5DJZA

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA01
1PZ5B 2JF1A 1NLDL 2JK5A 2CK2A 5D70H 3KG5A 5EIQA 4N8VG 4P2RB 2IG2H 1XF5B 3EDEA 4YNYA 2H1PH 1BVKA 4ZS6C 3X3FH 3E8UH 2R2BA 1QRKA 4ZUWB 4WW2C 1DLHB 4Y5VC 3RFZC 5IMOA 2R8SH 1QPPA 3UYPA 3VXOB 2A9NL 3O4OB 5I1IH 1CR9L 3QUZC 2BVUA 3MLZL 5DJZB 1MY5A 5F1SA 1YPZA 2BERA 5IQ7H 1H15B 3RWJA 2R1XA 1A3RL 3O6LH 3LKSA 5CINH 4I1NB 3CFCH 3QFJB 2A6KA 4JCMA 3SBWC 5DS8A 1U58B 2GJ6B 1AFVH 1ETZA 4HG4K 3ILPB 2NXZC 2XXCB 2B1HH 5MENB 1S7QB 3OKNA 4PJBB 1XIWC 4DZ8A 1I8MA 3HKFA 1R24B 1SYVB 2OS7A 4OGXH 3C9NA 3VFNA 3KWWA 3TIDA 3WFZA 4KRPD 4DKFH 1A7RH 4ERSH 5JXAL 1JFQH 3GBLA 3MUGB 1T1WB 4MZ2A 4P23C 4CMMB 2EZ0C 5JPMB 1EV2E 1WAAF 3ZYZA 4P9HC 2YMXL 2W38A 3DHMA 2XNAA 4N8VA 1AGBA 3ARRA 3MRFB 4H0HB 3A0OA 5LCVL 3L3IB 4M61A 5IFAH 4P3DA 4N5ED 1DBBL 4OM1H 3K74B 2OMNA 5IFJB 1R5VA 3SE9H 3OGCA 2ICEB 4JRXB 1Q9KA 1N7MH 2F53D 4M6OL 1CCZA 4ONHB 4BFEA 3T65B 4WCYL 5FECB 2AK1H 4J3UA 1H3WM 2C4FT 3ZT6A 3CGTA 3QIBC 1LO2H 2IGFH 1WZKA 4GKOA 3BVNB 2DJUA 5DGRA 5I19H 1TVBA 1S7XB 5EN2A 4NZUL 1D5MA 2EDKA 1LK3L 1KN2H 3RWDA 2BNQA 2EEBA 3DYMA 2NY6B 4WI6A 5E9DB 3V5HA 3SKJH 3QT2A 1UZ6F 3JTSB 1JWMB 3ARYA 3K4ZA 4X5LA 4ONGL 3SDCC 4BQ9A 5B8CC 5FDWA 4ZD3L 1B4JH 1WJ3A 4OLXL 5J6HA 4TUJA 5IEHB 3QXDA 2Q76B 3EYQD 1DQQA 2FWOB 4OLZH 1IFHH 4U49A 1G7QA 2A0LD 2CO7B 1D6VH 1UFUA 3QO1B 1RURL 3M1BB 1CU4L 3C2AL 2RFXA 2AI0H 1YY8A 1FZKA 5J8OA 2P7TB 3SQOL 2PR4H 3AC0A 2X2YA 3EJJX 3Q6GH 1YECH 2V7NA 1FV1A 3RWCA 1CF8L 3T1FA 1A5FH 1A7PL 4I18B 1T03L 1M7IA 5CD3A 4D3CL 2VUOA 3O2WL 3RVTC 3T2QA 2WK2A 4MHHI 1F13A 2R9HD 3AY4A 4AT6A 2X41A 1UT9A 4QXWA 4OUUA 4NN5C 3OXSB 5GRVL 1C16A 1NAMA 4U6TA 2OJEB 5ID1A 4XRCB 4YUEL 5FV1L 3MA9H 1OD7A 4JY6A 5ALCL 3QUXB 3BGMB 4I2XB 4FP8L 4P2OB 2C7UB 2VZ1A 5ETUB 2QQLL 1DCLA 2VXVL 4ZPTB 2VZVA 4M00A 2ATKA 5IROC 2A6DB 2WQRA 4C4KO 3IDIA 1QHOA 5CEXB 3JWOC 3UC0H 1SM3H 2R0LL 4FTVA 1W0VA 4JRYB 4GS7B 4KI5D 3WLBB 4WU7B 1WCQA 3QUMB 5IFHL 1NLDH 2ESVB 3QG6B 1Q1JL 4P9HL 3JV6A 3QDHA 5FYJL 1NMAL 4NC1C 3T09A 3WIHA 3MYZA 4YHPB 4D8PB 4HH9A 1OAYH 2EDFA 4MZ3A 3SDDA 5HHOB 2VLMD 1C12A 2VDOL 3VH8B 4TPRL 2NTFB 2D0HA 5DJXB 2DQUL 2NX5B 3DO7B 2BNQD 1BM3H 1CQYA 2V7HB 3WXVL 5DJ0B 5BW7A 1CR9H 3BJLA 2APBA 3GHEL 4AK1A 2V9TA 3MLZH 3FO9A 4UUJA 2YBRA 5IBLD 2Y36L 4EVNA 2YA2A 1A3RH 2J4WL 5E7BA 5CD5D 2X05A 4YHNA 1EMTL 1KLFA 3VXMB 3WO4B 4G6ML 1YMHB 1YN7B 1PKQA 1T1YA 3RWHB 5EOTA 3ZHLA 1D3CA 4S11A 2JJUA 1XR8A 1KNOA 3TPUB 5M94B 4JDVA 4H25B 4Y16B 5JXAH 4ZG1A 1D6EA 5J12C 1QSEE 2A2QT 2YMXH 1X3DA 4OFDA 1IGJA 4XBGB 5LCVH 4G8FB 3MRNB 1P7KA 3KJ6H 1JPGA 5HD8C 3C5JB 3U4BL 1NLBH 5DEFA 1DBBH 4NO5B 2FX8L 2OTUB 4IMLA 1J5OL 2R23B 5KSAC 2VN7A 2FJGB 2C3HA 1NGWA 3QFDA 3PWVB 4M4RA 4ODWA 3A67L 4M6OH 4CMHB 4WCYH 5GS0C 5C0CB 1EBPA 1I9RL 1BREA 1EHNA 1ZA6A 1N5YL 3K80A 2NW2B 5JDSA 5KAQG 4I3RL 3RDTC 4AH2B 3P0VL 4OBRA 4ETYA 1EFXA 1DBJL 1HEZA 3U82B 2GY5A 3P9LA 1F58L 2D7TL 4HJGA 4NZUH 1JZ4A 1LK3H 5EU4B 1AR1D 1UVQA 2HRPL 4FTVD 3QQ9C 1NFKA 4IOFD 4KK8C 5F21B 5F7DB 3OX8A 4KDWA 1Q9LB 1ZGLB 5ACMA 3VXQB 4NQTA 3I2CL 4ONGH 2Q6WA 5BS0B 3TBTB 3FQWA 3GKWL 4HX1A 4ZD3H 5DD1L 1X5YA 4OLXH 5C07A 3RWEB 3SDDD 2BC4A 4OD2A 4DWHA 1QLEL 3D0LA 3JWOL 1P7QB 4Y19B 4QCIA 5HHME 1QFWM 1RURH 2J6EL 1CU4H 1K5NA 3C2AH 5GZND 3QIWB 4RA0C 4RGMC 3SQOH 3UAJC 3LRSA 4HKBB 4PJFF 2FDBP 3MFFA 4EXPX 1PBYA 2QSVA 1CF8H 1RZGA 4ACPA 1T03H 4D3CH 3ES6A 4Y0GA 3O2WH 4NO0B 4TVPE 4OZGB 2H9GB 4LLYA 2P1YA 1CFNB 4N9GB 3RWGB 3BIKB 3FOLB 4PJEE 5J6GB 4MSWB 3BUYA 1ULVA 4Y5YA 3RRQA 1IAKA 4OF3A 4YUEH 2WWKO 4YHLL 4OQ1A 1AR2A 4Y2DA 5ALCH 5TDOA 2H6PA 4FP8H 4P99A 1YPZF 3N85L 3DURA 2QQLH 4JLRA 2VXVH 4HWEL 3VXUA 2QKIA 2C3WA 3CZFB 4TQEL 4EBQL 3VFVA 4CRPA 1T20B 5HYSB 3LN9A 3VRJA 1IKNA 1M05B 5DXWA 4JKLA 4Y5XA 1DUZA 4KC3B 3F6IA 5HGDA 1Q1JH 4P9HH 3OB0H 3MZTA 5D96B 4OT1L 4IDJL 2N1KA 1NAKH 1NMAH 2VWEE 3B2VL 1EFXD 4WI9A 3H9SA 2HJLA 5EU6E 1BJMA 1PY9A 2XKSA 3MO1B 3JUYA 1E4KC 2VDOH 4TPRH 3O3BA 1S7WB 4NBZB 4DVRH 2DQUH 3QQNA 2G5BA 4L9LC 3WXVH 2D0GA 1V3MA 1IMHC 4HLZG 5GS0L 1Q9OB 3ULSA 2ITDA 3RAJL 1Z9LA 3BH9B 1OWRM 2Y36H 4KI5F 2AXFA 1LHZA 2B7DT 3VFOA 1CGYA 3C6LA 5C07D 5EDXA 5ANME 3KPLB 2O5YH 1V7MH 4G6MH 4CVWA 2FR4A 1QLFA 3FT2B 2Z31B 4NPYB 3L7FB 1S7VA 4QXTB 1UWXK 4FXGB 3V4PH 1WBYB 2Q7YA 1BFOA 5KZCB 1S7TA 4Z7UE 1A3LL 3MRGA 1YEDA 4KJPC 1JPST 4O02H 1MCPL 3A6OA 4Z18A 2Z8RA 1AIFB 1HSBA 4PD4J 5E2UL 3UBXI 1S9YB 3CH8A 5C08E 5MEQA 4O2CA 2BY3A 4Y1AE 3OB8A 4NN6C 4P2QA 5E8DL 5D2NB 4ZXBC 4F7CB 1CT8A 2R2CA 4NQSA 5CZVH 1J5OH 3HI1A 2ICWI 1YNKL 3PQYE 5JIIA 3CX5K 3MBEC 2EC9U 5K9QI 3TO4B 3BP5B 4E41E 5ICXA 4HDIA 5DC4B 1I9RH 2BX5A 3BO8B 1BD2E 1N5YH 4Y2DD 2VZ3A 2VUYA 1VEPA 3L5WA 2IFFL 3P0VH 4HUMB 3TA3B 5J11C 3LN5B 5IJVB 1D5ZB 1DBJH 1FFRA 2FO1A 4IDLA 3D0VB 1F58H 1HH9B 4NCC1 1K4CA 2QJDA 1R3HB 2CDEB 2HRPH 3HE7C 3CFJB 4HKZA 3QXWA 3O8XB 1FCCA 3BD3A 1OAZL 1XCQB 3AAZA 1IAMA 1JNHA 3ELAT 1V05A 4QHLB 2DI9A 2XYCA 4F37K 2NNAA 2X7LA 3G5XA 3GKWH 3QEUA 5DD1H 3H9SD 4J6RL 4ODSH 5GPRA 5F6IB 3T3ME 5FHBL 4JREC 3ZKXB 4IRJC 3JWOH 4TNWK 4QEGA 2YSSA 2J8UB 4WWKB 4G8IA 4P4RB 