1IJ9A

Highly hydrated human vcam-1 fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR CELL ADHESION PROTEIN 1
publication title A new conformation of the integrin-binding fragment of human VCAM-1 crystallizes in a highly hydrated packing arrangement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 40
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A01
5J8OA 2ADIA 1Y6NR 2GJJA 4Z7UB 1IEHA 5FO7B 3MREA 4LKXB 2VTFA 3OJVC 3JTTA 4P3DA 4RAVB 1FO0A 1HH9A 3QH3B 2MTPA 1HHJA 1VEMA 3O2DH 4RNRB 5E8OB 4YNYB 2PW1B 2R8SH 2HH0H 3WNPA 4JZNB 3X3FL 4X6FB 4RFNB 2XY2A 5IJKA 4HIXL 2BMKB 2VXTL 1CDJA 1ZHKA 4P4KB 3QXDB 2VZOA 2BHZA 2Q76B 12E8H 4Z8FL 3WS6C 3X3GL 3V6BR 3HI6L 4YHIA 3MO1B 3H0TB 3QJFB 4ZS7L 3GK8H 2MWCA 3LN9A 4JKKA 1AE6L 3HG1B 1NKOA 4PJCE 5FYJE 3MV9D 1HSAA 2Q8AH 5HHVL 4KKCD 2V7NB 4TSCH 2ITDB 5JXAL 3BPNB 4PJHE 4JDVA 4K3HA 3VW3H 3OAZH 1U91A 5KSAB 1HZHL 3B6SB 2VR4A 4N8PA 5DEGB 1KTLA 3H7BB 1I8IA 4P2RE 2X05A 3WLWC 1PVHA 4E42A 1ZANH 2WUCL 5GGSB 1W72B 4AEFA 1VKXB 1BZQK 1T0NA 4LMQI 5BZWB 3LQMA 2AJXL 2MHAB 1MVUA 1WT5C 2O5YH 3FN9A 1P7QD 3Q48A 1PQZB 3H3PH 5TPWH 2W1NA 4M00A 4MS8C 2FX9L 3QEUA 3X14A 4AEIL 1KPVA 2QQNH 5B38G 4UQ2B 2HFFB 3BP4A 1TJHL 2YXMA 3CU7A 3BZEB 1KJ3L 4P23C 4PJ5D 3LKOA 2R0ZH 3S7GA 2FGWL 2FEEI 3BEWA 3WSQH 5C0FA 5C6TH 1S9VA 2VH5L 4ZSOE 3DWTA 5J12C 3RL2A 1UJTA 2IFFH 4QRUA 3WUWA 4ELKB 3LV3B 4IS6A 1EBAA 5BVJA 1BZ9B 4MX7B 3STBA 5TE4H 3MOBH 4RCAA 4M6MH 4U0RC 4R7DB 4GMSL 5SWSB 1U93B 1ZLUH 3VXSA 1JNHB 1F6AB 2YD9A 3DX6B 1PEWA 4LPTA 3AY4C 4MQXC 2QBWA 1FDLL 2DBLH 4OCMC 1OD7A 4LAJH 4QCIA 3T0ED 4P2QA 4J4PA 5D7JA 1KT2A 3QEQE 2W9LA 1T1XA 1QFPA 4YIQB 3Q0HA 2HTKC 1SVZA 4NKOA 1AGEA 4U6TA 1T66C 5DJ2A 4NUGH 1L4IA 1NLBL 3DROB 4MD0A 1XF5A 4HJ0C 3L3JA 4KY1H 2W65B 1YQVL 3RWHB 5ALCH 2AK4B 3CH1A 4Y19D 5J1AA 3QIWC 4NN7B 3WFEH 1EHLL 4TQEH 4XNQB 4WI4A 3EO1A 1Z9OA 1D5XB 3LH2H 4DFIA 4BQ6A 5CS7A 5E9DD 1MI5B 1FSKB 1ITBB 2HJLA 2F19H 3SGJA 2DM2A 1I8KA 4U3XA 5DUML 3TJHC 5LWYH 1W0YT 3TO4D 3DUUB 3O41A 5D1QB 3VFPA 1WBXB 3VFRA 1D6VL 3IXAB 1V05A 5HHPB 5HYSB 1CFNA 2IPKB 4J12A 4PD4K 2X41A 5CLWA 4R97B 2PCPA 3IXTA 3PXHA 3QQ3A 1NCWH 3Q5OA 4DCQA 1NAMB 1A7QH 5D70H 4WO4A 4XP4L 5EZJB 3SDAC 1BBDH 1YEJH 4X4ME 3STLA 5KVGL 1IKNC 1KCSH 5F9DC 1WEJL 4HGMA 5FYJD 3SDDB 1JNLL 2NNAA 2VZ3A 3BYYA 5C08B 1R5IB 4FQJL 4ELMF 1KBGH 1M7DB 3WNMA 5D7LE 4GXVL 4U3CA 1NFDF 1RIHH 1NGWB 5F1OB 4WHDA 3ZKMC 3VWKC 1YYML 1AHWA 2J4WL 4XMPL 3L3HA 1CIUA 5DQ9B 4BJLA 2XPGB 4ZAKA 1JPGA 2Z4QB 2O26U 5IBTL 3I3BA 4Y4HD 5TFSL 1J10A 4PREA 4LASL 2SEBA 3VD9A 4NCC1 3P30L 2VDQL 1BFTA 1KCRL 4EUPB 1G7QA 2VOTA 3K8MA 5HGAB 2OK0L 3MBED 5I30H 2DWDA 2YUVA 3NCCB 5F9OH 3P40A 3CVIH 1IKFL 5ADPL 4P9HH 4R90H 1OW0A 4OIIL 4LPCA 2R1YB 3PWJB 2IGFL 1C5BH 4Q6YA 2FSEA 3MV8D 3OR7B 1A6VH 3L7EB 4L8DB 4YHOH 1A64A 1EVUA 3QPQC 3DV4B 2E6QA 3B9KD 4U1JA 5E5MA 4ZO7A 5DRWA 2JK5B 3MLRL 4OD1L 5ESQA 4N0YH 5IOPB 5CJXA 3PHQB 3C5ZA 5EU3B 3L5WB 4YR6B 2AEWA 1BOYA 4B0MM 4QRTA 5B4MD 4D9QD 1A47A 2EDBA 3CDCA 3PJSA 3MROB 1QLFB 3BSZH 2J8HA 3ULVL 1H5BA 2IH3B 1CDHA 1NUNB 4PGZA 2BNQE 2E27L 5C8JB 1Q9LB 4TRPL 4PJIB 1INDL 2F54E 4JHBA 3EBAA 4ODXB 3S6CA 5J6GA 2X5PA 1H0DB 4OLYL 2B1AH 2JLLA 4P9ML 3I9GH 2FJFB 3G6JA 2RHEA 1OP9A 1EFXB 2AXFB 3AXLB 5CKAA 3HMXA 3IJYA 3IT8D 4NNYB 4QRQA 5KVFH 4HUVA 2ESVE 4V1DD 4CJ1A 4KK8C 4OV5B 4WDIA 2V9TA 3PWLA 4U2ZA 3RVVD 2VLLA 1KCVL 3ZE1F 1MFBH 1PY9A 4F8QA 1B0GA 4A2MA 4PLOB 3TVMC 2C9AA 1DVFA 1YJDC 3BP7A 4X7TA 3SGEI 3FKUS 1RIVH 5GGVL 5T33L 5EU5B 4G80A 3ZSTA 2BY2A 4XVUD 5JR1H 5FYKU 5D1ZB 1P2CA 4R4BB 2VIRA 4GAJL 1JGVL 3ESUF 3AM8C 3E1F1 3TFKC 2WANA 5EUKA 2KDGA 5D2LA 1VADB 1BD2D 2J12B 3CZFB 4PJDF 3Q5TA 4JQIL 1GC1L 1U2CA 4K94L 1F58H 3CMOL 1OGAD 4MXQD 3MJ9H 1DJSA 4LHUA 3D87B 4NRYB 3WNLA 4P4RB 1VPOH 3UTZA 3FZUD 4B53A 4X9BA 1URLA 3GBLA 2J8UF 2A1WH 4GRMB 5CD5D 4IMLA 5T1KB 3THML 1DQQB 1UZ6F 3BESR 3OPZH 4KVNL 4LCUB 5TJWK 5TGBB 1QD0A 2F9BT 1XH3A 4GO6B 1DR9A 2DLGA 3B2UC 4NO5B 4AEHL 1U8OB 3STZB 5C0CD 3EO0B 3LKNA 1FGNL 2DQCH 1F3JB 3KNBA 4MCYA 3ALWA 5D7LD 4KI1A 3LEXA 5C0RH 2GSGA 3O6KH 1MFDL 1JTTA 4W4NA 4G6AD 5DHVH 1D6EB 2X89A 4EDWH 5F7EL 1YUHA 1FGVH 3VMOA 2ICCA 1L9NA 2VZUA 4JDZA 1N59A 4Y16B 1VENA 1KV3A 4GW5A 4ELME 1FZMB 2PYEA 5CBEB 3HI5L 2V2TA 1NFDE 3QEHA 3DSFH 1CFSB 1S7VB 3NCEB 4KRPC 2BVTA 3BKYH 1TVHA 5HGHA 3AFLA 2Y9RT 2FL5B 1FZKB 4P46D 1IC5H 3LQAL 4DGIL 1HQRA 3C9NB 4QOKB 5F7UA 1F13A 1IAMA 3MRRB 3AS2A 5EZLA 3UJTH 4I0CC 4RA0C 3MACL 3M45A 1O7SA 4RMSA 3QFJA 5GS1B 4L4VB 5J6HA 3L5IA 1UCTA 2D31A 2YPLA 4HK0B 2VSDA 1NUDA 4YPGB 5CINL 5HHME 2B0SL 4MQ7A 5E8DL 4P3CL 1QLEH 5FF6B 1DEEA 4JZOB 1CGUA 2X4UB 2VABA 2G9HA 4TUKL 4X9IA 1X4XA 3V6OA 5I1GL 2X09A 2R69L 3MR9A 1NBVH 3ROOA 5CBAB 4OZHF 1N2RB 3O4OB 2VLKD 2BVOB 5C3LD 3FHQA 2OXGA 3D3VB 2ZUQC 3RVXD 4N68A 5C0IA 3DX9B 4FZEH 4NZTL 5CAYB 1K8DA 2DJUA 3I6GA 4H20H 1XCQB 2R0KH 3ARDD 4D9LH 1IM9D 1II4E 3E2HB 4WEBL 2P24B 3QUKA 4WWKC 3IRZA 3REWA 4LEOA 1PZ5B 3UZQA 1MJ8H 5GS0H 1L0YA 3PQYB 1FN4B 2NW3B 5JOEA 1Z9SA 1LDPH 4M1DL 3H3KA 4ZD3H 1UWGL 3OBAA 3GMMB 4S1RL 5KG9A 3KPNB 4LKCA 5A2KH 3P4MB 1CD1A 4DN3H 1K9TA 2ZG3A 1FE8H 