5DJZA

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
209
structure length
209
Chain Sequence
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzA01
4H0GA 2YD6A 1J8KA 3HHRB 1N5AA 3MYJB 1Z9MA 3FZUD 5KSVB 2E8ZA 2HVJA 1CDCA 3MA9H 3T3PE 3UTPE 3VXOA 4QHNB 5BVPL 3FQXA 4WUUD 1MJ7H 5KAQG 3MXVH 4OCLC 5BRZD 1UJ3A 3BP5A 5I71B 5JW4N 4LMQE 4JPVL 3L1OL 4GG6A 3HFMH 2NY4D 4JCMA 3CMOH 2JIXB 1J0IA 4GRMA 5JQ6L 2UZIH 3P4OB 2A1WH 2LVCA 3V6OE 1V3JA 3M1BA 5C0CB 5EO0B 3P3YA 3B5GA 3RGVB 1NFIA 4U6YA 4X6CA 4YHLL 1RQ5A 4JCLA 1EIBA 3UYPA 4GRLB 2DM2A 3HE7B 1AR1D 2J6EH 4M43L 4UAOC 1KJMA 4F2MA 5LQBL 2VLJB 2OZ4L 1WZ1H 3U46A 3PNWA 2I9TA 2Z31D 3NABH 2A77L 5K9OA 1TETL 4GMTH 1F8TL 3U48A 5I66A 5C0AB 5I73C 5IKCB 4I9WE 1FNSL 2O5ZL 5I9QB 3DX8A 1YUHA 3L3OA 4OM0L 3NFPA 5MEOA 2DJUA 4M7ZC 1XGYH 5C0IB 5DJ8B 4G42B 4HUNB 1HZHH 5I2IB 5EBLA 3RY6A 3W5MA 5I1LA 3OXSA 5EULV 4KFZC 3W0WE 2EXWD 1JI1A 4EIZC 1GZPA 3QO1A 4CW1B 2VLMD 4TULL 4OGXL 4ODVH 3BZ4A 3QPXH 3V0VB 1E6OL 1IGMH 3MGOB 3LN4A 1TZGL 4QXTA 2WWMD 3I6GA 4IRJD 3LAFA 4OZIF 3KPLB 2WLYA 5D1QB 2ERJB 1BD2A 4JFDE 1LO2H 4NCC2 5E9DB 2IAMA 1N7MH 4WEBH 4X6EA 5CKGA 3AXLB 3B9DA 1U92A 4L29B 1URLA 1IBGL 3MLUH 3O9WA 1FCGA 1CDYA 3EFFB 1RUAL 4L8SB 4WNQA 4X5XB 1OARH 1KCRL 2B4CH 1ZA3B 2D7PA 1VSCA 1FSKB 5AUMA 4NGHH 3Q6FB 5KZCD 2BSSB 1CFNB 4OCWH 2Q7YA 4G6JH 3WXVL 5B39B 4PJ8B 1SBSH 5SWZB 5E4IA 4LRIC 1NGZB 5IVXE 5TDPA 2E3VA 1K2DB 4UTBH 4NCDA 1ZANH 3RX7A 3VWKD 5F7DB 2VDLL 3QYCA 4KKCD 2BDNH 2NTSP 4KMQA 3DGCR 4NRZB 3K7UA 4OCYL 5TE7H 4EI5B 1JNNL 2NNAB 2VABB 1U0QA 3P73A 1BBDH 1XAUA 4OTXL 4MJ6B 5HYQA 2FH8A 3FAWA 2ATPB 3LQZA 4I48A 5CJ5A 4GRWB 5IV2A 3G04A 1QNZL 1RIHL 3OXRA 1OPGL 1UM5H 2NQCA 4I2XA 4HSQA 4WW2F 4UTAL 3MRIA 2ZOLA 4JRXA 1JNHA 5A2LH 5C86A 1DN0A 1FORL 3JVGC 4YO0A 4EI6B 3RIFK 2YRZA 3BYYA 4H0HB 2OI9B 1WZKA 5D8JL 4PR5B 2XTLA 5I1EL 3PP4L 1EEYB 2FR4A 5DMIL 2DYPB 1G7MB 3ULUF 1TTFA 3NCJH 5LAXA 3VG9B 4L8CA 1KJ2H 7FABH 4PV9A 3R8QA 4HUXB 1CF8L 1IZJA 3HI1A 1AD9B 4HWNA 2MPAL 2Y6SC 4KK6D 3GMPA 2I9LA 2VYRE 1C5CH 4ZODA 4FA8A 4O4YL 1RVFH 3RVVC 1KPVB 1FL3A 3BMVA 3G5VA 2C7UA 3IU4L 3QWRD 4PBXA 5D1XA 4W4OA 2X4QA 2EDLA 3IKCB 5KS9B 3QIWB 2RJMA 1T7XA 4IRZH 4S1RL 4XXDB 2BMKB 1T83C 3NH7L 1MHPL 2N7AA 1TVBA 2VH5L 5FV1L 3IJHB 3HS0A 4J3SA 4U0QB 4HZLB 4G9FE 1DQTA 4NDMA 3BUTA 1C5BL 3C60B 4JY6A 25C8L 1F02I 4TSAH 4KMTH 3BXNB 3IETB 2XWTB 1T6VN 1NC4B 3PDGA 3PG2A 2EDQA 4I0PA 3I3BA 3BKCL 1DQLL 2VL4A 5KSBA 1N8ZB 2GSIB 4FOMA 3T0BA 2V9QA 4L5FH 5DSCA 3FQUA 3OAUH 2Z91B 5DD3L 1RUML 2PCPA 3ARFB 3LSOB 4HS8H 2EIEA 5E00A 4C56D 2EYSB 3GI9L 4NNYA 5DLML 1BD2E 3WS3A 1EDQA 3FN0H 1EUUA 1X7QA 4ODWA 5CINL 1FFOB 3T0EC 2EIDA 5I8KH 4LVHC 5MEPB 4HF5H 1DDHA 1AP2A 1G1YA 4M5ZL 4Y4KB 3CX5J 2VZ1A 3L3HB 2DQHL 4CL7A 2AK4B 3HKFA 4YDJB 1INQA 2EICA 1QBLH 3VGFA 4YHOL 2D7QA 5J3HD 5HHOD 1U8MB 3Q3GA 1HDMA 2V17L 2D31B 1FG2A 2RR3A 1PVHA 1B2WH 2NY1B 4MVBC 1CFQA 4DGVH 4NM8L 4HWZA 4YFLI 1MJJA 3FB7A 3SDDD 3HZKB 1A7QL 4UI2A 2AV7A 5T1LA 3T0XA 2YPKA 1AQKL 2VKXA 3DX6B 3FHAA 5E5MA 4XCYB 3CUPA 5DZNA 4KJWD 1V3KA 1IMHC 1ADQA 5KANI 4Y89A 4KV5F 4J3VA 5D5ME 4RNRB 5AG8A 1UA6L 4Y1AE 4P5KA 2UYLB 3MV8B 4HIIA 1U91B 2F74A 5CD3A 3P9MA 3HUJB 5EU7C 3ARGB 5C0GA 2NLJB 2BHZA 4NOFA 5CEZE 3AU1A 1BFOB 1YN7A 3OKOA 3LS5H 2PW2B 4I2XE 5GGTL 4PJIF 3OX8A 4JRXE 5B8CA 4X8JA 1XGPB 3KPRB 4WFHD 2R2BB 2JK5B 5CGYC 5IBUG 4KK5D 4R4NC 1FBIL 4NM4L 3VDCA 1WWCA 4ZFOA 1EFXB 2IQ9L 3KXFA 2MQ3A 3NIGE 1Q9LA 4PP1C 1C08B 1I9JH 1E28A 1S5IL 3W39A 2CGRH 4POUB 2FD6H 3IU3A 1EXUA 3QCTL 2HH0H 3OL2A 5ACZB 5GGRY 4CNIB 4JKKA 1AGEA 5I74B 2BOCB 1YEIL 4Q6IB 3WEXB 1UGNA 3B6SA 1LDSA 3HLAA 2HLAB 4YLQT 4JDZA 3I3DA 2GAZA 1FGNL 5L2JB 4NQEE 4WI5A 3UBXI 2ZUWA 5CAYB 3GIZH 4FQ1H 4AG4L 1WQVT 2VR5A 1AXSA 1YC8A 4YUEL 2VDOH 4DQOL 4ZYKA 2EDTA 5KVEH 3MBXH 1KB5B 2CKBB 1FL5A 1YNKH 2CDGB 4OLUL 3RVXC 3AM8C 2JJVA 2FGZA 4XTRD 1S7RB 3HAEB 4RMTA 3KYMA 4ZG1A 3L6FB 3O6KL 2FYYB 2C3VA 5L88L 1A5FL 5B38A 5IROA 1EAJA 3MZTA 4DVRL 1VEMA 4JZJA 1Z0MA 3O6FC 4KUZH 5E94B 5D96B 5D7JB 4Z76B 3BPOB 1JZ8A 3LKNB 1GGIH 2M1KA 1C5DA 1A7OL 2JJWA 3RWJA 3B8YA 3OGCB 3IJYA 4PJ9B 3PJSA 2JCCA 1VACA 3EDFA 2P5WB 4RSVA 4Z95H 5D1ZC 3KDMA 4XP9L 1RHHB 2E6QA 4UQ2A 5DD5L 1ZAGA 4QRQB 1IGIH 4LGSB 3UTQA 4EN3C 5IIEA 1NCWL 3UAJC 1IC4L 1MRFH 4GFTB 4GAJL 5IFHL 5EIVA 5ALBH 2C4FT 4XI5C 5D2NA 4LASL 4HT1H 3HI5L 4OCRL 1FFPA 2YWZA 3BUYA 4PJFF 4N0FB 1CFSB 1P2CA 3BT2H 3E6FA 1HXMB 1JCKA 3MX0A 2FX8L 2WW8A 3O6LH 3U4EA 2H3NA 1A0QH 2OTUA 1HHIA 1AE6H 4OFDA 4H26B 1K3ZA 4NC1C 1IGCL 5FGSA 1CK0L 3VW3L 2EE9A 5DVKA 3QP3A 3BP7A 1Q0XH 3ARDA 2YKLH 3O4LA 1AIFA 1NMCB 1P4BH 4QRRD 4D8PB 4U1KB 3LVEA 4CMHB 5FYKH 3QQ4B 5D72H 4TPRH 5JQ6H 1QFUH 4LCIL 2X4RA 1ZWIA 1A4KB 4TSCH 3UTSB 2NXZB 1KIRA 4QHLB 1UQSA 3SDAC 2DQDL 3QFDA 4QCIA 3OJDB 4XBEL 5FHBH 3CC5B 4G8GD 4DKFH 2G2RA 1CLZH 3D48R 3LKQB 1UVQB 2OR9H 5I75B 1JTOA 3VXPA 3ZT7A 3QEGH 4KQ3L 4XVSL 3ARZA 3H7LA 1OAQL 1VPOL 2C4FU 3DVNA 4PREA 3RAJL 1A4JA 3OWEA 4H20L 1GJIA 3GO1H 2MSPA 5HGBB 5C0RL 1RURH 1TJHL 2E7LC 5DK0A 3DVGB 3PWVB 3W11C 3R0MA 1Z9OA 1P7QA 4NIKB 2VLLB 2LU3A 4XZUB 5DJDB 