1IJ9A

Highly hydrated human vcam-1 fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords VASCULAR CELL ADHESION PROTEIN 1
publication title A new conformation of the integrin-binding fragment of human VCAM-1 crystallizes in a highly hydrated packing arrangement.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A01
3BUTA 2IGFL 3BD4A 1PX4A 4M7LH 1J12A 3ZSTA 5JIHA 3MUHL 1S9WA 5C7XL 3MLSL 1DANT 4NYLA 5CJ8A 4FQCH 1ULVA 5ETUB 1OD7A 3WIFA 2QJDA 2SEBB 4I8DA 5DJZB 4X6DA 4N0CC 4ODHL 1R5WB 5E03A 3DSFL 2GJ6D 4AIZA 1WFOA 2X4UA 3SDCB 5L8KB 4M7KL 4ZDHB 1OF2B 2A0LD 5CMAA 1TPXB 4PJBE 4NQCD 3MFGB 4QWWD 1B4JH 3ZL4L 5GGRB 3QEGH 4JRWA 5E5MB 3LRGA 3TN0D 1JF6A 1NBQA 4PJBA 2O5XH 1SVZA 1SEBB 2W65B 1X44A 4WO4A 1XCQA 4GUPA 4S1DC 4XWOC 3EZJB 1MCFA 2V17L 4HUVA 3LOWA 1QACA 2Q86B 3ZDZF 5D72L 3B8SA 3CNKA 5E99H 1MAKA 3DVNB 5T33H 3VI4E 4XHQA 3CZFA 1LP9F 3C9NA 2C1OA 5GRVL 1CXLA 4ELKA 1WZ1H 1YY8A 2YK1H 4LCCB 3T4AB 3BHBA 3GKWL 3S35L 3RQ3A 5C0BD 1H0DA 2YUWA 1RIUL 1QG3A 4NP4H 1OB1A 4Q9BA 1RQ5A 4HUWA 4NQDE 2ZCLH 4NQCB 1S9KC 3DX8B 2ZUQC 3PWNB 4KXZH 2PCPA 3JWOL 3WFCL 2BVEA 4XI5C 3BVNA 3ARXA 4K3HA 1YEKH 4GMSH 3IU3B 4FQXB 3GUTA 5I66B 4PJ5D 3HC0A 4TUJB 4JEGB 1OGTB 3P0VH 5E2VH 1S7SA 4QRPA 4B5EA 4JZNB 2BMKB 2AK4A 3DETD 2VQTA 1NEZA 4XGZB 4ZYKA 2JB5L 1DQMH 3GSUB 3BD3A 4KXZI 3O9WD 4YXKH 3NBNA 5JW4R 1X5FA 5L2KE 3CH1A 3GSXA 4NO0A 1H5BB 2BVUA 4LBEB 4R8WL 1HINH 5C07D 1VGEH 4U0RB 3NCJH 4Q9CA 3UPRA 2AGJH 3RNKA 2GY5A 2GSGB 5IB2B 5IEKB 1IL1B 3R1GH 1RHHB 4Z5RB 4RQQB 3QEQB 4HWUA 3RVXC 1MHEB 4AM0B 1QQDB 4NQEE 5LAXB 4BZ1H 1YZZA 1KTRL 4JQXA 4J3OC 1N0XH 3S3PA 3HG1D 3GMLA 5DSCB 3RU8L 3BRGC 3SKUD 1ZWIA 1C1EL 5B3NA 1S9YB 4YC2C 4PP1C 1S7VB 3ESVF 1MJ8L 4KKCD 1ZVSA 2E5EA 3G6JF 3MTRA 5DFTA 1Q72H 3ARYA 1VSCA 3VDCA 4Z0BH 1KACB 1A4JA 1L7TH 1OTTD 4ETQB 1OD9A 1CL7L 4PJDA 4GXVH 1LEIA 