5IW3A 3T3PF 3VFSB 3QHZL 5CBEA 5T1LA 4OCSL 2FLBT 1HSAA 3C6LD 4YXHL 3RVWC 2JE8A 2G5RA 3UDWA 4D9RD 1HNFA 5F7UA 2P8LA 1G84A 4KXZI 2FATL 3RX5A 1ZHNB 2WP3O 1N8ZB 3KS0J 4Z7NF 4LMQI 3FZUC 3RKDD 3K46A 5ENWA 5D7LE 3HRPA 2DM2A 1IGCL 3OKKA 1UENA 3IJYB 3QNZA 3U0TB 4CL7A 4MCYA 5I66A 1T89C 5JLZB 1NBZB 3S8WA 4YXKH 3IKCA 4XPHL 4YHLH 4UINL 3QDJA 3RUGB 2OP4L 4W4OC 1MJ8L 3F7VA 2Y06L 4WV1C 3N85H 1U3HA 5HI5D 4P2QD 2X70B 5L8JB 4HWEH 4JFYA 3LQAC 4R0LB 3RY4A 2BVYA 3VDBA 1FG2A 2EDRA 4TQEH 2X9XA 1A6PA 4EBQH 2G9HB 4WEBL 5JMOC 4XZUB 4PR5A 4HKJB 1BVLB 2FX7H 5IHBA 3RVUC 2X4PA 5AZEH 1RPQA 2E9BA 5C0AB 1JK8B 1J10A 3CMOL 4WNQA 3S97C 8FABB 4OT1H 3ARWA 2J5LC 4IDJH 2N56A 4L3EA 3B2VH 3ULUE 3OPZH 2ADGA 3FB8B 4ETQA 5D5MB 2HKHL 1BFVL 1TTGA 2H32A 1UWGL 5D1QA 4N90E 2ADIB 4DZBA 3DRTB 3DMMC 4PTUA 2IMNA 1N0XL 2QR0A 3FONB 3WDJA 3ALPA 1R3KA 3MLYL 2YD7A 5LAXA 5INCB 3VFGL 3RAJH 3BZ4B 4MD4B 4OZHB 1JF6A 1NDMA 2VKWA 1U8KA 5EOCH 4ZSOA 5F96L 2W9EL 3EJZD 4XVUD 5DUML 5K33A 4J8RB 5DMKB 3TH3T 5FIEA 1ADQA 1BIIB 1MUJA 5CGYD 2BNRA 1G7MB 2Y4SA 3WJJC 2R0WL 3N1GC 3EYUL 4LCCA 5GRWA 4LVNC 1A3LH 1JIBA 3BYTA 3PHSA 5T1LD 4ZS7H 3O41B 1PG7L 5IK3A 1GGUA 1MCPH 4NHCL 3KPRB 1R3IL 3HZYA 3X11B 4P4KB 5E2UH 4LQ1A 3KLHD 3PUCA 4JQIH 4ONOA 2DMKA 3B3IA 5E8DH 3SCMA 5IV2B 3O2DL 2X6MA 3KPTA 4IOIA 2ATPB 1YNKH 5I6XC 1F3DH 1NGQL 2A9ML 4CVXA 4X98A 4OZIE 2YOCA 1JTTA 4E0RA 3PWLA 1IAIH 3HPLB 3VD7A 3BN3B 3TYFB 5J7CC 3QDJD 2X40A 4X6EA 1KXTB 2IFFH 1U3HD 2GFBA 1YDPA 2X1OA 2ZOLA 4J7RA 1K85A 1OOAA 5KAQF 2EDJA 3VDAA 1FNHA 1T66D 4G8GB 3VMNA 4Z0XA 4UTAL 1OAZH 3U0PA 1ZE3C 2VL5B 3L9RA 4JDZB 4U33A 5DK0A 3VE0A 1T2XA 5KG9A 1MCOL 5A1AA 5I2IA 3WFHB 4U3CA 4L3ED 3H3PL 1EEZB 3VGDA 3DYPA 4OZFB 2LE9A 3LQAL 3QQ4B 1FBIL 4J6RH 4PJ7A 5D1QD 5FHBH 2DQTL 5B22A 1KIQB 2ITCB 1EGJA 3MNWA 5TQ2L 4FFVD 5D1ZC 2F5AH 2X4UA 5HPMA 2XIDA 2FCBA 5ITFB 3CFBA 1CICA 1R5IA 3QHZH 3NFNA 3O3UN 4OCSH 2UWEE 4LKCA 2KZ1B 1ZWIB 1JUFB 2EKSA 2HH0L 4YXHH 3OJDA 1E4XL 3TJEL 4P5KB 1UXSB 1MCJA 5I1KL 4YZFF 5AG8A 2FATH 2X9YA 2BVOA 2BNRD 2DYPB 5JHDE 4GW1B 1DSFH 2FEEL 1U92A 2EYSB 5FYKE 3BIBX 1DBAL 4XHJD 5E94B 1GGYA 4ZQKA 1AKJA 3MV9B 4NQEE 5FA4A 3RGVB 5F89B 4XPHH 5IB3B 1N5AB 4RMSA 2OP4H 4GW4A 1AHWC 1I85C 2Y06H 3P73A 3SCMD 2F54B 2A74A 4L8SC 5DD6B 3ZDZE 1T04A 1UB5B 4K2UH 4WEBH 4JJHA 3V0VB 1VACA 5DMGD 1QFPA 4OFYA 2GTZA 1OLZA 5TFSH 3IJHB 4PB0L 3CMOH 4LAQL 2A6JA 2XFXA 1ES0B 2PO6C 1CLZL 5DRNA 5FO9A 1ZLUH 2HKHH 1XZ0A 1BFVH 3MGTB 5IVXE 4HPYL 1QTYT 3MRKB 2MWCA 1N0XH 3F12A 4GRLC 5J13B 3NFSH 3UO1L 3MLYH 3IU3A 3U46B 3VFGH 5H35B 4CNIB 5I74B 4KTEL 4EZMA 1ZS8B 5JXEA 5JQ6L 1JHTA 3CZJA 5F70A 5F96H 2W9EH 4PJAB 5DUMH 4WI7A 4HUVB 4ZO7A 3MREB 5J0BA 4F58L 3U36A 1H3TA 3KJ4C 2CRMA 3KPOB 2R0WH 1BQLL 1CICD 4XMPL 3EYUH 3CXDL 5FYLD 4MD0B 4K8RC 1VADB 1ZOXA 1PG7H 4ODUB 4LVEA 4NHCH 5GRZA 3T0WA 5T3XD 5FF6A 1C5BL 3FAXA 5CEZE 2FL5B 3FFCA 4OCWL 4U6YB 4N0RA 1BBJA 5D7KD 2AQ3A 4XCFH 1A1NB 3GSOA 3O2DH 5DJYA 2JB5L 3HHRB 3GO1H 4CJ1A 2A9MH 1NGQH 3SQBA 4NQVB 5JW4N 4PJDB 4Z7QF 2EYTB 1AKJD 1INQB 1D5XA 4DCQA 4WW1B 4WEUD 3IFLL 1I1AB 2ZUWA 2RIKA 4F7MB 5L2KE 4PRPE 2RB8A 1BHGA 1NDGA 2CLVA 2HMIC 2AJZA 2XN9B 4HKXB 4S2SA 4Y4KA 4ORGB 5HDBF 2QADB 3BT2L 2WINB 4LDLB 3V6OC 4XNMB 5F3HB 3LN4A 1MNUL 4LSTL 4OFYD 3CPLB 1JPTL 3N50A 1MCOH 5FGBC 1ITCA 4C56E 3H3PH 5BZDB 4UDTB 3ARDB 4S1DD 3V95A 4LSRH 3LQAH 1FBIH 2KPNA 1G7PA 3VG9B 2DQTH 4PLNC 1SVZA 4Y4FA 4QRRE 5TQ2H 3QCTL 3O6KH 3WUWB 3C8DA 4KKLC 5KJRL 3I6LD 3T2PA 4QHMB 2W65B 2NY6C 3HR6A 1MFBL 3O9WB 4JPWL 4X6CE 3S5LB 4Q9RL 4Q2ZB 2DQJH 5JXED 2C4FU 2V2TB 3EZ8A 5E8OA 2HH0H 1I8KB 5KVEL 4MAYB 5C0BA 1E4XH 3TJEH 2VLLB 1KEML 1CDHA 2MQCA 5I1KH 4S10A 5ESVA 3HLAB 2QSTA 1Q94A 5IHUH 5GZOD 4MS8C 2CO6B 1F4YH 3QDMB 3MODL 1K2DA 5DO2C 1DBAH 4WFGE 1NQBA 2HT2C 4OLWL 2ZNWA 3KXFA 5JOPD 5CJXC 3PHOA 3CU7A 1MJJB 4IJ3B 3SKOB 4BJLA 3FFCD 2VLKE 2MKWA 4KRPB 2FSEB 4MXVF 3LRHA 3VXPA 4PJCA 5FYKH 3MLTA 4HCRL 4N0FA 4I18C 3GMMB 4ZODA 4OAWB 4Y7MA 2YXFA 4EXKA 2A6IB 4PJ9B 3QJFB 4K8RL 1MAJA 1N59B 4KDTA 2MSPA 2DOCA 4XWOD 1X7QB 4GXUM 4PB0H 4L3AA 4LAQH 4TSCL 5AWNH 3AROA 3P11L 4WI5A 3ILQD 3BRGC 4GRMB 3WSQH 3NA4A 1IQWL 4QNPE 3QUXC 4P2OC 3DUSB 3D5OF 5L6YL 2VJXA 4MJIB 1KLUA 4Y4KD 3VWKA 5KSBB 4HPYH 3GJFK 4YDVB 3IS1X 3RNQB 3RZCC 4LGPB 4K23L 4Y8AA 1RVFL 5I1AA 4KTEH 1EVUA 4PRHA 1KIPA 5MERB 5JQ6H 5EWIH 4NUJB 1FNGB 1DVFA 2JK5B 1QSZA 3VGHA 4Y4FD 5IVOA 1EUUA 4F58H 3CH1A 3MUHL 5IQ9B 5LGHL 3PP4L 3UZVB 1BQLH 3GUTA 4YFLF 4ZFGL 4LPUA 3MLSL 4HGKC 2X4QB 4HFWA 2ARJA 3TCLA 2P42B 2CUMA 5D6DC 3TO2A 5C0BD 3O3AB 5C09E 5GS2H 1C5BH 2DQCL 1MVFA 3PDGA 4R4BA 3VFWB 3WO4C 4PJ5B 3PWUB 3BD4A 2JB5H 1WFOA 4PJ7F 3RTQA 3C6SA 2GUOB 2C26A 5EIIA 3IVKA 3KXFD 4Y16C 2J3SA 3I50L 1HHGA 4PJXB 3S7GA 3C9NB 1E27B 4J3OC 2P4AB 1S78C 1JWUB 3G5YA 3I75A 4CJ0A 1DP0A 3Q3GA 3BKYL 4U1HB 3NZ8A 3BT2H 3OR6A 5E99L 5EFIA 2X42A 1EEQA 1JV5A 2Z35A 5SV4A 1MNUH 4D0CA 1ZXQA 4LSTH 1CFTA 1HILA 1A9BB 4CMHC 4P3DB 4BSWB 4OZ4A 3VDCA 4PJGB 2BHZA 2PYFB 4YBQC 4Y5VA 4I9WD 3VWKD 4I2XE 3EDDA 4QT5A 3S36X 3WEXB 3QCTH 1MWAB 3QUZA 1AJ7L 5KJRH 1PYWA 3QJHA 3VW3L 1DBML 