4JR9H

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
213
Chain Sequence
QIQLVQSGPGLKKPGQTVKISCKASGYSFTDYGMNWVKQAPGKGLEWMGWINTSNGYTTYGAAFKGRFSFSVDNSASTAYLQLSNLKTADTAVYFCARSWYNRAMDYWGQGTSVTVSSAKTTAPSVYPLAPVTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords Nitrite extrusion protein 1
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 213
sequence length 217
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9H02
4IRJB 3OZ9H 3F7VB 4X9IA 3TH2T 5IWLC 5C0BB 4OJFL 5I75C 5HGGS 4ODVH 5FGCB 4NZTH 1AO7A 4G7VH 1ZA6B 3O6FD 2GFBA 2NY1B 5SWQA 3BP5A 3R06B 4ZNCD 1NL0L 1KIPB 5HGAA 1MJ8L 2AJXL 2DWDA 4YXHL 4EXPX 4PTUA 4P9ML 2VISA 3BT2H 3QNZA 3LV3A 4PRNB 2CKBB 3NFPA 4EIGB 3ARBD 1OAQL 1WBZB 4IRZH 5T1DH 4WJ5A 4M7ZB 1FFNA 1A5FH 1YY8B 2O26U 2WWKT 4RIRB 3KPQA 3S3JA 3LN5B 5F7MC 4M7LH 3DMMD 3QI9A 3D3VB 5D1ZB 3UROR 5DTFA 2DQUH 1AXSB 4KROC 2H26A 2YS4A 5LCVH 1MUJA 1ZT7B 5SWSE 2QADB 4PJIE 5DK0A 1A9BA 2VN4A 5KSBB 2DL9A 2E5EA 1INDL 3CSPA 2Q7YA 4LPXA 4OD3L 4M43H 3K7UA 4Z7UF 2VLRD 3P73A 2CR3A 1G7PB 2Y07L 5IW3A 1MJUL 1OTUC 5F9OH 4P57B 1A3QA 2LU4A 3B2VH 1JP5A 2YSSA 3AY4A 1BBDH 4UQ2A 4P9HH 1S7XB 1W8OA 4ONOA 5C0RL 1GGBL 4XTRD 3ARUA 4U0QB 4I2XE 4HC1A 4OLZL 1WBYB 5F21B 4GXUN 4LP5A 4XI5D 2JK5A 4WY7L 3QHFL 2BNUB 1RK0B 2XRAH 4PJXE 5A2KH 2P4AB 2F54B 3CPLB 1JIBA 3EJYD 5MENA 4ZOCA 1UXSB 4DVBA 5B8CA 5DHYA 2H45A 1WISA 4HXBL 4JGUA 1DLFH 4WO4D 2BNQA 1FG2B 4LLAA 3ULUC 1XIWA 5LGKA 4ZNEE 5F7EH 3DPBA 3AM8A 4QCIA 2VH5H 1J1OH 5GRZA 4N8VG 1HHIB 2P8MA 5J6GB 3SGDH 2DTSA 4KMTL 5GZND 3SGJC 5FUOL 1R3JB 4LHUD 4JPWH 4KKLC 3LHPH 1PKQE 1FNEA 4QRRD 1B0GB 2DBLH 5ADOL 4FQJL 3NZHL 3MOQA 3OMZA 4RMWA 2EXWD 5EH1A 4OFIA 4Y0GA 5GRJL 5ID1B 2F53B 2UZXB 5TPWL 2Q87A 1S7VA 3QCUH 5FKPB 3RWHA 1NBZB 4UB0L 1OM3H 1NC2A 4XB8A 2NY0D 5EPMA 3PG2A 3WJJC 5D7JB 4TUJA 3VFMA 4MJ4A 3UDWA 1A2YB 3G9VA 3PWNA 2DB8A 1CYGA 1ORQB 1S5IL 3O81A 3WEXB 3JWDH 3LRSA 2VDQH 4CUCA 1DVFD 1I1FA 2IQAA 4IOIB 3NIDE 3TZVD 3E6HB 4G7YH 2BMKB 5T33L 3RNQA 4ZOBA 4JFYB 2GJJA 5I1KH 4ZYKB 5EIQA 2RHEA 1D5IH 3MYJA 4F8QA 3EYVB 2F8XC 1FG9C 4JFXB 3MLYL 3L3JA 1E4XI 4N8PA 4XHJD 1JGUL 2A77H 2I60L 1HHKA 4LVNC 5AD0A 1A7NH 2XWTA 2R2BA 4PJAA 1WCBA 5C0JB 4NJ9H 5I1IH 5BS0D 1NFIB 3TT1H 4LSVL 3K1DA 1MRCL 3IDUA 1L9MA 2N7AA 3FO9B 4O02H 1BF8A 2DLHA 3MACH 2J8UB 4UIMA 2WBKA 1A7QL 3GI9H 1HQ4A 4ZOAA 3FFCB 5I71B 4YBLB 3NCYS 4W4OC 5FDWB 3CK0H 4HX1B 4NKMB 1AIFB 1IT9L 4YHYC 2O61A 3ECBA 3RJQB 4NN5B 4MNGB 3A6CH 4GFTB 3JV6A 1EJOH 5CEZH 4MA8L 1QFUH 4PJDF 3U7WH 4GUPB 3G5VB 4R90H 3QT2A 5IHUH 1OY3B 2YPVL 2R1WA 5DLML 3VCLB 5C07A 3MV7B 4EUPB 1QFHA 3W5MA 3TBTB 3IDNA 4HF5H 4ETQB 4FQPA 3WDIA 1G9NC 1TFHA 2YWYA 2AEPH 1JK8B 1M05A 4CBPA 1KJ2B 5FYKD 1P9MC 4H8WH 4XCCH 5JW5B 3K1KC 4AQ1B 5KANI 5I6XC 1L4IA 1EGJL 2HA1A 2W1NA 5F1KC 4JY6A 4R4BB 4QT5B 2R0ZH 1VGEL 4MZ3A 1KXQE 3V0VA 4DK6A 5IFAL 1FNHA 2H8PB 5C0GA 5CJQL 3OKYA 4HIHA 3NGBB 1EEZA 4N0RA 1R0AL 2NY2D 2OR9L 4PJ7B 1T7ZA 2VABA 1MCRA 3VGDA 4LKXA 2ZP0T 2D31A 3PGCA 1HINL 1TJHH 5HHXL 2VLKA 1J86A 2A9NH 4H26A 1FGNL 3QG6A 4ZTPL 3V7AG 2BNRB 3SKNB 2E3VA 3F62A 3TBYB 4KI5C 1FE8L 1LK3H 2OMBA 2R56H 5D9SA 2W0FB 3EOAB 5BXFA 3WLBB 4W6XB 3FB7B 5I1JL 3MBED 4D9LL 1WF5A 3ISWA 8FABA 4J3TA 4BFBD 2Y6SC 1Y6NR 2ADFH 2Y25A 4P2QE 3C5ZB 5FFLA 1N7ML 4ODWB 2XWBB 5HHOA 1FH5L 2AEQH 2WP3O 3BGFC 3SO3C 2IPTH 1K5NB 1OAYH 2J5LB 3CH1B 3HE7D 4QHUB 3MV9A 4Z78A 2PNDA 3QUYA 4R26L 5GSRB 4LNRA 2XKUA 4XBEH 3MJ7B 4F15B 2H2PC 4JE4B 3OV6A 3I84A 5HHMD 2OQJA 1H5BA 1EBPA 3REVA 1A6TB 3TO2A 2ICEA 4X6CB 5I74B 5FYJE 2DIAA 2HT2C 2XT1B 3VD5A 4NNYA 3HMXA 2GSGB 2VDPH 4KVNH 3L5JA 3KPSB 1AO7B 3HA0A 1IGJA 4JRXD 4JO4H 2NY5H 2Y36H 2D7TL 3BP5B 4KJQC 5HGAB 2KQNA 4J3WA 2ADJA 5KOMC 3ZTJG 2DWDB 4KUCF 4PTUB 2BDNL 1QSVA 3LPFA 3RX7A 3QNZB 3LV3B 1UB5A 1Z9OA 3NFPB 1FZKA 1IAOA 1DLHA 5BV7B 4LVEA 1GZPA 4LF3A 5D7LA 3KPQB 5IB3A 3QI9B 4MWFA 1OT1A 4HPYH 2LV4A 5DTFB 1GYAA 4XWGH 2H26B 4P49A 1MUJB 4PB9L 5D6CA 1CICA 5DK0B 1IC5L 3QPXL 2D2OA 1JF5A 3K4DA 3WO3B 1GGIH 2Q7YB 4AEEA 3KLSA 3P73B 5E5MA 1YMMA 3GO1L 4XRCA 2COQA 3GMOA 1PX4A 1LO2L 2DQDL 4QXWA 2HMIC 3EYFA 3FQNA 2YSSB 4UQ2B 4P9HC 5LQBH 4LARH 4LLMA 2G5RA 1AR1C 2ZUUA 3DSFL 4H20L 5FYLL 4B41A 4CMHC 3WLWD 4ZAKA 4HCRL 4MA7H 4Y19A 4OZGF 2BCKA 2JK5B 4ZUVB 4QHKI 5E2VL 1NAMH 2LTQC 1YEIH 3EYSH 4MDJA 1CD9B 2JIXD 5MENB 1KCVL 3B9KA 3DARA 4DVBB 1NC4A 5B8CB 4FNLL 4JFDA 2OZ4A 5DHYB 1Q94A 1KCSL 2BNQB 2ICWI 1NJ9A 1U93A 1XIWB 3TVMA 1UXWA 5TE7L 1IAKA 1WAAA 3S37H 3ARFC 4QCIB 5T3ZE 1MIEL 5D8JH 2P5WB 3Q6GH 3QUML 1TPXB 4OLXH 2P8MB 2OTUA 5TQ2H 5CILL 4CN6A 3SBWC 3ZKNC 4C55A 3CVIL 3K8MA 1TQCC 1XGRA 1MAML 2OCFD 2DJ4A 1FNEB 3QJHA 3T0ED 5C6WH 3VFNA 4OZGE 1D6VH 4BZ2H 1WWAX 4I3RL 4LRIC 3S35H 3PGDB 1SYVB 2IFFH 3DX7A 3VJ6A 3RA7L 1S9YA 2NNAA 3FRUA 4P46A 4XPHH 4ZQKA 1TNMA 4RAHA 3RWHB 1NCTA 1PVHA 3MLSL 3SOBH 3MROB 3GM8A 5C7XH 1JHTA 1Q8MA 2W9EL 4GKNA 4JR9L 2ZPKL 1TQBB 4NN7C 5EPMB 2BZDA 3PP3K 3VFMB 5BZDA 3CFCH 3D5OF 3PWNB 4ZFGL 3G08A 3LRSB 1I1FB 1CTNA 2IQAB 4XPAH 5BVPH 2F8VA 4XP1H 1HSAA 3RNQB 4ONFL 4ZPVA 3ULUE 3H6JA 4K7PX 4KI5D 3TLRA 1FZMB 1IAII 4PPTA 3L9RA 3UTTD 3VG0L 1A6WL 1E6JL 3MYJB 