3HB3D 5E0QA 3S34L 4TTDC 2HN7B 1UCBL 3T1WA 2VDPL 3VMOA 3WSQH 1E4XL 5J6HB 3FN0H 5DMKA 5AD0A 2ADFL 4QRSB 2C3GA 2K7QA 3E3QC 3QJFA 3NH7H 3OF6D 5D1XD 5IFAH 1LEGB 1L0QA 1NPUA 5HYIA 2NTFA 3PWPA 2QSCH 3FB7B 2A9NH 3P77A 2IH3B 1OL0A 3EYOA 4Y0GA 1G0YR 3HG1B 2LVEA 4QF1A 4DCQB 1DQJB 2ZCHL 5ID1B 1Q9OA 5I1JL 2Z8VC 3HC3L 4WFFE 3BESR 3EOYG 5ISZD 4Y4HC 1INEL 4FQQB 5HPMA 3MCLH 1MEXL 4DUXA 4KQ4L 1NDMA 3L95B 4PJIE 1IGCL 1FVEB 1NBZA 1EGJL 1WEJL 3VRIB 4RZCB 4MNQA 4X9FA 3PDGA 4Y2DA 3U0PB 4G43A 2J6EH 4PJIA 4QRRE 3U2SB 5DEFA 4MAUL 1QSFD 1SY6H 3GDBA 4Z78B 3SDDB 1JPGA 4NN5B 1T2XA 4RCAA 4OV5A 2O26U 4WU5B 2HJFA 5F89A 1K5NB 1CDHA 1FFQA 2R0ZL 3TO4B 3X14A 3SE4C 43C9B 5DO2D 2VSCA 4NSKA 4QRQA 1EJ6A 5KTEH 4HKXB 1C7SA 2JCCE 4R96A 1WBZB 2YC1A 1UB5A 4X7TB 4XP6H 5HJ3B 3S36L 5DC9B 4O5LL 3QFJE 1X6LA 4NKOB 1T5XA 3BZ4A 1YN7A 5ISZB 1QFPA 3TBSA 4OLVL 1QFOA 1QYGH 3BXNB 4UINL 5HGAA 2ZOKB 4EI6A 1KTLA 3T04D 3DV4B 4KTYA 3PL6B 3P4OA 2MCG1 3VXME 3BEVB 5JW5A 5FUOH 3X3FL 2ITCA 2MMXA 2R9HD 5JXAL 2YPVH 1MREL 1BVKA 5BJTB 5SWQB 3T65A 1D5XB 5ADPH 1K2DB 1U8MA 3I2CL 4MQ7B 3S7GA 1BOGB 1EBAA 1RUQH 3IXTA 1L7IL 1I3RA 2JKXA 3RNQB 3LKPB 1ZLVH 2R15A 3RL2A 3P0GB 3T0EB 4GAYA 4RMWA 3KR3L 1TTUA 4LSVL 3C5ZD 3V6FB 1AQKL 5K59F 3WXWL 1TNNA 3D6GA 4JB9H 4YHOL 4HKZA 4OKVA 1EBPA 3MNVB 1BLNB 3LHPH 1AFVH 3QPQC 4HHAB 3BO8A 4JFFB 4C56E 3M17B 3IFNH 1YNKH 1EHLH 1BGXL 2J6EA 5IW3A 4LCWE 1W0WB 2I9LB 2FX7L 5DD6A 2XN9A 2Y5TA 1KV3A 5CIPA 1MRDL 1PG7X 1SY6A 4BH8A 5I17A 3CSYA 5D2LA 4Z7OE 5TE4L 1NCAH 2BP3A 2EDKA 4LCWA 5EUOE 1CLZL 4MA7H 4K9EL 4OZHE 5LG1A 5MEQA 5EPMB 2F54E 4U6VL 3OKEB 1EFQA 4DKEL 5C0IA 3L5XL 4NNPL 4FMFA 1CR9H 1ZLUK 3PGCA 5FV1L 3NACL 3KDMB 3RAJH 1G7JA 1JF5A 2FSEB 4NKIL 3ZT6A 4YWGH 1IAMA 4JFHD 2OYPA 4JPKH 2VC2H 1T22B 3KPMA 3MA7A 3C5ZB 3OXSB 4F7EA 3MLSH 1K8DA 4F7MA 3VWJC 3G5YB 3IFPB 5KJRL 4JFQB 3ARED 