4JR9H

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
213
Chain Sequence
QIQLVQSGPGLKKPGQTVKISCKASGYSFTDYGMNWVKQAPGKGLEWMGWINTSNGYTTYGAAFKGRFSFSVDNSASTAYLQLSNLKTADTAVYFCARSWYNRAMDYWGQGTSVTVSSAKTTAPSVYPLAPVTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/immune system
molecule keywords Nitrite extrusion protein 1
total genus 38
structure length 213
sequence length 217
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H02
1PDKA 5IB4A 3PWLB 2ICWJ 1H15A 2KUTA 4RIRB 4PRBB 2AJVH 3LEVL 3U9PL 5D1ZB 3FT2B 3TZVC 3BZ4B 5FUCC 3X3FL 1RMFH 4GS7B 4JG1L 4GBXC 2DTSA 2R1XA 5EUOF 5HVWA 3ARQA 3Q5TA 1GAFL 4D0BA 4NN6C 32C2A 2IPTH 3H7LA 1KB5A 4L8CA 1CGUA 3O81A 3NGBB 4PG9A 2IADB 3Q2CA 2YEZB 3EW3B 4G7VL 4Q2ZB 5E00B 4DQOH 3BP7A 4HFUL 4WHCA 3OKKB 5FHBL 2V2TB 1Q0YL 5KJRH 4ZUVB 1HXMB 3L5XL 2W65A 3E8UL 3MUZ1 4YHNA 5AYQA 1TJHH 2ERJB 3BAEL 2CKBH 1ZVHA 2X1XR 1MHHA 4MA1C 3QIUC 3V5HA 3K74B 1T5WB 3BD5A 1AXTL 2OK0L 1QFUH 4YXKL 3RDTA 4HKZA 1EIBA 2DTML 1YZZA 5IVNA 4PPTA 4P46C 3IU4H 3TH4T 4UI2A 2YPLE 3OR7A 2A73A 1MHEA 1G7JB 2X2YA 2HYMA 3OX8B 2IADA 5CJXC 4CBPA 2WWMC 4OZGE 3CD4A 2VLRA 2B1HH 4WU5B 4MSWB 1CWVA 4D9RE 5CFHA 5D1ZD 2CQVA 4IDLA 4PJIE 5KANI 4NKMB 4NNXB 2A9ML 2HRPH 3LMJL 5CP3H 2IH3A 4XCFL 1B88A 5J6GB 2VAAB 3FB6A 1U8LA 3CVHL 2P1YA 2UUDH 3HC0B 3QUZB 2VN4A 3KXFD 2X4QA 2XYCA 5JHDA 4GW4B 4LU5H 5IW3A 2EEBA 4NRXB 3U0PB 4WW1A 1SHMA 2R0WH 4RWYH 5IKCA 2VDQH 5SWZE 3T0EA 1YEIL 2W60B 3BX7C 3BN3B 5I76B 1FNSH 3QXTA 3PABA 5LAXA 5IF0A 3NCFB 4JFXA 2FEEL 2EKSB 3U2SB 1FVCB 3ZKMC 3RVXD 4NFCA 3FCTA 1CBVH 5FYJD 3NA9H 4MXVE 4GG6B 1YN6B 5ESVB 6CGTA 4L3EE 5T5NF 3SJVB 4ZSOE 4I2XE 4QHKI 1BP3B 3O3DB 3B8YA 2GYSA 5KAQG 4YDKH 2E9WA 3P73A 1VB9A 3PXJA 4JFED 4M6OH 3VD9A 5C6WH 2AJ3A 1XH3B 4ERSH 5IM7B 2XY2A 4JFDA 5EZLB 4OKDA 1Q72L 3MQIA 1U3YA 1C12B 4ZOAA 3CSGA 3VFTB 2V9RA 2Z4QB 3CFEB 4V1DE 4DVRL 2GSIA 3D0VB 2FO4B 5JDSB 1BOGB 1OM3H 3QA3A 5CHNA 4GG6F 5KN5A 5HHPA 3S34H 3BKYL 3QIWB 4OV6F 4F37F 5BVJA 1FDLH 4Z7QE 3REVB 4TPRH 3HZMA 2X4OB 1VPOH 4ZODA 2XQBH 1T22A 5CMAB 1QD0A 4NM8H 5F3HB 2ZSVA 2CLVA 4LDOB 5IGXL 4BSWA 1JGVH 1J7VR 4UOW0 2CXKA 1NFIB 3JV4A 2PTTB 5LJYH 3VFVB 2BVQA 5CLWA 3BZ4A 3SGJA 4R4BA 4OTXH 1HQRB 4HKJB 4EI5D 1JHTB 2OCFD 2IAMB 1HYRC 3LEYL 3LPFA 2C3VA 3QUKB 4YFEA 4I2XB 1OSZB 5T1KA 3SJVE 5LGJB 1IM3B 4HWBL 5DO2D 3GM0A 2O5XH 3P4OA 5ISZA 3QUXD 4HEPG 4APQC 4R4FH 1GIGL 2FIKA 4AL8H 2PTTA 3MLSH 5DZLA 4LHJB 4I77L 4G8FA 1YEJL 5DJAA 4GG6E 3EYFB 1WTGT 1ZLUH 3HMXL 4TRPL 1YY8A 4HG4J 2DQFA 3RGVC 4MX7A 4EBQL 1J11A 5EO1A 3WIFB 5F9JB 1RUPL 2IH1B 1SJEB 1DBBH 4X4XB 4OQ1A 4NO0A 3IFNH 4FFWD 4MA7H 4POUB 5T1DL 1AJ7L 3QIBB 5C6TH 2VDPL 3A67H 2BVYA 5DA0B 1KJ3H 1XCQA 2DLIA 4MNGA 3VXSB 2VRAA 3TWCH 2OZ4H 2K9UA 1DVFB 3O8XA 4RISH 3T4AA 1HOCA 2IALB 4FABH 4H8WL 4QRRA 2F53E 2QQLL 4UIKL 2X4UB 5DK0A 5DD3H 2WANA 1LD9B 5F1NA 3ARRA 2KZ1B 1JN6A 4Z78B 1M05A 3EFDH 3TV3L 4HIHA 3BESR 5ERWA 1DFBL 5H37H 3VWKC 5AD0B 1TCRA 2R2EA 1VEOA 5DC0A 1I3RB 4HS8H 4LK4A 1KENL 2FX8L 2JLLA 2PXYA 4FFVD 2WP3O 1KC5H 4RAHA 5C6PB 2CDEB 1DVFD 1OTTC 5FK9A 1N0LA 1NEZG 1WSST 4ODXA 4GG8A 4R97C 4ZYKA 3C9NB 4U1GB 1GYAA 1GHFH 5DRZB 2NLJB 3DMMD 2YRPA 3LKQA 2VLMD 1XIWC 2VSDA 4FMFA 1YEGL 4XVUD 3G5ZB 4HKXB 5C92A 2VLKD 2ARWA 3ET9F 4ODVL 1XCTB 1CT8A 3CIQA 3DNKA 3SGEI 3SO5A 1QSZA 3V5KB 2PYED 1ZV5A 3G6JF 2GFBB 2XIDA 2YSSB 5JW4M 2R0ZH 4IHOB 1RUQH 2BZDA 1T2QL 5CEYB 5HGHA 4PP1D 5HYSG 1S8DA 4LIQL 3KPNB 4X5XA 4W6XB 1QFWI 2L7JA 5I1EH 2IAMD 5FEBA 5H37G 4N90D 2BFVL 4C58B 3RWGB 5E9DA 4PLNC 2CIKA 3JTTB 4HS3A 5J56B 1ZE3C 1NC2B 4P4KD 1OTTD 3B2VH 2HG5B 2E6JA 5GS2H 4J3OC 3RJDA 1JMXA 2BHYA 4ENED 4NWTH 3O6FA 4M6OL 2D7PA 4Z0XB 2H8PA 4HUMB 2DQTH 2ID5A 3HMWL 4HUXA 5TF0A 1LP9B 1KYOJ 1EGJA 1JYVA 5J12B 5J6HA 4K7PH 3VFNA 3ZE2E 4HBCL 3D85A 4PLKC 3AAZB 2IAMA 3V4VL 3NOIA 4OM1H 4JQVA 3VXSA 1A6WH 4MYWB 1P6FA 2HH0H 4LHUG 1LDPL 1JWMA 2OM5A 4GRMA 5CILH 4J8RB 1MFNA 2D0FA 4H88H 1JI1A 4PREA 4GSDL 4F37K 2Q8AH 1XGTB 3M45A 2DB8A 2ZCHH 4JB9H 5EU7C 3RIAF 3GSRB 2MFNA 3C6LC 5HHQA 3E6FA 4W4OA 4NQEA 1ZHBA 4F8TA 3BP7B 5C09B 5IJKA 4P4KC 1EA9C 5E6YA 4QKXB 4X8JB 1T3FA 5T1MA 4DTGL 2AEPH 1NUGA 1CZ8H 5GGQH 5K9JH 4HBQA 5ADOH 1MFCL 1XGQA 3G5YA 4DW2L 4ORGB 4K71C 2C7UB 3BISA 5ITFB 2MHAB 4LCUA 3AB0B 1G9MH 3X12B 1EUUA 1RURH 3TNNB 3ES6A 2NXYB 3MLTB 3T0EC 4GRWE 4PJBB 2E5EA 2OSLB 3WD5L 1KJ2L 3HFML 4AIZB 5MP6H 5MEND 5EU7E 4MMXC 1I8MB 1K8DB 5E2WH 1Y6NR 3EDKA 3RTQB 5GRZA 2Y25A 4PJ9B 5C0AD 2F19H 3QFJA 2RR3A 1F3JA 2HT3D 5CZXC 3A6CH 5EPMA 3U48A 3PNWA 2FHBA 2EO1A 2QQKL 4OLWH 2KZWA 1EDQA 4LPCA 2X1PA 1NGQL 4Y2OA 1F4XL 4WFGD 1D5IL 1MJ7L 2HTLD 2XN9A 4PJHE 2PCPB 2X7LB 1ZVSB 2UWEF 1WWBX 1OPGL 2E6QA 5L2KB 2DLFL 2H6PB 4JQIL 4R2GD 4F9LC 5EBWB 3SDDD 3DHJA 1REIA 3MROB 1TQBC 4N1CA 2VXQH 5HHVH 3I6LE 3OR6A 4OQTA 5F7UA 1FP5A 2CRIA 1U8OB 5CEZH 5CSZA 2FATH 3AB0C 3ARBD 5BV7L 1NGWA 3OB8A 1B2WH 4HWNA 2EDTA 4NQDE 3I6KA 4R90L 5E8OA 2R4RH 4BQCA 4LPTA 4OLZH 5DMJB 3NACL 2FJFA 1DSFH 3I84A 4MA8L 1JJUA 4WI8A 1QG3A 5HHME 2XZQH 4R8WL 4X7FC 4XZUB 3QCVH 2IH1A 3QNXB 3D18B 4ISVB 4ONGL 4DEPB 1E4XL 5JA8B 4KJYA 1OB1B 3ILPB 1AI1H 3D5OF 4E9LA 1BQHA 