1MFBH 4PRHD 4Q9RH 1U8IA 2E9WA 3SBWA 4MWFA 3VGAC 3GJEB 2V5MA 5DK2A 4U0RB 1QEWB 2P24B 3D3VB 3TFKC 4EUPB 2NY4B 1KEMH 1DVFD 1FLRL 1XIWA 5DJDB 1NKOA 2XV6B 4HIEA 1BLNA 4QRSA 1F3JA 1I7TA 2BOBB 5DJ8B 4F57L 5FDWB 2ZNXA 4MA1C 1AXSB 4P23A 5D2LE 2EIZB 2PW2B 4OLWH 4EI6A 3TJHC 1A7NL 3QIWC 4Z78A 5FA3B 2ZZUT 4GMSH 1CFQB 1G7IA 2D31A 2EEDA 5DUPH 3SDXA 5B39A 5GIRB 3REWA 3W9DA 2M1KA 3FOMB 1FZKB 3MLWL 1AGEB 4HCRH 1TCRB 4HUNB 3RTQD 2J12B 1LILA 4TNVF 5E00A 3UP1A 4K8RH 2Q8AL 1CQKA 1AQKH 1ZLWH 4TSCH 3QIBA 3P11H 2W9LA 3WCYA 1RU9L 2JCCA 2HP4A 1FAKT 1FFOB 4WWID 3H9HA 1IQWH 3KLAA 1R6VA 4U6VL 5L6YH 4X9FA 1C16B 2E7CA 2LQRA 1P9MC 3CDGB 3WXWL 1OW0A 3OKEA 4M4PA 3P9WB 2OJZL 1JF1A 4FABL 3MNVA 2W07A 1JF5A 3DUUA 1RVFH 3SDCA 5C0EA 1HCVA 4HZAA 5B8CA 1ZTXL 1F11A 5D96C 3IDIB 4ZS6D 4LP4A 3GSXB 4NKOB 2GCYB 5LXGL 3LKPA 2EXYC 4PREA 3SEPA 4D2NA 5GQBA 4F8TA 5EH1A 5LGHH 3ZT7A 3QUZD 3QR2A 4ZFGH 3MLSH 5C0JA 4KHXL 3WHE1 4QRQA 3CSYB 3SDDB 1C12B 2IADA 3PG2A 4QXGL 2NXZD 1NFDA 5JNYA 4MJ6B 1J0HA 1SVCP 1KF9B 3EDFA 1U93B 1QVOA 1XIWD 4XX1E 1OGAB 5SX4H 1QOKA 2DQCH 1CLOL 1TQCC 2P48B 1M71A 1SBSL 3S4SG 1GCFA 4FZ8L 5E95B 1B9ZA 1FFQA 4H26A 5F7MC 4P23D 1HZHH 2P5WA 1DE4B 1B4RA 5DJCB 2EZ0D 1R0AL 2P5EE 1A21A 2X5PA 5FYJD 2ENSA 5F9WB 4HAFA 1T1YB 3B9DA 3BOVA 4KQ3L 4OD1L 5EOTB 3LSOB 3VXSA 1BOYA 5TE4L 4HS6A 1J86A 3P30L 1D6EB 2YRZA 3ARXA 5IROA 4UOJA 5FUCC 1VERA 4XPFH 3MOBH 1BZ9A 1IGJB 5I17A 5C0FA 1PD6A 3TO4C 4OZGE 3QIBD 5HYQA 1SJVA 4CADB 3GSUA 3SHSA 2NXYB 1TITA 4YO0B 1HH6B 4Z7WF 4PB9L 2Y5EA 1M6OA 3TA3C 3C60B 1J88A 4NWTL 1UQSA 1G1YA 1OM3L 4PLKC 1FVEB 1EO5A 3S4SA 2DLHA 1CLYH 3ARSA 1AJ7H 3VW3H 3SDCD 1DBMH 4XBPB 3REVA 5D7IE 5B3JE 1I9IL 2X1XR 4CW1A 2Z93A 4PGJA 2O26U 1BMGA 3GIVB 3B9AA 5F6IC 2D03L 5HHNA 1IE5A 5JO5A 2YD8A 4F57H 2BSSA 3FQWB 4TULL 1BX2B 1EDQA 4UNUA 4XAKE 3QUMH 4WWKC 2OXHA 4LF3A 5LGJA 4BH7B 1H3UA 5I1HL 4CKVX 4QCIB 1WCBB 4F9PC 3RZWA 5IGXH 4NKDB 1L6ZA 1A14H 3GSWB 3RVTD 1M4KA 4U1IB 3RVVC 1UXWB 5DRZB 5KSAA 3LRSB 2P5WD 3TCXA 4JZJB 1S8DB 4NRYA 1MIML 3MFFB 2XXMB 4XVJL 2Q8AH 2EDHA 3BD5A 3KDMA 1RZGB 2Q86B 2Y72A 1CBVL 1FZOA 4ZAKC 3HMXH 3RDTA 1RU9H 2XY1A 3VXSD 1KELL 3AGVA 5IOPB 4U6VH 1U3JA 4KWUA 5BRZE 3MRLB 1J18A 4R0LC 4M62H 2OJZH 1MAKA 4HS3B 4N0CC 4QF1A 4Y2DB 3WO3B 5D2NE 4MX7B 4JFDB 4W81A 4GAGL 2QKIB 4NQDE 1ZTXH 1AC0A 1FIEA 3O81A 4DUXA 5LXGH 3W0WB 3WE6B 5SX5K 1J11A 1WWBX 2ZUUA 5HGDB 3DIFA 5JA9A 5E8PB 3X17A 5EZOL 1I7ZB 4Z76B 1B3JA 4J23A 4XGZA 4KJYA 1RUML 2HJLB 1RUAL 4O00A 1QZ1A 3QWOB 1LDSA 2R29L 1FG9C 2YD9A 3TVMC 4QXGH 1UEYA 4F9LC 1OF2B 1CLOH 1D7FA 2ITDB 4M9PA 1SBSH 4QRPE 5E8NA 2DIBA 2H2PC 4X4YA 4K7PY 4FZ8H 2ZOKA 4KUCD 3UTSE 5IESH 1R0AH 3U4AA 4N1EA 3MLPA 4PP1C 3SO3C 5GGVH 3HA0A 1UM6L 2BRQA 1S7VB 2EH8L 4KQ3H 4OD1H 1Q0XL 4JJ5A 3QQ3A 3FN0H 5TE6H 4P4KC 4LLDB 5HD8D 4HIXL 3MRQB 3P30H 3MRGB 4E5XB 1F6FB 3BYYA 2VLJE 5KSAD 3BZDA 5FEBA 1CIUA 4FMFA 5IR1A 3OHXA 5I1CL 1HHHB 5IB5B 5AYUL 1A2YA 3OXRB 1T7XA 5K9OB 3BH8B 5MEQB 3HR5A 4LCWA 4AJ0A 2YC1B 1I75A 1XGYH 1JRHI 3RDTD 2V9RA 3IDYC 4KZEL 3X14A 1H5BB 1KC5L 4PB9H 3O11B 5FM8A 1A47A 2AXJA 1E4KA 4NWTH 4F33A 1JP5A 4R96A 3OZ9L 3QQ9D 1CTOA 4KK8D 3RY6A 3U30B 3SDXF 3L5WB 5BVJA 2R2EB 4BH8B 1NH6A 9CGTA 1RZIA 4IOSD 4UAOC 5I1GL 5ERWB 1I9IH 43C9B 2WV3A 4PRDB 2OTWA 5DJ2A 5GGSA 4GG6A 4NO3A 4O9HL 3GMLB 1N6UA 4JZOA 5C0AE 1QA9A 3VFRB 1T2QL 4HK0B 5C3TA 4BK5A 4GKSB 4YWGL 2P8PA 2JCCF 1T0MA 4Z6AT 5IF0B 2YD6A 2D03H 2F8XC 4ZPVB 4HIHB 2EE2A 4XC1L 4OLUL 1K4DA 4TULH 1FDLH 3UAJD 1A6TA 5E0QA 1MH5A 3V8CA 4YC2B 1OAXL 2R4SL 5F88B 4PTTB 4KFZC 5I1HH 4L29A 2HJFA 4K7PX 5HDQL 2YSSB 4HS8L 1MSPA 2Z4QA 1MF2L 1QSVA 1SEBA 1RMFL 5IHZA 4G8IB 4ZXBA 2EDLA 4XI5C 3ROLB 2UZIH 3SGDH 2SEBA 5IMMB 4FXKB 2OQJB 1DN0A 1ACYL 4JDTL 1UA6L 5IMKA 3MBEA 1F90L 3BPCB 1AGFA 4HHAB 1XH3B 1MIMH 4XVJH 3EO0B 3FAWA 4NQCA 1CBVH 4MQSB 2DDQL 4AM0B 4PRIA 5J9PA 5HGHB 2AJ3B 3RGVC 3MV01 1U8MB 1KELH 2YKLH 4E42A 4G7VH 2E9JA 2RQ8A 1NFDF 3DX6B 1T3FA 4HWZA 3HE7A 1VFAA 1RFDL 4DQOL 3BKML 4NC2B 4X5WA 4JFEA 4XCCL 1A8JH 3F7VB 1ZT7A 3GMOB 4LCWD 4GAGH 4M7JL 4X7TA 1VFMA 3NVQA 3AS3A 1AGCB 1HNGA 3UCRA 5I15H 3QH3B 1TXKA 1ORQA 3L3KA 4M3JA 2AXGA 1MCLA 1MFEL 5EO9A 4IRJA 3O2DA 3G04A 3OR7B 2VC2L 1MRDL 4HUUA 1PSKL 5AEAA 1HKLL 4XXDA 4DKDC 4RX4A 4ETQB 1RUAH 1F6AA 1AO7E 4G8GE 2H32B 2R29H 3DXAB 1HQRA 2VMFA 5I8KH 3HUJB 1QRNB 1X5ZA 3DNKA 2WLZA 3IDNB 4OZIA 1XCTA 1P1ZB 5IM7A 1EAPB 3I3EA 4JPKL 5F93C 1DLFL 1D5BA 1T89A 4BSVB 4WHCA 1F3RB 3MR9A 1UM6H 2EH8H 2XQBH 4W4OA 3NCJL 1Q0XH 4TOYL 4WV1A 4XP4L 1GYAA 2GTWA 4ZXBD 1CGXA 4HIXH 3S37X 5K59F 4QOKA 4UNVA 2WANA 3GBNL 4H8WH 3MBED 1J0YA 3VGBA 2YN5A 3DPBA 2P8MB 4LRNH 2MFNA 5I1CH 1HXYB 1LO5B 4RWYL 5AYUH 3W2DL 1DBKL 3F7YB 3IDGA 4NQCD 2YPLA 1N6QL 3IJSA 5KW9H 4PRID 4KUCF 2V2WB 4JKMA 4ZUUA 4IOIB 4KZEH 1KC5H 1HOCB 3O4LB 1P2CA 1I1AC 3HE7D 3OZ9H 3V0AC 1JGVL 4IHOA 3DMMA 2UYLB 2A73B 4JFED 2QADC 4ISVB 3B6SA 3HNVL 3WUZA 1I7UB 1X4XA 2WM0A 1MAML 1U8LA 3MLVH 4AG4H 1AGDB 1JWSA 3EIFA 3PV7A 4O9HH 3KPSB 3UBXB 3WNNA 4JFQB 4XP9L 2ZUQB 2NMSA 1T2QH 5JHDA 3L9RB 4IRJD 4YWGH 4FQCL 3VE0B 5KG9B 4JFOB 1XF4B 