1N4XL

Structure of scfv 1696 at acidic ph
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
MDILMTQTPLYLPVSLGDQASISCRSSQTIVHNNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFPPTFGGGTKLEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin kappa chain variable region
publication title Structure of a single-chain Fv fragment of an antibody that inhibits the HIV-1 and HIV-2 proteases.
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 113
sequence length 113
chains with identical sequence M
ec nomenclature
pdb deposition date 2002-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n4xL00
4PUBH 4XXCA 4EVNA 4HIXL 3BHBA 1JPGB 2CLRB 1SEBB 4M48L 5F70A 2OQJA 2NY4C 5CGYC 4X6BB 3O4LE 5BMFH 4O2FB 4RIRB 5IOPB 4GMTH 5CFHA 5KSAA 4CBPA 4EI5C 5M94B 4LNRA 4BFBD 3H3BC 4U3CA 1INEL 3S36X 4PLJC 3LKRB 2A73A 5JXEA 4L29A 5HDOA 4KUCD 2AK1L 4U1LA 4YQXH 4L4TE 4GW5A 4RQQB 3GSOA 1X5YA 3FN0H 5L7XL 3HFML 3HI6H 1OF2A 4XRCB 2OTPA 2H3NB 2GJZA 2M26A 3ZZ1A 4FA8A 3HNVL 4HQQL 4LPTA 5CBAA 4WO4C 2KZ1B 5K9OA 4LPWA 4HWEH 5CZKA 5C3LD 3OR7A 4KKAC 4APQC 1G9ML 3E6HA 1SYVA 3RGVA 4HFWB 1IGYA 1ADQH 4BQ6A 1EAPB 2G75A 5E6ID 3GKWL 3HZKB 2W0PA 4DKFH 4NYLA 2DIAA 3BO8A 5EUOA 2YD9A 3TO4C 3X3GL 3VMNA 2DBJA 4ZUVA 4JDZA 3LV3B 5FO9A 4LSTL 3T1WA 2DQGL 3MQIA 4AYFA 1QSEA 5CLTA 1HSBA 2CK0H 4FMKA 1B6UA 4LARH 2Y36H 2GUOB 4XPHL 5KSBF 1MJUH 1KPVB 3B9EA 3I02B 2OX5A 3SKNA 1TQBB 4RISH 4S1DC 1P4BH 4WWID 5INDA 1QR4A 3BE1H 4FQIH 3RIFF 4MYWB 5DSCB 3K1KC 2E9BA 5C3TA 3B5TA 1PYWB 4Z7VB 4KPHL 1V3JA 4MSWA 4HUVA 1U3ZA 1I7TA 4PJ8A 1CICC 1T0PB 5KTEH 4JRXB 1QR1B 4KQ3H 5ESVB 1LE5B 2IQ9L 3DETD 2JB6B 3KLSA 4PJHB 3QCUL 2EICA 4P4KC 4IRJD 2D9QB 5IJKC 3KLDA 1S5HB 1NGXB 3MV8D 4EXKA 3ULSB 1KULA 5ACMA 2AJVH 4K7PY 3WMSA 2MKWA 1ZANL 4QRPD 3NZHH 2C3HA 3K2MC 3V2AR 3GK8H 4MNGE 4EI5A 1NBYA 3C60B 3AM8A 1H0DB 1J0ZA 5J3HD 3D25A 4HX1B 3KPOB 3TNMB 4Q9QL 3ME0A 1MLCB 1YJDH 5DD0H 5C7XH 5HDBF 1QFPA 5TE4H 1PKQE 1A7QL 4AQ1B 4ZUWA 4QF1A 1NBZA 5LBSL 3PV7A 5JW4Q 4GXVH 1RUQH 4N68A 4B50A 4PP1C 1CLZH 1KFAH 4HPYH 1I1FA 1OCWL 2VZTA 5EU5B 4KZDH 4F9LC 2A83A 1NCCL 3S36L 2DMBA 5KANI 3VFSB 1MJJA 3CAFA 3PE9A 4LPYA 5FEBA 3Q2CA 3Q6FA 4WO4A 3IT8D 3DUSA 5BQ7B 4P46D 4QOKE 1ZVSB 1YQVL 1S5IH 3MJ8B 1MI5D 5LXGH 3ZTNH 3O41B 4APQA 2ESVA 1KCSL 1IKFL 2FX9H 3O2VL 5HVFB 3DRTA 4PJ7B 4NRZB 4NN7C 1B2WL 2YRZA 4ZSOB 4XMKH 3HS0A 3QNXA 2Q20A 3TO4A 4R0LC 3T3PF 2NY0C 2DAVA 2OR8A 4YWGL 4MD0B 4CNIB 4OZFB 4D3CL 1LDSA 5KSBE 4IMKA 4FHBD 4KJPC 4HKBA 1WZ1L 5GGVY 1LQSR 1M71B 3GJFB 4WI2A 3NABL 5DD6A 2OXHA 1MF2H 2FHCA 5IB3A 1S9WB 4UT7H 2BVTA 2C7UB 4RFOH 2V7HB 3OMZA 3MACH 3MRPA 3VFPA 1UXSB 3GMMB 3RPIA 3QCTH 5I74B 3H7LA 1KB5L 2VSDA 3IDYC 3RQ3A 1CICA 3PWPB 3MSPA 2ZUQC 2E3VA 1IAKA 1FIGL 2QR0A 2CIIB 3V6ZB 3KR3H 4XH2B 5I18L 3JV5A 1J5OH 1SBSH 2R9HC 5DJ8A 5ID0B 4DJMA 3T65B 4MA1B 1AQDA 1QUNA 3EYQC 5GS0C 3TBVA 5J12B 5IJKA 2AEQH 2GY5A 2GFBB 5D7KE 3HMXH 3WIFA 1MIMH 1AFVH 1BEYL 1QSFA 1R5IB 4NUJB 3BP4B 3GMPA 5AYUL 3F5WB 5HDBE 3GSNB 5CSZA 4UNUA 3TIEB 4M61B 1IC1A 3C08H 1LEIB 1WFUA 3ZDZF 2EKJA 3CXHJ 3BISA 3MJ7B 4I3GA 1A7OL 2IGFL 4KVNH 43C9B 1KJVA 1FFNB 4P2OC 5HGAA 4HK3N 2AK4A 5EZJA 2PW2A 1FQ9C 4OCYL 4P3DA 3ARRA 1MH5B 3MRRB 4UIKL 2EO9A 2NY3B 1YEKH 3UTSA 4OJFL 4WU5A 5SX5H 3UZQA 1M6OA 3FO0H 5BV7H 4PRHD 3MRJB 2NXZC 3QDGE 4FZ8L 4EDWH 2DQJL 3T3PE 1OAZL 3UYPA 4WHYH 2DM2A 4M7ZB 1T1XA 5F72S 4JM2A 3D18A 5DVMA 4P99A 2NY5L 3MA7A 4OB5L 4XVSL 4R0LA 5DEFA 1FCCA 1N64H 2AJZA 3BUYB 5CJXA 2VQ1A 3D39D 1IAOA 3TT3H 5IVNA 3F7QA 3K8LA 1AHWC 3T4AA 5IT2H 1W0WA 4Y1AE 2X4RB 3ZYJA 4L8CA 4HUNB 3H7BA 5ILTH 1MFDL 2CSPA 1RZKH 1XF4A 5ISZA 5DVOA 5HXMA 4KK9D 4ZFZB 4I1NB 2DQEL 3RX7A 3ZE1F 4ZFOB 4P9HC 1NSNH 3R1GH 3T08A 3DVGB 1CTNA 3VH8G 1ZVYA 2OSLA 4PRIE 4OCRH 2VZUA 4YHOH 3H9SA 1ROWA 4X4XB 2QQLH 2V17H 2X09A 1DLFL 4WWKB 5IF0B 1G9EA 5DYOA 2AXFA 3MLTB 3HPJB 1NQBA 5MEQA 2ZCLH 4OV5A 3K80A 5HHXL 4U1KA 1PG7L 1K6QH 5DK0A 1MEXH 3KJ6L 3GIZL 1BLNB 4OCSL 2XACC 12E8L 4Q2ZA 4NQDB 4AEIH 4QWWD 4KHXH 3OXSB 1N4XH 1U41A 3ZDZE 1EERB 5HBBA 1TITA 3REWB 3IKCB 5CSBA 1IEBB 4WFEE 4LDLB 1BIIA 4GAFB 3ZKSD 4MD5B 2DYPD 3O3AA 2PN5A 4NKOB 2J5LB 3QAZC 3GB7B 3F12B 4P23A 4P2OA 5DFVC 4MS8C 4XAWL 4P2RB 5EZLB 4L5FH 4UU9B 3MV7E 5KVDL 4DGIH 3BXNB 2X7LB 4PB0L 5F6HI 5JW3H 1MFBH 2QSTA 5GQBA 1OB1B 4JY5L 4YHKL 1QSVA 5HY9A 2C5DC 4HQQH 4DN3L 1T21B 3VXQB 3NAAH 1S9VA 4KUZH 4HPOH 4JE4B 3PABA 2Q87A 4TN9A 3TZVD 2QKIA 3RZCA 1VCAA 3IFOA 4G42A 3QO1A 2IANA 1XF3A 3PUCA 4HFUL 2XRAL 2BP3A 4OZIA 3L7EB 3HI5H 2NTSP 2QSCH 2DLGA 1F6LL 1ETZB 1I1AD 1AHWA 4G43B 3W39A 3MFFB 2Z31D 3ARDB 1OAXL 3ZE1E 2Y5TA 4X83A 4U2ZA 3PJSB 3MYJB 3UEZA 5I15L 1X5JA 3ARZA 4M3KB 2J2ZA 3WIHH 3C6SB 3O3EA 4JLRB 3D0LA 5HJ3A 4FABH 3MRFA 2HJKA 3LQAH 2W9DL 2N1KA 5E4EB 1KT2B 3HKFA 2R4SH 3CXHK 3VXRD 3T3MF 4ETQA 5AZ2L 1ZLUH 3WS3B 4RAUB 3QHTC 5L9DL 2EE6A 2GSIB 4MXQD 3PWNA 1J1XH 1FGNH 4ZTOL 2VITB 5GGRB 1DQQA 1CXEA 5HI5D 3RVVC 1NC4D 3SKMB 2R0WL 4MDIB 1GAFL 2CUHA 3EOTH 3TWCL 4CMHC 2PTVA 3UTQA 4L8DB 4D0CA 5HDQL 2VLJD 2MQ3A 3QCUH 1W0VA 4DKEL 4LSSH 3NCJL 2M2DA 5JW4N 4E41A 1S8DB 5CJQL 2RR3A 2F53A 1MJ8H 1RHFA 1INQB 4PV9B 4ZYKB 1NDGB 