5DWUL 1VFAA 1CTOA 3ZE1E 3IS1X 2FATH 3WMSA 1J0YA 3H2WA 3MYJA 5E6ID 4YHLL 2OR8A 4CDHA 4UOW1 2DBJA 3LKSB 1HEZA 1A6WL 3A67L 2DLEA 5DJ6B 4L5FL 3H42L 5FO9B 4JHWL 5DA0B 3CUPA 3W0WA 3TNMB 3S4SB 1IGIH 5F3HB 4F9PA 1ZEAH 5IW1B 1VCAA 3IB4A 5J89A 3TIDB 4G8GA 5EBLB 1EZVX 4NZDA 4WFED 3GKWH 3ZYZA 3GHEH 2Q87A 1E0OB 3T4AA 1FL5A 1FLTX 4PJDE 4H1LB 2EE9A 5KSVA 4WUKL 4Y2DB 5I1LB 2BVEA 3HC4H 4R97C 5FECB 1C5DA 5C0ND 1AGFB 4G7YL 3RPKA 4X98A 5JPMB 3UC0H 3WL9A 4NRXB 2E9IA 4TOYL 3SO3B 4PRIB 3KS0J 5DS8B 5L2KB 2J8UE 3RY6C 2HLAB 5FOBB 2VITB 1UZ6E 1TJIL 1LD9B 1F11A 3B9DA 5BMFH 3BVNA 4U1LA 3TA3C 3RIFK 3SKJL 3GIVB 5K9JH 1G1CA 5HYFA 1IFHH 3LN4B 1U8MA 1VEOA 1Z0MA 3SDDC 3WCYA 3ALPA 2PKDA 4N0RA 2YMXH 2BVQB 4XHQA 5SV4A 3WHXA 3RTQC 3RWJA 3O6LL 3CDGB 4RZCB 3RDTC 5FUOL 3QIBB 4C58B 3QDGD 4PYHA 2AJSH 3FO0H 1MUJA 4WW2B 4OD3H 1YPZA 2PR4L 3P4OA 4M03A 3VE0B 2DKMA 1ACZA 5I8OL 2OS7A 6CGTA 1WIOA 5T3XD 5K9OA 3DXAA 3CDYA 2LQRA 2P49B 2XY1A 4XBEL 2HG5A 3JWNC 4PY8I 1F42A 3IRPX 3RVTD 2NX5A 4R3SA 1UWEH 1PX3A 4IDLA 3AS1A 2Y36L 3UJJH 32C2A 3V79C 2DIJA 3C6LD 1EAPA 3VDBA 3ARBC 4M6AA 4ZTPL 3GJFA 4JFDB 2ZPKL 2DQGH 3MNZA 4HJGA 2Y5TA 4JFQB 4QHMA 3TBYB 2AV7A 1CDYA 2BZDA 3C08L 2GT9A 3O3DB 1VACB 2DMCA 3EYQC 2XWTA 3LRSB 1C5CL 1FO0H 2BOBA 2G60H 5DHYA 5IEHB 4KUZH 3KPRA 4JPIB 4LVNC 4N90D 5IUSA 1DQJA 4PJ7F 4LLWA 1CLYH 1C1EH 1OAZH 3DSNA 4OLVH 4FXGB 3DURB 4Y8AA 5CJBA 5A43C 4NP4H 3VJ6A 4F58H 5ESVB 5HPMB 2NY5L 2DTMH 1YY9D 4Z7UA 5FO7A 5E8EB 3RI5K 1UCBH 4GKNB 4OZHE 3RWFA 4D0BB 2ARJA 3WXWL 3FCTA 1LK3H 4YEFA 3RWGB 1UB5B 4RNRA 5E8OA 1L6XA 4YNYA 3JWDL 4HZLA 5AAMA 1JFQL 1F90H 4NBZB 4Z0BL 3GI9L 2A6DA 4EN3C 1FNGB 2PW1A 4KK9D 4S1QH 4ORGB 4OGYL 5AZ2H 2BMKA 4XVSL 5E08L 2VXQH 1KENL 1FYTE 4P4KA 3QXDA 1SJEB 2MCPH 5C0AB 2GEEA 4G6ML 3IFLL 5EPMB 3MO1A 3DBXA 3W9DB 1BEYL 3BN3B 2J5LB 4DN4L 3MYZA 5I71B 4I2XB 2EEBA 5KVDL 4CUCA 4PRHE 3OAUH 3D85B 4IRJD 2MCG1 5BZDB 3MTRA 4ODSL 4OGZA 2X4PA 1TITA 1BFSA 3T4YB 2WQRA 2EYSA 2I5YL 2ITDA 3QIUC 5GZOC 3DI3B 2QADC 1ZAGA 2ATKA 3QDJB 3PV7A 5EOQL 4M7LL 5KSAA 3B6SA 1RMFH 2IPTL 5CZVH 1HI6B 4QRRD 1F6FB 4ZFOA 4JCLA 4XH2B 4HWBL 1JZ6A 3T3MF 5DFVC 3PABB 5GGSA 3UMTA 5JQ6L 1W72A 1VKXA 1UYWL 3TPKA 4LCIL 3FFDB 3SBWA 1NUGA 4M1GH 4ZFZB 1TQBC 1RUQH 2BSRB 4X7DC 2F8VA 2OP4L 2XZCH 1NCUA 1NGPL 2PW2A 4CDGC 1PQZA 3KYKL 3OXRA 2HLFD 1BREA 4UQ2A 5F6HJ 1SJVA 25C8L 2XZQL 3BZEA 5CILH 4CMMB 2FZ3B 5IVOA 1T80A 1YEHL 3KWWB 2H32H 2WIIB 2H41A 5I1HH 3GSQB 4WJ5A 1RSFA 2PTVA 3G9AB 4M5ZH 5FYLH 5TQ0L 4GW4B 1KFAL 4WU7B 2VLJD 3HHRB 2IALB 1EAJA 1BGXH 3NACH 3UO1L 1BZ9A 4MAYB 3BAEH 1KN4H 4JHZA 1B6DA 5HDLA 2LTQC 3F7RA 3P0VL 5D8JL 1TFHA 4R7DA 5SWSA 1U93A 1OF2B 3QG6B 5HI5D 2WV3A 3QR2A 2EEAA 3SDYH 1F6AA 3DX6A 4OBSA 2J7LA 1LGVA 2A6IB 2BC4B 4JQVA 3BGAA 4YO0A 2LAGB 3UJIL 2DKUA 2CIKB 2FEEL 4JY4B 2CDFB 3LS4H 5J13B 5J1TC 2XN9D 1G6RL 3MMEB 4YIQA 4JFFD 2BXZA 4UIKH 5FYKH 5DZNA 1H3GA 3C8DA 5A1AA 2DLHA 4OFKA 1XCTB 3DROA 1CXLA 4MA1C 5DLML 1UEMA 5GGTA 2W65A 3RWHA 4R4FL 3FRUB 4MXVF 5DJ0A 1KJMB 3HE6C 4M61B 2AK4A 4J6RH 1RULL 4NNPL 1DBKL 1XGRB 1LP9F 4FQPA 4XNQA 4FZ8L 1QFUL 4PJ7E 5GGUB 1MI5A 4KPHL 4QHUB 2V6HA 3EGSB 1MLCA 4CNIB 4K9EC 4DZ8B 3H8NA 5IEKA 5B39B 3DUUA 5D1QA 4GRWF 4XCFH 4R96B 4OGAD 1EO8H 2J8OA 1WBXA 5HYSA 3IXAA 5HHPA 4DJMA 4RMTA 4ZXBA 1QFWM 4TYUA 4C83A 5CJOL 1N4XL 3QQ9C 2YOCA 2D0GA 2YWYA 3NCBB 4UDTA 5I73B 5H35B 1NAMA 2D7OA 4AL8H 1TJGH 4RFOH 4W6XB 2G5BB 4XCEB 4E41E 4FQ2L 3VFGH 5DVMA 3SJVE 3MGOB 1ZT1B 3MLZL 4PRHD 2JJWA 5C08A 1R5IA 4FFVD 4XBPA 4TVPL 3W2DL 1M7DA 1QSFE 4P2OA 2H1PH 1OP3K 4I4WB 3NZHH 4JN2B 4U6VH 4NUJA 2YK1L 3H6JA 1QSEA 1JYWA 4OI9A 4ZPTA 3WLBA 5DQ9A 1PX4A 3MV9B 1RK0B 2XPGA 5GPRA 2CO6B 1HXYB 1NEZB 2Z4QA 1WK0A 4YXKH 3GSOB 1J5OL 4XWGL 2DDQL 1JHLL 4LCCB 2XRAH 4TTGA 1XIWC 1YYLH 3RRQA 3BDXA 1FRGL 5GIRA 3SPVA 4CW1B 3UTPE 3G5ZB 3ULUL 1AC0A 4EUPA 3IJHA 5GHWL 2DRUA 2FCBA 4QXWA 5GRYA 1P84J 4QRPD 5F7LB 2JJSC 1RZJL 5E8NA 4P99A 2PN5A 2DIBA 3RKDD 3T3ME 5IFAH 2FBJH 2C5DC 3CU1A 1B4JL 4X6CB 4DVRH 2R1YA 3PWJA 4HBQA 2DQEL 3OR7A 2Q6WB 2VC2L 2JCCE 3L7EA 4L8DA 4IMKC 1P7QB 4QGTA 1AGBA 4LARH 3CVHL 4BFBD 3HPJA 4I3RL 5EULV 4JE4B 3N1FC 5C7XL 4Q97A 4LLAA 5IOPA 1Q0YL 5EU3A 4QHKI 5KW9L 3KYOA 3ARZA 5F7MC 4YR6A 3BD4A 3KDMB 5K9KB 2NY0C 4WW2C 4PJ5B 2X42A 3HMXH 4KTEL 4MHHI 1T83C 1QLFA 3QCVL 4O58H 5IBUG 4YUEL 4MDIB 3BWUC 2IH3A 3O8XA 3RBSA 3RJQB 4XB8A 1JGDA 5BOZG 5C8JA 2CH8A 4PLJC 1Q9LA 3N1GC 3ZL4H 2HFEA 2KBGA 5IWLA 4OCYH 2WBJD 4BUGA 4Z76B 3IFNL 1CCZA 3NBNA 3RY4A 3BHBB 2FJFA 3HNTL 4PRPD 1EFXA 1RZKC 1UM4L 1NGZA 4GG8A 5BV7H 3RP1A 1NMCB 4NQVB 4O9HH 3U1SL 1JV5B 2QSQA 3U0TB 1EO5A 4C56E 3RIAK 4B50A 5BCAA 1T2JA 4J3WA 1PEZA 3WKML 3BE1H 4J3XA 3BKJL 5EU5A 5TDPB 3ARTA 3CSBA 2FB4L 1Q9KB 3OB0K 4R4BA 4AT6B 4O02L 4HF5H 4ZQKA 5J0BA 3D9AL 1P4IH 4KJWC 1MCHA 2WLYA 1A7PL 4G6KH 2GYSA 3CZFA 4MXVE 1P4BH 4Y19B 1DE4B 4LEXL 1OTSC 3M8OL 1LP9E 5KSUB 2FLRT 3MLVL 5GSVA 1DN0B 4NRYA 1NAKH 4P4RA 3EYOB 5FUZL 5E9DB 3G6DH 4GW1B 4PJGB 4U1KA 5K59F 1PG7H 4HH8A 4JO1L 1KPRA 5E1AB 4NZUH 1MRDL 1BFVH 3BPOB 3TO4B 2BHYA 4GRMA 5T1KA 4GRWE 3HE7D 3MRFB 2D7TH 4LAQL 4LCUA 1M6OB 1S5IL 4JQXA 3U4BL 