1ZLSL 3WFDH 3OKLB 1JPGA 2APXA 1F2QA 1G6VK 3UDWC 1CDCA 4ALAL 2ED9A 4CU6A 3U9UB 3MYJB 3PWVB 1DLFH 4FQLL 1IAOA 4JRYD 1NMCB 5E2TL 5E56A 4XRCB 4UQ3B 1N5AA 1RZKL 3EO1B 4LLQB 4GMTH 2XPGB 3O9WD 2MTPA 4GKNA 4FXKB 4RAUB 4JM4H 3MLWL 5HHMB 4ZUVA 3EYUH 1SYVB 43CAA 4M4PA 1EO8H 1KBGL 3D9AL 1NMAH 4KFZC 4OFPA 1VERA 3OPZL 3ZHKA 3V8CA 4KI5C 1JHKL 1PW3A 4HC1A 5CEXB 2QQKH 4OLWL 5GGVH 1TPXB 4D0BB 2A6IA 2BSSB 3CFDA 5E4IA 1ZHKA 2AJSH 4Q74A 3M17A 3MSPA 2P8PA 4JR9H 4CW1B 3D0VA 3E6HA 1DL7L 4LBEA 3VRLF 3BHBA 2H32A 2I60L 1FAIH 2WLZA 3SDYL 3STLB 4G42A 2WQ8A 1K6QH 3GMPA 5SV3A 4M7LH 5DI8B 1JNJA 4P5MB 1CL7L 2F8XC 3C09C 1CK0H 4HAFA 4L9LC 5C09A 2Q87A 4WTXA 1TVDA 5GSRA 2FBJL 5HVHC 4OUUB 4K7PY 3QWRA 2Q6WA 2C3WA 1YEIH 1AXSB 3TC9A 1UZ6F 3KPMB 5FFLA 1WFNA 1JV5B 1I3GH 4UT7H 6FABL 5L9DL 5ADOL 4MAUL 2RJMA 5SWQA 4GUPA 5IIEB 4YLQT 2L7UA 3PGFH 1NAMB 4B7LA 4DKFL 1R5VB 4M6ML 5GIRB 1GGCH 1FPTH 2ZUVA 2NY4B 3KYOA 1WEJH 1F11B 5MERA 4PBXA 4YUEH 1ADQH 5HTSA 4PJCB 5I1JH 3VFGH 2A9NH 5EU3B 3I9GL 3IDXL 2IFFH 2DQEH 2HFFB 4UU9B 3S3JA 5J9PB 3VI4E 3DROA 1VADA 3EOAB 1ZLUK 1J1PL 5IB2B 4ERSL 4NT6B 4X6DA 2DIBA 4QNPE 3KWWB 1NUNB 2VZ3A 2ZUSA 1T1XB 2RIKA 3OAUH 43C9A 5DC9B 2AJYL 5K9QG 3ULUC 4F7EB 1AGFB 3C09B 5GGUB 1UJ3B 2J88H 2EC9U 1VEMA 5I1AB 3PP3K 4RFNC 1GH7A 3QQ3B 5C0DA 4TYUA 5D2NE 4OZIF 2NQCA 5L2JB 5L88L 3GMRB 3L3DB 3NABL 4K3DH 1QNZH 4QHUA 4RMUA 2WBJB 5BZWB 2PO6B 4ZFFA 2APVA 3EYQC 1U9KA 2W9DH 2X09A 4WI2A 1RQ5A 3QWQB 1OP5H 2APFA 1J88A 2CIIB 1A6TA 5HSFA 2SEBB 3UYRH 1TZGL 1FVEB 1KCKA 3GBMH 3R4DA 4UINL 1HSAA 2G75B 3C5ZC 3CZFB 4X6DF 3OAYH 3QUMA 1V5JA 3UZVB 3FQRA 5IB5A 1QBBA 4HJ0D 3VMPA 3B3IB 3GSVA 5F3BB 3K4ZA 3UMTA 4FQIH 4IOIB 5DS8A 4PTTB 4JHAL 1C7TA 1YYML 1EJ6A 3G6JB 4LPWA 1PKOA 5E00A 3X3GL 1AE6L 5ENWB 4YO0A 5KSAA 1A6UH 1MCBA 3HZYA 4G9FE 3GSRA 3LN9A 3MCKB 4BFIB 4HCRH 5F7EL 4N0YL 3MV7E 3GSNA 5C3TA 3K80A 4AEEA 3WSQL 4PRDB 4HPYH 5FUOL 4D0CB 3EYQD 1OWRM 4OGAC 4Z5RB 3N1FC 2J8OA 5TF1L 3O4OC 2NY1B 2C1OA 3G04B 3VW3H 2ZPKH 3PWPA 3O45A 2ESVD 4ELMB 1ZA3B 1B0GB 4JN2B 1IGYA 5EUKA 3WJLC 1DQDH 1KACB 5B8CA 2GITA 3OJDB 5D9SB 4LSPL 5HHOE 1YEHL 1YQVH 2X70A 1L0XA 1JWSB 1S7SA 4RA3A 2YXMA 5D1QA 5D7SH 1D5MA 3CC5A 5D7KD 3MZTA 4M1GL 3VI4F 5D1XA 4FZ8L 5KS9B 1EXUB 5D7LA 2VZ1A 2GTZB 3IXAB 1XR8B 4FQCL 3UTOA 2D3VA 3G6AB 5E4EC 3MJ8A 3UTSB 2ZG3A 1IAIH 4JQXA 3B8SA 4PJDF 4TUOB 5KSVA 4Y2DA 4PD4K 2AXGA 1YEGH 4G5ZL 1MFDL 5IVZB 3NMEA 5B3NA 1F00I 3QQ4B 3V0WH 3DPBA 4N5EC 1G0DA 4O2FB 4KKCD 3H9SA 1A6WL 1IVLA 2ADJB 4JO1H 1A4KB 1NSNL 1FG2A 1NFDA 1O5DT 3RU8H 2XG4A 3VGHA 3KJ4B 4K3EH 2HWZL 1QFOA 3ESVF 4KDTA 2X89A 3BGMB 3NPSC 5JXAL 3P11H 5D6CA 3ZMRA 4OF6A 4XGZA 1KTRL 4G6AD 1CTOA 2JCCF 5IB5B 3CX5K 3GKWH 3FONB 1CXIA 3A67L 2PETA 2Z4QA 5EFIB 4JHZA 3BD4A 5FK9B 4PY7A 2GK0B 2NY5H 5D70H 4YGAB 2O5ZL 3CFJA 3OJ2C 3RPKA 4OSUH 1J1XH 4PJFE 3PHOA 1F8TL 4ZUSA 4L4TD 4XP6H 4XP1L 3ARDC 3MJ7B 1GVIA 4Y1AE 1OD9A 2R0LL 3WUWB 4L9LA 1JUFA 5HGDA 4ZFZB 1A1MB 3QEHA 4EUPA 3VD4A 1OARH 2KKQA 1CS6A 2HT2C 1FNGB 3LVEA 1OTSD 2ADFL 4KVCL 1H8OA 3LZFL 4JZNB 1MCPL 5EO9A 3ROOA 5IMKB 1JZ7A 4ZS7L 1IM9A 3DIFB 4PIRF 5D5MA 3ZKMD 1GC1C 3GMNA 3QI9D 4FZ8H 3LQAH 4U1JB 5HI5C 4MX7B 1H3TA 3EUUA 1SVCP 1J0HA 5DD6B 2HJFB 3SE8H 1HHKB 4UZGA 4Y5VA 5BZDB 5E2UH 2EIZA 1PKQE 3CLEH 4LGRB 4RWHA 4G8FB 4PJEF 3AU1B 5EU5B 3QUZA 3Q3GB 5IB1B 1VACA 4WW2F 3BPCB 4AMKL 4IIQA 3RWFB 1PQZA 3QO0B 5F1IB 1Y18B 2OZ4A 1S9YA 3INUH 4LNRA 3W11C 2QQLH 1NBQA 4PJAB 2UY7A 5B3JF 3N85L 4I18C 4LRIC 1VGKA 1JRHH 4LQ1A 2VE6A 5BVPL 3DVNA 3PWUA 5FO9B 3SDXF 1U8NA 4L8DA 3BDBA 5T3XL 1TZIB 3F7YB 4KKBC 2BK8A 2XKNB 1RFDH 2FX7L 1AHWC 1W0WA 2HFGL 4TSBH 4ZOCA 5A2LH 3V6ZB 4E0RB 3QI9C 2XA8H 3P9MB 2K3TA 4PRID 5HGBB 3WFBH 3S5LA 3TJHC 4TQEH 3OKEA 3BZFB 1TTUA 3ZDZE 3ARFB 2DBLH 3KPRE 4HGWB 3BPOB 3EYOB 1EHLL 2HT4D 3MCKA 3LOWA 3QH3A 1OB1A 3ILPA 3K4DA 2F54B 4ZUSB 4NIKB 4UT9L 1FGVL 4PG9B 4LIQH 3B9AA 3BPLC 3NIGF 4P57B 4AIOA 5HD8D 4KVNH 3WFZA 4ONFH 5J11C 3S7GA 1EEQA 5GS0H 5TE7L 1DTUA 2E27H 3V2AR 5GS3A 5ACLA 4UQ3A 3RP1A 1JNNH 5EULV 3FONA 1JF1B 5HDOA 3FN9A 3IDGA 1FL3A 4XCFH 2OTWA 3RIFK 1CXLA 4RBPH 1X5YA 3RUGA 3O6FC 2XWBB 3CH8A 4MHHG 3GSOB 4O9HH 1VHPA 4U6HA 4W4NA 3QHTC 3TVMC 2R29L 1J9CT 3U82B 2BXZA 1UGNA 4Q6IC 2R39A 5I17B 1WBXA 4P2YA 1WWAX 5L6YH 2BRRH 1RK0A 5BRZB 3IJHB 2CO6B 2ADIA 3ULVF 2X7LA 4MXQC 1YNKH 3T4AB 5GS0L 3T04D 1U3HB 3KPQB 4BH8B 1EJOH 1NL0H 1U42A 5DC4B 4GXUM 5I74B 1A21A 1O7VA 3BYTA 5CUSH 3ARYA 1RZJC 4YGVB 1UKSA 3QFJB 3JWDC 1BQUA 2QADD 5KS9A 1UCTA 2BNRA 4PRIA 1C16A 1JP5A 4KUZH 2Y06L 4XWOD 4BFGA 3FFDB 1U95B 2XT1B 3FZUD 1ZGLB 2YPVL 3FFCE 4LLVB 5DXWA 4N0CC 5DJYB 4CNIA 2IQAA 3EYOA 3B9KC 4M00A 5FOBA 2DL9A 3WS6C 5DK3A 2MKWA 4JRYE 4KGLA 4QXGL 3C6SB 5ID0B 3CCHA 3EDEA 1QR1A 3FN0H 1X7QA 3LEXA 1MREL 4HEME 2DQIL 1T7VA 2WUBL 4YXHL 1AKJD 3VWKA 4KQ4L 1BWMA 1UYWH 4TOYH 4UV7L 1KXVC 3RPIA 3OHXB 1K3ZA 3B6SA 3VGGA 3BRFA 3HPJA 3TFKD 2XXCB 3U7WH 4X4ME 1U6AL 4PJ7E 5ENWA 2KH2B 3U36B 3JBG7 3PXHA 3CXHK 4LQFL 5A16B 3IDMB 3LY6A 5TQ2H 1BHGA 3QCUH 4S1QH 1RHHA 4UAOB 1ZLWK 1QQDB 4WEMB 5HDBF 1U58B 3O3AA 4ZNEE 1R24B 1PEZA 3R06B 2D4DA 1FPTL 3CFDB 2A6IB 1A7OL 2BSSA 2CKBA 