4JR9H

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
213
Chain Sequence
QIQLVQSGPGLKKPGQTVKISCKASGYSFTDYGMNWVKQAPGKGLEWMGWINTSNGYTTYGAAFKGRFSFSVDNSASTAYLQLSNLKTADTAVYFCARSWYNRAMDYWGQGTSVTVSSAKTTAPSVYPLAPVTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite extrusion protein 1
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/immune system
total genus 38
structure length 213
sequence length 217
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H02
3TA3B 3VE0B 1VKXA 5J56B 1MCPH 3JWOH 3H42L 2BRQA 1SBSH 1QLFA 1U8PB 4PRDA 4Y2DA 4KI1A 2ZOLA 4KUCD 3OPZL 3QI9C 3QDMD 4DN3L 3OSKA 4GRWB 4KMTL 1MFCH 3BPCB 3T0VA 5FO9A 5BQ7B 1EJOH 4Z7QF 1FFOB 1HHJA 2BP3A 2YC1B 4JY5L 3ARDC 2XWTA 4CN1A 3CH1A 5C08D 3OKNB 4PRHE 2ZUYA 1VERA 3G6JA 5F7EL 5IB2B 2HKFH 2PXYB 2QQNH 3WNLA 3IDYB 1Y18B 4G6KH 1QKZH 5GS3A 1IEBA 2VQ1B 5C07B 1TZGL 4FQHA 3VFWB 2PTVA 1HHHA 4F37K 3FZUC 1FE8H 1AH1A 4BZ1L 2DYPB 3GMRA 2VAJA 3KXFE 1S5IH 3ARBD 1TJIH 3K74B 1PQZA 2Z92A 2KDGA 3OKOA 4WHCA 4CAGA 1NEZA 4WUUE 2I60L 5E2VH 5FDWB 2VLRD 4Z76B 2YPKA 3S3SA 3BIAX 1UZ6F 1ACYH 2WQ8A 4NQED 4FFWD 3A6OA 1QFUH 2LTQB 4K3DL 4P4KC 4HV8B 1MJ7H 5DK2B 3L3GB 4CW1B 4HWZA 3Q6FA 4U7MA 1I9IL 2GAZA 5CZXC 3OJMB 1BFOB 3QEGH 5IW1A 1N6QL 2VLRA 3SY0A 1SHMA 3I50H 3O2VH 4PJ8B 4PG2C 4X98A 2IALA 5DJ8B 1NKRA 1A0QH 1E4KC 3STZB 3MOAL 3H0TA 3QNZB 4DQOH 2AJZB 1G9NC 1OGTB 3Q6GL 5BS0E 3QYCA 1MFEH 3ULSB 4HC1L 1Z5LB 3RA7L 1PY9A 1YDPB 2R39A 5DS8B 5EU7E 2QHRH 2YEZB 3HE6B 4L8BB 3LCYA 3A6BL 5MENE 4YR6B 3EYOA 3KWWB 2CR3A 1KXTB 4XXCA 1S9XA 4N9OB 1ZKAA 3OX8A 2L4OA 3N50A 4Z7WF 2UZXB 5FA4A 4LHUB 1LEIB 5CWSA 2BNRA 3MNVB 5EULV 4P4RB 1YNTB 3IF1B 1IGMH 4WV1A 3W9EB 3LKQB 2OR9H 2ID5A 5B3JE 4NO3B 3RY5A 2QHLA 2CMRL 2GCYB 2L7JA 4GXVH 5F44A 1EEZB 3PJSB 4K3HA 5E2WH 4OQTL 3DX8B 4WRLA 4LVOB 1NCNA 3S36H 4G8EB 2ORBL 4HXAL 3ME0A 1JRHL 4N0CD 3HPJA 5CEXA 4MYWB 4YWGL 2VDMH 5FDYA 1V7MH 3RVUC 1RZJC 3T0BA 4PJ9C 1DLHA 3D1MC 4JVPA 3PWVA 1A02N 3VFVA 5DUBB 1G9ML 5EBWA 3RVVD 1JPSL 3FFCA 4OLWL 4NT6B 3ZT5A 2BRRH 5I73B 2Q8BL 2F5BH 3R8QA 3X14A 2MTPA 5DDHA 4KHXH 1EBPA 4P4KA 1FO0B 1HH9B 4NZUL 1BD2E 4L9LA 1YEGL 3QNXA 1FFQA 1KPRB 3HN3A 2VLMD 4I18B 4ZD3L 5SWZE 3SGJA 4TVPD 2Y07L 5DEGA 2AVGA 3SE4A 2D0HA 4HUXB 4PG2A 1OSPL 3C2AL 3QUYB 4IRZH 5ID1B 4RMUA 3VH8B 4XP5H 4PJDF 3FFDA 1NC2B 4GG6E 5GS0C 2EDNA 2BSED 3VGGA 1HINL 1XF5A 5T5NG 4ZFGL 1DDHB 5CUSL 3BQUC 1OAUL 3QXDB 3T3PE 1MLCA 2C3HA 3BKYL 1LHZA 1OPGH 4NFBA 3GSRA 1U9KA 4WGVB 1BGXL 3PIQB 1TFHA 4HWNA 5EUOE 1C5DB 1OQXA 3TFKC 3SDCD 1H3XA 2LABA 3SQOL 4WEUD 1A5FH 3WIHL 1BEYL 4UDTA 15C8L 3ESVF 1LNUB 1FO0L 3U4BL 1OF2A 3IFLL 4P9ML 2IADA 3B2VL 1GCFA 4P3CH 4ODVL 4HKBB 5EN2A 2R0ZL 1S3KL 3SBWC 5EWIL 3V52L 5F7KC 2IWGA 1ZLSL 3SDCA 4BH7A 3AXLB 4NQDE 2VZOA 1T0NA 1HHIB 4OUUA 3S34L 2D31A 5EO1B 3SKOB 4GMTL 5BZDA 2Z93B 4PGJA 3HHRB 4QXTA 1IGYB 1INEL 3BN9C 4HGWA 5FOBB 4NHCL 1JZ6A 1UXWB 3IDUA 4LSSL 3ULVL 3FRUB 4XP6H 3RWJA 1BQSA 2G9HA 4NYLB 4OBRA 2YRZA 4YUEL 3P4NA 1IZJA 3IU4L 4GW4B 3PWPD 2N1KA 4YPJA 4TOYL 2XKNA 1S9KC 2C1OB 4MAYD 4LPCA 4V1DE 25C8H 3OKKA 2P7TA 1FG9C 1DBJH 2OXGA 4E41A 5EZIL 4X7FC 2HVJB 1BJMA 1RUPH 4F7PA 3OR7B 3LKRB 1DL7H 1S7UB 1SMAA 4KROB 1DBKL 3WL9B 1Y6MR 2QR0B 2JELH 4QGYA 2HLFC 1A2YA 4K7PY 5HPMA 4HUWB 1QR1A 3TPUA 4MAYA 4FQIH 4O02H 12E8L 3M1BA 1A7RL 4LLUA 2B4CH 1ZA3A 1XIWB 4NZDA 1IBGH 2GJ6D 3BQUA 4QYOB 2ADIA 4Q6IA 5FYKH 3U2SA 1R3JA 5IB3A 5GSVA 1F3JB 4AEEA 2BC4A 1JUFB 3PWUA 5DFVC 1J11A 5FHBH 4EIGB 1PYWA 5EU3B 3D48R 4JCMA 2CRYA 3MFFA 1JIBA 4NQTA 3TT3L 4O58H 2GTWB 3TC9A 2NXZB 4TUJA 4Z95L 4ONFH 5T1DH 4S1SH 3HAEB 2BNQD 1FC2D 1EO8L 2P5EB 1BP3B 5E8NB 5E0QA 3GHBL 3BD5A 5ESAA 4M8QB 4XPGL 3QQ9C 1I8KA 2AGJH 1Q9WA 3PGCA 3GGWB 2B0SL 3SBWA 1ZT7B 1RZFL 4WO4C 1RUQH 1XGYL 5DURB 4WI2A 3T3MF 5L0QB 2AEPL 3CFDA 4FZEL 1IGJB 3VGAB 4EUPH 2JK5A 1AKJD 4UINH 4U3CA 2VLJE 4ONHA 1X3DA 3QRFM 3MA9H 1U6AH 3TBTB 2G2RA 3ROLB 1D5IL 3GJEB 4HUNB 1S7XB 2AJVL 5JHDE 2WP3O 4L8DA 5J12B 3BEVB 2WANA 3SN6N 1N4XL 4PV9A 3WDJA 5I8KH 1FIGL 2WBKA 4LPXA 3HUJB 3ETBF 3F58H 5IEKA 3FQXA 1Q0YL 2AQ2A 2E6QA 5EO0B 1NMCB 1UYWH 2R0LL 1HHKB 2FRGP 2VDQL 4RFEA 3MRGB 2IFGA 4J3VA 5GHWL 3CX5K 5DUPH 3TP4A 1PG7H 1EZVX 3G04A 2F54E 2JTDA 2QKIB 3L3HA 2A9NH 3D87B 1VFBA 5DRXB 1JF5A 3RJQB 5JORB 4HD9A 2ILLA 2R1YB 4CMHC 3UEZA 1KCLA 4YDJB 3AU1A 3OAYH 4NNXA 3D39E 5IFJB 2A73B 2ZCLH 1UWEH 4NRZB 3W2DL 4PG9A 2FIKB 5TF0A 1T83A 2YPLB 3E6HB 5D7SL 2YN3A 4MS8C 5AWNL 4Z7NF 5IQ7H 3BH8A 3LQAL 4IRJC 3BGFC 4LSRL 1MIML 3MMEA 1VPOH 5LXGL 3OR6B 1QSED 1TZHB 3RWGA 3NFPB 1QVOA 4U1IB 5HYJD 5DHYA 4APQA 5GJSL 1Q94A 1L9MA 4YFEA 2FCBA 4HGMA 2H32A 3L5XL 1FAIL 4JVUA 3WS6C 4G7YL 1QRNE 1HHGA 5ICYA 4WFFE 4KZDL 3GRWA 1IAIL 1GGCL 2X89D 2DTMH 2X4SB 5INDB 4HSQA 3MCLL 4YDVA 3HKFA 3NMEA 2ICWB 5E2TH 2XN9D 3PP4H 3RI5K 3SO5A 2F5AH 4WO4A 4EI5B 5E6ID 2FIRT 5ANMA 1MCSA 3IGAA 4U1SB 3KPSB 1EEYA 1MQ8A 2ERJB 2Y72A 1BOGB 4BZ2L 1ETZA 4PJ7E 3CFEA 3EJYD 1KJ2B 2WLZA 5DRWB 1UH4A 2IAMA 1QQDB 5E4EB 1DBMH 3BKMH 3RX5A 4UOJA 4JO2L 4M4RA 4G7VH 4X99A 4OFIA 1SVCP 2VITA 5DJAA 3VFPB 3GIVB 1NPUA 4XXDA 1Q8MA 1NJ9B 4XPFL 3VRLE 1UQSB 2A77H 5ECJE 3G6AA 3F12A 