5C9KA 1UZ6E 4AENA 2ICWB 4GKNA 4LKXB 3VG9C 3WJJA 5D9SA 3QWQB 4XC1H 4OLUH 3QDGB 1K8DB 1QFWL 4RX4D 4QHKI 1DEEB 1GVIA 4HIJA 2RHEA 4JEGB 3UTPD 1CG9A 1OAXH 2HVJB 2R4SH 3O9WC 1CFSA 4R7NA 4YPGA 3RIAF 4PYGA 4YDLC 4HS8H 1MF2H 1KENL 1K3ZA 1CE1L 1RMFH 2VL4A 3QDAA 4MAYC 2R56H 2BXZA 2YD2A 4ZO8A 1GRWA 1HINL 2GJZA 3FZUD 4LDEB 4PP2B 5J1SC 3NFNB 4JVPA 2CIKB 1ACYH 4JDTH 4EIGB 4G6AC 1F90H 5C6TL 2EKSB 5C0DA 1LEKA 3W11D 1EH9A 3QZWB 3C2SA 2AGJL 3DVGB 2VYRE 2BVOB 2DDQH 5GJTL 4CN1A 5SWSE 2DQHL 3NCMA 4QOKD 2YWYA 5T5NG 4WFHE 4NO2A 3RVUD 4DQOH 2I26N 1LEIA 4JO2H 3BKMH 4R90H 4XCCH 5KBNC 3AS2A 4PJ9C 5DYOA 2YPLD 2VZOA 3SDAB 4LFHG 4M7JH 2G60L 1QD0A 2CJUL 1CL7I 4JFHD 3GSQB 3TP4A 1VESA 1O7VA 2I5YL 5TF1L 3F5WA 1EFQA 5JIKA 2LVEA 3K4DA 4J3WA 1MFEH 3DMMD 3U7WL 1ZANL 4OFIA 1Q9WA 5GGRY 2X4SA 2A6JB 2HFFB 1YMMB 2VC2H 5D1ZA 5I1LA 1PSKH 5DRNB 5FO9B 1QBBA 2YEZB 1WICA 4WHYH 4MNQA 2DICA 3WIFB 2GK0B 2Y7QB 4L8CA 4PRBA 5F1OB 4IMKC 1WIUA 5ISZA 1EVTC 5JHDD 3VXRA 4OI9A 3CU1A 1O7SA 4HAGA 3U9UA 3T3MF 2VE6A 3IU3B 2KDGA 4XNXL 4HIIA 3QO0A 4XHQA 1PFCA 1ZT1B 1YEIL 4JPKH 3HG1A 1IGIL 3LH2L 3OAZK 4JN1L 1VFBA 3RY5A 4NSKB 3NPSB 1OP3H 5IG7A 1RZKC 1AHWA 5DTFA 4TOYH 1I85A 3NGBC 4XP4H 4OZFH 1R3JA 2P43B 4GG6F 2ZKHL 2FECL 4L8SA 2EXWC 5I8CA 2BSED 3GBNH 5DRWA 1EEUA 4Z7VB 4HUWA 2KUTA 3OAYH 4FQLL 5FF6B 4RWYH 1WFUA 3W2DH 5ACZA 4QO1A 1DBKH 3V5KB 2IBZY 4X4ME 1N6QH 1IM3A 4FZEL 2Z91A 5DHYB 5BO1L 4OCMC 1OTSC 4NRZA 2R1YA 3I6KB 1T1ZB 3B43A 2H8PA 3AS0A 1D5XB 1JGVH 3ZDYF 4LVHB 4B50A 4GRLA 4JVUA 4M7LT 4JANA 3I9GL 3HNVH 3C08H 2I9TA 1MAMH 1PZ5A 1X6NA 1ZAGA 3QCVL 2ZJSL 1NDGB 4P2RA 2AJZB 4S2SB 5TF0A 1IEHA 4IBLT 5GS2D 3LN4B 5TDPB 1KPVB 4ZUWA 1NBYB 4FQCH 1DLHA 1PX4A 4HCRA 4NC0B 5D1ZD 2Z9TA 1TJIL 4X83A 3VXOA 2GAZB 1AQDB 1Z5LB 2F53E 5DR5L 1ZVYA 1QFWH 4MNQD 4EN3B 5KSBE 5DJZA 2Q3ZA 1KCVL 3RNKB 3GI8H 1H15A 5DF0A 5ISZD 3QFJA 3VXRD 3K81A 2PNDA 1KENH 1CE1H 1U58A 2GJ6A 4U0RC 5DT1L 5HI3C 3ILPA 2NY4C 5MENA 1S7QA 4PJBA 1YA5A 1HINH 1OHQA 1JNLL 1MHEB 2ICWJ 1R24A 1SYVA 3HG1D 3WS6C 5C6TH 2DKUA 1MCEA 4X6BA 3T77B 1T1WA 4LFHD 4CMMA 4TVSa 5JPMA 3MV8B 2AGJH 1WEJL 5GJTH 4ESKA 5TGBB 2VAAB 4YE4L 5DQJB 5KSVB 3MRFA 2DQHH 5CSZB 4LU5H 3L3IA 5DRXB 2EDTA 1NBVL 2IPKA 4TTGA 2IBZX 1OSZB 3B4NA 4CBPA 3KXFB 4Q9CA 3V6OA 2AJVL 5IFJA 8CGTA 5HGBB 2ICEA 4JRXA 4OZIF 1YPZE 2APVA 5FGBA 1JTPA 5FECA 1YJDC 4CDHA 2G60H 3VXPB 4PJCB 3U9PL 2CJUH 4LEOB 1RZKL 4G5ZL 4AIXA 5BOPA 3O0RH 2I9LB 1NGZB 1KB5L 2I5YH 3QPQC 3CMGA 5TF1H 4CVZB 3BVNA 5H2BA 3V52L 4LSDA 1S7XA 3U7WH 1ZANH 1ZHLB 3ZTNL 4FQJL 4X7SL 4GRLD 3WKNA 3GSVB 3QXAB 4FN0A 1A9EA 5E9DA 3RP1A 4LCUA 3WJLC 1W0YT 1KTRL 3JTSA 4P2RD 1JWMA 3HZMB 3PWPB 2AEQH 2CQVA 1NEUA 4BKLB 4ZMAT 5IEHA 2Q76A 2FWOA 4XNXH 1IGMH 3B5TA 4KI5E 1KIPB 1A6AB 1YEIH 3N1QC 3QO1A 4K8RD 3O6FB 1IGIH 5AD0B 1S7SB 3LH2H 3VFTB 1L0YA 4JM2B 3FO0H 3KYKL 2P7TA 4N0YH 1SEQH 1HKFA 2ILLA 3QFJD 4GLRI 2GJ6D 2FZ3B 1ROWA 3GUTB 4MXQC 5MEND 2DL9A 1HYRC 2XRAL 3VH8G 2VLME 4MNHB 5DFVC 4I18A 5IB4B 2HTKC 3TCLB 3D3VE 4CGTA 3MLXL 2DQGL 4AEHL 1C5DB 4FQLH 1WFTA 1UCTA 1KN4H 1T21A 4KRMB 1A1MB 1MJUL 3HZVB 5MP6H 3MV7D 3NCYS 2NZ9C 4LAJH 4FZEH 5BO1H 3STBA 4XH2B 4XRCA 3H3BC 1Q8MA 3QUXA 3BGMA 4I2XA 4P2OA 5ETUA 3C6SB 1B88A 4L8BA 5KTEH 2HMID 2R4RL 5FOBB 4ZPTA 2K3TA 4R4FL 3TBSA 2DJ4A 3WDIA 4JRYA 4JRXD 4MQ7B 1FL6B 3RZCA 3I9GH 4WU7A 4DUVA 3BEVB 2YXMA 2ESVA 3I75B 3QG6A 4YHOL 3DO3A 2ORBL 2ZJSH 3G5ZB 2B5IB 3DRQB 2WSKA 2VDML 2NXYC 4YHPA 4D8PA 4D0CB 2NY1B 3FT4B 3C60C 5HHOA 1NKRA 2FEDC 3VH8A 1FQ9C 2NTFA 3P4NA 4XPAL 3DO7A 2NX5A 3CCHB 1TJIH 4KKLD 1IAOB 2V7HA 2NY6D 5DJ0A 2G75B 5DR5H 5E9DD 4WW2B 1YJDL 4V1DB 4Y5VB 3OKLB 4WDIB 5C3LD 3QUYB 4PRAB 2GY7B 1VDGA 5DT1H 3VXMA 3HAEB 2WMPA 2DLTA 1N26A 3T3PE 1YMHA 3MRHB 1JNLH 1YN7A 3LEXB 4FTVE 2DWEA 4MS8D 3ZMRA 3I6GB 4MWFB 3RWHA 3GMRB 5DO2D 3TZVC 3TPUA 2HT2D 3NIFF 4G80B 4H25A 4Y16A 2UUDK 3TIEB 4HIEB 1WEJH 4PJHB 3K4AA 4YE4H 4G8FA 4QTHB 3MRNA 3BDXA 4OF5A 3C5JA 2AKRB 4NO5A 5ITBL 2OTUA 1GIGL 2R23A 2AJVH 1BBDL 3VFUB 3WS3B 2OM5A 2FJGA 1Z0MA 3PWVA 1G7IB 3OKMA 4JZJC 2HAZA 3LQMA 4H1LG 3SDXB 5C0CA 4KROB 3W9DB 2FBOJ 3HPJB 4HK3J 1FC1A 1RZKH 1MQKL 1T5WB 3QUXD 4P2OD 4JHAL 1KB5H 4QGYA 4AH2A 4O4YL 3V52H 2OR9H 5KN5B 3R0NA 4AEIL 2DB8A 1PKQE 3V4UL 3IGAB 2X10A 3BIAX 4X0KB 3ZTNH 3LS4L 4FQJH 5EU4A 3EOAB 4RFEB 2HT4C 4X7SH 4JRYD 4QRUB 3RZCD 2JCCB 4DW2L 4MDIB 5C6PB 3H2WA 3VI4F 5IEKB 5F7DA 1ZGLA 1Q9LA 1HCFX 1TFHA 2ESVD 3R8QA 3NAAL 3VXQA 1RK1B 1Z3GH 5BS0A 3TBTA 1XF2B 3T08A 2AQ2A 3BEWB 4LLWA 4LLVB 1BOGA 1YUHA 3LKQB 1NFIB 3MNVB 3RWEA 5HHOD 4O51B 3ZHDA 1J87A 3FRUB 5HYSG 2NX5D 3LDBB 3R1GL 5B8CB 4LLAA 1P7QA 4Y19A 1VFUA 4CAGA 4DK3A 1YY9C 1FZJB 2XQYK 5GRJL 3QIWA 1IARB 3KYKH 3U83A 1G7HB 4WEMB 4HKBA 4KHTL 3VXMD 4HUKB 1NCWH 1VA9A 4JFFB 4F7PB 3WHXB 3AU1B 3LIZL 4QRQB 4LCYB 5C0RL 4NO0A 1ZGLP 3MLXH 4OZGA 1XF1A 2DQGH 2H9GA 3AREC 1CIDA 4G3YH 1NFDB 5JNYB 1CFNA 4AEHH 3RWGA 1MWAH 4Y16D 1UH3A 3KHOA 1MJUH 3FOLA 5J6GA 3D39B 3D69B 5IB2B 4ONFL 3L5JA 3D87B 4LPYA 3PJSB 5C07E 4UIMB 1S78D 4EUPH 1U8HB 2P5WB 3CVHL 3L6FB 1UH4A 5DA4A 1P9MA 2R4RH 3FFDA 3UTTB 1FL3B 