL8C 1JCVA 1IU1A 5DJDB 2IANA 5E4EB 3V52H 3W9DA 4AUYA 4N2LA 3MRFB 1P4IH 1QLFA 1XTLA 2JKLA 3L7FB 2R39A 5E6SB 2DIEA 4HKJB 3K81A 3PG2A 1S7VB 4IBYA 4D3CH 1MVUB 4PJ7E 5CM1A 1S7RA 2M26A 3QWOB 4ATTA 3TT1L 1YEHL 2FIKB 5C08E 2G3XA 3LEXB 4Z7QF 5HYQA 3HN5A 1KCVH 1F5WA 5FGRA 4GLRI 3MA9H 4ZUWA 5HI4D 1UADC 2R23A 1NSNH 5KZCB 2WNXA 4GG8B 3QJUB 1B0RA 1NKRA 2MCPH 3S8GB 3FFDB 3FMGL 2I9TA 1OTSD 3QBTB 3QW9A 1UM6H 3RZCC 3JWDH 4MQSB 3LS5L 1G1CA 3MRPB 3N44B 3STLA 1KFAH 1BYNA 3NSXA 1NZRA 1UOWA 1H5BA 3D25B 1CXFA 1XIWB 3V5KB 1LEIB 5CMAA 2Z0UA 3N41F 3TA3D 1IC1A 3D09A 3QXAB 1J1OL 4NZTL 4XAKD 4DPRA 3TZVA 3BQUD 1BVLA 2MEJB 2YAEA 1B9KA 5L88H 4JDEA 3RQ3A 3S36L 1IGJA 4YHPB 1I31A 2A83A 1B9ZA 1BQRA 1O7DE 3CBJB 3UPRB 2X4RB 3BN9D 1BQKA 1WHOA 5JZ7D 1QUPA 1RZIB 1UCBH 2X4OB 2FBRA 5CBAB 3U9UA 5T5NF 4PCYA 4FFYH 1CS6A 5K9QG 4F2MA 1T21A 1NGXA 3NIFF 4UQBA 4IRZA 2HVBA 3WUWB 5E9DE 4N8PA 3KCPB 3MRBA 1YC8A 4QXTB 3TEUA 4S1SL 3OMIB 4Y9FA 1MI5B 3KWTA 5F6HI 3MLXH 3RB7A 4FFWD 3ABGA 4GUQA 3L4CA 1WE5A 1EO8H 2ZWKA 1I7RA 5BJTB 3O3EA 4K7FB 5FYJE 2KPWA 2YMXH 2VLKE 4PRHE 2AHIA 3FOMA 4K4KA 3SYPA 2CE6A 3SJVE 3W5MA 1PZBA 4YZFF 1KBGH 1LEKB 1U8JB 5DJYB 3RAJL 1IFHL 2AF2A 4NQCA 1UJTA 3HE6A 3MRJB 3Q1SL 4TTDD 4U0RB 3BD3A 4XN9A 1MHPL 1Q1JH 1G7LB 1FFNA 4A7GF 4PJGA 4NAMA 2WQWA 4IW4C 3HRPA 3QI9A 4OVVA 3D1MC 3ZZSA 3FU6A 1LQSR 1N64H 5E5MA 5JW4Q 2YMTA 1A6AB 4L8SB 1W0WB 4XC1L 4LT7A 3WDJA 1O9WA 4DK6A 1FVDB 5ETUA 2WXMA 1KPUB 3SDAA 5CF3A 5GRWA 5EA0H 1OY3B 2NY5H 3CN1A 2BSED 1IGIH 3PIQA 4HC1A 1N0XH 4M1GL 3SBWC 3BIBX 2H9GA 1OHZA 1A7QL 3FF7A 3QHZH 2Y3NA 5EF0A 1OD9A 4ANWA 1QEWB 4GAGL 4OCSL 2OMTA 3K6NA 4Y16C 4AL8L 3PWNA 5CIPB 4ZZKA 1HOCB 4NLHA 3AS2A 1JI2A 4JZOA 4OZHA 2BHUA 4APQA 4HU8A 1EAOA 1YY9C 4NUJA 4XP5L 4HF5H 3WHE1 1AY1L 4HCGA 3UTOA 1J0KA 3B9AA 5E7FA 3RDJA 4DUWA 4S2SA 4E68A 4G43B 3RTQA 2XCMC 3T4YB 4QRUB 5E00B 4KTEH 2AXGB 2D3VA 3IDGA 3EFFB 3GPEA 3JBG7 1WIPA 3GKWL 1K4CB 5K1VA 1LK3L 3K6FA 3P9WB 3FHAA 4W9CC 2HVKB 4X6CA 3RUGF 2HFEB 4QRQA 3MYJA 2GBAA 2VERA 5TE7L 1ZRUA 3CFJA 3RYMA 4HKBA 4P4KC 4Y2DA 3HHMA 3P0GB 1WAAF 5J6SA 1U8MB 1AIZA 3QNYA 5EOCL 1FNAA 3QG6A 5IB2A 2LU3A 3FUIA 1UWGH 2Y6TE 3GSWB 5HGHB 3L08A 4CL7A 4K0OA 2W0FB 3FT0A 4P3CL 2DQIH 3S6CA 2VDKL 2P28B 1H3TA 2D0GA 3EHBB 4WW1B 5H94B 3CCHA 2L7EA 4HWBA 3TO2B 1SHMA 2J88L 2BZCA 1JXDA 1DJSA 1R3LA 2B2XH 5TDPB 1KCRL 3ATFA 3KWUA 3E8VA 4U1JB 3ATDA 1PSKL 3GHBH 3LXAA 3O0LA 4IOSD 4O2CB 1JS4A 2DQUL 3UTTD 1LE9B 3MYZA 3EG9B 1XR9B 3VXRE 1KGJA 4N0CD 5E08H 4K23H 3WN6A 2VQ1B 1G7PA 3S3DB 5JOEA 4QHPA 4OT1L 3ZQ9A 5DD1H 3SE3C 3WFDL 4XNBA 2IANB 4GG6A 3W9DB 5DUPL 1FYTD 3AC0A 4LSSH 3DJ9A 5FHAL 4M7JL 4XC3L 4X9GA 3PUUA 4JB9L 1VGEH 5K33A 2GEQA 2X2UA 4LMQE 4WWNA 4R5VA 5KVEL 4PY7A 1HYSD 2AMUA 4ZMYA 2DQFA 3T08A 5HYQB 3EJRA 1MAML 3EIFA 2XT1B 4XR8C 4KKBC 2R23B 4HJGB 5I71B 3LZFH 3LS4L 3LMJL 4LLMA 3NJFA 1A3RL 4TYUA 2WAHA 5CCJA 1T6WA 4ERSH 3UZQB 1ZHBA 2EKSA 2ITCA 5BOZG 4KK5C 2YJLA 3PHQA 2EXSA 4PWHA 2Y7MA 3STLB 1EXUA 2WSDA 5FM5M 4M48H 2HP4A 3NIGB 2Q1EA 3HTLX 5F1SA 3M1OA 1A6TB 5JPMC 4YSPA 4N86A 2O26U 3LNGA 2UY6A 3TZVB 3ZT5A 1BVLB 1IC7H 3JXAA 2UZPA 1HHKB 2K9FB 5DDHB 2Q76A 3D39A 3UAJD 1TQUA 5AW4B 5KYUA 1EAPB 3QUXB 4NKDA 4B9FA 3PDGA 3REWA 2F54D 3DX8B 3GZKA 1LP9F 3G6AB 1WLHA 3AT9A 3HI6L 5BV7H 3U9UB 2Y23A 1SLUA 5IVXE 3I3EA 4G8EA 2J12B 4IHBA 3RJDA 4YDLB 4N2AA 4MHHG 1T21B 2AVFA 1NGXB 1NMBH 4PLJC 5TQ0H 2L0DA 3MRBB 4RFOH 1FH2A 1TVHA 5D1ZI 1NTDA 2FATL 3FSZA 4CNIB 4PSRA 4MXVE 4UDTA 4Y4FC 3WKQA 3O3EB 1U30A 3LNEA 3U1SL 3G5XA 4CKVX 4YL4A 4J6RH 1XF5A 3WSQH 4YJZL 1E4JA 3IXTB 3K2UL 1EEUA 2F53D 3UPAA 1XCQB 2BOLA 1DYZA 4JFXA 1NOLA 3ZU8A 3OPZL 3HE6B 4U31A 1P4UA 2FH6A 1FFNB 1WFOA 3CV5A 4JNXA 3QORC 1AQMA 3HHSA 2NY1C 4JO4H 1D5ZB 5E70A 5E1IA 3H42H 2PPFA 4GY4A 3MLPA 4ZMLA 5EIIB 2YBGA 4WF7A 4RISL 3SDAB 3VDCA 1WTLA 2EE0A 4YE4L 3PIQB 2O61A 3EJQA 3BT2L 3TYFB 4EN2A 4JY5L 3TN0B 4XNZC 1GVIA 2VR3A 4OZGA 1ET5A 2JVUA 5EH1A 3CFCL 1T20A 5E8OA 3DETC 2VRKA 4GBXA 4FQHA 4F9LC 1IQDB 5FO7A 5KBMA 1WFNA 4OZHB 4APQB 4IRJD 5I73B 1NCUA 3KBEA 2J5LC 3T0BA 3WFEL 5IK3A 2FO8A 3SGJC 3O8XD 2B3RA 1X4ZA 3QIUA 4HP5A 3ZDYE 4PJ5A 2X87A 1QQDA 1AR2A 5B3NA 3HC3H 4OLZL 1DQTA 4WFEE 4DKAA 2IGFH 4JFEE 3VFPB 4HBCH 4XRCA 1FAIL 4DP6X 5EWIL 2LHAA 4Y1AD 2IO5A 1X44A 3FN0L 3PL6D 1R5WA 4DGVL 3ZKMD 4WKZA 1AQKL 4QRRA 2PO6C 3RVVC 4HKBB 4Y2DB 4JFWA 4TL4A 2VDPH 3E38A 4TVUA 5SWZA 4AE1A 4YHYC 4KX9A 3GDBA 5IB2B 2WZ6A 1MRFL 4YWGL 2DLIA 3OR7B 2WQUA 4G5AA 5J6HB 3KH4A 2WXGA 4Q56A 3KEHA 5A43C 1QP1A 3MRHB 2RBLA 4IM8A 4AQ8A 3L3JA 3QXUA 1CU4L 1R3LB 3NN8A 3C87A 