1YA5A 4PGEB 2HT4C 4KUZL 2D7TL 2WWMD 4WW2F 3BIKA 4MQXC 4ORZC 1GHFL 4YX2L 1CE6B 4XI5D 1J1OL 3QIUB 3LIZH 5L2KE 3L3JB 3C8HA 3M17A 3RAJH 1WBZA 4G3YH 2F53E 2PW1A 1ZVSB 3RU8L 4HUKB 4WEBL 5TDNA 2BY1A 4X6DF 4MX7B 4YHYC 2XA3A 1SEBA 4MJIE 1CG9A 2A2QT 1KJ2L 1OARH 1LO4L 4D0DB 4ZS7H 1Y6KR 3WNPA 3QAZC 3KXFB 5C0IB 4GT7A 5LWYH 1AFVL 3UCRA 5GRVL 2Z31D 3VXTB 5DGRA 5ALBL 5DD3L 1O5DT 4LF3A 4BQ9A 4HT1H 2BY0A 1D9KC 4WUUB 5FYLD 1EVUA 3NPSC 1AGEB 2R2EB 3MRFB 2XOTA 1R5IA 2CDFB 4Z5RA 2AI0H 1BJ1H 4HS3A 5GGRY 3WO4C 5CJBA 2OS7A 4NKOA 2WZPD 3IFNL 4QT5B 2BNUA 3CGTA 3S96A 3CVHA 4X7SL 5MI0B 4Z7OF 3ZE1F 5HYSB 3G5ZA 4LBEA 4PB0H 4GAYB 3SDAB 4ZTOH 5B39B 1F4XL 2OTUA 1S9WA 4MAUL 4NGHH 1J87A 4RGND 5FUZH 1KN2H 5AEAA 4K8RD 4Y5YC 5IESH 5JPNA 4OZ4B 5FOJA 3H7LA 4GRLB 5H35A 2P24A 1CLOL 5D1ZC 3RPIB 3MV9E 1RSFA 3EGSB 5LGHH 5C92A 4O2FB 4UTAH 4HG4J 5HVHC 4QXUH 5EORH 4N8VA 4FS0A 4Y1AD 1H8SA 4XCYB 5GISL 1N5AA 3BDBA 3BKJL 1QHPA 1NGQL 1LE5A 3DX9A 3L5WB 2JJWA 4I3RH 5MENB 3VXRE 5DYOA 5ITBH 1VACA 2ZJSH 3TCLA 1EO7A 3QUMH 4YDKL 1MHEB 2ARJQ 2NMSA 5EC1B 3TA3C 2CDGA 3NCEB 2A6KA 1JTOA 1HXMB 1CLZH 3GMNB 4LCWB 1JN6B 3TV3L 1MQKH 3K3QA 4H8WC 3MBEB 4X4XB 1MEXH 5D6DC 4IMLA 2O61B 2V5RA 4JJ5A 4Y4HC 5TE4H 1CD8A 4Q9QL 3LDBB 4I48B 3H3KA 2W0FB 5K33A 3TO4B 1TQCC 1IC7H 4P57B 1MCCA 2YUWA 5IWLC 1G7LB 5DQJB 2VOTA 1NGPL 1EK3A 5C8JA 3V5HA 3BO8A 3S4SG 1U2HA 1KCVL 2E7CA 1NC4B 4JB9H 3BPNB 2DQJH 4C83B 4ETQB 2R69L 2IANE 1OGAB 1D9KA 3C9NB 4ORGA 4KQ3L 5CSBA 4XBPA 5DFWH 5I1KL 1TVHA 3W5MA 2GK0A 4ELME 2DQEH 4MNGA 1VADB 3KHQA 4YPGB 3PL6D 1K4CB 1AQKL 1EFXD 3QUXB 5F9JA 4PY8I 3MNZB 1RIHL 3ZKMC 3QEHB 5SWZB 5T33H 1JGEB 2CH8A 4NQSB 4EN3D 5I15L 4Y5YA 1UJTA 1UZ8A 1P4LB 3GI9H 5FM5M 4WW2A 4R4FL 4IOIB 5D1ZA 4PUBH 1T0MA 4M00A 3BGAA 3EOBA 4JFXB 3R8BB 3VMPA 4YGAB 2VWEC 4Y88A 5AZ2H 3GMQA 5DJDA 2XWJB 1RAMA 4PREA 1I3VA 3HZMA 3KYNB 4JZNA 1JF6A 3P9LA 5JMOC 1OAKL 4P3DA 4M9OA 2YA0A 1YJDL 5MERB 5DI8B 1GIGH 1F97A 3QJHA 4F15C 4MHHI 3TA3A 4JG0H 3VE0A 5HDOA 1FG2B 4QHUB 2W60B 2ZP0T 5HD8C 4Y19D 3CLFL 1A4JB 4FA8A 1IKFL 2AJYH 2VXTL 1U8PA 1ZVHA 3HE6C 4CU8A 5DO2D 2VWEE 2Q76B 2F8VA 4OGAD 2XKUA 2CJUL 3CU1A 2WW8A 1MCWW 2PXYD 4G5ZL 1BIIB 1UWGL 2FX7H 4J3UA 5J0BA 3SJVE 3BPCA 5IWLA 5BQ7A 3FRPG 4R0LC 1FFOA 4PRPE 4OZFH 2A9MH 4XNXL 3D85D 5CJ5A 5J3HC 2P8PB 4JREB 2ZUVA 5D2NE 5EIIB 3HZVB 1NMAH 3STLB 3RWFB 3S5LG 3OKNA 1TDQA 2Q8AH 1KULA 5IB2A 2XTJE 2PXYA 1Y18A 5C07A 2VQ1A 3IB4A 4HC1A 3VFWA 1KENH 3B5GA 5HHOD 1QFWL 4LVOC 1A3RL 1QP1A 2DYPA 1J8HB 2KL6A 4LPVA 3U48A 1QLEL 3KYOB 5T5NF 4DOHE 2I07B 1Q0XL 1MVUA 2R0KL 4KV5E 4V1DB 1ZLWK 2KPNA 2EDBA 1HYRC 5DZNA 3VXUE 1V7NH 3P73B 3Q2CA 2H2SD 4IS6A 3HC0B 4Q58C 5GRUL 5FDWA 4Z76A 3VI3E 4KDTC 4PJ8D 5I73C 3BJ91 3D6GA 4AIXA 3HZKB 4JHAL 1BWWA 3DURB 5MEPB 4PJXE 4HV8A 5DK2A 5IB4B 3L3GA 4CW1A 2NY4B 2WBWB 3PHSA 5I1IH 5T1MB 1H3GA 2FGZA 2C4FT 2EYSB 3HRPA 1BFOA 1HYSD 4MB4A 2OM5A 1EV2E 4OQTA 2O5YH 4M6MH 4PJ8A 4KY1L 7CGTA 5DJ8A 5JXAL 1S9VB 5CCKH 2OYPA 5D70H 3STZA 5F3BB 3QNZA 4XPHH 2AJZA 1OGTA 5L7XL 2IFFH 4ZFOL 1CD9B 2B2XL 5E5UB 1R5VB 1Z5LA 4H1LG 1NAML 3EOTL 3MLZH 4YBHA 4R9HA 1YDPA 1GPOH 1S7SB 3ULVC 5DS8A 3HE6A 4L8BA 5HHNB 4YR6A 3KWWA 3RKDC 4G6FD 4HAGA 1I3GH 3QRGL 1D6VL 4D9RD 3KPRB 4LAQL 4TSAL 4LHUA 1LEIA 3MNVA 4QXGL 2E8ZA 4P4RA 4XWGL 1YNTA 3IF1A 1T22B 1RUKL 3MYZA 2OK0H 3ARWA 4PBVC 3W9EA 3T77B 1BMGA 3I2CL 1YNKL 4NO3A 3KLHC 2GCYA 2DD8H 4EIZC 1VENA 3BISA 3LOWA 1EEZA 1NGZB 3PJSA 1AIFB 5I16B 4X8XA 1XZ0B 1X5FA 3L3IB 1IM3B 3DX8A 1MIEL 4L4VB 1F4WL 5LQBL 1DQQB 1INDH 2CDEB 4G8EA 4CBPA 4MVBD 3SCMC 4RBPH 3EYVB 1H3TA 5IIEB 4RZCB 4HQQL 5LAXB 1AJ7H 2HG5B 3IDNB 4G9FE 4YC2B 1OTSC 1K3IA 3KYMB 5GRJH 4YHLL 1QNZH 4JM2C 1KGCE 5DUBA 4TNWF 5BCAA 4JFQB 3L5JA 2CIKB 1E6OL 4J6RL 4NT6A 5ID0B 3TO2B 3ZTJH 3QO1B 3WIHA 4FQJL 4J4PC 2EIBA 1A6WH 1FO0A 1HH9A 2DWEB 2RBLA 3D3VB 3QR2A 5CIPB 3D39B 4POZD 1KPRA 1H5BB 3CAFA 4M7KH 2P44B 4N1HB 5C7XH 3FAWA 2X4NB 4MNQE 4XMPL 4ODHH 4I18A 3UYRL 4OZGF 5MHSE 1OLLA 4Y0GA 4YH6A 4HUXA 5D7IE 2RCSH 1CGXA 3QUYA 2YWYA 4KROC 5ID1A 5JIKA 2P47B 3VH8A 1FFRA 1LP9B 3ARPA 4JRYE 1E4XL 5F7LB 5HI3C 3UDWC 4X7DC 1JMZA 5LKNA 4MA8L 5HVGB 2VKXA 5E2UH 1XIWC 1DDHA 1QRNB 4AK1A 2C1PB 1JPTH 1MCRA 5AD0A 4JRXE 4M43H 3QXDA 4LKXB 3QXVA 4POYA 3IYLW 4DW2L 1TJGL 3DETD 2HFFB 1I9JL 3PIQA 3QIBD 4Y16D 5CBEB 1C5DA 2F9BT 4IRSD 4NC1E 4GAFB 4RISL 3QDJB 3LEVH 4Z7VF 1HZHL 1JV5B 4HWUA 5E99L 1JFQL 4K94L 4HJGB 1U95B 3QXAB 3DJ9A 4PJ7B 5DD0H 3RTQB 5T3ZL 1LNUA 4AEHL 1BZQK 5C0NC 4IMKC 5HDBF 1AO7B 1EA9C 4HKBA 5HY9B 4JFDE 4XP9H 2WUCH 3ZE0F 4YDIH 3HNTH 3JSSA 2EC8A 1Y0LB 4NZTH 5L0QC 1HHIA 3MR9B 5EO1A 4DGYH 3SKOA 4LVNC 3VGAC 2IG2H 3S37H 3CDYA 5CILL 5KVMC 1IGYA 5C71A 3LQAC 5FOBA 3FOMB 4K7PL 1AP2B 2BJMH 1CN4A 1UXWA 5E4IA 2OXHA 4P23D 1WCQA 3B83A 3FRUA 4QKXB 1KTRL 3IXAA 3VMNA 4EEEA 1NLDH 4NYLA 4RWYH 4C4KT 3B2UC 1OT1A 1I7UB 4GW4A 4DKEL 4J4PA 3BT2H 1QUNA 2WIMA 1B88A 3KLDA 2V17H 3FMGL 2GUOB 2C1OA 1PZUB 1C1EH 5D5MB 2NY3B 2HVJA 5T1LD 4JG1L 3FONA 1KELL 2R8SL 3OR7A 3LKRA 5DZLA 1S7UA 3A6CH 3WL9A 2W0KA 2QR0A 5DJ0B 1F5WA 3EIFA 4OM0L 1AR1C 5SX5H 3UDWA 3JWNC 3QPXH 3PNWB 4HUWA 4FTVD 4K3EL 3P11H 3ZYZA 4WCYH 