2FD6L 4KDTC 3A0OA 4RBPH 2QR0A 5JA9A 3DUUA 1K8IB 1BWMA 3VI4E 2EDEA 1KJ2L 5AD0B 5AG8A 4NQDA 2R2BB 2AAVA 1FAKT 4BJLA 4HMEA 3Q3GA 3KPOA 1GOGA 4RNRA 4HKJA 2VLMD 2EZ0C 3QUZC 3EDEA 1LMKA 2B4CC 2WQ8A 4UIMB 1U3JA 1WTLA 4LLUB 1VCAA 5KN5A 4M62L 2BVOB 3TBWA 4JM2C 2BY3A 2ZUSA 1TJGH 3DRTA 4RGMC 1JNNH 4FQIH 2O61B 3ECBB 3DJ9A 3MRQA 3CIQA 4C54A 4OJFH 4F9LC 3JV6B 4XCNA 3CZFA 2E7CA 3D25A 5LAXA 5C07B 4U0RC 1MJ8H 2AJXH 3IDNB 1WIUA 1MLBA 2QL1A 4YXHH 3U4AA 4W81A 1CXLA 1J0KA 4UTBL 1MFDL 1WGOA 1OAQH 3DUHA 4YXLH 1F42A 1M05B 3MZTA 1KBGH 5IIEB 1E28A 4UNUA 3RKDD 5IB1A 3MA9L 4TQEL 4LVHC 4P2OC 3E0GA 2FB4H 5HYJE 2AW2A 4JY6B 1INDH 4H88L 4OD3H 3H3BC 3TCLB 1KEGH 2VNCA 1BEYL 4GBXB 1T1YA 1U3HA 2Y07H 3H9ZA 3V0VB 5E8DH 3KPRE 3ULVC 3W5NA 3WNNA 5C0GB 4JFHE 1NLDL 4GRWB 4WEBL 1J1PH 2MKWA 4OT1L 4HIHB 4IDLA 4OZHF 2KDGA 2F5AL 4ACPA 2AQ1A 5ACZB 4CJ1A 2VABB 4E41A 4LKXB 3PGCB 3O4LE 2VLKB 4H26B 3QG6B 3MGAA 3VRJA 4KK5C 4WY7H 3QHFH 3HRZA 5D9SB 1I9RH 4MNQD 2PYFA 1CE1L 3MMEA 3SDAA 2RCSL 3BZFA 2PYEE 3UXFA 2PW2A 1Q9OA 5E8EA 1PG7W 4YDIL 4GAYA 5K9JL 1T66D 2CRZA 5EZJB 4PGBA 2PETA 4FQCL 9CGTA 4AMKL 2NX5D 1WWBX 3VG9C 5I8OH 3P4OB 3O3UN 5C3TA 3VWJC 1RIHL 3MV9B 4Z78B 3GEWB 4F7CB 3NAAL 3STLA 1I75A 4KMTH 1ITCA 2MHAA 5FUOH 1FVEA 3O8XD 5I1HL 5E1AA 3OBAA 4PJHB 2OQJB 1MFCH 1H5BB 2JF1A 2QQLL 4NOBA 2RFXA 3CC5A 3TO2B 5E03A 2ICEB 5CHNB 3MXWL 5F93C 3TJEL 4XCYA 1BJ8A 4NRXA 3X3GL 4HC1L 1X4YA 2FSEA 4LL9A 4WI2A 5JR1H 5F1NB 4NNYB 4UV7H 4O9HL 4WUUA 1AKJD 2JJSA 4TVPE 3S88L 1CR9H 4UB0H 1BFTA 5F88A 1IGJB 3B9VA 4N0CC 2ADJB 1UWEL 4MQXC 4OF0A 4NPYA 1S5IH 5B4MD 5JUEL 1UB5B 3OKOB 4L4VE 1DLHB 1IAOB 3KYNA 4LF3B 5D7LB 4JN1H 5DMGC 5C0DB 3QULA 3WMSA 5IB3B 1N26A 2QLVB 5T33H 4OIBA 3VDAA 5DDHA 2I25N 2NY4B 5D6CB 4FFWD 3EDJA 4X6DF 5E7BA 4DKFH 2JCCE 3T77A 1LO4H 3L3IA 4CVZA 4G9FE 5E5MB 4QEGA 1YMMB 3WYRA 1DN2A 1J10A 3EYFB 3FQNB 2CIIB 2VITA 1NEZA 1UA6H 2HJFA 4LLMB 2I60H 4WHTA 3TO4C 2XA8H 3F58H 1F90L 4J4PA 4ZAKB 2DM4A 4Y19B 2EZ0D 3QUZD 3LMJL 4MDJB 4LSVH 1QRNA 1AGBA 3BKYL 3BZ4A 4GKZB 3HB3C 4YEFA 1J8HE 2DLIA 3B9KB 5HYSA 4R7DA 5KVDH 4JFDB 4LMQI 3RKPA 3TA3D 1QYGH 1A7QH 4JB9L 3I3DA 3T09A 1Q94B 4TNWF 3BDBA 5FDYA 3RGHA 4XZUA 2UV3A 1VFOA 4LFHG 1NJ9B 1U93B 2CMRL 3TVMB 1UXWB 1QLEL 1FL3A 4L3CB 1OSZA 3DX9B 3RY6A 2WWMD 5A16A 3FAXA 4OZIA 2MJWA 3U4BL 4X6DE 2GK0A 1DEDA 3H9SB 3QIUC 1PJ9A 1FPTH 2G60H 1C5DA 4Q9RL 2OTUB 3NCJH 2CQVA 5DLMH 2Q3AA 1CXHA 2DLEA 3BW9A 3KLHD 1XGRB 4POZC 2P24B 1AGEB 1CDYA 2VN7A 4UINH 1L6XA 1OAUL 5CLTA 5KSAD 2J6EH 3PABA 1HYRC 4MVBC 2OJZL 4PJ5D 5D2LE 3VFNB 3C60C 3HNTH 3DX7B 3VJ6B 5IROA 5HTSA 2NNAB 3FRUB 4P46B 4ZQKB 2DQTL 4Z0BL 3V52H 4U49A 3QDJE 5GS2H 3ILQC 3LQZA 3MV8A 5FKAA 1JHTB 4GKNB 5BVJB 4JFQA 5I19H 3O3DA 5IHLB 1MHCA 3E3QC 2OL3A 5IFAH 5CJQH 5BZDB 4PLJD 5EUOF 5E7FA 1FC2D 3G08B 5J4MA 1R0AH 2NW2B 5J7CC 1N64L 3GBML 3B9DA 1NFKA 1HINH 1SY6L 4N5EC 5HHXH 4KK5D 5TE4L 4NHCL 4ZTPH 1HSAB 4ZPVB 4EDWH 2EIBA 4MDIA 2WMPA 5TJWK 3L9RB 1FE8H 3GIZL 3QISA 4NSKA 3T3MF 3MLWH 4LCWE 1UJ3B 3VFSA 3IRPX 5JQ6L 5I1JH 4BYHA 3UBXB 3E2HB 2CKBH 3DUUB 4UILL 2GTWA 4PD4K 1QSEA 3DIFB 5J12C 5FCUH 1N7MH 1IGTB 3S3PA 3OR7A 3R1GL 1FH5H 3HPLA 4NZDA 3GNMH 5F7LB 1BQHA 3Q3GB 3KPOB 2XTJB 4RNRB 1UT9A 3ROLA 5ESAB 1D5MB 3T4AB 2VDRL 3LOWA 1YNLL 2G2RB 3QNYB 1ROWA 4ZXBD 5EUOE 4AJ0A 2ARJA 4W68A 4OF3A 3H9YA 3LKNA 3OB0H 5KN5B 1V3MA 3TBWB 4RFNB 2Z91B 1QKZH 2CD0A 2LE9A 3DRTB 3VXMB 3T0VA 4DUWA 1E4XL 3SDCD 5B38G 4QRSA 5IK3A 5L2KA 2JJTA 4L8CA 1MNUL 3QO0B 4YHOH 1CFVL 3CLEL 4XCNB 2CO7B 5B22A 3CZFB 2P43B 3D25B 2D7TH 5LAXB 5GRYA 4P4KD 4CNIA 3ZL4L 1K3ZA 2LU3A 1MLBB 3EDFA 3LY6A 2ED9A 4NBYB 2E6QA 4BZ1L 4KJWD 1KULA 4LLWA 4MB3A 3EOTL 1NLBL 1CXIA 2CGRL 3WXVH 5IB1B 4LSQH 4PB9H 1PZ5A 1IC5H 2O5YL 3D85B 5C0EA 4I18C 4NQVA 3C08L 3DRQB 5TF0A 3QUKA 3QEHA 5E70A 1MY7A 2PR4H 3P0VH 5E6IA 1UACL 1YY9C 2R29L 4CDGC 1JHLL 4Y4HC 1U3HB 3LEVL 3VGBA 2M26A 4XVJL 4UV4H 1U8JA 1PKOA 3IU4L 1LO2H 2DQDH 2EKSA 1WCQA 1WZLA 4NCC2 5DJ0A 2AKRB 3QIWC 1A21A 3DSFH 4H20H 4E41B 5SWSA 2EDYA 4PJIA 1U58A 3HR6A 1BM3L 3GJFB 2VZOA 4HCRH 3VRJB 3HRZB 3C09C 2B0SL 2PYFB 1LP9A 3MMEB 2XN9A 5CEZE 1T1ZA 3BZFB 3OKEA 2PW2B 1Q9OB 5E8EB 1KCSH 3U0PB 1UM4H 1VHPA 3KR3L 4I2XA 3SPVA 3RNKB 2WUBL 4BQ8A 3KPNA 4PGBB 4K9EH 3EO1A 4PJXA 2D7PA 3FT4A 1MIEH 3GSUB 3GBLA 5F96L 4PJBE 5DJAA 4D3CL 3BQUA 2DYPB 3L3OB 1F45A 1NGWA 1G0YR 4HUVA 3STLB 3FL7A 1X44A 5DQDL 2R0WH 3CVIH 5D2NC 3KYOB 2MHAB 3QDGA 5CKGA 4CVXA 1FVEB 5IEHB 2BXZA 1PW3A 2DL2A 1XH3B 4KHTL 2LAAA 3NPSB 5BO1L 1RUML 3ULVE 5JHLL 4Z76A 4XCYB 1A1NA 4NRXB 3IT8D 3C60D 2FSEB 4U2YA 5ETUA 4I3RH 4WUUB 3RA7H 1K8DA 2APBA 2Z31D 4APQA 2VKWA 5F88B 4HWNA 3TIEA 1YZZA 5E9DE 2B1AL 2P5EE 1ZGLA 3GSRB 3MV11 5C3LD 2W9EH 2OZ4L 4G8IA 4JR9H 3TP4A 3VXSB 1ZEAH 3HTLX 2YWZA 3I02B 3PWLB 3MREB 1ZVSA 4ALAL 4ZFGH 4NPYB 3FN3A 1QO3A 5I1GL 5CZXC 1IC7L 3KYNB 1TIUA 3BPLC 3KWWB 3QULB 3PXJA 4F7PA 5DDHB 1F4HA 3VG0H 4XNUL 1E6JH 4FN0A 4WUKL 4EUPH 7FABH 3T77B 3L3IB 4X4XA 5D96B 3B6SA 4WHCA 4CVZB 3IB4A 1H3TA 4FQXC 4LCUA 4WIQA 3WO4C 1HSBB 4EI5C 2VITB 2XQBL 1NEZB 2HJFB 4RWYL 2I9TA 3S4SG 2N1KA 1KJ2H 4U2ZA 4WHTB 4Z7VB 1KCKA 2A6KA 3W9DA 3A6BL 