1GGCL 1ZT1B 2KUTA 3RNKB 1K8DB 1TQCC 3STLB 3G5YB 3UCRA 5J6HA 4U1HA 3SCMD 3S5LG 3WFZA 4P46D 5DGQA 5ANMA 1QRNA 2QBWA 1BQSA 1YPZA 2XNAA 3DSFL 3LS4L 1ZTXH 5IB1B 5JIIA 3ARBC 5JDJA 1R5WB 2GHWB 1DZBA 3OHXA 2C9AA 3DMMB 3DXAD 4XBGB 1VFBB 3OKEA 3UTTB 4KY1H 5IGXL 2NXYD 1C8PA 4NN5B 1N59A 3IFPA 1MCWM 5IW3A 3MACH 4ZSOB 5LGHH 1CIUA 1T1ZA 1WF5A 32C2A 1RU9L 2LU7A 5C6PB 1RHFA 1MI5E 4KTDL 4TTDD 5D71L 3P9LB 4WI7A 4YHPB 3ZYZA 3WO4C 4KI5D 1RZKL 4MJID 1U93B 3VD4A 5EUOE 1EH9A 1L7TL 1VADB 3HG1E 3BJLA 3HNTH 2DTMH 1F90H 5ESAA 2DBLL 5ACLA 4R3SB 4Y4FD 3UYRL 1RULH 4U1MB 4MJ5A 4O2FB 4UBDC 3CVHH 3QDGD 4ODBD 1BM3L 4JFPA 3MROB 1HQRA 4OQ1A 2CXGA 3WMSA 1YEDA 4B41A 2F8OA 3UDWC 3FZUC 1FPTH 3NMEA 2P4AB 3MRRB 1M7DA 4DUVA 4YXHH 3S5LA 1I3VA 5DFTA 3CSPA 3GSUA 4PRAA 2Z35B 4LCYB 2DIJA 2NY2D 1V8HA 4EEEA 2AJVL 5JNYB 5BXFB 4KU1A 3C9NB 2NY4C 4PY7B 4UU9A 3R1GH 4WTWA 5FGBC 4AMKH 1HHHB 1UH2A 4XVJH 4BZYA 3T2NL 3B9KC 4PP2B 4IS6B 1KXTB 1A6VL 3OAYK 3RWFB 3WXWL 1MJ8H 1ETZB 1T3FB 3BN3B 4NKMB 5T33H 1QSZA 4HJ0D 2M2DA 2CQVA 3UTPD 1KIPA 4LHJB 1AGCA 2EYRB 2YD9A 1JGDB 3L7FB 1AR1C 3O4LE 2F5AH 3QUXA 4GKNB 4RGNB 4PTUA 3TJEL 4HK3N 1WFOA 1G6RB 3GI8H 1Z0NA 2XG4A 3UXFA 3BO8B 5IT2L 2Z31C 3SOBL 3CFKB 5TF1L 4ZFFA 1U8LA 4YC2C 2IPKA 4CJ0A 1FH5L 4JQXC 3WLWD 3EYFB 1I9RL 4QYOB 3TBWA 1X5ZA 1I1AD 2H2PC 5EDXA 1JF1B 2PYEA 1A6AA 1SJXA 1A3RH 2AK1L 1EAPB 4S2SA 1WBYA 2QV2A 4UDTB 2AJXH 5CD5D 4F3FB 5CIPA 1JWMA 3DYPA 1Q1JL 3QNYA 5EBWA 1N64H 1DBJL 4GSDL 3X14B 4JHBA 1MEXH 3S4SG 5K59E 1QHPA 1JPFA 2EXWC 1OT1A 2G75A 3OKNA 5EUKB 3IDGA 4NUJB 3ZYIA 3VXQA 1D5BA 3T09A 5CP7A 5GGUB 3TVMB 4OT1H 3P4NB 1J87A 1ZEAH 3IXAA 4K23H 1KEGL 2CRZA 1HINL 2WWMC 4IRJC 4JZNA 3PWUB 2VC2H 4GLRI 4I9WD 3HZYA 3IFOA 2FEDD 5E1HB 5EU5A 3TA3B 1E4KC 4IEFB 5E2VH 1G9ML 4F57H 3VFOB 2YC1B 1CT8B 1D9KD 3BH9A 2PETA 5TFSH 1NBZB 3MV9B 1J8HB 1J1OH 1RIUH 3QAZB 5ISZB 1VKXB 3DWTA 1LDPH 2PTTB 3RTQB 3MV7A 3GSWA 3VWJD 1DLHB 2R2CA 1DE4A 1TZIB 1YPZE 1HILB 4H5SB 3DV6B 3CJJA 3IYLW 5DUPH 1JPTH 3N1MC 3C6SA 5IBLD 3TV3H 4CN4A 4Z7OF 5T3XD 3CFEB 2IEPA 1PZ5B 3H3PL 4MAYD 4RRPA 1JHLH 1QQDA 4WTXA 4PRNA 2ADGB 1D5XA 4OCXL 5I0ZA 4CGTA 2W9DL 2N1KA 2H8PA 4MA7H 1YY8B 2BOBA 4KKCC 2F53A 3GSOB 2E27L 1MFDL 2YSSB 4DZBB 3S4SA 1ZHBB 4HWUA 5E5RB 4GRWF 3C5ZA 4IRSB 4LQFH 3NZHL 4KVCL 3FMGH 5F9DC 4K7PX 3B83A 1KN2H 3QG6B 5J57B 1Z5LA 5EU4B 4PJXE 1NBVL 5HHNA 2X4UA 3EBAA 3PHOA 4GW1A 4JKWA 3S34L 2A83B 3DI3B 4JANB 4FABL 5CJBA 1NSNL 1H5BB 2Y06L 5I1CL 5JDSB 2J88L 1I8LA 3QULB 4OZHA 3N9GH 1KCUH 1LVEA 1YNLH 4UT7L 3LQAL 1DBML 2R56L 1VEOA 2VR4A 5GGRA 1XR9A 4LLDA 1IGYA 3MBED 3P4MB 4DZ8A 1MRCL 1GGUA 3KWWB 5HY9B 5LBSH 5I6XC 2GTWA 1PQZA 4XP4L 2XTJB 4PJDB 4RA3A 1G7IA 2VERN 4NWTL 2R29L 5B3JF 1ZT7B 1WWAX 5JHLL 5CSGA 1FYTB 4MNHA 4KK6C 5KS9F 1MIML 1WBZA 1RD6A 3E0GA 2JJUA 5IFAL 5IFJB 3R4DA 3C8KB 3WD5H 2Z4QB 3MLVL 4P4RA 4LVOB 4QTHB 5H94B 3KG5A 1TJGH 1NLBH 5CLWA 3HZVA 5EBGA 4LIQL 4FP8L 3SEPA 1QSEB 3PGFL 4WU5A 2IMNA 4JPIB 1G7PA 1EGJA 1JGEA 1MCKA 3GMLA 4FQPA 3U7YL 2XPGB 2C4XA 2YN3A 4MNQE 1PKQA 3WFHA 3DO7A 1AO7B 3MOBL 5GS0H 5GRUL 3ZLQC 3KPMA 2EE6A 3GMMA 2PW1B 1U3JA 1OTUD 1W2KT 2ARJQ 2H6PA 4NBYB 1NGYB 5KG9B 4M3JA 1XT5A 4GBXB 3T2PA 2MQ0A 2V9RA 3S37L 3SDCA 4GAYB 3TCLA 1KIQB 3MJ9L 4WGWB 2K7QA 2P24B 4GJTB 1T6WA 5HI3D 1OTSD 2DQFA 1EEZA 1SHMA 1WT5C 4X6BB 1T2XA 3TYFA 2F19L 1F3JB 1FIEA 4X0KB 2DB8A 1RY7B 2NW2B 4YDIH 2CLRA 4CBPA 4XCFL 4QF1A 3Q5TA 1T20B 2EH7L 1KNOA 2X70A 4RAVA 2G5BA 3T8XB 1CFVL 2XQBH 3QI9B 1WBXB 2B1AH 1MQ8A 3QIBB 3UJIL 4WW1B 3IDIB 1JV5A 2IFFL 1P4LA 1BFVH 3WFEL 2A6KA 3A6BL 3MRCB 1SJVA 3FFCA 2CDFA 3ZDYF 4QY8B 1R5IA 2ITDB 2IALB 1UXSB 4ZAKD 3UBXB 5J3HC 3HI6H 1RJLB 4U1NB 4JVUA 5M95B 4JFQB 1KV3A 3VXUA 4JY4A 4FQ2H 4QRPD 3QHFH 4OZGE 3D85A 4RMVA 3STBA 3VA6A 1A6WL 3OTTA 1KGCE 2FJFB 1IZKA 4BYHA 5EZOL 3BHBB 2VSCA 3GMQA 4KJWC 3HUJF 2ZUXA 1NCNA 4FXGA 3O11B 4ZFZB 3CXHK 4AL8H 4LHUD 2IAND 5DA0B 1BVLA 4XC3L 1QSFB 4C4KT 3FCTA 2B7DT 3SQBA 2P5ED 3ZT6A 3ULVF 4TNVF 4OLYL 4TVPD 3UPAA 1XGTA 4X6DB 1QLRB 1T03L 4I13B 1DBKL 4WTZA 1BF8A 4R2GD 5SWSA 4WWKA 4WFGD 4KC3B 3NPSB 4M7JH 3WIIL 4KK5C 1FZMB 4NNPL 5DRXA 1I7TB 2GJ6B 5J4MA 5MI0B 2ESVA 3RY4A 4Y1AD 1CDIA 2BVUA 4E0RA 3HMXL 1W0WB 4XNXH 4LNVA 2JIXD 5EU3B 4JHWL 1ZGLA 5C0CD 1FFQA 3FB5A 1Q0YL 2AJ3A 2IPTL 4HJJL 3HZMB 1N5AB 4H1LB 1IC7H 3CVIL 2QR0B 4KPHL 3GKWL 5KSAA 2HVJB 4GRLD 4W6YB 3VXOB 3HE7D 2QADB 1FNGA 4YK4B 1UM6H 2DQIH 3KLDA 4IDJL 2V2WB 2VLJD 2B5IC 3WJJA 2HT3D 4EQ3A 4WDIA 3KJ4B 1UJ3B 3BP5B 1A2YA 4XPBH 1GHFH 4GG6B 2XWJA 2VN7A 2J1KA 2VDRL 1L9MA 5C08A 3M1BB 4AEHL 5C0AD 1NFIB 4U6YB 3UZEA 4X6CB 2YD7A 4NBZB 1JE6A 2A9ML 3PWNA 5DJCB 3S3PA 4Y5VC 4HXAH 3PABA 4XTRC 5MENA 2BCKB 2DJSA 4X7CC 1BZ7A 4RGOH 3EJZD 1UEMA 3QEUB 4F2MB 1KJMB 2EEDA 4LLQA 4YDKH 2Y36L 1W72H 3O45A 5IB5A 3U46B 3PNWB 4XVTL 3MLRH 2EEAA 3Q5YA 5K9OB 2A73A 4RBPH 1PFCA 1LO0H 4PLOB 2FL5B 3PUCA 5D1QD 1RFDH 1XIWA 1YY9D 1FRGH 5TF0A 3DX8B 2D0GA 5E9DD 1KUMA 1RZKC 3NFPB 4IJ3B 2CSPA 5C6TH 1JYVA 1I4FA 4N1HB 4GKZA 4ZOAA 3B2UD 5EBLB 3OXSB 2ZUQC 4R4FL 1BGXL 4MWFA 1GZPB 3LZFH 3QO1B 1FZJA 3QFJA 4URTB 3S9DB 1Q94B 4TN9A 