3VCLA 5B8CA 1TFHA 3B7UX 3M8OL 2X4TB 2NW3A 2V17H 3CSBA 4E9LA 4PJCF 3WXVL 3WTVA 5JYMA 2ZXAA 5E2VL 4JQXA 4AUUA 4NS0A 4GG6B 4YBQD 4RMVA 5GZOD 4PVLA 2ZONA 1IAIH 3G5YB 4WI7A 5F21B 5D7LE 4HALA 2C3HA 1Q72H 4JFUA 4M5YH 4DGIH 1CLYH 5CJOH 3LHAA 4YK4C 2ICCA 1XBDA 2W65A 4CSTA 5EZLA 2Q6WA 2VXSH 3VRJB 4MLIA 3ML8A 1ZT7A 1UG9A 1FZJA 2V3DA 1XGQB 3V5DB 1RUML 4FKKA 5LKNA 3RVTD 4M6AA 2BM3A 4LLMB 1U6AL 4IKKA 3VI4F 5J56B 1DUYB 4C56E 2L8AA 4HX1B 4TNGA 5F93C 1ZHBB 4PJ7A 2C9AA 1HHHA 2IAMA 5C08A 1EXUB 4JGJA 1B3IA 2UYLA 5T3XH 2DQEL 2Y25A 3DUSA 3IMWA 4NZUH 5AVXB 2IMNA 3WMPA 4AYDC 1ANUA 2FRGP 3QO0A 3MCKA 2UY6B 3TV8A 1CIDA 5I0ZA 3QIBB 3F04A 4JZNB 1PF3A 3L54A 1C7SA 2Q76B 2APFA 2IGLA 1QOKA 1FDLH 4CU8A 1JMZA 1DSWA 2XV2A 4TF4A 3H3PL 3REWB 1L9SA 5DRZA 4HPYL 4LK4A 5JHDD 1Q8MA 4UTAA 1GIGH 3KS0J 1FFQA 1QSEE 4MNQD 1G0YR 1RP8A 2E47A 3FO0L 4PRBA 4NQED 3GPSA 4Z78A 1JYXA 4O02H 3W56A 4KQ3L 1G9MH 2KI6A 2PW1B 2WGNB 1FCCA 4GXUN 3BVDB 3HUJE 5AZ2L 1JZ6A 2K4AA 3HC4H 4H13C 4I3GA 2XA8L 1IX2A 1TVHB 4ZUVB 3F8UB 4X9HA 3E7JA 1GTFA 4Y2LA 1TQVA 1HAWA 2F7PA 2H2SC 5KVDL 1CGSH 3RLSA 2XG5B 1WTGT 3WKNA 4QHNA 3VGDA 2VISA 4PGCB 1DVQA 3BVXA 3MV11 2L3BA 1P9MA 1Z5YD 3P30L 4NNYA 4ETQA 2DQJH 5CJXC 4B9CA 3PAZA 4GSQA 1K8DA 1HJBC 4XAKE 2OMNA 4V33A 3HHSB 2YSTA 1TZGH 2R2HB 4WWKD 1KTRL 4XO8A 5L2KE 3SJVA 3ULUE 2G9HA 1RHHA 1RULL 5HHME 4LKCA 1AYOA 3B2VH 3GRGA 1UURA 2VLJD 4OZIB 1SBSL 3S37X 4ELMF 4OLUL 2ADYA 5CZXC 5BZXA 4OM1L 3WFCH 1T20B 2Y36H 5E8OB 5DD5H 3JTTB 3HFML 1CDUA 2GK0A 1KGYE 4ZUTB 4N5EC 2EUWA 3WEOA 2AJVL 5GGSA 5FO7B 1JVKA 3AY2A 4KI5F 2Q3AA 1KG0A 1G1OA 4GAYA 4NC1E 4OTXH 5HDOA 4BUQA 4CRPA 4HVBA 1RQ5A 5JW3L 4I18C 5ID1A 2QVFB 1MVYA 2KT6A 3DMMA 3VXPA 1NAMB 3HI1B 4PGZA 1Q90A 4PJ5B 3VRLE 1QQDB 2K8MA 1T0NA 2DLFL 3GSXB 1RFDH 1PEZA 3I02B 3BW9A 4M7ZC 1MHHB 1G7QB 1O9ZA 4J3OC 4X5RA 3KLKA 4ZODA 4AQ1A 3RE0A 1BOGA 5CGBA 2A0LC 2I5YL 4PCSA 1CL7L 4BWWA 1JUFB 2A73B 2EUXA 1R5WB 4X6EB 1M57B 2D4FA 4Y4KB 4YN3A 5A1AA 4QRRB 5C9KA 1Z5HA 3OAWA 1ZV9A 1EBAA 4FCAA 4QY8A 3FTXA 1DQKA 4B9GA 4G8FB 1OPGH 3O2VL 4DHLA 4NDMB 5KBPA 4U2YA 3PQYA 3NJXA 1EHNA 3JTSB 4PRNA 4Q4IA 2V2TA 2KPNA 3LVEA 4DN4L 2X10A 1JGDB 4HIEA 3RPIB 2ED8A 5SWSE 4UM9B 2MJWA 4PYGA 1DVFC 5J13C 4QYOB 4L1HA 2R29A 5D5MF 3RWDA 1R3KB 4JCMA 3L9RA 5G4OA 1BG1A 1RV6X 1AOHA 2X2HA 3D9AL 1NCNA 2IH1A 4MA7H 3FB7B 5FECA 3C6LA 1DZBA 3BPLB 5JHBA 2R9HD 4YQXL 4AJ0A 1SVZA 4FTVE 3WJJC 1J11A 4GSUA 4R96A 3QUMB 2CBTA 2UXVA 1QD0A 1ZGLP 4TNWK 5IM7A 5EUKA 3WTTA 2E6PA 3EDKA 4FI8A 3ZDWA 5DRXB 1GOGA 4W68A 3VXRA 4ONHA 1NGWB 2BOCB 3QJOA 2E8ZA 3QUKB 5F89A 1E8YA 5EZLB 2Q6WB 4JFDB 3GUTA 3IU4L 3PJLA 1YAZA 4Q6IC 1ZT7B 2ENYA 3KDPB 2KQMA 5IQNA 5CZVH 3VWJD 4OCNC 1U8OA 1TQTA 1ZHLB 3S2CA 5FYKE 1O7VA 5AYUL 4YLCA 4XX5A 2WYZA 1GMEA 1FNHA 3H54A 2IAMB 4K3EH 4ZXBA 2NXZB 1ZT1B 1PG7X 2J71A 4JG9A 1EJOL 1U8LB 2UYLB 1QFWM 1L9TA 1XQ4A 3BZ5A 3NAAH 3QQ4B 4YXKL 2J6WA 7FABL 3LEYH 4KK8D 3NSCA 1UXSA 1AZRA 3TNMB 2WBJA 4R8WL 2YARA 1YPZF 3TFKC 4A7VA 1W72L 1N8OE 5D71L 5KJRH 4P46D 4L9DA 1LWRA 2QFPA 1RXLA 4Y19D 1MHCA 5DRZB 3BPNC 4Q9CA 2AQ1A 1BPLB 4O9HH 3QIWC 5DYOA 5AOJA 1JV5B 1VACA 1AKJA 5C09B 2XXMB 2CDEA 4I5BB 4PPTA 4JFFD 1TQWA 1SPDA 4HXAL 4JRXA 4PRBB 5HHNB 2C26A 3GSNA 3VFOA 3GK8L 1MFVA 3CFIC 4ALAH 2WMPA 2WOYA 1X5GA 4HUXA 4QTFA 4EZJA 1UWEH 4HUUB 1CUOA 4U3SA 2QGBA 4QRFA 3DXAA 3MBWB 1JAEA 5K9KA 3F2LA 3NCMA 4BKSC 2F68X 3FYIB 3BJLA 4BRVA 3EJJX 3UBXA 3LB6D 3WDHA 3RY4A 5L0QB 4DQAA 5GJTH 3BSZA 2HLAA 3ULVH 1ZXKA 2ZICA 1N19A 2Z1PA 1I9JL 1KJ2L 2VLRD 4AQZA 2APSA 3HPJA 5DURD 5IG7B 1HL9A 4ETQB 4A68A 4V1DA 4JM2C 1ZANH 4MBOA 1K8DB 1KYUA 3X1FA 3O2WH 4CGUB 3QZNA 3ZGHA 1H6EA 3CVIH 4Z7UE 1MWAH 4LHUD 1N8ZA 4FADA 1K8IA 3C2AL 1SYVA 5E2TL 3LZPA 2VDRB 2B4CH 1VFOA 5C0CB 2G9HB 3L5JA 3NK3A 1Q0EA 3PV7A 1LO5B 3NBNA 2F54E 3NJVA 1N3NB 4LSUL 4ODUA 4Z7WB 3R7RA 4RCAA 3SPCA 2D31A 1UYWH 3GINA 2VXTL 4U1KB 4TLTA 3TIDA 3V4VA 1J05B 3D52A 2GK0B 3O0RH 4IBTA 5I74B 3BIAX 2A4EA 5GGSB 1GW6A 2I07B 3PP3K 1KG0B 1SDDA 2BRRL 4GAYB 1FWXA 2AABH 3BFQG 2X42A 1HYRC 1UEYA 1CURA 3KPOA 5JOFA 2IPUG 1FNFA 3FK3A 3OQ3B 1WQVT 3N85L 2NY0B 2Z31C 3QPQD 3R06A 5HD8D 2XQBH 1RUQH 3BW9B 4FP8H 3GIZH 3N6YA 4AQ1B 3ZHNA 1XDTT 1BF2A 4B96A 1BVNT 4AW4A 1OSPL 4I2XA 5BXFA 4LL4A 4XBGA 1N4XL 4WEUD 4OW6A 5HTSA 1IGCH 4JVUA 5AOZA 3GSRA 3IKCA 4FQPA 4XP6H 3TESA 1T0OA 2V7HB 2WXKA 1RSYA 1NMAH 1T22B 4QY8B 1RLBA 3KHQA 3UIZA 1MWOA 3CQQA 5EU6A 5GS2H 3T0VA 4WKXA 2QSVA 4BFIA 3PQYB 2ZUYA 3T0DA 1ZHNA 2V8MA 4I48B 1H3VA 4GP5B 2CQVA 4UYPA 1CLZH 1C1EH 1UWFA 3WTWA 1RJZA 4JFZL 1NAKH 3QEHA 3UTPE 3OD3A 