4MB4A 2COQA 3CZFA 2OZ4L 1T20A 5HYSA 4PJBF 3C5ZB 2DQFA 1M05A 1VHPA 3LRGA 4MNGB 3L5IA 5C0CD 5DD3L 1IILE 5LGKA 2ORBH 3F8UB 3LS5H 4M03A 3SE3C 2B20A 3LV3B 5D1XC 4YHYB 4YBQD 2CKBB 2NY0C 5I17B 3LQZB 1H5BC 4R2GB 3G9AB 3WV0A 1NGPL 3MO1A 1P7HL 1S7WA 4XPAH 2YUZA 4KKBC 3BKJL 2APXA 1FRGL 3U30C 5ADPL 2Q20A 2V5YA 2C1OA 3LMJL 1YJDH 4K94C 4P5MB 2J88L 2DM7A 1Q9OA 2JB6A 5DZNA 3BH9A 4DOHB 3TFKD 5BS0D 2ICCA 3HI5H 3STZB 3Q5TA 4JHWH 3KPLA 43CAB 4RISL 4YEFA 4Y88A 1LEGB 4YHZL 3EZJB 1ZLSH 2Z31A 3C8HA 4NPYA 3L7FA 1P7QD 4QXTA 4Y19D 1BEYL 5KVDL 2E8YA 3RKPA 3W0WE 4L4JA 4FXGA 1WBYA 1IAII 4NNPL 3VI3F 1JI2A 5ICYA 3GK8L 2QTEA 4JFXB 3TJHD 5DVMA 3V5DA 3QIWD 4YZFE 4JG0H 3KYOB 4RGNB 4YC2C 5HHNB 1T83C 2CLRB 1AIFA 3H9SE 1S9YA 1JPSL 2EDXA 5J12B 4F7CA 3Q6FB 1JYWA 4NO0D 4LSQL 5ITBH 1GIGH 1BBDH 4WI4A 1RIVH 2FJFB 2XPGB 3ISWA 3TO4A 3BP5A 2R69L 3U48A 1ZHKB 1T2JA 2BVPA 4N0UB 3U4EA 2IAMB 3WNMA 4ZYKB 1NCDL 4NNXB 1MQKH 4FA8A 2LVCA 4JHAH 1I1RA 3TA3A 1GZQB 4D9RE 1NMBH 4NRYB 3LN5A 5IJVA 1D5ZA 3TWCL 4AEIH 2WWMC 3KDMB 3IT8D 3V4UH 1HH9A 5ICZA 3LS4H 1FZOB 1R3HA 2CDEA 3CFJA 4FQ1L 1OAUL 4DW2H 3O8XA 1XCQA 1OP9A 3NAAH 4WI2A 4QHLA 3QCUL 1A6VH 5GGQL 4Z77B 4YHIB 2EXYD 4P2QE 4KDVA 1X6LA 4KTDL 3MBXL 4MA3B 3SO5A 5F8QC 5LBSH 5FKPB 1BGXL 2J8UA 2F19L 1FNEB 4WWKA 2ED7A 4P4RA 3VFSA 1J1PL 1JZ8A 5GRJH 2ZUYA 4JGJA 4GG8B 3TNNB 1KPRB 3EGSB 1P5VA 4F9PA 4XAWL 2DM3A 5GRUL 2ZSVB 5JIPA 1QG3A 2Z31D 1G1CA 1UZ8B 5CWSB 1ZHNA 1N8ZA 3G6DL 2WZPD 5KZCD 3W5NA 4K94L 2DIAA 4Z8FL 2IPTH 3IJYA 4MXWL 3U0TA 3QRFM 3G9VA 4ZAKA 5I8EB 4U1LB 5DQ9B 4X6DB 2JIXD 3RUGA 4YH6A 1MCKA 4LNRB 3QNXB 4LK4A 4Z7QE 1UACH 4R0LA 2KQNA 4MLSA 3GZKA 2XTJB 5JOEA 2G9HA 2YK1H 4XZUA 1BVLA 3TO4D 4CVUA 4JB9H 5GJSH 1KLGB 3S37L 4G6FB 5DD3H 2UVEA 1MPAL 3L3DB 3KPMB 8FABA 3L3OA 5KSUB 1HYSC 5HDBE 3TA3D 4G9DA 3U6RB 4HT1L 3T8XA 3FB8A 4O5LL 3ARGB 3QP3A 4PLKD 5D5MA 3HR5B 1NGPH 5M7QA 1U6AH 3U2SB 3ME0A 2ADIA 1NANI 4WHDA 3O8XD 3BKJH 1AP2B 4WHYG 2ADFL 1CS6A 5ADPH 5C8JA 3LMJH 2EDDA 4RIRB 2J88H 2IEPA 5INCA 4F33B 1CGTA 5CUSL 4KVCL 3BZ4A 4MD4A 4OZHA 3BDBA 3WYRA 3ZT5A 4L9LB 4R97B 2E6QA 3ZKQD 2JLLA 1ZVSB 3GMQA 1UKTA 4XNZB 2ZUQC 4RISH 4YHZH 1RUKL 5DMKA 1RZIB 4JO4L 1MCCA 5KVDH 1BEYH 4NO3B 3SGJC 2NW3B 3NBNA 1G7MA 4WWKD 3D18A 1GPOH 4NNPH 4P0DA 4X4XA 3PABB 3PIQA 4TUOA 1IGYB 4UT7H 3GK8H 2DTML 3O41A 4ODTL 1MJ7L 4L3EE 3KPRA 4V2BA 3MTRA 1OCWL 4OZFG 4P4KA 5IW1B 3U7YL 3X11A 4NCC2 1QP1A 2H2SC 2BRRL 4BA8A 1JPSH 5E4EC 3RVVD 1XT5A 1LK2A 2OCFD 4WFFD 4GT7A 4YXLL 5IV2A 4W4NA 5JHLL 1CD8A 4L29B 2ATPA 4X6FB 5CMAB 1A4KB 1WZLA 2XA8L 4W6YB 1INDH 3DV6B 5FHAL 4NN6B 4PGDB 4ZAKD 4IRSB 1RQ5A 4MXVE 3OJMB 3HPLA 5DJAB 1NCDH 3MNZB 1DN0B 3MBEB 2MPAL 3TWCH 4U1NB 2BNRE 5IIEB 4N0CD 4NQCB 1U2CA 4XP6H 1XR9A 1OAUH 1WVZA 5J11B 1KJMB 2VL5A 4JDZA 1SMOA 4OZGF 5KANG 3SDAC 4H0GA 4HWZB 3HE7B 3QCUH 5EC1B 1WWAX 3DX9B 5GGQH 4MB3A 2JJWA 1EEZA 4O2EB 1KOAA 3WDHA 4JFEB 4KTDH 3MBXH 4OZFA 3MMEA 1U36A 1ZT7B 3QQ4A 4U1GC 4NNYA 4KH2A 4I0PB 1BGXH 1JZ2A 1KIQA 1BQSA 3E6HB 2F19H 1JGLL 1OL0A 3T4YA 1HIML 5CGMA 1GHFL 5ITFA 3L3KB 2IPUK 1J1PH 3BXNB 1PVHA 4IRJB 5ECJE 2V2XB 4FOMA 1ZWIA 1OY3B 1JUFA 4HUUB 2Y5TB 2D7QA 4NRXB 4XAWH 5GRUH 1ONQB 4JPVL 3VD3A 4JRWA 3IDUA 3R8BB 4P5KA 2H2PD 4HGMA 5ID0B 2OSLB 1KG0A 1NC2B 5F9OL 3G6DH 3QXTA 4HXAL 2VIRB 4EIZC 4GW1A 3QXUA 4LNVA 4M9OA 4K94H 4PP1D 2EYSA 4Z8FH 1YQVL 4JHZA 4MXWH 5E94A 1Y6NR 3TV3L 4Q74A 3KPRD 3MV9A 4G6JL 4P4KD 3RGVA 3NPSC 3VD5A 4QTIL 5F89A 5IM7B 2BHUA 5IB3A 1N5AA 4PJ7E 1DEDA 4KUZL 3T0BA 3GMPA 4YFEA 2F54A 2OK0L 4M1DL 5ILTH 4CU7A 3TBVB 4LASL 4LARL 1CD1B 3V0VA 5FYLE 4WV1B 1BWMA 1P4BL 5I1EL 4BFIB 3RA7L 1MCHA 1MPAH 5DEGB 3IJHA 4QOKB 2MCPL 1ES0A 2IC2A 4HT1H 5D7KE 4O5LH 4DFHA 4BQBA 1J8HB 3MGTA 2OL3B 4B0MM 5GISL 3MCKB 3MRKA 3SJVB 4JGUA 1EHXA 4HGWB 1FGNH 2WUBL 4P46B 3U46A 4KVCH 3T0EB 4CNIA 5H35A 3BKCL 3CSBA 3V79C 1ZS8A 2XZAH 3ABZA 1IGTB 1X5GA 4PJAA 4LEXL 4HUVA 1KTDB 1U8LB 4JO4H 3MREA 2D7MA 5KVMC 2ID5A 1M7DB 1U41A 4UDUA 5BJTB 3KPOA 4PS4L 4Q6IB 2BZDA 2CR3A 4MD0A 1VADA 2DTMH 4ODUA 4EN3C 4ODTH 4WTXA 4OKDA 1EO8L 4P57B 3H0TB 3U7YH 1FFNA 5JTWA 2BRRH 4XI5D 4LVNB 4NYLA 4U6YA 5TQ0L 4YXLH 4XPBL 5ADOL 1PZUB 1A1NA 3WUWG 5JHLH 1EK3A 1CFSB 3BWAB 1EA9C 4LVOB 5I1DB 2EDEA 4NQVA 4ELKB 4PJDA 3FQTB 5FHAH 3S5LG 4C83B 1J0KA 2EYTA 2X4TB 5F44A 1INQA 1A6WL 2J8UF 4G43B 3MV9D 1NGXB 4KU1A 3RGVD 2H32H 4WW1A 5CS7A 4B7LA 3QULB 4UIKH 2BCKB 2MPAH 1LP9B 1F42A 3GJFB 1JGDB 1I1AA 2XWBA 4OM0L 2F54D 3WMSA 4F7MA 3SGKC 1E6OL 3HFML 1WC7B 2XN9A 3FB5A 4HKXA 4ORGA 2WINA 4XNMA 5F3HA 4JZNB 4F15B 3RJDA 2IANB 3CPLA 2X4OB 4ZUVB 5D72H 5JOPE 3BPLC 4UQ3B 3FN9A 5DI8B 2YA1A 1CN4A 3TH2T 3KYAA 1KIRB 2R2HB 1ADQH 4ELMB 5BZDA 3IYLW 3FFCE 4UDTA 1HQ4A 5EZJB 1I9JL 3E6FB 4FFZL 1LD9A 5FUZL 3RUGF 3BQUC 4CDGC 4NKQB 2NCMA 5EU7C 2MQ0A 3WUWA 1QSFB 1FZMB 2D7PA 2HWZH 1JGLH 1HIMH 2P47B 3BZFB 1GHFH 1ED3B 4MQXC 4QHMA 2W65A 5C86A 2D9CA 4MD5B 1U2HA 3PNWB 3O9WA 2VXUL 3S5LA 4Q2ZA 5D71H 4M93B 1MHHB 4NZRH 4ZO6A 1I8KA 4MAYA 4JPVH 5AAWA 2VLLA 1RHHB 3X13B 1SBBA 3HLAA 3G5VA 4LPVA 5KS9B 3OKOA 2HTLC 4LQFL 5F9OH 2UY7A 2FJHB 2EH7L 