2QBWA 1HEZA 2YA2A 3JSSA 4HHAB 4HUWA 4XPGH 5IB4B 1WWCA 4WV1A 4KXZI 4TULH 5C0EA 3IGAA 4NHUA 3L1OH 1XF3B 1S9XB 3FT4B 4MS8D 5K33A 1FJ1A 3MV8D 3FQWA 3M1BA 3FQNB 2ZP0T 3MJ6A 3BDYH 1SEQL 4RAUA 1R3JB 1QUNA 3KXFB 4OCYL 2AEQL 2FLRT 3IFNL 2HMID 5FHBH 3KG5A 4JZJB 4N8VB 3U4EA 1YN6A 4MXVF 3C5SB 4S10A 5MHSE 4GT7A 1DSFL 3L9RA 2ORBH 1A7NH 3MRGB 1KTKE 4LOUC 3L3HA 1KLGA 2XZAH 3UZQA 2JB5L 3ULVL 1S9VB 3RX5A 4L4VB 1PLGL 2FJGB 1H3PH 4J3WA 4MNQE 5HDBE 4YDIL 4XCNB 3NA9L 1F13A 1XT5A 4HXBL 5FA3A 1WBZB 3BUYA 1S5IL 4KKAD 2DN7A 4OZFH 4FFYL 4JGJA 3VD3A 1TIUA 1K5NB 1T0MB 4M3KB 4NKQB 5C3LD 1IAIM 4U1LB 2FB4H 3QFJD 4P9HH 4D9LH 5LCVL 1G9MC 3TBSB 4X4YB 1ITCA 2GY7B 3IDNA 3MRPA 5ETUB 1NJ9A 4ZYKB 5KBNC 3SGEH 4NO5B 1UEYA 4JQVC 4I3GA 2W91A 4GXVH 2LQRA 1QFWH 1INQA 4NCDA 2DQJL 1KXTB 2KBGA 1INDL 3BN9D 4KJWC 5FYJU 5C7XL 3HNVH 2P24A 4WHYH 1P53A 3TBWA 3EZJB 3QEQA 1X5ZA 4WI3A 4M9OA 4JDTH 5FA3B 1NCCH 1EX0A 3BI9X 1DQMH 2VDNL 3MFFB 3K4AA 3ARFA 1UH2A 4XNUL 1SEBA 3UYOD 5F7MC 1AQKH 3VXUB 2BXYA 5AZ2L 2XACC 1MHHB 1SJHA 3DXAA 2PF6A 4OF0A 2OK0H 1G0YR 1M7XA 3GJFB 5EBLA 3QDMD 4K8RL 4X5WB 3QIBD 3P4NB 5LGHH 2YBRA 2XXMB 4KPHH 1FC1A 5FA4B 1FZOB 1A1NA 4P2CG 5DD0L 4ZS6D 5KVDL 1D9KD 1YEKL 3MBEC 5GGRY 3D39B 1YPZF 5E99L 1UB6B 2VE6B 2OSLA 5KVGH 4ZUWA 4OSUL 1TVBA 4ZPVB 5C07D 4UT6H 3ZT6A 2AK4B 3DYMA 4Z18A 1IARB 1VCAA 3CX2A 2Z93A 3DX6B 5IMLB 2YPLD 4LEXH 4HWZB 4PJIF 5CCKL 4PJDA 3QO0A 3U83A 1HINL 4UTAH 1OSPL 1S7TB 1CFSA 2IBZY 5D93B 1TQCC 1CQKA 1T5XB 1KB5H 3NAAL 4C56A 4L4VE 4PJHB 1D3CA 2R1WA 4YC2C 3T3MF 1EXUA 3OKLA 5D7LB 4LCIL 5CGMA 4P46A 4EXKA 5F93C 4O4YH 4G6MH 4LIQE 2IF7A 1AR2A 5KANG 4AEHH 1FO0A 4CU8A 5KS9F 2EC9T 3U46B 1VFAB 4Z7UA 3VFMB 3BZDA 4FTVD 4EDXA 3C8HA 5D7JB 4ZFOA 2IQ9L 4UT6L 3AM8C 3RY4A 4TNVK 4R2GB 1PSKL 3CDGB 4POZD 1C1EH 4K9EL 2H1PL 3HC4H 4XMLL 5E08L 3TNMA 2NXZB 3VXME 3FQRB 5IHBA 1CD1A 1LK3H 5E8OB 3S5LG 1NBYA 4EXPX 3DGCR 4GRWB 5FOBB 4PB9L 1S7WA 1TCMA 3G5XB 4FA8A 1U8IB 5JHLH 2NY6B 3K8KA 3VDBA 2VXTH 2A6DA 4HUVB 4PJ8C 2B4CC 1A14H 3GGWB 3RY6A 5LKNA 3UTTE 1LEIB 1KYOK 2CPCA 3MO1B 1FFOA 2ZNXA 3KS0H 2P49B 4LSPH 4FQXD 1T20B 3QDHA 4JKMA 2X4OA 3DV6B 2NW3B 4JO4L 2BNQB 5E9DB 1X4ZA 3BH8A 3VXTB 4XAWL 4J3SA 5IEKA 4DVRH 3B3IA 3GSVB 4OFVA 4WWKA 2EKSA 3U2SA 3QUYA 1A3LH 1GPOH 2WLYA 1NEZB 3A6BH 4BFEA 15C8L 2D2OA 5IFHH 4YH6A 3IFPA 1KOAA 1AE6H 1C5BH 3DV6A 5DJZA 4AQOA 3T0EB 1VADB 1BFSA 3WL9A 2NY3B 4Y89A 3SQBA 4DZ8A 3W5NA 4JRYB 4NFDA 3C2SA 5DWUL 5HPOA 2Y4SA 1H5BB 4Y5YB 3WJJA 3MLRL 4PY7B 1MCEA 1UFUA 3IFLL 4GG6A 3N06B 1L7TL 1JF1A 5F7WC 4C56D 1MCOL 3V95A 4JHBA 3U6RA 2V2WB 4YFLF 3H9ZA 3VXTA 4XTRD 1V3LA 1DQLL 3EJYC 3QIUA 4EVNB 2FECI 1T2QH 2DWDB 4X80H 3L3KA 3BH9A 1S7SB 4I48A 1HHJA 5F21B 1LEIA 2OXHA 3GMQB 4N1EA 5JIIA 2RFXA 5IK3B 1OGTB 4OFIA 1OAQH 5IR1A 4FRWA 2C4XA 4I5BB 2AKRA 5ACZB 3GIVB 1NCBH 5A3ID 4QHMA 1D9KA 2HFEA 3U4AA 4RDQF 5KSVB 5L0QB 1NC2D 3MODH 3IFOB 3QIBA 1DJSA 2E7CA 3G6AA 4ZFGH 4GW5A 1QLEL 5IMMA 2YK1L 3O2WL 1OGTA 1X9QA 1KLFA 3MRLB 3UPCA 4JM2B 4WI4A 4TSCL 5FM8A 1A9BA 1F6FB 1FO0B 2FZ3B 1VPOL 3P4LA 3QNZB 1CVRA 1FGNL 5F7LB 3H9HA 3MRMA 5GS1A 4O2CA 4DCQA 3ZTJH 1IKFL 4OLYH 1XMWA 3NPZB 2HN7A 1CICB 1HI6A 4JFEA 5DFVD 1WK0A 1L6ZA 2M2DA 4OZIB 5DD1H 1IC7L 4MQXC 1SEBB 1U58A 3O3AB 2YPKB 2MSPA 4NQSA 1JZ8A 5A1AA 1QLEH 4ZPVA 2WUBH 4A2LA 4YXHH 1T03L 1HCVA 1OAXH 1ZGLA 5E94A 3L3JA 4UV7H 2VLJB 3L3KB 4UNTA 4QGYA 1UB5B 4XAKD 4ZFFB 2MJWA 2W07A 1TJGH 4R3SA 4NOBA 2R23A 4MDJA 3P0VH 2X4SB 1INQB 2QR0A 3LD8B 5GRVK 4DGIH 5E8NA 3SDDA 4DGYH 1FIEA 3D2UA 2J6EL 3EO1A 1A3QA 3WE6B 4G6FD 1BQLH 3P40A 4GAJH 4HDIB 4NT6A 4X6DB 1H3VA 5C0FA 3Q1SL 4GQ9L 5CJOH 2Q7YB 5J1TC 4JFQA 5DR5H 5BRZA 5DVOA 1BJMA 3RA7H 4GO6B 3DO7A 4N8CH 3QEQB 1JGLL 3H0TA 3WV0A 2F5BH 1K2DB 4LLWB 3DSNA 2J1KA 5EO0B 4JPIA 1SJVA 1T2XA 2XRAH 4JCMA 4M3JA 3MTRA 4EUPG 5TDNA 4JZOA 4FQHA 4NQEE 4IMLB 1DQQB 3UBXA 2CDFB 4H1LA 4GSDH 2BJMH 1T80A 2V6HA 3ZL4L 4OLVL 5MEQB 5EBGA 4Z7UB 1PAMA 1ZK9A 1DUZB 3O4LD 3U7WL 1UEMA 2J12B 3KHQA 4Q7DA 5EU6D 3NCJH 5CD3B 5I1GH 3NPSB 4YDKL 4PRHB 2E7MA 2E7LC 4V1DB 4CKVX 1XF2A 3UTQB 1TETL 1F6AA 3D3VE 3MBEA 2H6PA 4O00A 2Z31A 2NY4D 2Q3AA 4MA8H 2EDKA 1NAKL 4FNLL 4MCYA 1PJ9A 3TT1H 1Z5LB 1CFQB 5CEZL 4DW2H 4LCUB 4M5ZH 4UDUB 2WWKT 2GUOB 1FL3B 1NKOA 1QKZL 1XGQB 3G5YB 5E7BA 3P9MA 5DD5H 1TITA 1DDHB 1C5DA 3S6CA 4GJTB 4EOWH 4U0RB 5E2JA 3MA9H 3BWAB 3QG7H 5GSRB 5F9OH 3RTQA 4YK4B 3NABH 5ITBH 1KTLA 2PYEE 4KHTL 4PR5B 2J6EH 3EHBD 1KJMB 5JPMB 2BVOA 2D31A 5ICZA 1YJDC 1E28A 1I3UA 4KV5F 4KKNA 4RGOH 1IGJB 1NGQH 3DXAB 4MWFA 5SWZB 2C1OB 3G04A 1RU9L 3FO0L 4GW5B 4IRJD 1OTUD 5HYJD 3QXDB 4OFYD 1JFQH 5IQ7H 5ITFA 3S37L 2PXYC 4K3JH 3S4SA 2NY7L 3MV11 3MBXH 2AJVL 2P4AB 2NPLX 2AV7B 3FB8B 1XGYL 2UWEE 2AV1B 1KJMA 1P4LA 5I30H 4UBDD 4EQ2A 4MCZA 3UTSE 1EHAA 3GMOB 4PJIB 2FD6L 3D18A 4WO4C 4JY4B 5L0QC 5DJXA 1OHQA 3BKCL 1E6OL 1JYNA 5KS9E 1QHOA 4Y1AD 4OZGB 5T5FL 4BZ1L 5I1CL 4FQ2H 3MV8B 3UAJD 2ADGB 2FH8A 4W81A 1MLBB 1FRGH 1QR1B 3CMGA 3FFCA 1P7KB 2ZOLA 1IZKA 2B2XH 3BJLA 3PWLA 4MNQD 3MYJA 2VDOH 1NDMA 3F7QA 3DMMA 4JHWL 1VESA 3EDJA 2I25N 5C0AE 2CIIA 1N0XH 1K4CA 3HCVB 3CVHB 3SKUD 4X7TB 3WMSA 5D72L 3UC0L 4XPFL 2NMSA 