2VDRH 4KJYB 4NO5A 3SJVD 1U8OA 3STZA 1FZJB 1UENA 1BJ1J 4QKXB 4XAKD 4JG1L 1JZ2A 5AD0B 4YC2B 5GJTL 1UVQB 4OIAA 5CKGA 3SY0B 3VXUB 4ZOCA 3S96A 4HUMB 1H8OA 5IMMB 2FEDD 1D6EA 1GH7A 2H8PB 1T5XB 3D39B 1RZFL 4I5BB 4DGVL 1A9BA 1ZLWH 1JGLL 4Y16A 3HNSL 1MF2H 4JHAL 4K8RC 1FZMA 3VWJA 1CR9L 3RVUC 4Y1AE 2R9HC 3PV6A 4X5WB 3VRJA 1S7VA 3BJLA 5HYJD 1NMAL 1BZ7B 2BFVL 5I1CH 4LSRL 4XNXL 3IAPA 2FL5A 4XCCL 4APQC 1FZKA 1QKZH 1RFDL 4YQXH 4Y4HB 3BI9X 3O9WD 3C9NA 3MRRA 1AI1L 4KDTC 1GGBH 3BZ4B 1CT8B 2KQNA 4OGXH 2ADFH 3UYOD 4WNQB 5GS1A 2MQ3A 4L4VA 2APXA 1EJ6A 4MJ4A 2DKSA 1DFBH 1SBBA 4HK0A 3ZKXC 4YPGA 1J1OL 2BHUA 3DLQR 3P77A 4DGYL 1I3GH 3VGHA 1FL3B 1IGJB 4GUPB 1KB9K 5MHSD 3WDJA 3MV8B 5FF6A 1OSPL 5FK9B 1BFOB 3QUXD 4LSQH 3B9KB 4JN1L 2QLVB 5ID0B 7FABH 2AK1L 3ABZA 3TH3T 5E2UH 1INQB 1N2RA 1H3VA 3D3VA 1HHKA 1YEIH 3CFJB 4HW6A 1OM3H 5I19L 15C8L 3PG2A 5DVKA 3DV6B 1XCQA 2O5ZH 4DZBB 3DTXB 1W8OA 4OCWL 1CIDA 4LFHG 4JY6B 2DQDL 2P24A 3QUMH 5GS0D 3OKKB 4POUB 1PZ5A 4FQCL 3PQYA 2NW3A 3VFWA 1CF8L 1J0JA 4Q58C 5J13C 1OAKH 4PJ8A 2R2HA 5JIPA 2AABH 1S7UB 4L1DA 1AXTL 3OV6A 4V1DB 5IFHL 1C8PA 1KULA 1I9IH 1LK2B 3P4MA 5EG6C 1WC7B 2RCSH 4WFHD 3LKSA 3H9ZA 2FJHA 5DJ6A 1EPFA 4R4NC 1EBPA 5FO9A 3W39B 1G7PB 4LCWE 1OAUH 3DYMA 1F02I 4QHNB 5F9JB 1WBYB 5IW1A 5DRNB 4NN5B 3TIDA 1P5VA 1GRWA 5EBLA 3QWQB 3REVA 2HMIC 1IAIH 1BD2B 5B38A 2VLMD 3OJ2C 1V7MH 2QEJA 1FVCB 4H1LA 1QBLL 3QDMA 1KCUL 5TF1H 4I3GA 3U46B 1OGAB 4Y2DA 4OCSL 3I2CL 4LSPL 4ALAL 1AGFA 1X5XA 1NCNA 4TSBH 5JPMA 5K59E 5T3XL 2A73B 4NRXA 3MV7D 3P9MB 4PRIA 5L2KA 1KG0A 3CPLB 2HLAA 5FOBA 1PYWB 2XOTA 1NC2D 2R0LL 3FL7A 5D7IB 1LD9A 5F7WC 3GIVA 4JGUA 2B4CH 3LN4A 3P2TA 1QFHA 4FQIL 5CMAB 2UWEB 4FTVA 4JDTH 5C0CB 2GI7A 2VN7A 2OZ4H 1N0XH 5L9DL 5TE7H 1G9MC 4AH2B 2B2XL 1RPQA 1H3XA 3VU2A 3TGXA 4Z7NF 3VXSE 1FORL 2R29L 4OLZH 3DJ9A 5F71A 4KKCC 4C57C 4YK4C 3MGAA 4F57H 5DJXA 3GJFH 4L4TA 5GGQH 2AW2A 4P2QE 3VGGA 1IAIM 1TZHB 3KLHC 5IESL 1S3KL 3DSFL 4KI5F 4FFWD 4H88H 2A9NH 4NO3B 5H94B 1IGMH 4LRNH 3MCLH 5TE6H 5D2LF 3UP1A 5I15H 3HZVA 3DUSB 3O2DL 1I7RB 5I1KH 2A6KA 1HILA 1JWUB 4NKIH 1HK6A 4JKPL 4U1HB 4JFQA 3TBYA 5IHUH 1ZHNA 2APWA 2R8SL 3SDCB 3F6IA 5MENB 4OCXH 3O3DA 2FO4B 4KMQA 2V2XB 2PXYD 3SE9H 4QY8B 3LRSA 1IAKB 4JPIA 4BSWA 5GRUH 3HUJB 2ZNWA 5L2JA 12E8L 1QQDB 3JZ7A 2C3GA 5B3NA 4FXGA 3DURA 5ECJE 1R24B 3NFNB 2P47B 1AQDB 1P53A 3KS0H 3WN5B 3KLDA 3WD5H 5GZND 5ESVA 5HPMA 5T5FH 1CS6A 5IHZB 3WFBH 2CSPA 4NSKA 1YZZA 5E8EA 4GKNA 4D0BA 2VLKB 5CEXB 1KTRL 1KUMA 2HFTA 3TBSB 3VXNB 2JB6B 3H9HB 2VWEE 3VW3L 2VL5A 2DQTL 3BW9B 1FNGA 3ARDB 1IM9B 1NMCC 4ORGA 4PD4J 1ZANL 2ZCKH 2XTLA 5ANMB 3PGDA 1BF2A 2R4SH 3VH8B 3T0EC 5FGCE 3PUCA 1SJEA 5TH2B 1PKOA 2NY3B 5C0AA 2O5YL 4HS8H 4KVCH 4JFPA 5EPMA 3FT4A 3V6ZB 2IQAB 3H3PL 2EXWD 1QFWI 5TPWL 4KRNA 1FFOB 4NNXB 3T04D 3D85A 5BZDA 2QQNL 4QT5B 1MCBA 4KQ3H 4JPKH 4Y4KA 5E6IB 4J1UB 2WWMD 3T4YA 2EDOA 4MVBC 2R0ZL 3QDJA 2GUOB 3TN0D 3CFBB 3WSQL 2AAVA 1WFOA 5JUEH 1HI6A 1LO4H 4XH2A 3KYNB 3PABA 4KK6D 5C09D 1ZHLA 3KYMA 3H7LA 2KQMA 1JRHH 4LK4A 4GS7B 4HS6A 4N8CH 5J57B 4M6ML 4L8SB 1FPTH 4JLRB 3V7AE 3R06B 2BSRA 3B5HA 5BS0E 2AXHA 4IOIB 2CIIB 3SDXA 2Y6SD 3K4ZA 4W68A 3B5TA 1U3HD 1QUNA 3T0AA 3G6AB 2X1OA 4Q0XL 2DBLL 1FP5A 3RWCB 2FWOB 4CMMA 2FZ3A 3KWWA 3VI3F 2WIIA 3FN0H 5C0BE 3GSQA 4YXHL 3OR6A 5FYLD 2EE6A 1T04B 5CGYD 4XXDB 2FIRT 4NUGL 1EJOH 4WU7A 1HHGB 5DVLA 4B7IA 3PGFH 5HGBB 3MFFB 3QDGB 5ALCL 2A0LC 5D7JD 4Z7NE 3ARFD 4WI6A 1MHCB 3CSGA 1Q72H 4TQEL 2DF3A 3D69B 1AO7D 1OF2A 4UV7H 4NRZB 5JXEA 5LGJB 1L7IH 4M9OA 3L3DB 2F19L 1N64H 4JJHA 4KQ4H 2A6IA 1F3DH 2BC4A 2ICWI 5LWYL 4YZFF 2YSSB 3MBEC 2CIKA 4LU5H 2HKHH 3DX8B 4JY4A 4KI5E 1B2WL 4CVZB 2CDFA 3PE9A 4MJ5B 4YBLC 3MJ7B 2Z8SA 1ES0B 3MMEA 4LDOB 5FYKD 5D7SL 1SYSA 5EOCL 4HG4K 1I1AC 3HMWL 5D2LE 3C6LB 1N6QH 1KJ2L 1PSKH 1NCWL 2EIEA 1Y0LB 1A7QL 5D70L 1N26A 5FGRA 3FRUA 4OT1H 4M61A 1BBDL 1TPXB 1YEJL 4HUXB 4W70A 2R2EA 3EOAB 1XGRA 5A40E 4ONGH 5DEFB 3MOAH 3GI8L 2JB5L 5GGUA 5L8LB 4J3OC 2XYCA 4S1SL 1R5VB 1FFRA 1RIHL 4QHUA 5IT2H 4G8EB 2EYTB 1CXFA 1D5BB 4DZ8A 1MJUH 3QEGH 4Z7OF 4EVNB 5B39A 1CU4L 4R96A 1K85A 3ARRA 3ZT7A 1NCCL 4OCNC 2GJ6A 4G9FE 1PAMA 3IETA 3DX7B 4B5EA 4JKMA 5H35A 2NY6C 2WBKA 4NO2B 1YPZF 5E70A 4ZAKD 3VGEA 3RVVC 3MA9H 4XCEA 1OCWL 2G5BA 2PYEE 4D94A 2X1WL 5HYQA 3DETD 3X11B 3EZ8A 1BWWA 3CVIL 1ZT1A 3JV6B 2PYFB 1CICC 2IBGA 3OF6A 1FCGA 1V7NH 1JWSB 4HDIA 1A6VL 4O5LH 4I4WA 4JN2A 4HEPG 4M3JA 4YHOL 3TESA 3C2AH 2J6EH 1VFMA 3DRQB 1Z3GH 5FV1L 1PLGH 4WI8A 4NN5C 4TUOA 5GRXG 3MV9A 1RK0A 2AQ2A 3OKYA 4IRZH 3UBXG 4N0YL 3BH9A 4TTDD 3GM0A 3GSOA 3KPTA 4KFZC 4JM2D 1GZQB 3QFJE 4LCCA 4X5XB 2NY1C 3EJYC 4MNGB 1IM3B 3X3GH 4Z8FH 3HI6H 2H26B 4ZS7H 3QJHB 5ACZB 1FVEB 2YPKB 3BSZL 4CW1A 3CJJA 4MXQC 3HLAB 4LGPB 4NQED 1G0XA 5DMIL 1FIGH 4QRRB 4I0PC 3WDHA 1I1YA 1UKQA 1TXKA 3LN5A 5HHVH 2EKSB 1MCRA 4ZG1A 3RA7H 4XRCB 5T5NG 1IAOB 4LVHB 4X6CA 5JXAH 3RVWD 1A6TB 3RWIB 1N8ZA 2B1AL 3I9GL 1O5DT 2NY4D 3V6OE 4MSWA 5KVFL 4Z7UF 1P7QA 3G5XB 1ROWA 5H37H 3KPPB 4U6YB 4U4BA 2CK0H 5ETUB 3V5DB 1XT5A 3WIFB 1F2QA 1OP5H 4UTAH 5AZEH 1MFBL 2AJXH 2DQUH 2OTWB 5HHOB 3I02B 4G6AC 1NJ9A 3GDBA 