5DJZA

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA01
4U1GB 2XZQL 3TZVB 4BK4A 2X4PB 3I3EA 2CIKA 1D9KB 1JRHL 2A6KB 3KYKL 5C0JB 4GS7C 3MJ7B 4IDJL 5IMKA 1HXYB 1RULH 3DGGB 1GPOL 4OZGB 2JJTC 2YD9A 1QBML 2IG2H 3AREA 1HINH 5C3LD 2CMRL 3QYCA 4WI6A 2LU4A 5DI8A 3LVEA 4WI9A 4PGCB 4L3ED 3RTQC 5HD8D 1CD1A 1QO3A 4V1DD 3N1PC 4RGOH 5ANMB 3FB7A 3GFUA 4U1HB 1BBJB 4WRLA 1PG7X 5HYQB 3TBYB 3ARBB 3DV4B 4PTUA 4RGNC 5GS1C 1EA9C 4DN4H 5E00A 5A2JH 1T5WB 3B9DA 3QP3A 4UT9H 1H5BC 5D2LE 2CO6B 2XN9A 5DJ6A 4LCWD 1MHEB 3FQNB 1H3UA 4Y4FD 3OWEA 1D5MB 3G5ZA 3SDXB 3CVIL 2X4SB 3UTTA 1A9BB 4NQCD 5D7IB 1JWMA 4PY7B 3W0WD 1NLDH 3SE4A 3DXAE 4M7LL 4OLWL 1ITBB 4MJIE 4NKOB 1P4BH 1S7QA 5BQ7A 1ZT4A 2VDKH 3IFPA 1OSPH 4H88H 3HAEG 1XT5A 2GHWB 1ACYH 2YPLB 1A7RH 1OGAD 1ZHBA 2FATL 4XP1L 1ODAA 2RFXA 3HE6C 2DJ4A 1U95B 1AXIB 3IKKA 2X4NB 4NRXB 1CG9B 3TN0D 1X5HA 4IEFB 1CDCA 4GRLC 3V5KA 4A6YH 2BNQA 4MDJA 4YDKH 4HAGA 5IQ7L 2EIDA 3ARVA 4G8GB 2OI9B 3MREB 4F3FB 3DIFB 3KLDA 4NQUA 4F7PA 3L3KB 2AXHA 4OCSH 2FRGP 3P4NB 5KVDH 5DSCB 4P4KA 2VZ3A 1JHTA 3HNSH 4ZUVA 5MERA 4JQXC 4ODSH 2AJXH 4F37F 1S9VA 4JQVC 1JYXA 3BZDA 1C12A 4FXLA 5F6HJ 4WTZG 3MO1A 5C8JA 5F7FA 3KLSA 3BZEB 1KN4H 4L3AA 1RIHL 1X5GA 1MUJB 4JZOB 3TO4A 3RX8A 2YD1A 5DMIL 1CGSH 3HB3C 4HS3A 3UTQB 1MF2L 2EE3A 3S4SG 3EO0A 4MXQD 3T2PA 3SGDH 1BZQK 5GGUA 2FLBT 1TZHB 1G7PB 4YHOL 1CDGA 1MQ8A 4X9HA 2BXYA 2NLJB 5F9WC 1NCTA 1UGNA 4MB3A 2ESVA 4X9IA 2BVQA 5IG7A 1LEIB 3WO4B 4WFEE 1TNMA 2QL1A 4MQXD 3KYAA 5TQ0L 4R97B 4EKXA 4NHUA 2OQJA 1WLHA 4ZODA 1GC1H 1DTUA 2R39A 4LVHC 1RPQA 5JW5B 3BW9B 2HJFA 2VJXA 4DTGL 5SWSD 3VRIB 4DFIA 5IEHB 3UYOD 5HGDA 1Z9LA 1CBVL 2VDNL 5DJAB 2BNRD 3RAJL 3PGDA 2EKSB 1BAFL 2XRAH 5FGRA 1LWRA 1F58H 5DEGB 1DBKL 3VFPA 3Q1SL 4AMKH 4KK9C 3HFMH 2XKNA 4NN6B 1BF2A 4KKBD 2CKBB 2X7LA 3C6LB 1P7KA 4KAQH 2ZNWA 1T3FA 5L2KA 3TA3C 5I73B 2IANA 2LTQB 4N8VB 3NPSC 4TVSa 4J4PC 2VLKA 5T1KB 3EAKA 4ZSOA 3O3EA 4O4YL 4JY4B 4OV6F 2GAZB 3RWFA 2Y7QA 4L3EE 5FO7B 1HSBA 3PP3H 3S5LA 2HT2C 2OZ4H 1P5VA 4K23H 4ZFOB 1B6DA 4X6FB 2DM4A 1IFHH 4MJ2A 5I9QB 3UPCA 2G75B 2GCYA 3QXVA 4JG1L 1J86A 5E24E 2LV4A 4IS6B 3QHTC 4U6VH 2YOCA 4HXAH 3DRTB 4Y5XA 2IMMA 4YGVA 4GSDH 4QF1B 3ALXA 4F8TA 1TMCB 1Z2KA 4LCWE 2R69H 2WIIA 3O3DB 2AQ1A 2ZUUA 1C1EL 1P2CB 2I9LA 4X4MA 1TPXB 3O45B 4MA1C 1KCRH 4RAHA 4EBQH 1FZKB 2NZ9C 5H94B 3DPBA 3LN5B 2DTML 1SJHA 2HT4C 4XVJH 5E5MB 3QZWG 4OZIF 4I13B 4Y8DC 3PWUA 1M71A 3TH3T 3VFOA 4JZNB 3VXRE 2J2ZA 4ONFH 3QI9C 1AP2B 2CR6A 2AV7A 1BVKA 2VH5H 3GSRA 4JGUA 5LGHH 4F7CB 3DX8A 2ZCLH 5AD0A 2CSPA 1FC2D 3MNVA 1S7TA 3VGDA 2A0LD 1FN4B 4KK6C 1ZGLA 1X5ZA 5FO9A 3F7YB 4HKJB 4PJHF 4PRBB 3O2WH 4FXGB 2BP3A 3WJLA 3ET9F 1IBGH 4EJ1C 1A21A 4U6HA 1CT8A 4Y5YB 4G5ZH 2W65B 5MP6H 1S5IH 3VFVA 1DL7H 3WCYA 2EXWD 1Q0XH 4J3UA 5A3IC 5I19H 1IC7H 1OAKH 4NQEA 4UINL 3F12A 2R2BA 1JYNA 3BI9X 1INEL 2HWZL 1WEJL 3BGFC 3M8OH 2ZUTA 5DJ0B 1W72A 4BZ1H 3PP4L 1ORQB 1QRKA 4MZ3A 5CJ8A 3V8CA 2PYFB 4Z7WA 1X44A 2Z91B 5CMAA 1A0QL 3FQXB 5H2BA 4GRMA 4RGMB 3K2UL 5F9DC 1NBVL 3GJFA 4O2EB 5C9KA 1I9JL 1NLBH 3MRJB 4PJGE 2YPVH 5DZLA 4JG0H 3M17A 1VFBA 3WS3B 1DQJB 1NPUA 4ODXA 3RDTA 1FO0A 1ZHLB 1WBYB 1JGVH 4P5TC 3WNPA 2YWYA 2YD8A 5H37G 1XGUA 4CMHC 5KVEH 5JUEL 1F4WL 4HC1H 2FSEB 1BQLH 2OJEB 1JWUA 4P2OC 1A2YA 2HRPL 5SWSE 5JLZA 5GS0C 2OK0H 5HYJD 2NY2D 5CBEB 4HMEA 4KROC 3CH1B 4HWZB 5T1MB 4X7TA 1J87A 3D85D 5CP7B 1EZVX 1LP9F 3S37X 4R7NA 4TTDD 1UH2A 3EOTL 15C8L 1DUZA 2J6EL 4R2GB 4OI9A 3SCMB 2UWEA 3QRGH 4FG6C 4MAYD 1X3DA 2MKLC 2NNAA 4XCEB 1XH3B 2HN7B 4YDVB 4X99B 1CFNA 3CLFL 4MD5A 4ZG1A 2ADFH 1ZSDA 2YUZA 2UV3A 5J13B 2BC4B 4Y19D 5CIPH 4PUBL 5JHDE 5DUML 1BQHA 1SJEB 1MFEH 3AB0B 1I3GL 1SY6H 1IGCH 4JY6A 2FWOB 1T7YA 4LLVA 2DYPA 5F96L 1DQLL 1I3RA 5JNYA 1RFDL 5HVHB 5SWZD 4J3SA 4W6XB 1TJGH 1UM6H 5I75B 2HFFA 2X89A 4HWEH 5IFJA 2VISB 1MI5E 3A67L 1U91A 1E4KA 1EAJA 1W0WB 4AEHL 5JDSB 4FQIL 1KB5B 3BN9C 2VO5A 3BYYA 3JWOC 4JFFA 3BP7A 3H3PH 4LCCB 3Q5YA 2O5ZL 5M7QA 2R1WA 4JFEA 2G9HA 4NZDA 3MNZB 3V4UL 2JCCA 3OJ2C 4FTVD 4MD0A 1HQ4A 1VESA 1IEAB 1I1AB 4YHPA 3CPLA 2W0FA 4GW4A 3R8QA 4HJGA 4X6EB 4XNYL 5D1QA 4HLZH 2FHFA 1HNGA 3RVWC 2DLHA 3GM0A 3FRUA 3MJ9L 4U1GC 2NY0D 4OKVA 4U2ZA 1NDGA 1S7RB 2HP4A 3L3HB 4D0BA 3WHE0 2GSIA 4U0RB 1EIBA 3ALPA 1LEGA 2NY5H 3EYFA 2EYSB 5DRZA 3O6FD 5DJCB 5GHWH 2NY3B 5C6TH 3V0WH 5I1CH 4MHHI 3OKMB 5TDOB 5E6IB 5GXBB 5BMFL 3C5ZB 4M8QA 3CFBA 3GMOB 2A9MH 1IKNC 2QR0A 1P6AB 4OBSA 5KSUA 3RNKB 4G6MH 4DN3H 5EPMA 1T7WA 4LNRB 4R4NC 4RIRA 4N0UB 5C7XH 2WK2A 3V2AR 3ARBC 5MEPA 2F8OA 1JYWA 4JM4H 2M1KA 1AO7D 1FFOB 2P8LA 3WS6A 1GIGL 2RB8A 4WEMB 3CFKA 4R7DA 2JIXB 3ESUF 4PLJD 3LPWA 3KYNA 2VLRB 1VDGA 3L5WB 4RZCA 5IW6B 4FQCL 4PJXF 4LSDA 4WHCA 3HHRB 4MNHA 3HZKB 1KPRB 4YQXL 1MJJA 3MRCB 4PGDA 5CLTA 5F7UA 2EDDA 3EO9H 1FCCA 3IRZA 5IB2B 1IAKB 3RUGE 3ZT7A 2EC8A 2QSTA 5FHAH 4J8RB 1PAMA 2PW1B 3MA7A 3QQ3B 5CEZH 3MBEC 2DIJA 3QA3A 1H8NA 2OLDA 4M1DH 3X13B 4XPHH 5TE4H 3OZ9L 4FQ2L 2VQTA 3DO3A 3SDCA 1KENH 3RBSA 2AJUH 4OF5A 2R4SH 4OI8A 4K3HA 3O6LH 4F7EA 4GXVH 1N6VA 2W9DL 4G80B 1SVZA 2DQDL 4QXGL 4IOIB 5DJZB 4PJ5D 