4MJIB 1Q72L 3RZWA 5C92A 1WTLA 1F90L 1IGMH 4Z7NF 1R3IL 3L9RA 2Z8SA 3GSNL 4G80A 5CEXA 4N8VG 4G9FE 2KQNA 5D2LF 2OM5A 4K94L 2NR6D 5I1EH 2AJSH 3L3KB 4QLRA 3MGOB 1YN7A 3ULUF 3UTPE 4FS0A 2NW3B 3BIKA 2PYEE 1GPOH 5LGHH 5JMOC 3QR2A 2NNAB 1U8QA 3A0OA 3JZ7A 1UXWA 1EFXB 3WXVH 2HRLA 3TNNA 1ZMYA 4JHWL 2PO6B 5HPOA 4KRPB 4PJ5B 4ENEC 4I48A 3CDGA 3Q6GH 4I0PB 3PWLB 3QDME 4OGYL 4J3XA 3V6FB 1DQMH 1LP9A 2HWZL 2NY2D 4HXAL 4FQ1L 4AY0A 2AJ3A 1B2WH 1CDCA 5D7JB 2SEBB 1JUFB 4EI6B 4Y2DB 5CD5D 2UWEB 4LP4A 3QWRA 5ICXB 4Z7WB 3GHEL 2EDNA 5FKPB 4YWGH 4D3CH 4XPBL 3T0EB 4O51A 1EMTH 1EBPA 4M1GL 4WY7L 2YPLB 5GSRB 2VNCA 1KGCD 1UZ8A 4NCC1 4V1DE 4AT6A 5HHQB 1WZ1H 1I8KB 5D72H 4ZAKD 2VMFA 3V6OC 4DCQB 2PXYD 3ULVC 3MREA 3VI3F 4NKQB 2ZG1A 4AENB 1WGOA 1IQWL 3S98A 1AXIB 1FL6A 3KXFA 4OI8A 3T3ME 3ZKMC 2XA8L 4N1HB 1DLHB 5D70H 3U36B 1Q94A 4E42B 1T6VN 4N90D 1INDH 1A4JA 4NFBA 1YPZB 4WI8A 1JWUB 1LK2A 1OT1A 4WFHE 4R3SB 2B5IB 2ERJC 3QDAA 3QDJB 2G2RB 5I1IH 1A8JH 3GSXA 2MHAB 4J3WA 3JXAA 5J13C 1BFTA 3NPSB 3L3DA 3L5HA 2XWJA 3EFDH 3MR9B 3MV9D 4YH6A 2YZ1A 3I6LE 4Z7NE 2YXFA 1FRGL 1SJEB 1KB9J 1K8IA 3BPOC 3X11B 4J2XA 4P3CH 5HHPB 5F89A 3OG6B 5IFJA 5D2LE 4NM8L 4FXKB 1S7TB 1H3PL 3N1PC 4YXKL 3U1SL 3ULUE 4L9LC 1EX0A 4LCCC 2Y6SD 2VE6B 2LFGA 5L88L 1AKJB 1LO3H 1IKNC 1MCLA 2R1XB 3DXAE 5T1KB 2P5WE 3TV3H 2R1YB 1VADB 4PJXA 4HIIA 1G7JA 3MRGB 1AR1C 5I30L 1FJ1B 5IHUH 4RDQG 3VFNB 3EUUA 4Z6AT 4OJFH 1QBAA 4TNVF 1X5AA 3MLYH 2G60H 4FZ8H 2X4QA 4DK6A 3FB8A 1YECH 2NY6C 1BOGB 3DYOA 2ITDB 1OAZH 1I9JL 3H3KA 4XP9L 5F9AC 1TENA 3MNVA 1KOAA 3EJZD 1IEHA 4JGUA 2X70A 1NAMH 1JTPA 5IKCA 3LS5L 3WJJC 1J8HA 2BDNL 5IROC 2DQDL 1NGZA 4JFZH 2HVKA 5IW6A 3VI3E 1UVQA 5DO2D 4TVPL 3TPUB 4JRYB 1TCMA 4NBYB 5B38B 1OOAA 3V6OA 4GW4A 1RZ7L 5GJSL 2E7LC 2FZ3A 4QYOA 4EQ2A 5I66B 3BRFA 3UJTH 4KMQA 3SE3C 3D2UD 4RDQF 4ZMAT 3ZKXB 4D9RE 3MA9L 1PG7W 1G7MB 1OTTC 3VFTB 5J6HA 2XI9A 3BDXA 4J4PC 4PG2C 5ADPH 1CD0A 3GRWL 4YDVA 4Z7OF 1AE6H 1WZLA 4NFDA 4LGRB 4RAVA 5DK2A 5GGSB 5EC2A 5HHOD 1DZBA 2V7NA 1FL3A 4HGWB 3IFNH 1REIA 4GW1B 1JRHH 3CH1A 3QUYD 2FH6A 3LRSA 4HXBL 3H0TA 5E5RB 1OAKH 2X1QA 1DQJB 1P7QD 5ITFA 1LVEA 3V5HB 4K9EL 2YC1B 4AEHH 4HS6A 4YGVA 1WT5A 5F7DB 1GCFA 2VUYA 4X6EB 4HWBH 4OQ1A 4K3JH 3ECBB 1JWSA 3BKCL 2YBRA 2VXTL 5E8DH 4FZEH 1GC1H 4LCCA 1KG0B 3PXHA 1KC5L 1GVIA 2HTKD 2HMID 1IKNA 4NZTH 3O4OB 5J11B 4QXUL 1CK0H 3P73A 3NN8B 4NQSA 4RGND 5F7WC 3LZFH 3HC4H 4FQQB 4CVWA 4PJFB 3VXTB 5C0AD 4K8RH 4HZLB 4Y19A 4WJ5A 4MZ2A 4KKBD 1DUYA 4KDTC 1RSFA 3JWOC 4EEEA 4OFYA 4HLJA 4YHKH 2BNQD 4P2QB 4X4ME 2BNRE 1TQCC 3UZEA 3W0WB 1NGQH 2IBGA 2C26A 3BP5B 5JHDE 3ZSSA 5DQ9B 4D9LL 3WE6B 5F6IC 2QQNL 4GQPH 4Q7DA 2QADB 5MENE 5J1TC 4Z95H 4MNHB 1EVTC 3MJ9H 5GSVA 1JNHA 2IPUK 4X4ZA 2XRAH 4F2MA 3X3FH 4QCIB 2H8PB 4XPTH 4LVOB 3B9KD 4X7TA 4E5XA 3O0RH 2XKSA 4TUJA 1ZT4A 1MPAL 2E7LA 1VFUA 4KRMB 3VWJD 1BD2A 3SKOB 5FB8B 2YD8A 5IK3A 1G9NL 3SE3A 2BVOA 1KB9K 1D5XA 3AAZB 1MCOH 1CVRA 5CIPH 4LLYA 1RJLB 3U0PA 5D1QA 4J3TA 4Z7OE 2HFEB 1GGBL 5K9QI 4ELMF 5H35B 4J4PA 3JTSB 4ODXB 1JF1B 1OGAD 3B5HA 4UOW1 1G6RH 4D9QD 5DQDL 4MA3B 1FFPB 1R3KB 4WVRA 5DJ0B 3UBXG 3BFOA 5E1HB 1X3DA 2BFVL 2DKMA 1FNHA 1XMWA 1BBJA 2OR9H 3TWCH 5FM4A 5LCVL 2P8PB 3QB7C 3EYUH 2IPKB 4QRTB 1NFKA 1YMMB 2GITB 3RWGB 1UQSB 4CGTA 1U58A 4MAYC 1G6VK 3T0VA 1DN0A 3GBNL 2GSGB 1ZEAL 4U0RC 2FO4A 4WGWB 5E8NB 4OAWA 3P0VL 5T1MB 1EO8L 1QZ1A 2WSKA 4UUJA 1WWWX 5C09E 4JFDE 3TIDB 1J1PH 4RMVA 3OJMB 2X5PA 4P57B 4U6HB 1AGDB 4JGMA 5TDPB 4G6KH 2B2XH 2WP3T 5FM5O 3V52H 4X9FA 5ANMB 5JORA 5HGBA 2JJTC 2B39A 2AJUL 4S11A 3LSOA 4JKMA 5GRXG 1RFDH 4HS3B 4WHCA 1U3JA 4KDTA 1C5DA 2HYMA 3VFGL 2J12B 4PJGB 4G8GA 1FO0A 5GRJH 1PKOA 2A6KB 2VOTA 2FDBP 3SOBL 3P3YA 2MWCA 4Y88A 1XR9A 1HYSD 2Y7QB 1QQDA 5C0DA 1I1RA 1MAKA 2BVQB 2K7PA 1K3ZA 3CGTA 4R96A 1YEEH 5TDOB 3WN5B 4LQFH 3LEYH 3O4LD 4P5TC 5C0CA 2WBWB 5CJ8A 3OX8B 1YNLH 3VU2A 2IMNA 3IDMB 5FOBA 1NANI 2DQCL 2FWOA 4PGCA 1R3JB 1JHLH 4KQ4H 2VLRA 1QFUH 3HE6D 4JFEB 4NQCA 5BO1H 3QUMA 2UVEA 4YHNB 3C5SA 3TFKC 4FXGA 4XNUL 4L4VB 4MX7B 3IDXH 1WZMA 3ZE0F 1IC5L 1MHPH 4XCCL 4PJCF 5E95B 4ELME 2Z8RA 2X4PB 2FIKB 1DANU 1Z5LA 2P45B 4WI5A 5IMKB 5JNYA 5JPNA 2EXYD 2ENSA 4PGZA 1CU4H 3HB3D 2EDWA 2AW2A 5I6XB 5DJAB 3MBXH 5EUOF 3L3JB 4RGOH 5T1LA 1FLRL 2BSTA 1FZJA 3W2DL 1NMAL 5MEPB 3QHFH 3MUJA 4YBLC 4PJ9D 1KLFA 3P4NA 3L3OB 3KHQA 1MCPL 1U8OA 2R56L 1FPTL 2Z92A 4HV8A 3FRUB 3MRDA 3EGSB 2DJSA 4RMQA 5IIEA 3VGHA 2VISA 2QJDA 3KWWB 4MAYA 4YXHH 2AI0H 5T5FL 4N0YH 2WINB 3FQUA 3IAQA 5DRWB 1G7PA 4B41A 2GW5A 3ZDYF 3UTTE 4H88H 5BRZE 1NMCC 1TZHA 3DETC 1BQHB 4JRXD 5D93C 1JMZA 1Q0XH 4UDTB 4AIZB 5D2NB 5BS0B 5E00B 2QQKL 1HXMB 4OLYL 4M8QB 1P1ZA 2JJTA 3WFEH 1RIUH 2R0KH 1S3KL 3ES6A 1L7TH 1MCJA 4IRSA 4BSWA 4YHZL 2DBLL 3OBAA 5J3HC 2Y06L 2XWBB 3C60D 1U3HB 1WBXB 5FYJE 5B39G 1K3IA 5MI0B 5GS1A 5EO1A 3LKQB 3OAYK 5E08H 3TO2A 3NA9L 3QEGL 3BZEB 2IFFL 3FB6A 1I9JH 3EDKA 2JCCB 3HUJB 3Q3GB 3RHWF 1MCNA 3GBML 2FATH 3VGAB 2BOBB 3BQUD 1CDUA 4P5TA 2YD4A 1OSPL 3NCMA 1N59B 2F54A 5FA4B 2ITCB 3BUTA 2VRAA 4XCNB 3LS5H 2AV1B 4P46C 2FJFA 3KS0J 2DQDH 3WO4B 1OAYL 1J0KA 4R2GC 4KKLC 1HZHH 4C56B 5JTWA 3ZE0E 3QO0A 3IU3B 1VFAA 2G5RA 4PJCE 