1A3ZA 1M7DA 5GGRY 4WUUB 1KB3A 4QXUH 5FUZL 3RWDB 3QFJE 4LBEB 3L9RB 4JJ5A 5FFGA 3PP4L 3RJOA 2NX5B 3C6LB 5K39A 1HWWA 4WW2A 3SKMA 3EH2A 1MJUH 1KLFA 4PV1C 1QSFB 1NGPL 3F5WA 4J3BA 1RJYA 4XP4H 3TO4D 4R96B 5E56A 3VMNA 4LOUD 1QBML 2D03H 1S5IL 4H7VA 4UT7H 3ROLB 5IM7B 2DBJA 5EUKB 1RZQA 3M1BA 3ESMA 2UXFA 4BFFA 1LNUA 3FO2B 4FQJH 4BYHA 1JN6A 1S7WB 4IK7A 5AD0A 2VW6A 5L8JB 1X5AA 2V0AA 3FZUC 4RIRA 4XCNA 3GMOA 3MJWA 4HJ0C 2WQRA 4WEBH 5L9DH 4YC2C 1WD8A 1XMEB 3KWWA 2EXYD 5LCVH 2VDLL 5DS8A 2ZCHH 1DBBL 1G87A 1U4FA 2EIKB 1DQJA 3TBYA 1HINH 1U8OB 4X6DF 4F57H 5EORL 3R7QA 3JV6A 3HC0A 2PPDA 2VO8A 1ZLDA 2IBBA 1ZSDA 3V10A 1NLDL 5F1IB 4O4YL 4ZAKB 4ZXBB 5TE4L 4AGQA 1E4HA 1P5UC 1W0YT 1KWGA 3IT8D 1TEGA 1HQ4B 2O5YH 2JH2A 3FFCA 2G60L 5EBWA 4WUKH 3BP7B 2X6MA 3DGCR 4ADIA 1AGDB 3MLWH 1AP2A 1UXSB 2J8UE 2PXYD 4ZMVA 4G70B 1Q94A 3DJSA 1EZVX 1IKOP 4CGTA 3QNXB 3GS0A 4Y1TA 4HT1H 1BGXL 3DRQB 2Q7YB 1MHCB 1F11A 1XGRB 4WENB 1OP5K 5IBUG 4X6FA 1VACB 3QRGH 3QUYD 1D7DA 3QDHA 4K2UH 4F7PB 3PNWA 4JRXB 2GY5A 2YC1B 1Q0YL 1RUAH 2F5AL 4HIXL 4HUXB 4ZQKA 3AMLA 5DTFB 4F9PA 3OB0K 1X5HA 3BKCH 4U3SB 1OCWH 3ZDZE 3DXAB 12E8H 4L0YA 1L9OA 4QRTA 1TG8A 4RMQA 4YR6B 4NNXA 4PM1A 4KVPA 2E4FA 2OA9A 3T0AA 4IBUA 4TQEH 2DEYX 3D0LA 3P3TA 3NGBB 3UTZA 2HLAB 3B7RL 2XIIA 3SEPA 3P9MA 5EZIL 2MOGA 3Q5YA 5ESAA 3ZTJH 5CFHA 1XGYH 2VDQL 3BOVA 1NICA 3HUJA 4NNPL 4W9JC 3HPJB 3RGBA 3UZEC 4AV0A 4V1DB 4FFVD 2ZXQA 3V6OC 1A6UL 2G2PA 3QFDA 1DVXA 3QS3A 5DLML 4K71B 4LLVA 1A3QA 1K5NA 1SYVB 1SJEB 3BKYH 3TVMB 1UGNA 5T5NG 3FH8A 3SB3A 3IFLL 2BY2A 3V4UL 1UB6B 1AQHA 4YMPA 1A7RL 1EGJA 3SYOA 3D85D 1CE1H 2CLRA 4TNVK 2JKNA 2R4RH 2COQA 5ECGA 3HMXA 2VL4A 4PTUA 4HJUA 4NQEE 3LOWA 3CVHA 3HIZA 3TEWA 3CH1B 3BQUA 3WELA 1EVTC 4LLUA 3TIDB 2K0RA 1NCAL 5F0LB 2WXPA 4NHCH 5FHBL 1F4YL 1V7MH 3DX6A 4B41A 1YEFL 5TD4A 3RWGA 2FYYB 5K59F 3E3QC 1SDDB 2VAJA 3B2UD 1N10A 3SKJH 1NL0L 1VFMA 4QRPD 2X28A 3KE0A 4KKQA 1KBVA 3KPOB 3NSJA 2OZ4H 5JOFB 4AGPA 4AOFA 5JA8B 3H1ZA 2F19H 4OCMC 5D2LA 4FABH 1JZGA 5E2WH 4UAOB 3R06B 1AGBA 2YFOA 3LRSA 1FVCA 3QJQB 4OGYH 5D6DA 4CJ0A 2LQRA 1JNLH 2EDWA 1U8PB 2ZX7A 3VD5A 3VXOA 4I2XB 1R4XA 3MSPA 2JELL 3B5HA 3I84A 4XBGB 5F9OH 1XZWA 2XFXA 4FG6D 2YFNA 3BPOC 3ZTJG 4CSPA 5CCKL 3GSRB 4PSPA 2QTVA 5TQ2L 1TF4A 3AMKA 4J3WA 4EI5C 2DBLL 3MRNB 4DEUA 3WFBL 1OAXH 5EU6B 4K07A 1BQHA 1S78C 4MB3A 4RGMC 4UMSA 2AC0A 1UQSA 4BK4A 2VXUH 3BAWA 4LOEA 4Z7WF 4ODSH 2EYTB 3TWYA 3BESR 1ZHNB 2JFCA 4Z76A 4KVCH 3AITA 2XU9A 2P8LA 1DVTA 3QZWG 1TNNA 1RJZB 1E3FA 4XCFL 3QEHB 2AJYH 1SDYA 5FX3A 1M7DB 3IU3A 4MYPA 4R5XA 2XWCA 5GSRB 5KS9E 3VAEA 4K3HA 4HXBH 3PGFH 2BSRA 3S88H 2B3IA 4PJ9A 4BIKA 1ETB1 3K72A 5K39B 1CI3M 3HBGA 1JTPA 1L7IH 1CVRA 4Y5VC 3KVPA 2AMGA 5C0IB 4KUCF 3OV6A 2ZYHA 2Y7QA 3F5WB 4Y5YA 4XPHL 5IFHH 2DOCA 5IVZB 4R4ND 3M1BB 3WFHA 3DX9B 4O2FA 1LNUB 2EIMB 3WIHL 1JN6B 3HZVA 3HE7D 5C3LD 2VLME 3OSVA 4XCNB 1IL1B 3TT1H 1YEHH 3ZHFA 4YBHA 1NBZB 3AG3B 1AR1D 1SF3A 2UZIL 2YXVA 3LQZA 3F01A 3KWWB 1YA5A 4JJOA 3QPKA 3AT8A 1DQJB 1T5WB 2GG1A 3AY4A 4M8RA 1ZLWK 1ZGLB 4HWZB 4ZX6A 5MERA 4PTTB 2O5ZH 3IJYA 1B2YA 3HC0B 3JV6B 4TVPH 1GYCA 1ND0A 1ZSDB 2QADC 5DEGA 3IVKB 2F15A 3RU8L 2UXGA 1B0IA 4FHKA 3FUNA 3HN8A 1SOXA 2IWFA 5A7BA 1T1ZA 5JA9A 1F3JA 3FFCB 4B5ZA 3NA9H 3TBVA 3HS9A 3UGEA 2N56A 3P11L 2WJ7A 4TUKL 4BFKA 3W0WE 1AP2B 4MDJA 3WL9B 5HPMB 4UTBH 4IOFD 2CKNA 3E1ZA 4YPGA 3G6JE 1V3JA 3EOYG 4DPCX 1J8HB 2JKIS 1XGPA 3ABZA 4X6FB 4NYLB 4S1QH 4F2EA 4FLOA 1BAFH 3PNWB 3UTTA 3EOAA 3G5VB 3AWEA 3Q06A 1CYWA 2ZIDA 2VZSA 1RZFL 3FNKA 1ASOA 4IDJL 1JK8A 4EN3C 3ULAB 3BKJH 3OLDA 3BAXA 4JHAL 4M9OA 1OV8A 3P4LA 1N5AA 4M1CD 5AZEL 3KW8A 1FYTA 1L9QA 2IOMA 3MGTB 1EBPA 3IAGC 4I89A 1CF1A 4WTQA 1YN7A 5J57B 3LDBB 4HIPA 2DTML 5I5JA 5EUOA 5C2BH 3K91A 1MW3A 3JZYA 4D0DB 1C08A 1E65A 2XDHA 5J8OA 3ZQXA 4ES9A 3UC2A 3MPCA 5HY9A 2I24N 3DGGB 3S3JA 4DZ8B 4OCXL 5FK9A 4H20L 1MSPA 2ICWJ 4WK2B 1QBLL 2PPEA 4OIFA 4CMHB 4P5MB 2ESVE 2EC9U 4Z7OF 4UWQB 5E23A 4LVOB 1Z7JA 4NERA 4Y19E 2FX8H 4OI8A 2ARJQ 2P5EE 4NCC1 4QKTA 4LSQL 1F4WL 4EIUA 2DL9A 2IEPA 4LPUA 3X13B 4PRDA 1MQKL 2B0SH 2JK5B 4PP2A 1U9KA 3TA3B 3CVHB 2B16A 3IAPA 1H0DA 5E6IB 4H26B 5ADPL 3BQUB 4N1EA 1A7QH 2ALAA 4Z7UA 3Q2WA 3V7AG 3GIVB 2CKBA 5T3ZL 1U3HA 3NK4A 3CXDH 4AL8H 3BXNB 5E1QA 2O5XL 3DX6B 3RWGB 1GL4B 2W59A 3DSNA 2F54A 1DDTA 2F0CA 2DQDL 1X5JA 4QOKE 1T1YB 3QJXA 1KEGH 2ITDA 1RIHL 1Q38A 3AU0A 3QVAA 1ZEAH 3C60B 5E4EC 3MRGA 1KULA 5D2LB 3OKLA 3QC5X 5E5LA 3TYGH 4AEIH 4NQXA 1PZ2A 4N0YL 3QYCA 3BSHA 15C8L 1AGBB 1CIUA 4OUUB 3LRSB 1FVCB 3MV9D 2C4FU 2ZKXA 3CPLB 3RDTA 4PIRF 1UT9A 4QPEA 