3U30B 1A3RL 2OI9C 4M5ZL 3WMSA 1I8KB 1WBXB 3BP4A 1XGQA 5TJWK 2D2OA 3RP1A 4S0SD 3BSZL 3SDDA 1G6RA 5TFSH 1NFDB 3IKCA 5ALBH 4FQQB 4OI7A 2BVPA 2CRMA 3K0WA 3Q5OA 3IDGB 3MLUL 2ITDA 1F3JB 4I5BA 4Y19E 3PHOA 1ZA3B 2ED7A 1UA6L 5M94B 5DHXB 1BLNB 3MMEB 4YHML 1A14L 1AQDB 2OL3L 4G8IA 4APQB 3IDXH 3P4MB 3G5VA 5DRWB 5JPNB 3MRHB 4PGBA 5ID1A 1EEZA 2H1PL 5SWZE 3WFEL 5ECJE 3VMOA 4LRNL 1GAFL 4HUMB 2KUTA 3VH8B 1DUYB 1KULA 5INCB 5F9JA 4IMLA 4EN3D 2E9BA 2MCPL 1I9IL 1RJYB 4RAVA 3S34H 4X8JB 4LOUD 4R97C 4D3CL 2Y9RT 4MWFA 1LNUB 1G9NH 1ZT1A 3CZFA 3PWPB 3CFDB 5CJ5A 1PSKH 2OP4L 5D2LA 3PWNA 2BOBA 3HKFA 4NUJA 4E41E 3CSPA 4UDUA 4ZAKB 4D9QD 5LBSH 3SBWC 3TCLA 3WKMH 4DGVH 3NCEB 3NABL 4TULL 3WLBB 1X5FA 2WLYA 3DXAA 4X9GA 1EVUA 5ITFB 3C5JA 4MJIA 1Z9OA 3CCHA 4NN6C 4XBEH 3JVGA 2DDQH 4OQTL 4ONHA 4GBXA 4P4RB 3C6LC 3JWOL 4H25B 5AYUH 1GXEA 4OZHB 5J3HD 4ALAL 1KJVB 2LTQC 4N1EA 4PP1D 5J4MA 2R0WL 4LVEA 1QSEB 3BWAB 1CFSB 4DUXA 4LHJB 3TBSB 4P59H 3BKYL 4Y5VB 2R2HA 4H1LA 3NFPB 4WI4A 3DYPA 2W60A 4GG6B 1YUHA 1WT5C 5T5NG 5I9QC 1OAUH 1X6LA 4XP9H 4X7FC 3MPCA 1XZ0B 1R5VB 4GAYB 3BDXA 1AO7E 5JXAH 1RVFH 1WF5A 3EIFA 1CWVA 3KLHC 3GBNL 1VGKA 2DOCA 1CD9B 2J8UE 3B2VH 4PJ9A 2X70A 4FNLH 3CX5K 1UT9A 3QUZD 5H8DA 4DKEL 1IEBA 3R0NA 4ONGL 1DDHA 1AKJD 3TCXA 4KTDH 2FJHB 5DWUH 1TPXC 4OLXH 5F7HA 3JV6A 4HCRH 1NUNB 3P40A 3VFRA 4L4TD 1JN6B 2ZSVB 3DSFL 4YO0A 3W11D 1D6VL 5D71H 4N0FA 4QHNA 3KPLB 4NWTL 3OKLA 1KLUB 2WLZA 3OF6D 3EYQD 3FO1B 4Y1AE 5KS9B 3ULVC 4U0QB 1LE9A 3LKNB 1WZ1H 1Z3GH 5HGBA 3T0EC 3G6JE 3MOAH 4EDWL 4AT6B 2X9XA 4J7RA 4LU5H 2AK1H 4HXBH 2P48B 1QPXA 2GK0A 35C8L 4R3SA 2A6JA 2V7NA 3QQ9D 3VDAA 4GJTB 3TPUA 3MLWL 5D9SA 1H15B 3CLEH 4PJEF 1DSFH 2BSRA 1HZHL 4LLQB 2BSTA 2HJKB 4ETQA 5AEAA 1C16B 3U1SL 1VADA 2ZUQB 4Y5YC 3P30H 1MHHB 4PB0H 1I7UA 3U0PB 1W2KT 3OGCA 4NO2B 1YEHH 5DK2B 1XIWB 1ZE3C 3ARFA 4HV8A 4WW2A 4PJ5E 1FYTD 4WUUD 3ECBA 3F58H 1DQQB 4QXUH 5C08E 1TCRA 4LAQL 4QOKD 4HBCH 1JNLH 3LEXB 1KLGB 4AIXA 5I1EL 3BEWA 1HHGB 4X6CF 4YEFA 3T4YA 4ELMF 3NIDF 3BKJH 2VQUA 5J6GB 2UY7A 5GISH 1BFOB 1ZTXL 4Z7QE 5C2BL 1RURL 2XWTB 5IFHL 3OB0H 2AP2A 5JOFA 2FO4A 4RGMC 5C0BB 4DGYH 1HHHB 1V7NL 3C08L 1FV1A 1NEUA 2VC2H 2VL4A 4JN1H 3IXAB 3F8UB 1BBDH 1NCCL 3I9GL 1F3DH 2P5EE 4WGVB 1CLOL 5I17B 5C07E 5ICXB 4UUJA 2Z93B 1AH1A 2D31B 4X6DB 1B3JA 2ICEB 5EBWB 1HDMA 2XQYK 6FABH 2V2XA 1OQOA 5EIVA 3QEQD 4Q9QL 3B9KD 5D7LB 3MJ8A 4DQOL 8CGTA 1ORSA 4AEIH 5IVZA 1VKXB 3CVHB 2GJZB 4FQXB 1IAMA 4EI6B 2RBLA 2I27N 2WP3T 1A6ZA 3IDMB 4FZEL 3OAUL 3VXRA 4WEBL 1X6NA 4NQXA 3EYOB 4U1KA 2YUVA 5A2FA 5HHMD 2DQFA 3S98A 2J8OA 4R2GC 3T65A 3H7BA 3PJSB 5EU4A 5KVFH 1A02N 5B4MD 5I1DB 2IPUK 5I1AA 3WNNA 4ZTOH 3VD9A 5IQ9A 3BGAA 1QLEL 4KTEH 4EUPB 1RIUL 3Q3GA 3HZMB 1ZLUK 3D5OF 4QCIB 4X7SL 5DJYA 2DQHL 4DWHA 1LK3L 1LDSA 4L8CB 1MY7A 1KIQA 5F1IB 2RR3A 4HBQA 3NTCL 4P46B 2J4WH 1UXWB 2CKBL 5GGRA 3LKPB 5HVHC 2OXGA 3F6IA 4S2SB 3SE9L 5L6YH 2HG5B 4R96A 4N8CL 1U42A 5I75C 5CJQH 1DJSA 4O2CA 1OTSC 3U2SB 4L8BA 4NJ9H 3MCKA 5BZWB 5FYKE 4YHNB 3VXNB 1QVOB 3MRKB 1EJOL 4U6YA 2BCKA 4L4TE 5FYLL 1K6QH 1FVEB 1VGEH 2D7OA 4LCCC 2PNDA 4NC2B 2FR4B 2KPNA 4ZFOL 5DFVC 4PJGA 1HI6B 4XT1C 3LMJL 43CAA 2CXKA 2YRPA 1UZ6E 4LFHG 3EDEA 1XGRA 2VB5A 4Z9KB 1GCFA 4XCCL 4L3CB 1I1AC 4NBZB 2ED9A 4XI5C 3UYRH 5KAQG 5JW4Q 1K5NB 5D1XB 1PKQB 3AGVA 1KB9K 2VAAA 5IBTL 4DN4L 3RTQD 4U0RC 2APTA 2IPTL 1IC5L 4FFZH 2VLMD 4HIXH 4NT6A 1A64A 2W92A 3U4EB 5SWSA 4ODTH 3ULVL 3VXSE 1FYTE 5EN2A 2C4FU 1CYGA 1GHFH 4KQ3H 4RGND 4ZO6A 4PJFE 2A6DA 4G42B 5E6IC 3C5ZC 5EC2A 2FIKB 3I75B 1HEZB 3KYOA 4OD3H 4UDTB 3MZTA 3O6ML 1FNAA 3DGCR 1AD0A 1QQDB 3WFDL 1PLGH 5IWLC 5FK9B 5JQ6H 1BQSA 3TZVA 2WP3O 3ZE1E 5KSBB 1GZQB 3AM8A 1N0LA 4UMGA 5BXFA 2Z92A 4WDIB 3CD4A 2OYPA 3HMWL 1F6AA 2V2WB 3P9LB 3QIBB 4W70A 4W4NA 3RVXC 4JPVL 3TNMB 2B1HH 4QHUA 1II4E 5JHDA 4GMSH 5ISZE 4A6YL 5MEOB 4YDKL 4PGCA 4OFYA 2D0HA 1I3UA 1PYWB 3KPPA 1YEFH 3HE6D 3BXNB 3L1OL 1U8OB 5F7KC 3WXVH 1L6ZA 1UB6B 4KVCH 3V4VH 4OCSL 3H9HA 1X4XA 1KTLB 1YEJL 4GRLD 1NAMH 1AJ7H 1NQBA 1ZS8A 5KSVA 4UAOB 1FL6A 4LCYA 4F9LC 4WV1A 1MI5A 4OCRL 2M26A 3QQ4A 3RWHA 5ESVA 4MJ6A 4JPIB 5DJ8B 1Z0NA 1YQ2A 3L5HA 3VFWA 2X4SA 1M7XA 4HUXB 1NC4B 1OT1A 3LKOB 5HHME 1J18A 8FABB 3D39B 3MRDB 3S97C 3N50A 4ZYKB 3U30C 5CJXA 4YNYA 4JVPA 3WNMA 4DVBA 3GB7A 4PRPD 1A1MA 3KS0J 4M6NH 3HB3D 2FD6H 4Y89A 4WU7B 1NKOA 4KDTA 1YYML 1UH3A 1OGTB 1CXFA 3LQZB 3C8HA 4ORGB 3KPOB 1EEYB 4Q0XH 3BAEL 3BO8B 2NW2B 2AXGA 4NSKB 4HZLA 4LQ1A 5IROA 5GZOC 4FFVC 2EO9A 1F58L 4XAKD 3DROA 3B2UC 4MSWB 3VW3H 3MUZ1 5C0CB 4YR6B 4Z7OF 2JE8A 1Q38A 4OGZA 1ONQA 1IM9D 3AS3A 4NKIH 1KNOB 1J7VR 3QDME 1ADQL 2O5XL 2OM5A 4NZUH 5I8CA 3QXDB 2P7TA 4KK9D 3QEGH 3VWKC 4LSRL 4JZOA 4Q2ZA 3TA3D 4JFDD 3E6FB 4PRID 4K23L 3DVIA 3ARTA 4I48B 4J4PD 5J11B 4GMTL 1G7PA 4IHOA 5E8NB 1T89A 3RUGA 4F2MB 3V79C 4U6VL 2FB4H 5HYEA 3MRBB 2HMIC 2V9QA 5CILH 5JOPD 1DVFB 2HT2D 1XR9B 4Z7NE 3CUPA 1KCUL 2VLME 2ZWLT 4JHZA 4Z0BH 3HR5A 3NCJL 2R69L 3OKEB 4GRWH 4R8WL 4KRPB 1MEXH 3QIUB 2ITCA 4EBQL 1D5BA 3KPNB 2CLZA 4Y4HB 2Q7YB 1LE5B 4NQDD 4HEME 4NNXA 1SYVA 1WFTA 4HKBA 2GJ6D 4RAUB 