2WM0A 5K9KA 3BIKA 4PJ5A 1VFOA 4EQ3A 3VI3E 4E5XA 2NPLX 2W91A 4FRWA 2QKIB 2FX9H 4MDIA 4AEIH 2X4RB 3KJ4B 4HWBA 3GSXB 4X99B 1IKNA 1T0MA 2VLJB 2DQJH 2NLJB 3B2VH 1H3WM 2WP3O 4Z76A 3MCG1 4YHMH 4NCC2 5HTSA 3EFFA 3BHBA 3HAEG 2APTA 2F53D 4P46C 1F58L 4F7EB 3MJ9L 4Y0GA 3FFCA 3MNWB 1VPOL 1U42A 1YEEH 3EYSL 1GIGH 3L5HA 1SVCP 1JV5A 3W0WE 4TNVF 3U0TA 2I07A 1R3KB 4YZFE 4UT9H 4BFGA 3RWEA 5ADOL 3OPZL 3T8XA 4PGBA 3G08B 1DEDA 2DOCA 1NBYA 3P9WB 3ROLA 1OTTD 4LHUD 1IL1A 2XN9B 4JFFB 5LGHL 1Q9KA 3BZDA 4AT6A 2DQCL 3D5OF 3IS0X 2CD0A 1FDLH 4U1SB 2UZIH 4ODBD 5C0RL 3O6KL 3PDGA 3WN5C 2O93L 3SKNB 2GFBB 4EDWL 4Y19A 4HFUL 4KMLB 1IT9H 1FGVL 1DE4A 5D7KE 4RX4D 3GGWB 1JZ3A 3OKEB 2FJGA 5KSUA 3O0RL 1HKLH 3O3EA 3RVXC 2P7TB 1FL6B 1X7QA 3SE4A 4I77L 4LHJB 5DK0B 3RL1B 3EYOA 1E28B 3TT1L 2XT1B 4GW1A 4PJGA 4Y4FA 4P57A 3V5KB 4G8FB 2AQ3A 2EXYD 5A3ID 1F8TL 3TO4A 3BKYL 4JFED 2JJTA 3MRFA 2XXMB 4YBQD 1M6OA 3EFDL 1G6RA 5DF0A 5DGRA 1IC5L 4KJYA 4U49A 1A8JH 1YMHB 1FZJA 2EC9T 4KMTH 5D2NA 1XR9B 5DUMH 5AD0A 4X7CC 5B8CB 1QSVA 2HWZL 1UVQA 4C55A 1YPZE 3VXUA 3RGVD 5IMMA 4URTB 3V8OA 2I9LB 4Z7VA 1BVKB 2H8PA 1T5XA 3WKNA 3D39A 3DRTB 4I5BA 5C0GB 5KZCD 2EH8L 3QXAB 4F7MA 4O4YH 2GCYB 3NPZB 5DK2B 1HOCB 1TCMA 5KBNC 1LEKB 3NA9L 1QLEL 3MUY1 4FQXB 2NX5E 3E6HB 4LLYB 4XP4H 3BRFA 4X5WA 5MP6H 4ZUVB 2YPLD 5KVGH 1HXMB 1WEJH 4JFYB 5AEAA 1BZ7A 3GSVB 3ZYOA 1JNLH 3ARVA 3EOTH 4BH8B 4FQJH 4EQ2A 1LE5A 3SCMC 4QF1B 4PJEA 7CGTA 3MV11 4FZEL 1YYMH 3BZ4A 2XKSA 1CT8A 2J4WH 3VG9B 1QEWB 1TCRB 4PV8B 4WNQA 4QRPB 4BKLB 2R0KL 4OUUB 4NPYA 4D9LL 1MCEA 5I2IB 3TBWB 5FAAA 5L8JB 4LASH 2YA2A 1S9WB 1MJ8L 1MFAL 2R0WL 5GS0L 5ERWA 1FL3A 1IGJA 4GUPA 4K23L 3VXPA 3S35L 1T7VA 2GK0B 1LDPL 5DD3H 1KCRH 5MEQB 3A6BL 3L3OB 4LQ1A 5FK9A 4OZFG 1BFOA 4Z7UE 1X44A 3BRGC 4LCYB 3B9KA 1FVDB 3O3AB 1IKFH 1FE8L 3TYFB 5SX5H 5ADPH 4OIIH 1Z5LB 2FATL 2IGFH 5IMOB 1INQA 3PGCB 3BISA 2W9EH 2XWJB 4RAUA 4U1GC 2EYRB 5FHBH 2D0FA 4G8IB 1BJ1H 3GMLA 3CFJA 5HHXL 1HHHB 1IGIL 5DD6B 3SHSA 1I8MB 1BQHG 3QXTA 1WWCA 1VGEL 1AR1C 2AEQH 3VDCA 4R26H 3RUGA 4OD1H 2VZTA 5E4EB 3DTXA 4JY6A 3OKKA 4L29B 4H8WH 2ADGB 3GKWL 3RVTC 3HG1E 4D9RE 3MRQB 4PRPB 4UT7H 3CVHA 1GAFH 3HC4L 4BFIB 3F7YA 1FNEA 1J1PL 2E27H 3C6LC 3DVNB 3GRWH 1LK2A 4G8GD 5T1MB 1INDH 4NWTL 1WSST 3UC0L 4ONOA 1EGJH 3GMNA 4YXLH 1U8LA 1A7BA 4PG9A 5LXGL 3EDDA 5B21A 1JI1A 5BMFL 1MQKH 5IJVB 1TPXC 3WFCH 1IFHL 1G7PA 3MRLA 3AU1A 4PV9A 2ITCB 2OI9B 4FA8A 4QHNA 5F9JA 2YMXL 1WBYA 5DRNA 3ZDZF 1BJMA 3MZGB 3JXAA 4IHOB 1AH1A 5FA3A 1I7UB 3FO0L 4U7KA 3I84A 4OD3L 1FVCA 4OFYA 1AQKL 1JNNH 1WTGT 3U46A 4NM4H 4PYGA 4ZO8A 4KAQH 5IB3B 4UAOB 4E0RA 5C0EA 3I3EA 2A73A 3KPMB 2H9GB 5L0QC 5JZ7D 4OBRA 5DMKB 1PYWA 1G0YR 1GC1H 3K1KC 3HE7B 5D7IA 3K2UH 5IKCA 3CMOH 4KV5F 1EXUB 1UWEL 2ENSA 4L8CB 4PJ9D 2I27N 4W4OC 4PJIF 5CMAA 1D9KC 2UWEA 3DXAD 5C86A 4OZIB 5DJ8A 1DQMH 1P5UA 4XP5L 3QNZB 3JWOH 4CBPA 2MPAL 2DQGL 4AH2A 2K7PA 5DHVB 1CE6B 1WWAX 1Z9MA 2YEZB 1NCTA 4IRJC 4RRPA 1YEFH 5EBWB 2G60L 4HV8B 1FGNH 3QO0B 4KUZL 1MOEA 1CLYL 1C1EL 1OAZL 4QXUH 1NDGA 2FD6L 1MFDH 4OLVL 5F70A 1MRFH 5HYJB 1TZHA 1A7OH 2X4QB 3O11B 1QHPA 5JHLH 3K3QA 2DTML 4KKLD 4GAYB 3KPRD 5HDBF 1I9JH 4UMGA 1UCBL 4NO3A 3O9WB 4P5TC 4ZTOL 1ZLVK 3DUSA 1JTOA 3NCMA 3PDOB 1LK3L 2K1MA 4UTBH 3K46A 1K2DB 4O2EB 4PR5B 1UQSB 1I7RA 3LRHA 2AK4E 1JWUA 1F90L 4U1HA 4BA8A 2NR6C 1KF9B 5DO2D 3FN3A 3K8LA 3MFGB 3OX8B 3SDCA 3V4UL 5MENA 3F12B 4N0UB 4WV1B 2HLFC 1MI5E 4Z7WB 2HA1A 3IF1B 4QY8A 5JOPE 1IAKA 4HSQA 2D7NA 1FC2D 3C2SA 3NA4A 2VXQL 5DJAB 3I6KB 3HUJA 1JRHI 2MCPL 4ONHB 4F33B 1QQDA 3QHZL 3QUXB 5D96B 1R24A 4F3FA 4R0LC 4Z0XA 4FS0A 5DZOA 3OAUL 2B0SH 5IHZA 3MRGB 4M8QB 5BQ7B 4LSDA 4N0FB 2VLRA 5E8DH 4P4KD 5DA4A 2JF1A 1HDMB 4FMKA 3RTQA 3TBSA 3VXNA 1NUFA 4CU8A 4FQHB 2X9XA 1CD0A 2JB6A 3H9HA 3K7UA 4JVWA 4PUBH 3RDTA 1RVFH 2Z8VC 1V3KA 4D9RD 1XF4A 5CZVL 4ODTL 3BW9A 4NDMB 2X1QA 3CX5J 1YMMD 3ARDA 1CK0H 4UUJB 5C08E 1IGYB 1IM9A 5GRVL 2EZ0D 1H15B 4JR9H 3AB0B 5ANMA 4KUCD 4JRWA 2ZOLB 3MRBB 2EDYA 3FB7B 3VH8A 4M1GL 1JZ5A 3DMMB 1MH5B 4EBQH 4JGJA 4Q9BA 3LD8C 4POZC 5TH2A 1RUQL 4UT6L 3L7FB 5H2BB 4GAGL 2IAMD 1QACA 4NQDA 3V6ZA 4OM1H 2NY2D 2IQAA 3IGAB 4NNXA 5IMLB 1UEYA 5E6IA 4J1UA 3DI2B 4GG6B 4OAWB 4FNLL 3UAJC 4ZFGL 1YC7A 2AJZB 5FDWB 2GUOA 3CFBA 5DWUH 4M5ZL 4XVJH 1DUZB 4PTUB 3WE6B 1ONQB 5ITFB 3BIBX 1QBBA 3ZDZE 2DM7A 3IDYC 1BGXL 1A6WH 3A67H 3NACL 3PWNB 4PTTA 2IWGA 2Z93B 2NZ9D 3H42H 4JPWL 4X8JB 4OGAC 3BAEL 5E94B 3RPIB 1KN4L 4TPRH 5F96L 1QZ1A 1T4KB 4L8SA 4JLRA 5BJTB 2BDNL 1FLRH 1U8NB 4IOIA 2BNRE 5C07A 2FR4A 4ZOAA 1QFWL 2CIIA 4MXWH 3SGDI 3SDYL 2E6PA 4GQPH 4Q9RL 3KPLB 2QQQA 3MV7B 3G6AA 4Z78B 4M3KB 4LL9A 3D1MC 1EMTH 1NC2B 2OR9H 4ISVB 3RWCA 2FWOA 1T7YA 2YBRA 4KV5E 5SWSD 3LS4L 2YZ8A 4S11A 4G7YH 4PJIE 4YDLC 2ILLA 1KLUA 4UIKL 1T04A 5FYKL 4PY8J 1NGQL 4XXDA 4TOYH 4I18A 1HHGA 5HY9B 1Y6MR 4WHYG 4G6FD 3MFFA 5KVMC 3ME0A 3SKJH 3TZVA 4QEGA 4RGND 5FGBA 1S9XB 3MJ8B 1KGCE 5LGKA 5I1DA 1T89C 1G9NC 1MHCA 1RUKL 2ZUTA 3MQIA 4BQCA 5CD3B 3D69A 3PNWB 2CQVA 1CQKA 5FUOH 4ZOBA 2Z35A 4JRXA 3L3DA 2DS4A 2BX5A 2X9WA 4LDLB 3ULVF 2AK4D 2VAJA 2YSSA 2M1KA 4FQLH 4HBCH 4XCFL 1EO8L 3DX8A 3N50A 