4HXAH 1KIUA 4OV5A 5D5MF 1D9KC 1P69B 3QDMA 1KTLB 3VXRB 1CI5A 3O6FC 1YQVH 3DTXB 5FKAA 3TV3H 1Y0LB 4JM2C 4YEEA 2DN7A 3M45A 2ZCKH 3KGRA 2APFA 4G6JH 4QTIH 1QO3B 1MJJA 3SKOA 4I48B 4OZHF 5L88L 4KUZH 2BVTA 1QKZH 2FSEA 1MCDA 2OK0H 4WUUB 4M1DH 4RDQG 2DKMA 4OAWA 3N1MC 1AHWB 2A6IA 4PJ9A 1KJ2B 4OCRL 3QJFA 1N59A 1P4BH 2CUHA 2GI7A 4LRIC 5I1EH 3RA7H 4KMLB 2MCPH 5C0BE 3PHQB 3P0GB 4HUWB 1I1AD 4GRMA 5DK3A 2DWDB 5AAMA 2J7LA 1RD6A 3DUSA 5F7HA 3PP3K 1IM3B 2XN9D 4MJIA 3UTQB 3GI9L 2QADD 2PO6B 3G6AB 5GISH 1QR4A 2EE3A 5C71A 4NRZB 4YDVA 3RNQA 3KXFE 1MCQA 3VA2C 4EEEA 3QEQB 2WUBH 2E27L 3LKOB 5SX4I 2B5IC 2PCPB 5A16B 2EE6A 3NACH 5DHVB 4JANB 3VD9A 4PJCE 4NUJA 1FNGA 1PEWA 5T1KB 2NY1C 4EKXA 5IQ9A 1UB6B 3SE4C 2X44D 5CGTA 4IIQC 4PS4H 2FH6A 2XQYG 4OJFL 2X4QA 3O9WD 3UPRB 4ZTPL 3QAZC 3I3BA 5MEOB 3KJ4B 3QUYC 4MAYD 3O3AA 1KB5A 2F9BT 4I9WE 3BESR 4D0DB 4KXZH 5TQ0H 4XPBH 5ADOH 3VFWA 5HHXL 1FNLA 5DWUL 2DI7A 4G6AD 3MA7B 4PJ5A 3HS0B 3PWUA 4KK5C 1IT9L 2VNCA 3QDMD 1IKFL 1T7VA 3K3QA 4WGWB 3TH4T 1H3VA 2GUOA 4PRHE 1A6WH 2UZXB 3RQ3A 4F2MB 3L5XL 4EUPG 4ODHL 3V6ZB 2XZZA 3Q1SH 4PJXA 1HHKB 3DVNB 5DFWH 3D1MC 1E27A 1YEKL 2CXKA 3A6BL 4OM0H 1BPVA 4X6BB 3WFCL 1JWUA 2VLRB 3FO1B 4S0SD 2B2XL 3HFMH 3G6JB 2PYED 3MV7B 1KTKE 4U1HA 4PJ9D 1XAUA 4D9LL 3VFPB 1YC7A 3U0WL 1ZLVK 1ZLVH 1H0DB 2IPKB 1IBGL 2YS4A 1A9BA 4BSWA 4KROC 1OT1A 4YIQB 1B90A 4PJGA 3RL2B 3DGCR 5E5MB 1JN6B 3IF1A 2PYFA 1I9JH 2Y1VA 4L4VA 4OB5L 4JY5L 4FFZH 4MJID 1MI5B 2I24N 5FUZH 5C9JB 1FNFA 3WEXA 1WBZB 1MWAA 3WD5L 5F9AC 5H2BB 3CFKB 1GGTA 2X1WL 4XMLL 3QG7H 1ZT4B 4WUKL 1GL4B 1XGUB 3L3JB 2EYRB 3GJEA 1QEWA 2P24A 3D3VA 4EUPA 1HHIB 2C1PB 3GSRB 5FAAA 5DJDA 1A9EB 4LCUB 1PY4A 2VDQL 4XB7A 4C55A 2IBGA 3WS6A 4LQFH 2CRIA 2EH7H 3LDBC 2BOBA 4POZC 5DJ8A 4F3FB 2VZSA 1AXSA 2EIZA 2PW2A 5FA3A 2I60H 1TENA 4FXLA 2DQDL 4ZUTB 2MCG1 2RBLA 1CFQA 4I0CC 5L88H 2EXWD 1EHLL 1NGYB 4LLQB 5CLTA 5FXCH 3FQUB 1J05B 4PJ5D 2WUCH 3SKNB 5GIRA 3FOMA 3PL6B 5CJQL 1AGEA 4MYWB 3RI5F 1TCRA 4ZFFB 4PJAF 1JL8A 4BZ1L 4L3CB 5BXFB 3CLFH 3P40A 1S9KC 4LPWA 4FQ2L 1OTSD 5EBWA 2BVEA 4F7TB 1FFOA 3HMWL 4XP1H 1T21B 2ZCLL 4MA8L 4OCXL 3GEWB 3NCBB 3CDGA 1JHKL 1MFNA 3GI9H 3MJ9L 2AK4B 1C08B 5JW3L 1TZIB 3C5ZC 3WJLA 1IC4L 3J7HA 4L8BB 3LVEA 1VEMA 5FYJE 2E27H 2VSCA 4KY1L 4DGVL 3IFOA 4PGBB 3TBSB 4PJDF 3WFDH 2FH8A 2YPVL 4RBPK 3GSXA 3RZCB 3SDXE 4L4VD 2GCYA 4NKOA 2VRAA 4YHYC 3U7AA 4OF0A 1ORSB 2BY1A 4R2GC 4JPIB 5T3ZL 3SKUD 4KJQC 2V17L 1I8IB 4OJFH 4XXCA 3CSYA 3QIUB 1MCSA 2JCCE 5GXBB 1V3KA 3P4NB 4XMKL 3D3VD 5HI3D 2NY4D 4MJ6A 2A9NH 1L9MA 1U93A 1OGAA 5E5RB 3DUHA 5HHXH 5DWUH 4Z9KB 4FQQB 4NN7B 1IT9H 3C09B 3EHBC 1KJVA 3BZEB 1DE4A 5DJCA 2BMKB 3B8SA 1Z0NA 2DWEB 3L5XH 2VO5A 4GAYA 1WF5A 4ODHH 4RGNC 1VFOA 3AB0B 3LSOA 3GNML 1LE9A 1YEKH 3A6BH 1L9NA 3WFCH 1C1EL 1OT2A 2B2XH 2F8OA 5DA0B 2GSGB 1F00I 3LAFA 3CFDB 3OGOE 4D9LH 4FFWC 4PGEA 3U0WH 2AV7B 3EDJA 3HC4L 2FYYB 4OLYL 1NFDE 4RQQB 3QPQD 4CADA 2IAMC 4HW6A 3B5HA 4YO0A 1HH6A 2X4RB 1V3LA 3OKMB 3C60A 2L7UA 4P2CG 4OB5H 4JY5H 2DIJA 4OI8A 4YHKL 1EJ6A 3OV6A 5JZ7C 3K8LA 1FVEA 2P5WE 4M8QA 3FB6B 3U1SL 4QHKJ 3WD5H 5EIVA 3LB6C 1FO0B 4XMLH 4XBPA 1CYGA 2AW2A 3VXSE 3IDXL 4HBQA 3S96B 1QHPA 2J8HA 3DROB 4LHUB 5DVKA 4GO6B 3GIVA 5H37H 1T0PB 1KV3A 2VDQH 5BV7C 5MHSD 4K71B 3VGAB 2OZ4A 2NY2B 4J3XA 2L4OA 1BX2A 4LLWB 1BOGB 1YUHB 1W0WB 5KSBF 4AMKL 3VCLA 5HJ3B 1YN6B 1B6DA 4BH7A 4L5FL 5E08L 4MXQD 5HVHB 1E0OB 1NSNL 2DQDH 4MA1B 2R0KL 1WCBA 1OGAD 2CKBL 4UV7L 5DFVD 1EHLH 2HTKD 4NKDA 3CK0L 3GSWA 2PUQT 4MHHG 4U1IA 3DGGB 1UXWA 1I3RB 5DRZA 3T04D 4H1LB 4NM4L 4BZ1H 4NHUB 4JZJA 1S8DA 4HJJL 2NZ9D 4W6XB 3MPCA 4RDQF 1A7PH 5K59E 4PY7A 2RCSL 4FQ2H 2Q86A 4FG6C 4DGYL 3RPKA 5ESAA 3HMWH 5IOPA 4RAHA 2ZCLH 3HAEH 1IZJA 4MA8H 4OCXH 1TNNA 5T1MB 1U95B 3DYOA 4ZOEA 3MRLA 3MJ9H 2XTJC 4XTRC 4HS3A 5JW3H 4EDXB 1YNTB 4MX7A 4JFDA 5CZKA 3RVXC 4JGMA 1IC4H 3CDCA 4LLUB 1WV7T 1BF8A 3FFDB 4KY1H 4TN9A 4DGVH 2NXYD 2YPVH 1GGBL 2R0LH 2DQFB 3C60D 2FEDD 3W0WA 3BP4B 5EU5A 3WE6A 5IFHH 3ARGC 4PJXF 3SN6N 4XB8A 4NJ9L 5E8PA 5FYJH 4K3JL 3VXNB 1I7ZA 4Z76A 2V17H 3EFFB 2IPUG 2VXSL 2EDOA 3OKDB 3GIZL 1R5WB 2IALA 5EPMA 3L1OL 4DGIL 5E1AB 3QWOA 1LVEA 2VH5L 3BAEL 1A3QA 5HVWA 4OIIL 5F1NB 3PWNB 1FNAA 4R97C 1OF2A 2C1OB 3GHEH 1G7JB 4PJGF 2JB6B 4XNZC 3C5SB 2D2OA 4WFED 4BUHA 1EO7A 3UPCA 3AREA 4WGVB 2NY5C 2E7MA 2J4WH 1YEHL 1EMTH 3FTGB 1TQCB 3ZE0F 2IMMA 4OKVA 3EDKA 3E2HB 1UWXH 3GNMH 3MRPB 4LLDA 3MQIA 3SE8L 3NCYP 3MGOB 4BM7A 3MRQA 5ICYB 3BP6B 1C1EH 5BV7L 3V5DB 4E5XA 1CXKA 1ZSDA 3NIGE 4RCAA 4UZGA 3STLA 4EOWL 1Z6JT 3BGAA 3KYNB 1HHHA 5IB5A 2JIXB 4LPTA 3OXRA 5K9OA 3HC4H 3BH8A 4OLYH 2YC1A 3SE3A 1PQZA 5F7YC 4IRSC 3U4BH 2CGRL 2FX8H 1MCNA 2IQAB 5F7EL 1DJSA 1H5BA 3ARTA 1DQLL 3O11A 2X9WA 3A67H 1NUNB 1U8PB 4M6NL 2BVPB 3U4EB 2FIRT 3MV11 1VPOL 3KPPB 2FHCA 3U1SH 3ULVC 4JFDD 4LIQL 4I3RH 2R2EA 2DQEL 4BH8A 1JTOA 3V2AR 4G8EB 4ZO9A 2D7TH 5ERWA 43C9A 4PRDA 2UY6A 5ICZB 3GMLA 1EX0A 2AJSL 3WN5B 3IDXH 5DLML 1U8JB 3VFRA 5DSCA 3W0WD 4HK0A 1G0DA 3GFUA 4GKSA 4HUXB 5IF0A 4ZPVA 4K07A 3I2CH 2PW1B 4HIHA 4I0PC 1MEXL 1YY9D 4LCWE 1L7IL 4R3SB 1CLCA 