4KY1H 4KPHL 3PGCA 5BV7H 2ARJB 2VKXA 4XP4H 3PWVA 3OKDB 4MNGE 4U1JA 4PR5B 2J8HA 2VH5L 2JB5H 2EKSA 3INUH 5LGHL 4QT5B 4KZEH 2P45B 4KJQD 2NZ9D 4MAYA 2HT4D 1IJ9A 2AABH 4YHKH 4K94H 3OKNA 4QTIL 1BIHA 3QB7C 1FG9C 5I76B 3QI9D 3TFKC 3PXJA 5MEND 4XVTH 1RZJH 2VDRH 3VFSB 4NYLB 5HY9A 4WW1A 2VXUH 4X4YA 4ZUWB 1A1OB 4Y19A 4FQPA 5C0EA 3NCMA 5MP6L 1S5IL 4LHQB 5HI5C 3GSQB 4L8SA 5CKAA 1YA5A 3K7UA 4KK6D 2VUOA 3ROOA 1JNNL 1GZPA 5JOEA 2BK8A 2ZOKA 4N90D 1OAKL 2IADA 4X6FA 2W0PA 2PETA 1KG0B 4U1NB 1MFDL 5EB9A 3D2UD 1MCHA 4JDTH 4JLRB 3GSOA 5MHSE 1VB9A 1U8QB 5A3ID 1TIUA 3AAZB 1AGEB 2DB8A 4XVSL 4LFHD 1MCIA 4QHMB 1T03H 2XWJA 4G7YH 2F74A 1N0XH 1EUUA 1LO5B 4E41A 3T04D 3UO1H 4XC1H 3VFMB 1SMOA 1XIWC 3JV0A 5IHUL 3GMMB 4XBPB 1L0YA 1OAZH 3UAJC 3FO0H 3WXWH 1AY1L 4BZ2L 5IOPB 3GSWA 1PBYA 2Z4QB 2R4RH 4DJMA 5CZVH 1FG2A 4EEEA 1I1YB 3VXME 1H3TA 4HC1L 3CMOL 4HDIB 5C2UB 3QXAB 4GAJH 3THML 2NMSA 4P5TD 4FXGA 5D1ZC 3VI4E 1JUFB 1A6WH 2YBRB 1JNHB 2IH3A 2AAVA 2HFGH 4H8WH 4P0DA 5DMKA 5EOCH 3VMNA 3H9SD 5E4EB 3MFFA 1BGXL 3KGRA 1RK0A 4LLUA 2P43B 2QHRL 1LEKA 1S7WA 4P9HC 4HKXA 2KH2B 4P2OD 4WJ5B 4RFNC 4ZPTB 5SX4H 4I8DA 4IIQB 4YFLF 3I6LD 4PJIF 5GS0D 2I24N 4KROD 3AXLB 4L1DA 5A1AA 3VXUB 1KCVL 4ZUUA 2Q8AH 3BH9A 3UTZA 4N8VG 1QKZL 3NAAH 2J8UA 1E27A 3ZHKA 3HG1E 4YK4B 1RZKC 1OCWH 3KYMB 5GGSB 2OX5A 3LEVL 3QCTH 3TO2B 4E9LA 4GLRI 1FRGH 4BUHA 4FG6D 2E7LC 4HJ0C 1G9NC 3EHBC 3MCG1 3BHBB 4KMTH 1HH9B 1CE6A 4Y1AA 5ITBL 1BJ1J 2CXGA 2ZG3A 3O4LB 5KOVC 1E6JH 4F33B 4B7IA 3G6JA 4YHYC 4L1HA 4HWEL 4LKXB 1WZMA 2F5AH 3TV3L 1JZ5A 2OJEA 5HGHA 5TGBB 5AAWA 3LZFH 3LQAH 1N64H 4L5FH 5IIEB 4XMLH 4RMRA 1ZANL 4GRWB 1IAOB 4PJGF 4RBPH 4JO2H 5IUSA 2E3VA 3IETA 1YDPA 5J0BA 1JGEB 2OTWB 2QSCH 4I0KA 5D6DA 1D5XB 2V7HA 1JHLH 4U4BA 4Z5RA 4YHLL 3BN9D 5E8PA 4P46C 2EZ0C 1MPAL 4CVUA 1KIPB 5GIRB 5C08A 4RMTA 3S9DB 4WFFD 1DFBH 3BDBA 4XNMA 1GGCL 4KI5E 3K2MC 2EEAA 1JZ2A 1F6LL 5DRXB 2D03L 3U36A 1KTDB 3QFJD 2PYEE 2QADB 3VFGH 3DI2B 2VE6B 4OQ1A 3G5YB 3NVQA 3RVWD 1UWGL 3L3IA 4M03A 3SDYH 1QA9A 2UYLB 2R2EA 4N90E 2YD2A 5KN5A 1R24A 1SJEA 3GSVB 1I1FB 4G6ML 1T5XB 3OJDA 2P5WA 5F88A 3MXVL 3ULUE 4BQ6A 4EN3A 2P5EA 2DQJH 3QAZB 1OP5H 2G2RB 3QBTB 4OUOA 5CGMA 3WL9B 5C07A 4GKNA 3OKOB 1EHNA 1BZ7B 5D1XC 5ERWB 3VRLF 4DKAA 3KXFB 5E9DB 2R9HC 3IDNB 3S88L 4BJLA 1KB5A 1RD6A 4R4ND 3N85H 2IAMB 2Q20A 3C60A 3ARBD 2X5PA 5EUOE 4PIRF 2FGZA 1A6PA 3OAZH 3X14A 3GIVA 1TDQA 5CCKL 3KWWB 1NCDL 5FB8B 4M9OA 3ARDB 2VDOH 1T22B 4S10A 4CU7A 4YX2L 1YZZA 3SGDI 4QHLA 4M1DL 1FNSL 2K1MA 5TDPA 1YNLL 5FYJE 4E5XB 5FDWB 4EOWL 2GIYA 4FZ8H 3O0RL 2EDRA 3QIBC 4S11A 32C2B 4TUOB 5JIPA 4OUUB 2OSLA 3MBED 2Z9TA 3LV3A 3W82A 1FNGA 4J12A 2QQLH 4YE4H 3WIHA 2ATPB 3BE1H 3I6LE 1CLZH 2QHLA 5DVLA 5CJOH 4GKZA 2MSPA 2F5BL 2JF1A 4U6TA 2ZG1A 3K46A 3DRQB 1P9MC 3GRWL 3IRPX 1ED3A 1A1NB 3RL2B 5ALBL 4TN9A 4UAOC 2D7TH 5E2UL 4LVNB 2GT9B 1YY9C 1U93A 2GYSA 1G7JB 4WO4B 3GBML 1W0VA 2FLRT 4P9HL 4AK1A 3IDXL 1BJ8A 1T1WB 1XF3A 4TNWK 5BS0A 2C9AA 5FHBL 1QSZA 5FECA 4P2RB 2F53E 5HHPA 3QSKB 1A3QA 3DHJA 1X7QA 3N06B 1F90H 5GGTH 1JCKA 1KACB 5DFTA 2APXA 1UXSA 5DMGC 3BUYA 1RZKL 2R0LL 3VGHA 5HHQA 3J7HA 1DANU 3OXSB 3SKMB 1UVQB 3MZGB 4HS6B 4NZRL 5CKGA 4TQEH 3CVHL 4P2QE 5D72H 1Y6KR 3ILPB 1FL5A 5M95B 2OR9L 1XEDA 1HCFX 3MLXL 3JTTB 4PJCE 4ZTPH 4QXTA 3BIAX 4FQ1L 3VXSA 1FYTA 5ICZA 3L3GB 5C09E 2Y5TB 4PJFA 4WFFE 1FC1A 2C7UA 4M7KL 4LARL 3RUGF 2ICWI 5IHZB 3BPCB 2FYYB 5HHOB 1REIA 5L9DH 2JB6B 3HPLA 3AU1A 5AYUL 1B0WA 2WANA 3GMQB 4KRNA 3IDUA 4MMXC 1EO7A 4NUGL 1AQKL 1JMZA 2YSSA 4UOJA 5F9OH 4KQ4L 1C5DA 1TTGA 3ZLQC 5LQBL 3C6LD 3OV6A 3P4MA 3MCLL 2YA0A 4WVRA 1A6AA 5ISZA 3Q6GH 4JQIL 3MROA 1OAUL 5EZIL 1IGTA 5J11C 4XP9L 5T1KD 2PTTB 4WCYH 4P23C 1T1XA 1NC2A 2CRZA 1QFPA 1TVDA 5JXAL 2Q86B 2GQHA 3CC5A 1JZ8A 1ZT7A 5FYLD 3V6ZA 4DGIL 3LDBB 1T20A 2P8PB 4OZ4A 3B9KA 3ZDYE 1OTUC 2NY4B 3SE3A 3TBTA 2CGRH 3QIUC 3EZ8A 3G5XA 3MUJA 4M7LT 2OR7A 4OLXL 4Y4HC 4HCRL 1A3LL 2C1OA 4ZAKA 3KLHD 5GRUH 4Z78A 1EBPA 3FFDA 3PG2A 3O3AA 4PD4J 3AVEA 4QGTA 1OT2A 3S36H 5F97E 5C0FA 2DI7A 1Z3GL 2EH7L 3RPIA 3MRQB 4HGKC 4Z95H 1U41A 3B5TA 4GUPA 4QY8B 2AK1L 4HXBL 4PLKC 5DQDH 1UM5L 1MCSA 4PV8A 3D3VE 2V17L 4H0GA 1I7RA 1LMKA 3KPSB 3L5XL 3L7FA 5FM5O 1WTGT 3ULVD 4YIQB 2GY7B 2XACC 3T0ED 1CGUA 1QSEA 2DTSA 2ZOLB 5EU5B 2WZPD 5B3JF 3P30L 2HFTA 3VXPA 5I1LA 3FFCE 1YEHL 4FXKB 3LEYH 1CLYH 1CGXA 4JAMA 5GS2H 4U3HA 3F58L 3G6AB 2VXQH 4AH2B 2I26N 1JNLL 2EDKA 4EQ3A 1OAYL 1EXUB 3EYSL 4G6JH 5DK0B 3STZA 2DQUH 3FQUA 3OR6B 4GAYA 3SHSA 4AG4L 1PGRB 1KTRL 5EZOL 3SKNB 5GISL 4NBXB 5DC9B 3GMLA 2Z31B 5I16A 3QDMA 2WQ8A 2Z8SA 4EIGB 2XOTA 2K7PA 3EJZC 1VHPA 1SEQH 1NL0L 1PZ5B 4HPOL 4POUB 3L3DA 3DBXB 5I8EA 2D3VA 4KKLC 1NMCB 1U8MB 1I7TA 5IMOB 1K3IA 4LCIH 1H8SA 4TSBH 3U7YL 3VH8G 3H0TA 4MNQB 5FKPB 1BBDL 1KLUA 5DHVB 2NW3A 2JJTA 3I02B 2YMXH 5IW3A 4DVRL 4R26H 3M1BA 3LH2H 1F2XK 5C9JA 1P7QB 5EUKB 4J3OC 4X0KA 3RTQA 3VXOB 2Y07H 3BISA 2K9UA 3IJSA 3LKRA 4Q74A 1OTTC 2YA2A 5I0DA 4FS0A 4PJDE 3IS1X 1UEYA 5E4EC 3QRFM 3HMXH 3FOLB 5IB5A 1S3KH 2I60H 4JY5H 3T77A 5ESQB 2BRQA 3V5HB 4MNGA 4LLMA 1KT2B 4ZFGH 3G6JF 