1OP9A 3CQFA 3GKWH 4JANB 3VXOB 2OULB 4W4OC 5BRPA 3MRIB 3GRBA 1ZAGA 2AQSA 4IIQB 4A66A 2XFXB 3MLZH 1ACCA 1E4XI 5DJ8B 2Y9RT 3POHA 4NM8L 4YXHL 5EO9A 5TE7H 1JCKA 5D1QE 1UZ8A 2F1AA 1PPIA 5FOBA 3MOQA 4GNKB 3IBOA 4L3ED 3RFZB 3A6CH 4LP4A 3EOTH 3SCMD 3RA7L 1BQHB 3QDMD 3BEWB 3P73A 1IGTB 2VN6A 4ZX5A 2X0VA 2Q8AH 4QHLA 4YGVB 2WP3T 3X3FL 2R69A 1XIWC 1JHLH 4AENB 1CFVL 1Z0MA 2BCKB 1JGUL 2R0LL 3BZ4B 1VFBB 5GZNA 1UD3A 1A1OB 32C2B 1V10A 4NM4L 4TLKA 1DQMH 1INQA 2TSAA 2AAAA 5B39A 3QH3B 2LU4A 3NACH 1AD0A 1S3KL 4LOFA 2GI0A 4Q8BA 3WIIL 1FZKA 1IAMA 4OKVB 1XB8A 5F44A 3W9EA 4F3FB 2Y7QB 5DD3H 3RVXD 5DUPH 4IRJA 4XXCC 2FL5A 2ZSWB 1C5DB 4X7SL 3SQBA 3QFJA 1IBDA 3DPBA 3MRKA 5I1GH 5IB5B 2VNCA 4M8VA 5K69A 3WFHB 4YSAA 1S9YA 4JDVB 3O8XA 4JFPA 4O2FB 4CUCA 3V0GA 3SBQA 5FGCE 4L48A 2GJPA 2YAFA 1UUNA 4UT6A 3QQ9D 2F74B 4U6HA 2VN7A 3TJHC 1KXQE 2VT0A 4YAQB 3NZSA 3A6OA 1BWWA 2CO2A 1HEZB 4PJAF 1HSBB 4M4RA 4WNJA 3LMJH 4Y1AA 4ZD3L 5EEYA 1A3RH 5MERB 4L1BA 1P7KA 4U0RC 3PL6A 5DQ9B 2ISDA 1ND0B 4AQEA 3VGGA 3X11A 3A21A 5DEGB 4MQXD 4WI4A 1RMFH 1QWUA 1XF2A 3GGWA 2WXNA 4ZPTA 2FSEB 5I19L 2H0EA 1R0AL 1TUPA 1OAYH 2XY1A 2YEVB 5DR5H 2IXQB 1F3JB 3AQXA 4L8SC 4Z76B 1UFGA 2XXCB 3MLUL 4E9QA 2EUZA 1N6QL 4N2FA 1NCCH 4GSRA 2X1WL 2DRUA 1FAKT 3LNDA 4YPGB 4AYBA 5MI0B 5ACLA 3QHFL 3ESVF 3RIFF 3VM7A 4M6NL 1AQ8A 1RZKC 1B4LA 3O41B 3MBEB 5D1XE 5IBTH 3HI6H 1EZLA 3Q43A 2P5WE 3UTTB 1JZHA 1R47A 3AQYA 4LQFL 1DHKA 2CUHA 4B9KC 5F7UA 1I8UA 4QHUA 4XPFH 1KB5B 2J8UA 5DHVA 4O00A 5HJGA 5PAZA 3IDJB 1JK8B 3KBHE 1GHFH 1D7CA 1LXMA 1N68A 1TQCB 3L5HA 2PO6D 3O3UN 1CXLA 1N5AB 1CXIA 2FATH 3MCLL 5DWPA 4MJ4A 1FYTB 3CUPA 4DVRL 3WY3A 5GZOA 3HG4A 3WLBA 1YN7B 4MCZB 2OL3H 2KZWA 4YOKA 5EUOB 4E9TA 1HZLA 2OBGA 3LEVL 1C08B 2XC8A 5E5UB 3UTSD 1ZT4B 1C5CH 5EZJA 2W9EL 5EIVA 3LKQB 4NQSB 4HYTB 2Y07L 3B9KD 3D12B 1P2CA 5BW7C 1TYJA 1JXGA 3VUAA 2ARWA 4MQTB 3R8BB 4NENA 2PYEB 2R1WA 4WSKA 4MS6A 5L4FA 5I1DA 1S9WB 3RY6A 4JO5A 2JKRM 3LY6A 2ZUUA 4JKPL 3TF4A 4WY7L 4RISH 4L3CA 3EHBC 3MRMA 1DANU 5EN2B 1FRGL 3BUDA 1R6VA 4XHJC 3CG8A 5ITBL 1TTBA 3KM2A 5F7LB 4L3FA 2HPOA 3P4NB 5GGTH 5KANI 2ZCKH 2XN9D 4ZW3A 1LHZA 1YMMD 1ILSA 3IN2A 4IDLA 3HB3B 4KAQH 2ZYSA 4XX1G 2MNUA 1RD6A 2XX1A 4NN6B 2FJGA 3N0PB 4NQEA 1MCJA 1KBWA 3T4AA 1TKWA 5LUMA 3IJHA 2QDVA 2YWYA 3LKSB 3CSPA 1MCCA 1T2QL 3MRGB 4RMTA 3WI9A 4G9DB 4O58H 3WEXA 4UILH 1NLBL 4UB0L 3PS6A 1T03L 2QSTA 2FCBA 4NPKA 4ODTH 2Q0ZX 3KPLA 1KB9K 3TM6A 2Z64C 3KL5A 1E4XH 4AZUA 1II4E 4DGVH 1K72A 5EO9B 5I71C 2F53B 3B9EA 1UZ8B 4ZFGL 1WBXB 1N5YL 4XN5A 3VFNA 5L6YH 3NQKA 4KY1H 3ECUA 2H6PA 1UJ3A 3P73B 3DROA 5EBMA 4U3CA 1J1XL 5LBSA 1ZVSA 2AJSL 1YECH 3PWJA 4M3KB 3KM1A 2Z8RA 1U93B 2YUXA 4WWKA 4A6YB 3TCTA 2F8VA 1E5AA 1RZKL 1EIBA 3TZVC 2OTWA 4M62H 4WHCA 2YAPA 3OHMB 4LFHD 1A4KB 4HCRL 2AK4E 2YXFA 1OT4A 1X9QA 2VLJA 4WK4B 3WJMB 3TGXA 4BQBA 5B39B 3QUXC 3EYQC 4AYSA 3EJTA 4PJBA 5I24A 1XH2A 1OT1A 1FZKB 3GMQA 4LEOB 2VDMH 1JXFA 1TZIA 3ARZA 4XMPL 3F7YA 4XNUL 3MREA 5BOPA 2J72A 1S9XB 3RPKA 5CXPA 4KK9C 4IRJB 4YDLC 1OAKH 3V4PB 2FL5B 2V8LA 1FQ9C 1R3JB 3OC8A 5KS9A 3DPBB 5IJVB 2DJUA 4KNTA 5GHWL 3VGAB 3O8XB 1H3UA 2QVMA 3P0YL 4JFPB 4MMXB 1VADA 1EHKB 3H3KA 3DO3A 3ZIMA 1XR8A 2CR6A 4FNQA 4FA6A 2YK1L 4HS3A 5IHUL 2ATKA 1BZ9B 4GAFB 4M4RB 5CJ5A 1JTTA 3Q2VA 3FH7A 4Y1AB 3ZE0F 4UF7C 3ECQA 4NP4L 2DWDA 3HE6C 1V55B 3PL6B 2V9QA 4HS8L 4QR7A 4B7LA 2PW2A 2VC2H 3KXFD 3IDUA 5GJSL 4BXVA 1F86A 1TLMA 2PPAA 2ZG2A 1MCNA 4ZPTB 3R8QA 4AZ8A 4R26L 3CFUA 2CIKA 1U2HA 3CBKB 5DFVC 3O11B 5MEQA 4QUOA 3II1A 5DHXB 1UT1A 5F7AA 3SDAC 2O72A 2RD0A 4FQIH 4MSWA 5I30L 2FB4H 3O3AB 5KN5A 4IJ3B 1SXSA 4LGRB 2LVEA 5KVEE 3F64A 4BFOA 4F7KA 3SDDA 5I9QB 2GJ6E 2JCWA 3BWUC 1QI4A 4FYRA 1JD7A 1EVUA 1U3ZA 1FPTL 4KKLC 4X7TB 4APQC 2NYKA 3EADA 4KQ3H 2LLLA 3K0WA 5AW5B 3W0WA 3LN5A 5I73C 4XBPA 3K1KC 4HZLA 4M7LL 4MS8C 5DMKA 4Z7VB 3QR2A 5A2FA 3FOLA 3G6JA 3K5SA 4UQAA 1PKQE 2OSYA 3DOSA 2JV6A 3ATBA 1F00I 2VABB 4JFSA 1GGCL 4PRID 1TR7A 1P7QD 1KDIA 1PZCA 3EFDL 4YFDB 2G3NA 4KKZA 2EDQA 2LAGB 3Q2NA 4L2YA 2BVUA 2B1OA 4XB3A 2TRHA 2VDOB 5D1ZD 4CJ1A 2XYBA 3BUYA 3P02A 4LO9A 2X4UB 4BXSV 1OB0A 4NZRL 3VWJA 1CGYA 3X12A 4Y2DC 3V8OA 5DRWA 3V79C 2Z6FA 2BS8A 2QHLA 1K2DB 4YHKH 3NCJL 4FFZA 3HG1D 3RP1A 1CE6A 4R90L 3UJIL 3QDAA 1GZQA 4PS8A 3QEGH 3WO4B 2ZUWA 3LD8B 5T8IA 4X9IA 3TIEA 1G0XA 5EOCJ 2A6IA 3IFNL 2ESVA 1HKFA 2GJZA 2W8CA 4F5CE 2ID5A 3IMTA 2QVTA 3BH9A 4Y19A 2GHWB 2CAKA 4TMPA 1X5LA 5JHDB 5GS1B 2YLKA 3V0FA 5IVNA 1SJHA 2OTUA 4R5TA 4MNQB 5IUCA 2NR6C 4KKCD 2FJHB 2XZQH 1I85A 4HLEA 3VFTA 3VYPA 1TKWB 2YD7A 4ZPVA 1T5XA 4F7EA 