4J8RA 4L3ED 4RMRA 1FNSL 2ERJC 4ODVL 4JPVL 3QQNA 1IILE 4ODHH 4RAUA 5DJ6B 4G42A 4K3DL 3LPGA 3BE1H 3BGAA 2AJ3A 5LGJA 4PIRF 2OX5A 4PJFE 5T3ZE 4L5FL 5AYUL 1CFQA 4APQA 2UUDH 4JHZA 3EYQD 2DQJL 4OJFH 4KK5C 3MRDA 4G8GE 3NFSL 4M8QA 1RZKC 3QUMB 2WQRA 4NNXB 3C6LC 3MRNA 1MRCL 3RL1B 3PGDA 5TE6L 3LEYL 1T4KA 2Q7YA 1E4WH 4J7RA 4K55A 5C9KA 5JR1L 2V17H 4BKLA 3ULUE 3T8XA 2BY3A 2ICES 5SX5K 1QHPA 5EO0B 3WNNA 2VMFA 3K81A 4QXUL 1NQBA 5DT1L 1FFNA 3KG5A 4HEME 2X41A 5EUKA 3P9WB 1QFHA 1CGSL 5F7KC 4N0YH 5IW6A 5KS9A 3AREB 2D0HA 4K71B 4MWFB 3ZHKA 2QQKL 2VLKE 4R7DA 4Z95L 1GZPA 3S35H 4PRNB 3WBDA 5GGVY 1CS6A 3BP6B 1K6QL 3HRZA 3K2UL 1XFPA 3LEVL 2VO5A 1UVQB 3QXDB 3VRLE 1RMFL 3IDJA 4XAWL 3U6RA 5I73B 1BVZA 3BP7A 5CD3B 5IB5A 3I3EA 5DMIH 3GSVB 2EDRA 4FS0A 1XCTB 2DWDA 4JANA 3TPKA 3RVTC 5KSVB 1TJIL 4ZOEA 4EDWL 4OQTH 5IMLA 2JB5H 3S4SA 4O2CA 2DN7A 5D93B 2R23B 3MLZH 2H2PD 3VE0A 4FZEH 4D8PA 4Q0XL 3RWCB 4EUPB 1ZGLM 3DV6B 2OCFD 3KPRD 3P9LA 4WV1A 5D2NA 3NABH 2P47B 4S11A 1A2YA 5I16B 4ZFOA 5I71C 2FD6H 2FJHA 2QADD 5CJQL 3RZCA 3MLXH 3GK8H 4PRDA 3ZT5A 1Z5LA 5I76B 2PXYC 1G9MC 2H41A 2DIAA 1QKZH 5FYKL 4MNGB 3BZDA 1C5CL 4JVPA 4Q2ZB 4BELD 1I7TB 1O7SA 2VLLA 4RWYL 1C1EH 3MBXL 1CQKA 4M9PA 1P53A 3OKNA 1D9KD 3P73B 4M48L 2OI9B 5T3XH 1AGBA 2AJUH 4WVRA 1CBVH 3UMTA 1PZ5B 3DGGA 4OM0L 1VACB 3H9SE 1CL7H 1I7UA 4HAFA 1LP9A 1IGIL 4LLYA 4CMHB 4IRZL 3RPIB 4E42A 3CAFA 4KKLD 4P0DA 5F7EL 3ARGA 3KPRB 4PB0L 2ILLA 1EJOL 2FHCA 2UYLA 3NCEB 2ADFH 3STLB 2A6KB 2D2OA 4D9RD 4OBRA 3MRFB 1DFBH 3HZMA 1NMBL 3ARFB 1TZGH 2VISB 2QADB 1CICB 1DLFH 2HJKA 4NN7C 3GGWA 1CL7I 3D69A 2XOTA 3WUZA 3QDGD 1IE5A 1MCSA 2CK2A 2EIZA 4OQTA 1F4XH 3WLWD 4H25B 5FF6B 2HWZH 3OKLB 1IAKB 1FZOA 1FL6A 4HWZA 1AI1H 1D9KB 4KJWC 3HAEB 5I1JH 3HC3H 4UMGA 2WINA 4YHZH 1YDPB 3QQ9D 4P5KB 3VXPB 1C7TA 1JK8B 4CADA 3KNBB 1NGPL 1E28A 3HHRB 4YQXL 3U83A 