3NFNA 4WWKB 1HH6B 3CXHK 4M1GH 1YYLL 1MJ8H 3WNLA 2YPKB 3BH8A 5EO0B 1TJIH 1RUPL 3GKZA 3VRJB 4KTEL 4NFBA 4XCYA 3S6CA 2DQGL 2QEJA 2X4OB 2MQ0A 4LHUB 4YK4C 3OKYA 4XTRC 3IJYB 5DYOB 4R2GD 2EYRB 4RSVA 4OV5A 2K3TA 1FZJB 3QG7H 2CK0H 2DKUA 3PDDA 4QLRA 5ALCL 3BZFB 4PJ8A 1X5IA 1JV5B 1ZHNB 3PWJA 4QGYA 4UNUA 1KPUA 3TJEH 4XBGB 1A4KA 1J1OL 2J88H 3DOSA 5L6YL 5GJSL 4JM2A 5I17A 3WDHA 1UB5A 1AGDA 5CJQL 1J0JA 1YMMB 3MNWA 1NFKA 4D94A 2CD0A 4Z7QF 1BIIA 3QDAA 2AEPL 1R5IB 4JPKL 3SDAA 2LVEA 1VGEL 3QDJD 1QRNE 2WQRA 2JKXA 1NGZB 3FQWA 3NZ8B 4TVPE 4QHKI 3EFFB 3I2CH 4K3GA 1OTSD 2X4RB 5DD0L 1KXQE 2R2CA 5IJVA 5BZDA 1QHPA 1NGPH 4JFHE 2EH8H 3UTSB 4PG9A 3PJSA 5JA9A 1NUFA 2V5SA 5DFVD 4D0DA 3MGTB 1GGIL 1MJ7H 1ZHKB 3VXMA 4QRRB 3L9RA 3FT2A 5T1LD 3T0EE 3GJEB 1MRDH 3MUGB 3BVNA 3VFTA 3I50H 1I1AD 4XI5D 5DJXA 4XP6H 3EUUA 2JK5A 2IQAA 1T0PB 4JDZA 4OT1H 1U3ZA 4JKPH 4OZFA 1A7NH 1EPFA 1DQDL 3CFJB 4NDMB 1IC4H 2IGFL 1Q9WA 1E6OH 1EZVY 1YEIL 3QUMH 1PLGL 5D93B 1NGXA 4N8PA 3QAZC 5ACLA 3RIFK 5TE6H 1RU9L 1S9XA 4JB9L 5E6ID 3C5ZD 5EZJB 3MA9L 3QCUH 3CFEB 5BZWA 3VXNA 2XXCB 4CVXB 3HG1A 5IK3A 5IM7B 3ARQA 1A6UL 2R23B 2IAMC 5TPWH 3IDJA 5IEKB 5JDJA 4S1QH 5CS7A 3ZE0F 3D6GA 3DI3B 4BFIA 2ATKA 1OQXA 3S35H 3VFUB 3WXVL 2V5RA 3D0LB 3GK8L 3HLAA 3Q6FA 1ZV5A 4NWUH 3RVXD 1KJ2H 4WY7H 1MWAB 3MXWH 5DK3A 3WFZA 1K5NA 4IJ3B 2I25N 2KQNA 3QH3A 1TQCB 2PCPB 1RZ8A 3AROA 3K1KC 3QIWA 2H32A 1S7UB 1WFUA 3REVB 4M62L 2CH8A 3VDCA 5ESAB 3QUKA 4H8WC 3IXTB 4S1RH 4Y16C 5IJKA 4G42A 2I9TA 4LASL 5C0IB 4U6XA 1IARB 1V3LA 5DJDB 1A7BA 2AXFB 3T0WA 1QEWB 1U6AH 5EBMA 1KIRA 3RZCB 4EUPG 2CLVA 2FD6L 2DQCH 1F6FB 3PNWA 1CE1H 3REWA 4R0LC 4DFHA 4M43L 1FL3A 4LVNC 2WUBL 4XMPH 5A16A 5EG6C 4KUZH 4WO4C 4WUKL 4LPTA 3ZSTA 1A7QL 2PYEA 5JZ7C 4G8EB 5FF6B 1N5AA 3MOBH 1Q9LA 4PJFF 1YN6B 4G9FB 3V4PH 1XF1A 1F4XH 2NPLX 4ZUSA 12E8L 2YS4A 3WUWB 3GUTB 1WUNT 4NRYA 4XWGL 2ADGB 3F7RA 3VGBA 3BEVA 5FOBB 4F57L 4WTWA 1NUDA 3D2UA 3DVNB 2IBBA 5IW1A 1T4KB 1LP9B 4OLUH 5L8KB 2JJSA 5GZOD 3ZE1F 4FFVD 4UV7H 2A73A 3B2UD 5F1KC 2VWEE 2HLFC 2NY7H 3QDJE 3CDGB 3QHZH 1ZLUH 5CD3A 1KELH 2R0ZL 4RMVA 3P11H 2QKIB 1U58A 1G0DA 5EUOA 4DKDC 1JGDA 2B8OT 5I71B 3ARUA 1MVUA 1U8HB 5TQ2L 3MLRH 3VWKD 3LRHA 3O9WB 4RMUA 5F89B 4ZDHA 3G08B 1BEYH 2FB4L 1TZGL 2H3NB 1KXVC 4LEOB 4PLOB 4MB5A 4HKZA 1HSAA 4K2UL 4L9DA 4UU9B 5F7DA 4Z0BL 1EUTA 1F4AA 2JJWA 3VE0A 3OB8A 2FBJH 2DQIH 1CF8H 3VGGA 2E27L 1DN0A 1IT9L 2HMID 4OF0A 4D9RD 4C56E 5IMKB 2CK2A 3ZL4L 4LSVH 4P2OA 5E2WL 5DDHA 1N4XH 3AREB 2JB5L 2VZ1A 2VRAA 3UBXI 5DI8B 4XX1G 3ZZ1A 2AABL 4GW5A 1CD1B 1QO3B 1JZ6A 3OGOE 3GSNH 1ZA6A 4RRPA 5H37H 2VZUA 3FB7B 3MRMA 5E7FA 3LDBC 2ZUYA 4XVTL 3HZVA 1QFUH 4XMKH 2VYRE 2VXUL 4PTUB 4AZ8A 1IAIL 2MNUA 5BRZB 5E00B 5I1JL 3RL1A 2XY1A 3GNMH 1N7ML 1CGWA 1SBBA 2XN9B 5DJ6B 3TFKD 3MV11 2IFFL 4JDVA 2BY1A 3G5ZB 2DI9A 3RBGA 3UTTB 3WE6A 3O3UN 2YD5A 3LHPH 1AE6H 2F53A 1KBGH 1LO4L 3SN6N 5I8OH 5HI5D 3PGFL 1MVFA 5ADPL 4JDTL 1S7QB 5BQ7B 1G0YR 1ZT4B 4JHBA 3IFPB 1MCDA 3P9WB 4U2YA 2FJFA 5DVMA 5KJRH 5CZKA 2XZQH 4P2QA 1ZHBB 2J5LB 2NTFA 1I8IA 2VIRA 2X09A 4PJCA 1JRHH 2RFXB 3OMZA 4EIZC 4IDJH 5DEFA 1GPOH 1XCTA 4HUNB 2IEPA 3VXTA 1QBMH 1RHHA 5C09A 2CMRH 1JF1A 1MFCL 3V5KB 1LD9A 5EH1A 5INDA 3ZDZE 2BNQB 4MDJB 2EECA 2R4RL 3C6SA 3E8UL 3LRSA 5I1IL 1UZ8A 5JMOC 1U3HC 1XIWD 4F7PB 1EGJA 1FQ9C 1W72H 2XFXA 4TRPL 4Z7NF 3MQIA 3IDIA 3UAJD 2Z31C 4OKDA 3TNNA 1JHTB 5I2IA 1CS6A 4ZUVB 5MERB 5EOCL 3IFNL 3GJFH 1C12B 2VR9A 1NMCC 3MO1B 5C8JB 4IRSC 2RAMA 2Y72A 5D1ZD 2V9RA 5DT1L 4Z0XA 3CVIH 3TO4B 2Y25A 3EO0B 2R1XA 3SGJC 4M7LH 5GGUB 5C0BD 4OLWH 5LWYL 4H20L 2BSSA 4ZOEA 3AS1A 5D96B 4XXCC 1IKNA 5T3XL 1RI8A 4JLRA 5FUOL 4PJAE 2VOTA 2ESVB 5MEQA 5E2JA 1OCWL 5IG7B 1NFIA 3X11B 5CAYB 4EDXA 1AGEA 5T5NF 2I5YH 2Q1EA 2MOVA 3LRGA 2FL5A 1FRGL 2FATH 4XP1H 4NHUB 2OQJB 4W6YB 4RX4D 1LO5A 3BKCH 4IOFC 1HHIA 2HJFB 1LILA 1V05A 5CFHA 4JKKA 1MCRA 4GXUM 2EE6A 4JHAL 5D7LD 5HGDB 4MVBC 1FLTX 1G7IA 4HJ0D 4WWKC 5DGRA 4MA7L 5IQ7H 3EHBD 1YQVH 3VFPB 1K8DA 2XKNB 3C87A 3RGHA 3D3VA 3MRGA 2X7LB 1P7KB 2GY5A 1T3FB 2NCMA 4LSTL 3MBEA 2IANB 4RDQG 1URLA 3O8XA 1WITA 2VLKB 4ZSOB 3O3EB 2UZYB 5FGBC 1BFVH 3FFCA 2PR4H 4YDIH 3RWFB 2Y7QB 3HE7A 1RIHH 2FX7H 1HSBB 4ZD3L 4IIQA 5JIIA 1DEEA 43C9A 3S5LB 1J8KA 1MF2H 4RMQA 2AVGA 3JV5A 3D18A 4HHAA 5KZCB 2GCYB 1JL8A 4GG6E 2EIEA 3TH2T 2AEIT 1DP0A 4Y5XB 5ETUA 1BM3L 3VI4F 4YGVB 4P46D 2EZ0D 5J12C 3U0TA 4AL8L 2A74A 1FCGA 1OLLA 1TLKA 3TO2A 3FN9A 2D7PA 5TQ0H 4NN5C 4JFYA 2E9JA 2WIIB 4HWNA 3BOVA 2I9LB 1SJHB 3PWUB 1M71B 4UNTA 4ZPVA 4DTGH 1T2JA 2ADIB 2DLIA 1WIPA 3VFOB 2APVA 2DQJL 1CBVH 2VDNH 2E6PA 4V2CB 2AV7B 1BVKB 4P3CL 3RAJH 3GSRB 2WWKT 1BAFH 2PO6A 3DX8B 3J8F7 5C0AE 1DBKH 5AD0B 3MBXH 3MNVB 4P9ML 2DWEA 1S7TB 1MH5B 1P6FA 5B8CA 1ZGLB 4RCAA 4HX1A 1WAAE 3NACL 5FO9B 1W0YT 4PJDA 2EEBA 4U6HB 1CT8B 5D1XD 5GPRA 5CEZE 4RFOH 5EU6E 2R9HD 1UFUA 2Y36H 4HG4K 3VFVB 4P5KA 1IQWL 5DTFA 3VD5A 5GGQL 4OAWA 5D93C 4NQEB 4CVZA 1R3IL 2VXTH 3F12B 2R2BB 4FRWA 2X9YA 1YY8A 1ND0A 4X4XA 3SO5A 4ZNCD 1AHWC 1HIML 1G0XA 1L9NA 1W72B 3QWOA 2RHEA 3OHXA 2P24A 5FCUL 3N1MC 2C3VA 2H45A 4Z7WB 