3N9GH 5DHXB 1DQML 1EFXD 4YPJA 5IB3B 4KU1A 3GMNB 4LASH 2VQ1A 2FJGA 3QDAA 5I1AA 2NY2D 1ZLVH 4AENA 1MREH 4G9FB 1U92B 4GRLB 1ZHNA 4KY1L 2CDFA 3D69B 5IJVA 2ZUUA 5J3HC 1FSKB 4NDMA 1YNTA 5INDB 3WN5A 1R3JA 1OAZH 3RHWK 3WUWA 1EHXA 1QVOA 1J1OL 3UAJC 4JFPB 2AGJH 1TZHB 5F6IB 3MV9D 2DYPD 2ED8A 3H0TB 1FNSL 3BDXA 2H2SC 2ZJSL 4MCZB 1CGXA 4XVUC 1I85C 1RULL 5EC1B 3ZZ1A 3F6LA 3HG1A 1WC7A 3BUTA 1A4KA 1Z9LA 3VG0L 3ECBB 4NNYB 3QFDB 4FFYH 1PY9A 4YDVB 3DUUB 2XQYG 4XVTH 1U8PB 4ORZC 4NOFA 5F1SA 2A83A 2NX5E 3UTTD 1HHHA 1V7NL 3H7BB 2BVTA 3D25B 3DJ9A 2N7BA 2NY1C 4GG8B 3MRQB 2XKUA 4OZGA 4U49A 2Y1VA 3GI9H 4FFZH 5I73B 5D2NB 4DFIA 4PJ9A 1QSFB 3EIFA 2H3NA 1FHGA 2AABH 2VH5H 1II4E 1MCHA 2V2TA 4HK3J 3AMLA 2C3GA 4NNPH 5DGQA 1HK6A 5IOPA 5SWSB 4WNQB 4APQB 1D5MB 3CC5B 5GS0C 4O51A 4QOKD 2V5YA 3BZEB 2X5PA 4I3SH 4MNQA 5INCA 2QADC 3T77A 4LAJH 3W0WE 3VXQB 4KK9C 5FYLD 1RIVL 1T7YA 3MV7D 2J6EA 3FRPG 1J5OH 1IKNA 3FZUC 3HNTL 5F1IA 4DUVA 4OFKA 3GBLA 3OGCA 2D4FA 2EO9A 5TH2A 5GZOD 1ADQL 1KPUA 5GGTA 2R56L 4HWZA 2IG2L 3V4UL 3WFCL 2FDBP 1RZ8A 2HA1A 1RZKH 4F15C 4PRDA 3UTPE 4NO0B 4WVRA 3U36A 1XR8A 3P0GB 4Z7VE 1HH6B 4H20H 2CRYA 4URTB 1FG9C 4BFBD 4E5XA 4NRYB 4JM2A 3B83A 3SPVA 3C08L 5E95B 4YGVA 4HKBB 5CJBA 4LLQA 4K2UL 3AGVA 3TFKC 3W9EB 5TQ0H 3RVVC 4KRPD 4FXLA 4HQQH 4QNPF 1ZHNB 4P3WA 3WFBL 1MWAB 4Z7NE 2EE6A 5JXAH 3SDCA 3VFNB 1CFVH 2BY0A 3L7FB 5D7IA 2AGJL 3A6OA 3ULUE 2CKNA 1JPGB 2VN7A 5DJYA 2ZCLH 3F65A 3GSQA 3U0WH 1GC1H 5FUZL 3MJ7A 1BF8A 3VFWB 3OJVC 1WIUA 1EEUA 3HFMH 2A9MH 2HRPL 4H1LH 3UO1L 1P4BL 5DRWB 1A6ZB 2DQCL 4G6JL 4PRIB 5EZIH 5E2WL 3T0ED 4PJXE 2Y07H 4HS3B 1HXYA 4M8QB 5DEGA 5ETUA 2BERA 3ARWA 5DUPL 2HKFH 4WW2C 1AGEA 4P5TD 2R0WL 4L3CA 4DTGH 4RWYL 2HMIC 1XZ0A 2D9CA 1SBSL 3CJJA 2NW3A 3NIDE 4Y19B 4ZTOH 2X10A 4PJDE 3TCLB 2EH7H 2VO5A 1Z9MA 5JHLL 3PHQB 1KCSH 1XF5A 4TUKL 2BCKA 5BS0E 1MAMH 2DLGA 2XTJD 3LIZL 3WYRA 2BSED 4JPVH 4R2GC 3VG9C 2DM4A 1U8KB 4GOSA 2LVEA 2FYYB 2YA1A 4OD3L 5ISZE 4AJ0A 1S9VA 3TZVA 4J6RL 4U2ZA 5C08B 2Z8SA 3KYOB 4OZHA 3VGBA 2B8OT 4M03A 5ALBH 2AXFB 5SWSE 5EPMB 3TNMB 3GNMH 2UYLB 3RDTD 4X5LA 2AERT 3MLUH 5D6DA 4GXVL 1QSFE 1ZA6B 2YUVA 1KGCE 3QULB 4UNUA 1A7PH 3PHSA 4BKLA 4H25A 4QXTB 2JCCE 3VD5A 1I4FB 2V7NA 3CFKA 1U36A 2NW2B 4PGCB 3MO1A 2ZCKL 2QKIA 2X4UA 5C0CD 4RGNB 4WUUB 4HHAA 1I9JH 1NLDL 3H9SE 3ZO0A 5MERB 4EN3C 2BC4B 3OGCB 5H35A 5F8RC 1KJ3L 3ABZA 2Z31B 4QCIA 1EUTA 1QQDA 3CDGA 3KPSB 5JW4N 1Q9WB 1U0QA 4KAQL 5IR1B 3RWHA 1P4BH 3GRWA 5EA0H 5HGGS 4BFIA 1D5XA 3E6FB 4ZUWB 3U46A 1QSEB 3HTLX 4GW1A 2EYSB 5DSCB 3C5ZB 1DDHA 4WU7B 3VGAC 4TSAL 2ICWI 5B38B 4U6YA 5FM4A 4HKZB 1HKLH 4PJFA 4FQXB 1TLKA 2AXHA 5IFAL 3JWOL 5KVEL 4QTIL 3U30B 3WXVL 1MCWM 2H2PD 5J7CC 2F15A 4WHDA 3AREC 1EVUA 1FFPA 3DO7B 2UZYB 4LSRH 3CLFL 4XP1H 4YHPB 4HIXL 3QUMH 2AVGA 5DUML 1Y6KR 1MUJA 2R4SL 4MZ2A 1I8KA 1QACA 1AGBB 3O0RH 1NCNA 2AI0H 4B41A 4JRXB 4OQTL 3X14A 3ULUH 1UQSA 1KTDA 2E6PA 4RFEA 1UADC 1DQQA 3N50A 3UBXB 1KEGH 4HMCA 4WWKB 1HWHB 5TFSH 4Z95H 1AJ7H 1F42A 3LAFA 5FHAL 4XCYA 4NBZB 1NC4B 3AFLA 4ZS7H 2YC1A 4HX1A 4YHZL 4HSQA 2DI7A 1WBXB 1T0PB 3P77B 3BKMH 3OQ3B 3LZFH 4CJ0A 3F5WA 3QXVA 7FABH 1EH9A 1I1CA 4WDIB 3MUGA 4C57C 1S7VA 1FZMB 5FB8B 1B6DA 2VQUA 1G7HA 5FGCE 2XWBA 3MOAH 1RJYB 4MJ2A 4HJJH 2AK4D 4U6HB 4NKOA 2EH8L 3PE9A 3ZKXB 2GY5A 3NN8B 3IAPA 4LFHD 4OTXL 2DMKA 3ARFC 4M62L 3VXRE 4LSDA 2ITCA 1KN4H 4X6CE 3ULSB 4MNHA 4BYHA 5K9QI 3N85H 1P2CB 2IEPA 3BPOC 4XBGA 1K85A 2A6KA 4HFWB 5ISZD 4GQPH 1G9NL 2EDXA 3WNMA 3ZYZA 4HG4K 1U41A 4MVBD 3TPKA 4XPBH 3MPCA 3C87A 3M1BB 2VDOL 2YWYA 1AXIB 3SDAD 3TT3L 1T1YB 4YPGA 2B1AH 1JNHB 3S98A 1N6VA 4O2FA 5JW5A 1S7WB 3HE6D 4UDTA 4F7TB 3MA7B 4CU7A 1UA6H 3HI5H 3WXVH 3S8WA 1KELH 2HJLA 1MRDH 2IH3B 3R06A 4X0KB 2C7UA 3GNML 2VZOA 5HGBA 1EBPA 3KLHC 3ULVE 4CDGC 5D7JA 1AI1L 2WNGA 4EI5B 4KJQD 3PIQA 1S78C 5SWZD 2E7HA 5EN2A 3HB3D 1T1WB 2DTMH 3Q6FB 4QXGH 3C8KA 3EFFB 3UTZB 1VSCA 2XN9E 1MEXL 4PJHA 1MIEL 3RPIB 2NZIA 4R0LC 3BT2H 2P48B 4G42B 4K23H 1ZMYA 3U79A 1I3GL 1VFMA 1DEDA 1X5JA 1K4DB 4JM2F 3WKML 3HE6C 2DIJA 1V7NH 5BZDA 1UKTA 5LWYH 1CLYH 4YIQB 1QLRA 4J2XA 3GO1L 5JLZB 2DDQL 1HHKA 1ZHBB 4WHTB 5FGSA 1FNEA 1AO7E 2W59A 1LDSA 4M62H 3X3GH 1UJ3A 3GJEB 4ZTPL 2CIKB 5I1HH 3IDNB 3RTQD 2HAZA 2C1PB 3RNKB 3P9WB 4Y4FC 2I9LB 3GFUA 3I6KB 5I2IB 4RIRA 2BNQA 3OKDB 1SM3H 1LEKA 3V0WL 1TFHA 4HWEH 3NCBB 5I6XB 3ZSSA 3QHFL 1HINH 4MD4B 3WXWH 4XH2B 4NC1E 3MLZL 3PP4H 3FMGL 3GIZL 5D96B 3MROA 5ANMA 4F57L 4MQ7B 2GAZA 3IFPB 3MGAA 1UZ8B 5MENA 2JJVA 3FCTB 3G9AB 4PJ7A 4Y7MA 2CLRB 1U92A 4ODXB 5HYIA 1UXSA 4XMLH 3MRNB 4YHKL 1JPFA 2Q8AL 3Q1SH 4WTZG 1CYGA 1I8IA 1IFHL 2AP2A 2DJ4A 3WXWL 3I2CH 5JDJA 2B5IB 1JK8A 4X9HA 5FGBA 1RZIA 4P5MA 1CE6B 1WFUA 4QT5A 4NQED 1IQDB 2DQEL 2BSRA 5D71H 3H6JA 1S7TA 5KSUB 2YPKA 3EGSB 2VZUA 4OGZA 3TJEL 1ED3A 3IDYC 4D8PA 2EECA 1R24A 3UTSA 1LEGB 1CD9B 4YZFF 2OS7A 1LO5A 4HS8L 1U91B 4BQ9A 4TVPL 1X5XA 4RFNB 3LS4H 3RWJA 4LAQH 5FGBC 3TO2A 2FSEB 3P9LA 4F58H 4M9PA 1HH9A 4X6CB 3JUYA 5F9AC 5ERWB 3D2UD 4H20L 2CDGB 3C08H 2WIIA 1P4LB 2EIDA 4LMQE 5DJ2B 1FH5L 4HGWA 4MXWL 1T5XA 3RVWD 1OP5K 3P4OB 5JHDE 5AWNH 1A6PA 5DD0H 1ZT4A 4R6UA 3GBML 4I0PC 