5I1EL 2WV3A 1MEXH 4KQ4H 3EDDA 3RVVD 3DUSB 3MUJA 4K7PH 4OQ1A 2DM2A 1IGCH 1EGJH 1WEJH 3GBNL 4DKDC 2D03H 5SV3A 3WL9B 4BUHA 1V8HA 2YD7A 4PJXE 3HCVB 7CGTA 4HMDA 1NUNB 4FQHA 2OXGA 3MV9A 1U8OA 3CX5J 4BQ8A 4HJ0D 4M1DL 4U1NB 3GSNB 1A6VL 3QUXC 3INUL 3QIBA 3QIUB 3HE7D 4L9LB 1Y6MR 5TDNB 3QDGB 1F2QA 2ARWA 2GT9B 3MRHB 4NKDA 2R0ZH 1VKXA 1MLCA 1DBBH 2PKDA 1UJ3B 3ULVC 4RISL 5TDOB 3FFCB 1KCSL 4HIXL 3QUZB 5FO9B 4I9WE 1Y0LB 4JFEA 3G6JA 1BQHB 2D4DA 1ZLSL 2WK2A 1A14L 2NZ9C 3L9RA 4MS8C 4PJCB 1ZHNB 3V8CA 3QRGL 5FHAL 3TNNA 2EH7L 3S37L 4G6ML 5FDYA 1HILB 4GS7B 1DBJL 2VDQH 4JFZL 4PV8B 1DVFB 4UINH 1S8DB 3LN5B 3VFPA 1DBMH 5JW4Q 3E2HB 1TJGH 3RGHA 2XKNB 3H42L 1YEEL 1OAZL 3NAAL 2BXZA 3PIQB 4YHYC 4KMTL 3X3FH 3QZWB 1AP2A 3QG6A 4I4WA 4ZUUB 3MUGA 3SKNB 1QBMH 3CXHK 4L4VB 5A3ID 4E0RA 4EI5D 1YEJH 3QISA 4H26A 4JZJA 5GS2H 1MCWW 4NRZB 1KB5H 3KR3H 5F8RC 4LSVH 2X42A 3FZUC 1FL3A 2FR4B 5IR1A 5EO9B 8FABA 4L4TB 4I3GA 4P5TC 1JHLL 3MJ7A 2CO7B 4IRSA 5CZXC 4MDJA 3SGKA 5GS0C 4ZODA 3VXUE 1IJ9A 1JWSA 2GAZB 1EGJA 3KPTA 2FB4L 1CDUA 4M7JH 4GT7A 3L3KA 5A2IH 4GRLB 1UXWA 5HYSA 1BGXH 5BZWA 4RGNC 4J6RH 2NX5E 4JAMA 2FX7H 3VGGA 3TT1L 4X4ZA 1MRDH 1QEWB 4NRXB 1H3XA 2FO1A 3FCTB 3QDMD 4N0UB 1MHHA 5C8JB 1YNLH 5J0BA 2H9GB 5E9DE 4K9EH 4MQSB 1FJ1B 5E6ID 3NIFE 1N5AB 4FNLL 2F5BL 4U7SA 4DKEH 5K9KB 2FLBT 4HFWB 5C2BL 3NACH 4EI5B 3EOBA 3D3VA 3MMEB 3H7BB 3ZKMD 4ZSOE 3IF1A 2VLJB 4HMEA 4LAJH 3I9GH 4AIOA 3DXAD 5JHLL 4XCNA 4ZO8A 3UAJD 5A2FA 3H9HB 2AK1L 1A6AB 3DURB 1OT1A 2E9JA 2CDGA 1EPFA 1YEGH 3TP4A 4QCIB 4FQPA 1HWHB 3U4BL 5KSBB 3LKQB 5ADOL 1E27B 4XB7A 2V9QA 4ODVH 2IALA 3L3JA 4UU9B 4DOHE 4HBCL 3RWEA 5AG8A 4KTEL 4OZFH 1T89C 4GBXC 5FGRA 4W81A 4KKAC 3EYUH 4DQOH 5AYUH 4O58L 5KAQF 4OI7A 3D85D 2Z31C 4G3YL 1MF2L 1QSED 2NXZC 3L3DA 3DVGB 5FYKU 1KB5A 3FO0L 2GK2A 5KG9A 5FDWA 1BZ7A 4LSDA 5TE6H 3RWGB 2B1AL 1PBYA 