3MR9A 1G9MC 1QR4A 5GZNC 1YEKL 5C3TA 1XGYL 2A6IA 4GRMB 4KVNL 5H2BB 1IGYA 1UEMA 3GJFB 5CHNA 1IGIH 1CLZL 2WBJC 3HZYA 3M17B 1A8JH 1VFBB 4IRJC 1GL4B 4ZUTA 4ODXB 3RDTB 1AC0A 4L9LC 1FO0B 5KSAA 3QIBD 1XGUB 3MV7B 1RQ5A 4IJ3C 3RNQA 5B38A 1ZEAL 1TQCC 3EDKA 3B6SA 5F1NA 3QO0A 5FV1L 1I8LC 4QTHA 1CICA 1JWUB 2FZ3A 4Q7DA 1A2YB 1QRNA 1KYOK 1ES0A 3RU8L 5JLZB 3CZJA 1FZOA 5D7LE 1YY9D 4X7TB 1GGUA 2ZUVA 4TNWF 4CW1B 2CPCA 3PHQA 1B0RB 4R7NB 1RUKL 1MNUL 3LIZL 4M7ZB 3RZCC 1DUZB 2FECI 2CDFB 1NC4D 3IGAA 4UINH 4CAGA 2UWEB 1INEH 3AFLA 2HWZH 1WEJH 3QWRA 1G1YA 3T0EA 5JXEC 4MA8L 3D39D 1CFNB 3BP5A 2NX5B 3PP4H 4MD5B 5A40E 3VDBA 1YMHA 3ARGB 4ZTPL 2BMKA 4LP5A 5DMGD 4W4OC 2WWKO 1ZSDB 2VXSL 1A0QH 1YNKL 5ACMA 4ZFZA 5EUOF 4ORZC 3DSNA 3K2UH 1H3PL 3RWIA 4JVWA 3ZMRA 1BX2A 1T6WA 3DX7A 2A2QT 3W81A 1BQHB 3PQYD 3QUXA 4JY6B 2Q87A 5EIIA 2DYPB 1I3RB 2OBGA 5JNYB 3I3BA 3BFOA 3BWUC 5DFWH 3DV6A 2HFFB 4ZQKA 3X3FL 2DLEA 4A6YA 5JUEH 1G7JA 1CU4L 5IFJB 5GGSY 3BD4A 5C0CD 4G3YL 1U91B 3UJIL 5FKAA 4DEPB 3MUHL 4X80L 2Y5EA 1T6VN 1Z9SA 1H3VA 4JFFB 3BP7B 4NQSA 3TP4A 3Q6GL 1MRCL 2R1WB 1HHJA 3DURA 2N1KA 4JFEB 5I71C 2G9HB 4P2RA 4LDOB 4HK0A 1D5ZA 1KJ3L 2JTDA 3P0YL 2PF6A 3O9WC 3NA4A 2JCCB 3VJ6A 4MD0B 5I0ZA 3EOTH 15C8H 4YJZL 4YHPB 3CPLB 4GW4B 2J6EH 4HZAA 4HJGB 1A22B 5D1QB 3WD5L 1S7VA 1MAKA 3FRUB 5TH2A 4MQ7A 4OKVB 1CVSC 5DURB 1NDGB 4P23D 4D0BB 3VCLA 2GSIB 3SGEH 3CLFH 4LSSL 5GRUL 1LEGB 3LPGA 1RJLA 3EYFB 3VWJD 3G6DL 5DRZB 1MFBH 1OTUD 1QFWM 3WHE1 1K2DA 3AREC 2DIBA 3QIUD 4M8QB 5DUMH 3ZTJG 4I2XE 3CFBB 4MLIA 4UIKH 3I6KA 4Y4HD 1I3GH 2APBA 2QR0B 4JR9H 1NCAL 5KSUB 1AGBA 4OLZL 5EPMB 1DQLH 2ICES 1RFDH 2HJLA 2K7QA 5I1GL 4RIRB 3QNXA 2XZAL 4M5YH 1KCLA 4XZUA 2OMNA 2BOCA 4XAWL 5MEPB 4XX1E 2P8LB 3W5NA 4PLKD 1GGYA 3CFKB 4R7DB 4AEHH 1VSCA 1UJTA 4FQIH 5IV2A 3KYNB 5E8OA 4CVWA 1CLYL 2PXYA 4RZCB 1A6TA 2O5ZH 1VEPA 1F02I 4MNHB 1WK0A 3JXAA 1MJJB 4JRYD 2PTTA 4HIHA 4PGDB 3SE4C 4BQ9A 3V4UH 1OOAA 1LGVA 5CWSA 3MRFA 5SX4I 3RPKA 1L7TL 5LG1A 1ZVSA 1G9ML 1J8HB 2OZ4A 3MA7B 1R3JA 3QA3B 4POZC 3IFLL 1ACZA 1F97A 2HRLA 2J5LC 3GMRA 3W5MA 4N0RA 3O2DL 2MHAA 3JWDH 1F4HA 3SDCB 4TSBL 1M7IB 1OB1B 4DZBA 4F7EB 1MWAL 3EJZD 2RQ8A 5BMFH 3LH2L 3D25A 3HI1A 3HS0A 4KKLD 4BFBD 2UVFA 3P2TA 1U8LA 5LXGH 2DBLH 1S9WA 5T1LA 3BP4B 4NCC2 1XGQB 2XYCA 4HULB 4P4KC 3ZDYF 3SDDB 1G6RB 2X4TA 3IKCB 4FMFA 1I8MA 2ZOLA 4Y8AA 2BVPB 4OBRA 1GIGH 4PRHE 2ITDB 4I5BB 4Y2OA 3PHOB 4C56A 5TE7L 4J6RL 3PQYE 4FQCH 4YHIA 1OTTD 1P84J 2AEWA 4G8IB 3G5VB 3TO4C 4ZFGL 5CUSL 3SDXF 4YQXH 3GM8A 4PGBB 1EEZB 1N59A 2P47B 4NC1C 5F9JB 4IMLB 5D96C 2VN4A 4YXKL 1MCCA 3B3IA 2O26U 4U7KA 4RAVB 4H0HB 4U7SA 4RWYH 3LKQA 4MWFB 3OZ9H 2AJ3A 3IS0X 4FQ2H 1ZT1B 2CK0L 3CZFB 3C5SA 3VXUD 1LVEA 5D2LB 3PWNB 2BOBB 2EDQA 4NUJB 4ACPA 4UDUB 4MQTB 4L4VE 2VR4A 4UTBL 3TCLB 3EDDA 4XTRD 5IVOA 3I84A 2W9DH 3DJ9A 3JWNC 1R0AH 3DXAB 4QXGH 3C5JB 4MJIB 5L2JB 3NCYS 3VXOA 4MJ5A 4M5ZH 5IGXL 1HKLL 3P77A 3CCHB 1VEOA 4UU9A 4CDHA 5F7WC 5C71A 4ONHB 4GBXB 1WJ3A 3S36X 1NDMA 1C8PA 4N68A 3C8KA 3FOLA 2ARJQ 4I0PA 1EHAA 5KANI 1UA6H 4XHQA 4O5LL 3V5HA 4QNPF 2R2HB 2OL3H 4H1LB 4ISVA 1R6VA 5IR1A 2W60B 5CJBA 3RVVC 1YUHB 2H1PH 1QLFA 3B9EA 3WFEH 2R1YA 3MRRA 1GAFH 4LRNH 4MDIA 5C92A 4LPUA 2R29H 1RJCA 1I9IH 2EDBA 4Y5XC 4TUJA 5HI4C 1VGKB 3T1WA 4JKLA 3RZWA 4PJDF 3I50L 2X70B 4D3CH 4PJEE 5EU7E 1DDHB 1FIGL 2OP4H 3VFRB 4JRYE 2WINB 4YO0B 4NFDA 4F9PA 3QNYA 3NABH 1C5BL 4TULH 3OKLB 3UEZA 3ZO0A 1LE9B 1QFWL 5L8LB 5HGBB 5CIPA 1F2QA 3QCUL 4H5SA 3E3QC 4PJAA 4M48L 2GK0B 5HHNA 2UY6A 4R3SB 1SY6A 2A6JB 2V7NB 4UT7H 4AYFA 2C5DC 3TPUB 2AQ3A 3NOIA 5D9SB 5IT2L 3L95A 3NZ8A 3WJLC 2BSRB 5IVNA 4NO0D 1B4RA 3DX9A 2BSTB 2R0WH 5IVXE 4ETQB 3PV6A 1VADB 4FFWC 5C1MB 2AK4E 1I7UB 3KXFD 3VWKA 3OGCB 1J1XL 5E9DD 5E94A 3BKYH 4O58L 3ARFB 4HV8B 2HT3C 4WW2B 3P4OA 4EI5C 4ZXBA 3K8MA 2ZKHL 3ECBB 3HC3L 2IAMD 1TENA 4WY7L 4R4BA 3JV4A 5FGSA 4DUWA 1TCRB 4UTAH 5IF0B 2YHGA 3BEWB 5D70L 1B4JL 2BHZA 3MV8E 3T4YB 4CDGC 4HAFA 3GBNH 2LABA 5EC1A 1K4CA 1CQKA 4DKEH 2AKRB 3RWGA 3IDYB 2VQ1A 4ONGH 4QO1A 5JOFB 1A4JA 2FO4B 1C7TA 2GTZA 3MTRA 4OZIA 1MRFL 5JW4M 1D6VH 2VTFA 1P53A 5T1DL 4NWTH 3RDTC 5AWNL 1BD2E 1EFXA 4A2MA 2DQCL 2Z35A 4F7TA 4Y16D 4LHUG 4J1UA 4EDWH 5DMJB 5FIEA 5ADOH 4UUJB 1U8NA 4Y7MA 2BNUA 5CINH 35C8H 4WENB 4KUZL 3RWCB 1HDMB 1RAMA 1FGVH 2V2XB 4PJHA 3SKJL 2LAAA 1OAXH 3MLWH 3MJ8B 5HPOA 1HZHH 3KPRD 5JPMA 1ORSB 5IVZB 3FO2A 5DD5L 4YPGA 3V4PL 1DLFL 4QRSA 5I66A 3QR2A 4ELKB 1A6ZB 5T3XD 4WO4D 3VMPA 5MI0B 5JZ7D 1J05A 4HMDA 3VXRB 4NQXB 4Z76A 4U1KB 2J12B 4Q9RL 2UVEA 2XTLA 4IRZL 4M7ZC 2DQFB 5C0AA 4LAQH 3T65B 1YN7A 3H7BB 5EU4B 5HJ3A 5I1EH 1IKFH 3S7GA 1IE5A 3QHZL 5IQ9B 5F6HI 4TYUA 3BIBX 3REVA 1WAAA 4FN0A 3NA9L 4NC0B 5C2BH 1RURH 5IFHH 4KGJA 3Q3GB 5AZEL 4CUCA 4NO3A 2VZTA 3HC0A 5HYSA 2HLFD 5EU6A 5DJYB 5F8QC 2H2PC 1V7NH 4GRWE 2FH6A 3DUSA 1KIQB 5SX5K 2UZIL 1NCCH 2WNGA 1E4JA 2F8XC 5GGRB 1U8KA 3RWJA 1CLOH 4R96B 3SE8H 4O2CB 3VG9C 4L8BB 3MCKB 3DO7A 1Q0YL 1E4KC 3MRPA 1DEDA 4U6YB 4Q9QH 2BCKB 1E4XL 4DQOH 5IMLA 4KZDL 3E2HB 4LSVL 3B43A 1N4XL 1QP1A 1CIUA 4PJGB 4OCYL 4LBEA 43CAB 2OR8A 2VSCA 