5HGDB 2MFNA 3BP7A 4TSAL 1Q9KA 4YHPB 2OZ4A 3V5DA 1MSPA 4LRIC 4M5ZL 3STLB 4PP2A 1ONQB 2CDFA 3KDMA 4N0UA 5C0BA 3U30C 4RFNC 4XVTH 5EUOE 2UV3A 4H5SA 3TT1H 4L8SC 4GBXB 2DLFL 4QOKD 1QACA 3U6RB 3RUGB 4G8EA 1QSEE 5DQJB 4D0BB 1RZIB 3CFBA 3RAJH 1F3JB 3OKDA 3OB0H 4NPYA 1H3VA 4FQHB 4JANB 4NP4L 2YD7A 3H2WA 3QIWC 5F7YC 3U7YH 3WLBA 3ZDYE 2HTLD 4XMLH 4M9PA 3SHSA 2UZYB 3ARFC 2PNDA 4LKCA 5T5NG 4DAGH 2Z4QB 3UROR 1Q9OA 1HXYA 2D7QA 3B9VA 3PWPD 3FT3B 2VXTH 3DJ9A 5DTFB 3P77B 1MHEB 1A02N 3BIBX 3I50L 4PJAB 2IFGA 5TE6L 3ZO0A 3M45A 3EO0B 1XGQA 3ZL4H 3QXAA 2IJ0C 4S1QH 1TPXB 1HHJA 2DM7A 4EN3A 5ESAA 5DGQA 3G5VA 4QRPA 3FOMB 3EOBB 2EDOA 5HYSB 1HWGB 1EHXA 1A6VL 3L3GA 4JKPH 1ITBB 1GIGL 2HRPH 4IIQB 4ZD3L 2XV6B 3RWCA 1XGTB 4HAFA 3IETA 4L8BB 5DD3L 1AQKH 1EGJL 1GRWA 4YFEA 1WITA 1G1CA 2Q3AA 4TSBH 5MEOA 1MFCL 5I75C 1ZK9A 5H94A 2QQNH 2FIRT 3CDYA 3BH9B 5D7KD 4GRWH 2AKRA 2V9TA 3GSRA 3FO1B 5EO9B 1NCTA 2VDLH 3X13B 3CMOH 3B43A 4NKDB 3PNWA 5JOFA 5CGMA 3HAEB 3WNKA 2XT1B 4JY4A 4P46A 1GJIA 5DS8A 5L0QB 4JDTH 1CZ8H 1E4JA 1GOHA 3MX0A 4GRLD 5L2KB 4QKXB 2C3WA 5CUSH 5IM7B 1IGCL 3C8DA 2ESVE 4HHAA 1QKZL 1MCCA 1XFPA 4U3XA 4LRIA 5EFIA 3EDEA 4X6DA 4WEUD 4W68A 2X2YA 3T77A 2D4FA 3JTTA 1PSKH 3SQOH 4ZUSA 3MGAA 1QFWH 1T22A 3AREB 4OCWL 4LLUA 4KK9C 4L4TB 3VFUB 4N5EC 3VGFA 5I1GL 2ICEA 4OF6A 1Y6NR 4YHYC 4XCYA 1NDMA 1F4XL 3ARBA 3QNXB 4FTVB 4MQTB 1KELH 2F8XC 2DB8A 1ZXQA 4C59B 3QIWA 2OMBA 1J0HA 2DTSA 5IEKA 2CKBA 3QUKB 3ARFA 2AJYL 5J57B 1MHCB 3EDFA 4GG6B 2H32A 3GJEA 3S97C 2A6DB 2AEWA 4WWKD 2APWA 1V7ML 4ODWA 4ZFGL 2EYRB 5FECA 5ICZB 1DFBL 3U0TA 4PRID 3LEXB 5F88A 1CDBA 1OPGL 5ACZA 2YWZA 1G7LA 1LMKA 4M1CD 2AJUH 4QWWC 4JN2A 4M7KH 1I7RB 1QSFE 3WLWD 3K4DA 4N9GA 4PJEA 3F7YA 2A2QT 3E2HB 2DI7A 4OLWL 2NYYD 2A9MH 1RURL 4FFZL 4Y5YB 1TZGL 3ULUH 4QRQB 3TBVB 1T0NA 4LL9A 5EIVA 1G7HB 3HC3L 4LCUB 4U2YA 4PJIA 2ADGB 2GY7B 1Z9LA 3VW3H 3I6KB 1DL7L 2D3VA 3G6DH 1NBQA 4L3CA 1IFHL 3UYRL 2AK4E 1WCBA 1JGVL 3PGCB 1MCWW 4KAQL 1IGJA 3LEVH 1M7DA 1BGXH 4WFED 1QBLL 4FP8H 3PP3K 2VN4A 4XP4L 1QRNA 3CLEL 4GAGL 3WSQL 1HQRB 4UTBH 2IADA 5AAMA 3VFVB 1AO7B 3BX7C 3DRQB 3HG1B 4X6CF 5C71A 3MLUH 4XB8A 1D6VH 4HWNA 4CU6A 4IOIA 2FRGP 5HHNA 1CFQA 3D39A 4KKNA 1MJ7H 1OW0C 3FOLB 4F7PA 5I71C 1I1AC 2Z31C 4OUOA 3MRNB 4NO0B 4Z77A 3AB0C 3MXWH 2ILLA 1SEQH 4Y89A 4TVPD 3MRQA 5IB5A 3M8OL 4PLNC 4Y16B 3RY6C 5ISZE 3FO2B 4PGJA 4R7NA 5FCSH 3GEWB 3S5LA 1IL1A 4P9MH 2XY1A 1CFNA 2W65A 1YA5A 3D85D 4LSPL 5DFTA 3EO1A 5FUZL 4S0SD 2AABH 2ADFL 2YD3A 1RUAL 5E1AB 2JTDA 3H9SE 2JK5A 3OKNA 2O5XH 1T3FB 4ZQKA 3NZ8B 4ZXBD 1IZKA 1P7KB 5INCB 5CIPB 1FV1A 4Y5VC 4HBQA 5HI5C 3WFCL 4LF3A 2IBZX 2J8UA 3ARGD 5GIRA 4M7LH 3OG4B 4X9IA 4PIRF 1NGWB 1CCZA 2GK0A 2EDEA 3RWEA 1A6AB 4NGHL 4OFIA 1G7IB 1GGCH 2ZKHL 1J1OL 4RGMC 3ZYIA 3QULA 2VDOL 1OD7A 4TUOA 2YA1A 3JWDC 2D0HA 3GM8A 4MJID 4LLAA 4NT6A 1V3KA 4J12A 2EIDA 3DX6B 4R4BA 3QEQB 4J1UB 5I1CL 5IFHL 3VXUA 2NR6C 4EBQL 3RBGA 1ES0B 1T2QH 2YK1H 1BX2B 3VFMA 5TF1H 3RWFB 1SQ2N 3B8SA 4QTIH 4PJBB 1HH6B 4Y4FB 1OSPH 5GHWH 4FQLL 3G5XB 2X10A 2YMXL 1LO4H 2HLAB 2CXGA 4YDIL 1LO2H 4X6CE 4CDGC 2D03H 2Y25A 4WW2C 4WV1A 1NC2B 4KRPD 4PJ5D 4X7CC 3Q5YA 3KPNA 4MCZB 1UADC 3A67L 5D96C 2IANE 3BT2H 3LKSB 4XNXL 5HYJE 3UTPD 3W11D 4TSAH 4O58H 1OW0A 1K4CB 3F7RA 1JGUL 1RULL 2EZ0D 3PL6B 1I1AA 5SWZE 3VGEA 5D7JD 1SJHB 3IS1X 1LP9F 3PHQA 1DBAH 3QEHA 3IB4A 3ZMRA 3UPRB 1AD9B 4BQBA 5A2IH 4ZAKC 3RY6A 2PXYC 4KXZH 5B22A 4R8WH 4YHMH 4TRPH 1K5NA 3MOAH 1CLYL 4RZCA 5DJCA 5ALCH 5F21B 2BHZA 2UY6A 5EBMB 4MNQA 1IM9D 1KF9B 1CWVA 1IGFL 1UM5H 4NJ9H 4NP4H 4OTXH 3N06B 4HS8L 4YXLL 1J88A 3MLZH 1IILE 3HE7D 5D8JH 5DURD 2W91A 5AZEL 1NC4A 3JBG7 4QHNA 4P5KB 1MFEH 1R3LA 1KLGA 3QDJD 2CDGA 4UAOB 2ZSVA 4JFFB 5TE6H 1A3RL 2FB4L 5J0BA 3JVGC 5JPMA 3BEVA 3PWUA 4J23A 4PLOB 4RX4D 1FFRA 2YRPA 4KI5D 4JREB 2V5MA 4E41E 2F53E 3G08B 1BZ7A 3C8KA 1YY8B 3NCEB 5J6GB 4X7EC 1BZ9B 2HKHH 3O6MH 5KSVA 4MQSB 1KSRA 2Y6SC 2F74B 4M43H 3LS4H 4AMKH 2PCPA 2R2HA 3KPQB 2DLTA 4PJDA 1Z9SA 1MFCH 4JJ5A 4KTDH 3KYMB 4Y4KA 1T0MA 3UP1A 2IH3B 1ZHLA 3I6LD 4WI7A 3L3IA 2VXSH 3QPQD 1EJOL 4Z0XA 1FVEA 5LWYL 3BP6B 1QBML 5T3XL 1W72A 4LSUL 2YD2A 4WW2A 5DJ2B 4PJXF 1JF6A 1UFUA 2R0LL 4NIKB 1JZ8A 1TJGH 1QFWM 3NOIA 4X80L 1LP9E 4K3GA 4U7KA 2P5WD 3EJZC 1ZHKA 4MJ5B 2Q8BH 3AGVA 5IB1B 4QHKI 5F6HJ 4CMMA 3D48R 1J8KA 4F80A 1CGXA 4XP5L 5E2VH 5DO2C 4JDVB 4ZAKA 2NY7H 1G9MC 2D4DA 4HULB 1ORQB 5JXAL 1GGIL 1MY5A 3S7GA 4JZNA 2BNUB 5IWLA 4UTAL 2X4NA 3CXDL 4ODHL 4BZ1H 3GI9H 4OBRA 3HTLX 1RJZA 4XB7A 3KXFE 5EBLB 4CJ1A 4QT5B 5KOVC 4HCRH 3ULVF 1BJ1J 4QHLB 3SO3C 5D6DC 5E9DB 1HCVA 3VMOA 3BVNA 4NWTL 4JQIL 4Y7MA 1H3GA 5I1JL 1FNAA 2IF7A 4K3DH 2P7TB 1GOGA 1D5MB 4NNPL 3FB7A 3QUYC 4R26H 1F11B 4PRDA 2VDNL 4G6ML 1AR2A 3LMJH 3TN0B 2BSSB 3RGHA 3MV9A 4U1MA 3U9UB 1DDHA 4NBZB 2BZDA 2X9YA 5F7EL 3RKDD 3OPZL 4MJ4A 4KMLB 1CDYA 5B8CC 3QQ4A 4TULH 5D7IA 1NGYA 1F3DJ 3R06A 1A64A 1DBKL 5I76B 4NZDA 4YPGB 2VDPH 3SDCB 3MNZA 3NFNA 1FE8H 3MLWH 5I1AA 1CR9H 2DM3A 2HTKC 2HMIC 1TZGH 3P9LA 4TQEL 5HHMB 1NUNB 4RGNC 3CH8A 1FN4A 1I3GH 4LASL 5EU4A 1K8IB 4KKBC 4PJXE 3UMTA 1MOEA 3KPRB 4P3WA 3N85H 2VAAB 4OGAD 5KW9L 1JMXA 4JPKL 1UJ3C 4W70A 5IBTL 1I8IA 3VH8B 