5CILL 5D7JB 3MRJB 4DN4L 5K9KB 4KV5F 1QLEH 5F88A 1T83A 4L5FH 4PTTA 2R1WB 2HG5B 2M2DA 2CKBH 4UV7H 2J6EH 2NTSP 3CFEB 3ROLA 3ARED 5IMMA 3WNLA 4FXKA 4KKNA 3LD8B 2OQJA 1HI6B 4NM4H 3BPCA 4HHAA 1XH3A 3SY0A 4HJJH 5A2IH 2CXGA 5EU3B 3EO0A 3E3QC 4GG6E 1XGPA 2RCSH 3TT3L 5AG9A 3F58L 4AM0A 4DGYH 5HGHA 1CFBA 4UTBL 2AJ3A 1SYSB 1H8SA 1U8MA 2QQNL 2WQ8A 3BPOB 3D85A 3PV6B 4C59B 5EBMB 1A02N 3DX6A 4ZAKB 1DFBL 1EEYB 2NY5L 2VR9A 3CD4A 2Y07L 1K8IB 5I9QB 1KYOK 1WUNT 4Y2OA 3GMOA 3FQNB 3LPGA 1AD0B 4JQVC 4JQXC 3SPVB 3ZDYE 2NY0D 4BUGA 4FFYL 1AGCA 4PJEB 3QH3A 1DQJB 1PW3A 1ZVHA 1IEAB 4KKBD 5KVFL 3OR7A 1W8NA 4APQB 1F97A 4NJ9H 5ALBL 3L3OB 4K3JH 5CAYB 4G9DB 2VXSH 3T8XB 3GIZH 2JELL 1BZQK 4NQCE 4PRIE 5HVFB 3PWJB 3L1OH 1A1OB 2VXTL 4DGIH 1XMWA 4P46C 1ND0B 1N0LA 3T0EC 1OAQL 2CDGB 2PTTB 5J1AB 3DXAA 4OIIH 1UWEL 3ZTJH 4R26L 3HUJA 5C8JB 1EUTA 1QRNA 5GS0H 2R15A 3IDNA 3RIFF 3UYRL 4S1QL 3SOBL 3TVMB 3FB7B 4JFEE 1P1ZA 3ULVL 5EUOA 1JZ6A 1EAPA 1YEHH 1RUQL 5EU6B 3TF7C 2C3XA 3GMQB 3PGFL 4Q6IC 1WTLA 4BSVA 3BE1L 3UBXG 3VGEA 1GGCL 1W2KT 1U3HC 5D7SL 2HT3C 2ZSWB 2Q1EA 3D18B 4BSJA 5E03A 3SE8H 2PTVA 4X4XB 3PIQB 4TUOB 3SO3B 3ZYIA 3CVIL 2YA0A 1ZA3B 5K9QG 1FNSL 1TTUA 1EERB 4JE4B 4EOWH 3IB4A 2P8MA 5DURB 1HXYA 1LO5A 4LVOC 3AM8C 1LK2B 3F7YA 3UTPE 4JKWA 1FN4A 2DKSA 5DUBB 2CGRH 4ZFZA 2V2WA 5F7EH 3TNMB 2H41A 4Z7UB 4PBXA 4AL8L 1DQLH 2WWMD 1HOCA 3D85D 3O4LA 2ZCHL 2VQ1B 4HMDA 4M6NH 1T0NB 3IDYB 2UYLA 1VPOH 2A73A 4LIQH 5C08B 3AFLA 2EIDA 4Y1AB 4ISVA 1OB1B 2DQEH 4F15C 1I7UA 4X8JA 3QZWG 5C0NC 5FB8B 2CIIB 1AGDA 4UILL 3V7AG 4AZ8A 3PQYB 3KPSA 5GHWL 2AJSH 4M5YL 3UBXA 1XR9B 4JFQA 5DLMH 5DVOA 2RAMA 1GZPB 4EDWL 4ZOBA 4QOKE 4UAOB 4UNTA 1BD2B 4JFOA 1XF4A 3SGJA 2ICWA 2DJSA 2FHBA 2LFGA 4LKXA 3EYFB 3PGDB 1Y6KR 1MEXH 3QDGA 1L7IH 2YPLE 1K8DA 3GB7A 3MMEB 5A40E 1Q72L 2ZG3A 1DEEA 4BQ6A 4DTGL 5CILH 5SWZA 4NNYB 3D2UA 4JFHE 2HVJA 3KPQA 3O3DA 3RWIA 2KQMA 3SJVE 3DXAD 4I5BA 4M93C 1A0QL 4ODVL 3T4YB 5E7FA 3TN0B 1QRND 2N4IA 3B2UC 5AUMB 5E8EB 1AD9B 3QA3B 4W6WB 2D9QB 3CUPA 5HI4C 3FQRA 4PP2A 2FGWL 2OL3L 2CIKA 2E7HA 1Y6MR 5DMGC 1HDMB 3ARFB 3D25B 2ICES 1WSST 3RBSA 1CDGA 4X8XA 1FL5B 1JMZA 5E70A 3QZWA 4MCZB 3DVGA 1KG0B 3F58H 5I30L 4UTBH 1AXIB 2RGSA 5JW5B 3ROOB 2W92A 2QQNH 3X12B 1IGCH 2PTUA 4WTWA 4Y4HB 4FQIL 5B38B 3JV0A 1DDHB 2APWA 1DFBH 2NY5H 1CXEA 3PGCB 1NC4A 2Y07H 5BZWA 1FVDA 4UINH 1CGVA 1MJ8H 4OGAC 1MRFL 3GMPB 1B0RB 5DQDL 3SDAA 2BHYA 3OKYA 5KOVC 1HYSD 5F1IA 1JRHL 3V6FB 4U7MA 5D7LB 3GSQA 3O45B 4WTZG 2YUVA 3O4LD 4RA3A 4NZDA 4RAVB 2FGZA 5KVFH 1SY6L 2XWJB 2HFFA 1YMMA 3FCTB 4WI8A 5ALBH 4QYOB 5GGSY 2CR6A 4P49A 2YEZA 1JGEB 2JELH 3EKCA 2VXTH 3WIFA 4U2YA 2PF6A 2GK0A 3KPSD 1UWGH 5EO0B 4F7EA 2Y7QA 1OAQH 4RRPG 1J7VR 3MACL 3F62A 4FMKA 4ELME 1U0QA 4BZ2L 4S1QH 3ULVH 4JHBA 1ZT1A 3QDGD 1IVLA 3T0VA 1RUQH 5E1HB 1FVCB 3PGFH 5SWZD 4U1JB 3D2UD 3L95B 4NSKA 3BE1H 1GGCH 1TZHB 5HYJA 2H2SD 2P45B 2RJMA 4RMWA 4UDUB 1E28B 3NIFE 4LSSL 4WTZA 4PBVC 4Q58C 4XP5L 1QLRB 1FNSH 5CJ8A 2AABL 4Z7VA 1R3IH 1FFNB 3NCFB 4MNQE 5KS9E 5EOCJ 4NYLB 1KULA 3V5KA 3IU4L 5FYKU 5DC9B 5DHYA 4IS6B 5ISZE 3VXRE 1MLCB 2JJTC 5GGUB 1TJGL 4TSBL 3I6KA 1T1ZA 3TT1L 4RRPA 1WAAA 1IM9B 1NC4D 1CE6B 2X1QA 3HG1E 3SGEI 5I73B 1JPFB 4KMQA 5HYIA 5LKNA 2BSTB 4MB5A 4FS0A 3DHJA 4HXBL 3UEZA 2XWBB 3SDAD 4KTYA 2BNUB 2HLAB 4UILH 1J1OL 2XOTA 2VDPL 3FB5B 4M5YH 5CJBA 5GHWH 3TBWB 1G7LA 2VZTA 5TDPA 4UTAH 1F3DJ 1KPVA 3VI4E 4OV6F 1S9WA 1NBYA 5I8OL 2ZG1A 1I3UA 1YMMD 2H3NB 5JUEL 3LKNB 2GAZA 1AQDA 1KJ2L 1HQ4B 1Z5LA 2EICA 5LJYH 5TJWK 1Q72H 4EN3A 4DTGH 3RX7A 3L5HA 3S3PA 3RNKA 1LD9B 3MRMA 4KAQL 4XCEB 4LSUL 3VFMB 4QWWC 1A0QH 1IEBB 1U8QB 3BFOA 1DN2A 2FGWH 1MHEA 3NN8B 2OL3H 1OP5K 3L7EB 4YDLB 5F6HI 1QUNA 5C0IB 3DLQR 5DVNA 4XNYL 5EBGA 4C54A 4MJ5B 3IXTB 4P2RE 3T77A 5T3XL 3G5VB 3DJ9A 5HYJD 3OKOB 3MV8A 1SJEB 5TGBA 2VAAA 2XZCL 5I30H 5DQJA 5KSVA 4OV5B 2ZPKL 5CSZA 1ODAA 5DRXA 3SGKA 4NBXB 5FKAB 4NQUA 2UWEB 4FQIH 5JW4R 1OSZA 3EOTL 3HUJF 3PL6C 1IQDB 1I1YB 1S5HB 4GBXB 1D5IL 5HGBA 5FDYA 1MRFH 5DQDH 2H1PL 1JRHH 3QFJE 5IT2L 4LEOA 1PG7X 2GJ6E 2PYEB 3LHPL 2I9LA 1NGZA 3MCLL 5MENE 4PJBE 4CVZA 3VRLF 12E8L 2Z8WC 2VOTA 4L8DB 3BQUA 5I1IL 1K3IA 1NEZB 2DI8A 1ZHLA 2C4XA 2W1NA 3F7QA 3DX7B 1CLZH 3GSVA 1GGIL 3QXAA 3ARBC 1Y18B 1NCCL 3MV7E 2XA3A 5A3IC 4J12A 1RJZB 3HZMA 3PWPA 1NCTA 1G9MC 3WIIL 3MACH 5T33L 5H37G 3GJFH 4OGXL 4BKLA 5F7NC 5HYEA 3UO1H 3V6OE 5C2BL 3JSSA 4DKFL 4BZ2H 1QFHA 4JRXE 1D9KA 1A6AA 3OSKA 3O6FA 5AD0A 1S7SA 4EN3D 5L8LB 2AEIT 3L3HB 4HPOL 3VFTA 1FFPA 4JM2A 5IVXB 3ZYJA 3QIUC 2I27N 3NPZB 2FZ3A 4U6HB 4XMPH 3VI3E 4LSSH 3CXDH 2J8OA 5IP4A 3HC3L 4MNHA 1P84J 4GJTB 4XP5H 5IB4A 1F8TL 2AABH 4NN7C 3NGBB 3C09C 2XKNB 5E9DE 1C5DA 4LRIA 1KB5B 4HMCA 3IFPB 4PYHA 1A1MA 4U7KA 3HZVA 4OCWH 3IU4H 4QXUL 3MV8D 3BUTA 3IXAA 4XH2A 5MI0B 4MMXC 3FJTA 5CEYB 3HAEG 3UTZB 4TSBH 5EZIL 3AB0C 3TT1H 2VISB 4DKAA 5FOBA 5DZLA 3KYMB 4XCYB 4F80A 4MQ7A 1FL6A 4HXBH 3IFLH 4NP4L 5FO7B 3BEVA 5DHXB 2E8ZA 2W91A 2YUWA 3G5ZA 1CL7L 3QRGL 4OGZA 5CZXC 1J1OH 3DRQA 2VDPH 4OLZL 4HJ0C 1IFHL 1RZ8A 2BOCB 1A7BA 1CDJA 4MJ4A 3BQUD 3CAFA 1JPTH 5I8OH 