2IWGA 2ZG3A 2X1PA 4TTGA 3MBXH 2FATL 4Q0XH 1NCCH 1B6UA 3CVHA 3RX5A 1QRNB 1AGBB 1CD8A 3BZ4B 3UPCA 3QAZB 3VH8B 4OCXL 2NXZC 2ESVD 5HYSB 1GGTA 1ZLUH 1YPZE 4LLYA 3LIZL 1DQJA 4IHOA 3GRWA 4QF1A 4G8GE 1MVUA 4XZUB 5IOPB 4MQTB 4JFOB 2EYSA 1TJIL 1C12B 5KBNC 5JHDE 4NO0D 4NFCA 4TSCL 4DVRL 3GSOB 3BDYH 2W65A 3PDGA 1FL3B 1T7YA 1F58L 1NGPL 4ESKA 4PV9A 3RDTC 2IMNA 5A16B 4OZIB 1U8OB 1P5UA 4FTVB 3AU1A 3C8DA 3VA6A 3RTQD 3IDYB 3W81A 5HVGB 3LS4L 1QBMH 1C5DB 1I7ZA 4GQ9L 3CD4A 3NCBB 3DVFA 4HUMB 2X4RB 3BW9B 4Q6IC 2C3VA 4NT6A 1T03L 2VSCA 4P23A 4UTBH 3LN4B 5EO0B 3BKJL 3DYOA 3PABB 4EI6A 5E99H 4M5ZL 1D9KA 4RAUA 3QPQD 3RIFF 4GT7A 4KUZL 2NZIA 2XV6B 3ILPA 2NR6C 4X7SL 4K8RH 2YPLA 3MA9H 5JLZA 5E5UB 6FABL 2R23B 2OSLA 4Y1AB 3LQZB 4N1CA 3WNLA 3HCVA 3L6FA 4JFQB 5ECJE 3UAJD 1NBQA 3O3DB 4GG6B 1MHCB 2OL3B 1NH6A 2GJ6D 5C08D 3L5WA 1NLDH 4WEBH 4KK6C 3EDDA 2HKHL 5JXEA 1CDCA 5H94A 2F5AH 2PW1A 3H3KA 4O00A 5DS8A 5FOJA 2OK0L 5C6TH 3ZE1F 4M93C 5FGBC 1WT5A 2ZKHL 1DBJL 4ERSL 1KFAL 3F6IA 4O4YL 1M7IA 2WBJC 5JXAL 3SJVE 4NSKB 1CE1H 1DBML 3CNKA 1DTUA 4K7PY 3QO1A 3LZFL 2YD5A 1K3IA 4MJID 2ADGB 4YDIH 5BV7H 1N4XL 1S9WA 5K9JH 5F9AC 1I1AC 1GHFL 3ABZA 4OCSL 3RVTD 2X9YA 3R8BB 1BQHB 3HN3A 4JHZA 4PRHE 2EDTA 2B1HH 1RIHH 4JQVA 3ROLB 1KPRA 2BRRL 1IGIH 3OAYK 1J05A 4CN1A 1IAIL 3NAAH 1BZ7A 3OJDA 4M8QB 4NZRL 2QQQA 3TJHD 4IMKC 2NZ9C 2ARJB 5DMIL 4P2QA 2PXYA 5JW4N 2OP4L 2QQLH 4R4FL 3TJEH 3E3QE 4QRSB 5L2KB 3CSYA 3DYMA 4HC1H 1QQDA 5C0AE 4L8CB 1NCWL 5TFSL 3UYRL 1KN4L 2YZ8A 1HH6A 1M7XA 2XXCB 2YOCA 1RUAL 3QQ9D 3VFOA 1SMOA 4OM0L 1A0QL 5GRWA 4CNIB 1YYLL 3LKOA 3DI3B 2VWEC 1TZHA 5HGBA 2ZWLT 2YXFA 1A7RH 5LGHL 4HXAH 5IESL 4JKKA 4C56E 4LLWB 2NCMA 4JDZA 3RBSA 3T8XA 4PTTA 1PBYA 4M1CD 1I85C 3MUHL 1MCHA 1R3HA 3SDDB 2ADIA 4XMPL 1PZ5B 5TDNA 5C0EB 1IL1A 4NQVB 4BH8A 4JO1H 2AJVL 4DOHE 3QUKB 2QBWA 5E6IB 4MMZC 5CGTA 4FQXD 2P49B 4H5SA 5I1LA 3ZT5A 5J9PA 5J11B 1KGCD 4EI5D 4ONGL 3K4ZA 4HH8A 5HYFA 4AL8L 5DR5L 4AQOA 4F7TA 5DJ0B 1W72A 2VLJE 2MPAH 1JZ2A 2HKFL 5SWSB 4MMXC 1II4E 1ONQA 1U58B 4PJIB 5B39A 4Y16C 1P2CA 4HIXL 3QCVL 4L29A 5BS0A 3WD5H 2VYRE 3TN0B 5I9QC 4K23H 4OSUH 1NDGA 3BVNA 1T1ZB 5GHWL 4KAQH 1MHHA 4PJ8D 3FQRA 1QZ1A 1G84A 1NBVL 5C6PB 4I2XB 4XCFL 2W38A 3SPVB 1QLEH 2VMFA 5EDXA 3F7YB 3RDTD 4LBEA 3KPNB 4HD9A 4K55A 3EO1B 4PJXB 3U4BH 5JORA 5IWLA 3FT4B 4IRSC 3HLAA 3HZMA 5DJAB 3V4PL 3BQUB 4KUCD 1MPAH 1N0LA 1NGWB 4Q9RH 4HUVB 1IZKA 5C0IA 4R4ND 4FXLA 3EHBD 3QDGB 4NYLA 4V2BA 4HEME 4OFYD 1CBVL 2FBOJ 5DGQA 3MRBA 1OAUH 4I9WD 2X40A 2Z35A 2OJZH 4Z76B 3PE9A 5FO9A 3DX8A 1MCFA 4U1JA 2Q8BH 5ETUB 1LK2A 1DCLA 2DQTH 1K8DB 2IAMD 4J7RA 2ILLA 4FXGA 4APQB 3HC4H 1IFHL 1ZVHA 1ZGLB 1PKQB 5HHQA 4G8IB 4RZCA 4XPTL 4QKXB 5J6HA 1OP5H 2R39A 1CQKA 5GISL 1CLZL 1CGSL 1CGTA 1KG0A 1ZVSB 4M7LT 4UDTA 3TYGL 3UTZA 3HE6C 1QO3B 1UWXK 3INUL 1P7QA 3MRIA 4NWTH 2ICES 2WIIA 3ZE2F 5D71L 2I5YH 4ORGB 3LEYL 4NHCH 4X5LA 4BK4A 4NN6C 3VGFA 4U1KA 4ZO7A 1KENH 1BFSA 3GIZH 3UTOA 3IFLH 4X4XB 3B6SB 1MCPL 3VXOA 4E42A 1J87A 4LCUB 5JQ6H 1XEDA 1DFBL 1CGUA 3Q5OA 4XMKH 1CDBA 1JFQL 4PJ9D 2MNUA 5D5MF 4ZTOL 1I7TB 4PD4J 2GITA 5DWUH 3RI5F 3R1GH 4NJAL 2A6KB 4LSPL 4HJ0D 4K94L 5EBWA 3RWGA 2P1YA 2LAGB 2QQKH 1WZKA 3CVHB 4Q97A 3PWUA 3QJFB 2VDRH 3NOIA 2VIRA 4GMSL 4JRYA 4LIQL 2J7LA 2JELL 4GRWH 1VPOL 1BVKA 3BIBX 3SGJA 2ZUQC 4EN3C 3PXHA 3Q48A 1DQJB 5MEPB 4IHOB 1MVUB 3ZE2E 4LPWA 3HS0A 4OB5H 2EYSB 4LSUL 5GSVB 4YAQA 1NBYA 5CP3A 1E4XH 1PG7H 4FABL 4ODTL 4PV9B 1KNOA 1MF2H 1MNUH 4ODXA 4MXWL 1CFVH 3CLEH 2IALA 5IB5A 4XBGA 1F3DJ 4JRXA 3ARGC 3NCYP 2C3VB 4NT6B 3MLPA 3WJJA 2HJLA 1CLOL 4P23B 3HR5B 1Z9SA 1TZGL 1D9KB 4RAUB 3ZDYF 3KS0H 5EOCL 5KZCD 3ILPB 4HHAA 3WJLC 1WBXA 2YPLB 1DQQA 1OW0C 4X4ZA 5T1LD 5JLZB 1I9IH 1AC6A 5H8DA 2OSLB 1P69B 4DN3L 3MLUH 4DTGH 2R29H 3L6FB 2QQNL 4LK4A 2VZTA 4G6KH 2BVQA 3BEWA 5FCSH 3FRPG 5H94B 2PW1B 5DS8B 1RQ5A 5C0ND 3VXRD 2P8PA 3ELAT 1FLRL 4AZ8A 3ME0A 2HT3C 5D93C 3HMXH 1RZIA 1TTFA 2VQ1A 1BM3H 1JZ4A 1ITBB 5DD6A 1TVBB 5IMMA 5CJ8A 4RGNE 1FIGL 4JY4A 4P99A 4LOUD 2B0SH 4BUGA 2P48B 3CU7A 2DJSA 4YQXL 1JGVH 2JIXA 5GGVL 5CGYC 5GGQL 2ZUWA 4CU7A 4OLEA 3DECA 4LCCB 3ZDYE 3KR3H 3O4LD 4W4OA 1CG9A 5IBLD 2WUBH 1JNLL 3WIIL 4XCEA 5IW1B 4G42A 4QWWC 3GFUA 2KBGA 1GGCH 5DVOA 4GH7B 2ZCHL 2FBJH 5F96H 4D3CH 4JDVA 3VMNA 2PYEA 3RWEA 1J05B 4PUBL 1F3RB 4QOKE 1BZ7B 3DTXA 3LKPA 1X5FA 3OJDB 4IDJL 5DQDH 1OT2A 3AY4C 4P2QB 2PXYB 4NKIH 3PQYD 4JM4L 3MRNA 5BO1H 2R8SL 1UZ6E 4BKLA 1GVIA 5DC4B 1IZJA 5ICZB 4HPOH 5DSCA 2QSVA 3CSYB 1QQDB 1S78D 4X9GA 1GGUA 3T0EA 3G9AB 3BISA 5T1KA 5I1AA 1LQSR 1I1RA 4L8BA 3B9AA 1EIBA 1ZLVK 4YHPA 3SY0B 1U3YA 3WS6A 1ED3A 4OUOA 2B1AH 2NY6C 2OZ4H 5FGCE 4JZJC 3VFOB 4TTDC 3HG1E 1HOCA 3EFFA 5HGBB 1YEKL 3DUSA 2XWJA 3AREC 1HNGA 4NZUL 3TT3H 4IEFB 5BW7C 4JDZB 4TVPD 3T8XB 3QZWA 4PTTB 2FJFA 4V1DD 2AS5M 4U1GB 3HC0A 2ADIB 3D3VE 1N6QL 1IL1B 2FDBP 4WFHE 4BH8B 5DK3A 5F8RC 2D0HA 5DRNA 4WUKH 1YEGH 3UTTA 3OPZH 5J9PB 1IQWH 1BOGA 5DMKA 4LVOC 4YUEL 3UYPA 5JO5A 5FM8A 2XQBH 3PWVA 2XZAH 2PO6B 2DWEA 4YJZL 5IV2B 5IMLB 1W72B 5EZOL 1DBKH 5HYIA 3UCRA 4OIIL 1HN1A 3LS5L 1ONQB 5B39B 3WKMH 2JCCA 1P2CB 3D1MC 4CKVX 3HI6L 5IBUB 4G9FA 25C8H 