1XIWA 3O6FC 1UB5B 3BZ4B 4QYOA 3QHZL 4XGZB 1JZ3A 2GITB 3OKMB 4F58H 1CICC 5E2JA 5GRZA 1F3JA 1HXYA 1JUFA 3OKLB 2HH0H 2W91A 2XZCH 3EJZC 1QSFD 3GJFA 1NUFA 3T1FA 3P0VL 5EU3A 5DD5H 5A16B 1OB1B 2GTWA 4R8WL 1L7TH 5GQBA 3VJ6B 3HAEA 3RHWK 2P5EA 3BD3A 2QJDA 5E8NA 3NA9L 1FSKB 4IMKA 2XZZA 4MA3B 2RR3A 3WV0A 1B3JA 3GGWA 1ZT7A 3MV9B 4X8JB 4EI5C 2ESVE 1AD0B 4Q6YA 2BY2A 4P59H 4BFGA 4JFEB 4PJEE 2UWEB 1IGJA 3UTQB 3VXRB 3N1PC 4DEPC 3FO9B 3BOVA 5E08H 3T0WA 5E4EC 3NTCH 5TE7L 1QOKA 3M45A 3H6JA 1NLBL 5EZLB 3ROLA 3K2UL 4RA3A 1WGOA 3GJEA 1CDYA 1S7XA 4U05A 3BEVA 4AYFA 3G5XB 4OFVA 2ZSWB 2YMXH 2J5LB 4FXLA 3KAAA 2V9TA 4NP4H 5EO0A 1HHKA 4CVXB 4P2QD 3IETB 1CF8H 3JWOC 2W0PA 3MRGA 4LOUC 2N56A 5SWSB 2QKIA 3WFDL 2IQ9H 2EEAA 1HKLL 4KVCL 5IJKC 5EIVA 3LS4L 1Z3GL 2CGRH 5DRXA 4KFZC 4I77H 3MRHB 1DE4A 2VLKD 5JORA 1T5WB 2R1YA 4XCFL 4YDJA 3I9GH 4WENB 5IFJA 3SPVB 2A73A 3MOQA 5BV7H 2IANB 4NRZA 1K2DB 2X42A 2EXYD 2FIKA 2AXHA 2YPLA 2H45A 4ODWB 3E6HA 1N5YH 3DMMD 4KZEH 3IVKB 5F89B 4JFOB 1MPAH 3CZJA 4ZUUA 3PQYD 4FQCH 3OR6A 1TZHA 3LHPL 2DQHL 2ADJB 1KCSH 2VIRB 3NFPA 4U1IA 2KQMA 4R6UA 1CL7L 1FFPB 3MLSH 5B3JF 2NR6C 3RY4A 5DMGD 2CK2A 1MFDL 1WWAX 3DECA 2Y06H 1NEUA 4WWKD 1LO3L 2X4SA 4DK3A 5INDA 4DVBB 2CD0A 2L0DA 3TJEL 4HK3J 1TVDA 3GJFK 2ICWA 4R7DB 5GGRB 4EI5A 5MI0C 4U1SA 3KPSA 3O4OB 3BGMB 1SM3H 3HNSL 3SDAC 3GI8L 5GS2H 3LAFA 1BOGA 3RWDB 3C09C 4I4WB 5IFAL 4I9WE 3VW3L 4WWKA 1KJ2A 2NW2B 3WIIH 4XNYH 5DRWA 2VXVH 3MXVL 1QQDA 1MREL 4GRLC 1FN4B 2ZUXA 1LE9B 1YUHB 4HFUH 4OKVB 1I8MB 2CLZB 5TJWK 3P77B 5HVWA 4ODBD 4P2RB 1QFPA 4UT6L 1NL0H 1F58H 4XNUH 3VFPA 3LKNB 3LKPB 3GBMH 2IMNA 3H9SB 3U7WL 1NJ9A 3NIDE 3V7AE 4IOFC 1UQSA 4BQCA 3HMWH 2XXCB 4PRHD 3DVGB 4HF5H 4XVTL 4PGEA 2IEPA 4OIBA 1IJ9A 4JQVC 2YD9A 4CVUA 3QI9D 4XAKE 5T3XH 4GG6F 3T2PA 6CGTA 1CE6A 4U6VL 5KW9H 1LK3L 5D2NB 3KXFD 3QIUA 3L3JA 1N6VA 5TDPB 4KJQD 1ZVSA 3SGDH 1U58B 2FJHB 3T3PF 2XTJB 4U6XB 3DSFL 3U9PL 3LDBC 4WUUD 3RUGF 4MX7A 5TPWL 5EUOF 3V4PL 4F7CB 4XPAH 1KEML 1PKQE 5DUML 2HVKB 4D0DA 1UKSA 3EYSL 1G84A 1HNFA 2NY0D 3KXFA 3UO1L 5C0IA 5D1XC 3MXWL 3GSNH 2PF6A 3SDXB 3VXTA 3VXUB 2BZDA 3DUHA 3ILPB 1TPXB 2CO7B 4KU1A 1YJDC 5DR5H 4TNVK 4WUUA 4I0PB 4LU5H 1L0YA 1AGEA 5J06A 1U93B 2R2EA 5I75C 6FABL 4HKZB 2CDFA 1T2QH 1OAXL 3MRNB 2FYYB 1NCDL 3E8UH 4OZHE 2BSSB 5BS0D 4QT5A 4N8CL 1YYMH 4P99A 3WLBA 3QUXC 5HYSA 5KSUB 3P4MB 2IJ0C 2PW2B 1YECH 4GAYA 3SDAA 5F70A 5B39A 2NX5E 3BKCL 3BZEB 5MEND 4HZLB 4QXWA 1KJMB 1KBGL 1NCAH 3TT1H 5BO1L 4GRLA 4JGMA 3RPIA 4HIXH 3EGSA 4O2FA 4UILH 4JVWA 3WXVL 4XCYA 2JIXB 1KJ3H 4YBLC 3R0MA 2JCCF 4LSQL 3L5WA 2D7PA 5MENA 3MBED 4M7JL 5ILTL 1RK1A 3DO3A 4MJ6B 3L1OH 4JQVA 4N68A 1N8ZB 2W0LA 1A4KB 5J13B 3TO4D 5GRVK 1MHEA 3QWOB 3E0GA 2W92A 3VD3A 5EC1A 4QRTA 2UUDH 4JPWH 1MHPH 4NCC2 5D7LE 1HXMA 1QPPA 3GMNA 2AP2A 2NY1B 1FRGL 1JN6A 3MBEA 4X4XA 4HPOL 4DVRH 4GG8B 5TQ2L 7FABH 4HIJB 3WJLC 2O61A 1J1PH 4OD3L 4I48A 3HG1E 2W0FA 3TO4A 4X4MA 4OAWB 4K71B 4P57A 4GRMB 2CUHA 2ZCKH 2YD2A 3R1GL 4XC3L 1G7HB 2FH6A 1ZLVK 5DQJA 4I3SH 5DTFA 3MUGB 3PDGA 1BD2D 4JDVB 4G9FB 1NC4A 4WJ5B 4J7RA 4C83A 4ZSOE 4ETQA 2H26B 4UBDC 3GSVB 4O5LH 2M1KA 5DVLA 1OGAA 5DJ6B 3VFGH 3C9NA 5SWZD 5DK0B 2MCPH 5E5MB 4K7FB 4Q74A 1R3IL 4CGTA 3VRJB 1U3HD 2X41A 2H8PB 5IVXF 1VADA 4YPGA 3IKCB 5IOPB 1K4CA 3QUXA 3L6FB 3LB6C 1JHLL 4M1CC 4RDQG 4XVUD 4BA8A 3QEHA 5SWZA 1N59B 3DV6B 4S1RL 3REVB 1JGEA 4NQSA 4MD0B 1QYGL 1XGUB 4BKLB 1P4LA 2HT3C 2GI7A 4IOIA 4M6OH 1J8KA 3FN0H 4HLZH 5TH2B 1TNNA 4OB5H 5F9OL 4JFXA 1U2CA 5D7JB 3NN8B 1DLFL 2X05A 3EKCA 4R26L 1YMME 4MQTB 5M95B 3DTXA 4N5UA 4ERSL 4LRIC 3GSWB 3KJ6L 2XWJA 2EDFA 3KYNA 4PJFB 4GOSA 4EKXA 4K3GA 4ZQKB 1FYTB 1EJ6A 5MERA 1RPQA 2I25N 5DI8A 3BVNB 4JO1L 2VQTA 4NQDD 3QH3B 1ONQB 2VDRL 1T4KB 1FG2A 3UBXI 4ZO7A 4QHUA 1FNLA 2W60A 2J88H 4YXHH 3TFKD 5ERWB 1F13A 1A4JA 3TBSB 3SO3B 1MH5B 4MLSA 3U0PB 4Y4KB 2R4SL 3WJLA 4MA1B 2O5ZH 1Z0MA 3X3GL 1BIIA 4JO4L 3T0EC 1HH6A 1N7MH 5ICXB 2UZYB 4HPYH 5FFLA 5FYKE 2QQLH 3ALXA 4PJ5E 5EIIA 3HZVA 5CJQL 3STLA 1BAFH 3RWFA 1MWAH 4ODSH 4V1DD 3RWHB 4KC3B 4PS4H 2J8UE 5T5FL 3TH3T 4LASH 3MA7B 2M2DA 4H88L 4JQXC 1HILB 1NAMA 3T0EE 1J8HA 3QFJD 5A2IH 1C5BH 4L29A 4X6CB 2MSPA 3KYOA 1AE6H 2I07A 4HMCA 4V1DA 3LQZB 3O3BB 5C09B 3S35L 2FJGB 1SJHB 3P73A 2VZTA 3HC0A 2C7UA 1IQDB 1MAMH 2B39A 1MCOL 3DYMA 2D7OA 4K94C 4OLUH 4AY0A 3HZKA 4R97B 1KB5H 1URLA 3DURA 5ETUB 5MEPA 5IB4A 3VRLF 3IJSB 2HLFD 1WIOA 3PGFL 5T1MA 2W9EL 2EYSA 3PUCA 1BQHB 3TBVB 2J2ZA 1DQDH 4KRMB 1FGVH 5KVDL 2APBA 3P0YL 2V7HB 2X1PA 4JAMA 4LRIA 1FV1B 3T0XA 1J5OL 3SE8H 4ODXB 5DD1H 1KCUL 4UV7H 4MXQD 1BVLB 4LLQA 5ADPH 5F3BA 1KXQE 5HI5C 2FGWH 5EOTB 1TETL 3UMTA 5DFVD 3KR3H 4PB9L 5AUMB 1ZEAH 2IH1B 2O5XH 2BERA 1R5VA 1UACL 3O4LB 5E00B 1S7SA 4W6WB 4HFWB 2EDXA 4OGZA 4XMKH 5HHNA 1I1AD 2VLJD 2EDDA 1B2WL 2VH5L 5SWQB 3AREC 4ZNEE 5L6YL 3O41B 4XP1H 3BI9X 5JHDD 4XBEL 3MUHL 5F7WC 3U36B 4U2ZA 2MOVA 5EUKB 1G0DA 1A7OL 2A6DB 1T22A 3RL2B 3RTQC 3T77A 5C3TA 2EIZB 4PRAB 1FQ9C 5GGQL 3ARGB 4UQ3B 2F54D 1NGZA 1AIFA 3BSZH 5I16A 1TIUA 1XZ0A 3L3IA 4RRPA 4OF7A 1IM3A 4JQXA 1FFNB 4L4VA 4M5ZH 3VWJB 1KNOB 2JJTA 2CDEA 3WBDA 2Z9TA 3WXWL 3C5ZD 3EYVA 2SEBB 