2XPGA 3HI1A 4P2QD 5FYJH 1E4KC 3CLEH 2OJEA 1KIPB 1JI2A 3VXPA 1SVZA 5K9KB 4JO3L 3BPLB 5GXBB 5FHBL 5F8QC 3W81A 5L8KB 2A6IA 5FHAH 1KTDA 4OZGB 4DVBB 2QADD 4P5MB 3ELAT 2VKXA 3FQRA 4NN5B 3WXWH 3B9KC 4MVBD 4OGZA 1J8HE 4OUUA 4PS4H 4ZTPL 1KCLA 4GRWB 2BNRD 1TCRA 3GZKA 3F7VB 3VWKC 5JHDD 1DQTA 4XPGL 3QIUB 5FDWB 4F7MA 3VWJC 1LILA 5D1ZD 4F7CB 4HK0A 4EUPA 3V6OE 1A7NL 3ULVE 5GGSY 4CVZB 4HGMA 5JOEA 2E5EA 5MEND 4ODSH 3TBTB 4JAMB 3QJHA 3VFRA 4ODTH 3BGMA 5FGSA 4LSPH 5D6DA 3OKYA 4WUKL 3T4YB 2YPKA 5IR1A 2DS4A 4U7MA 1JZ5A 4HDIA 2X4TA 5HHOA 1VGEL 4F15B 1FZMA 2AQ3A 4KFZC 1NFDB 1DTUA 3UTZA 4LVNC 4IDJL 1MVFA 1TJHL 1EEYA 2HJFB 1BECA 1P2CA 5E5MB 4G7YL 3DX9B 1P7QA 1HILA 1FZKB 5DR5H 1NUGA 3GUTA 2XQBH 5BOPA 3M17B 2CMRL 3CFJB 4OLVH 2VLKA 1YYLH 2EH7L 3CFEA 4DW2L 4IOFC 4UB0H 1YMMD 3GMOA 4OV6F 1XCQB 3L5WA 3KPPA 1KEGH 3CFIC 3MZGB 1I9IH 4QGTA 1DN2A 4S1SH 4GAJL 1CIDA 3FQWB 3G5ZB 3CMGA 1N6QL 1HHGB 3MV01 5C0AA 2XXCB 4H25B 4HJJL 4LLMB 3P11L 3UO1L 5IQ9A 4JG1L 1VEMA 4Z5RB 4RMUA 4Y19E 5E8EA 3WUZA 4OGXH 2BNQA 4GKNA 4N8CL 4ZO8A 4F3FB 3E8UL 3P4OB 5F9OH 1KBGH 3BJ91 3QUXB 1UYWL 2VO5A 1MRCL 3DNKA 5EPMA 1ZHNA 1HYSC 4HLZG 1MNUH 1ZWIA 2KL6A 2C4XA 3NCFB 3GI8H 5D2LB 2VZ1A 1X7QB 3D9AL 4AZ8A 4KZEH 4OZ4B 2A6JA 4MXWL 1JP5A 1KYOJ 3G5YA 4JZOA 4HH8A 1CFTB 4XCEA 5TGBB 1K9TA 3ZT6A 1KCRL 3MRCA 4L3EB 3VWKA 3DXAB 2ORBL 4NBXB 2QTEA 1HH9B 1AGCA 1AD0A 2H1PH 1X6NA 2BJML 1WAAA 1F6AB 1KCVH 2JELL 1MQ8A 2B0SH 2NY5C 1YDPA 1BD2E 3FONA 5SWQA 4PTTB 5KS9B 1VPOH 1OP3H 3FFDB 1NMBL 2EXYC 1I3RB 4ONFL 3HB3C 2CLZA 3EYSL 3IDJA 4UV7H 1OGAA 4I18B 3S88L 3BPCB 4N8VB 1D9KA 5D7LB 5ID1B 5TDNB 3GMLA 5DHXB 1ZLSH 3BKML 3O6FD 2P4AB 1HHHA 4BELD 4CJ0A 2D31A 2G5BB 4PJ9C 1FBIL 3MUGB 5JMRA 1A6UH 2VLLA 3SKJL 5I1HH 5CZXD 5DHYA 2FJGB 1DJSA 1T66D 2RFXA 4IHOB 5GISL 1CIUA 2WBJD 2PTTB 4YBQD 3GO1L 4GLRI 1C5CL 3N1GC 5C2BL 5JLZB 4I13B 3U9PL 3RU8H 5E2UL 2FX7L 4PY7B 1IVLA 1ULVA 5DXWA 2BC4B 1RUPH 3ISWA 2DQFB 1KJ3H 3B2UD 3V79C 1JPGA 2CLRA 1SEBA 4NWUH 3HNSL 4WHTB 4X6BA 2O61B 1T20B 4JM4L 4UUJB 4O2FA 4RIRA 1T04B 4XMPH 5IOPA 1F13A 2IAMB 4DOHB 3C60C 1XZ0B 1VHPA 3UTTD 1A7RL 2I5YL 5BRZD 1ZV5A 3MMEB 4G8GE 2OXGA 4M6OL 1F6FB 3LKRA 1OWWA 2AQ1A 3I9GL 3T0AA 4X80H 4NM4H 1ORSB 3S35X 4MGXA 4RQQA 3L5XH 4Z7QF 3GJFK 1UKTA 4XRCA 3CX5K 4KUCF 5C0CE 2H3NA 3SGEH 4NO5B 5KSAD 1CG9B 2I26N 5I16B 1TETL 5FYJD 2V2XB 1AI1H 1QBBA 2VLRE 3QHZH 3S4SG 4NQCE 5JA8B 2BRRL 5JXAH 4OKVB 4WGVB 1CS6A 2FBJH 1IC7H 2AJXL 1CE6B 3ILQD 4PRNB 5JXED 3CXDH 1EAPA 1TIUA 3EAKA 3HZKA 3RNKB 4MB4A 5FCUL 5MHSD 2VR4A 1Z0MA 4ZPVB 3IDGB 1DANT 1TLKA 2FWOB 4JFHE 1CDHA 3LV3A 5E03A 4NWTH 4BSVB 4LAJH 3PV6B 2YD6A 5HYEA 1E4WL 2EXWD 4X7DC 4QGYA 5I17B 4JKLA 2GUOA 3RGVD 2Q8AH 1CGVA 3NMEA 4TNWK 1YY9D 2UZXB 1KPVA 3I02A 4NCDA 4M6MH 2WUBH 5IMMB 5JPNB 2PETA 2HTLC 5DSCA 4MA8H 1JPTL 1YZZA 3SGJA 3PQYB 2ZG3A 1AY1L 1PYWA 4MA7H 4Z7VA 5CEZL 1QSED 2EDQA 1PX4A 5I74C 4HKZB 5F44A 3H3PH 4JRXA 1QR1A 2EIEA 5ESVA 1LE5A 2VXVL 2ADIB 2JB6A 4DFHA 4PJHA 3EZ8A 4KGJA 1CD9B 5K59F 1D5ZB 2FLRT 5GS0H 1S5HA 4X5LA 1NGXA 2ZPKL 3ULSA 1TTFA 2H9GB 4HMDA 4IS6B 1RHHB 3DPBA 3RL2B 1A14H 3VFWB 3C60A 1H0DA 3STBA 1IAIL 4HX1A 4ONGL 3KPOA 3TNMA 4JCMA 3OKOB 2VQUA 4K94C 1MLCA 4Z7QE 5FO8B 2BY1A 1HKLH 3GHBH 3LPGA 4H20L 4JO3H 5DUML 4L1DA 5C09B 4OD3H 4JFDB 4LSRL 4PD4J 5EU5A 5MERB 5CILL 4YDLC 3VFSA 2R29H 3OQ3B 2F54E 3SPVA 5JR1H 4XCFL 3T0DA 1PZ5B 5BQ7A 1MCKA 1MQKL 1LEKB 3S35L 1ZVSA 3MJ8A 4OCXL 3O41A 3QWQB 2XZCL 4PLJD 3T09A 2ICCA 4KGLA 2YS4A 4PJ7A 1YEFH 3OHXB 4M7ZC 4Z9KB 5GPRA 5L2JB 1FAKT 4ZSOA 3QG7L 4CN6A 2COQA 5CCKH 5C0BE 4CNIA 4MD0A 4OZFA 4YFLI 1S7UB 3ROOB 2GI7A 4FQJH 4O5LH 4WO4D 3LQMA 1HE7A 1YMHB 2YRLA 4X6DF 3WL9B 4OLUH 4JFXB 3GJFA 1M71A 4I77H 1N7MH 4KKAD 3EDJA 4LHUB 2ESVD 3B83A 3ZSTA 5F7UA 1S9WA 2VIRB 3G9AB 4RWYL 4P9HH 4DGVH 3MCKB 2C7UA 2I25N 5GGTA 4G7YH 4NCC2 1MAMH 2V7HA 3TO4D 5A40E 1UT9A 3PGDB 3PDDA 3NIGF 1MLBB 2F19L 5LQBH 2EH7H 4LBEB 1BBDL 4H26B 1UXSA 3GMMA 2FD6L 1HHIB 2OL3B 1ZHBB 4WWKC 3PWPA 4GLRH 1A1NB 4YLQT 5C08B 1D3CA 2CIIA 4Z0BH 3V6ZA 5K59E 4XH2A 2D2OA 1WC7B 3LAFA 5ID0A 2DLEA 4UINH 3T65A 2WIIB 5DDHB 4Q9CA 1F4YL 1N6QH 4YX2L 2GFBA 4M1CC 3B4NA 5C0ND 4JO2H 1ZA3B 4QRPE 3WLWC 3UO1H 1IC4H 3LN4B 3WHXB 2A1WH 4M9OA 1R5IA 4NUJA 3UDWC 1IAII 3F5WA 3GSNA 2W60B 1MRDH 3TJEH 2NYYC 3C2SA 3TIEA 4M61A 4RMRA 1LEIA 3VJ6B 5DJDB 3MJ7A 1MCIA 1MREL 4PJEF 5E8PB 1MCSA 4K23H 4FQXB 4JHAL 5EDXA 43C9A 6FABL 1FFNA 4UT6L 3D9AH 3VD9A 5D1XB 3IXTB 4WEMB 3REVB 4OT1H 1BVLB 4PY8I 4E0RB 1DQDL 2NXYD 1CE1L 1MH5A 3MRRA 5TPWL 2QEJA 3UBXB 4PJIF 4PYGA 4QXGH 1YEIH 1U8IB 2C1PB 1BAFL 4U1GC 1FO0L 3MRJA 2AERT 3L95B 2FX8L 2BJMH 4LAQL 3S5LG 4FFYL 4YEEA 2DQIH 4JB9H 2VUOA 5DZOA 1AO7D 3HG1D 5C0RL 3DSNA 4DUWA 2CLVB 4X6DE 3DBXB 3BUYA 5F71A 4MJ2A 3CVHB 3V4VL 4M7JH 3WIIH 4NO0D 3UTSD 1FYTB 2X4RA 2YD1A 1J12A 4Z76B 5BJTB 2A77H 2VDKL 4ZFZA 2HN7B 3WHE0 3QUML 3OAZH 4Y16D 4NN6B 3EFFB 4ZFOA 3NIGE 5FFLA 4JM2D 3DVGA 3FO9B 1T03L 1G0DA 4ZUSB 1OVZA 2NY0D 2IBZY 4RFEB 3BAEL 5GZOD 5E4EC 3RL1B 1P4LB 2BY2A 1RUKL 2XN9B 4X4XA 4ZXBC 5GISH 1OAQH 3QUZB 3FZUC 1XF2B 1J0JA 2XWTB 4WWKA 3U4BH 4G7VL 3ARGC 1DBML 5ISZD 4LCIH 1U2HA 4WTWA 4F8TA 1C5CH 5IF0A 