1MRDL 4MD5A 1LNUB 2E6PA 4D2NA 1HQRA 3AMLA 4YBQC 4EN3D 3BVNB 3LIZH 1AE6H 3Q6FA 1MHHB 3CJJA 3U2SA 5EU6E 1D7FA 5C2BH 3FQRB 2F15A 4KKAD 1TJIH 4LCIH 2NTSP 1ZHKA 5JIHA 3DSNA 1F58H 1NGPH 4LBEB 3OJVC 1JGEA 3N1QC 5JORB 1Z6JT 4MXQC 2KL6A 1QPPA 1J8HA 3HLAB 5I75B 3T2PA 3LS4H 1F2QA 5HHPA 4KDWA 4NGHL 1FHGA 5C0IB 4GQ9H 5ANME 5EFIA 4NYLB 4G80A 1UZ8A 1FCGA 4ZFZA 4I0PD 2IPUG 4WNQA 1S7QA 3GB7A 4ELMA 3MRBB 3DGCR 1A22B 4NKOA 4EUPG 3G6DL 5FO9B 3DX8B 4U1JB 4KUZH 1IARB 3CDGA 1IC4H 2OJEA 1WTGT 4FRWA 4X7SH 2DI7A 4KROB 2F53E 4FXGB 4Y2DD 2OBGA 5FYLE 2VOTA 4BFIA 4C59B 3RIFK 6FABH 4WFEE 5HHQB 1QR1A 4RZCB 5J6HB 2NYYD 4UDTB 2EDHA 2HKHH 5D2LA 4OZGB 3UTZB 4FQ2L 2OK0H 2FX7H 4U1MB 1CFNA 1IILE 1P7QB 3MRIB 3UPRA 2WIIB 2J8UF 5TDPA 3KHOA 3KXFE 1NGXA 1CDGA 1Q0YH 2ZKHH 1DBJH 4NRYA 4ERSH 5K93A 5C0FA 4OZFA 1CL7I 3QDJD 1DL7H 4U1KB 5JXAH 4S2SA 2CUIA 1HXMA 4I48A 3OG6B 1V7NH 4E42B 1YJDC 5IR1B 1EZVX 1NCBL 4PLKC 5FGSA 1RVFL 4I4WA 3CCHB 4K3JL 1N4XH 1FP5A 3L95B 4P2YA 2GITB 4L3AA 1P4IL 2DKMA 5EBLA 4OCSH 3VXQA 5C09E 4XPFL 1Z9LA 3ARFA 1GJIA 5HI4C 4XVSH 3ZHLA 5EBWB 3P0YL 3RWGB 4JFFD 1ZE3C 1K4CA 3NMEA 5DC0A 4LCWD 2BRRH 3KJ4C 2VIRB 3MRGB 4JRYB 4WTXA 4NZRH 3SBWA 2HP4A 1BVKB 32C2A 4UOW0 2I26N 3RFZC 4LASH 2OP4H 1SEQH 3O8XA 2FECL 1RFDH 3HS0B 2YUWA 1JPGA 5L9DL 2EH8H 3HAEA 5HHMB 4F80A 3P9MA 1KJVB 1NBYB 2G75B 1KNOB 3V4UL 1NCWH 2X4OA 4LRIA 1KN4H 1XF3A 4K2UL 3HI1A 4PJ7F 2Y06H 1AKJA 2IALB 4YWGH 4ENEC 4LFHD 1RUAH 4TTDD 5IB5B 4XBGB 5EIIA 1A0QH 1YYLH 2DI9A 4WHYH 1F02I 2HJLB 4XBPA 5LGHH 1JZ7A 3IRZA 4BQBA 2LABA 3D2UD 1S5HA 4O5LL 2H2SC 3RGVC 1T89A 4HHAB 4D9QD 3BD4A 3O11B 1DQQB 3VDBA 3O3BA 3R0NA 4XMPH 1N0XH 2AJVH 1F8TL 3LQAL 4G6ML 1A14L 4KDTA 3H7LA 3QB7C 4LRNL 5DJYA 1IAIM 2BVQB 3BEWB 4AL8H 1L7TL 3CX2A 3GMQA 5AZ2L 1X5LA 1Z0NA 4M48H 2P8PB 4PRAA 4A6YB 5K9QI 4OIAA 4M1GH 1EFXA 4LVNB 2HKFH 3OHXB 4YE4H 2VQ1B 3WCYA 5HYJB 4HIXH 4X6CF 3QCVH 4OCYL 3VFUA 5EUKA 4JY4B 3KPRB 1T20B 4LEOB 3QUZA 1KELH 1F4XL 4YBQD 4F33A 3VGHA 3ALWA 4V2CB 2ZUTA 3ARYA 4PLNC 5GHWH 1F6AA 5EZIH 5CJOH 1NBVH 1CGXA 2P8LA 1FNGA 4JM2A 1LO5A 3WHXB 1CG9B 3KGRA 2W07A 3FO0L 2UVFA 5SX4I 1SVZA 3IFPA 4KQ4H 4G42B 4YHYB 3JTSA 4MXQD 5ALBL 1CICC 4E5XA 5FO8A 2R0LH 4F9LA 3VGEA 4JDVB 1CGWA 4WWKD 2WP3T 2PYEB 2YA0A 2G9HA 2UYLA 3DTXB 3LKPB 4KZEL 4D8PA 2IAND 1CBVH 1B4JL 1LHZA 3H0TB 1FN4A 4BKLB 1G0DA 3IF1B 1HHHA 2BVYA 2W0PA 5DSCB 4PJBA 4RMTA 1BZQK 1QSFD 4PJ5A 2A6DA 3O9WD 1X6LA 4FOMA 5T1KB 5I1AB 4L8BB 1BGXL 4YX2H 3T0BA 5J0BA 5I6XB 2ITDA 1ED3B 1NKRA 4FMKA 5CSZA 4P2OA 5F3BB 8CGTA 2DRUA 4LLDA 3GMMA 4XPTH 4L3EA 1P5VA 3UJIL 1HOCB 1SJEA 1CLZH 1IGYA 4FP8H 5DD1H 3NABH 3W9EA 2XWJB 2MQ0A 3DGGB 4YLQT 4RMRA 1WFNA 2XG4A 1CF8L 3INUH 5HD8D 3S34L 2D0FA 3UEZA 3PV6A 3SE8H 4JQIL 3WKNA 3QZWB 2FJFB 2P5EA 3KPPA 1R3IL 5E9DD 5HYEA 2C4XA 3HC0B 3OF6A 3F5WB 2A6JA 3FQTA 4P3CH 4IOSD 1S8DA 5DRNB 3SKUD 1MCIA 1MCPH 3C6SB 3VXUE 4KV5F 4L4VB 1BOGB 1JPFA 5DMKB 5JO5B 3HUJA 1X5ZA 1HKLH 3G6AA 2WBWB 3MXVH 3PWVB 2DWEB 2GIYA 4R2GC 5IFHH 1CDJA 4LSPH 1PFCA 4OF5A 5FYKL 2JCCB 2C26A 3IJYA 4K94H 2MCG1 3BGAA 2Z8WC 4NUJA 3FN9A 4G9FB 3BGFB 4Y4KC 3RI5K 2DOCA 2YZ1A 3SO3B 2EXYC 4X5WA 3VWJA 4MD5B 3DXAE 4KY1L 4LIQH 1HQRB 2OL3H 3ZSSA 2JELH 5CJ5A 2PTTA 3K8KA 3Q6FB 5EU4A 3U2SB 1A4JA 2IADB 2V2XA 2XZZA 5F7YC 4L9LC 1MHPL 2NXYC 4GKSA 2BNQE 2K7PA 1JGEB 3ARZA 1Y0LA 5E8PB 4ZMAT 1FZJB 1J8HB 3MLRH 4QRPD 3X14A 4RX4A 4H0GA 5HHPB 2YXMA 4KV5E 1YPZA 3QDAA 4EQ2A 5T1MA 4NO3B 5KVMC 4QGYA 2D4DA 3UYOD 4G8GA 4DWHA 4JFZH 3W0WE 5EFIB 3VXNA 3PDOA 1AD0A 2FJGB 4DW2H 4ZFZB 5F9JA 3V9FA 3PWPD 4WNQB 3FB5A 4GAGH 4F2MA 1S7QB 3GB7B 3IJHA 1OPGL 5D1QD 4JVUA 5EC2A 1RZKH 4NKOB 5EOQL 1UEMA 5KS9A 1B0RA 2EYTA 5EOCH 3FTGA 3CDGB 2OJEB 1BX2A 1RURL 5ESVA 1UB6A 5D72H 1YN7B 2HTKD 5DQJA 1FVCA 4PG9A 4PJAF 5DO2D 1QR1B 4OZ4B 1MWAA 3D18A 4PRDA 2EE6A 2IPKA 1OB1B 1ND0A 5I8CA 5D2LB 2DQGL 4PRIE 3LB6D 1CFNB 1KN2H 3UPRB 5TDPB 5KTEH 1E4WH 1NGXB 1UM6H 4NRYB 4CMHB 3M17A 4OZFB 3ULSA 3KAAA 4Y5XC 3U46A 1CTOA 4S2SB 1NQBA 1HHJA 2LTQB 4I48B 4J3SA 1PLGH 3QEQD 3MRFA 1A47A 5GGVH 1IEAA 5EWIL 5GGQH 3WE6A 1YEHL 1HNFA 2BX5A 3E8UL 3MPCA 1A6ZA 5IHZA 3MLXL 2FGWL 3ARFB 3SJVA 4CJ0A 1C5CL 3RVXD 2A9MH 3MLVL 4PJAE 4XP9H 3ZDZF 4U1LB 3MUJA 1VKXA 4G8EB 4PUBH 1EFQA 2M8XA 3HMWL 2C3HA 4K3EL 1F00I 32C2B 5BJTA 4MAYC 1T6VN 4JJHA 1I7RB 1JPGB 2R8SH 2X41A 3P9MB 4XAWH 4XC1L 3FZUD 3PL6C 5I76B 3HZYA 1A7PL 3Q2CA 1RU9H 1P4LA 4GRWF 4MYWB 5F89A 2X4OB 3C60A 1LO3L 3OKNA 4JJ5A 1XF3B 1FL5A 4OBRA 4Y2OA 4Z7UA 3HI1B 2D7QA 4LGPB 2DTMH 4YZFF 2MQ3A 4ZO8A 1LE9A 1K85A 5EIIB 3P11L 4NN7B 2ZCLL 1T7XA 4HK3N 5C07E 1YEKH 1UYWL 3MLZL 4WV1C 5C0AA 5JZ7C 5KANG 3GSQA 1S5HB 3FT3A 4YH6A 4E9LA 5GJSL 4X5XA 1JI1A 4MXVF 4NCDA 1M4KA 1JYNA 3O3BB 4EDXA 1U8HA 4U4BA 1N6QH 2X4TB 2HWZL 3EOYG 5ITBL 5FOBA 3LRHA 4M7KH 2D9QB 1CFTA 4B7LA 3B5GA 5DJYB 4YUEH 3B5TA 3X3FL 1KIUA 1DQLL 2KZWA 4C56D 4Z7WE 4BUHA 1RI8A 3GMQB 4GRWE 1DDHA 5EZOH 4HBQA 4IMLA 4PRAB 5DFVD 4OIIH 1EFXB 1EHLL 1OP3H 4UTAL 3BO8A 4Y4KD 2VLKE 3HI6H 3VFUB 5EUKB 2EO9A 1MRDH 1I1CA 3CDYA 4F33B 1JGDA 3LVEA 1WIOA 1QOKA 4JO3L 1QACA 2HTLC 3S37X 2ESVA 3GJEA 4M6OH 4XX1G 2VLJD 1ZHBA 4DEPC 4Y4FD 2P8LB 