5IIEA 4RZCA 1WISA 5LAXA 3CFCL 4KK8C 1J0JA 2HG5A 5KS9E 3IDNA 3D39D 4PGDB 4JO3H 2IBZY 3KYMA 3NFSH 1A8JH 4LCUB 2DLEA 1A14L 1IC4H 4JFQA 2EXWC 2UY7A 2BOBB 4GLRH 2H9GB 4RMWA 3W0WE 4HJ0D 5ID0A 3TO2A 2EDRA 3U1SH 3QO1A 4LGPB 1XCTB 3C5ZA 3VXNB 3V0AC 4UTBH 2DWEA 4K9EC 3O2DL 3D3VA 4D9LH 5CIPA 2BVQA 3D39A 1ZTXL 2JLLA 4OLVL 2BHUA 3IS1X 4ESKA 1JNLH 1H5BA 4LNRB 4JHBA 2NLJB 2X4NA 1QRND 3OXSB 3CNKA 4WFFD 4JANB 5CINL 1HIML 4MS8D 2KH2B 3W5NA 3WLWD 4XWOD 1YEHH 4IRJD 2GSIB 1LP9A 4ZAKD 4KPHH 1PEZA 2VDOL 5J6GB 1YNLH 3ZT6A 4OCXL 5CD5C 3U4AA 5B38G 1OAYL 1ERNA 3OKDB 1IT9H 2VTFA 4WI4A 1FDLL 1QRNA 5K9KB 1UWXK 2C1PA 2DJUA 1QD0A 1U0QA 2MWCA 4LKXA 2DICA 4NN5B 4Y7MA 4HWEH 4YGVB 1JWSA 3TNNB 2HFFA 1U8JB 1OD7A 5CBEA 1FJ1A 2YD5A 3PE9A 2HRLA 1T89A 3QDJA 1D3CA 5FCSH 1JV5A 4PTUB 3V7AG 3GNML 4KGLA 1A7QH 4JHWL 4HJGA 5TQ0L 1U95A 2AV7B 5DMKB 4PJ7A 4OCWL 2HKHL 4GQ9L 3RTQA 3BRGC 1NCBL 1UA6H 2FL5B 1MI5B 5D2LE 3C60B 1FSKC 4ZOEA 3EYFB 4OFYD 4ELMF 1AO7A 5HY9A 4NFDA 2R9HD 2OZ4L 5E94B 2D9QB 1MUJB 4X80L 3N85L 1Y0LA 3QPQC 3WKMH 2YK1L 2YR3A 4JPKL 3P30H 2C26A 3MR9A 5L2KD 4CVWA 1HK6A 2EH7L 2F53D 4MLIA 3FOMA 1AP2A 4OFYA 2H3NB 1IMHC 3IU3B 1O7SA 4MDJB 2OTPA 4J8RB 3OGCB 2HMIC 5C6TH 3VRIA 2QSCH 1JZ8A 4P5TD 4MJID 4QTHB 4MHHG 1D6EB 3VGDA 3KJ4B 5DMJB 4UU9B 3WDHA 1I7UA 1YPZF 4JM4L 3KPTA 4F7MB 4G8GE 1CGSH 3CUPB 1XEDA 2NQCA 1DUZB 4G6KL 1QKZL 2VXSH 2GUOA 1OOAA 4TSBH 1IILE 1G6VK 5C0DB 4QRPE 5IK3B 1FE8L 5C6WH 2YA1A 1CIDA 5D5MA 4PLJD 3VXMB 3PHOB 4Y8AA 4P2OC 3GMLB 1S5IL 2ARJB 1WVZA 2HJFB 3MLTB 4P46C 2DQFB 3WUWB 2GFBB 4R4ND 1T21B 5DJ0A 4LRNH 3MLWL 4TRPH 5CP3A 5IUSA 2X9WA 1RMFH 3PNWA 1JNNH 3O8XC 2GT9B 4JDTH 1MSPA 5C0AB 4D9QE 1UB5A 3NCFB 3KYKL 5IB1B 5J11B 3BZ4A 4FQLL 4PBWD 2FBOJ 3ZLQC 4F8TA 1QFUL 4XGZA 5ENWB 1MNUL 2GITA 3OKMA 5GSRB 2BSTB 3OKLA 4M93B 4NRYB 4OZHB 5IJVB 5HHXL 3QEGL 4YHKH 3MV9D 1PVHA 4AENB 5A16A 2E9IA 3BIBX 1UCTA 1P9MC 3RZCC 1OB1A 3BJLA 1EEUA 3HI5H 3VJ6A 5D72H 2NX5B 2C3VB 1MRCH 2APVA 3VXRD 1OM3L 4ZS6D 1TXKA 2ZUUA 3MJ7B 1VFOA 5LCVL 4MA3A 5CJOL 1B0WA 2V9RA 3FQWB 2PR4L 2CUMA 3MV9A 3TVMB 4X8JA 1U3YA 4DFIA 1AD0A 4KV5F 1WZ1L 3O4OC 4JFEA 4WI6A 5ESVB 4LARH 1CR9H 4CUCA 2R1XB 3UTQA 2FEDC 3VXRA 1WC7B 3EJJX 1RJYB 4FRWA 3PABB 1ZOXA 3BW9A 1EH9A 5FK9B 3QP3A 5EZLA 5C0EB 1V3JA 2DJSA 4PJXF 3BDYL 4LSUL 1F3RB 3G5XA 1I3RB 3LS5H 5D7LB 4DAGH 5I71B 1MHHB 2ZSWA 3FQTB 3D0LB 2Q6WB 4GXVL 4CVXA 5HHMB 3IETA 1R6VA 2IAND 3M8OH 5E03A 5I1EH 4NUGH 3RDTB 2ICEA 1AGFB 4G6AC 3SGDI 4YHOH 3MACH 4YXKH 4HKXB 4IEFB 2ICCA 3F7RA 3MRHA 3ZYOA 1T5WA 3UJTL 4M03A 1FVEB 2ZWLT 2ENYA 3O9WD 4NWUL 3SPVA 3P2TA 1G9NH 2BRRL 2IANA 1K2DA 3NA4A 3ZKQD 1QACA 2NY5H 4OLZH 1CFNB 3IVKA 5F89A 4JFOA 5I1HH 1CT8B 1QBAA 3QUZB 3RVWD 2VIRA 2ADJA 2D0FA 4WW1B 3HZYB 4AJ0A 1FFPA 1MCJA 4Z77B 1X5KA 4XP4H 3ZKMD 4DZBB 1KXVC 4FMFA 3V6OC 4RMVA 4X7EC 3ZTNH 1BFSA 4R7DA 5GGRA 4ONGL 2RAMA 4AL8H 4IM8A 1OPGL 1G6RH 3BGMA 4CDGC 3RWDA 4I4WA 4DN4H 1J1XL 2DWDB 2ZKHH 3EOYG 3S98A 2NW2A 1G7MB 5IMOB 3UC0H 1S8DB 1FN4A 1LE9A 1YUHA 1RZJH 4OKVA 1I8MA 2CLZA 3SJVD 3CJJA 5FCUL 3P77A 2KQNA 4P2RA 2NYYD 4PRPD 3LKNA 3LKPA 2QL1A 3H9SA 4RCAA 4P3CL 5E8OB 3E3QC 3MV01 2XICA 3LN9A 1NGXB 5HD8D 4JM2F 1OSZB 1KCRH 4ZYKB 3DVGA 5D7IF 1ZGLP 2XTJD 4ZXBB 5J13C 4ZUVB 3VXSE 4OQ1A 1A3QA 4YBQC 1T7WA 3J8F7 4M48H 1UH3A 3VDBA 4I2XE 4JFZH 4U7KA 1T1XB 4LDOB 3ZDZF 1QSZA 5D2NA 5IBUB 4RDQF 2PYEE 4XP6L 3CD4A 5E5RB 3RWCB 5TDPA 3E3QE 3W9DA 1U58A 2FJHA 1FORH 4YO0B 3VXUD 4U6XA 5GS0H 4EUPG 5HPOA 4XB7A 4NKIH 3UTSE 4Z7WE 4F7CA 1V5JA 2FECL 1YEIH 2HVKA 5KBNC 3MJ9H 5D1QB 4UIKH 1DBJL 4RNRB 3SDXA 3EO1B 4HJJH 3VXUA 3ILPA 3S6CA 1DL7L 1H8NA 4OCSL 1HE7A 1CLCA 1PBYA 3C2SA 4I0PA 5BJTB 3CPLB 1RZKC 1ITBB 4JY4B 3DIFA 3QQ3A 5JA9A 4HKZA 3V6OA 5JQ6H 1KEGH 1XF3A 4FQIL 3X17A 3MRNA 2FYYA 3IRZA 3OG4B 1SEQH 2BSSA 3O3EB 1WBYB 4PJXA 1N0LA 5KSUA 2XYCA 4TYUA 3P4MA 2YD8A 4CN4A 2PW2A 4LK4A 2JIXD 3MLYH 4NM8H 2EDQA 1T80A 2OCFD 3BUYA 3LSOB 3BZEA 4HZLA 1KJMA 1ZANL 3ZL4L 1YN7B 5CZKA 3UTPE 4W4OC 4NC0B 1PZ5B 4GBXB 3O81A 4P2YA 1CDUA 1EUUA 4ONFL 5I8OH 3DXAE 3SDYH 2BNQE 1EZVY 3PDDA 2JIXA 5JA8B 3MGOB 4G80B 1IC5H 4JZOB 4FQ1L 1ED3B 2LU4A 2AGJL 3F7VB 1JK8A 4JFFE 5GRXG 1OTTD 2BFVH 1LEKB 4N9GB 3O3AB 3VXOB 5CD3B 4MJ6A 1MELA 4EDXB 1N8ZA 4RQQB 1A4KA 3HR5B 4G6JL 3QIWB 4XX1E 5FIEA 3QWOA 2FBJH 3Q5TA 2BVUA 2VLLB 1RULH 3O6MH 1OTUD 1Q38A 3O0RL 4G9FD 3ISWA 3DX6B 3RJDA 4GG8A 3OWEA 3MRPB 4PD4K 1KGCD 2DIJA 4HIJA 5I8KL 2B8OT 3O45B 4YHMH 3KLHD 1MRFH 2F15A 2ATKA 4XCNB 4GRMA 4KKCC 1MHCB 2RIKA 1G7HA 5KSBB 4NKMB 2N4IA 3SDDB 3MUGA 3TWCH 4CVZB 2VR5A 2DBLL 4G9FA 3SCMD 4YJZL 4WJ5A 2D7NA 2H26A 4P9HL 2A9NL 3GSVA 1BQLH 4MNQD 2W59A 5DJ6A 5FYJL 5MHSD 1AY1L 2X4UB 1A1NA 2Z8SA 5DK0A 4L8CB 3OTTA 2H32H 2AQ1A 4N0UB 4K7FA 1KV3A 3CFJA 2VDKH 5I0DA 3GRWH 3VRJA 1IL1B 3MGAA 1DFBL 4PJEF 2H8PA 1G1CA 4JRYD 3ZSSA 4JR9L 5IOPA 4RAUB 2ED9A 3C5SB 5ADOH 3L6FA 3B9KB 4RMTA 3EYQC 5D7JD 3FCTB 3LN5B 1VPOL 2AEQH 1N59A 1RZGA 3OXRB 4JRXD 3DV6A 1PX4A 4KXZH 3REVA 4DUXA 1M7DB 4MD0A 1D5ZB 5HI4D 1XGUA 4BKLA 1UM5H 3SE9H 4O4YL 2UZIL 4R97C 2XFXB 5TH2A 5DMIH 1JHTA 5GGVY 4U0RB 1NFDE 5HI3D 1J18A 5D7JA 3HE7D 2DTML 3NN8A 4PJIB 2UV3A 