3RY6A 4FZEH 3OAUH 2P46B 5E2VL 1XGRB 3NFSL 5IBUB 5T33L 4KJPC 4MCYA 5DD3H 2EIZA 3BUTA 3JUZA 5D1QC 1QFUL 4LRIA 4XMKL 2W1NA 3LPFA 2O5YL 5CGTA 5HDBE 2VAAB 3S35X 3FKUS 1QSFD 1N8ZA 1QLEH 5DUBA 4HIIA 1MIEH 3ZE2F 2YEZA 2ZPKL 1RIUH 1EHLH 1LO2L 4Z7UE 2XZCL 2QKIA 1BJMA 3EYVA 3NZHL 25C8L 5SWSB 1OM3L 2COQA 4ZNEE 1YEGL 1AE6L 2DQHH 2A6DB 2E7LA 3E1F1 1MCOL 5EC2B 5I6XB 2XKSA 3BQUC 3KYOB 3QDGE 5FEBA 3FTGA 2CKBH 1AD0B 1NJ9A 3SE9H 5KJRL 4GLRH 4KJWC 4N8CH 4O02H 2H2SC 3GSUA 1QBLL 3DNKA 4HIJA 2XTJE 5BXFB 2Z92B 2EC9T 3DMMA 2I07A 3WS6C 1GJIA 5HYIA 3AY4A 1F6AB 1KIUA 4XVUC 1EJOH 1A6VL 5FYLH 3KPSD 4Y88A 4OLYL 4QHUB 5JHDB 2VKWA 2E7MA 3LMJH 2X10A 3KPPB 5F3HA 5IESH 4H26A 2NXYB 4MD4A 4Q58C 4AQOA 3H9HB 1W72L 1XR8A 4XCCH 2VDQL 4MXWL 1ZS8B 4NIKB 5KSVB 3MJGX 1S9KC 3E6HA 1FL6B 4LCYB 1LO3L 5IBLC 4WV1B 5IBTH 5CP3H 5BRZA 1MI5B 3KPRE 5BJTA 3QQ4B 4G43A 2IPTH 1IC5H 3RWHB 1U3HD 5ESVB 4MJ6B 3WUWG 4XWOC 2VL5A 3SDCC 3WN5A 1FO0L 1XF5A 2Z31D 3VFWB 3ABZA 1JPTL 3ULVH 2QQQA 3S3PA 3FRPG 3N1GC 4ODVL 5EO1A 1TJHH 4IRSD 3O6MH 4YNYB 4Z7OE 3WFDH 3BPNB 3GB7B 1RJZA 4MNQD 4DVBB 4V2BA 1A1MB 4GT7A 2I5YL 4OCLC 2L0DA 4TSCL 4RA0C 3S96B 3ARXA 3EZJB 1LK2A 3TBWA 3L3JA 2X1OA 1P7QD 3HMWH 3BKCL 4UOW1 5J9PA 2G5BB 4QRPD 3CX2A 2GKIA 2AXGB 4JPVH 3SQOH 4PJXA 4HZLB 3ZKSD 4WFHD 4I2XA 3O81A 1WFNA 5D7JC 3DROB 3CDFA 1DE4A 1OW0A 3L1OH 3UBXA 1YQVL 4OF7A 3TT1L 4IOFD 4LGPB 4NFCA 1ONQB 3WUZA 4CN1A 1YEJH 1CDBA 4MVBD 1B9ZA 5I8KL 3L7EA 2C1PA 3KDMA 2EDTA 3NGBB 1JFQL 4WWKD 1P4LA 4OCRH 5I8CB 2P7TB 1BFVL 2KZWA 2E9IA 4JRWA 2PR4L 1G9EA 2ZG2A 4Z7VE 4YDIL 2X40A 3K74B 1KJMA 2FX7L 1J11A 4Q2ZB 2QQNL 4LHUD 5CEXA 4I4WA 4JO1L 3ZDZF 3FO9A 4DW2L 1JPSL 4IHOB 2OTUA 2F54D 3RUGB 2DIAA 1JWSA 2FH8A 1G1CA 5F70A 1PEWA 1UCTA 1QSFE 3JVGC 3X11A 4GBXC 3EGSA 3CUPB 3SPVA 1JI1A 1QFWI 3HR5B 1UACH 2GEEA 1YYMH 4U1MA 3RGVA 3ZHLA 4U1IA 2D7MA 3HUJE 2ITCB 2XWBA 1D5BB 2CLZB 3BAEH 4NNXB 1SYVB 4HKBB 4UILL 3PGCB 3HAEB 3P9MA 3HNVL 3PWVB 4U1JB 1SEBA 4YDJA 3MLVL 4QXWA 4I9WD 2F19H 4MCZA 5FA4A 4MAYB 4EVNA 3MBXL 2CUIA 4PJAF 3MV9A 4M6OL 3OKNB 5FO8A 3KPMA 2MKWA 2YN5A 5D6CA 3OAYK 3UTSD 4PJ9C 1G6VK 1ADQH 1GVIA 2O5XH 5HY9B 4WW1B 5DVOA 4PRHA 4X4YB 4QRRD 4Y19B 4BSWA 5C0EB 4RFOL 1AFVL 1QOKA 4KXZH 4L8SB 2Y36L 1MSPA 3PQYA 3ROOB 4LSRH 3BD3A 3MODL 1GZPB 4RBPK 2ZOKB 4V1DE 1FE8L 2IADB 4GMTH 2VXTL 5SWZB 3B5HA 5KVMC 3MLPA 4HD9A 3NCBB 1IL1A 1KB5H 3GSOB 5GS2D 4F15B 1KCUH 1ZLWH 3NCJH 2B5IB 4HK3N 5C6PB 4R8WH 2XWJB 2F74B 2AJZB 4NQCE 3W0WE 1IGIL 4E41B 1DBBL 1PY9A 3JWDC 4HS8L 2ADIA 2C4FT 2EDOA 4KPHH 4L4VA 5BW7A 3ARFC 4WW2C 3GEWB 4NP4L 5GZND 4ZFFB 4PJIE 3GSWB 2W9EL 3WV0A 4GG6F 4LIQE 1FDLL 3OX8A 1FG2B 2XIDA 1X5AA 2WBJD 1OGAE 4IRJD 4QTIH 1OP5K 1MH5A 4C4KT 5EO9A 1NEZA 4D9LL 1V5JA 4BM7A 5E1HB 4QRPE 3TIEA 3VWJA 2G60L 2IH3B 4K7PL 3O6FB 3IDYC 4O51B 5DMKB 1UJ3A 3EJJX 1S9YA 1PQZA 3MFFB 1RK0B 4WFHE 4LLUB 2XNAA 4AIZA 1JNNH 1LEKB 2Q7NA 4EQ2A 2Z8WC 1S7WB 4HKXB 4XC3L 4OIBA 3OAZK 1G6RL 1MFDH 2AEQL 4XCFL 5I30L 4ZUUB 2ERJB 3BH9B 1QSVA 3UTZB 3TVMA 4UT6L 1WAAF 2J8UB 2KL6A 1E27B 5LJYH 3F62A 3RZCD 4X98B 3PDOA 4PJEA 4Y4KC 5DD1H 4XVSH 5JW3L 1LO0H 4DK6A 3S5LG 1B0GA 5JXED 4JRYA 1ZVYA 4PJBE 4OFVA 1CL7L 4M9PA 4TOYL 2F54E 5MI0C 3FCTA 4JEGB 1CE6B 5IHUH 4Y1AB 4KK5D 2YD3A 3FT3B 1AY1H 3KJ6H 3MV7A 4YLQT 4BZ2H 3UYPA 1O5DT 4G9FD 1JTOA 1C7SA 1WWAX 3G6JB 5I15L 4X6CA 3CMOH 1JZ7A 4ELMA 4OM1H 3P3YA 5LAXB 4CRPA 5HGHB 3THMH 3C8DA 2VLJD 5DR5L 1OP3H 1SYSA 1NAMA 5IVXA 5B21A 1JTTA 1UH4A 3T0VA 1BGXH 1FLRL 2BNRE 3N0PB 2AK4A 3IETB 1YDPB 3OXRA 2VDPL 4FQLL 2QHRH 4CW1A 3ZKNC 3U83A 2V7HB 4Z5RB 4U3XA 1B0RA 2GFBA 5E8PB 5HPMA 4IBLT 3T3PE 5C08B 2CDFA 5DUPL 4JZJA 4XNMB 1AIFA 4OLVH 3Q0HA 4HLJA 1KCVH 4KKCC 3ZYJA 3MV8A 3P73A 3TBVA 1QKZH 2E8YA 3O9WD 2NX5A 3VRLE 5SV4A 3ARGA 3U36B 2EDLA 1HILA 4X6DF 3PL6A 4HUUA 4XNXL 3KLAA 3LEVH 1YPZE 3T3MF 1MFBL 2HA1A 3E2HC 1Y18A 2VLLA 4FFYL 1F11A 3L3IB 1QA9B 2R2EB 2ZP0T 5KN5B 4OF3A 1R24B 4UIKL 1JRHI 1RY7B 4JR9L 1MELA 2J1KA 3OJDB 2B0SL 2P5WB 5F88B 1EO5A 5ITBH 1BD2A 4EN3B 1VFAA 2P5EB 5F21B 3UCRA 4XNQA 1FFQA 1BOGA 3ETBF 4M5YL 3BDYL 5C07B 4GKNB 2W9LA 4IDLA 3TV3H 3KHQA 4I18C 4NKDA 4RISL 1ZANH 2PW2A 4CBPA 4S1DC 3IU3A 5DZOA 3C60B 3HRZA 5JIKA 5FYKU 2FHCA 1VACA 1I7ZA 1UKSA 5GRWA 3X14B 1J5OL 3GIVB 5I6XC 4YHLH 4MA3A 4I77L 1FH5L 1MPAH 2XN9D 3EOAA 4WWID 3W9DA 3V7AG 3RKDC 3UTTD 3ARYA 2LU3A 4Y2DA 1GGCH 3TZVC 1PKOA 4QHLB 3HI5H 5TDPB 2L7UA 2D03H 5EZLA 1D9KC 5GSRA 2QQKL 3JWDL 1NGWA 5DRNA 1JPFA 2AJVH 2OSLB 3DVGA 3LV3B 3WO3B 5HYFA 4POZD 1UWGH 4LCUA 1FNGB 2NR6C 2FNBA 3D69A 3EO1A 4YZFF 1PD6A 4M1CC 3STLA 5LXGL 4GKZB 2DBLL 1MHCA 3MXVH 2NXYC 2XI9A 4BKLB 3QULA 2E6QA 4P5MA 1KUMA 2IQ9H 1ED3B 1SM3L 2X1WL 2A83A 1OARH 4WV1C 1U93B 2Y23A 3VA6A 5ENWA 4F80A 3S88H 3U9PH 1AGFA 1W0VB 2R8SL 1BQHG 1CFTA 4Q6IA 5JW4R 4P4KD 1DBML 2A77L 4LKCA 1XF3B 5BS0B 1SBSL 4G9DA 5FECB 5CCKH 5L88L 4G9FE 5HHPB 3LN4A 2F58L 3HNTL 1OPGH 4HSQA 1X7QB 1WISA 4M8VA 5GS3A 1NCDH 2E5EA 5EA0L 4N1HB 4X9BA 3V6FA 5CJXC 2B20A 1K8IA 4R9HA 1UXSB 3BUYB 3BPNC 1J8HA 4U33A 4U05A 3TO4D 5HHQB 4RWYL 2VLJE 4YX2H 4PFEA 1Q9KA 1FNSH 3BZ4A 