2HTLC 4P9HC 5IMKB 4MJ5A 4GRLB 5HDBE 3GB7B 3MJ7A 1ES0A 1JNJA 1MI5D 2NTFA 2Z92B 4OF0A 4R7NB 1ZLUK 4XPTH 2X1XR 3FRPG 1HNFA 1PBYA 2GTZA 1Y0LA 3D0VB 3ZE0F 3KPOB 1J9CT 4AL8L 1TJGL 4P5MB 4RFOL 4ZXBD 4P3DB 4HUXA 3RY5A 3T0BA 1AKJD 2PXYB 1HHJB 3VFVB 3BPCB 3EOAA 3OWEA 4ZTPH 5DEFA 3WJLA 2J88H 4LOUD 2H1PL 3MGTB 4Q9QL 3NZHL 4G8EA 4U6VL 2EYTA 1D5BA 5GQBA 4EIZC 5E4EC 4EVNA 4YXKL 1CGVA 3BX7C 5C08D 1TENA 1CYGA 5DC0A 4CN1A 1ZHKB 2WBJC 2YA1A 4P2OD 5DFWH 4PJBB 3FAWA 3RZCB 3VFTA 3O2DA 2XRAL 1YYLL 4Z9KB 4WW2F 3DX7A 1QSED 1K4CA 2Y4SA 1DUYB 4NO2A 3T65B 4EI5D 4J23A 1HSAB 4LRIC 4XX1E 2N4IA 1PD6A 5IFAL 2FBJL 2LVCA 2R4RL 3EDJA 2DM3A 3X11A 5CEZH 5SWQA 2GQHA 4ZPVB 4MDJB 2W60B 3NPSB 3JBG7 4OSUH 1JFQH 4Z0BH 4QXTB 3PXJA 3T77B 4LARL 1WZLA 3MLTA 4ZUSA 4YAQB 2RR3A 4S1DD 4QOKE 2D3VA 1T0NB 4LSTL 2RAMA 3CMGA 2CKNA 1B0WA 4D8PB 2YRZA 3SKUD 3WJJC 4X5XA 2X4SB 3IFLH 4L4VE 4MNGA 1IM3A 1AXSB 3NCJL 2H26A 3S88H 3HMXL 1BEYH 1FVEA 3ZHKA 1BQSA 5GISH 3TN0B 1NGXB 4HPYH 4PG2C 3K4AA 3HLAA 4QRRA 5AUMB 4ODSH 2EKSA 1AR2A 1IVLA 4HUUA 4ODHH 3ZL4L 1U2HA 3UYRH 4OCYL 5C09B 3RJDA 2EDEA 3LKOB 4M93C 1RJCA 1A6TA 1P6AB 3NN8A 5TDNB 5IBLC 5EOCJ 3RGHA 3S9DB 3O8XD 1F4WH 3ARSA 1HIML 1X5AA 3KPPA 4U6YA 4FOMA 5ETUA 5BV7L 2Z9TA 3WIFA 5C92A 1UYWH 3S35X 4IS6B 5BVJB 1U3HB 4LCIH 1G7LA 4PPTA 5HHOA 3I02A 1J0HA 1OAYH 4L3EA 4X7EC 3CGTA 4XI5C 4LGRB 3BE1L 2H32B 3FQNA 4YGVB 2E7LC 1LWRA 3TLRA 1QLRB 4K3EL 1KGCD 1JN6B 1ZOXA 3KYKH 1YEGL 3PQYE 5FDYA 1X5LA 1K4DB 3GSXA 4X99A 3OTTA 2IFGA 1VHPA 4HF5L 1P4IL 25C8H 5DJDB 4DWHA 5I6XB 4QCIB 3GMRA 5CSZB 1P4BL 3LHPL 2GW5A 2DI9A 3ARFB 1QO3A 4JM4H 3VA2C 5DJ2B 5LBSH 3V8CA 1KFAH 1AO7B 3O9WC 4GXUM 4MD0B 2HFGH 3MNWA 3G6DL 3EJZD 1RI8A 5C3TA 2GIYA 3ULVE 1BFVL 5DYOA 1R3KA 5KN5B 1UA6H 4AK1A 2D7TL 5D8JH 4LBEA 4K3DL 3U0PB 4OLWH 1MRCH 2W9DL 4DUWA 5BVPL 1A14H 2VDRL 4LPWA 2G5RA 4JFFA 4RISH 1LDSA 1NMBH 1YNLL 2CRIA 1I8KB 3O4LB 2VR5A 4MA7H 3U7YL 3UJIH 5T1KD 5GGRA 4U1SA 5D96C 3ZE0E 3VFPB 3T0DA 3SKNA 2GFBA 1CG9A 3VD7A 1G6RH 4RGMB 5MI0B 3ZKSD 3SE3A 1XAUA 3OKEA 1MF2L 3IXTB 4PRIE 3U9UB 5L2KE 2P7TA 1FL6A 4DCQB 3WNKA 5DK0A 3RL1A 1E28A 3AREC 5CGTA 5SWZA 5I17A 1O0VA 4R4FH 3SOBH 4G8FA 3V5KA 4EZMA 2D03H 1RULH 2B1HH 1DBKH 4WEUD 2NNAB 1CVSC 2JKXA 4YQXL 3VWJD 4YHNA 4RAHA 1YMHA 2A6JB 4YLQT 3NABH 1KJ2A 5E00A 1XR9A 5FM8A 1GGBL 2F5BH 1YJDH 5B8CA 5TF0A 5ICZB 2ADFL 3L3HB 3JVGC 1JPGB 2I9LA 3V0WL 1BVKA 1DFBL 4RDQF 5JDJA 3FT2B 3V0VB 3QXAA 4RA3A 5SX4H 2GCYA 1I3VA 1I3GL 3ZTNL 1IGCH 2VUOA 5DK2A 3EYFA 1LEKA 1G7QB 4FQXA 4L4VD 4LLYA 4GSDL 2DWDB 1I1CA 4LSQL 3BQUC 1TZIB 4ZUVA 5C71A 4HIHB 1FHGA 3GZKA 4JFYA 3BOVA 4BH8A 2XZAL 4R2GC 4JFDE 1A22B 4JM2B 1BBJB 2R56L 3GSNA 1YEIL 3KHOA 2XTJD 1OM3L 1NEUA 4CU6A 1EERB 4U1MB 3S97C 2ZUSA 1GXEA 1TCRA 4PV8A 1ZHBB 3FHAA 4NQEB 4BKLA 2J1KA 4OUUA 3F8UB 2O5ZL 4LLDB 5I2IA 2G75B 3QUML 3TBWA 3L9RA 1SMAA 1MJ7H 1S9WA 3D3VD 1JHLH 4XXCA 5A2LH 3OXSA 1U58B 1FRGH 3GMOA 2GK0A 4M5YH 3U4AA 3ULUH 1JF6A 2NY4B 1NKRA 3L3OA 1PKQB 5EC1B 2DLFH 4LCYA 3DO3A 1I9IL 1FVDA 2C3VB 3O3AA 3PQYD 1NDMB 1Z5LA 1CDGA 3K80A 5IMOA 2QSVA 3PGCA 1BP3B 3G6JB 3ARXA 5IB2A 2XWJA 4PJ8D 4DUVA 4ZODA 3CVHH 1MAML 4K55A 4KH2A 4KKAD 5C7XH 4WDIB 1OAUL 3E8UH 1I8MA 3DGGB 1EZVY 2VLLB 5EZIL 4EDXA 1J12A 1FCCA 1B0GB 1Q94B 5D72H 1OARH 1Q0YH 1A3LL 4F7PB 5KW9H 1JBJA 1VFBB 3BP7B 5C0AE 4YPJA 1DBML 3Q1SH 3U9PL 2NCMA 4KTEH 4PJFB 2H2SD 1V7ML 4FFWC 4I2XE 3HR6A 2XQYK 4X6EB 4YUEH 2F53B 4PRPA 1A4KA 4LPXA 1IQDA 1RZGB 5BV7B 5HJ3A 1MAJA 3DVNA 1L0QA 5T1MA 4TSBL 5HD8D 4J8RA 3SKMA 4UQ3B 3QDJE 2R1WB 1AP2B 1D7FA 3QDMD 5IJVA 2E9WA 4FQQA 4Y2DD 2WIMA 2B4CL 4NBXB 5GS2D 1DCLA 1VSCA 2UVFA 4X6CF 3U1SH 2QSCH 2OZ4L 5L2KD 1I4FB 2C4FT 5EWIH 5TE7L 3O6MH 4OQ1A 4IHOA 5IJKC 2AXGB 4OLEA 1I7UA 4JGMA 4PRDB 5GZNC 5T1LA 3KPSB 4FTVD 3MJ9A 2FB4H 2E9JA 2V5YA 3OG6B 3LKNB 2VRAA 4DW2H 2E3VA 3KNBB 3D9AH 2H2PD 3C8KA 4F57L 4NWUH 4CN6A 2GSGB 3P0GB 1WISA 5GGQL 3I85A 2H3NA 3QI9D 2H9GA 2XA8L 3F7VB 4KZEH 2MKWA 1J8HA 3QRGH 4JFEB 3HE7A 4LEXH 1GHFH 1S7SB 4H88L 1EXUA 2XWBB 4L8CA 4QWWD 1MEXH 1IGML 4LRNL 3MCLL 3VD4A 2V2TB 4L4TD 5TE6L 4XWOD 3NPSC 4OZIA 3D18A 3QNZA 2Q7NA 2WZPD 4MB5A 4JRYD 5IHUL 3RGVB 2EXWC 4OCXL 3CSPA 2YEZA 1I9RH 2NXZB 4ZUUB 3U79A 5I1JH 5KZCB 3C5SA 3SE9L 4HUKB 4HV8A 5I75B 4JG1H 5E7FA 2P4AB 1GOHA 3ARYA 5GRUL 3VXMA 1XGTB 5HVHB 5L6YH 2YPLB 4NJAH 4OD2A 4CADA 3O11A 2COQA 1QR4A 3BPLC 3MZTA 4X9GA 3HNSH 4GAYA 2EKJA 4JHAH 3WFBL 4MQ7B 2WMPA 1FG9C 3WXVL 5EC2B 1DEEB 4MMXC 1GL4B 1SBSL 1U8HA 1K2DA 2VABB 4PR5A 1UQSA 2G9HB 2KKQA 3QBTB 1A1OB 3D6GA 4XNXH 4XCCH 3OX8A 3MR9B 5J11B 3ROOB 3F12A 5J4MA 4N0UA 4WV1A 2ZCKL 4FXLA 4HG4J 4PJGF 4Z7WA 3IF1A 2NTSP 5IR1B 1T1ZA 5C0IB 5DC4B 3I6KA 5DJAA 4WFGE 1NGYA 1RJZB 4OB5H 3P9LB 3DPBA 1DP0A 1FV1B 2UUDK 4HS8L 4KVCL 4F33A 3QUXA 4CVXB 2XQYG 5CGYC 3G5VB 1J1OH 3HZMA 1UM6H 1IC1A 1BM3H 4M8QA 5BQ7A 5HXMA 3MRPB 4J4PC 5D7JC 1UADC 2DQIH 1HDMA 5C0AD 2IEPA 4FQHA 5KG9B 1NBZB 5I8KH 2Q8BL 4N8VG 3RQ3A 3F7QA 4NDMA 2IBZX 1LO4L 4UUJA 3QUMB 4Y4KD 1IGYA 4XCYB 5E99H 5D1XB 1H15A 1ETZB 2ZOLA 1OL0A 3MRBA 1JRHL 3FB7A 3IU4L 1QRKA 3DMMA 1MH5A 5I19H 5JHDA 1T7ZA 4N8CL 5IW3A 1FPTL 3AVEA 