5HGDA 3BZ4B 5IEKA 4XPTH 4J6RL 3LN4B 4EKXA 3VXNA 1OGTA 3FFCE 5TDNA 3TBTA 4Q97A 3I6GB 2GY5A 1RZFL 1M7IA 4R0LC 1LMKA 3MRPA 1ZOXA 4P5TA 2R0WL 3ESVF 4HJGA 2WIMA 4BFBD 4X6EB 3VXUE 3PXJA 4HS3A 1U92B 4ODSH 4TVPL 3TO4B 3O9WB 4WHYH 5DQ9A 4NHCL 3QUYA 3HC0B 4WNQB 1MWAA 4P9HL 3G6JB 4EI5D 3O2DH 1CI5A 3PHSA 3LMJH 3QUML 5AUMB 5GISL 4WFFE 2ZSVA 2DD8L 5A1AA 3MCLL 3GJEA 1MCDA 3SE8L 4GUPA 4ESKA 2Q7YB 1V3MA 2IPUK 4UOW1 1EBAA 3HC4L 5JOEA 1MRDL 3FQNA 5TE4L 3K4AA 3V4UH 1KTKE 2YD1A 3MODL 5SWSE 1BF2A 3QDJA 3O4OB 4WW2C 2CIIA 1W72A 3P73B 3W9EA 1AC6A 2ESVE 2DYPD 4HCRH 5HYQB 1D5ZA 4I48B 3LQZB 3AB0B 2E5EA 3OXRB 1IQWH 3SCMC 3D3VE 4UNTA 5BW7C 3MRIB 4P46C 2ZOLB 4ENED 5HPMA 1JNHB 4JRYA 3V0AC 1DN0B 4GAGH 4NQXB 4KK8D 4YO0B 2ZJSL 4P3DB 2YPVH 5BV7H 1G9MC 3VG0L 3QIWD 2D9CA 1WIPA 2CRMA 4ZO6A 2FR4B 2NXYC 4XPFH 1LO3H 1UWXH 4YIQB 3VFSA 4PV9B 2QSCL 3HI1B 2AV1A 4WJ5A 1OCWL 5F9WB 4HV8A 2I9LB 4TTDC 1OL0A 1RIVH 3C60D 3RQ3A 4DWHA 2BVPA 3HB3D 4OKDA 5HVHC 3AROA 4OV5A 4KI5C 2ZOKA 3LV3A 1FL3B 3G5VB 1L7IL 2C7UB 1FFNA 1NC4D 5D1XB 2X4QB 4TQEL 1JGUL 3ZE2F 4Y4FC 2GKIA 1JFQL 1UCTA 2YUXA 5C9JA 2BVEA 4Y19A 3SJVA 2XACC 2W9EH 1TVBB 5D7KD 2ZCKH 3HS0B 1FP5A 3ARFD 1AJ7L 3QCUH 3K1KC 4NDMB 1C1EL 3RWGA 3SO3B 4JY6B 2DQGH 2BHUA 1R3LA 4QRSA 5DD6B 2EYTA 3NAAL 1ZS8A 1QFOA 1NFDE 2NY2C 2YN5A 4JM2F 2XV6B 3JTSA 3FO2A 2WWKO 4I0PB 4J3UA 5F9AC 5ID0A 5KSBB 2AK4D 2OR7A 2V5YA 2R2HA 1RJYA 2ORBL 1X4ZA 4WENB 5DSCB 4W6XB 5TQ0H 1QPPA 3IFLH 1MNUH 5IVNA 3K46A 2LV4A 2PCPB 5E00B 3S3JA 4NNYB 4HJ0C 1MIEH 3WS3B 1X7QB 2NY1D 4ODWB 1MFBH 2ED7A 1IAIL 3DURA 1XH3A 4CDGC 3QXVA 4I3RH 5D7SH 3B9EA 3H8NA 3PL6C 4OGYH 2WZPD 1MQKH 4HIEA 1AP2B 4M62L 4XX1E 3V8CA 5CZVL 1E27B 5JW4R 5C0FB 2P8PA 2Q8AH 4ZUTA 2Q7NA 2DKMA 3A6CL 3VFMA 3WJLC 4UINH 3BEVA 3WLWC 1S7WA 2KQNA 1INQB 1UEYA 4Q9CA 3AC0A 1LO4H 1CDUA 4EDXA 2XRAL 2YXMA 1I1AC 3H2WA 1B4RA 1NC2A 3Q3GB 1HDMB 1FG2B 3T08A 3MV8D 2WUBL 2KBGA 4Z0XA 5CD5C 3S96A 2ZCLL 3ARGD 4HUMB 4G8IA 1MELA 3FKUS 5DT1L 3QRGL 4PGDA 4HWZB 3CSYA 4L9LC 4JQVC 4R9HA 1TMCB 5JLZA 3FB7B 3IFNH 3JTTA 1IL1A 1U6AL 2AV7B 3KPRD 5T1LB 5ITBH 2YPKB 2VWEE 3AREB 4OBSA 3H9HA 4DFIA 2HTLD 5E5MB 4ONGH 1HEZA 5DFVD 2KZ1B 2GITA 2Q8BL 1Q9WA 1YEHL 1EFXD 1BVKA 1FLRL 5JIHA 2FEDC 4HMCA 4U1JA 4O9HL 4KRPB 4P5KB 1SVCP 4HIIB 5ESQA 1D9KC 5CD3B 1YMMB 2HJKA 1U8OB 5C0GB 3QG7L 3AU1B 3ZE0E 3OKOB 4FN0A 5HYSG 4XNZC 1GGBL 3U7AA 5E6IA 1S7SA 3OX8B 4X8JB 3F7PC 3VWJC 2UWEA 4JRYE 2MJWA 4FS0A 4PRDA 4UV7H 1ZK9A 3RWDA 2KDGA 4QWWD 2J5LC 5IBLC 1CLOH 3V79C 3KXFB 5C09E 3W9DA 1TJIH 1Q9LB 5DI8A 1TFHA 4MAYC 1OAZH 3W39B 1LK2A 1U8IB 3IU3B 2GCYA 1EXUB 4M1GH 3VDAA 5GJSL 3ULUH 2R0LH 1AGEB 3VGBA 5DHVA 5F97E 3F58L 1UACL 4BUGA 3NACH 1B6UA 5HI5C 3B6SB 4C83B 3JWDC 3HLAB 4JDZB 1BOYA 2GAZB 3RVTD 4JY5L 5CJ8A 2FATH 2QQNH 3WUZA 1CU4L 1AXSB 3HMWH 5BZWA 4PJ9D 1E4WL 4ZYKB 4Y19E 4LOUC 2P5WD 3CK0L 3VXME 5F9OL 3QNZA 5HYSA 3KLAA 4ZS6D 2VXQH 4LSPH 4PJDF 4K7PY 2C3VB 3J8F7 4JFZH 1CL7L 2O61A 4JZJB 5IBUB 1PSKL 4EVNB 2MWCA 5ADPL 2QLVB 3SGKA 2CMRL 2NY0B 1C5DB 3RWJB 3VGHA 4TSBL 3PJSB 2JCCB 1VACB 3G9AB 2AEQL 4DFHA 1V7MH 4ZFGH 3KDMB 2YEZB 4ZPVA 1U42A 1FIGH 3E8UL 4UQ2B 1GIGH 2RCSH 1E4XH 3UTQB 5IIEB 3FFDA 3WSQL 4NKOA 1QFHA 2XQYK 1AFVL 5D2NB 2VITA 2VE6A 3ARWA 2ZKHL 2B0SH 3BUYB 3Q6GH 4LARH 1YYLL 3UTSD 1P2CB 1CGSH 2CK0L 2H3NB 5TE6L 3IAPA 4APQD 3RKDD 2OTUB 1G84A 1HHIB 4FQJH 1DBAL 3UYOD 4QGYA 3SHSA 4U0RC 4OV6F 4K3DL 3BP7B 2IG2H 2P8LA 2QJDA 2VXSL 3ARDB 1OTUC 4NUGL 1AIFB 4N8VG 1I9IH 1VERA 2VDNH 4AY0A 1LE9A 3FONA 1MCEA 3RA7L 4A6YA 4GMSL 1Z3GH 5K9QG 1J5OL 1UM4H 3RJQB 3H9SE 2X4RB 1P9MC 1ZWIB 2GQHA 2HKHL 1KIRB 1JNLH 1UQSB 5AD0A 5HI3C 1OTSC 1GRWA 2R69H 3OPZL 4MNQD 4QCIB 3ZL4L 5BOZG 5FFLA 1GOHA 4ELKA 1QYGH 1RPQA 3WIHH 2G2RB 3L7EA 4Z5RA 3MRLA 3VXPB 3I3EA 4BUHA 3EZ8A 1Y6MR 1LEKA 1C16A 2F58L 3DVNB 4PREB 3C6LA 1A4JB 3NA4A 4XHJD 4HHAA 3MUZ1 1HXYA 4L3EA 4LQ1A 4QHUA 2CO7B 2YS4A 5DK0B 4JFHE 5DF0A 1DUYB 3WNMA 1P7QB 1MUJA 4ZUWB 3DARA 3ET9F 4ZAKC 3GMRA 1MLBB 1HIMH 3UJJH 1SYVB 1QACA 1U8PB 5IB2A 1KPUA 4MZ2A 4OLXL 4FNLH 5TH2A 1L9NA 3BZEA 3I6LD 3H42L 3CXDH 5C70A 4J1UA 3RJDA 5ANMB 2R0ZH 3STZA 3ELAT 1QRNB 4N8VA 5F6IC 2DQJH 2XNAB 5SV4A 5E08L 15C8L 4RWYH 1FAIH 4A2MA 2BNQB 3BKYH 2EDHA 4P2YA 4JFEA 3OG6B 1HI6A 5T3XH 3D0LA 3NFSH 3OHXB 5HDQH 2WBKA 2DQCH 1N59B 3IFPB 4L9DA 3V8OA 1HHJA 2VUOA 1VCAA 1VESA 4YBLC 2Q76A 3F6LA 2BSRA 2HFFA 5D7IA 1WFNA 4P9HC 1C7SA 5EOQH 4R2GC 4I1NB 1LE5A 3JWDH 1YQVH 1ZVHA 3SY0A 4LSTH 4AQ1B 4G80A 4ZUVB 2HA1A 4QT5A 1XZ0B 3KJ6H 4AENA 5ESAB 1I7RB 1IFHL 2ADIA 4MJ5B 1ITBB 5L6YL 3D2UA 2FEEL 5L2KA 2EZ0D 2J4WL 3C2AH 2B39A 4HDIA 3LD8B 5HYEA 3MRKB 1DQQA 1QFWI 4LSDA 4E5XA 2WV3A 3O6MH 1JGLH 4GRLC 5JW4Q 1M7DB 3OMZA 3HE7C 3LCYA 4HWBA 3S5LB 1AHWA 4GG6F 3P0YH 4RGND 3GSUB 4PJ5E 4PRAB 5E8DL 5FGCB 4R97B 4DAGL 2OTPA 1IM3A 5IEHA 4Q9RH 3JVGA 4X6CF 4N0UA 3PE9A 3X13A 4UU9B 3X11A 4X98A 4GKSA 1JPSL 5GHWL 1FVCB 1UCBH 4HIJA 1WCBA 2ZP0T 1U41A 1ZV5A 4Y16D 3OAZH 5AYUL 1CD9B 5JMRA 5I9QC 4PB0L 1KIPB 1OLLA 1AGCB 4OD1H 3SQOL 3QUXB 3EYSH 2XKNA 3EJZC 4PTUB 5EU6A 5IHLB 4LPXA 4XP1L 4K71B 5D7LA 1AD0A 2H1PL 2C3WA 