4NJAH 4QF1A 1IGYB 5FIEA 4KZDH 4CVZB 3KPOB 1RZGA 2VL4A 1EFXB 2R1YA 4NRZA 4OJFH 1UCBL 3BPCA 3PP3H 4ODBD 3T0EE 1LNUA 5FUZH 1BJ1J 4D0DB 1XF2B 5TDPA 1YDPA 3SGKC 4XPHL 4OZFB 5CZXD 1J12A 3PL6A 5DO2C 4KVCH 1EGJH 5GRUH 1G7LB 4O5LL 1A7BA 3MRNA 5D2NA 2I5YL 2X40A 3M8OL 2OL3L 4QRSB 4GKNB 1IGFL 4HFWA 5IGXH 4I2XA 4HS6B 2VLKA 1X7QB 3LEXB 3HG1E 1KC5L 1MY7A 5CJQH 1R3LA 3I6GA 3NVQA 4QRPD 2VITA 2LABA 5L8LB 1A7OH 3TJHD 1RJYA 4JO3L 3MBEB 1AXTH 3WFCH 3ARBC 6FABH 1BBJA 2PXYD 1P9MA 4LARH 1G7MB 5GRJH 4DZ8B 3V4PL 1AC6A 1A1OB 3PGFL 5D2LF 4H88L 3W2DH 3SQOH 4Q0XL 1BVKA 4OB5L 5JMOC 5MI0B 2OZ4L 4H5SA 1BF2A 5DURB 4MAYC 4Z77B 3IYLW 4PUBL 3NIGE 2P5EB 5HD8C 4TSAH 4HUUB 5JTWA 4ETYA 2G2RB 4MJ5A 2GSIB 1Q94B 1DVFC 2XA8L 2FL5B 4FQIL 4OD1L 4ODHL 4LVEA 4XC1H 1E6JL 1CIUA 4G7YL 1MFDH 3RI5K 3IGAB 5EU3A 2YSSA 2DQUL 1UWGH 4X9FA 4XPFH 3QPQD 1A8JH 3SOBH 1P5VA 1LGVA 2VXQL 4HJGB 1RZJL 1IEAB 3OG4B 1I1AC 3OAYK 2DQDL 3AS3A 3KYMA 4MB3A 2CUHA 1WZLA 4KC3B 2GT9A 4U05A 4XP5H 2WW8A 3S5LB 2Z35A 5T1KD 5HYSB 4U1GC 1KT2A 3D2UB 5HHOD 3GJEA 4MB5A 2XICA 2IAMC 2WUCH 4U7MA 5HYEA 4X4XA 5HHQB 3QR2A 3U30C 3K8MA 2EE3A 5IHLB 3UJTL 1Q1JL 1CE1L 4MNGE 5EN2B 3HZKB 3QDGB 1AY1H 1LD9A 3MACL 4NQCA 4Y4HC 4XNMA 1RIUL 3CDCA 3RBSA 4GW4A 4QRRE 5IMMB 2F53A 5C0GB 1MCPH 3QHZL 4JN2A 4CAGA 2MHAA 1XGRB 3FB6B 1MWAA 4OD3H 1RAMA 4JFEB 1XF1A 1HQRA 2J2ZA 4PJDB 1RJLB 2HLFD 3O3BB 3M17B 3LHPL 4LSVL 4YQXH 1RIHL 3MMEB 4RFOL 3H3BC 1F58L 3H2WA 5DVNA 1DBKH 3MNZA 4Z7UF 2P5ED 5ID1B 3OF6D 5F3HA 1NGPH 2CKBL 5JQ6L 4YO0B 2IPKA 4NKIL 1KB9K 1SVZA 2A0LD 3I02A 2NYYC 2I27N 2NR6C 2YEZA 1GZPB 1DN0A 4P2OC 3JWNC 1PGRB 3ARVA 1ZA6A 1RJLA 1EHNA 3C6LD 4N5UA 2Y06H 3HS0A 2BY2A 1S9WA 4KI5F 4MXWH 2M26A 4PFEA 1ZTXL 5J11B 4PGZA 1I9IH 3OSKA 5IHUH 4PYHA 2EEAA 4MCYB 4ZUUA 5CINH 3LKRA 3OXSB 3KLDA 5D1XC 4HUXB 3ARTA 2X4RB 5FYKE 4LDEB 4MNQB 1IZJA 1XGUB 3HC3H 5C08D 5KZCD 4RGMC 2VERN 4NQVB 4PV8B 3MLVL 3GRWL 5AG8A 5K59E 1BZ7A 4R4FL 1F58H 4AL8L 3LQAC 1IM9B 3DIFA 5D5MB 5I1IH 3SKMB 3CVHH 3HZMB 4M7KH 3IDIA 3VA2C 1BIIA 4QRUB 1TVHA 1MHCB 3VFRA 2FJFB 2NR6D 3N1PC 3ZHLA 1IKFH 3QDGD 2HT3C 2MKLC 3SCMC 2EZ0D 3UPRB 2R23B 4PD4J 4KRPC 3R0NA 3LV3A 2VDRH 1G7HB 3HPLA 4X99A 5EZLA 1NDGB 2XG5A 2EYTA 2BRQA 2XQBL 3DXAD 2R15A 4MJIB 3AROA 2B1AL 3X11B 3IU3A 1N7ML 3WL9B 4ZNCD 3CUPA 3TZVD 2B0SL 3RGVA 4XWGL 5E2UL 2YC1B 5BQ7B 4P9HL 4D9LL 1N8ZA 1MVUA 4MNGB 5I8KH 2ZSWA 2J8HA 3F7VA 3BKCH 4PJ7B 4O58H 3AREB 2HKFL 4Z7WF 4JO2H 1E27B 3ARXA 2X4SA 3HS0B 5LQBH 3G9VA 5BO1H 4UOW1 5ESQA 3OKOA 3HR5B 4IS6B 2FZ3A 3ZKND 4QY8A 1QSEA 1U8JB 2VB5A 1JHLH 1S5HA 3DUSA 2PN5A 1S9XA 3HCVA 2HJKA 4FQJL 4KV5E 4AG4L 3C6LB 1F3RB 4PJCF 4PJHF 4RX4D 1H3WM 3X12A 2XNAB 5HJ3A 1T04A 3G5XA 2LVCA 1C8PA 1S9YB 2AS5M 3FFCB 4LVNB 2AXGB 4A6YA 2VDLL 1HI6B 1IAKA 2IWGA 2CH8A 1JGDA 2VAAA 4QHMB 1L7TH 5IIEA 4KUZL 3MRBB 4KJPD 1S7QA 1NMBH 1MFBH 2PNDA 4KTEL 4M43L 3QFJE 5F9JA 3GHEH 1YEDB 3AXLA 2OJZH 1QPPA 3H9SD 1T7XA 1IRAY 1G7JA 2XZCH 3EO0A 3ULUL 2E7BA 4F33A 4Z7QF 1ZKAA 3QUXB 3ZKXC 5E2TH 5E6IC 1GOGA 1R3IL 5BRZE 3L5WA 4KH2A 3GSNH 3TPUB 1V05A 1PQZB 2BY1A 4NHCL 2XQYK 2D03H 4M61B 3QQ9D 3SN6N 4ZMAT 4Z5RA 3KDMA 2JKXA 2APTA 1YMMA 2QL1A 2IGFL 1PG7X 2VUOA 2RFXB 1X5HA 3PQYA 3QJFB 1JHKH 4GXUN 4CMMB 1NAMH 3LN5A 3HG1B 5EWIH 5J0BA 4JFHD 5J89A 1MFCH 4BH7A 4FXGA 3B5TA 4PG2C 4PRNA 1NC2A 4P3CH 4K7FA 2FL5A 4XXDA 1BJ8A 4G8GD 3BW9B 2J8UB 5IW1B 4NCC1 3BEVA 3BP6A 2A6JA 1J86A 4QTHA 4NUGL 5GGSA 1SJHB 4UB0L 4MHHI 1OT1A 2UWEB 4Y5YA 3MCG1 4JVWA 5KW9H 3CSYA 1ZS8B 1JYXA 4M4RA 4OI7A 5IKCB 4G9FD 1I7ZB 1Q8MA 2J8UF 3P73B 1V8HA 4Y8DC 1BBJB 1MCCA 5I8CB 1DUZA 3LPWA 4R9HA 2MPAH 5C70A 1WVZA 5ADPH 2HT2D 1H3GA 5EFIA 4M7KL 5DHYA 2DQTL 3CMOL 1AGFA 4LPYA 4QRQA 1AR1D 1ZXQA 3AREA 1UXWB 4M7LT 4XI5C 1PG7H 1D6VL 1BWWA 1CF8L 3HI6L 4ZO6A 1JV5A 4Y4KA 1WAAE 4OCSH 4EOWL 2BHZA 4KROB 2FBOJ 3ILQC 5B4MC 3RVTD 3L3OB 4U1SB 1A0QH 5DUBA 2G60H 5KW9L 3CUPB 4LLDA 5EU4B 1MJ8H 4JVUA 5D9SA 4ZNEA 3LN5B 4NCC2 1C08A 2BFVH 3IVKA 4D3CL 2VTFA 3GSUA 4ONHA 2Z0BA 3ES6B 4X6EA 3IKCA 2VXVL 3HAEB 2Y9RT 4LLYA 4MZ3A 12E8L 1NC4A 1AGCB 1EFXA 1I1YB 2R1YB 4NRZB 3PWPB 1EFQA 1F5WA 1TPXC 4C4KO 1QNZL 1RI8A 4GBXA 1EJOL 4RAVB 2QSVA 4IRJB 1GGTA 4KZEL 3X14B 4P23D 5INCB 4U7SA 2CD0A 3SKMA 1L7IL 4KGJA 5F7KC 3WIIL 1PZ5B 1X5AA 4FQ1L 5I30L 1FORL 1JIBA 1FNFA 3OJMB 4KRMB 2FSEA 1QRND 2YBRB 4Z7NF 3ARBB 2YUXA 4C83B 1KPUB 5F3BA 3LS5H 4Y5YC 1MCSA 3PV7A 1IAOB 4OKVA 2J4WH 3H3PL 1CFNA 4KTDH 4ODWA 5C0JB 1T21A 5GS1B 4PRPA 5B38A 4ZDHB 3QIWC 5EC2B 1HQ4A 2HJKB 4U1MB 4X6DE 1F6AB 1YC7A 3GHEL 3S88L 3P0YL 1NGYA 1QBML 4PRHA 5AAMA 5GJTL 5D7IF 4U1JA 3MRLA 1F3DH 4W68A 1FZOA 3RY6C 3MMEA 3NIFF 3JWDH 4KJQC 4P23C 1IKNC 1E27A 4NC1C 3F62A 4X0KA 4JG0H 1CIDA 1TNMA 3ARSA 3REVA 3WDHA 5I66B 5KJRL 4OT1L 5FDYA 5IUSA 3TA3A 2EDHA 1I1YA 3O4OB 5ALCH 4KI5E 2XFXA 2UVFA 4OCSL 1A6AA 2PW2B 2OR9H 5CZVL 2V5SA 3ETBF 5CUSL 1U8PA 2UUDK 4Z8FL 2ADIB 4YE4L 5J1SC 4OCWH 1WAAF 3WS3B 3C6LA 4I9WD 4N68A 5IG7A 5IBLD 4J3XA 1F4WH 5DFVC 4XB8A 1NANI 1RSFA 3MUY1 3C8DA 4X7TA 2P24B 3VMNA 1TZHA 2H45A 3MNVB 2FX9L 1ZHLB 5GISL 3MXVH 4JFYA 3MLYH 4G6KL 3HE6B 1T4KA 3FKUS 1HHIA 2DKMA 3SDAB 2GI7A 3OWEA 1QPXA 3W0WA 