1EGJL 3ULUL 5E2TL 1CFVH 3EFDH 3GSWA 3OHXB 1CCZA 4PJFA 3WFEL 4AMKH 4JFDD 4ZUSB 2X4OB 4ZQKA 1FNAA 1FYTA 5HHVH 4ZUWB 3BVNA 4HGKC 1DBAL 4Q9BA 1R0AL 3TYGH 3QH3A 1ONQA 1T4KA 4JY6B 4EDWH 4W6XB 2E7LC 5ERWA 3A67H 4Z6AT 3TIDB 3TBSA 1UM4L 2B5IB 5JW4M 4JQIH 5DQDH 5L88H 1MH5A 4Y4KA 4G6MH 2GW5A 3VMOA 4JFDA 2BVEA 4X9BA 3J7HA 3NZHL 2VZ3A 4UB0H 3TNMB 3G6JB 4NNYB 4UT7L 5JR1H 1IGIL 3QDMB 2BK8A 4FQHB 5C0RH 3RWHA 5EA0H 4XHJC 3ARGC 3RGVD 2VQUA 3MA7A 3H3PH 3PWNA 3C6LD 5CMAB 3BN3B 4XTRC 5C08B 1DVFC 1HILA 1T7XA 3UJJH 4XCCL 4WEMB 2MHAB 4X6CA 4GLRI 1NEZB 3MRRB 4FG6D 3O3BA 2YPKB 3LQZA 2V2TB 5C09A 3NABH 1H3WM 2FJGA 4NQXB 1SJHA 3CVHH 4WHYH 5DVNA 1Y6NR 3QCVL 1G9EA 1B4JL 2YSSB 5DRNB 1X5ZA 1IQDA 2X1WL 3ARBB 5JMRA 4D3CL 4PIRF 2ZOKB 3QHFH 1XR9B 2HTLC 1HWGB 2ZCHL 2OJZH 5ETUA 1Q72H 4TULL 1KT2B 2B1AL 3IJSA 5FYLE 4R4BB 3TN0B 2WUBL 4QWWD 4KKLD 1CGYA 3KPQB 3MODL 3FO0L 1BQHA 4JCLA 3TBVA 3UROR 4NQEB 4OJFH 2HWZL 4NZJA 4KHTL 2V7HA 3K81A 3N1QC 4OGXH 1FV1A 2XQYG 4X5XB 1AC0A 1LDPH 1MCKA 2ED7A 2Y36H 4ODXA 3G5YB 5CEZH 2MFNA 2NY7H 1BVLA 1CICD 1W0VB 3LZFH 3ORJA 4WUKL 4PJHB 4LEXH 4NOBA 4Y5XB 2ESVD 2IH1A 3EJZD 5AUMA 3VI4E 5FUZL 3O4LA 1G7PB 5B8CB 1P4IL 3EYOB 4HFWA 5HDQL 4QHKJ 4PR5A 2BHZA 4KK6D 2AEIT 4GSDL 3CK0L 5LGHL 4UTAL 1EMTH 4QXUL 5SWQA 3O41A 3O2DA 3T2NH 2HT2D 3CFBB 5CLWA 4LPTA 1NMBH 3U36A 2XNAB 4PP1C 1F8TL 1SVZA 5EUKA 3VWJD 1R5WB 4K3JH 1JYXA 2ZJSL 2A6DA 2DLIA 3SEPA 1PAMA 3RL2A 4LSTL 3QDGE 2EIZA 4PRAA 5FYKU 5IHZB 3BE1H 3L3OB 3ARGA 4UQ3A 2YKLH 1ZLWH 1PFCA 1CLZL 5FGCB 2FB4H 1GRWA 1PLGH 2EEBA 3JV4B 3VWJA 1KNOA 5BVPH 2ZPKL 1JPST 3F6IA 3CX5J 3VFVB 2SEBA 3EBAA 1IC1A 1CQYA 2GHWB 3H42H 1VEPA 4PGDA 2EH8H 4RGMB 3ZHLA 2I26N 2AAVA 1F4HA 1MLBB 2BOBA 4DN3H 3KJ4C 3UJIL 4JB9L 5F7FA 3RVXC 3I85A 2DQJL 1JBJA 1XCTA 3VXNA 1A1MB 1I75A 1AGBB 4JN2B 4OZFG 4LNRA 4FQXC 2A1WL 2NLJA 4Z0BL 3OXSA 5EG6C 5F7EH 1HSBB 4JANA 2OZ4A 1I85C 4MQ7B 2VZUA 3U4EB 3K0WA 1AI1L 1QEWB 2F19H 3JVGC 3QZWG 5TE6H 1DP0A 4BZ1H 4O51A 4R2GD 4IDJL 5T3XE 2CK0L 3OKDA 1VFMA 5I19L 4N0RA 5K9KA 4OD1H 3RY6A 4I9WD 1TTFA 4M5YL 4PUBL 4X6DE 4CNIB 2EO9A 4YGVA 3TNNA 2I60H 1WZMA 1DR9A 1AGCB 3NCBB 5FYJU 5F1NB 1FC1A 4K3DH 5JDSA 1CGWA 4PTUA 4GRWH 3QA3B 4B7LA 3BP7B 5JTWA 2AV7A 5DMKA 1I9IH 4R96B 2FL5A 2CPCA 5I1GH 1NBZB 2OSLB 3C60A 1MFBL 3U7AA 1GGIH 2CQVA 3MNWB 4P2CG 2FATH 3CZFB 4U1MB 3JWDC 2BVOB 5I1LB 5E94A 4XAKD 3MOAH 3HMXL 4Z7OE 1MUJA 1HDMB 3Q6GH 3VD9A 4RAHA 1UJ3C 1ND0B 4HC1H 2X6MA 2WBJD 3RA7H 1H0DB 5HGDB 4PJAE 3WD5H 4IDLA 4TUKL 1I8LC 4TVPL 1YEEH 4IOFD 3A0OA 4D8PB 2H3NA 3IU3A 3A6BH 4MDJA 2A9ML 4J8RA 3MCG1 4PJGE 4QTHA 3VFTB 3DUSB 1NMAL 3WJJC 4I2XB 3UBXG 4FABL 4UU9A 4NM4L 3B6SB 4GKNB 4F7MA 5CJXC 5I71C 1VFUA 1Q9KB 3CUPA 1IQWL 5C0DA 3FN3A 5IK3A 5CSZA 2DLHA 4F7PB 1PDKA 2P48B 1RQ5A 2E9BA 3PWPB 3VXMA 2EZ0D 3PHOA 1U92B 2CMRH 1I85A 3GMLA 2FJFB 4Z7WB 2ARJA 3PV7A 2HJFA 2DQFA 3WUWA 2GFBA 4OQTH 1WV7T 3DVNB 1T21A 2EEDA 4A2LA 4ZMAT 2DQDH 4GJTB 1KYOK 2ORBH 2ADIB 2GT9A 4HXAH 5D1XD 1JRHH 1X5XA 4LFHD 3U2SB 1R3JB 5FUOL 5C0AA 3BPLB 4KK9C 1F2XK 5IB1A 5EIQA 2E6JA 5JPMB 5IROC 1DQMH 1YY9C 2NX5D 5E6ZA 1QPXA 5ENWA 5IW6B 1CDCA 1A9BB 2P43B 5GSRA 2LU3A 4FFYL 1JPSH 3MLXL 4LDEB 5I1IL 4OLWH 4QHKI 1T7VA 4NRYA 4OZHA 4FZ8H 1SY6L 4TUJB 2GJ6B 3TVMD 4AENA 3ZTJG 3LEYL 2K3TA 3BWUC 4LMQI 4NZUH 5CCKL 2J8UF 1YEGH 5CGMA 2NX5A 4JDZB 2C3VA 1Q9WB 2IFFL 4P5KB 3MJ7A 2NCMA 2ZUQB 1NBQA 3UYPA 3Q0HA 4QEGA 1OSPH 3ARFB 3FQWA 1XR8B 1MCHA 3TVMA 3TZVD 3DXAB 4NHUB 2DLTA 2BNQB 1EDQA 5F6HI 3MLRL 5D7LD 1ROWA 4ONHB 5ESVA 4E42B 3HFMH 1HINH 3PP3H 1FNSL 2R1XA 2G2RB 1RZIB 1U42A 4Z8FL 4ZFGH 1WC7A 4WNQB 1RJYA 1EHLL 4D9RE 3PABA 5FK9A 3HG1D 5C0EA 3BKYH 2F8XC 4PJDB 3TZVA 4AT6A 1AKJB 1I3RA 5D7LA 1MHHA 5CJXA 2AK1L 5CAYB 1ORSB 3FQTA 4CKVX 3SQOH 3D0LA 2Q6WA 2R56L 2F74B 2YS4A 3O6LL 5JXED 2NTFB 2E3VA 1BJ8A 1FO0H 3U82B 3U4BH 1AXTH 1NDMB 2A0LC 2BXZA 3BP6B 3IFLH 4P9MH 4S1DC 3RDTA 3B2VH 1AGFA 2R0ZH 3DI3B 5ITFB 5KANG 1S3KH 4HKXA 3V52H 3IAQA 2ZNWA 4U31A 1ZLSH 1QNZL 2VAAA 1WAAE 3ARUA 3S34H 5DA4A 2HYMA 4GMTH 1WIPA 4HIHB 2L7UA 5KSAB 4NHCH 2ADFL 5IROA 5HYEA 1O7VA 1A6WL 1CFNA 2JB5H 3WNOA 3ULVH 1CT8A 4ZOAA 3G08B 3QUZA 4M7KL 3QUKB 5D1QC 3OF6A 4J1UB 2DTSA 4YUEH 4Z0XB 4ALAH 4WW1A 2FEEL 1DJSA 3IU4H 3HZYA 1GGTA 2FNBA 2RCSL 4TOYH 4M3JA 4Z77A 5IFHH 1YMMD 1DQJA 1DZBA 4Z7UE 2R0WL 4DZBA 1QSEB 4YDVB 3MGTB 5HYJB 5EZIH 4RFOL 1PX3A 4F7TB 4HDIA 3TLRA 2J1KA 3BRFA 1L9NA 5JW4R 2MPAL 5KS9F 1ETZB 2H2PC 4Q97A 1T2JA 2EECA 12E8H 3KDMB 1A7RH 3SGKC 3VWKC 1AHWB 3CDGB 2CUIA 2DWDA 2XN9B 4ZTPH 1BVZA 1REIA 1LGVA 1KTDB 5E6IB 1G7MA 5IMOA 2AJ3B 4P49A 5BOZG 1S8DA 4ZXBD 4JJHA 1DEEB 5EBLB 3T1WA 1Z9SA 1ULVA 4P48A 2OL3B 1IZKA 1X6LA 4Y2OA 5FYKD 5C0GB 5H94B 4F9PC 4PJ5D 4TSCL 4C56E 1GH7A 5E8OA 1H3VA 3BFOA 3QXUA 3TT3H 3RNQB 4XP9L 2DS4A 1OSZA 4W4NA 3E2HC 1N0XH 4WTXA 1EO8H 4ZXBA 1SBBA 4NZTL 4ZUVA 3D18B 4KTDL 1Z9LA 2BVYA 3QIWC 4XPGH 3NACH 1L7IL 1YMHB 2B0SH 3T0ED 2VB5A 2BJML 1RZFH 1T1XA 3K8LA 3MV7E 1LMKA 2VABB 4I0CC 5DEZA 1JJUA 1DEDA 3FQUB 1KN4L 3RWCA 4UT9L 5TGBB 1NLDL 2AEPH 4FZEH 3GSUB 4YO0A 5C9JB 3BT2L 4HUMB 2EDTA 1D5IH 3ARTA 4IIQC 1CFTB 5D1QA 1S78C 3DHMA 3N06B 1N4XH 2GK2A 