1YMHA 4ZFFB 1EPFA 4UIKL 1U8LB 4NJ9H 3TZVD 5ICXB 2IPKB 3TVMD 4PJHE 1FVEA 4TNWK 2W0KA 4OF0A 3TBWB 1KFAL 3IDUA 4LLVA 2PYEB 3GK8H 3DUUA 4OSUH 3DRTA 1A6AB 5D1QC 3TA3D 2DQUL 1YY9C 2X42A 5ACMA 3GSNH 1BAFL 1T83A 1WBYB 5FO8A 2H2SD 5CIPB 5EIIA 3CDGA 2W07A 3MV9D 5LWYH 2ZUUA 5KAQF 1J8HD 1WEJH 5EBWB 5ISZD 4AH2A 3B2UC 3N85L 4L4TA 1KELL 3BP4A 4UT6H 1GPOH 2OL3L 2XZCH 3RTQD 4JKLA 1JPFB 3W81A 1X5JA 2G75B 3TWCH 1DR9A 5EOCL 3OKNB 3IDGB 4L8SC 3VXQB 3DTXA 5CP7B 4JGMA 1CLYH 4AEIH 4MJ4A 2UVFA 3INUH 1UKQA 5FEBA 4WY7H 3IFOB 5EU5B 1UWXK 3KPSA 1G7QB 3BH9B 4XPAL 4Q2ZB 5E2WL 1YZZA 3VGAC 3NOIA 1H3PL 3DUSB 4P2QE 2AS5M 1OAXH 5EO1A 4HWEH 1N6VA 3MV7B 4N5EC 2VO5A 1DE4B 3T0EA 5B22A 4EI5C 5EC1A 4HS6B 3C6SB 4JFEE 1G0DA 4GG8A 4IRSD 5FM5M 4CDHA 1OM3L 4NN6C 4OI8A 1UZ8A 1WTGT 2YPLA 4M7LL 5C7XL 4O51A 1QQDB 4RAUA 2V2XA 3PGCA 4PRNB 3UPRA 4XC1L 3GBLA 2H8PB 4KHXH 1J05A 1JBJA 2BOBB 5D7IE 5DVLA 1I8MA 3LEYH 4YHNA 3THML 1GYAA 2F53B 1BQHG 1J1PH 1MCCA 5I1AA 1WIUA 3PWPA 4EXKA 4PBWD 4PB9H 1XEDA 4JFYA 4PTTA 3S4SB 3ARVA 4PJCA 2F54A 2OI9C 3DSNA 3BGFB 4XH2A 4S10A 4QLRA 4CRPA 4L4VD 1Z5LB 3DGGA 1JHKL 1I8KB 2XTJD 3VG9C 2X4UB 3PHOB 5CSZA 1EO8H 3MREA 3I75B 4WU7A 1G9NC 4OUUB 5FHAH 4XXCC 4P3CH 1FYTD 1ZKAA 4ENEC 4OZHB 1Y18A 5IQ7H 3RDTD 2AXJA 1FO0A 4KK8C 5I8OL 1HKLH 4JLRA 4NQDA 2NX5E 1T2QH 1XR9B 2ZWLT 4I77H 5EORH 2E6PA 1ONQB 4GH7B 1QSED 4JR9L 4OI9A 3SPVA 3IVKA 4MDIB 5IESL 4PGEA 1TENA 3C5SA 1BJ1J 2GTWB 1G7IB 3OJMB 4NSKA 4YDLB 3LEVL 3DYOA 4F7MA 3GNMH 2DLFH 4XWGH 1MVUA 1AO7D 4MNHB 3L5WA 4M1DL 2I24N 2XFXB 3DNKA 1WBZB 3C60C 2JJTC 3HB3C 4XNMA 1HKFA 3QCVH 4PRPD 1DCLA 4GBXD 1H3XA 5C07A 4P4RB 1NGXB 1UT9A 2BVOA 4K3HA 3LDBB 5D7LE 1MFCL 1UWGL 4WU5B 3BDYL 1G7PB 2D7TL 1A6UL 1JGEB 1RZ7L 1QLFA 5D2LE 3GMLB 4U6XA 4JG0H 3SKJH 2ZCHH 1PKQB 3WFHB 1GAFL 7CGTA 3DO7B 4TRPH 3ARFC 1SJEA 5J6GA 1A14H 5F88B 4X7DC 5IJVA 3KPMB 5IMKA 4OFYA 3GMMB 3N1GC 3ME0A 5KSBF 3QI9D 3KPOB 3TIEA 3AM8A 4L4TE 1FZKA 3CFJB 3QIBD 4N1CA 3TCLB 1KEMH 1J1XH 3TBYB 4OLZH 1D7FA 5C6WH 1I7UA 2A6JA 5I19L 2ICWA 2R0KL 2DQFB 4OIBA 3WNLA 3TYFB 4PGCB 3NIDF 1UC6A 2IADA 3AAZA 2X40A 1T0MA 2Z8WC 5HHXL 3TC9A 4HMEA 3U0WL 2N4IA 2CLRB 1DBBH 1KN4L 3T0VA 4QF1B 4K3EL 2MCG1 4L8BA 1IGTA 2X70B 4RAVB 2NY3B 2G5BB 4ZXBD 4FFYH 5D1ZA 5GGSY 3WNKA 3LPGA 3H3BC 2BRRH 3U82B 2XN9A 5IW1A 2FCBA 2MHAA 4G6ML 3RWCA 5HHPA 3GGWA 4JO3H 4EN3A 2OTWB 3LRHA 1MAML 4F58L 2A6KB 1YJDH 2DOCA 4HUUB 2CDFB 1R5IB 2EIBA 3LIZL 2UZYB 3M8OH 1JZ7A 1XR8B 4H25A 2EH8H 1QSFD 3MLYL 3JSSA 4QXUH 3VXUB 1IC5H 1IAOA 1IEHA 3D85B 1I3GL 4JQIL 5J11B 1NH6A 4UILL 4LSUL 4X7SH 1IAIM 2YD2A 5JPMA 4NKDB 5F71A 1MJUL 2LFGA 3QUKA 4YGAB 5ALCL 5CGMA 2HTLC 3BZFB 1R3IH 4BZ1L 3GMQB 1KCKA 1E4JA 5DFVC 2DIBA 4N5UA 5L8KB 2GJ6D 1CR9L 4FXGB 2F54E 3SGDH 2VDMH 4LDOB 2GYSA 3VFTA 3VXSA 1N6QL 3SDAA 3U4BL 1BVLB 3VD5A 4NZUH 4GRWH 3JWOL 3EDJA 3IDJA 3ES6A 1XGTB 5DQDH 1NGWA 4KHTL 4K8RL 3BGAA 5I74C 4Q6IC 5EU7E 2OZ4A 3RWHB 4WWKB 4WO4B 3S36L 2WUCH 4U3CA 35C8L 3D87B 2J8UA 4QHKJ 3MCKA 4QWWC 1M71A 5HVGB 3FT2B 4L4JA 2E7LA 3FRUB 5GRJL 4AIZB 4E0RB 3OR6A 1NCCH 4QHMA 4C58B 2OR8A 3MNVA 1ZGLB 1UYWL 1G9NH 4MMZC 3FB5B 5CILL 2AJ3B 1H8NA 4LLUA 2VLRD 4MAUH 1KC5L 1DQML 5KSAB 2Z0BA 4O2EA 4PJEA 1F3RB 2XZZA 2AABH 2Q6WA 4LRNH 1FNGB 4RFEA 5GS1B 5C09D 3RVTC 4G7YH 4WDIB 4JFFE 4MLIA 2H32A 5FECA 1A2YB 2ICES 5D96C 4DW2L 3Q1SH 3BPOC 3KGRA 3LH2L 1H3UA 1PG7H 1BBJA 2DM3A 1WSST 2EDFA 3ARBA 5C08B 3DVFA 4FQLL 4MB3A 1V7NH 2YA1A 3CCHA 3MRNA 1MFAH 3HCVB 2VAAA 4JKPL 4P2RE 5DTFA 3PWNB 4RDQG 3P77A 3PABB 1NBQA 2VQUA 5MENB 4F33A 3VA2C 4ZS6C 1E4XI 1MHEA 1JGVL 4LLQB 3PP3H 1MSPA 5FUOL 3O45B 5IB5B 2JCCF 3A67L 4OCSL 1DQDL 5GZOC 1EVUA 1WIOA 3PQYE 2A73B 3ZDXF 2L4OA 1FN4B 1DEEA 1YYML 1AY1H 4NO0A 2HFTA 4UOW0 5FYLE 4NZTL 3VXMD 4NQCA 1NLDH 3BKJL 1OLZA 3VFGL 3G5ZB 4YQXL 3RKPA 4OIIL 4GKZB 3PHQB 4ZUSA 4Z7UB 3O3BA 1NANH 1QBML 4MZ3A 3UDWA 4CJ1A 3TO4D 4CMHC 1INDL 3GEWB 3O9WD 4I8DA 4MWFB 1FE8H 1XCQB 2JTDA 1FZJB 3QFJB 1F6AA 4LSRH 2YA2A 4DGYL 4O2CA 4F80A 2O5XH 3TO2A 5HGDB 5IEKB 3IDYC 4WUUA 2E7HA 3VXNB 5C0ND 4JHZA 3O0RL 3TBTB 3LN5A 4APQC 3RKDC 1M7IB 5GRVK 5I75C 4P5TB 5EWIL 1YEKL 4Z7WA 4BSJA 3B9KA 4U1LB 4HJGB 5FO9A 2OBGA 3DIFA 1M05A 1SY6L 5DQ9B 3QUYB 4J3WA 3MLXL 4P99A 3VRLF 1TQBC 1JPGA 4ODXA 3MLSH 2FGWL 3QIUB 1S9WA 2BXZA 3GJEB 4GUPB 1FDLH 5CJOH 3VFUA 3ZYJA 2XA8L 3X3FH 2ZKHH 4KJYA 1MCBA 3FQNB 5IHUH 2QQQA 4BZ2L 2VXUH 2HVKA 2LU4A 3PWLA 1DL7H 3MUY1 3ULVH 1CXEA 1ZLUH 5HD8D 1F4YH 4FQCH 5GGQH 2JELL 3CLFL 5BS0E 1WTLA 3NGBC 2MKLC 2FX7L 2R4SH 3QDJB 4F7TA 4XNYH 4CKVX 1HQ4A 4XNQB 1WWBX 1W72B 1QLEH 3QZWA 3W9EB 1HH6B 2ED9A 2B1HL 3JV5A 3QUZD 5F70A 1KTRL 4N8PA 3V4PL 2AERT 2PR4H 4NN5C 3DROA 1WITA 5DD0H 4IRJA 2V5TA 5ICYA 1YPZF 1NAML 4M93C 1N5YH 3OAZK 1TPXB 1E4KA 5MHSD 1B0GA 4BJLA 5GRXG 5HPMB 4XP6L 3BAEL 3L3GA 4FQXD 4PJEE 1F4WL 5GQBA 5J89A 1QUNA 2AJZA 3MRHA 5EZLA 3UP1A 4W81A 5D1XD 1IGFH 2HLFC 4YHZH 4G6KH 3VXRE 5F7LB 4ZTOL 3OKYA 3VFSB 2C1OA 3LKSA 5CJQH 1KB5H 2CKBH 2AV1B 4K9EC 1BIIA 3L3KA 4IOIA 4WI8A 5I15L 5I18H 1PG7X 4HV8B 2BNRE 3HAEH 2BVPB 2DWEA 1E6JL 5TPWL 4OV5B 2ZOKB 3LV3B 4N8CL 1FFNB 