1FNGB 4JM2B 4FG6C 4P3WA 3MC0A 1CZ8L 2FRGP 4RGMB 3IFPB 3JTSB 5CEYA 5GGRA 4E0RA 5FO8B 4E5XB 5HHOE 2RB8A 2FNBA 1EHNA 4R0LC 3C6LD 3CH8A 4JFED 4NGHH 2G9HB 3DHMA 3GGWA 4EOWL 3MV9E 3GM0A 4U0RB 1EHXA 4MCYB 2ZSVA 4D8PB 5I17B 4Z8FL 1B6DA 3S35X 4R96A 4EQ3A 3VU2A 3VWKD 1FN4B 1S3KL 4X7EC 3LKSA 3G6DH 4KQ3L 4J4PC 1RJZA 4PJBB 4UIKL 1BJ1J 1KV3A 4PJ5B 4N8VA 4S0SD 3DURB 1FYTD 3CVHH 4JHWL 4LGSB 4DCQA 4F3FB 5CSZB 4P2OB 4I18A 1HWGB 1L0YA 1TZIA 2VXSL 3RU8L 3GMMB 4PV8A 1V7MH 3GRWH 1GSMA 5ILTL 1CLYL 4L3EB 5H35A 3CXHK 1IGYB 3SKJL 2YPKB 2BHUA 3W9EB 2GJ6A 4ZO9A 2RR3A 3UTPD 4OUUA 2XFXA 4FQ2H 5IMOB 3QUXC 4FFYH 3JZ7A 4S1DC 1CXFA 3WIFA 3PV6B 3OAUH 1YC7A 1IKNC 1VA9A 1NEUA 2P5EB 3KPPB 3RWCA 2IQ9H 5GGSY 3LSOA 1I1YA 4OM1L 1S8DB 1WAAF 3L7FA 4JKLA 4TRPL 2B20A 2FEDC 4PG2C 2AP2A 1J0YA 4Q9QH 3B5HA 1E6OH 1JPFB 4LSSL 3HUJB 4NQUA 3AFLA 2HG5B 1RVFH 1YMME 2IH1B 3G6AB 3SEPA 2I9LA 1I8IB 2IPUK 1P4IH 4OD1H 3SE9L 1RHHA 5IROC 3UBXG 5KVFL 4C83A 1LGVA 5L8JB 1CD1B 4K94C 3IJYB 3VG9B 4NUJB 1PQZA 2QADC 4Y19E 3VWJB 5IGXL 1ZOXA 3NFSH 4NQED 3SQOL 4XX1E 5D2NA 4MAYD 5EU4B 2PTVA 1A4JB 3ESUF 4PBVC 2V2XB 2YRZA 4YDJB 4JFDE 3WNOA 5IJKC 5L9DH 4ZUSB 2JKXA 2X1WL 3PL6D 2Y1VA 3IDIA 4U1HB 4X0KA 4GKSB 5SV3A 4YHNA 1BAFL 2FWOA 1I3GL 4RGOL 1Y0LB 4EVNB 1VEMA 3QEGL 3X14B 4PB0L 1U42A 3GI8L 4ZFOA 1YPZB 7CGTA 1KSRA 5T1MB 4G8GB 3DV6A 3VXNB 3PDOB 1AD0B 4YR6B 5F9JB 5J1TC 1Z3GH 4F2MB 1MCOH 3RVUD 4MB4A 3IJHB 1UCBL 3BZDA 4PGEA 5EC2B 3WFEH 5FK9B 1KYOJ 3VFPA 4O5LH 1DSFL 1B0RB 2EYTB 3FTGB 4GW5B 1BX2B 2DQIH 4O2FA 4WHDA 5ESVB 1UB6B 1FVCB 2AJ3A 4PG9B 5D1XD 3LQAH 2E9BA 2I24N 3D18B 4PRDB 1YECL 4RMVA 4ZS7L 4LRNH 4FQXA 2ICWJ 2IPKB 4K07A 4U3HA 3JUYA 1ND0B 1Z5LB 4HS6A 4J8RA 4XVTL 5I8CB 4GRLD 3BWUC 4EI5A 5I73B 5AZ2H 2DQHH 1MSPA 5CSGA 2F74A 2MMXA 3TO4B 2Z93A 1MAKA 3ULSB 1TENA 3U46B 1GPOL 4WFFD 5ADPL 4X6BB 1Q72H 1OGAE 2O5XL 5JDSA 3X11A 3MRFB 2DQFA 5J1AA 3V0AC 2VZUA 1DUYA 2D0GA 4PRBA 3RWDA 1BJMA 1RIUH 3FO0H 1EZVY 1A6ZB 5IHZB 3IFNL 3SJVB 3RDTA 4F37K 4NQDE 3EYQD 2V17L 1CL7L 3FB8A 3QIUB 1VKXB 1X5HA 5D6DC 3ARDD 2XTJE 4KZEH 1RZJL 4DZBA 2A38A 3MJ8A 4GG8A 4P5TD 4Q6IA 3M07A 5BJTB 4L4JA 4YHKL 3WFCL 5EN2A 5IT2H 3EAKA 1W72H 1B4JH 1XR8A 3ROOA 3GKZA 4J1UB 1QBBA 3NH7H 2CLZA 1DQDL 2F58H 3QWRD 5D70L 1QFWI 4PRHB 1ACYH 1P4LB 4N90D 5TH2A 3MGTA 5F89B 3C60B 3OKNB 4M6AA 1FL5B 4U3XA 2C7UA 2X4SA 1EGJA 1N59A 1PY9A 4HQQL 1LE9B 1UGNA 4BM7A 5GS2D 5SX5H 3EIFA 4IJ3C 3UJIH 4KVCH 3RWJB 3GHEL 3ARVA 5KJRH 2Q3ZA 5CIPA 3LPWA 1G7LB 5C0AB 4BSVA 2R4RH 3FO2A 3S34H 4YBLC 2C4FT 3QFDA 3GSQB 4PRPD 2Q6WB 4IRJD 5FGBA 5C0BD 4JANA 4X5XB 1DANU 1R3IH 4I77L 4EDXB 1U8HB 5MP6H 2WBJA 3HG1A 2NY1D 1ULVA 5FOBB 2EDQA 1CFTB 3ZKXC 5T3ZH 4HFUL 3UTSA 1DDHB 1SM3L 2J88L 3C8KA 3QXDB 5DA0B 4IMLB 5CD3A 3QP3A 3PUCA 3O6ML 1I1AA 5J12B 4HWBA 1VERA 3D3VD 5D1ZD 3SGKC 1RJCA 5DUPL 1NEZG 1EH9A 2AJZA 4KTDL 1CIUA 2QADD 2QJDA 4GSDH 3QIBC 3B9EA 4KY1H 1JGDB 1T0MB 5CS7A 3X13B 4IMKA 1JGLH 1X4ZA 2MOVA 3QBTB 3EJZC 4HIJA 1T0PB 3U36B 5AUMA 1RULL 3VH8G 2NPLX 2DQCL 5HYSG 2OR7A 2AJSL 5FHAL 4F58L 2D03H 3LN9A 5CEYB 3RVVD 4LAQL 2AV1A 2CLRA 1K6QH 2F54D 1HEZA 5EU6A 3GGWB 3OXRA 3QXWA 1XGYL 2F19L 1PD6A 5IVOA 1T3FA 1CDUA 5FA3A 2ZSVB 4OI8A 3TFKC 1F4YL 4IM8A 1NCAL 1OPGH 5F9DC 3ULUH 5FUZH 4KJYA 3KHQA 3LKSB 5JPNA 5EOQH 1HE7A 1F4WL 2FZ3A 1RJZB 3MCG1 1QR4A 4I0CC 4N8VB 2C3XA 2HVJB 3TYFA 1I85A 4DCQB 2FLBT 2WQRA 4TUOA 1XMWA 1GC1C 4Y4HB 2FL5B 5H35B 1R5IA 5HI3C 2GJ6B 2DQGH 1A1MA 2XFXB 3E1F1 4MAUH 5CP3H 5I8KL 3RAJH 3BPNC 1JPTH 1DBBH 1H3GA 4R7NA 3WIFB 3QIWB 3MTRA 3I6GA 2F53D 5HDBF 1JN6B 1INEL 4M8VA 3QNXA 3V7MA 3RWCB 4YPGA 1ZWIA 3LSOB 1I1YB 1WEJL 1Q9LA 4KXZI 1OP5K 3P9LA 3L7FB 3C09B 3O6FC 4HH9A 4OZIF 3W2DH 4M3KB 1U41A 3MUGA 5D7JD 1NMAH 1I7UB 1OAKH 3VMPA 1YEHH 1MHEB 1VB9A 2XKNA 3KXFA 3V5KA 1EHAA 2IG2L 3ARBC 3KYMB 4ONHA 1RHHB 3DMMC 5AYUL 5EO9A 4C83B 2YUXA 3M1BA 5EO1A 4R8WL 4IRSA 3NIGF 1PQZB 3UMTA 1B2WH 3QUMA 5DMYA 4NM8L 1MWAL 1C1EH 3D39A 3QHZH 4G5ZH 1RD6A 1QRNE 5D2NB 2YC1A 2KPNA 3S7GA 5I66A 5DRZA 4Z95L 5TQ0L 2CK0L 5JNYA 1IE5A 4Q9CA 5DVKA 4EBQL 3IDIB 5HDBE 4X0KB 4XC1H 4GG6F 4XTRC 3ZMRA 4X6EA 2HT4D 2FWOB 4XI5C 4F7MA 2GHWB 1AFVL 3WSQL 4ZFOB 3EJYC 3MUZ1 5MI0C 5DURB 2HLFD 4HMCA 1T7VA 3D69A 4WGWB 3WFZA 3FFCD 4OTXH 1G7JA 2JE8A 3BIKA 4WO4C 4M5YL 5FYKU 2YD7A 4PGEB 4XPBL 1NDMA 3Q1SL 3GK8H 3BJLA 3VFPB 1U8QB 4YGVB 1H9VA 3BPLB 5DT1L 5T3XL 1AJ7H 2A73A 4KKBD 3VFRA 2HWZH 3HFMH 3KDMB 3GMPB 5ITBH 3LQAC 2DIJA 4LLVA 3BIAX 3MV7D 5GZNC 3BGMB 3ARTA 4OGZA 3MV8E 2YD8A 2E8ZA 2F5BL 1IGMH 3VXPA 4LIQE 1DQLH 4G9DA 4J8RB 3WO4B 4DGIH 1EERB 1G9NH 3U7AA 4XPGH 2XNAA 5ISZA 4X7TA 1MI5A 2EXWC 3T1WA 1GL4B 3AVEA 3RPIA 2Z93B 4UTAH 3BH8A 3ZTNL 1OP9A 3TCXA 4TN9A 2NY0C 2V9TA 5FF6A 5JDSB 3THMH 2VUOA 2GEEA 2NXZB 3X11B 4JO3H 2DQFB 1T0NA 3MCLL 4EN3A 1YDPA 1JRHH 4DGVL 3ZE0F 2A0LD 3SDXE 4KGJA 5JW3H 1DVFC 1CZ8H 4LMQE 1SJHA 3TZVC 4UI2A 2J8HA 4RGNB 1QSEE 3TH4T 5A1AA 4XNQA 1G0XA 2EDJA 2BNRD 3O6KL 4Z9KB 3S36L 2GYSA 3VI3F 3FB8B 1U8PA 3FT2B 4EOWH 4AY0A 2GTZA 2VZ1A 2APXA 3P30L 2DLGA 2ZNWA 1FDLH 5E6YA 4Q6IB 3ARGA 5FECA 2GQHA 1YNTA 5FHBL 2Z4QA 1XR8B 4NNXA 3G5ZA 3ROOB 4U7KA 1S3KH 5AZEL 