4KDTC 3W39B 4NO0A 4CNIA 4P48A 2BZDA 2X4QA 4FMKA 1U8JA 1YNLH 3IF1A 5HYJE 5KSBF 1FL5B 5GSVB 4B50A 4GFTB 4EOWH 4Z7UA 3PWLA 5C6WH 2D0GA 2NY1B 4JRXD 3O0RH 4QXTB 2WBKA 1M7IA 2HTKC 2ESVD 1OB1A 4ZNEA 3PDGA 3VXSB 1FYTB 3V7MA 2X1XR 3ARSA 5FCSH 1AC6A 2R56L 4GW1A 5ICZB 5IROC 4PJFB 1R0AL 3T2QA 2C7UB 3BGMA 2YRZA 5K9KA 3QDGA 4N1CA 1FSKB 3SJVD 2CDGA 2F5BH 3LS5L 2B4CH 3GRWH 3HPLB 4PY8J 1KN2L 2BHYA 2IH1A 3AU1B 5IB3A 1EDQA 1JYVA 1PX4A 5F7MC 2WMPA 5EFIA 1AGCA 4UQ3A 3QG6A 5E2UH 3TT3H 2YSSB 1MCWW 4JFPB 2DL2A 1C5DB 4LLDA 3GBMH 1I4FA 4P9HH 3MLTA 1Q94A 3ISWA 5L2KD 5ISZB 1A6AB 3L5JA 4HGMA 2AJYL 3FQTA 1C08A 2XICA 5FHBH 2IAND 3MROB 1IGTB 4Y16A 2VLKD 4LF3A 3WIIL 2YC1A 4B0MM 1T89C 1T1XB 1NC2B 2FGWL 2R29L 3QHFL 3V5DA 5BOPA 3CC5B 1RZKH 1TZIA 1ZT7B 5SV3A 2R0LH 3V6ZB 1GGBL 1T20B 3S8WA 3WO4C 3GGWA 4OZ4B 5D2NE 3B9KB 4NZRH 3RVVD 3TBTB 3KPRA 3CVHH 2FX9H 5KZCD 1FGNL 3SEPA 4R0LA 2OMBA 2D7QA 2OR9H 4WI2A 3G5XB 5B3JE 3MLXH 2WAHA 2C3XA 2C1OB 4K71B 3BRGC 5HI4D 4F58L 3QDHA 4NGHL 4Z78B 4FQ1H 3FFDB 7CGTA 4FTVE 3O3AB 4OLEA 1QZ1A 1WFOA 5HHMB 5C0FB 4M7KH 3RPIB 4LARH 5L2JA 4GUPB 1MFAH 3OTTA 3BP6A 4K3DL 4EUPH 5J06A 2XV6B 4PV8B 1RUQL 1I7RB 3L7FB 4UT7L 5I73C 4NUGH 1OSZA 4G6FB 1AQKH 1GOHA 1N5YL 2WV3A 1MAML 4KQ4H 3V52L 4DAGL 1M7DA 3VXPB 5I1LB 3ALWA 5LQBH 1FIEA 3MCLH 4JAMB 5DO2C 3RI5K 1Z5LA 5K9JH 4UTAL 4JQIH 5EZIH 2MQCA 2IPKA 1HE7A 4FFWD 1YC8A 3V8OA 2DLFL 3STZB 2AERT 3FQUB 5GGVL 1XGTA 3CK0L 2A9NL 3QQNA 1I1RA 2P1YA 2HT3D 3TPKA 4EI5D 4DGIH 3R06A 3GMLB 2EC9U 1DCLA 2QLVB 5I16B 3QDMB 1UCBL 3UDWA 3WIFA 5B22A 4F15C 1ZWIA 3OJVC 4HW6A 1WIOA 2B5IC 3L3DB 3RIAK 5I8EB 2VABB 4Z7VA 1KPVA 1A3LH 2WINA 1TFHA 1I7TB 3KR3L 4BUGA 2EDFA 3QUYA 3NN8A 5GRJL 3H0TB 3FMGL 2NW3B 1BMGA 4RDQF 1T04A 2EH7H 3M1BB 1CFVL 3NIFE 5BO1L 5C9JB 5ADOL 1UENA 4X0KB 3RTQB 5TDNA 5CINL 3K3QA 1CL7I 1QSFA 4NC1E 1UM5H 4OIAA 1FGVL 2V17H 3RDTD 2DWDA 3L5XH 4HPYL 3IJSB 1S5HA 3LKRB 1OAXL 3O6KH 4JRXE 3PHSA 3QXWA 4JJ5A 2VXVL 5FA3A 1V8HA 3T2NL 5BCAA 1MCWM 1O7SA 5GS1B 5HVWA 5FDYA 5IB5B 7FABH 4K7PY 3T77B 4UBDC 4HFUL 1XCQB 4OM0L 4MNGB 1AI1L 4W68A 3SJVE 4LLMB 5ID0A 5J8OA 5IF0A 1VPOL 2C4XA 3NFNB 1BQUA 1OAYH 1IKFL 3EYSH 4ZOAA 3WDJA 3BH8B 4AG4H 3C2SA 4I3SH 2DQEH 2ERJC 5EZOH 4XCYB 3ZYOA 1OY3B 5JA8B 2MJWA 3NIGE 5HGAA 1UQSA 4KHTL 3NCCB 2AKRA 1XGPB 4XPBL 5HBBA 1MJUL 5IVXF 2VR5A 4OV5B 4H1LG 1NL0H 5E4IA 4HPOH 5L2KE 4F7MA 3CGTA 3SGEI 3A6OA 4L3EA 2IANE 4PJ8B 1H8OA 3U7YH 3U4BL 4ZSOE 3PWJB 4V1DA 1KPUB 1QUNA 1HYRC 1AXTL 1A4KB 4DVRH 3TEUA 4JM2B 3WFHA 1UB5B 3QISA 5CGYC 2H2PD 1KFAL 2Q8BL 1AGDB 3SE8L 3Q2CA 3MNWB 4POYA 5EOQH 1DANT 5C0DA 3RWCA 4I3GA 1BIIB 4LCWA 2DYPD 3SDAB 1WTLA 4D9QE 3H8NA 4Y4FA 4GQ9L 4FQJL 1DBJH 4ZS6C 3V0AC 3FQWB 3QO1A 1EJ6A 4NQCA 3W0WA 3EDJA 2X89D 4EXKA 4ELKA 2WW8A 3OR7A 5D6DC 5IJVB 3VI3E 5BZDB 4IRSA 5DD3L 4PBWD 4PJIA 1HCVA 3F7VA 4PG9B 4JFFD 5IB1A 5KW9L 1YYLH 3SCMC 3TYGL 4D0DB 3VXMB 1OGAA 3L9RB 1RUPH 3FT2B 1FBIL 1MIEL 1FVCA 1EHLL 2DQGH 1MHPL 5GGTA 4QRPA 3BVNB 2NTSP 3C9NA 3VFTB 3IT8D 4G7VH 3JZ7A 5D1QD 3TN0A 3ZDXE 1VFOA 5DJXB 3QCVL 5J13C 2JK5B 2IQAB 3RVTC 4JDZB 4PG2A 3ROLA 1EO8H 2YZ8A 5DURD 4OZFB 3U9UA 3ZE0E 5ALCH 4CU8A 4WI5A 1AD9A 1Q9WB 3AB0C 3MRLA 4PTTA 1J1OH 2GITA 1BPVA 1NGXB 5GJSH 1WBZA 1HYSC 4O02L 3NH7L 2VMFA 5FM5M 4PB9L 1S9XB 4NRZA 4FHBD 3BQUD 1QLRA 4PS4L 3HG1B 1JP5A 2AEPH 5IK3B 1QNZL 4JPKH 2IC2A 4KJWD 1RUML 3IDJB 2VDMH 3C60C 5E6ZA 4Z7WE 2H2SD 4GRWF 5JO5A 5DD0H 2H6PA 4PJBA 3UMTA 4BFIB 2ATKB 3EW3B 5IESL 2F54A 3HN3A 4XVUD 1D5IL 2DL9A 3HLAB 3Q6FB 3MRNA 5AZ2L 3GSXA 2V9TA 1GGIH 1EVTC 2IALA 1WQVT 4M61A 3QH3B 1RZ8B 5JHLL 2DMCA 3QIWB 2H32B 2ENYA 1NCNA 3QUKB 2NY3C 5IBLD 4NCDA 4WUUE 2BNRA 5GQBA 2I9TB 1DQDH 4QOKE 4U6XB 3BPOB 2IGFH 1YEIH 3A6BL 1IRAY 1TJHL 4UV4L 4XWOD 1X4YA 4GKSA 5EBMB 3SDCD 2SEBA 1KIRB 1P69B 3LOWA 4X5XA 5LKNA 3VFNB 2CLVB 4LSQH 3PNWB 3REWB 4NJAH 5HDBF 2RCSL 1RU9H 4DKFL 4JB9H 1GOFA 1QYGL 1JK8B 3MA9H 3NCYP 3ULSA 1FL3B 4DOHE 5K9QG 5A16B 4QRUA 2H26A 4Z7UF 4QEGA 1JGLL 2PYEB 4HUVA 2ZCHL 2MMXA 1YPZA 1A6UH 1N5AB 5CSZA 3SQOL 2XA8H 5FYJU 4P57A 1Q9LB 1KEGH 3WFBH 4RFEA 5K9QI 3O41A 4ZUSB 5HHVL 3AMKA 4NRYB 2YK1L 3UP1A 3GK8H 2X6MA 3BEVB 1NCWL 5B39G 3D2UB 1HK6A 5IW1B 5J7CC 2MPAH 3QEQE 2Q6WA 2OJZL 4NZTH 1W8OA 4OTXL 1SJVA 2A73B 5D7JD 2FIRT 4JN2A 5CD3B 4LSPL 3T0XA 4QWWC 1UADC 1AHWA 3BGFB 4M62H 3BN3B 4X7CC 4J2XA 2NY1C 3GKWL 1UWXH 1U58B 5SX5H 3GJFK 5EUOB 1JGDB 5FM4A 4LASH 1N6QH 1MVUB 1CDHA 1PG7L 2P42B 4ZDHB 4Y0GA 1TETL 2WBJA 1T2XA 1FSKC 4IRJA 3GMNA 1EHXA 4OGXL 2GUOA 4NM8L 3OL2A 4UOW0 4WHYG 4NPYA 4L9LA 4HKZB 1HSAB 1JF6A 4PJ7E 5DLMH 2JCCE 1F4YL 5DQ9A 5F7DB 2X4UA 4WFGD 4NM4H 5BVPL 3CFCL 1UACL 2CLRA 5E7BA 3S96A 3VE0B 4ENEC 5DZNA 3DXAD 4M43H 2WUBH 4MJID 2HFEA 4OSUH 4WUKH 3A6CH 2G5BA 5KTEL 1A7QH 1DN0B 2CJUL 1P5UA 5LGJA 4GQPH 4GBXD 2AJSH 3VGEA 1T2QH 4APQC 4P2OB 5DDHB 4DCQA 1V3JA 12E8H 1FPTL 2F19L 2D4DA 2MWCA 4KROB 1T83C 4XWGH 3FB6B 5GGRY 3HMXA 5T3ZH 4GW5B 4BQBA 4F57H 4MX7A 1ZA6B 3B5GA 4OCXL 4PRDA 1MAJA 3MRMB 3QXUA 4YEEA 3U0WL 3HZVB 2EDXA 3SE3C 1RUAH 3FONA 1IGJA 3U6RA 5FAAA 2MQ3A 1FHGA 2R0ZH 3RL1B 1FFNA 