4L8DB 1VA9A 3L95A 4I0PD 3P30H 5F7KC 1VFOA 3MA9L 5C9JB 3EOAA 4Y19B 2EZ0C 1AQDA 5DWUH 3SJVB 1IQDA 2N7BA 4Z7VB 2G5RA 1I3UA 1MJ7L 4MQ7A 3MXVL 1ZVYA 4G43A 4NQCE 5DUBA 5DEFA 3RWGB 2FB4H 3HFML 1FZOA 1R3LB 4MD0B 4RGNC 3CMOL 3TCXA 5L8JB 5HPOA 3IRPX 4LEXH 2UZIL 4LSVH 1ZS8B 2A1WL 3TBVA 1F6LL 4NQVA 3MSPA 4M5YH 3RZWA 3V5HA 4OM1H 3JTSB 2QHRH 4BFGA 5ID0B 3RZCC 2W1NA 2FH6A 2R2HB 4WUUE 2OLDA 1RJYB 2J6EL 4KK9D 5BRZE 3TJHC 1Y0LB 4Y16C 1L6XA 1WZ1L 1OAKH 3NABL 1ED3A 4FXLA 4GMTL 5GGTA 2JB6A 3DURB 1XH3B 2DLHA 1TDQA 2X5PA 5CWSA 4HIEB 2IGFH 1MAKA 3MNWA 1T5XA 5T1LD 3TZVC 2P8PB 3ARED 4ZUTB 2DI9A 3TVMC 3BEVB 1S7WB 1XGYL 3C5JA 4PRBA 4EDXB 4P5MA 1HZHL 4OAWA 1KXVC 3TA3C 2C3XA 1A1NB 1MOEA 4KRPD 1I1CA 3BRGC 3QQNA 1UENA 3LKOB 4Z0XB 2H2SC 1YMMD 4ODTH 1U58B 3S96B 4ODVL 3QPXL 4G8IB 3DRQA 1IGML 1SVZA 1CE1H 2FIKA 5FUCC 3QAZC 4PGDB 3CSYB 5JLZB 4HKJA 3RTQC 3JTTB 1IL1B 1YN6A 3BPLB 4N90D 3WN5B 1LO2L 3H9HB 3TH4T 4HXBH 1N7ML 2VJXA 2GITB 1Q9WB 4WEBL 4JHAH 2VLME 3MA7A 3L9RA 4U1JB 4Z7NF 1J18A 3MLUL 4M7KH 3TH2T 1ORSA 5ESQB 3NVQA 1VFAA 4Q9BA 4YPGA 1OARL 2B4CL 1KCSH 1CDGA 4D0DB 4NGHL 4YAQA 4H88H 2MCPH 1P6AB 1S7SB 2UWEB 4LU5H 4OCWL 4PRDB 4G6JL 4AT6A 3RWDB 2O5YH 1SBSL 5E2TH 1BWWA 4LLWA 4IRSC 3ZHKA 3O3EA 4F9LA 1NEUA 4UTBL 2OQJA 1ZANL 1NKRA 3W9DB 3R0NA 5DI8B 1KCVH 3F5WB 2MMXA 2BDNL 2FSEA 1BX2A 5HHOA 5TE7L 2R15A 3MR9A 1EHAA 4LNRB 5T3ZH 2D4FA 5DHVB 1HHGA 1BBDL 3UO1H 4BSVA 2Q20A 4XVUD 3RU8H 3QXTA 2DI8A 3F6IA 2BY3A 3WKMH 2ZZUT 1UM5L 3EO0A 5DQJA 2ENYA 2XTJC 4OZHF 2NY0D 2J8HA 3BIKA 3MOAH 4K9EH 5EB9A 4A2LA 1KENH 1OVZA 2PXYB 3TYGH 3RDTC 4RMRA 1JZ4A 1KLGB 3QNZB 5HYSB 4TTGA 5ICZA 3T2QA 3NCJL 2BSTA 3QHTC 4LVOC 1KJ2L 7FABL 4YXLH 1CXHA 2CH8A 1K6QH 2YK1H 4UT9H 2O61B 3ARRA 2G9HA 1XGQB 2A6DA 5CUSH 4P9MH 1TVHA 4E42A 1C5CL 1PX4A 4K94H 2Z92A 3UMTA 4XAKD 4FQQA 1RVFL 2R1WA 5KSUA 2HRLA 5HJ3B 3QISA 1CLCA 1OSZB 4B50A 1JN6A 4IRZL 4X9IA 1ZMYA 3K2UH 4ZPVB 2VLKB 4GBXC 1D6VH 1G6RH 2NX5D 3Q0HA 1NPUA 3EOBA 1AGBA 2VOTA 4O00A 2VKWA 3FFDB 4G7VH 4NKOB 3QJFA 2VITB 3PDOA 4CAGA 2PUQT 5F96H 1IEAA 3WCYA 1OT2A 4KQ4L 3VFWA 1FNHA 4Q7DA 2F9BT 4TSAL 1SQ2N 3RUGA 4KMTL 1II4E 5IB4A 2ZPKH 2VZOA 3SGEH 2HG5B 1T22A 3BPNB 1T0NA 4UDUA 4DGIH 2DMCA 4YHMH 5DK3A 1IAKB 1A3QA 2I07B 3QI9C 3MUJA 4ZNEA 3KVQA 1LE9B 3FONB 3QIBC 4L5FL 4Y5VA 4A6YB 1EHLH 3X3GH 4G8EA 3JV6A 3OAUL 4HS8L 5FK9B 5EC2A 2ID5A 1BQUA 1D6EB 1O0VA 3E6HA 3FN0L 4UAOB 3FQRB 5AD0B 3CFIC 4ELKB 3L7EB 5I8KL 2WINB 4HF5L 4Z5RB 3HPJB 3PGDA 1LEKB 3IDMA 4HLZH 4Z6AT 5KTEH 3C6LB 1IE5A 3TNNA 5H35A 4ZXBC 3LKRA 3FN3A 3D39A 1QBLL 4HK3J 3MNZA 4X9GA 4HHAB 4C56E 2C26A 1HXYB 4L3EB 1RI8A 1QRND 1I7ZB 2ICWJ 3UROR 2BNQD 1L0QA 4OGAD 4WFED 1B2WL 3SDXA 5J1AB 4YGVA 4NO3B 1PEZA 4DKDC 4DGVL 1MUJB 3SGDI 4D9QD 1XMWA 3GMRB 1HWGB 2NY6B 3PWJA 1RZIB 4UIMA 4XPGH 1OWRM 5IB2B 5DVOA 1KPUB 1RUPH 5TH2B 2VZTA 4R0LA 3BZEB 4LFHG 4AEFA 4HLZG 4QOKB 2WLZA 6CGTA 1CIDA 1I1YA 4ZTPH 3STZB 4V1DA 2DQTH 4N8VB 5FM4A 4OUOA 3K8MA 1FNAA 4NKIH 4QRRA 3NPSC 1NCAH 3WLBA 5KVDH 4TUJB 1HI6B 5FYKD 5MI0C 3D0LB 4NO2A 5HDBE 4QO1A 3LS5L 1EJOH 1EFQA 3DX7A 3EW3B 5EZJA 3X17A 4RISH 4G8GA 5CBEA 1HHJB 1GZQA 5EA0H 4DKAA 2Q76B 1N4XH 1MLCA 5LGJA 2BSRB 2HFFB 4GW4B 3LY6A 4EUPH 5FYKU 1EERB 2VWEC 4HC1H 1LE5B 1T89C 1I9JL 4KKAD 4YK4C 2PTVA 4X99B 5DEGB 2CGRL 2EDOA 3SY0B 5BQ7A 1F2XK 3SDYH 3FO0H 4G6AD 4G80B 2FD6L 1X4XA 4PUBH 3QDMA 2HH0L 3ZKMD 3KJ4C 4QT5B 4WFHE 2ZUVA 2XZQH 5DK2B 4XCCH 1NUNB 3DX9A 2ADIB 1LO5A 3ULSA 1T5WA 1ULVA 2GTZA 4JO1H 5EBMA 5L2KB 2XA3A 4KTYA 4B7LA 2GT9A 4HDIB 2RFXA 1DQQB 1YDPA 3MGTB 2EIZA 4Z0BH 5FCUH 1YEGH 4E5XB 3NFNA 5GPRA 2DMBA 3IDNA 4XRCA 4FQHA 3GIZL 4FQ1L 1T1XA 4EUPG 1AHWB 3QUXD 4MXQD 4P46A 3T04D 4PJGA 1A7RH 2VDOL 5KVEL 2OSLA 3MBXL 4RFOH 2WQRA 1IM3B 1MCJA 5IEHB 5JXAH 1YNKL 5T1KA 4N0UB 3DPBA 5CS7A 5C0BA 3V7AE 3X13B 4X98B 4GKSB 1XF4B 2Q86B 2R9HD 4AM0A 5ILTH 4HIJB 1WCBB 2WP3T 3DXAA 4ORGA 3RUGE 5DURB 4L3AA 4PRIE 1MCQA 2FBJH 4IJ3C 4KUZL 3U30B 2R8SH 4ELMA 1GGIL 2XKNB 5EU6B 3QXAA 3RY6C 1PBYA 5T5NG 1NANI 4ZNEE 4TNVK 1ZLUK 5DRNA 1AD0B 4HPYH 1K8IA 1YMHB 3G9VA 4Z95L 1WFTA 2HJLA 4JN1H 1FVEB 1A1MA 2X4SA 2Y23A 3BKMH 4HEPG 3BWAA 1IGIL 4C4KO 5ITFA 1CVSC 4BSWA 4LLVB 1MRFL 3SE9H 3U7WH 3I02A 4P2RD 3DRTB 5ALBL 3QDGA 4HT1L 1QA9A 4LBEA 4XGZA 5F1KC 5FO8B 2FHFA 3EDDA 2QQLH 3EDKA 5EIIB 3CDGB 1IVLA 3BT2L 1ZSDA 3O6LL 4AH2B 4BQ9A 3BP4B 4J4PA 4LAQH 1A0QL 3TO4C 1AE6L 3O9WC 3MV7D 2B8OT 3OKDA 4D0BA 5CCKH 4OZIE 3DTXB 4OF7A 4G6FB 1Q0XL 1T1WA 1U8HB 2YKLL 5C0NC 3SDXE 4FTVA 4PJ7A 1P4BL 1MPAH 4DJMA 4NRXB 1YEJH 1R6VA 3OKKA 5FYKL 3TF7C 5D72L 1NMAH 4M4PA 3KPSB 1QFUL 1QO3A 2E9IA 2UUDK 3KS0J 4TPRL 5E2UH 5EFIB 3EYQD 4TSCL 5A43C 3REVA 4S1QH 1KT2A 4MLSA 3GMNA 4I3GA 5FHBL 4DKFL 1CLZL 2D3VA 2OR9L 2F53D 3WNOA 3QEQB 3RL1A 3T0EB 3ZDZF 3QEGL 1X5IA 2GSGA 4QRRE 4DTGH 3PL6A 3MRBB 4JDVA 4P3WA 4GG8B 3NZ8A 1A47A 3HC3H 4F7PA 1T4KA 3WJLA 3GO1L 2YPLB 4RMQA 3V6OA 1RURL 2FWOA 3AB0C 4O51B 2R23B 1I1AA 4G8GE 4OZFA 2V2XB 3PGCB 4PJFB 3UPRB 3GRWH 3MQIA 2WBJB 4NYLA 1CXIA 1J05B 5A16A 4JFXB 1I8MB 1SEBA 2E9BA 2MNUA 5E0QA 5HD8C 1F3DJ 5DC0A 3JXAA 4BKLB 5I1AB 3PWPB 