4GMTL 3MV7A 3EOTH 4G6AC 5IROC 5CKGA 1ZANL 3RTQC 3TWCL 1BMGA 1BLNB 2IFGA 1DANT 3NTCH 8FABA 4CRPA 3PWPE 2Z91B 1ORQB 2HTKC 2RQ8A 5FKAA 4A2MA 4LQFH 1V7ML 1FV1B 4NRXA 4I3RH 1OCWH 4BZYA 1Q0YH 1XZ0B 3SE3A 2VMFA 4L4VA 2JF1A 5F7EH 3MV7B 1MCKA 3TYGL 5EOCH 5HHOA 3BVNB 3KYKL 4NZUL 4J1UA 1PG7L 4YNYB 4P5KA 4X98B 3V0VA 3AY4A 2EDDA 1X5GA 3W5MA 2IANA 3HZVB 5EH1A 4YHMH 2V5MA 1I8KB 3V52H 1YMHA 4Y16A 4LCWB 4K07A 1T0NB 3OHXA 2OR8A 1IGML 2YRZA 5HY9B 5GGVY 1C5DB 2DYPA 2XA3A 3FB8A 4MD5B 5IBUB 25C8H 5HI5D 1DQLH 1HE7A 1WWWX 2N4IA 3LKRB 3OXSA 4EDWH 5L8KB 2HVJB 3T1FB 4LNRB 1DANU 3D6GA 3L5WB 2VL5B 4QLRA 1RD6A 5EIVA 5F6IC 4LKCA 2YR3A 2Q8BL 1A3RL 2VR4A 2B5IC 3BIAX 4PJXA 5JOFB 4I5BA 4WU7A 3CLEL 1HXMA 1IEBB 5GGTH 3F58L 4NYLA 2C4FT 1FBIH 2CGRH 1KIRB 1RUMH 4DEPC 1OT2A 3BQUB 3VXMD 5HBBA 1KF9B 4NO3B 4W6WB 2YZ1A 2LTQC 3FO9A 1IAKB 4N0YH 1RUAH 5C0JA 1MJUL 1U3HA 1XEDA 3KPQA 3H42H 5DMGD 3SDDC 2P7TA 1SYSA 4KKAC 2WBWB 4B0MM 3GI8H 1XF4A 3NGBC 2I24N 5DEFA 1MRDL 4Y1AA 1SBSH 4U6XB 1KCVL 4JDZB 2SEBA 1NH6A 5SWSA 1I9EA 3PL6D 1CZ8L 5F96L 4PJFF 1R3HB 2ILLA 1GRWA 2DKSA 2DOCA 1HDMA 2KDGA 4WV1C 3S96A 5J1AA 2FR4A 1MFEL 3RWJB 3THML 1NANH 4DK6A 4OV5A 3DUHA 3GB7B 3QQ3A 2GHWB 5C0DB 3RWEA 2AXFA 1T4KB 3O2VL 4IRZL 3O41B 1S7XB 1UZ6E 4YDLC 1JUFB 4ZFZA 1ED3B 5C8JB 1PKQA 1JTPA 1U3HC 4LVNC 1N2RA 2GJ6E 5CZKA 1UQSB 4X6EB 4I1NB 2FNBA 5DMGC 1FL5B 4TVSa 3MRKA 4F7MB 1AIFB 3ARPA 1NBVL 3ARGB 4IRSD 1F4AA 3LV3B 3K2MC 4M48L 3L5JA 3BMVA 1GZQA 3GHBL 1G7PA 5JNYB 2ZUTA 3QDMB 4G80A 5EZJB 3QIBC 1BZ9A 4H0IA 1I7RA 2DS4A 1D9KC 4Q9CA 1MLCB 5CD5D 3BDYL 4OV5B 3UTSD 2NY2C 2AEIT 3QP3A 5IVXB 1MCFA 3FB7A 2R8SL 2XY1A 1G7LA 1KFAL 5EO1B 2VWEE 3IU4L 5AD0A 2XRAL 5HXMA 4OCRL 5I8CA 5E5RB 4BK4A 3WDIA 2EYRA 3JV0A 4JJ5B 4WFHD 1E0OB 3KJ6L 4GKZA 1MRCH 3WBDA 1N3NA 3RA7L 3S35L 2JB6B 4UV4L 2H2SD 3TYFB 4WW2B 1DVFA 5MEOB 4MJIE 4L8SB 5IVZA 2LE9A 3RWFA 5F88A 3MRHA 4EI6B 2ADGA 1QRNB 1WITA 1QHPA 3ZE1F 1J1PH 1U8HA 2OI9B 1KJ2A 1NCAL 1S7RB 3ARGC 1NGZA 1W0VB 3HKFA 2C3XA 3ULVC 4BQ8A 2NY7H 3VMOA 3NACH 2A9NL 1M6OB 5FGRA 5GZND 3OX8A 4JFZL 3VG9B 4I48B 1DBJL 4QRRD 2NXYC 1VGEL 3RJQB 1IMHC 1P9MC 4GMSH 2NY0D 2O5YL 3TIEA 1KELL 1KB9J 5F7DA 3QDJD 4NQDB 5DQ9A 2E7LA 1AY1L 2DICA 5BRZD 1BEYH 2MQ0A 4J3TA 1CR9L 1HIMH 1BX2B 4WWID 5AWNL 4KK8D 3GK8L 4R4BB 3WHE1 2HLAA 1NMAL 4PG2A 3KLSA 5GSVA 3H9YA 5IBTH 4Q9RL 3HZKA 4U6VH 2P43B 1G84A 5HHMD 4KK5C 4YDIH 4F3FA 3LS4L 2GEEA 1N4XH 5DVMA 2AW2A 3ZT7A 5TPWL 3RBGA 1WZMA 4DZBB 1GXEA 4KPHL 3PDOA 4R7NA 4NKIH 4NSKB 5EO9B 4EI5A 2QHLA 2GTWA 3KXFE 4YNYA 3SDYH 4LU5L 4MS8C 2CLRA 5T3ZL 3HAEG 3PDGA 1V3MA 1LO5B 5FF6A 2BNRE 2V2WA 2VIRA 1I7RB 1O0VA 1MIEH 4F7CA 1HHHB 1F6LL 4HC1L 3P2TA 4NGHL 2G5BA 4UDTB 1F3DJ 4F7TA 3TA3C 5JUEH 5DT1H 3QI9A 3OAUL 4CNIB 4M5YH 5FYLE 3VJ6A 3C60C 4OLVH 1LP9F 4MJ6B 4YXLL 1YEEL 5J9PA 1D6EA 1KEMH 2F74A 3T3PE 4CADA 1INDH 1BZQK 4LHUB 2FWOB 2A6DB 4LCCA 3WS3A 5HVHB 4HUVA 3VFWA 3WLBA 2O61B 1LEKB 3O0RL 5INDA 3GKZA 3E3QE 3ZDXE 5GGUA 1LO0L 4YBLC 3O3EB 4BUGA 3HLAB 3KNBA 5I15L 2WAHA 4X4MA 2NY6C 4JZOB 4KTEH 5D6CB 5EB9A 5T5FH 5IWLC 3FTGA 5IVOA 3FOLB 2VQ1B 4K7FB 3MGOA 1LWRA 1P69B 3GEWB 3KPMA 3JXAA 1JGEA 5HI3C 5ABDE 2PUQT 5GS1C 4JFFA 4QXUH 5CAYB 1YEEH 3GGWA 1CI5A 1WJ3A 1ND0B 5I8OH 1LP9E 1NCTA 4YFDB 1A5FH 1AH1A 3HC0A 1EPFA 3UO1H 5TH2B 4XMKL 2UZIL 2XFXB 2OTWB 1FYTE 4ODTH 3BEVB 3BP6B 3VRJA 4F7CB 1QFHA 4OCXH 2Y5TB 1U8MA 4UUJA 2AK4A 5SX5H 3GO1H 4LSUL 1JZ3A 3GUTB 4PJAF 2F58H 4FXGB 5I1DB 1QLRB 3MC0A 2BOCA 3UBXG 4NQSB 4RAVA 3U1SL 5C0AA 3SKOA 3ZKNC 4UB0H 1ZT1A 3LKOA 4PJ5E 1QRNA 5D1ZA 4OZGF 1FFNB 1ZGLM 2GSGB 4LBEB 3GSXB 5CSBA 2V7HA 1BM3L 2FGWH 4E0RA 4YHNB 2WV3A 4ODUA 5JMRA 5MENE 1MIMH 1TDQA 3LQZB 5FV1L 2YUWA 2D7OA 2QTEA 4UOJA 2VXSL 4HK3N 4LGPB 3MV8E 3HRPA 5I1JL 4KMLB 4JFPA 2Y23A 3MJ9L 1G9ML 4K94C 3MBXL 4PGDB 1S7QB 3KJ4C 5DRNA 4CGTA 1QZ1A 4YBHA 1YJDL 4LEOB 4IIQB 4LDLB 2DJUA 4MD0A 1MVUB 2BSRB 4UT9H 1YEHH 5D93C 3TYFA 4JQXC 3KPRB 5CCKH 1T2JA 2CUIA 2VDML 3TM6A 5ICYA 3TBTB 3IB4A 4YK4C 1JWUB 1BQHB 3W81A 4JRWA 2F74B 4P4KB 4YJZL 2X9WA 3DXAE 5JHDB 3HR5A 2OTUA 5ESVA 5MEQA 3DGGA 5JPNB 5I9QB 5CIPH 3DVGA 1U2HA 3HI1A 4NZTL 4EIZC 2CUMA 5D7JC 4IRSA 1NGPL 3SOBL 5B8CC 5JQ6H 3MREB 3EAKA 3T3ME 3PGCB 4DGYL 5TDOA 1GC1L 1MHCA 5EOQH 2Z35B 3FOMA 5I76A 3DRTA 3IXTB 4AT6A 5BQ7A 5JZ7C 3MNVA 3D1MC 4AYFA 4U2YA 4TVPH 1H5BA 2W9EL 1G7QA 4LSQL 4U1HA 1T7WA 2BCKB 4J4PD 4ZXBC 1AIFA 3D9AH 1OQOA 1CLOL 1BFVH 1IBGL 3DX7B 3IJYB 1LK2A 1QOKA 4DGVL 3E3QC 1RJZB 3DARA 5I2IA 1BOYA 4WJ5A 3GMPB 3RVUD 1BM3H 1JGVL 4N0FB 4KUCD 4PRHE 1KLGB 1E4WL 5I66A 1N6QH 5JW3L 1XGPB 5DJ6A 5C07B 1VEPA 3V6BR 3BMWA 1J8HA 3TESA 3O6MH 3BD3A 4Z7UE 2R9HD 5DZOA 2OMNA 1Q9OA 4NN7B 4PRNB 4HH9A 3WIHL 3V7AG 3C5ZA 4KRPB 3FQWB 4JLRA 4XTRC 4GAFB 3X13B 4OM0L 1RIHH 4LLAA 2NY3D 4YHPA 4O5LH 4GAJL 3VXMA 2GJ6D 4AY0A 4OCNC 4QRTB 2CK0L 4JPKL 3WNOA 2DQHH 2MQ3A 3SDAC 1CICA 4P2RE 1Q0XL 4TVPE 1BAFH 1FO0H 2P5WE 4PGBA 1VFBB 1UACH 2PO6D 2YD9A 1MHPH 2JB5H 3QWRD 3T65B 5TE4L 4DUXA 4XNMB 4L3EB 1DN0B 3VH8A 1JPTH 2AJZB 4NRYA 3DURA 2R2BA 1W0YT 3SDXA 1JZ4A 2VSCA 3HC3L 1CTNA 4OB5H 3MGOB 4JLRB 3W9DB 4XZUA 1IEBA 1T83A 4FXKA 3KPRD 3INUL 