2RGSA 4ZAKC 4K71C 3K80A 3KVQA 4PJ9D 1ZLVH 4N0YH 4JDVB 5E8DL 3ZYZA 3CNKA 3MSPA 3WE6B 4QYOA 4RNRA 5TQ2H 2F53B 3CU7A 2VITA 4DUVA 1TZGH 3N1QC 1ZGLP 4E42A 2BVTA 4K2UH 1KB5L 2FJFB 1NGYA 3SOBL 3HC4L 1R3HA 4P2QB 5HYJA 4OFPA 3IFOA 2JLLA 1INDL 4ERSL 4TTGA 1UM4L 4YXLL 2NTFB 1I8IB 2VIRB 3B83A 3ESVF 4PJCB 2HKFL 4RGNE 2E27H 4Z7VF 3UTOA 1IT9H 3F7PC 2E7BA 2YXMA 3U46A 3D85A 3HAEA 5DEFB 3T0BA 4Y5VC 3ZL4H 1XCTB 4W6WB 3VXTB 3V0VB 5E2WH 3NPZB 1RHHB 5C09B 1JF1B 1B90A 1LD9B 1HN1A 4LMQI 5INDB 3C6SB 2XQBH 1S7XA 3LRSB 4ZOBA 2F15A 1UZ8B 4TNVK 4D0CA 1XFPA 1OWWA 3ARFD 2XFXB 4S0TD 3UZVB 3IDIB 4M93B 4NNYA 4PRNA 5GGVY 3TNNB 5I2IB 3EDFA 3FN0L 1D6EB 3HUJF 1IAIH 2HKHL 2HVKA 3WIHL 5I1JH 5I18L 5F3BA 4LQFL 1QBAA 1N7MH 4U1LA 4YHZH 1UKTA 2IFFH 3U79A 1G7MA 1NBQA 4Z0XB 3QWQB 3AMLA 3ORJA 5SWZA 4JFXA 1IGML 2R1XB 1LO4H 3X12A 4WTZA 1FZMA 4X5WA 2BSSB 1V7ML 3PGFH 2VDLL 5FYKL 5ADPH 1ETZA 1FVDA 2BVOB 1VENA 3BJLA 4UIMA 3QUMA 4WNQA 5MEQB 5D2NA 1NFIB 3S4SA 4EDXB 2Z8VC 5DD1L 5IB4A 1UG9A 4TVPH 2FL5B 1LO0L 3BKMH 4WIQA 2AJZA 2ICCA 2ZUQC 3QPXH 1BVZA 1EAPA 3TYFA 1HHIB 2DQTL 4FTVA 1OD9A 3STBA 1FJ1A 4Y4KD 1MFCH 3ZTJH 4ZFFA 3KJ6L 1LDPL 4PRPE 4MB4A 1G7IB 3I3DA 5TF1L 4JO3L 2CRIA 3E8UH 4WFGE 5I1IH 2JJUA 2L4OA 1K8DB 2XPGA 1MLCA 1WWBX 4NQTA 4OM1L 3D3VB 4TRPH 3MRGB 3VXRD 2B4CC 1EMTL 4K9EL 1FNEA 2JELL 1DQMH 1KJ2A 3QNZA 2XG5A 1WSST 3O6FA 4YUEH 4O51A 3MBEB 3O8XB 3KPTA 1F13A 3IFNH 3QJHA 3OPZL 4NBYB 5C0GA 3WJJA 4GG8A 3FFCB 1FP5A 4XAKE 5DEZA 3WEXA 1S7SA 4HWBA 4HJJH 3TGXA 1CXIA 3DX6A 3HE7B 4PJ8C 5DT1H 4AY0A 5KG9A 4WHTA 5JR1H 1NBZA 1DEEB 4YC2B 43C9B 4LSUL 4XH2A 4O2FA 3D18B 4HHAB 4OLVL 4JM2C 5LWYH 4H20H 3D0VA 4BH7A 4B7LA 1BHGA 1AO7A 5T3XH 3ZKND 1CXLA 4XCNA 5FUOH 3RY4A 5ETUB 5BVJA 2FJGA 2KZ1B 4X98A 3U0TB 1C5CL 2W0KA 2A74B 5D5ME 2ZSWA 1MIML 3SDAC 5DVNA 4JFYB 4JFDE 4FQXC 4PRIE 2NXZB 4KKCD 2B39A 1MY5A 3RX5A 4K8RH 4LPCA 4ZPVB 3VD4A 3IU4H 2VERN 3IB4A 4JHAH 5I1HL 3FT3A 1B6UA 1WIUA 1YEEL 5JOPE 3QEUA 1T7VA 3H9YA 2PO6B 1U2HA 3OAYH 1RZFL 4MA7H 3MACL 5DQJA 3QZWA 2EDWA 4XRCB 2DWEB 5LAXA 3KAAA 4KDVA 2MFNA 1N2RA 3VGAB 1BREA 1ERNA 4NQDE 5B8CB 4HX1B 4JRXA 2GJ6E 4PJDB 4LSTH 1I85A 3S3SA 3VG0L 4PJBF 1CZ8L 3ZTNL 3T0AA 3JSSA 4KRMB 4XPGH 4R90H 4L29A 4PJ5A 1TVBA 4ZD3H 4P5KB 3SJVA 5DTFB 4S1DD 3LSOA 4OAWB 3ZKMC 3EFDL 4ONOA 2EDNA 4CVZB 3TF7C 4MYWB 5MENE 4KHXL 5DS8A 4LLWA 3HI5L 5J1AA 1YY8B 1ND0B 4RQQA 1IGFL 4X4XB 1BM3H 5FUCC 3QWOB 3OHXB 2XZZA 2P24B 4AL8H 1Y0LA 2C3VB 2AJVL 4OIIL 3MR9B 1IC1A 4JFQA 3RKDD 5C0RL 1KEML 2A6IB 3TZVD 1IGYB 3S37L 3UZQA 1U92A 4M6AA 3L6FB 2Z0BA 5CHNB 2BRRH 3HZYB 1D9KD 3MGOA 2BDNL 4ZUTB 4ZO8A 3T3PF 5KSAB 2LFGA 3P4LA 3RA7H 2N7BA 4P3CH 1QACA 5JHDD 2IQ9L 1X5YA 1OARL 5DHYA 2NR6D 3RNQB 5B38B 4OFYD 5IKCA 1J0ZA 3OG6B 4P9MH 3CXDL 4CL7A 4M1CD 2XQYG 3B6SB 5F1NB 2NXYD 3U9PL 3QO0B 3QIWC 3NACH 3GSNA 1YPZF 4QTHB 1CICB 2FZ3B 1QRNB 2X41A 1ES0B 1TVHA 4NHCL 2E6JA 1FZOB 1F00I 2YUXA 1MI5D 4QRQA 5IJKC 3FZUC 3D9AH 5HHXL 3BPOC 3PABA 1OPGL 4KJQC 5JIHA 1IQWH 3SGKC 2WWMC 3FQRA 3PHQB 5GGQH 1QFOA 1R3IH 3IGAB 5C70A 2IPUG 4XGZA 3LB6C 4KI5C 5EORL 3T0EB 2DD8L 3WYRA 1HIMH 4LDEB 3H9SE 1G7QB 1FFPA 3BP5B 1YMHB 3ZT6A 1Q1JL 5FCUH 2BMKB 1KOAA 1M6OA 2O61A 4LGRB 2ZJSL 2V5MA 1YEKH 2BY2A 4ZFZB 1XGYH 4KVNH 2YPLD 1XAUA 2L7JA 3F5WA 4ODWA 4OGYL 3RWIB 1BX2B 1H0DA 1X5JA 3DX7B 1WCBA 5E03A 1TQBB 4D8PA 4EXPX 2A1WH 3QUXB 3DECA 4BKLA 2B4CL 2CIIA 2HTKD 5EIIB 3ULUC 3DETC 1Q9OA 2EICA 3T4AA 4EI5A 5K93A 1YECH 1YEDA 2KBGA 1EK3A 2JJSC 4G8FA 4HH9A 3JUYA 3QUZA 3DV6B 4ZQKB 3TT3L 3FT4A 1G7LA 1ZEAH 4A6YB 1AKJA 4G8GD 3N1FC 4CN4A 4L4TA 5FKAB 2IFGA 1X5KA 4CN6A 5DHVH 1TNNA 3RU8H 4XNUL 4NQSB 3OF6A 1XF2A 1L7IL 5J6HA 1HHJB 3DURB 4HK0B 1R3KA 2B1AL 1D5ZB 3BIKA 4KXZI 1G84A 4NKMA 3VJ6B 1RUKH 1MNUH 3LIZH 3ELAT 5CZXC 3SKUD 1S7VB 5FOJA 3W39A 3GHEL 4JREB 2FX9L 4YGAB 5TH2B 4MQ7B 3LKSA 2Y06L 5GSVA 4MA8H 3VCLB 5E56A 2ORBL 4OGAC 1RJLB 2VXSH 1YNKH 4WUUA 1H3PH 1K2DB 5HDQL 1UKQA 4QOKA 2APFA 1MFAL 3I6KB 3CX5J 1T0MA 1AGBB 3SY0A 1DLHA 1V3MA 5DF0A 2HJLB 1CVRA 4BELD 3QFJE 3QNXB 3A0OA 1CDIA 4X7DC 3F65A 4XZUB 4XPTL 3X3FH 2BOCB 1M1SA 1CU4H 4FABL 1A47A 2BVUA 4JFPA 4G3YH 3UJIH 1J1PH 4PLNC 4X80H 3V6OC 2VUYA 5IV2B 1NKRA 1A7OL 2LE9A 1WZLA 4U1SA 5E8OB 2PXYB 1A6TB 1MRCH 2DMBA 5K9JL 4OZGE 4HIHB 3V95A 1KJ3H 5EU3A 3P0YH 3CDCA 3RI5F 2DN7A 3HI6L 1TXKA 5CWSB 3MRFB 4CJ0A 5J57B 1K4DA 1DVFC 3QEQA 5DO2D 1ZVSB 3WD5H 1R3JB 5ANME 1S8DA 1BVLA 3QDJB 1Q72L 4KRPC 3GMRB 4LSSH 4N5UA 2MHAB 4TSAL 5DC4B 5AUMA 1GGTA 4IMKA 3G6DH 3RIAF 2DS4A 2EE2A 4ODBD 4DZBB 2V5YA 1X4ZA 2EYTA 3EOYG 4OJFL 3SDXE 3D25B 1TTFA 3HI1B 3HS0B 1WGOA 4OB5H 5D7IE 4LMQE 1NCAH 4E41D 1U8LB 2ICWB 4OLZH 1S9WB 5T1LB 1T21A 4PJ7A 3GI9L 5I1GH 4M93C 2XZAH 3O6KL 1G7HB 4PBVC 4XAWH 2X4TB 4K55A 1I8MB 1L0XA 3ES6A 1RMFL 1RK1A 3W2DL 5KVGL 2YPLE 7FABL 4G6KL 4PP2A 4C56B 4MHHG 4R6UA 1U8PA 4YHIB 3NMEA 3UX9B 4W81A 1N59B 1NCBH 5C86A 3H7LA 5T5FL 4I3SL 1BZ9A 2DQEL 5DJ2A 4UBDD 2NYYC 3BQUA 3D87B 4G8GE 4LEXL 2DKMA 1L7TH 3B3IB 1G9MH 2YKLL 3GO1L 2UZXB 4NO5A 3IFLH 3FOMA 3ZKQD 1D3CA 4GAFB 1JTPA 1I75A 3LKQB 2AJ3B 2VABA 1JPST 4C57C