3VCLA 4JFYB 4JQVA 4L9LA 4I5BA 4PJAA 4HLJA 4PTTB 3QXDA 4PJCB 4MX7B 3QUZC 5TDOB 1ES0B 4JPWH 3H9ZA 4MHHI 3DGGB 4MDJA 2HMID 3U0TB 5CSZB 5JW5A 3MREB 1B88A 5J0BA 4WU7B 2D9QB 1ZTXL 4EBQH 4JKMA 4NKQB 5JUEH 5F9WC 5K9KA 1D9KA 4GAFB 1ERNA 1Y18B 2VSDA 5BS0D 4FQXC 4ODUA 4KY1L 3MJ9A 3U9UA 4JLRB 5C2BH 1DN2A 2ZG3A 1G6VK 3MACL 4NQDB 5I30H 5LGHL 1GCFA 4RAHA 2BSED 5D1XC 3ULUE 3NBNA 1LD9A 5E56A 1CZ8H 3SPVB 3IVKB 3RHWF 4PGEB 4HK0A 3C5SB 3QNXA 2B4CC 4J3XA 4NSKB 4F7MB 3N06B 4JFDA 5I1HH 1MVUB 1R0AH 1RK1A 3L5WB 4MAYA 2D4DA 5BJTA 3B8SA 2MFNA 3HNTL 2AVGA 2DTML 1F90L 4G9DA 3ROLB 3SO3C 1RULL 4RCAA 3MO1A 4U7SA 1UWEH 3CVHL 5F93C 2COQA 5C07B 3BJ91 2BVOB 3N1FC 3S8WA 3F12A 2OK0H 2AJUH 4X7TA 3CGTA 1DTUA 1NFKA 4PRHE 3MFGB 4I0PC 3SE3C 1FPTL 3GHBH 4KI5E 4MJIE 2NR6C 1T2JA 1QLFB 1OTTD 1LK3H 4YXHL 1NCBH 3I2CH 4U6XB 2EC8A 3EZJB 4O58H 4JPKH 4EDWH 3IJSA 4Q9QH 2EDKA 1SJEB 4KGLA 1U95A 5IMKB 3QDGE 3S98A 5IVXA 3R1GL 2NY3D 3U0PA 2YBRA 2ATKA 4AMKL 4XVJL 4TNWF 2AQ2A 3TIEB 2EDJA 1FZKB 3OKMA 5DHXB 4CVZA 3T4AB 1VGEH 1NBYA 3GSRA 1MJ8L 5T33L 4G3YH 4F7CA 4JFOA 1I7UB 1X5XA 2A6JB 3NN8A 2ICWB 4KWUA 2X1QA 1QHOA 2F5AL 4KK9C 2IADB 4Q0XH 3GI8L 1T0MB 2JE8A 1S9XB 1Q9KA 4AK1A 4HW6A 1UG9A 4M02A 5I1KH 4L8BB 4OLWH 5I1IH 5D1ZB 3FB8B 4HBCH 3QB7C 2AQ3A 2XN9B 1A3RL 4X5LA 3AREC 3GGWB 4WV1A 4EN3B 1MHCB 5D4QA 3AGVA 4R4BA 1A9EA 4OF6A 2AJXL 1J0YA 2ICCA 4D9RD 3HMXA 2AP2A 1N64L 1VEPA 2FO4A 4H25B 1MEXL 4KRPC 2E9JA 3LKPA 1P5UA 1BZ9B 3JV4B 1KACB 4UV4H 1IAOB 1H0DA 2CLVB 3K8KA 4OT1L 2DM7A 5IMOA 1ZEAL 4K23L 4OZ4A 4N1EA 2DN7A 5GS0D 5JPMB 2VC2L 5E4EB 3QUKB 5E2VL 4WO4D 4F57L 3EDEA 4KV5E 4LIQE 4YXKH 4RZCA 4ZO8A 5TFSL 4PJAE 4M6AA 2XIDA 1J1OL 1RIUL 1G7JA 1P9MA 3CX5K 3VFTB 5GRYA 1LDPL 3VXSB 1N2RB 3CZFA 3ZTJG 1A3LH 3FJTA 2UWEF 5CEZH 1U8QB 3HNVH 4GO6B 4F37F 3WDJA 4PJIE 3ES6B 2Y07H 5HYJB 4G9FA 5DUPL 3T0DA 1JPTL 1NGWB 1C7TA 5HXMA 3TV3L 4XPHH 3QO0B 9CGTA 3VMOA 1H3TA 2X44D 3NA9H 3B3IA 3WBDA 4I0KA 5F3BA 4FXKA 4NP4H 4CADA 3KYNA 2J8UB 1JHLL 3MCKB 4Y5YC 1M71B 3NCMA 5I76B 4MA7L 1BLNB 5DVMA 3OR6B 1WISA 4H8WC 3MNVB 5KN5A 5C08D 5I16B 2O93L 5T3XE 4DEPC 3CIQA 4LLUB 4LQFL 2IBBA 3FMGL 5JO5B 4O2EB 1KN2L 4PJEB 4Y0GA 2PKDA 4QRPA 5MEND 1U8JA 3H0TA 4XVUC 2D0HA 4RFEB 4HKZA 1KPRA 1BQLH 3QPQD 5FECB 2D0FA 4FHBD 3N9GL 2W65A 2NY0C 1T1YB 1KCUL 1BBJB 1YNLL 2X89D 4GLRH 3VFNA 3ARBB 1CG9B 5E99H 3BFOA 3CCHB 3TT3H 3OAYH 2VAAB 3VD3A 1S9VB 2P5EA 1IKNC 3OZ9H 3P77B 1CD1A 3T3ME 5HGAA 5LBSL 3EHBD 4F33B 3VI4E 3MJ8A 3QA3A 4D3CH 5D2NC 5DVNA 2XZAH 3I85A 4E41B 3QFJD 3QUMA 3UTZB 3WO4B 4YR6B 2CJUH 3LRGA 5D5MA 4NO0B 3WD5L 4Y1AA 3ARPA 1TJGL 1NLBL 2NY5C 3DECA 3SGEI 3SE4C 5T1DH 2FO1A 1PGRB 4TUKH 2YXFA 2BJMH 4ZUSB 3O3BB 1WAAA 2EDNA 1CFTA 3BH8A 4KVNH 1F6AB 2BNUA 5GS0L 3QUYD 1Y6KR 4U3XA 4O2CB 1ZHLA 3TO2B 3Q48A 1KG0A 3QIUD 3S35H 5HBBA 4JGJA 2WM0A 4DOHB 2DI7A 5GS3A 1J9CT 4Z7WB 4FZEH 3B9KB 1DVFA 5FO9B 1JUFA 3DIFB 3ZE1F 4OKVB 3WNNA 1S8DA 5C92A 4YDIL 4G42A 2NZ9D 3GIVB 1ADQH 2YZ8A 1JPGB 3QDJD 2XWBB 1JHTA 4ODXB 5JR1H 5FXCH 4NQEA 5CMAB 5F7UA 3HE6A 5JA9A 2XQBL 4YC2B 4O02H 2B1AL 2UV3A 3MGOA 3QHZH 1W0VB 1BFVL 1OP5H 5D1QA 4KJYB 4BA8A 1W0YT 3FN9A 1UH4A 3TN0C 2Z8VC 2NMSA 2HVKB 3QSKB 4KQ4H 5CEXB 4NWUH 3HI6L 4OGAC 5DJAB 4F7TB 4FQ2L 5AZ2H 1HQ4B 3QHFL 2AKRB 3WL9B 3I84A 2V5RA 4X5XA 2GW5A 1LEIA 3NCBB 1IAMA 5TJWK 4IRJB 5ICYB 4R90H 4Y2DA 4KROD 4LLYA 1B0GB 4HAFA 5B39A 4OBRA 2FX9H 2V9TA 4AL8L 3L3GB 3GJFA 2WIIA 4QRPE 1X3DA 3MRHB 5EZLB 1W8NA 3MCG1 5D7IF 3U36A 4H8WH 3L5XH 5E5UB 5J13B 3SJVD 2C1OB 4M7JL 4KJPD 2IWGA 4MD4B 5FDWA 3LD8C 3L3KB 4IOIB 2AAVA 3KNBA 2IANE 2ZSWB 4HIXH 5DDHA 2P5EE 3FL7A 4NC0B 2DWEB 4XNXL 4TVPE 2V2TB 4KKAC 1K5NA 4R97C 4HKXA 4G6AC 4LMQI 2D7OA 3ZKMC 4EI6A 4HUWA 4WFGE 1IC7L 3L95B 2I25N 4RX4A 3CDFA 3SBWA 3V5KA 3T0AA 3EOAB 1RZ8B 1AQDB 2RGSA 3BPCB 1UM6L 2DQIL 2DYPA 1G7MA 1YNTA 4S11A 2H41A 4RMUA 1ZHNB 3QWOA 4B7IA 4G43B 5DUBB 3M17A 4XNUH 5DEFB 4XPBL 2GUOA 3LN9A 1GHFL 4YX2H 3EOTH 5C0CE 5DGRA 4I3SH 4XXCA 2E7MA 1CDJA 4MXQC 4GW5A 4KZDH 4K71C 3TBVB 5B38G 4S0SD 1JK8A 1WAAE 4R8WH 3V5HB 2CKNA 1KPVA 5F7MC 3O2WH 4HXAL 4M61A 2VLJE 2R9HC 2X7LB 5GXBB 5D70H 4JN2B 4RGOL 3MLWH 4YDKL 5I6XB 2NY5H 3B9AA 1W72L 1QFPA 3MLRL 2GFBA 43CAB 3FT4B 2EDBA 5ADOH 1ED3B 3IJHA 2JB6B 5C0AE 3S35X 3OR7A 5L9DH 1RZGA 3IT8D 1OAUH 4LCWD 4W70A 1F4XH 1LO0L 5B3NA 3LB6D 5CWSB 5FO7A 2JJTA 1JRHH 1T5XB 3BD3A 1RFDL 1FRGL 3BXNA 1X5FA 1ND0A 1F5WA 1XF3B 5C6TL 3C5JB 4HMDA 4P5MB 3VU2A 4AIOA 4OAWB 2CO6B 4PRID 2X10A 4XCEA 4NPYA 2GSIA 4OD3H 4HFUH 4KKNA 3LZFL 1EHNA 2JB5H 2X4PB 3P40A 4YWGH 4XPTL 3DRQB 3LSOA 1MI5A 4YHKH 3WFCH 5IB3A 4HKJB 2ADJA 5E9DE 5DZOA 2AW2A 1YN6B 4Y5XB 5JOPD 3B4NA 3E1F1 4IBLT 1B4JH 1FFOA 5EUOA 5F1IA 5MEPA 1WGOA 3HG1A 2Y5TA 5F7YC 3VFVA 3U6RA 2BY1A 3OB8A 2OXGA 2QKIA 2CIKB 1UXWA 3MA7B 5E6YA 3L9RB 1L0YA 3GHEH 4ODSL 2AK4A 1ORSB 1VFAB 4TOYH 5IR1A 4HX1A 4YPGB 5I8EA 3O2DL 1G1CA 2D31A 3LMJL 5KVFH 1WC7B 4YAQB 4YNYA 3C08H 1BREA 3G08A 5SWZE 3EJJX 5F44A 4AT6B 2DAVA 4IIQA 4LLWB 3OB0K 3R8BB 1T80A 3BGFC 3O3EB 1EJ6A 4KMLB 2OQJB 1HCFX 4XCYA 3V4UL 1PY4A 5AYQA 5DMKA 4ZPTA 4QXGH 1P7KA 3WHXA 3AS2A 