4RNRA 3HC3L 2OL3L 3CDCA 4PJBE 2DI8A 3EO1A 2JJUA 4LLYB 1I3UA 5D2LF 2KKQA 2R0LH 2VDQH 4D2NA 5K9QI 5BJTA 3CPLA 4YLQT 4JY4A 3IJHB 3B9EA 2Z31B 3ZYIA 4AEIL 2P46B 3HAEH 1UGNA 3G5ZB 3P11L 1DN2A 1YQ2A 3O3EA 1WBYA 5A3ID 4LP5A 4KXZI 2YRLA 1FZMB 4F58L 4NNPL 3MREB 2A83A 3WS3A 2AK4E 3SGKA 3W2DH 2I9TB 1KC5L 3LSOA 4N0FB 3QDAA 1FVCB 5B4MD 5DD5L 5IHUH 5D7SH 1YN7A 5E1HB 1PZ5A 4GBXA 4N8VB 2NY2D 3LQAH 1GC1L 4LSRH 1MIMH 1L7TL 5LXGH 4DWHA 4BFEA 4U0RC 1JE6A 4RGNB 1W0WA 2P45B 3GKWL 5GJSH 2CSPA 3MGOA 2XACC 4G80A 1ED3A 4CU6A 2FH8A 3F7VA 2E7BA 3QFDB 4A2MA 4OZGE 3WFBL 1FAIH 4IOSD 3RVTD 4G7YH 4N9GA 1LEKA 5I6XC 2VXQL 2WWKO 3O3AA 4KKBC 3ZHKA 1IAIH 5CD3A 4YHIB 1GGCH 1IEAB 4EDXA 4P59L 4ZNEA 4RQQA 4Y1AB 3HR5A 3FT4B 3QIWA 1J86A 2OP4L 1DQLL 4LAJH 4TTGA 3HI1B 4Y2DC 2VLLA 1U8HB 3V9FA 3SDDD 1NCUA 4HULB 4U1GB 3QDGB 4MXWL 4GS7B 5FYLL 3DX6A 4BZ2H 3MRPA 1OWRM 3CMOL 3IAGC 2VYRE 1HCVA 3ZKXC 3O45A 4Q9RH 2CRZA 4XCNA 1XMWA 3W0WD 5LVEA 1BM3L 4M61B 4O9HL 1MHCA 4X4YB 5KSBA 4YIQA 4JO2H 1EGJA 3E1F1 3SDDA 4CVZA 1YC8A 5AG9A 3DOSA 4XPFH 2CR6A 3B9KD 1RD6A 4GAJL 32C2B 5GGVL 5HTSA 2X4UA 1JGLL 4L8CA 3AGVA 4N0UA 4KUZH 3ZE0E 3GM0A 4LL9A 3I9GL 1GHFH 5EBMB 1NSNH 4RAUA 1PGRB 3C5SA 4R7NB 3B9KA 2JF1A 4HS8L 1ZAGA 3O3DB 3FCTA 3LEXA 3LN5A 4U1NB 4RGOH 4NUJB 3RU8H 4WW2B 1MRDL 5K9JH 4WEBH 1M7DA 3ARBC 1D5ZA 3PL6B 1EFXB 5I8CB 1AXSA 3MLSL 1KJ2H 2XFXA 4DUVA 4H20H 4BZYA 4OV5B 1CXHA 2AQ3A 1AFVH 1VEMA 2Y06L 2Y6SD 4XPTL 4U3XA 4EN3B 3D9AL 4JKMA 3SKMB 2CKBB 4PJIA 4PREB 2FX9L 5ALBH 3HZMB 4AH2B 4FFWC 4XCEB 5DD3H 5CKAA 4X6DB 4LEOB 3OHXA 1JHKL 5IF0A 3GBNL 5SV3A 3VGHA 2AS5M 1GJIA 2BXYA 2XA8L 4ZUSA 2X4OA 3T2OA 1SM3L 5AAMA 4ZUWA 4OGYL 1UEMA 3IFNH 4JY6A 2VXUL 1ORQB 4X7SH 3HC4L 5BW7A 3TIDA 4XXCC 4YK4B 5IG7B 1VEOA 1ZLVH 3LMJL 2D03L 4HFUL 3RGHA 3I02B 1JTTA 2GJJA 4MAUH 2DMBA 1G7IB 4XNUL 2E8YA 3GBML 5A43C 4Y19B 1CQKA 1CIUA 1CVSC 1FBIL 3OAUL 1X5IA 1JP5A 1CLOH 4WV1C 4XC1L 3WFCL 4G8GD 3TNMA 3ZDYE 4NNYA 1NFIB 3QDMA 5GISH 3BKJH 3NCJL 4QRPD 1NGQH 1FL6B 3V5DA 1OHQA 2CKBL 5MEOB 1JYNA 4LCIL 4KK5D 3D85B 5KW9L 5CMAA 3T4AA 2PUQT 2GIYA 2BNRE 5C08A 4YDKH 3TCXA 1MVUB 5FO8B 2MHAA 1P1ZB 5FUCC 3MRRA 4IS6B 3GBLA 3H9HB 2COQA 3TN0D 1E28B 5HHOB 2V2TA 4NQXA 5TF1H 4D9QD 2FZ3B 3QO0B 2MQCA 2YSSA 4NJ9L 5DRNA 1U8QB 4Q9QH 3ARBA 1ZS8B 2ZOKA 4L9LC 4NO2A 4H0IA 2C4FU 1XR9A 4P46D 4W81A 2YHGA 4NKDB 1KT2A 2OJEA 5DSCB 1NGPH 1TLKA 4FNLL 3RVVC 4R4BA 3SGJC 4H0HB 3TN0A 3O8XD 3SE4C 3KPQA 5FUCE 1KCVH 5D93C 4NQEA 3WCYA 1F6FB 3FFCE 2LAGB 3E8UL 2R69H 4HXBL 3FHAA 4X5XA 5CBAB 3KVQA 1T3FB 1X5HA 3I84A 3G5YA 1W0VA 2NY5C 2G5RA 5I1KH 4GFTB 1E4WL 3FAXA 4FQPA 2BCKB 2EE3A 4PJHA 1FCCA 4TUOB 4X9HA 2R29H 4KI5C 4Y5XA 3QEUB 2DRUA 1G7PA 3LV3B 5B8CA 1AQKH 1GAFL 1NCAL 3X13B 1KSRA 5EU4B 5H2BA 3RZCD 5IVOA 1RJCA 2HFGH 2UYLB 1B6DA 5I15H 5L8LB 4WTZG 1BF2A 4FFZL 3VFUA 3CFBA 3QBTB 4OLYH 4R4FH 1BQUA 2XNAA 5F97E 4KI5E 4HWBL 1R5WA 4NN7B 5FKPB 1J05B 4G6FB 4HLZG 3L1OL 2QQKH 4N8PA 4OT1L 3EW3B 4E9LA 1GOHA 5GS1B 3SDCC 5IHZA 5M7QA 3GMPB 3L3OA 4JN1L 2ICES 5HJ3B 4I5BA 3LD8C 2QADD 4JGUA 1OAKH 3JV4A 1YJDH 2QTEA 3QG6B 4LMQE 7FABL 2KZ1B 2AXGA 5DJCB 3CLFH 1IKFH 2VXTH 3TJHC 3OMZA 4QO1A 1JWMB 3I6GB 5B22A 1MJJB 1RIUL 1MLBA 2CJUH 3AS0A 2J6EL 4XAWH 3GKZA 1D7FA 4G5ZH 1TVBB 1UWGH 4G6AD 3N1FC 3RIFF 1A1MA 4O5LL 4XNXH 2BX5A 1AGBA 2VRAA 3ZE2E 4JN2A 3IS0X 2MCPL 4QY8B 3X11B 3INUL 5CGYC 4M02A 4Y89A 2WAHA 1FIEA 1CLYL 1GZQB 1HSBA 1S7RB 3NBNA 3HMXA 4MQ7A 3U4EA 4UNUA 1JRHI 1X5JA 3RIAF 4MAYC 1CFQB 1WBXB 4OM1L 1JGUL 1QEWA 1ZXQA 1QFWH 1A3RH 4LLWB 1RURL 5F3HA 5AD0B 4Q6IC 2Z4QB 1QLEH 5DWUH 3BPLC 2QSVA 3LKOB 4E41E 2R0KH 3U7YL 5FHAH 3RUGE 3MV11 4CNIA 1EVTC 4OB5L 3EZJB 5GRUH 1AGCA 2DLGA 2F58L 2G60L 2B20A 5F1NA 1LO2L 1SJXA 3V7MA 4JHAH 4ZFFA 3V4UL 4YDLB 3QA3A 3BP7A 1J0HA 2IH3B 4R96A 2AJXL 2YUZA 3QIBB 4L4TE 4Y16B 2E7HA 2RQ8A 1NBZA 4IRSB 1A1OB 2OSLA 3O2WL 2XQYK 2ZUQC 3MNWA 4KY1H 2J88L 3VXSD 4U1MA 3CZFA 5JXAH 2BVOA 5I1LA 2HN7B 5JOEA 2EDYA 1HDMA 5L7XH 5LGKA 4C56B 1ND0A 3ARYA 2B2XH 1EAJA 5BRZD 1DTUA 1H0DA 2PYED 5HGDA 5IGXL 1T6WA 5KVEL 1JPFB 2APWA 3IXAB 4YQXL 4HPYL 4D8PA 1EERB 2EC9T 2EKSB 1MCQA 5LBSL 1SY6A 3FOLB 2VDNH 3UTSD 3DUSA 3VFTA 1A64A 4I2XA 3QRGH 1UKTA 4GW1B 3B6SA 1NFDF 4GKNA 1D6VH 1S7TB 3MV7B 4LAQH 4TSAH 1Q9KA 4P23B 1PKOA 3V95A 1WSST 2JCCE 2DDQH 4XWGH 3F7PC 4CJ1A 4OIIL 2AEWA 1RUKH 3FONB 4P5MB 4OLXL 3I2CH 3BAEL 2AV1B 1YNKH 3PWPA 3QFJE 1U92A 4Z7WA 2FJFA 2OX5A 5EC2B 1T03L 1AE6L 2WV3A 1WF5A 5A2JH 3V79C 3DVNA 2VDPL 1ZK9A 1MIEH 3IAPA 1F4WH 1I7ZB 1P84K 3UTTE 2NXYB 1T83C 5JUEL 4HCRL 1JF1B 3MRIA 4YEEA 5T1LB 5HSFA 4HQQH 1F42A 4HBCH 1HXYB 4YHLH 5JPMA 4PV8B 4NC2B 3GJFB 5IW6A 3T1FB 1A9BA 4APQC 4FTVB 3UTPD 1E6OH 5JDJA 4J6RH 4DJMA 3ARFD 1CDBA 1DQDL 1W8NA 2XY1A 2BMKB 3HI6L 2GJ6A 3C8KA 4FQJH 3DXAD 4OI8A 1OQOA 4JKWA 5GXBB 1B0GA 2XZAL 3UAJC 2DQIL 4LVHB 2ICWJ 3PV6B 4JDZA 3BP5B 4JFFD 2FGWL 1QSFB 3S88L 4JPIB 4XMPH 4P5KA 5C0BD 3UYRH 4NQCE 4WI3A 3S37X 2FD6H 4U1JB 4B7IA 1JGDA 3ARFA 2DM3A 1XR8A 2K7PA 3OKYA 5IVXE 3B8SA 1D5BB 3AS2A 3DXAA 2GKIA 4NHUA 4KRPD 1RV6X 5MEQB 2BNQA 1E4XH 1FAKT 3P3YA 4LSDA 2E5EA 2APTA 4E5XA 4E42A 2IAMC 3LQMA 1MCEA 1RZIA 1AHWC 