1QO3B 3MLTA 3QEUB 2QV2A 5I19H 2ATKB 2PF6A 4NHCH 4JO1H 3DX8B 2D7PA 5FM5M 5F7MC 3BWAB 1BLNA 3A6CL 1C7TA 2J8UF 4K9EC 3NFPB 4ZG1A 1A2YB 1QLEL 1UWEH 3QQ3B 4NQDA 5IQ7L 5CBEA 3OXSA 2HFFB 3R0NA 3UDWA 1AIFB 1NBVL 1LDPH 2HLFD 4JQXC 4LSVL 4PJEE 3IKCA 3REWA 1IEBA 1V3MA 4J7RA 2I5YH 4MD5A 1L9MA 8FABA 4NKOA 2R9HD 3GB7A 1CLOH 3F12A 1T2JA 1A6WL 5GS0D 4P2RA 5EZLA 4PJIE 5F1SA 2I07B 2D0FA 4JO4H 4QHMB 3BXNA 2X7LA 4OQTL 4GXUM 3TP4A 3ESUF 1YQ2A 1OB1A 4Y4FD 4LEXH 4F57L 2DKUA 3FRPG 3VXQA 2Z35B 4H0HB 2PO6C 2DJUA 2R2CA 4KRPC 5CAYB 2XA3A 4I0PC 4QXTB 1QRNE 3WDHA 3ZLQC 2NY4B 5KVEH 2BRRH 1NC2D 1XR8B 2VDRH 3LVEA 4P23D 3W11C 2NZ9D 2AJXH 5DMIH 1FG2B 1NCUA 5D7JC 2LE9A 3D39E 3L7EA 1CXIA 3RY4A 1ETZA 2AV7B 3LDBB 4G43A 3MFFA 3ARDA 4DGYL 3LPWA 3VXNB 3FAXA 3O2DH 3PJSA 3MYJA 4Z8FL 3RZCD 1G9NC 2B7DT 3PHSA 2NZIA 4P4RB 3C6SA 4M6NH 4JLRA 3ULVH 4YHIB 3FL7A 4F7PB 3INUL 1ZT1B 2OZ4L 2C4FU 1N2RB 4LK4A 4QRRB 4WRLA 3W9DB 1KT2A 5IJVB 5B39B 3HE7C 3GRWA 4PRPB 5LG1A 3WS3A 4RAUA 3OZ9H 2GSIA 3TEUA 1GHFH 5IFAL 4TOYL 2VITA 5GGRA 2OL3L 2B5IC 1CDIA 2J8UE 3QBTB 3SKMA 5CHNB 1UJTA 4KY1H 4MDIA 3WHE1 1OQOA 4L8DA 3H42H 3NPSC 4JFFD 4KI5C 3IDIB 3QSKB 1CLCA 3GSUB 3PP4H 2XTJB 3OKNB 1S8DA 3VD7A 3C09B 4PTUB 2NW2B 1INQA 4UDUB 1IT9H 4PV9A 4ZYKA 1NDGA 3SJVB 4MJIA 5E2JA 2EDFA 1QPPA 3OJDB 1L7IL 4ZFFB 2P43B 2VYRE 3BN3B 4Q9RH 4YHLL 5K9JL 5I73C 1E6JH 1E4XL 3L3KA 4CRPA 3MGOA 5KVGH 5C6TL 4PB9L 5L6YH 2NW3A 5BVPL 5DHVB 3QPQC 4E41D 4LSRH 4EOWL 2NNAA 2QSQA 1EFXA 4PJDF 3WKML 5HPMA 1EUTA 4D94A 1S9YB 2PO6A 4P4KB 4PJ5A 1AGEB 1MCHA 3AUVA 4TPRL 3OKMB 4I0PA 3PWLA 3V6FA 3IDUA 1RIVH 4XX1G 4D2NA 4XT1C 1RZFL 4CADB 4WW2F 5D7JA 2SEBA 1WJ3A 1KCKA 3MGTB 1JUFA 4E9LA 3FB5B 4EI6A 2J3SA 4Y2DA 3U7AA 2HVJB 2DI9A 3TVMB 2UWEA 2XZZA 35C8H 4Z7WA 5ICXA 3TH3T 1OP9A 1U8MB 5FKPA 4P59H 2DOCA 3T0EA 3CVHL 3CSYB 2YPLA 5GSRA 3DX7B 5HHQA 1FFOB 1I8KA 3RJQB 4R4FH 3NFSH 4DCQA 3C5ZB 4AENA 3LIZL 1U8JB 1E6OL 4PRBB 3DECA 4NNYB 2VH5H 2Z8VC 4MNQE 1FORH 3ZKXC 1DLHA 3U36A 5C70A 4E42A 1TDQA 3QWRD 1ADQA 2VABB 3VXRE 5JA9A 4FMFA 1J10A 5E9DD 1YPZA 1JWUA 2DRUA 2Z91A 2BY3A 3RA7L 4LVHC 2VR5A 4R3SA 3CU7A 1EVUA 2OP4H 3QDJA 4OD2B 4RMSA 2G2RA 5ALBH 1JN6B 3O8XB 2MHAA 3HZYB 4ZOEA 4RX4A 1BWWA 3DMMB 1DSFL 1PY4A 3MR9A 5GRUH 1J11A 2F58L 4BH8B 3MXVL 5EZOL 5IESH 3OKKB 3CDFA 5D71H 5JW5B 1SJEA 3X11A 2H2SC 2R8SH 3O2WL 1S7TA 3GSQB 2X9XA 2VZVA 1YYML 4KDWA 4YIQB 5D7IF 1LK3L 3WUWB 2VE6A 1E4XI 1AKJA 5J11C 2HFGH 3O4OC 4PJDE 5HHMD 5KANG 5T1KA 5T3ZL 1ZA6B 2ZUQB 2R1YA 1VADA 2W9EH 4UQ2B 5CSGA 3MRGA 1DQDH 4O2EB 1M05B 1FJ1A 1KCUL 3M1BB 5EA0L 3VFNA 1F8TL 3JWOH 4ZS7H 1IAMA 4EUPG 3CSGA 3VFOB 2WBKA 2ICWB 1HI6B 5EORH 4P0DA 4JPVL 4FQ2H 1BOGA 2VXQL 2ITDA 1ZLVH 2JJSC 3AS3A 4S1RL 2QADC 3QFJB 4CAGA 3L3IB 3TYGL 5BOZG 4JFYA 1L6ZA 1CBVH 4LDOB 4MVBC 5GGQH 5DWUL 3WD5H 3FQXB 2FYYB 3NH7L 3ARWA 5FDYA 1A7BA 3V95A 1JNLL 4ALAL 3NCYS 3TPUA 5D1ZC 1B9ZA 4JRYA 5B38A 1CT8B 1WV7T 4G8IB 3BW9B 1BWMA 2VERN 4OF3A 4I4WB 5I66A 4MWFB 4NQVB 2HH0H 4XX1E 2YSSB 4HLZH 1MWAB 1U8NB 1DUZB 2FECL 2NXZB 2XG4A 1G7MA 3VFTA 1J8HD 1N0LA 4NQEB 2VB5A 3N50A 3GSWB 5EWIL 3KPSB 4OI9A 5SWZB 1FDLL 5GGSA 2FGWL 3DURB 5HD8D 4HGWA 4MQ7B 3TYFB 3QP3A 4GW1A 5CZVL 1KENH 2EDTA 5FGCB 3H9HB 2ZUYA 3MBEA 5C0FA 1EEQA 3ZKMD 5AUMB 2OI9C 2D7NA 3S8WA 1DQJA 3MV9E 1XGUB 3V5HA 2EDRA 1EHLL 2YC1A 5F7DA 5BZDB 5TQ0L 5D7IE 4X6EA 1KIUA 2F5AH 1NBVH 5DLML 3ECBA 1EEZB 3P40A 5FYLE 5E8OB 1KG0A 1E27B 5HGHB 3FQNB 3ORJA 5IB4B 1W2KT 3NN8A 4JPWH 2KQMA 4KTEH 4FQQA 4PJFA 3VXTA 1KPUB 4HZLA 3PWJB 3V4PH 4XC3H 4WUUB 3AC0A 1XAUA 2CR6A 4C54A 1ACZA 4WTXA 5DRZB 1MIEL 4P2QA 4UILL 4XNYL 3W0WA 3BP5A 3ALPA 3DOSA 5DQ9A 3QUXD 1JGLH 4QHUB 4XP1H 5DUPH 3WE6A 3IRZA 4NKMB 1BZQK 4MNHA 3A6BH 2YZ8A 1HKFA 3T2QA 3WN5C 1AJ7L 2VC2L 2LQRA 4B7IA 4K7PH 1DBBL 4Y19D 5C07B 4QCIA 3QAZB 4MB5A 2H8PA 4MXVF 2XPGB 4L3ED 25C8H 3MRHB 3ALWA 4LU5H 4G5ZL 1OL0A 4EIGB 3IU4H 1R24B 4KC3B 5EIQA 1N0XH 3KYOB 3MLSL 3SKOA 5FB8A 1UM6H 1X4YA 4CL7A 2ARJQ 4KHTL 2DL9A 3AAZA 2CDEB 3MRBB 1QHOA 2FECI 3LD8B 1SYSB 4OLZL 5DI8B 4IEFB 3VGBA 1WAAF 1RJLA 5J1AB 2OZ4H 4LCWB 2HFEA 2XKNB 7FABL 5H35A 2CO7B 2EDBA 3JTSA 4ODXA 4DKDC 1JF1A 5I6XC 1N5YL 3O6FC 1FH5L 2OYPA 1EJ6A 5D7LD 5HHOE 4MA3A 5EU6B 1FFPA 1R3KA 5DJ0A 2DTML 1RUMH 1YEHH 3NCBB 1T66C 2BVPB 2P8PA 3F58L 5DD5H 3AY4A 3VD5A 2IPKA 4QRTA 3MOBH 1IAIM 5D1QD 1YMMA 1JBJA 2GITA 3OGOE 3RWGA 1UQSA 2WBJC 4L4JA 4I8DA 2VLKE 2GSGA 4YBQC 4DN4H 5F96H 4J4PD 5E8NA 5T1MA 2YUXA 3VDBA 5GGVH 4HWZB 3TIDA 4CU8A 3G6AB 3K4AA 4P57A 1AGBB 3DROB 4U6HA 1A6TB 3RY5A 5TDPA 3THML 2NY1D 1UB6B 5D2NC 2K3TA 4RGNE 3B2UC 3BKYH 5ANMA 1NCAH 4XVUC 5HGGS 3RJDA 1PEZA 5C0AE 1ZVHA 5E70A 3CFKB 5EUKB 4HS3A 1HINH 3OXRB 2DQHH 3P9MB 3JWDL 4IRZL 2RGSA 1EGJA 2P5EB 4M93B 4UV4H 1C1EH 2BNQE 3QWOB 4PJGA 1J86A 2XZAH 1A21A 2A6KA 1U3HC 2VTFA 4GAYB 5GRVK 1OTSD 1U42A 4A6YB 4NOFA 2Y7QA 5F3BB 3OKEB 2AVGA 3MCG1 4MXVE 4LDEB 1IEAB 2BVQA 3QRGH 5A43C 1DEEB 2DWDB 5TDOA 3WN5A 3VGAC 1VKXB 1TFHA 3HPLB 3HZMB 5KSAC 3DSFL 1VGKB 3OX8A 1AXTH 3IDMA 3ROLB 5IBUB 1JTOA 4OFDA 1R3JA 4G8GD 3WO4C 2I60L 2EDYA 1MFAL 4JFEA 2GYSA 4YHNA 5ERWB 3ILQC 1WAAE 4L4VA 4MX7A 2FLBT 5DZNA 5JXEC 4ERSH 1XF1A 1UH4A 