3LEYH 3DIFB 3GSWA 1JNLH 4YHIB 5JR1H 1ZA3A 3KPSE 1PZUB 1F4HA 5D5MB 4QXUH 4JDZA 4OM1H 3RPKA 3M45A 5DT1H 5GHWL 3DPBA 3MV8A 5ERWB 1HKFA 1QRNA 4U4BA 5HHQB 1MCPL 4ODUB 1EMTL 2VSDA 3BPOB 1A6TA 1OGAB 3ULVF 1TLKA 4HIJA 2F53B 5SWSD 5ICZA 4QY8B 2EDWA 1GL4B 3BPLB 1TVHB 2VXTH 1K6QH 1NJ9A 3V6ZA 4N8VG 1I8LC 3DI2B 2EYRA 3LEVH 1RIVL 2BCKB 4TVPE 3X11B 2FEDD 5KN5A 1QSEB 1P7QD 1RMFH 1D6VH 1EEUA 1GGBH 3PG2A 3IDXH 4ZNCD 4XC3H 4EKXA 2A1WL 1F00I 4DAGL 1I3GH 5CP3H 5HHPB 4U2ZA 2WLZA 3WNKA 2O61B 5IEHA 4I0PC 5KZCD 4KUCF 2P8LB 1U0QA 5IF0B 4X5LA 3MNWA 1DQDL 1UC6A 4L1HA 5FGCB 4OZFA 4YXLL 4MSWB 5HGBA 1EFXB 1REIA 4UOJA 2P8MB 4CU6A 4GW5B 3MJ9L 1LGVA 1A0QH 3HE6A 3SDXE 2V7HA 4GW4A 4N0FB 4K3JL 3NFNA 2AXHA 5MI0B 5ICXA 5E56A 4GLRH 1K3IA 1IT9L 1OSZB 3W0WE 4Y4HA 3QXWA 1JZ6A 3TZVC 4Z18A 4HGWA 5DJYA 5I8EA 3VFVA 3GSRA 1PW3A 5TPWL 1C5DA 2P8PA 3BP4A 4X0KA 1C5CH 3VA2C 5I74C 4RWYH 4JGMA 2F5AL 5LXGL 5H2BB 1S7UA 4GLRI 2AJSL 5IG7B 1BJ8A 3L3OB 2ZSWA 2PO6C 1AGCA 4NGHH 5HDQL 4YDLC 3UBXA 3MROB 1D6EB 1N6UA 2A6DA 5I8CB 3STBA 4U6HA 3OJDB 4BQ6A 3CU7A 3BH9A 5AWNL 1AQDA 4PJ9D 5JXEA 4PRPE 1J7VR 3WV0A 2CIKA 2VDOL 3BKML 3AFLA 5IIEA 4ORGB 3SE4A 3ARRA 5EULV 3QNXA 3QO1B 2EKSB 3FOLB 3WJJC 1IGIH 4LRNL 1YQ2A 4IRZH 5I19L 5MEOA 4M43L 2PR4L 2W0FA 4DZ8A 3WFBL 5F7EH 4NQUA 3JV6B 4AEFA 4HW6A 1T3FA 5INDA 4IOFC 2L0DA 3KLHD 5CP3A 1A6UL 3RI5F 5LVEA 5FKPA 4NCC1 2DJ4A 3REVB 4ENED 2BOBB 1DJSA 1YPZB 1G0DA 2X1OA 4LNRA 4LVEA 3CPLA 1FYTE 4O2FA 3KYKL 4JFYB 3U7AA 1KN2L 4DKFL 1HCVA 3RGVA 4UB0H 1A3RL 1NCDH 3NFPB 4G8EB 1BFVL 3CFBB 4GFTB 1N3NA 2X1XR 1A1MA 3NA9H 4F15B 5F7FA 5FYKE 3AS1A 2QSVA 3TO2B 3MXVL 1NGPH 4X7CC 2HKHH 3OXRA 4G9FA 4J12A 4UILL 5HYJB 5I1EH 1N5YH 4QO1A 5E2TH 4GRWF 2LAGB 2DQDH 5FYJD 4WI6A 2C5DC 4ZMAT 3R8QA 1J88A 2CIIB 5J13B 1HQ4B 3OR7A 4HLZH 1XR8A 5D9SB 4YNYA 2LVCA 3VFWB 4M1DH 3EHBD 1TVBB 4IBLT 