4XHJC 2CLZB 3C5ZD 2D3VA 1VDGA 3MODL 4KQ3H 4L8SA 2ITCB 1XF2A 4UIKH 4CRPA 5IHBA 5H37H 5GGTA 3MGTB 5TH2B 1XGQA 4QOKB 4X80L 2X4SB 4JHWH 1FJ1A 4K8RD 1OW0A 1N59B 3VE0A 4MA1C 3O6LL 4PJIF 2VXSH 2JB6B 1CLYH 4RA0C 3P4NA 2NY7L 3KPTA 5CIPB 3FQWB 3CXHJ 4ZDHA 3QQ3B 1EV2E 4HIEA 1LP9F 1F11A 4FQ1L 4H0IA 3QFDB 4M93B 5EORH 3BX7C 2A83B 2EIEA 3SDYH 3VI3E 1ZK9A 5I30H 4JANB 5CMAA 3IETA 2WBJB 3KPSD 1AO7D 4OM1H 1U3ZA 4JO2L 3HG1B 2DQJL 5F6HJ 4XWOD 3WN5A 4PJXF 4LSTH 2Q76A 3NVQA 4JPIB 2Z0BA 2QTEA 1KTLA 3FMGL 3UTSB 1I3UA 1OLLA 4HLZG 3C8KB 1JHKL 2J3SA 4WGVB 1I1AB 3QI9D 2FIKA 4LPCA 1ES0A 5IKCB 1FFRA 4P59H 3VXUA 4KJPC 3O4OC 4JFFA 3SQOH 1KB9K 1AXTL 1OCWL 2CRMA 15C8L 2ENYA 5ALCL 5D7IA 2UY6A 4GBXC 4HBCL 5L6YL 1LP9E 5I1DA 2YBRA 1OF2A 2XN9E 2EKJA 4HIJB 5A3ID 5AUMB 1J18A 2AERT 3NACL 5I1EL 2NY2C 4HS8L 1QA9B 4M61A 4OZFH 1HZHH 1I3GH 4JQXC 5E2TL 5FUCE 3DXAA 3RWIA 5LBSH 3QEGH 4L4TE 4QRTA 4PB0H 2AV1B 3WIHA 4K71C 2CLRB 3TPKA 3GI8H 1FO0L 3OTTA 1MJ7L 1JF1A 5MEND 5EU6B 2YD9A 3OXRB 2BERA 1K2DB 4JZJA 1T3FB 3MBEC 3QDGE 1M6OA 2BNQD 4YO0A 3MRKA 5E4EC 3AREA 2P44B 1XIWD 4AEHL 4GJTB 3AB0C 3VD7A 2VXVH 5JPNB 5BW7A 5FO7A 4RRPA 1VGKB 3P4LA 3N9GL 3NIDF 2M1KA 2V5YA 2DLTA 4HSQA 4JCLA 1XF5B 2P5WD 5ANMB 5CBAB 3JTTA 4MJ6B 5E94A 3W0WA 2EE3A 4XMLL 4UT7H 4XP4H 3HE7C 5DJXA 1BD2E 3I9GH 4TUOB 1YECH 1ZAGA 4ZS7H 5BRZA 1BFOA 1OSPH 4XVTH 2H1PL 3HAEH 4OCLC 1A1MB 1OGTA 1J0HA 4R7NB 5DJ8B 3FONA 3I6GB 3BKML 2BSED 5JW4Q 1HYSD 3QNXB 1KCUL 1OARL 4Y16B 1HIMH 3RZCB 1ZWIB 4ZFOL 1Q9LB 4BH7A 3WFDL 3P4MA 5ADPH 4MGXA 2HLAA 1VEPA 1S7SA 4HH9B 4X4ME 2E27H 2O5XH 5I9QB 4PRIA 1F6FB 3MUGB 3T2OA 4YGAB 4HIIA 4QY8A 2X05A 2APFA 2NTFA 4ZSOA 2YD3A 3KXFB 3V5KB 4DZ8A 1RZGB 5EC1B 3U4EA 1GAFL 4AEIL 5LXGL 4P5KB 4DFHA 4YHLL 4QXUH 5EO9B 4XNZB 3M1BB 2R1XA 5EO1B 4IRSB 2V17H 4HGWB 1CL7H 3QUMB 2BFVH 3RIAF 1NCDH 2YMXH 3SCMB 5IQ9A 3D39B 3BWAA 3U48A 1A7OH 1RZJH 1T7WA 3UZEA 2WM0A 4LDLB 4NFBA 2YC1B 5I66B 5DRZB 3MNWA 3MRLA 4YHKH 3WFCH 5JNYB 1URLA 3MRPB 4CMMB 2EE2A 4N8CL 5C09B 2IANA 2W60A 3RVWC 5D70H 5ICXA 4AG4H 3V6ZA 3WLWC 1FBIL 2VXUL 5CZKA 2X42A 1JV5B 2YA1A 3D0VA 3MJ9A 3QG7H 1HH9A 4WFGE 3U9PL 5J3HC 1JWSA 2XZQL 3O9WA 2B4CH 3N85H 3T1FA 4U05A 5MEQA 1H3XA 1IGFH 4P2RA 4M1DL 1EEUA 2E9JA 3BDXA 3BIKB 3GJFK 5IJVA 3HE6B 1NDMB 5EU7E 4U6VH 3SGEI 1SY6A 4HGMA 4ZUWB 1S9KC 4RFEA 4U1IA 2A73B 4S1RL 4NN6B 4RA3A 3VFRB 1DP0A 5K9OA 2YPLE 3BKCL 4MS8C 3WUZA 4LLVB 5C07D 3S5LA 3QR2A 4O51B 4XAKD 4LCYA 1CDHA 2LQRA 5CKAA 5GRUL 5CUSL 1A6VH 4G9DB 4HUKB 3VGAC 4XNXL 4Q2ZA 2XNAB 4K3DH 5ISZB 3IYLW 3O6MH 3T0EC 1H15A 1MI5B 4D0BB 1P1ZA 1MQKH 2A74A 3RPIB 2VRAA 3BH8B 3WS6C 1J5OL 4KTDH 4PFEA 3O3EA 2BC4B 5IMKA 4KJPD 5DFWH 3O2WH 2YKLL 1MCBA 3V6OC 2O5ZL 3A67L 5FV1L 5DZNA 5B39G 1D5XB 3EO9L 5FF6B 4GBXD 4Z7WA 3ULVH 2JJUA 4FZEH 2AJYL 1JUFB 1T0NB 2DM3A 5IBUG 3U82B 1MCWW 2ZUQB 1YDPB 5K33A 1QPXA 4ELKB 3UC0L 3MFFA 1H0DA 3B43A 1YUHB 2DQCH 3MRDB 4GMTL 5C2UB 1C5BL 1SJHB 2VLKD 3KLDA 5FHAH 4F58H 3RUGA 4XNQB 1CT8A 2JJVA 4LAQH 4Z77B 2IEPA 1G7HA 2AJUL 3B3IB 2WANA 4PJEA 4MSWA 1WFTA 1U8KB 2VQUA 2BOCA 2GTZB 4YIQB 2F19H 3DETC 5BOPA 3U7YL 1UJ3C 3OAZK 3ARGB 4W6YB 3DVGA 4YC2C 1F4YH 1YNTB 1ADQL 1NCAH 1N8ZA 3E2HC 3ORJA 4PJFA 1CXEA 4HWBL 1F4WH 4QRRE 5F3HA 3RGVA 2V7HA 5SX4H 1QNZH 1FJ1B 1OL0A 2CSPA 3VE0B 3MV9D 5DRXA 4K3GA 2YD1A 5I18L 4TSBL 1QEWA 5JIKA 3P4NB 3K2UH 4BELD 4ZDHB 5I8KH 4HIEB 1F11B 3GMRA 4OCRL 4Q7DA 3N06B 4POUB 3PP3H 4GS7B 4PY7A 1INEH 1QFWL 5D93B 1OD7A 3O2VL 5CMAB 1WEJH 2ZOKA 1A6UL 2ZG2A 3IETB 2GFBB 1QUNA 3I6LD 3VFGL 5SWQB 4U1SA 2FO4A 4YDKL 5DEGA 4IOFD 1QG3A 5IVXA 3EZJB 4S1QL 1KLUA 2PCPA 3QEQA 1KTLB 2VISB 2RGSA 3QDMA 2IG2H 4WJ5B 1FFNB 4U6TA 3TV3L 5D7LD 2HJKA 1JJUA 2FIKB 3RKDC 3WNMA 2NY4D 1A9BB 3VXUB 1KB5A 5CP7A 4NM8H 1MWAH 1WZMA 4TSAL 3SKOA 3KYKL 4RISL 5BS0E 2D4FA 3NCFB 5DHVA 1PG7X 1YMMD 12E8L 5DI8A 3GBNL 3BAEH 4FXKA 4Q6YA 2YBRB 5I1DB 4PBWD 4H25A 3FOMA 3RVWD 4EBQH 2Q86A 1QRKA 3JWNC 4OCWH 4M00A 4HJJL 4X4YA 1TTUA 1HCFX 3QWOA 2E7LC 4HKBA 2QSQA 4M61B 3REWA 4WW2C 3AXLA 4ZAKD 5C70A 3DXAB 4Y19D 3RWIB 5J3HD 3AS2A 2L0DA 1DBAH 4LSRH 5IBTH 3B2UD 1L0QA 3B9KD 1XF4A 1MEXL 2NY6B 5I0ZA 4HG4K 4JFDD 4JZJB 1KCRL 3ZZ1A 2VDOL 4KHXH 3S3SA 3TC9A 1M6OB 4YO0B 4OI7A 3AREB 4FFVD 3TVMD 2FCBA 5CWSA 1EAPA 2R1YA 1T66C 1JWUA 5H2BA 2EEBA 5DT1H 3H9SD 4QXTA 5T3XH 1V05A 3RWFA 2K3TA 3ULUF 5E94B 3W0WB 2W9DL 2CIKA 4JDTH 5E56A 1RUPL 5DJXB 4MS8D 3IDJA 4Y88A 1Y6MR 1FRGL 5FYKE 2VDML 2H6PA 3MRHA 1QBLH 3IVKA 2EIDA 2AXHA 2O93L 1G1YA 3OL2A 3IKKA 3PWJA 4UZGA 3ETBF 1UQSA 2E8YA 3O8XC 1BFOB 2F5BH 5BRZB 2HRPL 3GSNA 4LVOB 2C3GA 4Z18A 4TNVK 2JLLA 4PGDA 4WCYL 3MRJA 1VFAA 3FONB 3VI4F 1GIGH 3IS0X 4P46D 4XC3L 1S7VB 1P4BL 1NC2B 4BH7B 3P4MB 4NNPL 4Y4KA 4QYOA 2CXKA 2Y7QA 1Z2KA 1S7SB 1M7DA 4L5FH 3BP4A 4PRIB 4Y89A 4TUJB 4HIIB 3MCLH 4QY8B 1FFOA 1XT5A 4CN4A 4DGVH 5B4MC 4DZ8B 2VB5A 4L9LA 3U4EB 1E4JA 4GOSA 1E0OB 1T89C 2I27N 4LPVA 2R1XB 5DJCA 3O6KH 5FIEA 1OGAA 3S36H 4QHLA 4FFWC 1ZGLP 2HYMA 4RQQA 1VENA 2J4WL 3DETD 2AI0L 1RIVL 1RZJC 3BWAB 5ACLA 5IQ9B 4JFEA 3L5XH 1DN0A 4JRYE 4PJGE 3FQUA 3OGCA 3L3JB 3MRLB 4YHIA 1LEGA 5EOTA 4HS3A 4HUXA 1T2JA 5SWZA 1HHKB 5L8LB 