4XPAL 2J55A 5IMOB 5KSVA 2X7LA 3LNIA 3D3VD 3WEXB 4FERA 3VXMD 4XNXL 3IMSA 3T2OA 3TF7C 4FXGA 5KG9B 4N90D 4YGAB 4QOKA 4C58B 2OK0L 2VL5B 1YQVL 3DIFA 1BBDH 4FXKA 3ECWA 5D6CA 3MOAL 4KY2A 1J48A 3TFKD 3FO1B 4TNFA 5HGAB 3IFOA 4PG9A 1DLFL 4MCMA 4KDVA 2CJUH 3VFNB 3WTXA 1A9BB 2CMRL 3U2SA 1B88A 3O6KL 3TBTA 3DROB 2WBXA 4JFQB 3WCYA 4RDBA 1E5YA 1ZVSB 3AUWB 4FLHA 4N2KA 4LHUA 4Q9RL 2YN3A 1J0HA 4IRSD 4WWKB 1IEHA 4HC1L 2VXQA 3UG4A 4HHWA 2XPYA 2J73A 3L95B 2DDQL 4ZYKA 4JRLA 3UBFA 1PMYA 1WO2A 2DMBA 3QIBC 2H26B 5CZRA 5FLUA 3U7WH 2VTFA 8FABB 1ZTXL 5FEBA 1THCA 2VLJB 3AS0A 1GCYA 3CFDA 3L5XL 4PJBB 4RFEA 4AH2B 3D9AH 2VUOA 2HLFC 2BIMA 4ZMQA 4YDIL 4JREB 3OR6A 1HK6A 3F7YB 4C4BA 4JE0A 4XMKH 2OCFD 1NCDL 2Q5BA 4WJG3 1TTUA 4MXWL 4XN7A 2IOOA 1F90H 3IWUA 5D7IE 1HQRA 3U6XA 2L7QA 2YD3A 1M2VA 1I8IB 1ROWA 2BIHA 2Z93B 4BDVA 5JXEC 1DO5A 1MIML 1QEXA 2ZOTA 2DJMA 4TQ8A 1VADB 3EBIA 4IKIA 5HYFA 1SLVA 4AVHA 1FHGA 4IGBD 3SE4C 1QFPA 1X5IA 1AMXA 4PWGA 3FKUS 2ATKB 3QDME 4OCRL 3L3OB 4GQPH 1TMCB 2ZCLL 2DIBA 4ODWA 3UADA 2QZ5A 4KQ0A 2AQQA 4WEMB 5F3HA 1T7ZA 1SXAA 4UV7L 4XCEA 4PHXA 3ZL2A 2QBWA 2PW2B 5IMLB 4MAYB 2XZAL 5ESVB 3K8LA 3CLEH 4H1LB 2I26N 1XAKA 4IBVA 1MCLA 1KXQA 2KMWA 2DWEB 5TK2A 5I18H 3R0NA 3QPXL 5CINH 4XN8A 4AZ8B 5FM8A 3EO0A 2EEAA 2I7SA 3MRDA 1YMHB 4M56A 2CPUA 3JWNC 7FABH 2H45A 4RESB 4AYID 3BI9X 3GHEH 3OKOA 4L1SA 2MTPA 4R8WH 4MSWB 4N2HA 3UDWA 5D71H 3OKDA 3EJYD 3UC0H 4AY0A 4R0LA 1PFOA 1DN2A 4YIQB 43C9A 3KYOA 5I1AA 4NJ9L 1MFAH 1E50A 2FSDA 1SXBA 4PUBL 4HXAH 3UL4A 4FN0A 3SIKA 2RALA 3QNFA 2C3XA 3LKNA 3TT3H 3ZYIA 4LXFA 5ISZD 5T1DH 4PJHA 3VD0A 1N12A 5DMKB 3L4UA 3LTVA 4MD5B 3VFGL 3FOLB 3MKGA 1FV1B 1OGTA 2VUKA 3MQIA 4YE0A 3UABA 4DK3A 3ZE1B 1TETL 4L5FH 4CMMB 1GTNA 2C1PA 1R3HA 1ITBB 1F58H 2F2HA 5D1XA 5IOPA 3FS9A 4XVOA 3BE1H 5TGBA 3DVFA 4U7SA 2K9UA 2EAEA 3CFKB 1F3DH 2CK0H 3U4BL 2HTKC 1UWXH 1IGMH 2XV6B 4LSPH 1JWSA 1MZYA 4RWHA 2DJ4A 2XG4B 2E6JA 4KOBA 1JI1A 4S1DD 4XTRD 4Y4KC 1YNKH 3PGDB 3VWJB 3X12B 2BNRE 4L4TB 3U48A 3KDMB 2AJXL 5DRWB 5FO8B 3ULVD 1I8KB 3QFGA 4XNMA 4EIZC 3TJEL 1BEXA 4TQPA 3ZKQD 3O6FA 5DZ9A 1URZA 5A2CA 3AXIA 3MJ8A 4NWUH 4H2AA 1DFBH 4GKSA 4QEGA 1GZQB 3D4CA 5ANMB 1BZOA 1FFOB 5IHZB 1MG2C 3TIEB 1DDHB 4YH6A 2EEFA 1OM3L 4OF3A 5B8CC 2GBVA 1QMUA 2GJZB 5KVDE 4L8BA 1OAZL 3EUUA 4KKPA 4P46B 3ASNB 2JMRA 2X44D 3BAEL 1NEPA 5EPMB 3JWOH 5A2KH 3H6AA 4XMUA 4Z7VF 2BRRH 1TTRA 2WO2B 3QUYA 4LASL 2X38A 3QZBA 4JFFB 4PYHA 4JQXC 4N6QA 4KJPD 3IFPA 4ZPVB 1DUZB 3WTYA 4GT0A 1XD1A 1I7UA 1VENA 2X7LB 2AZUA 4A2HA 3SPHA 1J1PL 2V9UA 3KLSA 4XMVA 5BRZD 4RQQA 5KBLA 5ENWB 2W07A 4GFTB 4Q2ZB 5DUML 3H0TA 2A9MH 3KWXA 1WFIA 1B4TA 3LHPH 4KOCA 5KYXA 4GIPD 1WZ1L 4Y7OC 4FXKB 1AZUA 5DUJA 4NKIH 3QAQA 1IM3D 3WY1A 5KVGL 3IFOB 4PG9B 2VLRB 2F08A 4H0LC 5DURB 5EDSA 5I1CH 1S4IA 4WFFE 2CPCA 2IAMC 4DETA 2NXZC 3HZ3A 5INCA 4LHUB 2FGWH 3J07A 2WQ8A 4QIRA 1K9TA 4W93A 3GO1L 4EZLA 5BNXD 1A7OL 4ZYKB 4XVSH 2J21A 3MACH 3BHBB 3GB7B 4OLVL 1SMDA 5GS2D 1YMME 5C0GB 1J5OL 3IDXL 3KLHD 3D85A 3MJ9L 4PJGF 1OE3A 3FQWA 1V3KA 1OLZA 3K8MA 4PD4J 1W6WA 3KBFA 5SX5K 2J6EA 3CFDB 4RFEB 4E42A 2XTLA 4HLZH 3BMVA 4DKDC 5EZPA 5EO1A 4KXZH 4ZMNA 3OR6B 2P8MA 1C7TA 4ODVH 4LRNL 5CWSA 1Z3RA 2QHRL 1NGPH 5KW9L 1NAML 3NH7H 4JG1L 1KY6A 3MJ6A 4UIKH 1UM5L 3RWCA 4QRPA 3BX7C 2NOYA 3A4FA 4E5XG 3K6OA 3RWJB 4P2QD 4U0QB 4N24A 3RGVB 4OIIH 4JY6A 1OGSA 3A67H 4IJTA 1AXTL 5L0QC 5IQOA 1ZS8B 2QGCA 3RZCA 1NBVL 4KQ4H 1FIGL 4Q7DA 2BC4A 3SQRA 4PP1C 1I1AB 1CFQB 2H8PA 2JJSC 2LU5A 1ZXQA 1FE8L 1DVZA 1P9MC 5F3HB 1NUDA 2EH8L 2JB6B 3U9PH 5IV2A 3TA4D 3RNKA 2CG9X 4NSKB 4EUPA 2D0HA 1JDDA 4XH2B 4OFVA 3WXWL 3PDOA 1WAEA 4PJIE 4HIIA 4Q14A 3ENEA 4P99A 3EO0B 2A9CA 2N7AA 1IBYA 4FZEH 5BS0E 4GMSH 3OKDB 5JQ6L 4CBZA 3KYOB 4PB0L 2F5BL 2QMKA 5I1AB 3D4ZA 5I74C 3WIFB 2BVOA 5GPRA 3JYBA 1HEJC 2AK1L 1DJYA 1PYWA 4ZMZA 3QUML 2Q3ZA 5E94A 1QRNE 2NTFB 3UYOD 1A6VL 3H9SE 4ZTOH 3N40P 3UJTH 1F1GA 1NOFA 5HHVL 2HX9A 4PJHB 5M95B 4XE5B 2HWZL 3OHXA 1OGTB 4LNRA 4N8VG 3TO4B 4P2OD 4EI5D 2JJWA 4W9LC 3NA4A 3FSAA 1HL8A 1S78D 4MD0A 2KS0A 2NY0C 1DCLA 5IOPB 1J0ZA 4XMWA 1H8LA 5TGBB 5B4MC 2IFFH 4AQ1C 3G6DL 5ADOH 5KSUB 2BSTA 5EZIH 3KXFE 1KTKE 2RR3A 2E9IA 3V7MA 5JOPD 3OX8B 5TFSL 5IFAL 4DPBX 2QR0B 1U3YA 2FQGA 4JM4L 3UZVA 1PBYA 5HHXL 1CXEA 3B8SA 3PWVA 3SBWA 1RZ8B 2Y5TA 5FXCH 2X05A 1B4JH 2OMBA 2YAQA 1UZ6F 5I1JH 5IR1B 1E2WA 3ARUA 2E7DA 5AKSA 3IFLH 3Q6FA 4XCCH 5LBVA 5DHYB 5GSVA 3ARDD 1Y7VA 2R8SH 4JEGB 1UD5A 2XWDA 4CDGC 1CTNA 4HWUA 3OLIA 3L6FB 1HZHL 2PXYB 4OU3A 2WNWA 3OJDB 4NO3B 1ZLSL 4GRWH 2R0WL 1EMTL 4XMLH 1F4YH 1OCRB 3WEMA 2P24A 