4XPTL 4GRMB 1FVDA 2HJLB 1OAKL 4RX4A 4XP9L 3NA4A 4WUKH 5C0IB 3O45B 4ODSL 5F88B 3MX0A 1JTOA 5ID0A 1X4XA 5D2NC 5BS0A 4IRZH 1Z3GH 2AKRB 5ACZA 3MRFA 3WLBB 4WJ5B 1BQHG 4EBQH 1RUQL 4FTVB 3VRIB 4P3DA 4JM2D 3DUSB 4I18B 5IFHL 3O6KL 2J3SA 5L8JB 5EOTB 1CN4A 3KLAB 3LMJH 4PY8I 4KK6C 7FABL 1PY4A 3QUXC 3WFDL 1XCTA 1YEJH 2IANE 4CJ1A 3BP5B 2BNUB 3PF2A 4NUJA 4QWWC 3AS1A 4PS4L 3KYKH 4HT1L 4JE4B 1NBZB 3RGVD 4RMRA 1RK1A 4YHOL 2ATPB 2ICWA 5E8EB 2YPLB 3KYMB 2R0KH 4NQCE 1UWEL 3W0WD 1PBYA 2R69L 2VWEC 4M8VA 3V8OA 1A1OA 1C7SA 4BA8A 4P23B 4ONFL 2R4RL 5C0BB 5KAQF 4CVXA 4N9GA 1HSBB 3HRZA 3R1GL 4I18A 4LRIA 4QRPB 4PV9A 2YMXL 1FNHA 2A1WL 1R3KA 2NY5L 5D70L 5DDHA 3D39D 4HPYL 1D5IH 4DK3A 5DRZA 5C71A 2Z9TA 4X83A 1MCNA 1UENA 1WF5A 4I9WE 3A6CL 1CG9A 1QO3B 1IGCH 1A6VL 4NGHH 2FHFA 5T1DH 2R2EB 5ID1A 4HJJL 4KK9D 3K2UL 3VXRB 4NQXB 1G7MA 2R2BB 3T0AA 4TOYL 4JDZA 1M05B 2V5RA 3TEUA 3B5HA 2F5AL 3BSZL 4JANB 5KOVC 3ZTNL 4PREB 1RZ8B 4R90H 1OLLA 3R8BB 1MFAH 4Z0BL 4JKPH 5FGCB 1IE5A 3CVIH 3QDJA 1OY3B 4HV8B 5T3ZE 2P8LB 4X6FA 2ZUYA 1IJ9A 4P9HC 1M7IB 3L9RB 4OLEA 2Q3ZA 1YYLH 4WGWB 1YPZA 2DIAA 4HKBA 4C83A 4JJ5A 2DF3A 1R5WA 4YZFE 3IS0X 1JGUL 4B50A 4FZEL 4W6YB 2Q6WB 3WS6A 5GXBB 2V9TA 2AQ2A 4Y2DD 5DLML 1WGOA 4D2NA 1OLZA 3FN3A 1W0VA 2H3NB 2GJ6A 4LOUD 3O3UN 2ARJQ 3NCMA 4XT1C 4OCRH 3GUTA 4Y4FA 1HQ4B 4PJ5D 4U1MA 1A9EA 2HTLC 3FHAA 2ZCKH 3G6JA 5DQDH 5I1GL 4XBPA 1J8HB 1UT9A 2ENYA 3LS5L 5F70A 4E42B 4A6YH 2IBGA 2R29H 4QYOB 5IHZA 4XPAL 1VACB 4KDTC 4I8DA 4UTBL 1LILA 4OF5A 1IGIL 1TJIL 2OR7A 4YBLB 3MODL 3IJYA 4PLKD 4JJHA 3P4MA 3O6FB 4I13B 2HJFA 3PWPD 4TUKH 4D9QE 1CG9B 3VXSD 4AH2A 1KIQA 2D0HA 3PIQB 4JKLA 2CSPA 1B4RA 4N8PA 4XCEA 2MPAL 1YNLL 2EDJA 1T89A 2VXTL 4OT1H 1QSEE 4UIKH 3D69A 4WO4D 1CLYL 3LH2H 5HYJA 1MI5E 2CXGA 5DRXB 5IEHA 5JXEC 2YKLH 5SV4A 1KN4L 3KPSE 2D7NA 2CR3A 3MOBH 3KLAA 1EAJA 2NY0B 4P4KA 3Q5YA 3U0PA 3DVIA 3LCYA 4M7LL 2BVPA 5IJKC 4OM1L 1X44A 1EO7A 1F45A 3CX5J 5E9DD 3B2UD 5ICYB 4MJ6A 5J13C 1V3JA 1UWXH 4GKSB 1I9JL 3ZDYF 1TENA 2GK0A 1GL4B 3PDDA 1U8LB 1GAFH 5IJVB 5HYQA 1P2CA 1WBYB 2X9YA 1DQJA 5IW6A 1S7UB 4WUUD 2FEDD 1AGDA 2AEQH 3T0DA 1RZ7L 3VWJA 2PYEA 3NH7L 1R3HA 1IGTA 3JUZA 4R4ND 4X9IA 4S1RL 1Y0LB 1L9NA 1JRHL 2VLJD 3K1DA 3DECA 1YDPB 3NZHH 4Z78A 5JXED 1QYGH 1S7VB 5EU6A 1WEJL 4FQ1H 4JO3H 5IESL 3GMLA 4LMQI 3MRCA 4A6YL 3CSYB 35C8L 4BUHA 3CFBA 2X4TA 1QFUL 4YXKH 1JGLH 2VYRE 4PYGA 2QV2A 1A6AB 1FZKA 5EZOL 2AEPL 2AJUL 1KCRL 3F6IA 4HF5H 1MRFL 3PNWB 1QBLH 3OKMA 4N9OB 2DBJA 4Y19E 5B21A 1I1AD 3CDYA 3SE8L 1J5OL 1AO7A 5DJDA 3SKNA 4NZDA 4RISL 1JZ5A 1J0IA 3BAEH 1RULH 4IIQC 4PJEA 1LO4L 1NLBL 2F8VA 3RWIB 1RUKL 4XXCC 4Z76A 1FQ9C 2G5RA 3K8LA 1TXKA 3GMMA 4PJXB 2VNCA 4XVSL 2XZAL 5JOFA 4KMQA 1A1NB 3WUZA 4P9MH 2ZNWA 1W8OA 1FFPB 3N1MC 5F9WB 4IOIA 4FHBD 2P5WD 4RMWA 3HUJA 3H3KA 3QXAA 3HMXH 5GS0D 5FKPA 4JY5H 4RDQG 1BD2B 3T1FA 2IPTL 5E7FA 4QHLB 4UQ2B 4ZFOL 3UJIL 2JK5A 2UZIH 4YHIA 3MOBL 2X4PA 4DVBB 4TNWK 1A7RH 4HIEA 4XC3L 5DJ2A 1T3FB 5T1MB 4NFBA 1FVEA 1ZEAL 3ROLA 1P84J 1ORQA 2OMBA 1PX3A 3QUXA 1ACZA 4M43H 1K3IA 3LPGA 2DLFH 3WKNA 4PTUB 3B9EA 4F2MB 4HUNB 4OIIL 4YAQA 5DWUH 5FECA 1OW0C 1YUHA 1EO8L 1WAAA 3TN0A 2QHRH 4AK1A 5L2JA 3V4PH 1FE8H 1HHIB 4XMPH 4JFFD 3FB7B 1B9ZA 3BXNB 4X4ZA 4XCCL 4MNHB 3RU8L 4TTDD 4LF3A 1FYTD 3KNBB 4ZPTB 4KI5D 4O02L 3BPNC 2FRGP 4MAYB 1LP9A 5HYFA 3I75A 3Q3GA 1IT9L 3O2DL 1U8OA 2G9HA 3VGDA 1EK3A 5FYJL 1T83C 1BLNA 4L1HA 4BSJA 4S2SA 1OGAB 1XGYH 2V7NB 3CFKB 3OAZK 4P99A 4EUPH 5L7XL 2WINB 4Q9QH 3L3DA 4MJ5B 3I75B 5A2IH 4Y0GA 4JHWH 1MAML 5C0IA 2Q76B 2QEJA 1MQ8A 3MRGA 1CDUA 3SDDB 2RBLA 3BXNA 3VXNA 5F1KC 4O02H 4NKOB 1CICC 4CUCA 3QWOA 2A2QT 5ALCL 4MDJB 5HHVL 1R5IA 1FNEB 1XFPA 3WHXB 1HILB 3BO8A 4XXCA 5ESAA 4P5TB 2VDRL 4LCCB 3LSOA 4NJ9L 3V6OA 3L5XH 3QRFM 3ZLQC 4FN0A 5D7KE 2BSTB 2YD7A 5IT2L 3FMGH 3GSOA 1CU4L 4PJBA 2P44B 5C0FB 4H0HB 1YMMB 5KSBF 3BPNB 3OKDA 3S36H 5TE6H 3WO4B 1GJIA 4EIGB 1B4JL 3IAGC 4C55A 1FFNA 1BD2A 4Z7VA 3RNQB 2GJZA 4G7YH 3VXOA 2XZZA 4OLXL 3RIAK 5LXGL 1RHFA 3UDWA 3KYAA 2WWMD 1HXYB 2ENSA 4UTAL 4P4RB 1CGVA 1QP1A 2B1HL 4Q6IB 5DFWH 2MNUA 3C5JA 4Z76B 3I3BA 2EDQA 2VLKE 3WD5H 5E5UB 4QO1A 4HH9B 5HPMA 4ZUTA 3BWUC 3BKML 5D7IE 1OWWA 3CU7A 5A43C 1H3UA 5MEPB 5KSAC 2LU7A 3LDBB 5IT2H 4KKCC 5I16A 2APBA 3NIDF 4NN6B 3DWTA 5B39A 5H35B 3LIZH 1MY5A 2DQGL 5JO5A 4FQCH 1BGXL 1YEKH 3S9DB 1NGXA 4EN3D 1KPVA 4NM8L 1QKZH 3IVKB 4GLRH 1ZAGA 3OKKA 5EU4A 1S5HB 5I1LA 4HJ0C 5ICXA 5HVFB 5E1HB 4YR6A 5ESQB 4UILL 1WZKA 1UG9A 2FIKB 1IGTB 3FT3A 3VW3L 4NQCD 4QHKJ 1KB5B 4L8CB 3QEUA 2DBLL 2IANB 3HZVA 3VWJB 4HT1H 5JW4Q 3TIDB 4HFUH 4P0DA 3IF1A 4QCIB 1BIHA 4DKEL 3BSZH 3GSNL 4HCRL 1T89C 1F4YL 5DTFB 5FM5M 1OAQL 4D9RD 1FL6B 2D03L 3JZ7A 5CIPB 3WSQH 4L8SA 4OAWB 4LSQH 5E6ID 5H94A 4PRAA 5IMLA 2X4TB 3ARDD 4FTVE 1X5IA 3ZL4H 5CKAA 1Z6JT 2F53B 4YDLB 1EZVY 4K3JL 1MIML 1OVZA 4S2SB 4D9QD 3BZEA 4F7MA 3FRUB 1T6VN 3HN3A 5CMAA 3DBXB 1WIOA 5FXCH 1OP3K 2YPVH 3ROOB 5LG1A 2ZUQB 2ARJA 2PYEB 3JVGC 1X6LA 1QSFA 4K94L 5C8JA 3KVQA 1C5CH 3JWDL 3Q0HA 1CCZA 4FQHB 3QPXL 5KTEL 4WFED 2JCCA 3B4NA 1DBBL 1D7FA 1L0YA 1UZ8A 2BOBA 2LU4A 1NSNH 2O26U 5I1EL 1M7DA 3ULVH 1MNUH 1G7PB 