1ZT1A 3VDCA 2J1KA 5ICXB 1U95A 2VZ3A 2QHRH 2H9GA 5M94B 2XWTB 4PJAB 1WCBB 2ICWA 1CS6A 5HHME 2J12B 5DD5L 4GW4A 3V6ZB 3UO1H 1I8LC 4BSWA 4YFLI 4P3DA 4X80H 1G9MC 4OAWA 1HH9B 2XTJD 4HK0A 4FS0A 5F7HA 1JWSB 3OQ3B 1FYTA 1YEFL 2F8OA 3FQXA 2V5RA 3HI5H 3O6LH 3QXTA 4DKEL 2XY2A 4Z5RA 3BZEA 1HQ4B 5KW9L 3TA3C 2NY7H 2XPGA 4P2RB 4I3GA 3QCTL 3QXAA 4JRXE 5F7KC 4Z7QE 2BSTA 5IJVB 4FQ1H 35C8L 3VXMD 2ATKA 4BZYA 2APWA 2FH8A 4ODSL 1X5XA 2WWMC 2UY7A 3OZ9L 3LD8C 2UZYB 4RFEB 5EU3A 2ZSWA 4U1IB 1B88A 4Y5XA 1UG9A 1EA9C 5K9OB 2DQJH 2R1WB 3AC0A 4OF7A 4U6YA 1VACA 5M7QA 3MOAL 1WITA 1NL0H 3QZWG 4G7VL 3S5LB 2X10A 1CGVA 3T0WA 1LE5A 4FQLL 5ENWA 3KLHC 4P9MH 3UZVB 1A02N 1ODAA 1ZS8A 3FMGH 3SKMA 5KSAC 3ZSTA 2HFEA 1JHKH 3BT2L 4NOFA 5GGTL 1H15B 1X3DA 3EUUA 2ZUXA 5T1DL 1P1ZB 1U91A 2A74B 1G7IA 2DMBA 1J7VR 1U2HA 2CUMA 3D85D 1IJ9A 5LCVL 1LWRA 1AXTH 3KJ4B 1MJUH 1KB9J 1KIRA 3PHOA 1U3HD 1KEML 5H37G 4Z7WB 1MFBL 4NQEA 5ALCH 3V4VL 5L6YH 3ALXA 1AHWC 3QFJA 2QSCL 4HBCH 5D4QA 2Z9TA 1MOEA 5GRVK 3ZHDA 1BVZA 4PLJC 1EEZB 4MAYA 5DEFA 3MFFB 5E08L 3NACH 1YEJL 2MTPA 4CVUA 5I1EH 5C0RH 1GGBH 1BBDL 2D31B 4E41D 3PL6A 4OLZH 3RUGB 1CT8B 1IM9D 3MCKA 5DQ9A 1G7HB 2AQ3A 3CFDA 1MJ7H 1M1SA 5BXFB 4JN2A 2BOCB 2FJHA 4HXBH 3HPJA 8FABB 1BZ9A 3IDGA 3DVGB 2X4NA 4J6RL 4U7SA 4KI5F 1UM5L 4WV1A 3SHSA 4AEHH 1B90A 4Y8AA 1NFDA 5HHOB 2E7HA 4IIQC 3BH9A 4QXGL 5F3HB 5F7EL 1S7UA 3RGVB 2V7HB 2BVUA 3ES6A 1V3LA 3T0EE 1T83A 2DYPD 2VH5L 4WI3A 3QUYB 4G6FB 4PP1C 5DRXB 4LNRB 1CWVA 3BOVA 4UNVA 2BVEA 3I3BA 4NQCA 5D5MA 4ZFFA 2JCCF 1QEWB 4ZXBC 5D1XA 2X9XA 2WK2A 3REVB 3WHE0 3LHPL 5ADOH 1BIIA 4HMDA 4FQJH 1MELA 3NZHH 3GMRB 1HI6A 2AK4A 2VXTL 4MQSB 1XR9A 1IEBA 2DBLL 3SDCC 5GRJH 5HGHA 3BKMH 1QLFA 4PY7B 1YEDA 4WUUD 5TPWH 1KCUH 1OARH 3WIHL 5C0CA 3FN0L 1IQDA 1F6LL 5BQ7A 3QCUL 3OWEA 2OM5A 4U1SB 2FO4B 3TGXA 3JSSA 1OM3L 4OZFG 3VXSD 4KI5E 2M2DA 3U6RA 1CN4A 4P4KC 4CAGA 1KLUB 3UTTE 1SEBA 5J1SC 2LVEA 3QDMB 1FZKB 1S9VA 1GZPB 4KJWC 4DN4L 1GAFH 4AEIH 4MWFB 4GAJL 1O5DT 2HJKB 5I2IA 3UTQA 2VDQL 4TYUA 4ELMF 1CICB 1W0YT 4J3XA 4PGJA 5F1IA 4R0LA 1GZQA 1KB5B 5CP7B 1Q9KA 3SKOB 5DJDA 5I1KL 1G6VK 4XRCB 3GMOB 2FEEI 5DHVB 1QTYT 5DI8B 3MLYH 2VLME 4YHML 5J11C 2W9LA 4H25B 4N8CH 1T21A 1JGUH 1EJ6A 1TNNA 3IDMA 4HAFA 4ZOEA 2NW3A 2G5BA 4X7FC 3QWOB 4BQ9A 4HKBB 2A77L 3REWB 3QWRA 1ZMYA 5D2LF 3AXLB 2BCKB 2VXUH 3DI2B 1A7NL 2ORBL 1H3VA 2XZQH 1MRCH 3BUYA 1QRND 2X4UA 1NC4B 1CXKA 1XF4B 3TT1L 5EB9A 3TN0C 4RSVA 4WW1A 4NM4L 4O02L 1SQ2N 4NCC1 3GI9L 1F3DH 5CSBA 1IAKB 5CWSB 1IT9H 3H3PL 1T6WA 3QUXA 1ZSDA 4ELME 1JWUB 2VAJA 3JVGC 4NDMA 3IKCA 3CFIC 1E27A 4FTVD 2WIMA 1P84K 4QXTB 5I1CL 4MA8H 2EC8A 1IKNA 5TF1L 2YPVH 3A6CL 3IDJB 1EJOL 3BKCH 3U7WL 2H6PB 3DHJA 4M7JL 3MRHB 1TLKA 1ZA6A 5IHUL 2VE6A 3PWJB 1PYWA 1FGVL 2NY3C 1UQSB 3HC3L 4PG2A 3NA4A 2W59A 1KIPA 1QHPA 5CUSH 3GSNB 3QJHB 4B5EA 3UJJL 4HF5L 4PGDB 5MERA 2AEPL 4R2GB 4NP4L 3MJ9L 1S9YB 2MQCA 3ARPA 1XF1A 4JEGB 5BMFL 3LN5A 1EGJH 2R2CA 3DYPA 4H8WL 4XCCL 4JREC 2Z31C 1AXSA 1A7BA 4Y1AD 1U8MA 2O5ZH 5MHSD 1ZT7A 3A67H 4XVUD 1VGEH 5KSBA 1DJSA 3EO9H 3P0GB 3BP4B 5CIPH 2R0ZL 2WLZA 1GXEA 4MNQE 3AS0A 2ATPA 2RQ8A 5IJKA 2OR9H 1EVTC 1W0VA 2BXYA 2X6MA 4L9LB 2NXYB 1FGNH 4PY8I 5F7NC 5DJCB 3GUTA 3TH3T 2A9NL 1OGAB 4QHLB 3ZTJH 4KMQA 4QNPE 5IW6A 2MSPA 3H7BA 3PHQA 1LK3L 2D7MA 1YJDL 2VC2L 2QR0B 3SDXA 2V2TA 4D9LH 3U7YH 1NMCC 3OGCB 1LEGB 5EOTB 1MCKA 4HS3B 1GOHA 4YK4C 5SWZB 3D9AL 4HWBH 1ZT1B 2WINA 3PP4L 1U95B 2ADFL 2EEDA 4N1EA 4NQDB 3TWCL 3S8WA 1H8SA 2ICWB 4GW4B 3CMGA 1KPVA 4BSWB 43CAA 4OAWB 4FQHA 4NO2A 2IBBA 4HKJB 4PP1D 1CI5A 4R26H 2ED8A 3FQXB 2IPTL 1OAYL 2EDFA 5F6HI 5I18H 4TSBH 1HHIA 4Z5RB 5HI5D 2XPGB 4XBEL 5M95B 3QXAB 3D87B 2BSTB 2EDWA 1Z0MA 5L2KD 3MRQB 2V6HA 1QFWH 2DMCA 1MREL 4JM2F 5EU3B 1QVOA 5SX5K 2VSDA 3RTQC 4Y5XB 1A6UH 3BPOC 1AR2A 3D0LA 5FKPA 2E7BA 2YK1L 1VACB 4U6YB 1NBZA 1FSKC 1LE5B 4S1QH 2NY5L 5ENWB 2Y36L 5K9QG 2BDNH 4NQSA 1ZS8B 3SKMB 4RAVA 1ZLWH 1RZ8A 3NA9L 3TV3H 2L7JA 3WEXA 2BP3A 3QPQC 3GMNA 1U91B 1E28B 4IOIA 1G7IB 3SDDD 3QPXH 2BMKA 4XWGL 3D48R 4PJBF 1N5YL 5D6DA 3KYKH 5E6ID 4ZYKA 1T1YB 4RISH 1NUDA 3GO1H 3PHOB 1GGIL 3UAJC 3QFJB 4QRUA 5F7WC 3PV7A 1JMZA 3DV4A 5FYLH 3EYOA 5LQBL 5SWSD 3ULVF 2HH0L 3MCKB 4JHBA 1RZ7L 5DQ9B 5C0JA 5E2VH 2GY7B 1QFWM 3CFDB 1KCVH 4S10A 3SDAB 4JN2B 5HDQL 3TN0D 1MEXH 4FNLH 1NAML 4DJMA 1YEIL 2FJHB 3MRCA 4HG4J 1H3PL 1BZ9B 2VDOH 3IDGB 2X4NB 3L5IA 3QEUA 3S96A 3T04D 4GAYB 4WV1B 5TE7H 5CLWA 2N4IA 4L1DA 1R3KA 1NFDB 4HX1A 4L4TA 1OD9A 2AEWA 3HUJF 3RVTC 3BN9D 1KACB 1S7UB 3S37L 1KB5L 3QUMH 1HHGA 3JWOC 3BQUD 4PJ5E 2W9DH 5D8JL 5CILH 1RUPH 3Q6GL 2VDMH 1A4KA 1KTRL 2NY3D 4NQCB 3F8UB 3QDGD 4ZFFB 5E1AB 1MAMH 3TJHC 2HRPH 3V6BR 4ORZC 2RFXB 3CC5B 4Y5YC 3TBTA 4L3EE 1BIIB 4NRZA 1T4KA 1BIHA 1HI6B 2AK4B 1GRWA 1PGRB 1XR9B 1IEBB 2GI7A 5HGHB 4XB7A 1J0JA 5I16A 1FORL 1QLFB 1YEDB 1BD2A 3TNNA 1D6VL 4BZ2L 3SGKA 4UBDD 4GLRI 5C0CB 1CFSA 5JW5A 1JTTA 4APQD 2IFFL 3MLSH 4Z7OF 5BQ7B 3QIBA 3DROA 2X89A 2ZPKH 3QQ9C 2DDQL 3U6RB 5GS0D 5C7XL 1A8JH 1BBJA 1SEBB 2LVCA 1YPZF 5C9JA 4DEPB 1UH4A 3CFCL 1S9VB 3GDBA 4PJCA 3HUJE 1JNHA 1IGCL 1JZ6A 5F7DA 1J9CT 2ENSA 4HJGA 2ICCA 3UTQB 4ONFH 1OTTC 