3L7FA 5H2BA 3MV9E 4J3TA 4TUJB 5IVXA 3QZWG 3SGJC 1EH9A 2DQDH 3QYCA 5CP7B 4G8GB 4FQCH 3IGAA 3MRKA 1UJ3B 5IMLA 1CF8H 4GG6A 5KSVB 1MCDA 3OJMB 4RGMC 1HYSC 3BGFC 4DKEH 2GK2A 2AJZA 3FN0L 4XNYH 1C5DB 3TC9A 1I1RA 4L3AA 4IOFD 1MELA 4BQ8A 4Q6IB 5KS9B 3X17A 4X6CE 4P2CG 4UOW0 1DUZA 4PTUA 3WE6A 2ERJC 1ONQA 5ITFA 5FXCH 4WO4C 1H8SA 1X5IA 2DB8A 3PGFL 4OCRH 1F4XH 2VWEC 3PWNA 5C2UB 3BVNB 2Z93A 2VJXA 4X8JA 1U8MB 3RPIA 4M7JL 3WIIL 1T4KA 5BJTA 3N1PC 1U8NA 3F5WB 3WHXB 3O45A 4UV7L 5ITBH 1JPSH 3RWJB 2FIKA 1BIIA 2JJUA 1XGUA 1L7IL 4HGWA 5I9QB 1A6PA 3C60B 1AHWC 3KPLA 4PJ5E 1N64L 1MUJB 3MV7A 4KQ4L 4U6XB 1E4KC 4F15C 2ADJA 3IJSB 1DBAL 4ZAKC 5A2JH 4ISVA 2HKHL 3P4OB 3DETC 4LSPH 3VXQA 4PJ9B 3HAEA 3IDGB 3DXAB 1N6QL 1O7VA 5JIKA 2C1PA 5HY9A 5HHQB 3VFMB 1K3IA 5I1AB 3BDBA 4OT1L 3WO4B 1OW0C 1S9XA 4FQIH 4TTDC 3WLWD 2CKBL 5CD3A 4ONGL 4HMCA 5EN2B 3MOAL 3GJFB 4U0QB 4QHMB 5IT2L 2GT9B 4DAGH 2ZNXA 1MJUL 5EO1B 3QEGL 4FG6C 1FORH 1A0QH 4Q74A 1CGSL 5CJXC 1OP3H 3C5ZC 2BOBB 2EDJA 3RWDB 1CD8A 4GRLA 4LMQE 5F3BB 4MS8D 1MCWM 4LLWB 4UOJA 1G7JA 1HNGA 4GFTB 3D0LA 4PP1C 4IBLT 2Z92A 1H5BC 4R7NA 2CXGA 3ZSSA 4Y19E 3VJ6B 4IM8A 3D0VA 3JV4B 1MREH 3KPOA 3MA9L 3UTSD 4P5MA 2IMNA 2FECI 3QXUA 3RWFB 3S3SA 4H25A 5E9DE 2ARJB 2PETA 4PJGE 2PXYA 3L3IB 3VFVA 3BPCA 3FCTB 3E6FB 2FH8A 2GJ6D 4GH7B 1V7NL 4HZLB 5D7IF 4JKPH 3MGTA 4OFDA 2A6DB 4O5LL 1KJVB 5DK3A 3C2AL 2J6EL 2DD8L 3CFCH 4U1IB 1Z3GL 1V3JA 1PLGL 4YDVB 2UWEF 1MJJB 5F72S 1DVFC 1KEMH 3EYVB 4IRZL 3OF6D 4AY0A 1U95B 4RFEB 5DQDH 4PJBA 3RZCA 1JWMB 3VXUE 4CMHC 4MQXD 1JGEB 5ILTL 4Y5XA 1F4YH 3DBXB 4OLXH 3D39E 4KI5C 3KAAA 1JK8A 1DUYA 3T65A 4P2RA 4E9LA 1FIGL 1YMMB 3QA3B 3TJEH 4X4YB 2HTKD 4NM8L 2X4PB 2VDNH 3SGKC 5CEZD 5F9AC 3RA7L 1T66D 2EYSB 4MJID 4ZPVA 3ARWA 4MDJA 5EU7E 4I0KA 2ATKB 3NIFF 1W0WA 2W60A 5C70A 4XAWL 3VG0H 2DQTH 3ETBF 4QXTA 2IAMB 3T77A 4ZFOB 2B5IC 4L8BA 3V5HA 2CK0L 2NY2B 1KPUB 4PY7A 4Y5YB 5CCKH 4YAQA 4UTAL 2IF7A 2UVEA 4UIMB 4KGLA 5AZEL 4WY7H 4NQXB 1I1AA 2DQUL 4OF3A 4D8PA 2EDHA 4DKDC 1BQLL 1G84A 1LHZA 2X4NB 3TJHD 2X4SA 5CHNB 3BMVA 5IVZA 2PW2B 1AXSA 3UPCA 4DKAA 3TN0A 1NGXA 4DEPC 1PY4A 1BOGB 4OZFA 2E7CA 2EICA 4ZSOA 3IDMB 3OXRB 4TVPE 4X4XA 5AUMA 3ALXA 3A0OA 1UXSB 2DQJL 4LLVB 3B2VL 3HUJF 3MV8E 2P45B 1ED3A 5C09A 3OB0H 3QUZA 2P5EB 5TDNA 4YHML 2ZOKB 3ARGB 4PJXB 4WJ5B 2LAAA 3WUWG 3SDAD 1KC5H 5JW5A 5HI3C 4ONFH 1BQHA 1NQBA 1YEEL 4D9QE 3FMGL 1GIGL 2FHBA 2HT4D 4HFWB 4IIQB 1U3HA 5F8RC 2XFXB 3FAXA 1CDUA 1SEQH 4UT9L 2H32A 3D2UA 3P73B 4YGVA 1QLRA 3FFCD 1JN6A 3UTTD 2ICWJ 1A1NB 1CFQA 1FNHA 4Z6AT 1K4DA 2BY1A 4Q0XH 4JFXB 4YO0B 5DJDA 1CICA 4G6FB 2UZIL 1S78D 2VXUH 5TQ2H 3ULSB 3VD3A 1IBGH 4HH9B 2V5MA 5CSZA 35C8H 4V1DE 4RGNB 2IMMA 4GXUN 5I74B 4F7TB 3OMZA 4YXHH 1IT9L 3ARFA 3HCVB 4MJ6B 3ZT6A 4JG0H 2A83B 4YHKH 1AO7A 5SX4I 1QTYT 1HKLL 2CGRH 5E03A 3HNVL 3TH4T 5DJ0B 1B3JA 3V6OC 3EAKA 3NZ8A 4ODWB 2Y5EA 5FKAB 2DMBA 2VXVH 5KN5A 4I48B 4L9LB 3LDBB 3HTLX 3R8QA 3QDHA 5EA0H 1I3RB 1YY8B 2R2BB 3U0PA 5FUCE 4KJQC 4JKLA 2JIXB 3TF7C 4Y4FD 4F2MA 4XNZC 1BD2E 3K81A 4KMTL 1MLCB 1YECH 3O4LA 5IEKB 2OM5A 3TPUB 1OGAE 1B2WH 2Y07L 5HI4C 3M07A 5FYJU 4ZXBB 1K6QL 3OKOA 2O61B 5CJ5A 2CPCA 1WZ1L 5D7SH 4C83B 5EOCH 1AKJB 3BD5A 3HMWH 3L5XL 4O4YL 4AYFA 1KJ2H 2VB5A 4UDTB 3U9UA 5D7IE 2AVGA 3NCYS 3VXUD 2VE6B 3GIZH 4ORZC 5MP6L 4RWYH 3D39D 4UINH 1RQ5A 4JO3H 2MJWA 2UWEE 1Q9OB 2B20A 1RZKH 2N7AA 3LRGA 5C0CE 2DQFA 4KK8D 3EOTL 4XBPB 3GI8H 1KCLA 5F1NA 4CJ0A 1XMWA 2JB5H 2X44D 4P2OB 4S1SH 2A6JA 4P48A 4HKZA 4NUJB 2ZG2A 5CZKA 1UT9A 4F9PC 1QSEB 4NC0B 3MCKA 5LAXA 5ICZA 4ZPTB 1CU4H 3WLBB 4EI5B 5C0JA 4JO2H 1CXEA 1GSMA 3FT2A 1NCCH 4HUWB 5AYQA 3V0VA 4ZS6C 4PGEA 3GSNH 5GIRB 4D3CH 3NIFE 5F7NC 3SPVB 3TFKD 4UBDD 2OTPA 3OAYK 2YD5A 5DD3L 2Q1EA 2ICWA 3IJHB 5DURB 1KIPB 3B9AA 4MNQD 5E8NB 1OCWH 1TZIA 1G7IB 1MLBA 4WENB 1P7KB 4HIHA 3S37H 1BWMA 1T3FA 4XVTH 1UZ8B 2L0DA 4MQSB 3RBGA 2QHRL 4TVPD 1XF3A 3FTGA 3LY6A 1MIML 5F6IB 4JM2A 2W9EL 1BBJA 3V7AG 1C16B 5FHBL 4YE4L 1HINL 1AGBB 1P4LB 3BKMH 1RZ8A 5MENE 4N5ED 2NY7H 3HPJB 4JZJA 4YHPB 3MRDA 4U1MA 1ZMYA 4G42A 5DD0H 4ZNCD 1KYOJ 1ZHBA 4NQEA 2AEQL 3EOBA 4R26L 4K7FB 1CDBA 3WFDL 4LLDA 1LO2H 3O2WH 2BNQA 2VNCA 2EE2A 2G75A 3KYOB 5I16B 3HUJE 3BN9D 5LJYH 4H8WL 4HXAH 1T03H 1U92B 1H3PH 4MNHA 1U58A 2OMBA 3ULUD 4HCRH 3QO1B 4Y2OA 3LS5H 5E8PB 1PKQA 2QJDA 5EC1A 5DMIH 3O8XB 4UT7L 1GAFL 1JGDB 3MV01 3EW3B 1RHFA 2APFA 4IJ3C 1S7TA 3GRWL 3MRMB 2VLKE 2VDMH 1AXIB 2HFEB 2OSLA 2C3VA 2P8MB 4R8WL 1NDMA 1EGJL 4K8RH 4YXLL 5E2VL 3KGRA 2QQKH 3O3BB 5FB8A 1X5FA 3VGAB 4XTRD 1OD9A 4UILL 5DSCA 1MQKL 3IAQA 4XPAH 4M6NH 3WFCL 1NGZB 4GG8B 3ES6A 3UX9B 1ZA3B 2V7HB 3QWOB 3DGGA 5ANME 3GHBL 5CP3H 4LLMB 1Q94A 4HQQH 4F7PA 4OF8A 1BQUA 5IQ9B 1VFBA 4LLQA 1MHHB 5D71H 5F1KC 2A74B 2CK2A 3LZFH 4RMRA 4MMZC 4PJFA 1QRNB 5HYIA 1WFNA 1EUUA 2BCKB 4WTZA 5HGGS 3RAJH 4X6EA 2F74A 2F53A 2CJUL 4L1HA 1JNNL 4NM4L 2DWEA 2H45A 4YHYC 1IMHC 4KAQL 4KC3B 1CGXA 1RZGA 4ZQKB 2VXSH 1FC1A 1N7ML 1OLZA 2DL2A 2CRZA 4UQ3A 2C7UA 4NBYB 1L7TH 1R6VA 2VAAB 2R1WA 1AP2A 5DO2C 4KZDH 2R39A 3OHXA 1DANT 4OFYD 3K2UL 1D5MB 2HJKB 2O5XH 2BJML 5GSVB 1WLHA 3EYSH 4U1KB 4WFEE 4KKBC 