2CUAA 3SPVB 2KKQA 4NFDA 3C6LC 3S8FB 5E8NB 1X5FA 3QUYB 4ZW7A 1G7IB 3ALXA 3ZE1F 5K1JA 4BM7A 1NANI 2B59B 5MHSD 1LVEA 2J8HA 3IFPB 4J7RA 1MJJB 1NFDB 1HE7A 3EF4A 4JRWA 4W9DC 1D5BA 3SDXE 4F5CA 3I2CL 1CD9B 4FNUA 4FNLL 4RQQB 2V3FA 1IC5H 1P7HL 2W07B 3L17A 3H0TB 2UY7B 4NKMB 1QHPA 3GSOA 4X8XA 3UG5A 1M2OA 2RCSL 4IU2B 3ARBD 5E8DH 4LOVA 4OCYL 2JELH 5KYXB 2Z92A 3SQOL 4G83A 1AZZC 3PWPD 1FO0H 1U58B 1HE8A 1TO4A 3JV0A 1S7UB 2B1AH 3ESNA 3ILQC 4JR9L 3PE9A 2VDRL 5GS0C 3CLFL 5AWNH 3IF1A 2MOVA 4N25A 3B37A 3TH3T 3T3MB 4ZAKC 4ZXBC 4FF9A 1MELA 5I0WA 4DOHE 3RI5K 4D9LH 3UACA 5BZWB 4G3YH 4MQ7B 1J87A 4U3HA 4AJWA 5CZKA 3IJEB 4MLSA 2E75C 4EN3D 2MNWA 2YGPA 3LXBA 4LDOB 4X0KA 3RJQB 2WBJC 3D85B 3SE3A 4LHQB 4BZ2L 4KRPD 3T3PE 4AEFA 3O6LH 1XH1A 1JD9A 2G4GA 3IKKA 1GJIA 4I3RH 1AI1H 3VXME 1KV7A 4NZFA 3U7YH 1A4AA 3LQAC 1IGFH 5KJ4A 5JR1H 3EDFA 3OKNB 1Y18A 3CZLA 4OZGF 4QRPB 4L9LB 4WTXA 2Y5QA 1BQ5A 3QJSB 3BMWA 2APWA 1PZAA 1XL4A 3S37H 2IPTH 4OJEH 1BFOB 4UBDD 2CHXA 5JW4M 3NGBC 4MD4B 3E9TA 2BC4B 2BFGA 2QLVB 4XNYL 2GJJA 5T5FL 2H8PB 4G59C 5GIRA 1F0LA 5D7IA 1LO2H 3QEQD 4JDTH 5JHMA 5JPMA 3ARWA 5IBLD 5AEAA 1U2YA 3AGVA 2ZNXA 4EUPB 1K4DA 4K71C 4G42A 3AROA 4ZMPA 4JRYD 4L3EA 3ZDXE 3V0DA 3PDOB 4JFTA 3SCMA 1F3DJ 2A6DB 4LCIL 3QDMA 3TVMC 4KZDH 4NQDD 4MNGE 1J5DA 4YVUA 5F7KC 1C12B 2NUPA 2R29L 4TVPD 5HHPA 1VESA 3FTUA 5IEHB 3TBCA 1FSKB 4N22A 1KGIA 1USQA 3O81A 4K8RD 5BQDA 5FLVA 3DVNA 4B27A 2ZOUA 1MIEL 3HNTH 3RL1A 5BUAA 4M29A 1QW8A 2BVOB 2W92A 4Y4FA 3UAAA 1FL3A 3EYOA 4IHOA 2BMKA 3VACA 3SO5A 1WC7B 1ET7A 2AGJL 5E94B 2NYZA 1T2JA 2MCG1 1QFWH 2JE8A 4UIMA 5ECJE 3TXAA 5DJ0B 1PU0A 1OQXA 3BZFB 5KZCD 2EDOA 2CRMA 3OHXB 3Q6GL 1J8KA 1KIQA 1WZAA 4BZ1H 4HJJH 2NNAA 2VERN 1IJNA 2QPDB 4UAOC 4KNSA 2YSSA 1RZPA 3K6SA 4X7EC 4AKOA 3I74A 3QORA 3RX9A 4GQQA 4POUB 4FE9A 1JF1B 1KTJA 3HE7B 3NQIA 3MKKA 3NTCH 3VI3B 5D93B 5HDQL 5GS0L 1AR1B 2J56A 3AUVA 3C8HA 3VD9A 3D05A 2CJTA 4UNUA 4OCXH 1BMZA 3UZVB 5KSBF 2PCFA 2YUWA 3TPUA 2Y5TB 4H44C 4BA0A 1ED3A 1ACYH 2XBZA 4A2LA 1GGTA 3U1QA 3Q6FB 2YQGA 3MO1B 2CO6A 3OKKA 3AFLA 1NFIB 3IDIB 1HH9B 3KR3H 3E8UH 1E6JL 2XVBA 3MXVL 3IRZA 4JN1L 3DX7A 5DZPA 2OSWA 5J9PA 4PJ7F 3IRCA 3VD7A 3E6FA 1AHWA 2WO4A 5T3ZH 3SGJA 3HS0A 2Q87A 1TZAA 1VEOA 2NY6D 4D0BA 3LQAL 4AV4A 5IQ9B 4BKTC 4LVEA 3GYRA 2VZOA 3QHTC 2EH7L 4WW2C 3ZIYA 1JGLL 3A4EA 3AADB 3GMMA 1QI3A 1HKLH 1A4JA 2E4TA 4NRZB 1AACA 1KELH 4CSZA 4D0CA 2K7PA 1D5BB 1X7SA 3BDYH 5CEXA 1FA4A 2PO6A 2UXTA 1W6LA 2XNAB 4HGWA 2Z35B 3HCVA 4U6VL 3GSOB 4PVNA 1XGZA 3DC0A 4RFNB 4TSBL 3W11D 3INUH 2F61A 1CVSC 2YRLA 2Z92B 3MV8E 3ZKXB 3GI9L 3NIDE 1RK7A 4WU5A 3RWHA 2YA1A 2W1NA 4YXHH 4HUKB 3UTSA 4L8DA 3NSYA 4AIXA 3U4AA 4HSQA 4GRWE 3FCBA 3U2JA 4QHMA 4LF3A 3T8MA 2C34A 4AX3A 1ORSA 5AAMA 4JG0L 1EJFA 1MNUL 4HULB 1AE6L 2Z8WC 4BELD 3PYCA 4TSCL 5IJBC 1D6VL 4XGZA 5HYSG 5JHLH 2GUOA 2VKXA 4PWEA 3B83A 2FAUA 2O6CA 3P4OA 4Z8FH 5DWUL 1KYOJ 1KCSL 2DAVA 3GBMH 5C0AD 2WLJA 3MROA 4PGBA 2XYCA 5DVNA 1IT9L 3KL0A 2R59A 2BNUA 1T04A 4MVBC 3BN3B 4PJXE 2WY3B 4Q52A 2X1OA 3P77B 4FQXB 4TULL 3F85A 3IDNA 4E9VA 4BUHA 3T0XA 1BPVA 2XN9A 4OV6F 3D69A 5CUSL 1YMMA 1A25A 2Q10A 1YUKB 1HZKA 1PTZA 2JCCE 4F9PC 1BOYA 5FKPB 1T3FB 3LRLA 2B39A 5LQBL 5BO1H 2X53A 3HR5A 2EDBA 1QFUH 4TRPL 5AW9B 3DTDA 2BP5M 1GC1L 3GSUB 4NUPA 4NBYB 2LFGA 4N6RB 3LDBC 4PH8A 3CDCA 3FB6A 2V5RA 3MZGB 1N26A 1YEIL 4RDQF 4WFHE 3MV9B 1E5UI 5ITFB 3WMSA 4Z3IA 1MW0A 1I9IH 5FYLH 5GIRB 3F7PC 1ZPUA 4AXWA 2D7PA 5KYNA 2XXGA 3NFNA 5HI4C 1JMXA 2CGZA 2JIXD 4H88H 2XQYK 3ATEA 1C5BH 3BO8B 4G42B 4TOYH 4PRPD 4L3EB 5I8KL 3DUUA 4CMHC 5FIEA 3VDAA 1G7JA 4NAJA 1OTSC 4ABQA 3SCMB 1SLXA 1R0AH 1MZZA 3ZJAA 4LVOC 5BZDA 3VW3L 3IJSB 4IKJA 2AEQH 2AJZA 2J4WL 5HHPB 5DQJB 2WXQA 1AO7D 3ZPDA 2AJUH 3SKNA 1DSFH 1CGVA 1F1AA 3TA3C 4PG2A 2HFFA 1HL5A 3V6FA 5E6IC 3BQUC 4M6NH 2HTLD 2W60A 3TLRA 3GBNH 4PJIA 4MJIE 3I9GL 4UUJB 1FORH 3V6OE 3WNNA 1FL3B 3EYOB 4HBQA 3S0PA 4LLDA 1T4KB 4HMDA 3L8QA 3GRWL 2W9DH 4DP7X 4CC1A 4Z7NB 5BS0A 3BN9C 4UIMB 5JZ7C 1SHXA 1WICA 4OGZA 1LTXA 2D7NA 4LAQH 1SBBA 1L3WA 3KNBA 3DSFL 3LRKA 1T89A 2M8XA 3MJ7A 4JM0A 4O2EA 3M17A 4GO6B 4POZD 3LZRA 2VW4A 3O4LE 2YSSB 3U9WA 3CDYA 2P42B 1K3ZA 1E3ZA 1HTYA 1TVBA 2M1KA 2QQNL 1QRNA 4NC1C 3MUHL 5DEZA 4FFWC 1ADQA 2YAOA 3F3HA 4TVSa 4Y0GA 9PCYA 4IIQC 1XV8A 5DRNA 1WISA 3E3QE 5JNYB 5GRJH 1ZS2A 2P48B 2IC2A 3RFZC 2PCFB 3QUXD 5C07B 5EF1A 4TTDC 1CBVH 3F7QA 3F58H 4AT6B 1ED3B 3HG0A 5DHEA 2GCYA 5F88B 5L4MA 3KXFA 2B1HL 4JUSA 1QZ1A 3KAAA 4F20A 1W72A 1BBJA 3CIAA 4JLRA 1L0QA 3QS2A 2FTAA 1A1MA 4KK9D 4OZFA 4E0RA 3CZKA 4I18A 1JGEA 4KI5D 