2D7MA 4WFFD 4NZUL 2O26U 3CD4A 1Y6MR 4BZ2H 4W4OA 2X4PA 2FIKA 1MY7A 5F9DC 5IMKA 2J7LA 4YO0B 1MWAL 4ODVL 1GXEA 1P5VA 5GJTL 4GBXC 3KLHD 1OGAE 2DF3A 1P4IH 4LFHD 5DJAA 4D9QE 2XY2A 3T2PA 2EXWC 3L3JA 1GZQB 4NQCD 4LKXB 4NSKB 3O6LL 3RWDB 2IG2L 2NQCA 1YY9C 3IYLW 5MEPA 4F8QA 1C16B 3WFBH 3L3OA 4LEOB 4MHHI 5ITBL 3FRUA 2CRZA 4KRLB 1JGEB 3EGSA 4GH7B 1KTLB 2E6PA 4WFGE 1RK0B 4JFHD 3WIHA 2GJ6B 2UZIL 1LO0L 5ADOH 2WINA 3C5JB 3LHPL 3PQYD 5DRWA 5C1MB 5SX4H 2CKBH 5T1LD 1IJ9A 2O5YH 3RKPA 3T8XB 2WANA 1QYGL 3HMWL 1BQHA 1TVHB 2H32H 1S7WB 4Z7VF 4UDTA 4AIZA 5D2NA 5BS0A 5E00A 1NGPL 4BQCA 1HXMA 4MB3A 4M8QA 1E0OB 4JR9H 3V5KB 1TPXC 1Z3GL 2ERJB 4MAYD 1UKSA 1NL0H 3KYKH 4QEGA 1I7ZB 1I8MB 4BQ8A 2XWBA 1U3HA 1WBXA 5FYLL 2FSEB 2IQAA 5KSUB 2YUZA 4I3RL 1ERNA 2ZJSH 5D5MB 4U6TA 3FTGB 3LKQA 1RVFL 2ZCKL 1WFNA 1D6EB 2OCFD 4WHDA 3BPOB 3BGAA 1RI8A 2CRMA 4YDKL 4X7SL 3BZEA 3Q3GA 3V4UH 2JCCA 3HUJA 1P6FA 2YUVA 4YE4H 4KMTL 2BOBA 4IRSD 4TUKL 4XVJH 1N59A 5FA4A 4L9LB 3MLRL 2ITCA 4XCNA 3AM8C 3FT4B 2AV1A 1T89A 4GMSH 5L0QC 1SBBA 2L4OA 4C56A 5J8OA 1JPSL 3IU3A 3LKNB 4ZO6A 5HGDA 5LGJA 4XPFH 4S2SB 1CFVH 2XOTA 4YUEL 5FYKE 3OAUH 4YHPA 4KTYA 5AYQA 3STLA 4XBEH 1B4JL 2VDQH 3SE8L 1ONQA 1WLHA 4P5TD 4WEBH 4MCYB 4P2CG 2F54D 1RMFH 4PJ7F 2EECA 4GBXA 4NDMB 2NY6B 4R4ND 5FGRA 3U6RA 3RUGA 4PGEB 2EDDA 3LH2H 5DQJA 2GQHA 2O5ZL 4D0BA 3TFKD 1RZIA 2MPAL 3U0WH 1F3JA 4JKKA 1XGYH 3DUUB 4LHUD 2UVFA 4KJWD 1WIUA 4O02L 5DC0A 4ZOAA 3TBYB 4FQHA 2MJWA 4RBPH 3O6KL 1RZJL 4JANA 2D9CA 5C0BD 1A7PH 4N9OB 1R0AH 1R3HB 4IMKC 2MQ0A 4N5UA 1NAKL 4NZRL 1U95B 2DQTL 1EHLH 1CN4A 1TMCB 1EH9A 4Z7VE 5DEGB 1RIHH 2Z4QA 1U8LB 5DLMH 1TNMA 4OM1H 3KNBB 2DMCA 3FT3A 4JRXE 3V7AG 5DTFA 3P77A 1MHEA 5C08D 4PJAA 3T2OA 5D7SL 3BZDA 1FVCB 3QI9A 3RRQA 3EO0A 2QHRH 2EDKA 5C0NC 2W0LA 1W8NA 2YR3A 2YKLH 5HYSA 3FOMA 3EOBA 1JHKL 3HCVB 4LSQL 4IIQA 4DVRL 1H3UA 4FQCH 5E99H 1XGTA 3CSBA 4R7DA 1I85A 3MRKB 3QISA 4L8BA 4TNWF 4NKIH 3E2HC 2YPVL 4QRUB 3UC0L 4LRNL 1K2DB 1OP5H 3IVKB 3OKLB 1OAUH 3DLQR 1B0WA 4R97B 3OJVC 4U1SB 3BH9A 4A6YL 4DTGL 5I8OL 2GKIA 3WNMA 4FQXD 3FO1A 5EO9A 1DQLL 4EN3D 1QEWB 3X13A 2NXYC 4NKDA 3VXSB 3HAEA 2VC2H 3CX2A 2Y07H 4J6RH 3L1OL 3KS0H 1FAIH 5L2KA 3P0YH 1SM3H 5IM7A 4FG6C 4TSCH 4H0IA 3D3VB 4PJ7E 4M62H 2GTZB 4B5EA 4UMGA 1A1OB 4ZSOE 3SPVB 2YUWA 5F6IB 4ZOBA 4R2GD 4KKLD 3AREA 4Z78B 1YEJL 1KN2L 3I2CL 3G04B 1N5YH 4L4TA 3VFUA 4Y16C 2FEEL 4TYUA 5CINL 4JM2C 5T1DL 1SVCP 4U6VH 3SE9L 4ZUTB 4FTVA 2GAZB 5E2TL 1ZS8B 5KZCD 5CJXC 4DZBB 4CDHA 3MRMB 1KJ2H 5GZOC 2E8ZA 1WBZB 5F1IB 1JZ3A 1X5ZA 4U0QB 1BPVA 5T33H 1YNKL 4F7EB 4Y4HB 3QUKA 5HVHB 1UKQA 3FMGL 3KLAB 1MHCA 4JN1H 4GG6A 1PDKA 2A6DA 3PWPE 4M1DH 4WIQA 3GIVB 3WFZA 2OJZH 4M5YL 2EYRA 1CXFA 1N5AB 3ARBD 3I3BA 5EO0B 2DQUL 5ICZA 3LEXA 3P4MB 3WYRA 1CL7H 4PFEA 3V9FA 3QIWD 1PG7X 4KJQC 4Q6YA 1NCBH 5ENWB 1I7RA 2HLFC 2X05A 3BYYA 3ARFD 4C83B 3JWDH 2Q6WB 3DVFA 1ZGLB 2MNUA 3VXOB 4KWUA 4Y5YA 2WM0A 2CPCA 4LLDB 4QRQA 3DGGB 1G7HA 4LCUA 2ADGA 3V7AE 4H1LB 3WFHB 2O93L 2Q76B 4ZO9A 5T3ZD 3I6KA 1F5WA 2FEDD 2FBOJ 3SDYL 1FNEB 3PGCA 1KXVC 4LMQI 5MP6L 4NRXB 1JGDB 4Y4FC 1FL5B 3DVNB 5HHVH 3MLVL 1ND0B 3WDIA 2GT9B 1W72H 5DRNB 5J89A 1JWMB 3ZDXF 3B9AA 3IXAB 1HQRA 4P23C 3VFVA 1UACH 2NZ9C 1AO7A 3DRQA 3HG1A 4MNGA 5SV3A 5AWNL 4PV8B 5HSFA 1OARL 1BFVH 3FOLA 5F9WB 5K9QG 2MTPA 3PL6C 1CVSC 3MRNA 3E1F1 1F58L 4JPIB 4NO0A 4OM0L 3X17A 1FYHB 2RCSL 4ONHB 2FEEI 4HEME 1TZIB 3RZCC 4Y16A 2WWKT 1QRND 5JUEL 2BCKB 5FO7B 4JHBA 3FO2A 2IG2H 5B3JF 4XI5D 1Q0YL 3CK0L 5FYKL 4AEFA 5CJ5A 3ZKND 2CJUL 4UT9L 2EYTB 2L0DA 1F4AA 1OGTB 3GMNB 4X9BA 5E1AA 1IGTB 1WWBX 3T2NL 2UZIH 1T3FA 5E6IB 3NZ8A 1LD9B 1P7KA 5INCA 4PRPD 5CIPA 1H3XA 4N5ED 3TBWB 3S96B 2LU3A 4POYA 4NJAH 3NTCH 1NGWA 2J8HA 1IARB 1Q1JL 3PGFL 4RWHA 4UAOC 4HMEA 1A6AA 1ACYH 5IVXB 1WISA 2C3VB 3WCYA 2MMXA 4IOSD 1KEMH 1G7IA 4U7SA 3BKJH 3DO7B 4NQXB 4JREC 5DMYA 4FNLL 3S4SB 2XTJD 2BXZA 3IFLH 4YBLB 4NQDE 3UJIL 1HHKB 3BGFB 1TTGA 5EOCL 4G6FD 2ED8A 5IMLB 3DX6A 4XBPB 2GTWB 1X5GA 2CGRH 3QEQA 4J1UA 5EOQH 1F4WL 4I2XE 2AS5M 2XKUA 1S7QB 4G3YH 5JHLL 1ES0A 4Z7UB 4HIXH 1BX2A 4P2RE 4M48H 2B1HL 3RWFA 1UWGL 4HKXB 5CBEB 3DHMA 2CR3A 4PJBA 1HH6A 3HA0A 3LKOB 4Y4FA 3V0WL 5D93B 3ZDXE 1SY6L 3G5XA 4F7TB 3ZYOA 5E6ZA 2HLAA 1ZTXL 4IRJB 3FHQA 1BMGA 4WDIB 1INEH 8FABB 3MV8B 1VACB 5FUOL 1NC2A 1QHPA 1WEJL 5EZIL 3VXUD 2EDHA 2DICA 4MCZA 4GOSA 1CGSL 2AK1H 2P24B 3C2AL 3LKSA 5EOTB 3JV4B 1S7SB 1K4CA 1MRFL 5L7XH 3HFMH 4PY8J 4KI1A 3PL6A 1SJHA 1UA6L 2LV4A 3KPLB 1PZUB 3TA3B 1TVBB 1MFNA 3HNVH 3SQBA 1HNGA 5B3JE 1QD0A 4TVPE 4HK3J 3UPRA 1AD9A 1NCWL 3G9VA 3O9WB 3ZE2F 3AFLA 1G9MH 3MCLL 2UWEF 1CF8L 5ICYB 3O11B 4EUPH 1C08B 2DD8L 4GFTB 3GKWH 2X4UB 3OB0K 5EBMA 1MI5B 5GGUB 1J05B 1FLTX 5IVZB 3X3GH 1KNOB 4IMLB 2C4FT 1NCDL 2Y4SA 4LSTH 4OZHB 1NEUA 4DQOL 1NAKH 2DQGH 2AGJL 3O3DB 3U2SB 3D69B 1KJMB 3N9GL 4XPHH 3SDXB 5F1OB 1VENA 4P5KA 3BSZL 1YPZF 4ZPTB 4L8SB 1FNFA 2XYCA 5EN2B 4JFFA 3TN0C 1A47A 4XNMB 4Y1AA 1U8PA 5KOMC 4MNQD 5C2UB 5GGTL 2CXKA 1XF5B 5TE7L 3DMMD 2EE2A 4KPHH 3G08A 1YY8A 4J3OC 5J6GA 4MJIE 1BZ9A 4KI5F 4LIQL 5EU7C 1OLLA 4CVXB 3SDCC 2IQ9H 4LCYB 2VN7A 2F74A 3K8MA 4F9PA 1GZPB 5H2BB 4LRNH 2XZQL 1FC1A 3KPQA 