1KPRB 5ID1A 1DQML 4NN6B 1GGCH 1UKSA 1I4FA 3JWOL 3QAZB 1NLDL 3ARUA 4RFNC 5ADOH 3MLXH 2AXGA 4YFDB 4PRDA 1F5WA 2CRYA 3KPSA 4R9HA 1YEFL 4RX4A 5CZXD 5LGHH 2MSPA 4LNVA 4P4KC 1KCKA 1U8KB 2XNAB 1P9MA 3HS0B 4M7LT 1UACH 5CUSH 3HI1B 4M7KH 1F4HA 4QXUL 5JW4R 1AY1H 3S96B 3W9EB 2KUTA 1MRFL 3F7VA 3O81A 4HFUH 1CZ8H 1A7OL 5BO1H 4JFEA 5JHLL 1A9BB 5BW7A 2P5WD 4GKZA 5BRZD 3VFNB 1S7SA 4Y7MA 3O0RH 4OUOA 2XWBA 1RUAL 1I9JL 3VWJB 4I77H 1VFUA 3BPNC 1U0QA 3TT1H 4MD5A 3QDGE 5KSAC 3PV6B 4UTBL 3VRJB 3KLAB 1SM3H 2ZG1A 1F8TH 3FJTA 4LVEA 2BVPA 3A6CH 2NY2C 3RGVA 4GBXB 3EFDH 1S5HA 3BJ91 4N9OB 4ZUUA 1R3HB 5T3XE 1L6ZA 1T5WB 2APVA 1MY7A 3DECA 1BPVA 4OFVA 3VXRD 2HWZH 4M62H 5T3ZH 3S3JA 1XGTA 2XACC 1QVOB 3SDCD 5MEND 2E9BA 2OL3H 1NFIB 1SJHB 1K5NB 5F9WB 2EH8H 2FHFA 3P77B 1ZGLM 3MUHL 1L9MA 2NZ9C 3NA9H 3UZEA 5EC2A 2YRPA 3NH7L 5KSBB 4PUBL 3RU8H 2XTJB 3GUTB 1RVFL 4WI9A 2V2WA 3MRHB 4Y5VA 4ZNEA 3TA3D 3FONB 4F9LA 1HYRC 2YWZA 3FOLA 1A1OA 1CK0L 6FABH 4N90E 2VLRD 3UTOA 2A77H 4JR9L 1WFUA 1HHKB 3RTQD 5IR1A 4G9DA 4XPFH 3RDTD 2AJUL 5D6DA 4I13B 3QPXL 1RJZA 4EBQL 3CAFA 1I1FB 2DM4A 2EDLA 3P9LA 5C9KA 1IEAA 4TULL 1FV1A 1QOKA 4PRAA 4WRLA 4CVXA 4D2NA 4OM1L 3G5VA 4S0TD 5JIIA 1MFAH 2R0WH 1EV2E 3VFWB 3BGMA 4KJPD 3DVGB 4K23H 3S35H 3MRPA 4OZ4B 1QPPA 3A6BH 2NY3D 4PJ8B 2R2HB 3GO1H 4NQDD 3LPWA 1NBZA 2FX7L 5JW4M 3MUZ1 2QSTA 5I8CB 4XVJL 1UM5H 3QUMA 4FP8H 4XCYA 5D1XA 3ESVF 2FJHB 1ETZA 4ETYA 4EKXA 3PL6A 4RSVA 5HHXH 4NN7C 4N0CC 4TPRL 4PJDA 1VGEH 3CFKA 1FLRL 4TUJA 1ND0B 1FSKC 4MXWL 4X6BB 5CP7A 2AEPH 2VZ1A 1UC6A 3B9EA 3QSKB 3REVB 4MNGE 1UJ3A 2QHLA 5D1QC 5B38B 3QXWA 1L0XA 4LQFL 1OQXA 1Q8MA 1EMTL 2OR9L 3QDMB 3U30B 4ZXBC 4QRRE 4HK3N 4LIQH 5C07D 2AGJH 1J1PH 4TNVK 1FNAA 4Q6IA 5KS9A 4NWTH 1I7ZB 4NYLB 1U9KA 3AS0A 2JTDA 1KG0B 3I75B 2DJ4A 5LXGH 4M48L 3G04B 1NCAH 3QHTC 1FFPB 1LE9B 3MLWL 4OKDA 3AC0A 4CVUA 1BECA 5B22A 1J86A 4EN3D 4FTVB 3HAEH 1XGQA 4P2OC 3F5WA 2EE3A 3T0VA 4WUUD 5IHLB 5GJSH 5HHOE 2D9CA 1QP1A 4EIGB 3C60A 4WI2A 1FFNA 3QI9B 3TZVD 5A16A 4U6XA 3IJSA 4NFBA 4HBCL 1JYVA 4FQLL 1J11A 5D9SB 1AQKH 2JJVA 3BEVA 2VLJE 4PJ9A 5DJXB 2XG4A 2HRPH 4JRXD 4DFHA 3IDGA 4L4TB 1NANH 4I9WD 2OZ4A 3BT2H 3DO7B 5HHQA 4XPTL 3VGDA 5GZOD 1PG7W 3VFMA 2QADD 2X10A 4JRYB 2BSED 4LVOB 1EO7A 4HHAA 1RZIB 5I1AA 2W0PA 4HPOH 2E7BA 4LDEB 1NL0L 2XKNA 3N9GH 2G2RB 4G5ZL 3HZVB 3FQXA 5GRJL 3TWCL 5EN2A 4XP5H 5AG9A 2A6KB 2J88L 4HMEA 9CGTA 1HILB 2MPAH 3AS3A 2IANB 3MX0A 2X9YA 1ZHNB 5CSGA 1I85A 4ESKA 5ABDE 4HIJB 2F58H 5EO1A 2XN9E 4JFFE 5I1EH 3QCUL 3RWDA 1DSFH 1QHOA 5ISZD 3CK0H 3OKNB 4BSWB 5F3BA 1M7IB 4OZHA 2IG2L 1F00I 5L2JB 2FD6H 4Z5RB 3UYPA 3O8XC 1LO3H 3N06B 3VFUB 3JV4A 1EIBA 4RMVA 5IWLC 4NSKB 5FYJH 5FOJA 1IRAY 1TDQA 2OQJB 1KLFA 1FNLA 1OPGH 5CEZL 3L3IA 4ZTOH 3VGAC 3E6FA 2P8PA 4HKJB 3OB8A 2XXCB 2DMKA 1FYTA 3H3BC 3N85H 5FGCB 2VL5B 4G6JL 3ZE2F 1S7QB 4OSUL 2VDOH 3JUYA 2VN4A 1KJVA 3V4UH 2OXHA 4M1CD 3N1QC 4U1IA 4GJTB 4FMFA 2VL4A 4NQCD 4ZUTB 4YDVA 3PGDB 1MJJA 3EYVA 4OZIF 5J7CC 1U95A 3UDWA 3KG5A 3HRPA 4RFEA 1OT1A 4MZ3A 1JWMA 3T09A 3QHZH 4JFPB 1ADQL 1JGEA 3FT4B 1CLOH 3S88L 1MWAL 1B9ZA 3ILPB 5D1ZC 3BH8A 5GISL 4HPYL 2AV1B 1RD6A 4QRSB 2FECL 4U1NA 1YMMA 3QA3A 4X4YA 5I76B 1F3DJ 3EJZC 4Y4KB 2NMSA 1DQLH 2VYRE 3ARPA 4ODHL 3UYRL 2IBBA 2PO6A 2HYMA 4G43B 3WBDA 2YC1A 4GT7A 3S36X 4ODTH 3J8F7 3OG4B 3HE6D 2IAMA 1F4WL 2YXFA 1VGKB 4OZFH 1E4JA 4Y5YA 1KPUA 3BP5B 5DMGD 3HA0A 4NN6C 1ZHLB 3KYMB 4UNVA 4UIMA 5EORL 1MCCA 3TIEB 1QNZL 2P1YA 3LEYL 4NQXA 4BSVB 1F4AA 4HS6B 3I6LD 1MHEB 4DQOH 1OAYL 4UT6H 2X4NA 4GAGH 4JQXC 4QRPE 5CHNA 3SDXB 3OGCB 4Z7WF 1X3DA 1BOGA 4LLUA 3IDMA 3CLEL 1E6OL 1PGRB 4LFHD 1UXSA 3QQ9D 4FNLH 4LLVA 5HHOD 3W5NA 4L3ED 2EDDA 4ZFGH 2QQLH 1N5YH 3CC5B 1ZLSH 3L3KA 5C2BH 2P5EA 2ZOKA 3ARGA 4PJXA 4Y16C 1GGTA 4JM4L 3OR6B 5JLZB 2HJFA 4V2CB 4J2XA 1FH5H 5LBSL 2HFGL 4WU5B 2NYYD 3V52L 4K7PH 3HRZA 4HFWA 4IIQA 2XFXA 4JPWH 1UWXK 2DYPD 5F96H 1UA6L 2BDNH 1NC4D 3P73A 3GM8A 1QFWH 4OLWL 1MRCL 3WEXB 1A14L 3T1WA 4RISL 2AKRA 4Q9RH 1ZGLP 1A1NA 1NMBL 1BLNB 5FA4B 5F89B 3S5LG 4MAUH 5HHNB 5M94B 3L1OH 5GS1C 4MA7L 2ZKHH 4JFXA 1R3LB 1T1YA 3ULSA 4PRPE 4ENEC 5IB5B 4HH9A 3CFEB 3OKLB 4F7TA 1WF5A 3HCVA 4MJ6A 1SYSB 3RNQA 2A83A 3L3GB 1NGQH 4UV4H 2X70B 5A2IH 1TLKA 4GG6F 3OSKA 4PRBB 1V8HA 2MMXA 3CH8A 4OQTH 3SOBL 4AMKL 5EU4B 4ODWA 2D03L 5FKAA 1P6FA 2B1HL 5EUOB 4I48A 4L9LA 1RUKH 3NCYP 2R2EB 3O4OC 5I1IH 1I3RA 1YY8A 2R2BA 2JIXA 2V9RA 5SWZD 3N1MC 3NABL 2HVJA 5ALBL 5HYSG 2YD8A 3RZWA 2OJEB 4P23B 4WW1B 3TPUA 2F5BL 1W8NA 1YJDL 5F88B 43C9B 3WS3B 5FM5O 3E2HC 3EUUA 4X9HA 3UTSB 2O61A 4WI3A 4P59H 2LU7A 4YH6A 5J12B 1AKJA 2CKBA 3B9VA 1IGCL 4PLJD 2GJ6B 1GZPB 3IETB 4PJ8C 4LPYA 4JB9L 3ZE2E 1QSFA 2GITA 4YDKL 5EBGA 2VE6A 3ILQD 2BSSA 1P84K 1OTUC 4U2YA 5C6PB 1LQSR 4U0RB 5HYQB 1Q9OA 4OZIE 1R3IH 3A6OA 4XAKE 3CXHJ 1UGNA 1KNOA 1RU9H 4HDIB 4Q9QH 2H2SC 3ULVC 3O2VH 4FQXD 2ID5A 4LP5A 3EZJB 3DNKA 1X4YA 2R1XA 2ZSWB 4TUOB 4EI5A 4O2FB 1TTFA 3BH9B 3MXWL 5HD8C 5IHBA 1QBML 2BRRH 1MJ7L 4HUWA 4MJIB 2VQ1B 4KJWD 1N5AA 4ZDHB 4HEME 5HYJE 4M5YL 4Y2DC 2V17H 1ZV5A 1A2YA 4Y8DC 1K8IA 2J6EA 2JCCA 3UCRA 1KIPA 1I1YB 4U6HA 3HFMH 3QIWB 2DLFL 3LN5B 