4OZGB 4YFDB 3MUY1 4XP1L 1ODAA 2PN5A 4WNQA 4X7TB 3U46B 3SKJL 3I3BA 5DJXA 4DW2H 1TJGH 4PJDA 5HGBB 5DHVH 5JW3L 3OZ9L 3DO7B 5FGBA 1AKJA 3GUTB 4MWFB 1ORSA 4RISH 5FM8A 1HZHH 4D0CB 5E99H 1JFQH 4K94H 2F74A 4OBSA 3BSZL 2I5YH 2NTFA 5INCB 4OIAA 4LQ1A 1F2QA 5T3ZH 4AM0B 3MOBH 3F7QA 5CIPH 1NDMA 5KSAD 3BP6A 1UG9A 1DE4B 3MO1A 3VI4F 5ITFA 2DQGH 4Z7VB 3QCUL 1L6XA 4KKCD 3NFSL 4P2QB 1ADQH 1M7IB 2VSCA 3WSQH 2WWMC 5CILH 4N1EA 4HIHA 4ZUUB 5KSAA 4MCYB 1GC1C 1IARB 4TN9A 4LLVB 4XI5C 3S8WA 2V7NB 3D69B 1WWWX 4UTBL 2VLKB 4RMQA 3FN9A 3MFGB 1CXFA 4N0YL 1RHFA 3G08A 1E6JL 1RUMH 3QUKA 3RQ3A 3O11B 4J1UA 4Z0XA 3BYYA 4M7LL 3DGCR 3DMMB 3FMGH 3Q48A 3PQYB 3RL1B 3H9YA 4LCYB 1QSEA 1KPVB 4EZMA 3FL7A 3MGTA 5HYJA 3CLEH 5HYQA 1GGBL 5IVZB 1KELH 3KPMB 2R8SH 3WYRA 4F7TA 5JW5B 3WN5B 4DZ8A 1U91B 3AM8A 4XH2B 2A6IB 3SE3C 4OM0H 1MF2L 1RU9H 2X89A 4HWEL 3EOAB 4WWKB 4G9DB 2Z35B 3KDMA 4K3EH 3NGBB 1JNHA 1AHWA 5CHNA 3CDGA 2XN9A 4R90L 1KTDA 3S7GA 5E6IA 3T65B 1YQVL 2AJ3A 4S0SD 1AGDB 5ISZE 5HBBA 5EOCJ 3K8MA 1A7QL 2RHEA 1DEEA 5EBLA 4EXPX 2VN4A 1UM6L 2OL3A 1F4YH 5SX4H 3U30B 1IE5A 5C0GA 1IAII 4RGNC 5H94A 4K8RC 3GSOB 3QHTC 3RNQA 1TJHL 4M1GL 5DJ2B 1EHAA 4IJ3C 1UENA 4K9EH 2HTKD 4L3CB 2NY6B 3D18A 3P30L 1OD9A 5F9AC 4GAGL 1YMHA 4YAQB 4PRHB 1G7JA 2PTUA 3LPGA 5KVGH 5CEZE 2VABA 1NCWH 2CXGA 3FQUA 1GOGA 4RAVB 5TGBA 3PXJA 3ES6B 3GSUA 3QI9B 5C9JA 1HSAB 3L9RB 1EFQA 1OT2A 5JW4Q 1NBVL 4GXUM 1NLBH 1DCLA 3K2UH 4KDVA 1CFTA 3NAAL 3U6RB 2DF3A 3SOBL 2XRAL 2R2BB 4LLYA 2Q1EA 4MQSB 5F7YC 2NY0B 1FNGB 3IJHA 1RMFL 2ICWI 4M6NL 3WLBB 3VXQB 2Z31A 4F57L 4JDTL 2AJUH 3WFDH 1HKLH 4XRCB 4KVCH 3LS4H 3V6ZB 1T6VN 3SE3A 5IBLC 4PJAF 1FZMA 5GGTL 1TTGA 3MREA 3KYAA 4XCFH 1MJUH 4PJGF 4WW2C 4U6YB 2I9TA 4DGVL 5BS0B 4N0FA 1E27B 1FVCA 3IRPX 3TEUA 2YPVL 3HI5L 5D72L 4PY7B 1MRCL 2DQUL 3LHPH 3WFZA 2DQHH 4EN3C 2IBGA 2OBGA 2V5YA 4JKPH 4BELD 1CL7H 3P4LA 1KLFA 1RK1B 1IKNA 4M7ZB 5I1AB 4KMLB 3QFDA 3AS1A 3PG2A 1FPTH 3QDGD 3H7BB 5I1CL 5DJZB 2NNAB 4YHIA 5C9KA 1IEAA 3MROB 4Y1AA 4QRTB 3L7EB 3FT4A 5DXWA 1WUNT 5KSVB 3TJEH 1NH6A 3RPKA 4UUJA 2W07A 4KKNA 3HI1A 1KIPB 2J7LA 1U8HA 5TFSH 4PP1D 4YK4C 1FZJB 3MRCB 3QDGA 3HNSH 3GI8H 1QA9B 1CDJA 5IFAH 3D0VB 3ABZA 3HB3D 5GS2D 4OSUL 1MREH 5DTFB 3MLUL 1NGYB 4BSVA 4M61A 2Y1VA 5J7CC 4X4YA 3C08L 5DO2C 4RX4D 1X5YA 4U1KA 4UT6H 4X5LA 2PXYC 5KOMC 3IDYC 5I1EL 3U7WH 4NBZB 5EOCL 1R3HB 2H1PH 2YD1A 3Q1SH 5HGHB 3IDJB 4YXKL 4OZIF 32C2A 1G6RB 4GRWE 4XVTH 2QBWA 5D8JL 4X7CC 3IXTB 4KJWD 4AQOA 1CFSB 1BD2B 1I9RH 5JIHA 3BEWB 4KMQA 3S4SB 5EBMA 4LQFH 4U6VH 4PJ9B 1FGNL 3U9UB 1LK3H 4NO0B 4R7NA 5T3XD 5EOQL 3O3DA 5C07E 4U1NA 4CRPA 4NUJA 4KTEL 1U3HB 3DSFH 5CZVL 2LTQC 3U9PH 3ILQD 3PL6A 4GG6B 1EFXA 5TPWH 5I8CA 3V4PH 3EAKA 1YPZE 5DUMH 1CVRA 3DTXB 3UO1H 4OV5A 2XQBL 4EN3A 3MXWH 3SKMA 2CKBA 4PJ8C 5AYUH 1RVFH 4AH2A 4XCEA 1CXLA 4X6DA 3RUGB 4LEOA 1ZGLM 5EUOB 3MX0A 3UXFA 4M6AA 6FABH 2YA2A 1G6RL 4OTXL 1OAXH 1WAAF 1ES0B 1G9MC 3CFKB 3FT3B 1HYSC 1NCDH 3K4DA 4N8CH 1ORQA 3MJGX 5GZND 5FF6A 3TF7C 3ZMRA 5IG7A 3G6DL 4L4TB 1RZJL 3IDGB 3MLVL 3I02A 2AXFA 1HH6B 1BIHA 1JZ5A 4NQDB 1QZ1A 3BKCH 1G7IA 3BD4A 1KBGH 3KS0J 4Y19A 4ODTL 1YC7A 2DQCL 1QR4A 1NFIA 1NQBA 2A38A 3WXVH 1A3LH 4Z7UF 2JJVA 4HS6B 1AR2A 1NCCL 4ZFOB 4LSQH 4MSWB 3BWAB 4LSPL 1FL6A 1WEJH 5MEOA 4M7JH 1NAMB 3D85A 5ILTH 1MOEA 5IVNA 4Y4FD 4MMZC 1HOCA 4L29B 2EIEA 4BJLA 4M8VA 5FO8A 3S5LB 2JCCB 1A7PL 1P1ZA 4JGJA 2CRMA 2C7UB 2CKNA 3H9HA 4EOWL 1FRGH 1E28A 4RSVA 5HHOA 5I1JL 4HPOH 2FZ3A 3QO0A 2PTTB 3MJ9L 5HHPB 5TQ2H 3QFJB 4MVBC 1U8QA 1FZOB 1CXEA 4PJCF 1ZS8A 4HWBA 4UDUB 2PETA 4KWUA 3ARQA 3R1GH 4XC3H 3UTTB 4NKDA 5DSCA 2UVFA 1F6LL 4I18C 3SQBA 1U3JA 4JAMB 4ENED 1BREA 5JQ6L 1KEGL 3QUYC 3R06B 1QFWI 4LLQB 1SEQL 3MZGB 4KH2A 1WFOA 5CBAA 1T3FA 2EDOA 4POZC 4K2UL 1R3IH 2DIBA 2BCKA 4NM8L 4TUOA 2D4FA 4ZOBA 3L5HA 3QEUA 4I13B 3LV3A 3X13A 5K9QG 5KOVC 5EU4A 1I1RA 1C5CL 3MYJB 3GIZL 4PRBB 2J6EA 3GM8A 1WTLA 4RA0C 4NQCB 2DJ4A 2UYLA 4NN6B 5F96L 5I76B 4CJ0A 1X4YA 1QYGH 5IVXB 1IC5L 4H1LB 1A6TB 4PRNB 4PJBF 1NFKA 1E4JA 4YDLC 1I1AB 2VLJB 3ULVE 1FP5A 5FKPA 1J05A 2JJSA 5F9OH 1DLFH 5IHBA 4R26H 2LFGA 3QIBC 5JHDB 1IGTA 5GS1A 43C9B 4IRSC 1ZVYA 3LRSB 2FBJL 5B21A 3GMPA 4F2MB 3WHXB 3KJ6H 1CBVL 5HJ3A 2FHBA 5I30L 4JO1H 1RZKH 3QG6A 4MJ5B 2VDRH 3MC0A 2FLBT 5E8EB 2H41A 5DJCA 1MRFL 2F54B 1PG7W 3K46A 1T1WB 3GHEL 4R3SB 4X9FA 1KF9B 1TITA 1JWMA 3I6GA 1RJLB 1MJJA 3D2UD 4WDIB 2A0LD 3C5ZB 1A6UH 3X3GH 1PW3A 4G8FB 1TVBA 2BVQB 4JO4H 5DC9B 1WAAA 4V2BA 1BQLL 4P23C 4QOKE 4WI8A 3DLQR 3LPFA 5FAAA 5EZJB 1MCDA 2J8HA 4QY8A 3X11A 2CXKA 3VG9B 4OFKA 3T08A 3GRWL 1GZQA 1S7RA 4ZPTB 5J9PB 5T5FH 4NKQB 3VG0L 1CFQA 1WBXA 4H88H 1VSCA 1O0VA 2PO6D 2I27N 4YE4H 3ZDZE 3ET9F 1OCWL 4LLWA 1OVZA 5I17B 4FP8L 1MFAL 3TBYB 2WWKT 3MJ6A 2Z4QA 4JE4B 5AZEL 3LKOA 1F90H 4M3KB 1JWSB 2B1HL 4AZ8A 4J3WA 1HKFA 4IRJB 3PXHA 3BGFB 4ZAKB 5C0CE 4MXVE 1FJ1B 4WHYG 3T4YB 3PHQB 5GZOD 3R0NA 2XZQL 1MCOH 3F5WB 2NXZC 5DVMA 1CFVL 3EFDL 4C56D 3PGFH 4O2EB 2IH3A 5KZCD 4AMKL 4HK0B 3WNNA 4MA7L 4M4PA 3QIBA 3KHOA 4Y16A 5HHVL 5I66B 2E27L 1E4XI 5KVDH 4IRSA 1A1OA 3P0YH 4OCMC 5C1MB 5ISZB 4X9GA 4EDWL 5IBTL 1J5OH 1DSFL 3SKUD 3S9DB 1KCUH 