3E6FB 1AHWB 5DEFB 2Y5EA 4FGMA 5D55A 3TJPA 5CJ8A 1JPGB 5ILTH 1XXFC 5J1AB 3WNOA 2D7OA 2MPAL 2BIPA 2UWEA 2R1XA 5PCYA 3JUZA 3GMMB 1Z0NA 1A4JB 2E7MA 5DCCA 1OP3H 2NNRA 4UV4L 5D72H 2GQHA 4R7XA 4HK0A 3D4GA 2GY7B 5BCAA 1L9NA 1J9SA 1KPVA 2JKSA 1CD0A 4KUZL 1CR9H 4PU2A 5DJ2B 1RUPH 1YYML 3KGRA 4RWYL 2A2QT 1KJ2A 5BV7B 3A24A 2GAZA 4GRLD 4MTMA 4BE5A 4EF3A 2GITB 4GQRA 2NT1A 2OI9B 2YEZA 3CTTA 4PRIA 3V6ZB 3NCBB 3A6BH 4FULA 1RJLB 2XZCH 4YHNA 3ZT7A 3SE6A 5I6LA 4WU5B 3RWHB 3VXNA 4NUMA 3U79A 1U8NA 4X4XA 3UTSB 2FBJH 1NKGA 2BFVL 4L8DB 5EC1A 5FUOL 3TV3H 1IGYB 3AY4C 1XGTA 2BW5A 3R19A 2AQ3A 3CK0L 4M7KL 1PG7L 4UNIA 3B9KB 3F05A 4NOBA 4P04A 5D1ZA 1A1NA 1TU2B 3S98A 5ALCH 3TN0D 4Q9BA 1KZYA 3LIZH 1KJVA 5IVXF 2Y1YA 3GLAA 2X4SB 4P3DB 3S96A 1PLBA 4H0GA 4P0DA 5F1KC 1JPTL 1MRCL 4KKLD 3B7TA 1T0PB 2GUOB 3QQ3A 4L4VB 2XUWA 2YGQA 4Q0XL 4IU3B 3UMNA 4GKNA 3HG1A 1V05A 4MS8D 4MXVF 1CDBA 5GRUH 2KH2B 4XOAA 3OM3B 4U1GB 4PGBB 4M5TA 5CSZA 2XVLA 1BFVH 4IBLT 8CGTA 5MI0C 2RH0A 5CIPH 2WBKA 2IQ9L 4ZSOA 3SPGA 1Z2KA 1EAJA 3IDNB 1PZUB 3MBEC 2H41A 3BZDA 4M03A 4PJEB 3VFRA 3UPCA 3KYMA 3VGHA 2XN9B 4N0CC 2ADFH 2KHAA 5JW5A 1A7PH 4NX0A 3POCA 2C9PA 2VOTA 1TQCC 3B7YA 4ODXA 4KMTH 2JB5H 2ZWZA 3IMRA 3CGTA 1XH0A 3KYKL 4BH7A 2D3JA 2XICA 1MFCH 3KLLA 3D3VA 3U1PA 1GKEA 3VXMA 1OVZA 3FB6B 1HHIA 2YD8A 5E9NA 2EQDA 1UD4A 1HYSC 2P46B 1KXTA 1YZZA 4AXWB 5I6XB 2QEJA 1A6WL 1G5GA 2ODIA 1RHFA 3NFNB 1S7SA 4G5ZH 5TPWH 4FNSA 1D6EB 4LU5H 3FU8A 3OMZA 3SDCD 5F9JA 4BQ8A 1TJIL 1G7JB 3OPUA 2VJXA 1BZEA 1K6QH 5D4IA 5BZDB 5IMMB 1QR1A 4I0PD 3QIWA 1KJ3H 1CF8H 2JWYA 2Q2LA 2APTA 1MJ7L 4HEME 1NCGA 3NZ8A 3FN3A 2UX6A 3L4XA 4IRSA 3ZDYF 1WS8A 3SKNB 4DN3H 3FTYA 2ORBL 1OK8A 2HFFB 2KZ1B 3MVSA 2VDPB 4X4KA 1QYGH 2BZDA 4GKZA 4NQUA 1KYDA 4PJFB 2VAAA 3BWAA 4HZ1A 1PD6A 2W81C 3BKMH 3UAJC 3W39B 1UD6A 4LLDB 4MNGA 5FYLE 4ZTEA 1RK1A 1VGKA 4PB9H 4GRMA 4AW7A 4M7LH 4NN6C 2V5YA 1DBML 1JHTA 2HX7A 4G72B 1DE4B 1EANA 3X3GH 5H2BA 5B1AB 2YPLD 3MJ7B 1KZQA 2A6JA 4ORGB 3OJMB 2JLPA 2HFGH 3S35H 4AYFA 2HKHH 5I1EL 1FNGB 3L4YA 3L3DB 1TVBB 4HIQA 1L7TH 4KK6C 2MIZA 4PJDE 4YSOA 5EBLA 3MRCA 4MA1B 3BP4B 4G9FD 2AQ2A 2Z91B 2DD8L 2R4SH 3I6KB 5DRNB 2BWIA 3MLSL 3QIBD 2Z4TA 4NZRH 1OSZA 2R0ZL 1QI5A 3IJ7A 3L3IA 5E1AA 5FDWA 2JJVA 4WO0A 4KZEH 3QJFA 5F0JB 1BX2B 1Y0LA 5DMIH 3NJGA 5LGHH 1DSYA 3CZEA 2Y7NA 2GCYB 4NJAH 4KXDA 5KBDA 2VITA 2ADGA 2CNZA 5KJ7E 3PHSA 4JHWL 2XVKA 1JJUA 1BBJB 4R90H 3S3PA 3WE6B 1XZ0A 1CG9A 5AAWC 1A1MB 4JRFA 4DAGH 4E0RB 1E6OH 3QYMA 1JGEB 1J5CA 1VSCA 4ISVB 5JXED 1F18A 1H19A 1TCRB 5FS5A 5GGVY 4HHAA 3LZNA 1QFOA 1FC2D 3OG6B 3T2NH 2HRPL 4O51B 1KB5L 4J8RA 1D2OA 5FB8A 1Q0XH 1YCSA 2UWEB 5E0FA 3WIAA 4MZRA 4IRZH 3TBSB 3LKPB 2BHZA 3L3KA 2K6WA 3EGSA 4YDJA 1U36A 1U0QA 3VXSD 3MJGX 5GGVH 4CADA 3FB5A 2XSKA 5DGRA 4IRJC 2AI0H 2DLGA 5ISZA 2OW7A 4HK0B 5ESQB 1LO3L 3FCGA 2SODB 1J5IA 3O8XC 2ZP9A 3H7LA 5D4JA 3ZZLA 5I23A 1SOKA 1JZIA 2P5PA 4OAWB 4MMXC 3S5YA 2NZ9D 1HIML 3H55A 4F1ZA 4HA1A 4PRIB 4O02B 1P7QB 4IQHA 4P2RD 2FQDA 3C75A 2KBGA 5EC1B 5FGBC 1ZJAA 2OR9L 2Q8BH 4FAAB 5JQHC 2KDYA 5D1ZB 4JKKA 4NO0D 4XP1L 2JKJA 2GKIA 2HVJA 3PL6C 1A5FH 3ZKMC 2ZOLA 3ILPB 3L1OH 4EI6B 1MCWM 5CS7A 4GIOA 1BVZA 1CQYA 3S96B 2ZXEB 1EK3A 4NWTH 1KIUA 4HS6B 3CXFA 2R0KH 4YUEL 4HC1H 1MI5E 1U8QB 1U8KA 2BOBA 3HUJF 3GNMH 3E1F1 4W81A 4WFGE 4P07A 3FUFA 3KPRD 3SPJA 3QGVA 4P5SA 3WN5B 4LSRL 4GKNB 3HG1B 3B3IA 1NC2D 1D5RA 2X40A 4NKOA 5DVPA 4PJ8B 5CSZB 4HDIA 4CC0A 4WI0A 4IJ3C 3L5XH 3VG0L 5T1LD 3EYSH 1KJMA 1P6AB 3CN2A 4ZSOB 5I9QC 3FT3A 4YDIH 4YHZH 4WNSA 1MFBL 4NRYA 4FI6A 3MV7D 3VFRB 3BPCA 3KYMB 1WBYB 1NCDH 2GBTA 4KHXL 2A9NL 3TPKA 2J25A 4MXWH 4AYEC 5CEZH 2HTKD 5JW5B 2I9LA 4EDWL 1KCWA 1N7ML 5HXMA 2XIDA 4Y4KD 5KVFL 5CILL 3ETTA 4ODXB 5CHNB 5HDLA 4YSRA 1DJHA 4YBQC 3ULUF 1X5ZA 2ZOWA 5GZOC 4JKLA 4OJDH 35C8L 3QULA 3D3VB 2XTJD 3SD5A 5GRZA 5D8JH 3CX5K 4PWIA 3EH3B 5BRZA 5F1NA 1EUTA 2FWSA 4KKAD 1EEZA 5LXGL 3U6RB 5JIHA 2BWDA 4D9QD 4GW1B 5D7SH 1KXTB 3WTSA 4RNRB 1OCZB 3MXWL 4NOFA 5ACMA 1IFRA 4UM9D 3VB9A 3NFSH 4J2QA 5BQ7A 3LZOA 4GAJL 1VKXA 5LGJA 4KV5E 2DQ6A 3RVTC 1HXMA 4ZX4A 3RY6C 4RETB 2R69L 5F9JB 1BMGA 1GY1A 4Z95L 4A6YL 3CMOH 2WUBH 4U49A 4HWBH 3P3YA 1GYVA 2VH5L 2BVPB 1ZHKA 5A16B 4BKLB 1MFEH 1TCMA 5K9JH 1GSMA 1OHQA 4LE8A 4K55A 3EYFB 2D8KA 2FX9L 2WVVB 4OGXL 4IRSB 3U0WH 5CLYA 3VRLF 4NQVB 1F8TL 3WO4C 3LD8C 5C9JB 5MEND 1MRDL 3N42F 1W8NA 4GKZB 5KTEL 2NSMA 1W80A 4JQIL 5CBEB 4OFIA 1A9EB 5AVRB 3L7EA 4Y89A 2WLYA 4Z3HA 2DI7A 2VIRA 4PUBH 5HSFA 3US1A 3V4PL 4JFDD 5GS1C 5BMFL 1RK1B 4NIYE 1VGKB 1CXKA 4FFTA 5J1SC 4LPVA 3HKFA 4ZS7H 