1P69B 1G7IA 5F7FA 5GSRA 1P7KA 3SO3C 2R4RH 1G7HA 1MQ8A 4RBPH 1UZ8A 4AIOA 4KK5D 4GQ9H 1N8ZB 1MHPL 1B0RB 3EDEA 4MSWB 5JTWA 1C16A 1I8LA 1E4XH 1P4LA 4N0UE 4YHPA 3E8UL 4Z7WE 2H2PC 4HX1A 4K7FA 4GKSB 3QIBC 4LSTH 4QTIL 5MHSE 5D72L 1OARL 5GXBB 4ZFFA 4U33A 5I16A 1NJ9B 1V5JA 3BIKB 1U92A 3Q1SL 3NCJH 4K94C 4KRLB 4E5XB 3QO1A 1PW3A 5E8PA 3SDAB 1CFTA 4QWWC 4YDIH 2X4OA 3T1FA 1T0MB 4M43H 4NHCL 4XWOC 3MRMA 4N8VA 4Q2ZB 5LCVH 3BO8A 4PJBF 4OI8A 4HC1H 4J3VA 2P8MA 3O3BA 3EFFB 3MRIB 5C9JB 2YD3A 3VWKB 1HCFX 4EOWH 4N1CA 5ACMA 1HIMH 1LO5B 4ZOEA 4G7VH 3FFCB 1ZA3A 3KVQA 1M71B 2V7HA 3UTTB 3WIHL 3QWOA 4APQD 4YFLI 1X5HA 2QSCL 4LLMA 5E56A 2I07B 5IQ9A 5EWIL 3RWEB 3U36B 1MHHA 3O6ML 1GCFA 2A74A 3T8XB 4PGBB 3ROLB 1NBYB 4K3EH 1IL1B 1QRNA 2BCKA 1GGIH 4PJAB 4X5LA 1YEGH 2F15A 4OF7A 3FB5A 4DW2L 4WFHE 2BVYA 1J88A 4GG6E 1WBZA 4NWUL 3NFPB 4MLSA 5EO0A 3V2AR 1BVZA 3LHPH 2VAAA 4KZEL 1JE6A 4M8VA 5T1LD 3QRGL 5JPNB 3LQAC 4Y88A 1D5MA 2FJGB 2HJKA 5HPOA 1GHFL 3O3EB 1X7QB 2HKFL 1MEXL 2ZUUA 4Y4FB 3MBXH 4P57B 2J3SA 2VSCA 2VLME 2ZSVA 3W81A 5JMRA 1J8HD 4WHYH 1ZLVH 4K3DH 1G6RB 2W9DH 1BF8A 1I9RL 5GGRY 5BVPH 5I1JL 3VGBA 4DUXA 1YNLH 1U8KA 2XNAA 3MV7E 3HS0A 5D2NB 4L9DA 3HC3H 3U7YH 1UXWB 3HI1A 2J5LC 3F58H 3EIFA 4HKBB 5I71C 4Y1AA 3W9EA 4Z7VB 4XX1G 3KXFD 5L6YL 1A9EB 4NJAL 2I9TB 1HQ4B 4Y4KC 4F7MB 1ZXQA 1WIPA 4U05A 3VFNA 5DR5L 1Z2KA 5IROA 3VXMD 2HP4A 2EH7H 3UBXI 4KGJA 3UTQB 3KLAA 4MA8H 5HVFB 2AJVH 1AC6A 4GBXA 4Z95L 1LE5B 1R3HA 1A7RL 1T5WA 4PJEB 3MRJB 4OB5L 4XMKH 1XR8B 5T3ZD 3B5GA 3QWRA 4IOFC 4NPYB 1QVOA 4MNQB 3V0WH 1NFIA 1SJHA 1K5NA 5ERWB 3ZTNH 3TT3L 1UM6L 2Q86B 1TVBB 5DXWA 3VXPB 3LKRB 4HXBL 1BM3L 5C1MB 4HGKC 5HBBA 3HZYA 2OMNA 2DQIL 5KSBA 4NKMA 2CLRB 5FCSH 2VQUA 4GSDH 1JHKL 1IZKA 4A2LA 4M4PA 3GUTA 2VMFA 3MRHA 5I8KL 1ZVSB 3GSWA 1A7NH 3IKKA 3FONA 3WHE1 3PWVB 5AAWA 5B3JF 1WZKA 1JZ4A 1G9EA 2XZAH 5E99L 4MAYC 4RAUB 2R56H 2BRQA 3GMLB 4MZ2A 4O51B 4DTGH 5EIQA 3MUGB 4CGTA 1FYHB 5D5MB 4EI6B 1DLHB 1I1FA 3SEPA 1KELH 5JXEC 3RUGB 4X4ZA 2VZVA 1T21B 4UU9B 3T0XA 4XPBL 1J18A 1MCKA 4M02A 5DVNA 2E7HA 2P46B 5IQ7H 4PJBE 1WITA 3GSRA 3RHWF 5IP4A 1TMCB 3DVGA 3DMMD 5JHDD 4OZ4A 3W11C 5JW4N 2HT3C 3BDYH 3H9SD 2YD1A 3CVHB 4KRPB 3HR5A 4NHUA 3KLHD 4DKEL 3F7YB 3VXOB 1FNEB 4XNYL 4LCWA 3X13A 1MVFA 4JFZL 5I8CA 3GMNB 1U8LB 1NANI 2NXYD 3FO1A 4PG9B 3S4SG 1MCNA 4OCRL 1F4XL 2AJ3B 4H0GA 5IK3B 1AD0B 1CE1H 3QG7H 4F8TA 1MAMH 2C26A 2WLZA 3MRLB 3AU1B 4PV9B 4X8XA 4XC1H 2ZUVA 4JFHD 5EZIH 1DZBA 1ND0A 2VDLH 3V4PH 3GRWA 5ITBL 1JPSL 1A3LH 4X6BA 1UH2A 4JM2F 4H1LG 1JGUL 1EGJA 1QR1A 1DBMH 3U9PH 1HSBB 5FA3B 3O6FA 1ORSB 2WUBH 1RK1B 3IU3B 4B7LA 3DUHA 2M26A 4OJFH 2LABA 2ARJQ 3S98A 4E0RB 5C0EB 5C09E 1I7ZA 4QNPF 5I73C 4NYLA 1C7SA 4HWZB 4BZYA 3I75A 2ZUQB 3G04A 1FFPA 1LE9A 3VXTB 4DKFH 1Q0XH 1T22B 5IKCB 4MJ2A 4OLUH 5J1SC 1RUML 4H0IA 2DI7A 1S9YB 3PWPD 3SQOH 2VR9A 5DJ8B 4WWKB 4JY5H 1SY6H 3G6JF 3QI9A 3S5LB 4DAGL 3WFHA 2NY5C 2ICES 1BVLB 5FYLE 1A0QL 5F7HA 1C12B 5D9SA 3TBTB 2Y23A 2P5WB 5BRZB 1GOFA 1IZJA 1WAAA 4LCCC 3C8HA 2ZUYA 3HC0A 2AI0H 5I8EA 3JWDC 1NDGB 2YR3A 2XA8H 1WVZA 3QUYA 4PJFF 5AWNH 3DO7A 2GAZB 4MVBD 4JRYA 2D7MA 1MREL 1AO7E 1AD9B 1RZIA 4GRLD 3DARA 4WWID 1U3JA 4YEEA 2G2RA 2BP3A 3VXRB 1CWVA 2I24N 2IANA 5E24E 1D5IL 2AEIT 5EH1A 3U83A 3EDKA 4HIJA 3CFCL 2WWKT 3V95A 5FYKE 1KEML 1KB5H 4FXKB 4NO0B 4WCYH 1N6UA 3O4LE 2E8ZA 2EO9A 3OKNA 1M7IA 5DQDL 5BXFB 1NBQA 4Z5RA 3QP3A 2BSTB 2AP2A 3PWUB 1F4YL 2ZCLH 4OLXL 3G9VA 4F3FB 4Z0XB 3TA3B 3VFUA 5B3JE 5JW3H 1NSNH 2Y1VA 3TJEL 5HDOA 2VLRB 2HT4C 2VDNL 3WXVH 2OQJA 4HLZG 3RZCD 3RTQB 1SBSH 5KANG 3RDTB 4HKJA 2EEDA 3BZFB 3ISWA 1YNKH 1CFVL 4IRSA 1RHHB 1S7QA 3VG0L 2A0LD 1XF4B 3SO5A 1E4KA 4P2RD 1S7XA 4XZUB 3QCTH 4DOHB 1IGTA 1MPAL 4X7FC 1G9NH 4C4KO 1CDIA 4ZUTA 5CCKL 3ET9F 4Q7DA 3HPLB 1JZ8A 5J56B 4GMTH 4WY7L 1S78C 5DC9B 1KIUA 1GPOH 4JFOA 1RJYA 2VQTA 1BHGA 4NQDB 4K9EL 1YDPB 4BSJA 3ILPA 3EO9H 5IFJB 2QTEA 2AV1A 4QRSA 2HVKB 1WQVT 4PLKD 5KOVC 3IYLW 4HULB 5I76A 1I1AD 1JTPA 3ARBB 3V6FA 5JORA 5FO8A 4G43A 4WI5A 2Q8BH 3F65A 4LF3B 2X4TB 5DD1H 1KC5L 2Z8WC 3SE4C 2X6MA 1IC4H 5BS0A 1VGKA 2BNRB 4UB0H 4Y4FC 5ACLA 2LE9A 2Y7QB 3BP5A 4ONFL 5EIIB 3ZT5A 2UZYB 4PTTB 5FKPB 3BPOC 4LVNB 3TO4C 2MOVA 1N0LA 2JJTC 3QUZD 1A4JA 3IU4H 1SEQL 3TIEA 4BSVA 2EC9U 5M7QA 1MHEA 3G5YA 4YHZH 3CFIC 4NQEE 2Z31A 2VDPL 1WICA 2FR4B 5C07B 3OGCA 5C0BA 5D2NC 5IBUB 4YC2C 4QNPE 4ZMAT 2QR0A 2FDBP 1JF1B 1PKQE 2VXUL 5TQ2L 4BM7A 3T2QA 1IBGL 2YBRB 3D2UD 3CC5A 4ACPA 2NY6D 35C8L 3QEQD 2L7UA 4EN3B 4XPHL 4JG0L 5JLZA 3UPRB 1KLUB 2OBGA 1A1MB 4YHKL 1F3RB 4I18B 2CGRL 4WUUB 2FHCA 4ZYKB 1FNSH 1CICD 3G6JE 3QB7C 4WU5A 5EU7C 2V9QA 3LSOA 4QGYA 4KXZH 1QPXA 1FAKT 3TZVB 2VISB 4I8DA 5EBMA 5DDHB 3JV0A 5JDSA 4M7JH 3WS6A 3TYGL 3WIIH 2VXVL 5I1DB 4RDQG 3IAGC 4QXGH 4Y4HC 2Q7YA 3IKCB 2FX8H 5EA0L 3P4LA 3FQRB 3WEXA 1INEH 4JANA 2Z35B 4JRXB 4X0KA 2CO7B 2GJZB 4UBDC 1BLNA 5FA4A 3SGKA 5F89A 1YECL 3B3IA 1LEGB 4PJFE 5HHNA 3CXDH 3VMPA 1DBAH 2NY1D 3EJYD 3QIUB 1DTUA 1R3LA 2QADB 2F53E 5DUBB 3WNNA 5IB5A 1MNUL 3CFEA 4WGWB 3OKLA 4HWEH 4OFPA 3TCLA 4I0PD 4XP1H 2NTFB 3L3GA 2X70A 5HSFA 3O4LD 2GTZB 4PRBA 4N5EC 1ULVA