3LQMA 2FSEB 1TXKA 5D9SA 1IM9A 5HHOB 4PJCF 3MR9B 4MQXD 5SWQA 2PXYD 2K3TA 4P2OA 5HHMB 4GRWE 2NLJA 1HHGB 3L3IA 4NFCA 3VH8G 3MRDA 4HCRL 4X4ZA 4GOSA 4BSVB 3HR6A 1ZXQA 5EH1A 5ABDE 4OCMC 1IQWL 4P23D 3WFDH 3BZDA 3EO0B 3P2TA 1DSFH 4FG6D 5DQJB 4F8TA 5DJXA 1U36A 4JG1H 2HMIC 1HCVA 4GAGL 3MRGA 2EDXA 2YPVL 1AH1A 4PLKD 5BV7L 5E8PA 2PNDA 2V5SA 5EN2A 1MCPH 2VLKD 4XPFL 2HFGH 1LO3L 1AGDA 1FNEA 4NNXA 5DR5H 5JMOC 1FVDA 1OY3B 1HYRC 3D1MC 3I50H 4XCNA 2I60H 2OX5A 3WEXA 4OB5H 3U1SH 2G9HB 2A6DB 1BECA 1NJ9A 5IHZA 5B3JE 1TVHB 4Y4HD 5DYOA 1EEQA 2Z92B 1UB6B 1RIVL 5LJYH 1AR2A 5H37H 1F45A 5KSUB 5KS9E 4YH6A 2LAAA 5GJTH 5C0EB 4X9BA 3TNMA 3ARQA 1H8OA 1BJ8A 1OSPH 2X6MA 4PYHA 3EOBB 3QRFM 1AGBB 3ULUD 5KOVC 2X41A 3VH8A 3QJFB 2W9EL 4UZGA 1A7PH 1X6LA 2ZCKL 3PDOB 3TLRA 5BZDB 2CK2A 4N0CD 3QCUL 2B5IB 1OTTC 2DQGL 5HYFA 3VFWB 5IB4B 5H37G 1TVDA 1UFUA 5DHYA 1KBGH 1ZE3C 1T22B 5CIPH 1T0NB 2CUHA 4UDUB 1R3JA 3C6LD 5D7KE 3RVWD 3BYTA 3GZKA 5T5FH 3ABZA 1RMFH 1QEWB 5FKAA 5DMGD 3JV6B 5TQ0L 1SMOA 4PRHD 3IFLL 1MNUL 4S1SH 1X4YA 1MIEL 1XGUB 3E6HB 4WIQA 1V3LA 1ZA6A 2GK0A 1P1ZB 1MFBL 2K7PA 1QP1A 1G7HA 4PJXA 4I3RL 5D7SL 2AEPH 4OGYL 2NY6D 1MQKL 4PV8A 3MJGX 2E8YA 3PGDB 4XMLH 2AK4E 5DJYA 3IDMB 4WI3A 3NPZB 2Q8AL 4H26A 1JYWA 4UINL 5H35B 3TNNB 1MFNA 4QOKD 3A6OA 5J11C 1PZUB 3LKRB 3D39B 2Z8RA 1LO4L 3LPWA 1BEYH 5IBTH 1DLFH 4LF3B 4D8PA 4N0YH 3BRFA 3SDXB 3ECBA 4YFEA 1BOGA 5FOBB 1NMBH 5CP3A 3IFNL 3PWJB 4UIMB 1MCOH 4CMMA 5ITBL 4APQA 4JM2B 4ONGL 2BERA 2V5MA 3GSXA 5GS0C 4X4YB 1I1YB 2DDQH 3MV8E 1U3HD 2E7BA 3P0VH 1TNNA 3HUJE 4V1DB 3QEHA 4WO4C 4OF3A 1NGPH 3WLBB 1IT9H 3MTRA 3KPRE 4NO2B 3DVGA 3V6ZA 3ULVE 3GDBA 2ZNXA 4PYGA 4MNQA 4JO4H 5EZJB 1DJSA 5CBEB 4G8GB 5L2KD 5M7QA 4XZUA 2JLLA 4UV7L 4PY8J 1GZQB 4RRPG 4GXVH 2J8UF 1CLOL 1P84K 1MLCB 2DQEH 4JEGB 3CH1A 5LGJB 3V5DA 3IDXH 1TJIL 3GJFK 3F7RA 4F9PA 3MLTA 3QDHA 4CUCA 2EDYA 1OAZL 5BQ7B 5GS1C 3F7YA 1YQ2A 4WHTB 5JHDB 5EZIL 4M6MH 4M1GL 3QDMB 4GKOA 5F6HJ 4DUXA 3ULUL 1EEUA 2R0LL 1GGYA 1QR1A 3RIAF 1LO5B 2CPCA 2VMFA 4LSQH 1T5WB 3L3DA 4PJEF 5EBMB 1R5WA 3CDYA 3OKLA 5FGRA 3NACL 4ZQKB 1WCQA 3GFUA 4XBGA 2GT9B 3OF6A 5DURD 2RFXB 1J11A 3KPPA 1YDPB 2EIZB 1GC1C 4Y8DC 3FOMA 2Q3AA 3NFNB 1L4IA 4ZSOA 5FIEA 3IDNB 4XRCB 2OL3A 4FQHB 3L3JA 1T1XB 2FATL 2QQNL 3KR3H 4HPOH 4ETQA 2B20A 5EU6D 4MYWB 3HMWL 4P46B 4PJGB 1R24A 4XAWH 1JVKA 5JW3H 2OSLB 1VB9A 2IH1B 3QPQC 4LPYA 5T1KB 1EGJH 5C0BB 1VFMA 2WANA 3CFCH 5MEQA 1DP0A 2VXQL 3FTGA 4LSPL 4ODHH 4M48H 1YEEH 3DXAB 4JFZL 5DMYA 4O2FA 5E1AA 4OFPA 4JO2H 4BQ6A 3O8XD 5C2UB 1OP5K 3ISWA 4OZGA 3EHBC 5HHVH 4KXZH 2HWZH 4ELMB 2DLGA 3VWKC 5J7CC 2P5WE 3QXAB 5DRWA 2OM5A 5DRNB 1K8IB 1Q72H 1V7ML 4ZFGL 4G6FD 2HJLB 5JIKA 2Z35A 4LCYA 5LXGH 1FIGL 2X4SB 5A2KH 3BWAB 5JNYA 1GIGL 5BXFA 2RCSL 1E4XL 5ITFB 2QEJA 3EO9H 4BSWB 5JXEA 3I02B 1IAII 1V5JA 5AZEH 1QA9B 4XGZB 1OD7A 4KGJA 3KPSD 2B0SL 4LARL 3Q6GL 2P44B 1ROWA 3DI2B 1GOGA 3L5IA 4DN4H 3RWIA 5AWNH 1CGSL 1CBVH 4B5EA 4FQJL 4KAQH 4EUPB 3QEQD 3QUYC 5KBNC 2KL6A 4D0BB 3T0ED 1C12A 5A2IH 1WUNT 2IG2L 4DCQA 4Z7WF 3QIUC 4FTVB 4PJ7B 5FCSH 3EJYD 4KZEH 1I9IL 4MD5B 4ISVB 5ETUA 2VDNL 2O26U 5F3HA 4RDQF 4NQUA 3UTSE 5FB8A 2NY7H 3OKKB 3RZCA 2YPLD 3EYFA 1Z3GL 1UM4L 1QO3B 4KTEH 5HYIA 3REVB 1WV7T 1JNLL 1ACYH 4Y16A 4JZOA 4NC2B 1KT2B 2R69L 1NUDA 2WBJD 3GMNB 3O3AA 1QYGL 3WIHL 4YJZL 1OAYH 2NZ9C 1CICD 1BVZA 2GSGB 3PL6B 3OQ3B 4JDVB 5E70A 3NZ8B 4X6FB 3TZVA 4F7PB 5EO9A 3KAAA 1T4KB 4QRUA 2FWOB 4XT1C 2BFVH 4NN7B 4HQQH 2PO6A 1I1AB 4OQTH 1H15A 1TTGA 1TPXC 4HKBA 4NJAH 5GGVH 1SM3H 1A64A 4DUWA 1CT8A 5A16B 4BQBA 1HHKB 1SEBB 1HIML 3UJJL 1J8HA 4IDLA 3VRIA 2AJSH 2X2YA 5F7EH 4I5BB 4FNLL 4PJAB 3RTQA 3QXDB 1F6FB 4KUCF 4XBPA 1JNJA 3DLQR 1MY7A 3CXDL 3K2MC 1CGYA 2R0ZL 2WSKA 1EVTC 1I3RA 4MDJB 5JW5B 2DLTA 2DQJL 4HH8A 4RWYL 1FAIL 3BKYL 4KROC 2YD4A 2R4RH 2D03H 4UUJA 1S7VA 3UTTE 3IGAA 5T3XL 3NFSL 3D25B 2DRUA 5HDQL 1TTUA 4NT6A 4ZSOE 3B2VH 4ZOEA 1NAKH 4WTZG 2DQCL 3I6LE 3U9UB 3BSZH 4ONFH 5C07D 3W0WB 2OP4H 3GSOA 2OJEB 3AFLA 1LD9B 1OGAD 4LKCB 4M6NH 4BFIA 4HK0B 3KPQA 3QNXB 4FFWD 4MJ2A 2J5LB 5EOQL 2EDEA 3JWDL 1RZJH 1YQVL 4KJPC 3QG6A 4JFDB 4LSTL 1P84J 5E95B 1RK1B 1GC1H 5BJTB 2X4TA 2X4NA 3KJ6L 1HSAA 5BVJA 4G9DB 4U1IA 3VFPB 1CL7I 1MF2H 3HN3A 2NTFB 2AI0H 1A7BA 1AXIB 4P4KD 3GBNH 3ZE2E 3BQUB 3SDDC 3C2AL 4MA1B 3F12B 4I18C 4JRWA 4X7TB 3O6ML 1JGLL 2PN5A 3P0YL 4L4VA 3KWWA 3WFBH 1PLGH 5HY9A 3V7MA 3KYOA 3IJSB 1FL6B 2GEEA 4Q9RL 2ED8A 3BESR 5IVXB 2VISB 2UY6A 3MJ7A 3D69A 4OQTA 1FYTA 2YBRB 2ATKB 1UCBL 4HGWA 3HA0A 5D1ZD 1PDKA 3OKMB 3RDTA 4CVZB 4MCZB 1NBYB 3GSRB 1JRHI 1D5MB 2VXTH 4F7CB 4JFOB 4RGNE 4QTHA 2A6IA 3VGGA 3NN8B 1KJ3H 3W82A 4OD1L 5C3LD 2KH2B 5BV7C 1P4IH 3EYSL 3ZSSA 4Z78B 4JPIA 1O7VA 5CJXC 1Q9KB 2EKJA 6FABH 5H2BA 2XPGA 4HUVB 1UKTA 4NJ9L 4LPWA 3D3VA 3RGVD 4JREB 1AO7A 4PJBA 3UC0H 2X4OA 4ZUUA 3TT1H 3TH3T 1FG9C 2PW1A 3LB6C 3MLZH 2LABA 1NGYA 4OSUL 3GK8L 3BPLC 4PRPA 4GBXA 1MWAH 3GSNL 3WN5C 1G0XA 4HGKC 4WV1B 3FQXB 5E8NA 1G9EA 4R4BB 3WIFA 1A9EB 1YEFH 4FZ8H 5LWYL 3DETD 1WEJL 3KPNA 5MP6H 2DWDA 3VXSD 2FO4B 4UT6L 1GPOL 2XZCL 1AKJA 4GRMB 3LKPB 3TWCL 3LHPH 2NW2A 