1AGBA 4HAGA 3ECBA 1H3PL 1PD6A 4I4WB 3B43A 1IC4H 5GHWH 3QJFA 4B7IA 1FIGH 4S11A 3G08A 3EOBA 3KGRA 3MRRA 1JRHI 3TBYB 1KIPB 3GJFK 3D3VB 2VKXA 3S3PA 2GW5A 3WE6A 2FHCA 1FLRL 3VGFA 5KG9A 2DWEB 4QTHB 3O8XB 4X9GA 1U8QB 4JO4H 1JI2A 4HUUA 3REWA 4U6YB 5D7SL 2AEWA 1KTDB 2BOCB 1QEWA 4L4TB 5J1AB 4L4TE 5J4MA 2FR4B 3ARFD 4JPVL 2XWJA 3TIEB 4L29A 5I19L 4HZAA 4NZRH 3FQXB 3ISWA 1FFOB 1A6ZA 1KIRA 1RZFL 1P5UA 1ZANH 2AXJA 4PJEB 2DQFB 5DJCB 5FYLH 3O9WB 2OJZL 1EEZB 4ZTOL 4UUJB 3Q6GH 3VH8B 5E2VH 4Y1AB 3VWJD 3DTXA 3RVTC 1MSPA 2XZCL 3TNNA 1IBGH 1YPZB 3D87B 5LGJA 3PP4L 1JGDB 4KROD 4N8CL 4AEIL 1FZKB 3QCUL 3WLWD 5IWLA 2NY5C 1Q72H 3QJHA 4PJFB 2HVJA 1UM5L 4NKMA 4NNXA 1ACYH 4ZSOB 4Z7OF 3UTZA 3RVUC 4HCRA 3ZE0E 3ZYIA 4KY1H 4XX1E 2AAVA 1ZT7A 4NC0B 3NBNA 5GGRB 2I60H 3DMMC 3QRGL 3HNSL 4P2RD 4PJ8A 4RBPK 4P48A 4WI5A 5IW6B 3RWGA 4HWBH 2VLJE 2HFEB 5F6HJ 4PJBF 4JPKH 1MCLA 3MGTA 2FO1A 1SEQH 3E6HB 3GIVA 2Z93B 3DX6A 4D8PB 1JYWA 5KVFH 5HJ3B 3LH2L 1N3NB 3LKSB 4H1LG 5FYKH 5FHAH 2D31B 4LHUA 4YHYC 3TT1L 1MRFH 4Z6AT 5ICZB 4OZIE 2CR6A 2DYPB 5B22A 4EI5C 3HE7B 3WLWC 2NCMA 1KTLB 3MRKB 5C0BA 4L4VD 3VXRA 3HPLB 4X99B 4X6CA 2P46B 4ELKA 5J3HD 2BY3A 3MJ9H 1H0DB 1JTTA 1NKRA 2QADB 4NO5A 5L6YL 1MLCA 2EXYC 1G7IB 3CXDH 1ITBB 5D4QA 1FVCA 5EWIL 4H5SB 4ONGH 3SGDH 3VXPA 2AK1H 3NFPB 2PXYB 4G3YL 3PV6A 4LKXA 3W39A 3B9KD 1L4IA 5E8PA 4MJIA 1KENH 4ELME 1Q9KB 1EEYB 1HSBA 3O6LL 3LKPA 5T1LB 4G9DA 5CBEA 2EYTB 2H9GB 4YDJB 4P5TA 1QFWL 5I8EA 1MRCL 4YFLI 4S0SD 2C26A 2R2HB 3RWCA 1OOAA 2WIMA 4WO4B 2W0PA 4RQQA 1Q94A 1UXSB 4WI7A 1D5ZA 5E1AA 3VWKD 4Y5XC 4QRUA 4HXAL 1OGAD 4KK6D 5BJTB 1TZGH 4M8QA 3O2VH 4Z77A 1JGUH 4PB0L 1NGWB 3G6JE 4IEFB 5CJ8A 4LLUA 5ILTL 3DROB 4OCXL 5DJXB 5FYKU 1T0MA 1LDPH 1MFBL 3CPLB 3QZWB 4F9PA 2GAZB 4HWBA 2HKHH 4Z7VF 5HDLA 1FYTB 4DN3H 2A74A 5MI0C 4AEHL 3DSFL 3NIFE 5DK0B 1IQWL 2W0FA 3OKNB 1YMME 4CMMA 3S37H 1YECL 1KPVB 3BEWA 3TVMD 3PQYE 1QFWM 2FX7H 1GCFA 4GAYB 3ORJA 2B4CL 3QO1B 4JFOB 5EOCL 4HS6A 4P2QB 3TA3B 1IGIH 1TJIH 1VKXA 1FVDB 2MOVA 2PR4L 4JFHE 4MXQD 5JPMA 3KXFA 2AJXL 1DBMH 5IFJB 3B9DA 2X9XA 4P2OD 4ZXBA 1UWXK 5DJCA 3LB6D 1N59A 2WWKO 2ESVB 4MJID 5HYJE 2A38A 1MI5A 5DMKA 1J0JA 1I8MA 3EYFA 1MVFA 1AFVL 2GCYB 2I26N 5C0CE 1EV2E 4Y5XB 1DFBH 2BNQE 3Q6GL 5EBMB 2VABB 1E4KC 2VLRD 5BV7C 5F7FA 4DKFH 4G8IB 4ENEC 3BVNA 1VFUA 3GZKA 3IDYB 4JRXD 5GJSH 12E8H 5ANME 2R0ZL 2DRUA 1U3ZA 4ZD3H 1WC7B 4Y5XA 3G08B 3MRRB 3TBYA 3VXRD 4DQOL 3MRMB 3JV6B 1YEFH 3FO2B 3TBVA 1TMCB 5AYUH 1KUMA 3QHFH 1VFOA 43CAB 4M6NL 3ZHDA 3CSPA 4XP4H 3TO2B 4P5TC 1ULVA 5DJDB 5HDQH 3SKNB 1X5KA 3GMRA 3IDXH 3MRQA 3UX9B 2VQTA 4LVOB 3ZDXF 4L3ED 5EU6E 4GAYA 3QYCA 4NWTL 4U1KB 1IC5L 2F54D 4FP8L 4JVPA 2VUYA 3EOYG 5CJXA 5JW5B 4LEXL 5E8DH 2WINA 1AD0A 1XH3A 2YHGA 1G9NH 5IBTL 2Q86A 1WFOA 5LWYL 2JIXB 3SKJL 4QOKE 3L5IA 5F8QC 3UPAA 2RGSA 4HUKB 4PJCA 2FJHB 1NDGA 1BQLL 3RDTC 2AK4E 1JPSH 1TTGA 4U1IA 4L1DA 4XBGB 1GSMA 3DO3A 4NQTA 5BJTA 5FYKD 4AM0A 3SGDI 2FCBA 4HPOL 1RK0B 3QZWG 3HUJE 1K2DA 2ORBL 4NSKA 2BVPB 5GISH 4YR6B 1UM4L 1QRNE 4MA3B 1AXSA 3SY0A 2EE2A 1ETZB 4JN1L 3KAAA 2EDOA 2ADFH 4MB4A 4NQVA 4PV8A 4G8EB 4Y16C 4ZO8A 1YN7A 3UC0H 2Q7YA 4BZ2L 4XPGL 4OZHF 3AY4C 4J3VA 5TJWK 2YD2A 2DQJH 1MI5D 4QHLA 4UQ2A 4XAKE 3VE0B 2AI0L 1F3JB 1YMMD 3HUJB 1YQVL 4KZDL 4O2EA 5DMIL 5HHXH 1FCGA 3S37X 3SE3C 4LSRL 2Z31C 4ALAH 3P9LB 4HIXH 3L3JB 2HH0L 3I6LD 1MUJB 4OFYA 4K9EH 3WDJA 1T66D 2H26B 3HUJF 5M95B 3O11B 32C2B 2CKBB 1J10A 1GGYA 2CLZA 3WCYA 2VJXA 4UNVA 1CFNB 4HXBH 1NBVH 4U1NA 3V5HB 4ORGA 4IOFC 3MA7A 4M7JL 1MWAH 1BPVA 2DM3A 1F4YH 3HMXA 2E8ZA 4FQXC 2RCSL 4KHTH 2DQIH 1ND0A 2QSCL 2NX5D 1LMKA 5BV7H 2QKIB 4PGEB 4NKDA 1HH9B 4FS0A 1PZ5A 3DVNB 3PWUB 3U4BL 1Q0XH 4OF8A 2XTJE 3OJDA 5F9OL 4RGND 4M7ZC 3RWHB 3FOLA 4CMHB 2DLHA 2HVKB 2Y5TA 2V5TA 3MBED 1R0AH 2NZ9C 3MV9E 2EIEA 3QJHB 3BKJL 2EKJA 4EN3B 2ZKHH 4JFYB 4Q58C 4TULL 3GK8H 3T2PA 1QBMH 4Q9BA 4K23L 4PJBE 1MQKH 2BHUA 3FB5B 4JREB 4MDIB 3V5DA 4KVNL 4PLJD 4GKSA 4KTDL 4JKWA 5ANMB 1BGXH 1YQ2A 1C08B 3AC0A 3Q48A 5DD6A 4FQLH 4WDIA 4C4KT 4IOFD 2QQQA 4JGUA 2K7PA 1LE5B 1J8HE 2VC2H 2OLDA 2H1PH 3HC4L 3U4BH 2OJEB 1SM3L 3UPRA 4WTWA 4G6ML 2PYFA 3QIWA 5BVJB 1WIPA 1P4IH 3GHBH 3CZJA 3P4NA 3HI5L 3L3GA 4WI6A 1FLRH 2F9BT 2BP3A 3ILQD 2FO4A 2X4NA 5C0BD 1CGSH 4U7KA 2DM7A 4XXDB 2W0KA 4YBQC 1S8DB 4OZ4A 1EERB 1HKLL 3V6OC 1HZHL 1I3VA 3S96B 4TTDC 5EUOE 2OR9L 5CZVH 5DHVA 1CFVL 2BNQD 3MYZA 4M6MH 3SEPA 1Q9KA 3ALWA 1YYMH 4GAGL 2EZ0C 5DRWA 1ZSDB 1K4CB 4MD4A 3NZ8B 2PTUA 3PV6B 4LKXB 3VJ6B 1AKJB 4E41A 3P77A 4S1DD 2WMPA 4LCYB 4N90E 2NXZD 3T3PF 4OKVB 1FH5H 2ZOKB 4Y4HB 1CK0L 3SDCB 5DQJA 3RZCB 3BW9A 3SO3C 5FF6B 1OPGH 2DMBA 2Y5EA 4MMZC 3SCMB 1W2KT 4XNXH 4R3SB 3SDCD 4QRSA 4M5ZL 1VFAA 1NEUA 1RFDL 1JF6A 1ERNA 4DJMA 5DFTA 1F4HA 1N59B 4YHYB 3V0AC 3VD7A 1XGTA 3X3FH 4N5ED 5EORH 4GBXB 1KCUH 1WZ1H 4UIMA 5EUKB 1IC7H 1NBYB 4Y4KC 4EI6A 2BJML 2K1MA 2IFFL 2VZTA 5K9KB 1XGRA 4HF5L 3IDJB 4HQQL 3F12B 1AP2B 5J6HB 1W0WB 1Q1JH 3MLXH 4MSWA 2Q7NA 3ZYJA 5DQ9B 5D1XB 4Q6YA 3VFMA 5HPMB 4ZQKA 2EC8A 2J5LC 3HZYB 4JFFB 1HHJB 1IEHA 4NBYB 3WJJC 1I4FA 5TE7H 1LE9A 2OL3B 4FABL 1RPQA 3RFZC 2DD8L 1CLZL 1VGKB 1WT5C 5BMFH 4S1RH