4KDVA 2BHUA 2FL5B 3KYMA 3U7WL 2IH3A 1ZANH 4JFQB 4XWOD 1QP1A 4G6AC 1ZLWH 2IMMA 2A9NL 3UJJL 3BP6A 5TQ2L 2BY0A 4Q9QH 5DJ2A 4PJ5E 4X0KB 3DV6B 5DT1L 2WP3O 4XHJD 1A7QH 1JYXA 5LBSH 5FV1L 4O2CB 3RWJB 2VR9A 3P4LA 2ZP0T 4Y4KD 4MJ5A 1OCWH 3QFJD 1NCCH 3S36H 4IJ3B 1I1CA 3ZE2E 5IB1A 5HPMB 2UWEE 2IH1B 5BZWB 2J6EA 1N6VA 3JV6B 1YQVH 4JDVA 5FA3B 1KN2H 2YPLE 1ORQA 3LQZB 4OLXL 4Q74A 1KCSH 3QIUC 1IKFH 2BNUA 2E9WA 3O2VH 4XP6L 2R2EB 1N8ZB 5CINH 3LOWA 4PRHB 5EBLA 3ILPB 1PLGL 4QT5A 2DDQL 4QHLA 5DD1L 5E9DA 2ATPB 3WNOA 5CD3A 1YPZE 4GUPB 3FMGH 5HD8C 3EYOB 3NABH 1VERA 3KPSD 3OR6B 2P7TA 1D5IL 1JPFB 2EH8L 4F15C 1D5MA 3QDJE 5IVOA 4YBHA 4BSJA 1F11A 3EKCA 3FAWA 4ZFOL 5IV2B 3TN0A 3LY6A 1P7HL 1QFOA 2BSSA 5F7KC 2DQUH 1BM3L 1S7RB 3U9UA 1C7SA 4KI5E 3F7PC 4AK1A 2ZUSA 3GMRB 4KJYB 1TVDA 2NX5B 2Z91B 5I1KL 4YHYB 4C4KT 5IG7B 2ZCHL 1KB5H 5I76A 1FIGH 4W81A 4YPGA 3SDCA 3ZT5A 1A3LL 4P48A 5I18H 3U83A 4P49A 4O9HL 3SGDI 3QA3B 1KLUB 4HSQA 1VFBB 3B8YA 1N26A 1RU9L 2W0KA 3KYNB 1WCQA 32C2B 2VXUL 1BEYH 5C6PB 1IMHC 4DEPC 2MCPL 1WT5C 1CYGA 2D0GA 3OGCB 3KPRA 4ODBD 3AS0A 1JYVA 2AEPL 2VAAA 5AYUH 2PKDA 4CUCA 3B2VL 4X4YB 2XIDA 5FYLD 5D6CB 4PJFF 3QCVL 1NLBL 3VH8A 3S37X 4PLKD 2ARJA 3QUXC 5IGXL 4ELKA 5HI3D 3S3SA 1A7OH 1KIPA 2YA2A 2IGFH 5K9KA 4XC1L 4OIIL 4ZUUB 4KK8D 4OZGA 3GGWB 4DVBA 2YXMA 4P5MA 2DYPB 4MAUL 2H6PB 4OCYH 4UIKH 5JQHC 2R69L 2X9WA 4H8WL 3RPKA 4RA0C 2WV3A 5DMKB 3F7VA 4NC1C 1Q9LB 2M8XA 2RCSH 1TJIL 5FDWA 3QIUA 2DQJH 2IC2A 3K3QA 3MODL 4PREB 4JRYE 4AIOA 4F7CA 3CCHB 5JUEH 2F5BL 4CVZA 2VDML 5DFWH 3VGDA 2NY5H 3ARXA 4NHUB 3K1DA 3TBTA 5DVNA 2X1XR 4JFYB 4OB5H 4XVSH 4XZUB 4JAMA 5GS2D 4PR5B 3TZVB 3RBSA 2AXJA 4EZMA 4Q0XL 1BJ1H 3VI4F 3T4YA 5H37G 1WBYB 1DBJL 4K3EL 2OK0L 2ENYA 1MFDH 3VRLF 2KZWA 3TESA 5SV4A 2DQEH 3LKPB 3GNML 1NFDA 1S9KC 3QPXL 1MHHB 2B4CL 2Z31B 5EU6D 1QTYT 2HJFA 1NH6A 1A5FL 2JB5L 3NACL 3AB0B 5E5MA 3PGFH 3DX9A 4U1IB 1FZKA 2P49B 4J8RB 3RWIB 5D1QC 3M17A 5BVJB 1A6ZB 3CFJA 5E2WL 15C8L 2XICA 3TH2T 1DLFH 3HZVB 1XCQA 4W4NA 4PBWD 3WS6C 3TM6A 1BF8A 2YEZB 5TH2B 4KK6D 1F3DH 1KJ2B 2ZNWA 3C87A 2VWEC 3CLFL 5FKAB 4QTHB 2AXGA 5TFSL 3WV0A 2QLVB 5HHXH 1PG7H 3MBEB 1S7XB 1BQLL 2NY1C 3VXRB 5C0FB 3ZHLA 3FQWA 3G5ZA 3KJ6H 1P84J 1R6VA 3GIZH 5M7QA 5AG8A 1HHGA 2V2WB 4WU7B 2DI8A 2P44B 5JHLH 3K2UL 4H25A 4Y5VB 5A2KH 4OCSH 3B6SB 4G9DA 4LLMA 12E8H 2VLKD 2LAGB 4PJFE 4Z5RA 2VLJB 4HF5L 1FHGA 1QLFB 4F3FA 3P4OA 5I9QC 1U91B 3L7FB 3QUXA 1OTSC 4NRYB 4P2QE 3W0WE 4XAWH 1CGSH 5JIKA 2GK2A 5D2LA 1X7QA 4OZ4A 3S37L 5KN5B 3HR6A 5JQ6L 1CFTA 5KVDH 2CRYA 4PB0H 5TGBA 5EU3B 4JY5H 2XQYG 3IJYB 4DN3H 5KBNC 4L3EA 3DXAA 4PUBL 2R2BB 1HH9A 3E3QE 4LNVA 1F6AA 3MCLH 1CF8H 1BFOB 1Y6KR 3AXLB 3VI4E 4GMTL 4HFUH 4ZNCD 1LE9B 1PGRB 4PTTA 5KS9A 4OBSA 1Q9WB 1RJYB 3HRZB 1NJ9B 3IJSB 3FFDA 3VRLE 2QHLA 1I3RA 3KLHC 1OAXH 2NY2B 4QO1A 1C5BL 4I18A 1JFQL 3BPCA 5ECJE 4N8VA 4RNRB 3VWKD 5D7LA 5ID1A 5TDNA 5I15H 4XGZB 4YQXL 1VSCA 5CMAB 3FN0L 1BQHG 4OLEA 3HI6L 2G5BA 1MCRA 3MUGA 4LLWB 2FHBA 5BV7B 4K3HA 2V5RA 2HP4A 1Y0LB 1YNTB 2A0LC 5B21A 2EC9U 4LVEA 2RB8A 2W9DH 2FJGA 4N8PA 4HWEL 3JV0A 4IHOA 2PXYB 1YMME 4QY8B 4PGDB 1ADQL 3WS6A 5AZ2H 4B0MM 1I1YB 2PTTA 3FFCB 2GJ6D 5L9DH 1D9KD 3H9YA 5DJZB 3QZWG 4HC1A 4ZTOH 4X98B 4DKFL 1NEZB 5JLZA 2W1NA 1WK0A 2R1WB 1CDJA 2R0WH 5D4QA 1GAFH 4PY7A 2P47B 5HDQH 2BC4A 2CUMA 2ZNXA 4DKEH 2DQFA 3NCJH 2CK0L 5ANME 1I7UB 4WFGD 5CJQH 2DMKA 3V8OA 4LARL 2Y36L 2UYLB 4GKOA 4IOFD 1MJUL 1A9BB 4WHTA 4DZ8B 2O61A 1T20A 1Q72H 3KPTA 3RVXD 1T04A 3I3DA 4XPAL 4ISVB 2IAMA 4RISL 1C12B 4X6FB 1XZ0A 3MO1B 3MNWB 1F90H 3MMEA 1R3IH 3BE1L 4FQIL 3SY0B 1YUHB 2R4RL 4HT1L 3GSNH 5DJ6B 3WBDA 4K94H 1L0QA 2K9UA 1ORSA 3FCTB 5KTEL 4IRSC 4D8PB 4KQ3L 1PAMA 3WFDL 4U1JB 2P42B 3BPNB 1P69B 1LEGB 4NO5A 4JHWH 1CG9A 2JCCF 3HUJF 5I16A 4U05A 3KPMB 4I9WE 2V2XA 4OGYH 5GS1C 3VRIA 3VDCA 2BOCB 4JFEE 2AJVL 9CGTA 4OKVA 3CDCA 2HWZH 2EO1A 5E4IA 3NZHL 4HXAH 2K1MA 2V5TA 1CE6A 4FQ1H 2EDJA 1F97A 4L4VE 4PRNA 5EG6C 3FJTA 3RNKA 1QVOB 4ZPVA 3IDGA 3GHEH 1YJDL 4UOJA 5DD0L 5C7XL 2FHFA 4XPBH 3I84A 4R4NC 5TE4L 3TBSB 2WQ8A 4M1GH 4WY7H 1P84K 4BSVA 3PV6A 4GXVL 1HCFX 1RUQL 3ET9F 1B4RA 1CLZL 3DIFB 1OTUD 4HPYL 5I17A 4KZDL 2AP2A 4M4RA 5JIHA 4KJWC 4N0RA 1IQWH 3MUZ1 5FYKD 3RUGF 3OWEA 5IMMA 2XA8H 1S5IL 5HYSG 5LXGL 3ZTNL 4HH9B 4F37F 3JUYA 2Q7NA 2FX9L 3PQYA 4JQVC 3D2UB 3TGXA 3KHOA 1CFBA 4XMKL 5FIEA 4HKZA 1Z6JT 2EC8A 3SO3B 2ADIA 3B9DA 1EAJA 4NUGL 1BOYA 5SWSB 3O3BB 5DJXB 1NPUA 5HI4D 2NMSA 2CIKA 5D2NE 5BS0E 1D5ZA 1FC2D 1HDMB 1GL4B 3G6JB 2V6HA 3HAEG 4HMCA 5ESQB 1QA9B 3SDAB 2H9GA 1FRGH 1MF2L 4IS6A 1RHHA 2E9JA 3QUYB 3RL2A 4UT7L 3VFWA 2AEPH 4RFOL 4NM8H 1NKOA 5EIIB 3KVQA 1H3PH 4YXKH 3U1SH 3LN9A 1O7SA 3QCVH 3SDDA 3OKOA 4FFWD 5IGXH 5L88H 3A6OA 1BQUA 1E28B 5FO8A 5B8CB 3BZFB 3QCTL 2JIXB 3QRFM 4FQXC 4OIIH 5TF0A 4EN3C 5C09A 4JFDA 3CFDB 2JCCE 3HUJE 4OQTA 5D1XC 5MERA 2N7AA 4O4YL 3KR3L 5I30H 3QH3B 1J5OL 1SBSL 1PZ5A 2IQAB 1LEKA 2AEQL 4C56E 2BSED 3X12B 4Q6IB 1AFVL 4AQOA 3MODH 2XFXB 3CIQA 4XP9H 1U93B 2XTLA 3OHXA 2VDMH 5L2JA 5MHSE 1UJ3B 1H5BB 3C08L 2BDNH 3ROOA 1S7UA 4WCYL 4C57C 3L3HB 4TVPH 1YMHA 3WL9A 3RUGE 5LGJB 4GO6B 4JFXA 4MJ6B 4YR6B 1AXSB 4LHUA 5GJSH 1RZ7H 