3S36X 4RA0C 3WIHA 1SF5A 5AOKA 1DVUA 5H2BB 4XPTH 3UZEA 1AC0A 3U82B 4HH9B 5F97E 3MR9B 4LL1A 2H1PH 1N59A 4RGOH 2VM3A 3E0GA 3ZE2B 1J12A 1T7XA 4WCYH 4XVTH 3MRCB 4I77H 4A67A 1M9SA 2K6ZA 5DF0A 1PLGH 4IGBB 5LLIC 3LPWA 4XP9H 2EYSA 5A2JH 1WP6A 2MOQA 3HMWL 4HFUL 3VH8A 1Q9LA 1WDAA 3JV4B 3MOBL 4AK2A 4DH2A 3L3IB 3KYAA 4JHVA 5IW6B 3O4LA 3APMA 1M42A 1D7FA 1SQMA 2IANE 4MJ2A 3QJFB 1YUHA 3ECBA 5C6TH 5IW1A 1UKTA 4NXSA 4GXUM 3TJEH 4U1NA 2ADGB 1G4RA 4NGHL 1MCHA 5ALBH 2IOIA 5LCVA 4WWKC 3U36A 1ZVNA 2EJ1A 3LNFA 4AYGA 1U8HB 5HJ3B 2DQMA 1OB1A 4RSVA 2EACA 1E0OB 2H2PD 2X6CA 5AUMB 4WGVB 4G6MH 3FTGB 4FMVA 3KGTA 3DARA 1WZKA 1W8OA 4HHAB 3ROOB 4YNYB 4KJYA 4JO2L 5FB8B 3TTSA 1EEYA 4JREC 5KUMA 5IESH 3L3KB 2PR4H 1SM3H 1CCZA 3FHEA 4N8CL 1JXJA 4HZAA 4CADB 3FB5B 2DPKA 5EFIB 3GI8L 4RMUA 4KGJA 5F3BA 1NCWH 1KGCD 3NIGE 5ISZB 1JPSH 3PGCA 1SJXA 1IM9D 1KTDA 2XWTA 1BZ8A 2EKJA 3OAYH 2NLJB 4QT5A 5IB4A 4EI5A 3RIAF 3UYPB 2VDOL 3C9NA 3MUGA 4G7YH 4Y4HB 4J4PC 1O5PA 4L8CA 4JPKH 2OMVA 1IVTA 1J0YA 2R2BA 4A7GA 3L3OC 1C16A 4YLBA 4WRLA 4F58H 5I6KA 3CSYB 1MEXL 2ZOOA 2E9GA 4L1TA 1HNFA 2HVJB 2VLLA 4R4FL 1OT2A 1P1ZB 2RFXA 4X9FA 1CTMA 2FD6H 5DD0L 3WY2A 4KHTL 4GUOA 4MAYC 5IQ7L 1FZMB 1T83C 2VN3A 4HFWA 5IHLB 1KIUB 3M86A 3ZK0A 2D4DA 1QUNA 4KRMB 1T4WA 1V3MA 2X89D 1A14L 5SV4A 4Y5VA 4X5XA 4NKOB 1RK0B 1J5OH 4HDIB 4KUCD 1KN4L 3AG1B 3LSOB 4EBQH 1KJMB 4QLWA 4AMKL 3FT3B 3ARYA 1MCKA 4FKEA 4UM8A 4NRYB 1LEGB 3A47A 5J6GA 3BPCB 1REIA 1KCUL 2MQ0A 4FZ8H 4LRNH 2ICEB 4ZOAA 1KN2H 3CMGA 2UZYB 4Q6KA 5GRVL 2I9LB 2YOAA 3C5SB 3VD2A 2R9HC 4M8QA 2BRQA 1KTLB 1F45A 3QXDA 2VR7A 3S3SA 1FIEA 2X9YA 2YPVL 3N06B 2KZKA 3L9YA 4A2MA 2WIIB 4ZNEE 2CCWA 3CN3A 5BRZB 1OO2A 1SEQL 2OJZL 1BQSA 1CFBA 3ARBA 3QCUH 2ZOKA 1HXYA 1MCPL 3IGAA 1QG3A 5DC9B 4OZHE 4WHDA 5LGJB 3PWPA 3VWJC 1OD7A 4RA3A 1IM3B 5L4JA 2ICWB 2PCPA 4AIZB 5DHMC 3K6DA 1MH5A 1MREL 4MNHA 4AIEA 1ZHKB 4PMEA 1FH5L 2FR4B 4BQCA 1LYQA 2EIEA 3GEWB 2OMXB 1QSFD 4OB5L 3NP3A 3OAUL 1R24A 3W2DL 3AXLA 3G9VA 1EJ8A 25C8L 2FHFA 2IALB 3BH8B 4OQTL 5AL0A 4EN3A 2RAMA 2IDTA 1MLCA 4KK8C 4EEEA 1HX0A 3QAZB 1MAJA 1YNLH 3L7EB 2WUCH 3R0MA 4P46C 1HILA 43CAA 4GMTL 3QEUA 5DI8A 4ZS6D 2AEIT 1FG2B 1MJ8H 4FJ6A 3NPZB 1TFPA 5JIQA 3QCTH 2O6PA 3U4EA 1KIPB 5IBUB 4MZ3A 3HG2A 1TXKA 4Z7QB 1N59B 1AD9A 4M61A 4ZAKD 2A7BA 7PCYA 3Q48A 4P2QB 1NH6A 3O3DA 4G6KL 1BM3L 5CN1A 3LB6C 4TTGA 1CYGA 4U4BA 2G75B 1MG3C 2ED7A 2JI1A 4FXKC 3I50H 4JHBA 4LMQI 5TFSH 1M71A 1Q9LB 5FF6B 3QEQA 4N1CA 1CK0H 5HHXH 2EDRA 4GG6E 5JW4N 1YUHB 1R5VA 5JORA 3ECBB 3N41B 4DJMA 1J88A 1IRAY 1JIBA 4K73A 4L18A 1BJ1H 5ICZA 1IVLA 1GJWA 5LHDA 4JRYA 1QZNA 2VZ1A 5F96L 4G1EA 1XCTB 1E40A 2VZUA 3KLAB 4LCVA 3UTQA 5ID0B 3NSDA 4NQDA 1MPAL 1OB1B 1C8QA 4OFYD 2EDDA 3WHXA 4AJYV 2K3TA 3EO1A 4UTAH 5K9QI 2CA3A 2IDQA 2BCMA 3CDFA 3BFOA 3NYKA 4FOMA 5EHFA 1OEZW 5F6IB 5DJDA 2Z4QA 3GXTA 2IH3A 2YD0A 4QDGA 2OMWB 3TWCL 5A40E 5AENA 2E46A 5DK2B 3L7FA 4IOIA 4S11A 2YRPA 2RJMA 1JZ7A 3NRQA 3WLWD 4HKJA 5HVWA 3E6HB 1EEYB 1S7VA 3NIFB 1MVUA 2MQ3A 1W0VB 1EXHA 2MFNA 5LNDA 3OWRA 4NLAA 3P2DA 4W4OA 5F3BB 4UTBA 3LEXA 4GSDL 2MHAA 1XH3A 2PR9A 3PNRB 1KPRB 4GG8A 1U8IA 4QT5B 4P2OB 5IB4B 3RGVC 2PTTB 1SJMA 3MUGB 4LCWD 2HH0L 2RCSH 3DYMA 4GKLA 3TVMD 2HJLB 3QPQC 4OJFL 4R3SA 3RL2A 2J8UF 5KAQF 5HD8C 5E99L 1HESA 3MRPA 1C16B 1CFSA 1E8ZA 1XIWA 3V5KA 1LEIA 3BGMB 2QMJA 5FYJH 1RH8A 3NP4A 4P9ML 2IADB 3QXAA 3ZKND 2VLLB 1NINA 4JGNA 3WNLA 2RFXB 1WCBA 1OARH 4LSVH 7TAAA 2AXFB 1P4BH 2Q86B 4Y5XB 4YHPA 1Z9SB 2FECL 5GGSY 1XL6A 3UPRA 1FVEB 1QUNB 2G5BB 2X9ZA 5C2UB 3OKMB 5EDXA 4K9EC 3ZDZF 4XBEH 2X4OA 2PABA 1MW2A 4X5XB 1EH9A 3BZEA 1VPOH 2SEBB 1IV8A 3ARDB 4BFEA 3DGDA 4XXCA 4LDLB 4ZFQA 4M8UA 3KCPA 3F7KA 4Y2OA 3EOBA 4UM8B 4ICXA 3II2A 3VU1A 3TH4T 2DJSA 2A5UA 3GMNA 3QZWB 4JPWH 5FKAA 5IMKB 5J6GB 4TSAH 4EIGB 4QWWD 1IC0A 1KIRA 3NFPA 4O5LH 5TE6L 5KVGE 2F1BA 1HXKA 4ONGL 1QNZL 4A2EA 2OYKA 3M88A 4HETA 1BEYL 1IE4A 3K46A 1LO4L 2R7EA 1U8JA 1OANA 3WKMH 2XJKA 3FT1A 4MMYB 2CO7A 3JWNE 4W6WB 3TO4C 3O9WB 3N43F 4LOUC 4QAWA 3MRJA 1LK2B 4OZIE 3FC8A 3GLEA 4KO7A 1MAKA 1INDH 1NUFA 2QQLL 4K9JA 4X9BA 3RUGB 4IMKA 4L2LA 3BVNA 3HKZA 2R27A 3HLAB 2DLHA 3ARBB 4MAZA 4F8PA 4NBXB 1IARB 1A6AA 2ZOKB 1W0WA 3Q8CA 3IGAB 2EXYC 2W38A 5E5RB 1FVDA 1OOAA 3PWPB 1HHJB 1CICD 1AZBA 1ZOXA 3GSVA 3O3BB 3Q3GA 2PCPB 2IBGA 5J11B 1WD9A 4MNHB 3TU6A 4Z7AA 4MAUH 4PJ5E 1NDGB 3SY0B 2P47B 3V5HB 4HCRA 1SJVA 3BRGC 1A3LL 2WQXA 4ZUUB 5J12B 4OFPA 1NC4D 1N6VA 1D5IL 3EBGA 1HOCA 2PWFA 4ODHL 1FC1A 1MLCB 5C3IA 5KEZA 2PXYC 4PJCA 5C0AA 3VXQB 5FW7A 2EVGA 4KRPB 5A2BA 4QRRE 4RDQG 2QGDA 3QEUB