1QBBA 2HN7A 4HCRA 5HXMA 3HR6A 1TETH 4JQIL 5DQDL 4PB9H 1OAQL 4C56A 4XB8A 2G5BB 3MV7D 2EE9A 4NWTL 2HP4A 1UACH 2P5EE 1JTPA 4U49A 4LKCB 5C2UB 3VRIB 1JPFA 5J12C 3EHBD 2OR8A 2EKSA 4Y5VB 4KJPD 4QTIL 1B2WH 1IVLA 3FOLA 2VH5H 1UCBL 3L3DB 5L2KB 4N5EC 3WUZA 5JR1L 5L6YH 1NMCC 4GW1A 3STBA 4ZFZB 2F53B 4XBEH 1S7TA 2LAAA 3MV7A 4P23A 1KIQB 3OB0K 2NXYD 1VCAA 2FHFA 3H3PL 1A7OH 4P5TB 4MJIB 2ITDB 5CP7A 1DQTA 3GK8L 1OAZL 4P5MA 1QFHA 3CVIL 2AV1A 5GGQH 1JVKA 1GVIA 5EC2A 3T8XB 4L5FH 4ACPA 3HUJE 5JOFB 4TQEL 1GSMA 3NABL 4EBQL 2BDNH 4UQ2B 1I7ZA 1AXIB 1S78D 4Q7DA 5KAQG 1JF1A 3WXWH 5T1LA 1FNFA 1V3KA 3CFCH 1BX2B 1VB9A 1BBDL 2AK4D 3EDKA 4PV8A 3CU7A 1BLNB 4FTVA 1FLRL 5KTEL 4WU5A 3ZDYF 1R3KB 2APXA 4WY7L 4D0BB 1F3DJ 2EXYC 1H3PL 2BMKA 3DMMC 1W72B 3O2DH 3U79A 2YPLE 2Y36L 1ZTXH 4OLVH 1ZT4B 2AK4A 3PV6A 3LZFL 3BP5A 1QSFA 4JPIA 4LEXL 5CINH 1P7QD 4U1JA 4O2CB 3WN5C 4C4KO 2P8LB 1HI6B 3LRGA 1D5BA 2ERJC 5MP6H 5DMGC 5MEQA 2VDOH 4WWKC 4OCXH 4KJYB 3BW9B 3NGBC 4OZGA 4EVNB 5SX4I 3B8YA 5DHXB 3T2NL 4U1HA 4X7TA 3U46A 3V0WL 3UZEA 3U0WL 1CE1H 1DBBL 3FO2B 2W65B 2YXFA 1MVFA 1NKOA 5HGBA 3DO7A 4S2SB 4UOW0 3U30C 3KPSE 4PD4J 2BHYA 3GUTA 1CD0A 4MWFA 4OI9A 1MCBA 1RUAH 3TBWB 4D0CA 1C8PA 3GNMH 3VFRB 2YD7A 5INCA 3M07A 2ICEB 4WHTB 5F9DC 4OCWH 1W72L 2HKHH 1GOFA 2LV4A 1NCBH 4FOMA 4AM0A 1LD9B 3K8KA 2W9LA 3P4OB 1CTOA 5BVPL 1F4AA 3QIUC 1F11B 2NZ9C 4Z7VA 2EH8L 2OZ4H 4P2QA 4NQVB 1M7IA 4DKFH 3C6SB 5JZ7D 4X80H 3N85H 1X4ZA 1A6VL 2YK1H 4JPKH 5DQ9B 3B9AA 4KAQL 5EZOL 1MCNA 4Y4HB 4XVJH 4ELMB 2EH7H 1TQCB 3I75B 3VU2A 2NW3B 4MCYA 5L8JB 4EJ1C 4LLVA 1LO5B 2V7NA 4XPBH 3SGEI 3D69A 5JHLL 1JZ4A 2VLKA 3O9WB 3W11C 4KJQC 1JPGB 4KI5F 5DLML 3O11A 4JM4H 5EU5B 3DMMA 3REWB 4O00A 3PQYA 3RL1A 1S5HB 2F19L 2HRPL 4LCYA 2NY0C 1KPVA 4FHBD 3ARVA 5TE6L 2YOCA 1K3ZA 1A22B 1CI5A 1TNMA 5IVZA 1FL5B 1YPZB 3KPMA 5JW5A 1BZ9B 5CKGA 3WN5A 1U91A 3EYUL 4OD1L 1HNGA 4XH2A 5F1SA 2A6IA 3RWEB 5B3NA 3MLWH 3I6KB 3EOAA 4PYHA 4G9DA 3ARRA 2Z35A 3S3JA 5C86A 4TNWK 2JKXA 4H8WL 3KYKH 4FQLH 4G42B 5A40E 3T65A 1CL7I 1MNUH 1AGDA 5L9DH 3FB7B 2NY6D 4UIMA 1OWWA 5EU7C 2WM0A 4UV4H 3FTGA 4JFYB 3ZE2F 5HHXH 2AJSL 5I1GL 4W6YB 3FHQA 4OLEA 3GSOA 1B4RA 1GGIL 2Q3AA 4M7ZC 2W9DL 3MRMB 3AY4C 2FATL 2J4WL 2N7AA 5GGUB 1AC6A 4YFLI 5DJ2A 3SJVB 1C08B 4L3CA 4LHUG 4PRPB 3QWRD 1OM3H 4F15B 3QQ4B 5LCVH 5F1OB 3ZT7A 5CJOH 2BNRD 5GGTA 5C6PB 3WD5L 2PR4H 2X5PA 4YAQA 3ARDD 3MBEC 4PRHA 5F7DB 1YEEL 3W9DB 5I18L 3DRTB 1FVDB 1BBJB 1WZ1H 5FV1L 5IMKB 3TO4C 1K6QH 4RAVA 1A21A 3ES6A 1SMOA 3QI9A 4FFVC 3QWRA 1HSAA 1XH3B 3L9RA 1A7NL 4R0LB 3FZUD 5BOPA 4DOHB 3LKSB 3ARDA 4OCLC 1F00I 4DGIL 3THML 1QBML 3BDYH 4LCWE 4LSUH 3U6RA 3BPNC 1T0PB 4UMGA 2R2BA 3DIFB 1ZA6B 3QQ3B 1XF3B 4X4ME 1Q9LB 3FFCD 3RI5F 1T66C 1FNGA 4U7SA 4A6YB 2DQDL 4PJXB 3UPCA 3VXQA 4P4KD 4XRCA 2GTZB 4WU7B 3V6ZA 1X7QB 2NPLX 2VISB 1DQML 5CZXD 5TDOB 4CMMB 5ACZB 3GSQA 3BUYB 3JWDH 3UJTH 1OGAE 2IQAA 4NWUH 1A47A 1U3HC 2LU7A 5C2BL 4FZ8L 4U6YA 3VH8G 1K5NB 3F6LA 5BS0A 1E27A 3IDXL 1RZ7H 4XVUC 2XIDA 1I1FB 2MCG1 2DL9A 3V4VL 1C7TA 4PY7A 1B90A 1JK8B 2D0GA 4KI5D 2W1NA 5BMFL 4M1DH 5I1AA 3AY4A 3VD5A 2GEEA 1E4KA 1Z9OA 3H7BA 5E56A 5DJZA 2NNAA 2X4QB 3MROA 1U36A 1Q1JL 5ELIA 3L7EA 3ZKNC 4HEPG 3HFML 3TYFB 4ETYA 5KSVA 3EUUA 4A6YL 1R3LB 1H8OA 5FM5O 4ONGH 1KIPA 3V0VB 5IT2L 3L95B 2DKSA 5IM7B 1FZJA 3MRCA 2O26U 2ATKB 1G7QB 5HGAB 4CU7A 1QA9A 2X09A 1J1XH 3D0VA 3JV0A 1UVQB 1KCKA 5DT1L 4YEFA 1NGYA 2DB8A 4JREC 2FX8H 4U3HA 3ZHDA 1J0YA 5FCUH 3W81A 1AXTL 4ODUB 3RVUD 1J10A 4B53A 4PJ9D 1A1NB 4PGZA 1R3HA 4MD4B 4NO0D 2Z8WC 5F72S 5HGHA 3IDJA 3MBXL 3CFJB 1G6RA 1NCTA 3TJHD 3IXTA 1CFSA 1BD2A 1T7YA 3SCMB 1OP9A 3OJDB 3BEWA 2ZG2A 3S4SA 4QOKB 1GZPB 1N64L 5D6CB 4QRRE 4MNQB 1ZHNB 4PJ9A 1MJ8L 1RZGB 4LP4A 4JM2B 3U9UA 4J3TA 5IMMB 4NO0A 1J0IA 1S7WB 2JB5L 4PLKC 5D7IB 2Z91A 4E41D 2ZUTA 5IQ9B 5CGYD 1U3HA 3V6BR 4ALAL 4JRYB 1A9EA 4RMSA 1NUDA 4GG6A 1J8HE 1JHTB 2NY4C 1X5GA 1YEJL 2X1XR 4ZO6A 4LHQB 5IFHL 2X40A 5GS0D 4L3AA 4Z78B 2CRIA 2PNDA 3IFOB 4CADB 4JRXB 2WP3T 4NPYB 1C12B 3BQUD 2E6PA 1CK0L 2N7BA 3RUGA 2FO1A 1JI1A 4L4TD 5C0CB 4OCSH 3B5TA 5EUOA 3QG7H 3AMLA 3OV6A 3HE7B 1YN6B 1ES0A 3CFKA 3FT3A 5J1AB 4PRIE 3WNMA 4MGXA 3HAEG 4ZTPL 1LO0L 5EB9A 3EO9H 3MJ9A 4MXQC 1B0RA 4JFDB 1JGVL 4L4TA 3IDGA 1J7VR 3K7UA 4NN6C 3NZ8B 4NQDA 2MKLC 2IBBA 1JYWA 1ZANH 3ZL4H 1HCFX 1J0KA 5GJTL 4RIRA 4ZO9A 1I1AC 1U8MB 1N0XL 2GYSA 2AABL 3BN9D 3MJ8B 1YEFL 4HS6A 1D5MB 2OI9B 3PWNB 4FQ1H 4ZFOA 3NACL 4MSWA 3BWAA 2JJTC 1XGPB 3PF2A 5I0ZA 1V3LA 3KPRE 1TZIB 3FRPA 5ABDE 4G6JH 4LVNB 4YC2C 3S5LA 1Z6JT 3UTTD 2JCCA 3RGVB 3C6LB 1X9QA 4G43B 1XGTB 3JTSB 3O6KL 1SJEB 3O0RH 1B9ZA 5DD6B 4NJAL 4YXLH 2PTTA 5HHPA 3QFJA 1KYOJ 4KQ4L 3C5ZC 4L4VE 1FZOA 1T2XA 1P4BL 1JI2A 4UDUA 1H5BC 4MMXC 3UTTA 4MNHB 1KACB 1T1YB 4ELKA 4HJ0C 2DBLH 4BK5A 2R2CA 35C8L 3VG9C 2ED8A 3R06A 4K23L 4P9HH 1OP5K 5FYJH 1AY1H 4NQCD 2EYTB 5T3ZE 4FMKA 4WGWB 4APQD 3D3VE 4H5SB 1VESA 4WFGE 1DFBH 5BXFB 3O6FB 4PR5B 4JR9H 1V3MA 3OL2A 2M8XA 2XPGB 5IHUL 3GSXB 1H9VA 1TTUA 1OY3B 3WLWC 1CICB 3FQRB 4XWOC 4PRBA 3MYJA 5DRZB 2G75B 3UAJD 3JBG7 4ZAKC 4NQCA 3QQ9D 2ESVB 3VFSB 1Q9OA 4H26B 5I76A 3C5JB 1T89C 1LP9E 3JUZA