1NFIA 2E6JA 4YPJA 3B3IB 5FV2A 3SCMB 3R0MA 3V8CA 2VIRA 3RDTB 1F3RB 3B9KB 3MCKA 4I5BB 4FFVD 1JL8A 5JO5B 1YEKL 1A5FH 3MUHL 4EDXB 3FO0L 5BV7L 4BKLB 3MA9H 3PGDA 4EDWL 3VWJB 1MLBA 1J87A 3VCLA 4JQVA 4LBEA 1A3QA 4H26A 2HT2C 1HHIA 3QUZC 1V7NL 2OL3A 3GRWH 1KXQE 2XNAB 1ZHBA 2CUIA 2Q7YB 4Y4HD 4AM0B 4XXDB 1A1NA 5C08A 3CZFB 4JZJB 1XIWB 3TT3L 3ARBC 1WC7A 1BQLH 2WIIA 4HXBH 5DDHA 5IT2L 1HSAB 4GG6F 1NCNA 5ILTL 1RZKL 3VXMB 4K9EH 1ZA3A 2L7UA 1WWAX 1NSNL 4LVNB 3LN4A 3R1GL 1PEWA 3WHXA 5I8EB 2H45A 2BXYA 3DI2B 2W60A 3BKCH 4BFIA 4OCRL 4YHOL 1KC5H 3QI9B 2GJJA 3VJ6A 5DJDA 2QQLL 2V17L 5HDLA 5E8PA 4HUUB 1KB5B 4OFVA 4QXUH 4BH7B 4FQXA 2CQVA 5GRYA 2FEDC 4O00A 3X14B 3W9EB 5EC1B 5D1XA 2BVYA 3IXTA 3REVA 2ZCLL 1BVLA 4JCLA 4E0RA 3GDBA 5F9JB 4JRWA 1K6QL 3UBXA 4R7DB 1U8IA 1MEXL 2C1PA 4PG9B 2VL4A 3IDNB 5FF6B 4B7LA 5L2KE 5FYJU 4D9LH 3L95A 3WEXB 4AEIL 2ICWJ 4KHXL 4KKCD 3F6IA 1HOCB 4ZO7A 1N4XL 4XAKE 3MC0A 3WO3B 2CD0A 2YOCA 2CLVA 4X5XB 5LJYH 3IRPX 3QDHA 1OP3K 3DBXA 4BK4A 4L9DA 3CVHA 3FQTB 3RFZC 4K07A 2NY3D 2ZOLB 2ZSWB 3LDBC 4MMXC 3RIAK 1NANH 1CFSA 1C5BH 1FYTA 3LN5B 3CUPB 3CVIL 1JFQH 4L5FL 2FJHB 4Z76A 1OHQA 1MPAH 3O4LB 5BJTA 1UM4L 2HN7A 5CJOL 2KPNA 3EFFA 4DGIL 4CKVX 4XI5C 1G9NH 5DA0B 5JW3L 1MFBL 3ZKNC 1JHTB 3FO9A 2RIKA 3D5OF 3HE6B 3NAAL 2NCMA 4FTVE 4KUZL 4HPOL 2Q86B 2FGZA 1U92B 2PW1B 4RFEA 4U1HB 3QNYB 2YN5A 4PJCA 4JM2F 3QXVA 1GGBH 3RL1A 1P4LA 2XN9A 1UGNA 1ZGLM 3QUZA 1XF2A 2XWTA 2VKWA 3GKZA 1NAMB 4X5WB 5DQDH 1QO3A 4GG6E 3QEUA 3HI5L 2BFVH 2QSCL 2ATKA 3TF7C 1A1MB 3DX8A 1M7IB 3BWAA 5LCVH 5JDJA 1B0RB 1DVFB 4UIMB 2KKQA 3NFPA 1A2YA 2ZOKB 3GBNH 2XTJC 3QQ3A 3C09C 4X99B 1ZEAH 3WIHL 4PJ9B 5IEHB 1F00I 3P0VH 4FABL 2HFFA 1EO8H 4HG4J 1AIFA 5CLWA 4XPAH 3EJJX 3RTQB 2E27L 3LQAL 4KK5D 3M07A 1B6DA 2R39A 2R4RH 4HT1H 3U48A 3VG0L 2P8MB 2R4SL 1FVDB 3TH4T 1BHGA 1S9XB 1J1XL 1FGNL 2I07A 4G8FB 4URTB 2K7QA 4NQDD 4QHMA 5T3XE 3TCLB 1NKRA 3EOTL 3WFDH 3VFGH 4HIEB 2Z35A 1FSKB 4LSSL 3SOBH 5CEYB 1LHZA 4PJBF 3F62A 3VMPA 1MJ8L 1KPRB 4HUWB 4QXTA 3STZB 4ACPA 3ZHDA 1XR8A 4BFEA 3R4DA 5C8JB 1AO7E 3HG1E 4P2RD 2Y1VA 1FG2A 1IGML 2OS7A 5C9JB 1VB9A 5AAWA 1CXLA 2B8OT 3TVMC 4NQUA 3DYMA 2AV7A 3UTSE 2DQCH 3TA3D 1MCDA 2AJSL 3VXNA 5I1EL 4X8JB 4WV1C 3BQUB 1BVZA 2ZUXA 1GPOL 4XNUH 5LGHL 3BWUC 4ZS6D 3O9WD 4MNGB 4P4RA 1EHNA 1MUJB 3C5ZC 1IC5H 1F4HA 3WXVL 4RCAA 4XCCH 4YHIA 3U4EB 1XH3B 3AU1B 1ZT1A 1N2RA 3Q6GL 5GRVL 1N6UA 1PKQB 4QRRA 3W9DA 1DQML 5IJVA 4QNPF 5B39A 3ARDD 4PRPA 4OZIF 3QJFB 3FT2B 5DZLA 4HEPG 1FLRH 3W2DH 4R9HA 1NMAH 4Q97A 4MDJB 5CHNA 4QOKB 1MCPH 2R56H 1FPTH 4NUGH 3O8XC 1EMTL 4TTGA 3DMMC 3IDIA 3GSUA 5DRXB 5D72L 4JFPB 4PTUA 2NW2A 4UDUA 2QL1A 2V5SA 5T5FH 4A2MA 3FZUD 3SJVA 3IF1B 3OJDA 4HIHB 1ZT7B 4ZFFA 2IALB 3I6GB 5D70L 5KSBB 5DUBB 1UB5B 1INDL 1G6RB 3QEQE 3VA6A 2QQKH 4OLYH 5DF0A 1SHMA 1S3KH 4L1HA 3EYFB 3MPCA 1K4DB 5DHVA 4XWOC 5I8KL 4YHZH 2DBLH 4O4YH 3WNLA 3L6FB 5I1IL 4PJBE 4HJGB 2Y06H 1S9YA 4P4KA 1AGEA 4F58L 2E8YA 3EFDL 3EO9L 3OKMA 1M7XA 4XHJC 3H8NA 3VG9C 1IM3B 3NA9H 5KG9B 1EO7A 3QEGH 2IFFH 4P3CL 4Y4KC 4CADA 3GBMH 1B88A 5L8JB 1T1ZB 3MGTA 3EDDA 3FB5A 3EW3B 1I3UA 2HVJA 3TVMA 1U8MA 1EFXD 4D0DB 1OAYH 1LO3L 4WCYH 3CSYA 8CGTA 5ETUB 2PO6D 3TV3L 2NLJB 3DX7A 1FFOA 4I0PD 3CNKA 4K7FB 4F9LA 4YDLB 3C5ZA 3HRPA 1U8JA 1YN6B 1Z0NA 3DTXB 4QNPE 5IHUL 4M5ZH 4GRLB 4PRBA 4HG4K 4NNYA 5E0QA 2WWMD 4TVSa 4OZIE 4Y2DD 1T7ZA 3PWVB 4N0CD 3MLYL 2G60L 2EYSB 4IBLT 2D7OA 2VABA 2DLFH 1YECL 3T0ED 1IQDB 3I3EA 1V7NH 2YPLD 4LLQB 3IKKA 3PG2A 5GGRY 5IWLC 4OD2A 1R5WB 3ARYA 5KVMC 1NAML 1JN6A 1OQXA 3O8XA 3U79A 5A16B 4HUKB 4JFZL 3HZYA 2APBA 3QDGB 4JFFE 3DMMA 1KN4L 4BH8A 1UWXH 3OKKA 2R23B 5JW5A 3UJTL 4LLVB 3D0VB 1TNNA 2NX5D 5H37H 3QXTA 5DK3A 1KACB 3V6BR 3GSQA 2UUDH 5HVWA 1T1YB 1PFCA 3I50H 4YIQA 4Y1AB 3WUWA 1U8PB 4MLSA 4DUXA 1H9VA 1RQ5A 5HVGB 5ADPL 1HQ4B 1AE6L 1X4ZA 4KROB 1ZA6A 4UQ2A 1A6VH 1W8OA 1GIGH 3IFNL 4ZD3H 1JRHL 4O2EA 1M05A 3P30L 2EE3A 4PRIB 3M1BA 1OAKL 2NPLX 5DD3H 1EGJH 4PLKC 3BZ4B 1FNGB 4FQPA 1CD8A 5EBWB 5HI3C 3VFOA 4KU1A 1N3NB 1PX3A 2ICWA 1Z9OA 4I3SL 1HI6A 4AEHL 4UNTA 3RWHB 1AKJD 1K8DA 4RRPA 4KK8C 4QRSB 4HWBL 4OFPA 3QFJA 5T1KD 3HC0B 2V9RA 4K3JL 4XTRD 1H3TA 2HAZA 4R90L 5E8DL 4FZEL 1GC1L 5IMOB 3FQXA 2FYYA 4I2XB 1AH1A 4NZTL 1CK0L 3TCXA 4OZGF 3CVIH 3LZFL 3HC4L 1IGCH 4GG8B 1CT8A 4G8IA 4K8RL 5F3HB 1QKZH 1UM4H 5CJOH 3OAZK 3BW9A 4I4WA 4GRWF 4MWFA 4NQVA 4X6CA 2YSSA 1MWAA 4Y5XB 1U8NA 1RV6X 3BN9D 3LD8C 1DUZA 4U1GB 1NGQL 4XNQB 3BH8B 2D7TL 3W5NA 5E9DE 4NQEA 4OCWH 1JK8B 4HKJB 3KJ4B 4FXLA 5HYJA 1OD9A 3MV7B 3GSWA 1EBAA 1SJVA 2ED7A 4Z95L 3KPSA 2DIJA 5I1GH 3MJ9L 4JRYD 4YFLF 5SWZA 3X3FL 1QNZL 3DURA 4MQ7A 3TYFA 3BMVA 1F4XH 4WW1B 2OTUB 1RZJC 4XPTL 3H9HA 1U8HB 3NA4A 5AUMA 3O0RL 1NFDF 2G9HA 1XGUA 5CD3B 1A9EB 1DP0A 4HIJB 5J7CC 1URLA 5BZDA 2AJYH 4KK6C 2JF1A 3D85B 5C0EA 1MCOL 4XBGB 2X1OA 5EU7E 1EEZA 3O3UN 2E27H 1V7MH 3BEWB 4AH2B 5E8OA 2LTQB 4ZFGH 1E27A 4WI9A 2BSRB 4ZXBB 5HGHA 1DFBH 3VG0H 3MBED 2APTA 3FQNA 4BA8A 5HHME 2RBLA 5IB4A 1G6RL 3VRJB 3ARGB 1OPGH 5E94B 1IZJA 1KPUA 3EOYG 3Q1SL 1JRHI 2ARWA 3K81A 3U46B 3PWJA 4UBDD 2H2SD 4WUUA 1GGYA 3KPRE 5EH1A 5EOCJ 1I9EA 5CP7B 2OR9L 4M93C 4YDJB 5I1LA 2VL5B