4KH2A 4M1CC 4X4MA 1NGYA 4XPAL 3OB8A 5BVPL 3TESA 5F1IB 4R0LB 4QTIL 1A6WH 5KS9F 5DZLA 2J4WH 2FD6H 5DJDB 1EUUA 1RIVH 4JFPA 2FECI 3HZVA 4KKCD 1KXTB 2HAZA 3GSNL 2AXJA 4O2EA 4HDIA 1O7SA 5INCA 4JGMA 3IDMB 4YFDB 1YA5A 2PO6C 5E1HB 2B39A 5DD5H 3C5ZA 5AWNL 4Z7OE 1J12A 1YEFH 2X4UB 4R7DB 4QHUA 3T0AA 4AK1A 3WNKA 5CD5D 2IMMA 5KW9H 4M62H 2DJUA 2VUYA 4PJ8C 4WI7A 4OKVA 4GAFB 4OFVA 3O0RL 1OSZB 1ZSDB 3QUXB 4H1LA 1RUKL 1YMHA 5T5NG 5F71A 1UENA 4MLIA 4NDMB 1E27B 2GK0B 4FQIL 2ERJC 5KS9E 1X7QA 1R6VA 4OGAD 3QQ4A 2GSGA 1TMCB 2KKQA 2OI9B 3MOAH 1UWGL 3O6FA 3KPSA 4R4NC 2VE6B 1PYWB 1VEOA 3EHBC 4FQLH 4P23D 1MFDH 5CJXC 2VXQL 3ZLQC 4U3CA 1H8NA 3ARBA 3CU1A 4X9HA 5GGTH 1D9KD 5MERB 1NAKL 1MCWM 4YXLL 4N0UE 3DMMA 4ODHL 2P42B 3NTCL 1XZ0A 2YPLD 4TQEH 1KBGL 2IAMC 1N6UA 3MQIA 3ALPA 3MV8B 1U8MB 5FKAB 4H88H 1MH5A 1BEYH 1E4KC 5E8OA 2FB4L 5D7KE 1KEMH 1MFBH 3V4VH 2VLRA 1KEGL 2QSCH 4OT1H 3P2TA 4K3HA 2HN7A 1A6AA 4KRPB 4X98A 5E8DL 5JXED 2ATPB 1LO0L 5E08H 1J1PL 1YEJH 4DAGL 2ID5A 4HZAA 3L5HA 1W0VB 5T5NF 3GSXA 5HVHC 1WIPA 2B5IC 4MDIB 3GUTB 2GJZA 1JBJA 4G8FA 4UUJA 4ZUVA 4PYGA 5IW6B 2X44D 3H7BB 3PHQB 2RCSH 3O2DA 5C8JA 5T3XE 2I07A 5F1OB 3VFSB 1I9RL 3SDXB 2V2TB 3K2MC 1WFOA 3CAFA 4J6RH 2GTWB 4PJ9C 1UM5H 4R9HA 4WO4A 1QSEB 3IS1X 1PEZA 3L3GA 2Q1EA 2WINB 3OR7B 3U30C 4FQCH 2QV2A 5AEAA 4AMKH 1V5JA 4QXGH 4XP6L 3HPLB 3RHWF 4QGTA 4HJ0C 1KPVB 4MD4A 43CAB 4FQHB 4NO2B 5I8OL 3MA7A 3T0XA 2P5WA 5DF0A 4Z7UE 3ZKMC 5I1HH 2AK1L 4P2QD 3LKNB 2PXYD 4LHUA 4KK9D 3MXWH 1MCSA 5IB4A 4QRRA 1MFCL 5IK3B 2VXTH 3X3GH 4O9HH 1KUMA 3AS1A 4KRNA 3S88H 4YDVA 1G9EA 5CINL 3WIHH 2GKIA 5JR1L 1UWXH 3FN0H 1QVOB 3PGDA 4UV7L 1SYVA 3NFNA 5FV2A 5DXWA 1T1XA 3D0LB 1CR9L 1GGYA 3KNBA 4RMUA 3MROA 1UWEH 1INQA 1NANI 2VO5A 3LPGA 5FYJD 4NQSB 2DS4A 2V5SA 5JUEH 3PNWA 4HKZA 4RAVB 1RZ8B 1RV6X 4DN4H 1FYHB 3M8OL 1DVFA 3GMNB 4GAJH 1OTTD 3TZVA 4JN1L 2C9AA 4IBLT 4LPYA 2V2WA 3P9WB 3QEHB 1FZMA 3I6KA 1U8JB 4DKFL 3N1FC 1JPSL 2EKSB 2AGJL 1LO4L 4PREA 4YHMH 4QRUB 4XGZA 2PO6D 2ESVE 1X5IA 3DV4B 5C0NC 1K8IA 4JZNA 4WTZG 3EYOB 2GW5A 1UA6L 1F90H 3VRIA 4JGJA 2XA8L 5LJYH 3F58L 1C7TA 3LMJH 2ARJQ 2ORBH 5GZOD 1X4XA 3BKYH 3N1PC 4LOUC 1LP9B 2XN9B 5E2UL 3QA3A 3OKEB 4JB9H 4IJ3B 4NM4H 3MRCB 5JW4R 5KVDL 3QEUB 3S96B 1QYGL 2XY1A 4LLUA 5EBMA 2CMRH 5J13C 5J06A 4HUWA 2BVOA 4JPVL 3LH2L 5IBLC 3H3PH 4TNWK 1R3KB 4L4TB 5IM7A 1N3NA 1XAUA 5I1CH 2CDEA 3V5DA 3RPKA 5IG7A 1EVUA 1HHGB 1P84J 3AUVA 4U1NA 5TF1H 4D94A 1NGZA 4XT1C 4YFEA 5C9KA 1FNLA 4M7JH 1FPTL 2G60L 1JZ5A 1A4KB 4CVXB 4D0CA 1FGVH 3MGOA 3NCJL 4RWHA 3HC3H 3ZKXB 2ZCKL 1BQLL 3BP7A 3UJJH 4ODBD 4NRZB 1T4KB 4OBSA 4UINL 4TOYL 5T3ZD 1A1NB 4HLJA 2GJ6E 5C08E 2J6EL 4RFOL 5I16B 1S78C 2MKLC 4NP4H 3MJ9H 5BMFH 1BD2B 3TNNB 4Z0BH 4EZMA 1EAJA 3HNTL 1CFSB 4KROD 5GS3A 5IIEA 1G7QA 3TIEB 1LVEA 2UWEA 3QIBB 1XCTA 3DROB 3V52L 4M3JA 5ITFA 3TCLA 1BBJB 1OTUD 3L1OL 4GBXA 5E24E 5I19L 1J8KA 5C9JB 1N64H 1YQ2A 1P7QD 2EDLA 3GBMH 1JNHB 4PJCB 1D5ZA 2EICA 1SY6H 5F7DB 5HJ3A 1FVDA 2VQTA 5TE4H 4HJGB 4MJIE 3J7HA 4F7PB 5ACZA 4JQXA 2APTA 3P77A 1NGYB 4PJDE 5IUSA 4MZ2A 4XXCC 4EDWL 3PJSA 4JFPB 3HZVB 3WL9A 1YJDH 2VC2H 4I1NB 3MLWL 2EDDA 4JVWA 3MBEA 4UILH 4O2EB 4HDIB 5D2NE 4C4KO 5KOVC 2I9TB 5INCB 2CKBL 3ULUD 5BZWA 3D9AH 3TNMA 3PP4H 3LCYA 3W9DB 3TWCH 5FCUL 5EZJA 4RDQG 3GNML 1MCEA 3P4OA 1YNLH 1T2XA 4PJGA 4PP2A 3ZKMD 3HE7A 4JRYD 4LLYB 4F7CA 5L88L 4QF1B 5MEOA 1DEEA 4KKLD 2YRLA 1ZLVH 3CZJA 3K74B 2FEEL 1ACZA 4OKVB 4KKAC 4PJHA 2W65B 1XGUA 3BPNB 3H42L 4W70A 4H1LB 5CHNA 1YMHB 1LD9A 1QKZL 3LDBC 3F6LA 3AU1B 2EC9U 5DFTA 1KXVC 1MREH 4JHAL 5HSFA 3X12A 5F1NA 5JQHC 2Y5TA 1I7ZB 1X7QB 2HFGL 4YDLC 3G6JA 3QQ4B 4YHOL 3QYCA 2YK1H 3O6FB 1QP1A 3ZL4H 1AGDA 4I0PC 1WFUA 4BZ1H 4EI6B 2R15A 4Y7MA 4L8SC 3NA9H 1KGCE 5DJ6A 3ARBB 3OKOA 4Q58C 4EEEA 3EOTH 1NLBH 4HEPG 2CGRH 3ZO0A 4F7EA 3DMMB 4RDQF 5C0DA 1XZ0B 3SGEH 2O5YH 2APVA 4Y2DC 3C08H 3WXVL 4LSQL 1KCLA 1RHFA 1UACH 2D7OA 1N5YH 3HCVB 1MH5B 1JHLH 1JZ3A 5E8OB 3LEVH 4XVJH 3L5WB 4OLVL 3IU4H 1TVHA 3P0VL 2PR4L 2VLRB 4I0KA 2FYYA 2HN7B 1A6AB 2BK8A 2NYYC 4UV4L 4X98B 1RJLA 3SE3C 2CIIA 4U33A 4KZDL 1UZ6F 3TBVA 3GSXB 3V7AE 2HH0H 1DE4A 5HYJD 3TM6A 1M7IB 2BJML 2GJZB 1RZ7H 3WN5C 3IXAA 4JY5L 1XCQA 4G8FB 5DVMA 3KPRD 4UUJB 4JFHD 1LDSA 5HDQH 2P45B 5C8JB 2I07B 3QO1B 5MI0B 2JTDA 4GKZA 4UAOC 3UBXI 3UJTL 5CFHA 1H3PH 4MCZA 1OAZL 4WO4B 1S9WB 3MLTA 1UM4L 3L3GB 1FAIL 1NCNA 3TPUA 4CU6A 4L3CA 5F6IC 3DX9A 4I9WE 4K9EL 4MD4B 4R97C 1KB5H 5IQ7L 3MA7B 4URTB 1DQML 1KPRB 4MB5A 3H9SA 2PYED 4F8TA 4P2CG 1BJ1H 4LQFL 4X6FA 5DHVH 4OGYL 3EKCA 5C92A 2H32A 2R0WL 4KHTH 4LHUB 2N56A 5HHNA 1RUMH 2P24A 3BJ91 5F9WC 1AGEA 5IB4B 4QRRB 5JHLH 1EO8L 4JPKL 2AABL 3FHQA 1FORH 4CADA 5E00A 2E9WA 2VR4A 1HH6B 4YDVB 5T1KD 3NFNB 1T1XB 3V6OA 3N0PB 3KNBB 2NY0B 1QHOA 2DDQH 2DLFL 1FL6A 3LKOB 3T2QA 1INQB 1TZHB 5BVJA 4ALAH 4ODUA 1ZEAL 1OWRM 3PNWB 4HKZB 5I1GH 1IC7H 2B7DT 1IGCH 2QHLA 3IXTA 3JWDC 3UTSE 3UZQA 2NW2A 4QHNA 1DVFB 3TZVB 3O41A 1R3HB 4ZPTA 5TDNB 1ZLSL 4QTIH 2OR8A 2WW8A 1IAMA 4XNUH 2V2WB 2X1QA 3DVIA 4H5SB 5IB2A 1NUGA 5I1LB 3I6KB 2PTUA 3QRGL 7FABL 4L4VD 3GSNH 3HNSL 4JZOA 4PREB 1UJ3A 2X2YA 2ZNXA 4F7TB 1HXYA 2Y6SD