1CLYL 5HYJD 1H0DB 5BCAA 3FT3A 4AEIL 5IMOB 4U0RB 1QFWH 4WEUD 3INUL 3BW9A 4XX1G 4WY7L 5T1MA 3MV9E 3M45A 1J8HE 1K85A 5FUCE 2EDWA 5ISZE 4Z7QF 2AJYH 1GVIA 2I9TB 1TCMA 1G7JB 3MRCA 5GSRA 5I66B 1OAXL 1FCCA 4HWEL 3D0VA 1BJ1H 1WK0A 1A6TA 2DF3A 4DKEH 4G9FB 1YUHB 3F7VA 3L3OB 4JFQA 5MEOB 3C09B 1K9TA 2AXHA 4U4BA 2WAHA 5F3BB 1W8OA 4FXKB 4ZXBA 1NFDA 5I1LB 3PIQA 1JZ6A 4N9GA 5FA4A 4KHXL 1B0WA 3LEYL 4QXTB 1J1PL 1DEDA 5KN5B 4QTIH 3P0GB 4PB9L 2IMMA 1BD2B 1QSFA 4U7KA 1XF1A 4MQXC 4PJ8D 3S88H 1S78D 1S5HA 2IAMB 4LSSH 5SWZD 2PXYC 1NL0H 5JW4M 1QSVA 4HFWA 1U8JB 3H0TB 4X6DA 1EO8L 2VZUA 4HKZB 3KYKH 1HH9A 5TQ2H 1NGQH 3ALWA 1F4AA 1KPRB 4P23C 4K07A 5FHAL 1AI1H 4P3CL 2JJSC 5B21A 4E41D 5F6IB 4GS7B 2XT1B 5IQ7L 1S9KC 3FRPA 4NO0D 1HKLL 3EUUA 2A9NH 2OYPA 4UNUA 1P53A 4L4VE 1T2QL 4I77L 4ERSH 4PLKC 5EORL 4K3GA 5EU3A 2XTJE 4PJDE 3EYUH 4NZRH 2G60H 1UZ6E 1CD1B 2X1XR 5HGAB 5TDPB 4YBLB 1F00I 1SY6A 3HZMA 1FYTE 2QHLA 4H1LA 3MJ8B 1T21A 2WQ8A 4Z8FH 2HKFH 3QA3B 3D5OF 2QR0A 4WI6A 3GNML 1TCRA 2DLFL 4R2GB 4XWGL 4K2UH 5JPNA 3QUMB 1T89A 2Z93A 1JZ3A 3PV7A 4Y4HC 2V2WA 5D5MB 3QCVL 1NCDH 4GQ9H 4XB8A 4Y1AB 1QSEE 3V4VH 1VGKA 3C2SA 5HGHA 3BPNC 5IV2B 5DD1H 4R6UA 3G04B 3B9KD 1UH3A 2DICA 5DRZA 4JB9H 4I2XB 1AO7E 4PJBE 2VLRA 4JRXB 5K33A 3ULUC 5DJCA 4J8RA 4JG0L 3SKJL 2ZCHL 5DZLA 3RUGF 4FMKA 1CFTB 1FHGA 2BCKA 3BH8B 4TRPL 2BNUB 1A14L 4PRPE 1ZHLB 3QEUA 4N0CC 2BK8A 1LGVA 5C09A 1KG0B 4JDTH 1NAMA 5LAXB 2BY2A 2ARWA 4L8CB 1KEML 1J1XL 4OLZL 2CXKA 2FL5A 1DVFB 2H2PD 1JUFB 1EO7A 3C6LC 3GKZA 3RVWC 5DS8A 3MRJA 3GMPB 5I8CA 1S8DB 2XXCB 4MXWH 8CGTA 5DMGC 4KDTC 1EBPA 2QQKH 2LE9A 1TIUA 1DFBH 1DBBL 3CLEH 3CFBA 1JHTB 4NQEB 2VUYA 3MRQA 3HE6B 4FFYL 1Q94A 2NY6C 2P8MA 1RJCA 2XICA 5KVGH 2BRRL 5FUZH 3WDIA 4JO3L 4DN3H 4KUCD 1YJDL 3VXMA 3GM8A 3SDXF 3P11H 5BOPA 3M8OL 5FA3A 4RFNB 5CEYA 4S1DD 4G5ZH 4LEOA 2EH8L 4ALAH 3TO4A 4QXUL 1IC5L 3EOYG 5C0JA 5KW9H 4Y4KD 5K9JH 1UKSA 3HC0A 4X7SL 1N0XH 1LEIB 3G6JA 5GS2D 3NCYS 3BE1H 4EOWH 2FECI 2I5YH 2X1PA 4Y2DB 1R3IL 3FQUB 4P48A 4OLVH 4LLYB 5KJRH 4QGTA 1QSFE 2VDML 1R5VA 5DHVH 1IKFH 1U3HC 3UJTH 2HFEA 5DUMH 4JE4B 3GJFB 2WIIB 4NZUL 2C3HA 2MOVA 3B5HA 4U2YA 3VGAB 3SN6N 4X6DE 1DDHB 4ZD3H 2W60A 4J23A 5DC4B 4X80H 5DQDL 3IXTA 4QXWA 2J6EA 5H8DA 4WUKH 2NW3A 1MVFA 3U36B 1RJZA 2GJ6E 1AXTH 2WUCL 4CVWA 4NN6B 2GJJA 1OQXA 5FDWB 2RIKA 3TPUA 3KNBB 1X5YA 5INCA 2HRPH 5DDHB 1CFQB 3DUHA 1AHWC 1NCCL 4XP5H 1MJJB 1EMTH 1G9NL 1K5NB 4HKXB 3H9SA 5TGBA 3D9AH 3V9FA 1YECH 1OP9A 4NQXA 3ULVD 4HUWB 3AS3A 3ROOA 2FLRT 4F15B 2ZG1A 4MAUL 3K1DA 3QH3A 4P3DA 5I17A 3CUPB 4UB0H 3NIFF 4OJFH 5CZXD 1LP9A 2AABL 3V5KB 2A38A 3Q5OA 1XGRA 4LRNL 1SEQH 4RWHA 3QUZA 1RUKH 1YNTB 2HYMA 4PJGF 4GG6E 4G7YL 2F74B 4YIQA 3P9MB 3QWOB 3T77A 1CWVA 3M17B 3C8DA 2GUOB 3Q1SL 4KXZI 1YN7B 3U30C 1PG7L 4X6CE 4GW5B 2VLRE 1EV2E 5B8CB 1V7NL 1S3KH 1JK8B 1FGVH 4FQXA 1MFAL 5J56B 5IMLA 4ACPA 2NCMA 2I26N 4M61B 4L1DA 4ZFOB 1T04A 1DUZA 2UZXB 5HI4D 4ELMF 2K1MA 4YFDB 1E28B 5BO1H 3O8XC 4HIHA 2GFBB 5EOCJ 5EZIH 4KI5F 3OR7B 4CN1A 1RZGB 2LTQC 2IF7A 1EX0A 4A6YH 1LQSR 1OF2A 1AY1L 3QR2A 4IM8A 5FO7B 2W0FA 5DD6A 1NLDL 1VENA 1ND0B 5D7JD 3SE3A 2H26A 4XCEB 4NPYB 3ZKXC 1FE8L 3AMLA 4LSRL 2MQCA 2O5XL 3G6DH 1FL5B 5E7BA 1MI5B 2Q1EA 1BZQK 1I75A 4PJ7F 3QDAA 4PG2A 5IB3B 2ADJB 2V7NA 2HTKD 4IHOA 3KYMB 1HOCA 3NCYP 2OJZH 3MXWH 5EUOB 5F1IB 3MBEC 5B38B 3HG1B 1KCLA 5FOJA 2Y5TB 1QKZH 3VFVB 3EJYC 2R1YA 3U6RB 1E27A 1BIHA 3V0WH 1J0ZA 2QKIB 5LCVH 5C0FA 1UXWB 5SX4H 4WVRA 3CPLA 3T3PF 12E8H 4M6OH 5DJ2A 5EPMA 3G6JE 3IJYB 5EG6C 5IR1B 4HX1B 1YC7A 5T5NF 2VDPH 5E8EA 4K3JH 5I8EB 3V52H 3MLSL 2WBJC 2IC2A 2VXVH 1K4CA 4YNYB 1KJ2A 4LPVA 5HHMD 3G08B 4PJ5A 1FDLL 1CQKA 3G5XA 5CJOL 1CICC 3T65A 4U6VH 1NDGA 3MUHL 4IIQB 4BH8A 4YE4H 3EKCA 1MY5A 3ILQD 3X3FL 2V6HA 5IHUL 1FFPB 3AREA 2NXZD 2VXUL 2WP3O 2YMXH 2XI9A 3E6FB 4RA0C 1DL7L 5DMKB 3U4EB 4ZPTB 3ULVL 2GIYA 3MGAA 1F4YL 1P7KB 4FQCL 5GGQL 3WHXB 2FLBT 4XB7A 3SKNA 5A2JH 4R26H 1QOKA 5D9SB 1KLUA 1IM9B 1FYHB 2R4SL 3EYVA 3LPFA 4PJAF 3DV4A 4XNYL 4LCCC 4OGZA 5SWQB 1QLEL 1YMMA 1U8OA 3O4LB 4P2OB 3L3IB 1OW0C 3MRDB 2PR4L 3TM6A 5DD0L 2KPNA 1IC1A 3WV0A 1N5YL 1RUQH 2X1WL 4PJHA 1U9KA 2PTUA 2WK2A 3RX8A 5DJXB 2C3GA 3QFDB 3SGJC 3MRGB 1LP9E 4XMPH 2FJHA 3VJ6A 2VDKH 1CD8A 5E8PB 4LL9A 4M1CD 3FAXA 1IGFL 1U8IA 4HWBH 4LPCA 5EN2B 4YHZL 3EFDH 4G6KL 3RY5A 1S7QA 1HK6A 1AGDB 5MHSE 1FNEB 4YBQD 4NNXB 5CJQL 1FVDB 1RV6X 1KB5L 2CKBL 4XCNB 1SMAA 1PEWA 4CU8A 3ARTA 5I18L 4C83A 1NJ9B 5IHZB 5DYOB 4FFWC 4Y5YA 4WRLA 5SX5H 2YA0A 5ENWA 5D93C 3DMMD 3U9PL 3UTTD 3HNSH 3TNMB 3CZJA 4UQ3A 4LGPB 5J6HB 3GM0A 1ZGLP 2E9WA 4U1HB 3P30L 4P2QA 4P4KC 3KPTA 4IMKC 5DWUL 5T3ZD 3VH8B 5IJKC 1A1OA 4B53A 1YPZB 2E7CA 3I9GH 3E3QC 2P43B 3T3MF 2FB4L 4X8XA 5IVXF 5J1TC 3VI4F 4PD4K 3TFKD 4EVNA 4LEXL 4LSVL 3OKEB 1ZVSA 4X7FC 4M5YL 4J2XA 4JAMA 5DHYB 5KSBE 4OM1L 2QHRL 1IGJA 1R3JB 1T1ZB 3BISA 32C2B 4WI4A 2ZUYA 3C8HA 5I1DA 4YEEA 3D39D 5A3ID 4O5LH 2YEZA 4JM4H 2ADFH 1IKNA 8FABA 4Y2OA 5FKAB 1KXQE 4LRIA 1RAMA 1XFPA 3NIDE 1FJ1A 4LDLB 1OAKL 4JJHA 3O2VH 1A22B 1ZA6B 2GK0B 2APWA 1D5IH 3JBG7 5I71C 1JP5A 1XCTA 1G7HB 4PJXB