3FT4A 4Z95L 5I71B 3ZKSD 5GSRB 2NLJB 3SE4A 5FK9B 5JUEH 5DD5L 3CCHA 4MQXD 1TVHB 1IAOA 3MOQA 5L2KB 2F8VA 3IF1B 1KJ2H 2G75A 3M07A 4PRPB 4WW2A 3Q6GL 4HWUA 4L4VB 4V1DA 2AK4E 1YECL 3OKLA 3QBTB 4WDIA 4M7ZB 3PWPD 3NTCL 3QUYA 5SWQB 4PRAA 3HI6L 1A5FL 4KAQH 5F71A 3S98A 3BMVA 4LPCA 4ZNEA 2AS5M 5I16B 4LSUH 3CC5B 1U8NA 3CLEL 3HAEA 2HTLD 4C56B 3MRHA 4QKXB 4JPWH 1OTUC 2IH1B 4ENEC 3LEXA 3MJ9A 4GRWF 4JRYE 3I6GA 1D9KD 3MROB 4XVTL 4K71C 3GMRA 3O6FD 1ERNA 2NR6C 5KVEH 1OGTB 4XNYH 2ESVE 2NY2C 4G80A 4JM2D 1BZ7B 3TIEA 1G9ML 4X80L 2LU3A 4YDJA 3CX2A 4PJHA 2XZCH 4L4TA 3JTTB 2ZPKH 5HVHC 4NQXB 5DHVH 5HHOE 3MODH 4M43L 4QTHA 4X6CB 1TMCB 3UC0L 2CDFB 3MRDB 2NX5E 3JUZA 2XWTB 5DVLA 2AKRA 5IB1B 3VFUA 3H7BA 3K8MA 3WS3A 1CVRA 1D5IH 1BFSA 1AY1L 4HFUL 3QWRA 4N8CL 1UKSA 4DN3L 1TNMA 1OAYL 1JJUA 5IT2H 4U1KB 3HPJA 4PUBL 3R0MA 1F2XK 1T5WA 3LHPH 3VXME 5IW6B 3MCLH 4RMRA 5GS1B 12E8H 1NPUA 5EB9A 1BM3L 1DUYB 5KN5A 3VU2A 1CDIA 3Q48A 3IGAA 3INUL 4X0KA 4YGAB 4XC3L 3EOAA 1NJ9B 4RFEA 4ZOAA 4QRUA 2BK8A 5EBWB 2VLKB 1GGIH 4MDIA 5IEKA 1NCCH 4JO3L 4Z7VF 1X5KA 5A2JH 3EYVB 1DTUA 1F4HA 1RK1A 3HC0B 3WIIH 1XF2A 5T33H 3BEWA 4LLVA 2NY1D 3LKQA 1NFIA 4PJ8C 4R7DB 3TBYB 2M26A 4K23H 4O51A 5C2BH 3FRUA 3BHBB 3IFOB 2H26B 1ZHBB 1G9NC 5EBLB 5C0CE 4V1DD 4XVSL 4HPOH 1FH5L 4KRLB 1FZJA 2EECA 3QUYD 4TNVK 4A2LA 1ZEAL 4NDMB 5C92A 3KJ6L 5IBTL 1G7HA 1GSMA 5E24E 3MOAL 1NLBL 3PP4H 3QUKB 2AJXL 4JFFA 4F7PA 4KK5D 3WHXA 3HC3H 1A6ZB 3AU1A 1HXMB 1O0VA 1OQXA 4LCYA 1F8TH 1IL1A 5HGAB 5A2LH 1PX3A 5J89A 3TM6A 1FO0L 4QXUH 4K3DL 3D39A 3D69A 5IB2A 2WBWB 5BS0E 2QSQA 4L4TD 1KJVB 3PJSA 3E2HC 4UIMA 1U8HA 5EZIH 2GITB 1AE6L 1OW0C 3L6FA 4NBYB 2DLEA 1F4XL 3UTTA 4Y19E 1FL3A 1I7RB 2DTSA 1VGEL 5T3ZD 4GAYB 3I50H 5C09B 5K9JL 5BOZG 3C5ZA 5IMLA 2Y6SC 1LE9B 3QWRD 4KPHL 4NP4H 4MNGA 4OLVL 3G08B 5E6IB 4HC1L 5F9JA 4KROD 3QRGH 1CL7H 3BKYH 1N3NB 3LV3A 2ARJQ 5E99H 3HZKB 3MXVL 2CKBA 4PGEB 3V7MA 2J6EA 3LQZA 4GAFB 1GC1C 3CIQA 1QR1A 1N4XL 4Z95H 4XPTL 1KPUB 5DD5H 2CUIA 2BP3A 2MNUA 4P5MA 3BMWA 1MLBB 2MTPA 3NTCH 3MRBA 3O2VL 3HI6H 2BY0A 3ZTJG 4M8QB 3WN5C 1JI1A 2AVGA 3CLEH 4GKZB 3H3KA 3STZA 5CSBA 5J1TC 4PJCF 2L0DA 4BK4A 43CAA 1LEGA 1WZMA 4K3HA 3BP7B 4POZD 7FABL 4XVTH 3BRDA 1KCSL 1A4JB 1KCUL 4YQXL 3CVHB 3WNPA 3SKMB 4JFXA 1FLRH 1I4FB 5D7JC 3KYOA 4AQ1B 1G9MH 4X80H 1LE5B 3TZVB 2HN7A 2CLRA 4WU5B 2CSPA 5ELIA 25C8L 4JFFD 4DEPB 2OX5A 1OAKL 4M43H 2D0FA 5I76A 1RI8A 3ZDXF 3VCLB 3Q6FA 2JJSC 2I07B 3QHTC 4CUCA 2C9AA 1G9NL 4LOUC 1A7NH 3LD8C 5FGSA 3FT3A 5JW4M 2FJFA 2XPGA 1J9CT 1AY1H 1NAKL 4HFUH 4N8CH 1BVZA 3D39D 1S7UA 1ZHKA 4DN3H 2KL6A 4N0UA 4I13B 1P6AB 2IAMA 3LZFL 1V7NL 4ZYKA 4KZDL 4PUBH 3MLWH 3BJ91 4NNXA 3T0AA 3TLRA 3FQXA 4Y89A 2GW5A 5EO1B 4JM2F 4DVRL 4PY8I 1GZQA 2W59A 5D2LB 2EO9A 3OG4B 5GSVB 3UTTD 1T5XB 1ZK9A 3BPOC 1L0XA 3VRIB 4PY7B 3INUH 4XC3H 3C5ZD 3C8KB 3HCVB 5ESAB 1P4IL 5BQ7B 5I9QC 4JO3H 1XGQB 5H94B 5T1DL 3WXWH 2CH8A 2O5YL 1V7ML 2NYYC 3S3SA 4Z77A 5J56B 1IGFL 4YHIA 4ZNCD 4UOW1 4R2GD 5HHPB 1FYTA 5FUCE 4FABH 3V4PL 4MA3A 3DARA 4U0QB 5FKPA 4X7FC 4H0IA 4KJQD 1FCGA 5FO8B 4HEPG 2GHWB 4APQC 4HV8B 4O02L 1J0ZA 3ZO0A 1FNEA 1KT2A 4XVSH 1FH5H 5EU5B 1RJYA 1KCKA 5SX5H 4GG8A 3TNNA 1ZEAH 1KPRA 3W82A 2KKQA 3EGSA 5HPOA 5IBTH 1JZ5A 3MOAH 1VKXB 1MY7A 5CZVL 3D9AL 1GC1L 3OQ3B 1LO4L 2ZSVA 3PDOA 1T1XA 2AJXH 1TLKA 1B6UA 5EUKB 4KHXH 2IALB 5EPMB 3EHBD 1Q38A 1UZ8A 1NCAL 1P4LA 5CWSA 2W0KA 2WBJB 2VWEC 1F6LL 2MHAB 1L4IA 1FO0H 4K3DH 5HHQB 5I8EA 4RGND 1WWWX 3AREB 4U1LA 4WW2F 3EO1B 5DQ9A 1VSCA 4X6DA 3IRPX 4BQ8A 5JORB 4BFGA 4LNRA 4WO4B 1AE6H 3QNXA 1MHCB 3FO2B 2E6PA 1F4XH 2J8UE 2AXHA 4FFWD 4OKVB 1VGEH 1RK0B 1LWRA 3GGWB 5K9JH 4XCNA 4G7YL 3VXTB 4PPTA 4KPHH 4OLVH 1UJ3B 5TE4H 1U91B 4HC1H 1KLGA 4LLMB 2IAMD 3PDDA 3L3DA 3HE6C 2K7QA 4ODSL 1BQHB 2W0FB 1ZSDB 3KPMA 5EC2B 3KS0H 5KSUA 3STLB 3U6RA 3MXVH 2P5EB 3VJ6B 4WFFE 5GS0D 5TH2B 4ZFOB 4XNQA 3ARGA 5JZ7D 4PJHF 4U1MB 3S3JA 1N4XH 5I0DA 1PQZB 3U2SA 4XPTH 5D1XB 4H1LH 3UXFA 5GGVY 3LB6D 1AP2A 2O5XL 2NY0B 4LSVL 2DF3A 3LEVL 1NCUA 4UQ2A 3ZKMC 2LTQC 4RIRA 5DZOA 3MXWL 1OM3H 3O2VH 3RUGE 4L9LA 4X9HA 5HYFA 1FYTD 2YR3A 1ZVSA 2F58L 3HRZB 1OARL 3NH7L 1IC5L 2Z0BA 7FABH 5GRVK 4HZLA 2Y23A 1KGCD 4WJ5B 2NW3A 5EORL 2AJUL 1DR9A 3M17A 4YXKL 1KCSH 1KCUH 3PABA 1IGYA 5DSCB 4C4KT 4YQXH 4I4WB 5CP3H 4EQ3A 4TVPL 3W9EB 1UC6A 2GYSA 1GXEA 4GLRH 1OSPL 3V9FA 5IW1A 5D5ME 25C8H 2Q8BL 1OAKH 5D7IB 3TN0C 1X5HA 1Z9SA 2FX7L 3IDJB 5EZLB 5FFLA 2G2RB 5AZEL 1X9QA 1G9NH 1W72B 3OB0K 4X6FA 3R06B 5C0GB 4PRNB 5CMAA 1A4KA 4KKAC 3DV6A 3ARFC 4OZHE 4PGDA 4FG6D 3OPZL 4IRSA 2XKUA 2HVKB 4O2FB 4RAUB 5JIHA 4W68A 4KZDH 3LZFH 3T1WA 1V7NH 4G9FA 5DJAA 3MRCB 3MNZA 4EI5B 2AP2A 3SY0B 1TZGL 4Z5RB 4U31A 2GJJA 4U1NA 3RY6C 2XTJD 1XGPB 3S9DB 5IIEA 4XTRD 4Y4HC 4HEME 4PJIA 3RVXD 5D93B 1P4IH 3T4AB 1CXFA 1KJMA 4G6FD 3D85B 5EOCL 1S9VB 3FHQA 3KPRE 3UYOD 5T1DH 2AV1B 1QBML 2B1AL 3GSNB 5EC1A 3DX9A 1IGFH 1K6QL 4O2EA 4GOSA 1S7RB 2CKNA 3ARGD 4X9IA 3K8KA 4I0PA 3W39B 5IVZB 4ZS7L 3DV4B 3E6HA 4UI2A 3KLSA 4YFLI 5BRZB 1MOEA 3BXNA 4F37F 2V2XA 3QNYB 4JQIL 4S1SL 2PXYB 2V5RA 5EZOH 2Y5TA 1JCKA 4NRXA