1OLZA 4Y5VC 2JE8A 1VA9A 1HEZB 5DJ0B 4LIQH 3RWIB 4X6CE 1KYOK 5DJDB 3FN3A 4HDIA 2MCPL 3VWKC 4S0TD 2JJTC 3U9UB 3BMVA 5HGHA 4RISH 1KCSH 1XH3B 1HI6B 4KY1H 5F1NA 4PGDB 3GBML 1ZLSH 4H20H 5T1LB 5EU4A 3L3GB 4XP1L 2EH7H 3BX7C 4R3SA 3ARDC 4UT6H 3S37H 4PGBA 1WCQA 2V5YA 1JRHH 1A21A 4JFZH 1WITA 1NC2B 2W9EL 3RTQB 3T0VA 1PSKL 4E5XA 3F5WA 4WUUA 3B2UC 3C5JA 4PLJD 3S5LB 3W2DH 2MQ0A 1KCLA 4R90L 4ZFFA 1D5ZB 4D0DA 3H42H 5E8EA 3BW9B 2W59A 1YEEH 1OAZH 5GGRY 3NAAH 1K4CA 2DI9A 1BQLL 3MGAA 3VXNA 1J10A 1WICA 1JRHI 4H1LH 1LD9A 1F97A 4X6EA 2HTLC 4PJ7E 3VXOB 5IOPA 1UWEL 4IHOA 3K80A 3BYTA 3VH8G 4OTXH 5JA9A 5DD1H 4P2QA 2Z92B 4U6YA 3PWVB 3CFJA 5DFVD 1NCUA 4C83A 2EECA 2OTUA 1OTSC 2PYEB 3UDWC 3D18A 4YBQC 4L8DA 4M93B 1DQQB 1T1WB 1ZANL 2ESVA 4M6OL 3QIWB 3T2NH 1PLGH 3NIDE 1LO5A 5GPRA 3B5TA 3VCLB 1U8LB 1BZ9A 4J4PD 4JDTL 3TBYB 4U1LA 3GHBL 2HFEA 4MJ2A 3GIZH 5IB4A 2ATPB 2X89A 5H35A 1YJDL 2DMKA 4EOWL 4LHJB 4F7TA 3SCMC 4XNZB 1F8TH 4NM8L 1A1NA 4ZTPL 5KSAC 5FYLE 3GRWH 1QUNA 5ESQA 4N68A 5EBLB 1J0HA 4PTTA 5DGRA 2EZ0C 1BVLA 2KDGA 5C09B 1H8NA 2AKRB 1BEYL 1XF4B 1V3LA 1CVSC 3OWEA 4PJAF 1C16A 3FO1A 3CVHL 2YPLB 3BDBA 2Z4QB 3BN9C 4DKAA 4NJAL 3LSOB 4Q9QL 2RHEA 2VZ1A 3TA3C 4BSJA 1HSAA 1JPFA 1AR1C 1FDLL 3O6KL 2QEJA 4GG6F 1KLFA 1H8SA 2IPUG 3PWJB 3WO4B 3DYMA 2BNRE 4RA3A 2UVEA 5ADOH 1WZLA 3ARBA 4LK4A 4Y1AD 1YEIL 2DAVA 4IOSD 1LO2L 1ZVYA 3H9ZA 3MR9A 1RJZB 4WHTB 4HWEL 4XBGA 3JTSB 4H1LA 1UXSA 3TIDB 4KTEH 2CO6B 4BZ2L 1EO8H 4FTVB 4JKPL 5IB1B 3RUGB 4PBWD 2HT3C 4JM2D 4WI7A 3VFTA 1UH3A 2AXFA 3FOMA 5D7KE 2P45B 4OGZA 5KVGL 4XNUL 3BQUC 4P2OD 1XGRA 5E2JA 2VITA 1QRKA 3LZFH 4OUUA 3B8YA 4P99A 2GI7A 4MDIA 2EO1A 3W39B 1RU9L 3OAUL 1HNFA 4NJ9H 1UZ8B 4UUJB 4ZPVA 4P3WA 3I6GA 4E41E 3LKNA 4FQLH 5J11B 4ONHB 2PXYA 2FYYB 5GXBB 3T0DA 1X7QB 3C8KB 3JTTB 2NW2A 3HA0A 5GHWH 4BK4A 1KGCE 5C08B 4EXPX 3ZDYF 1J8HB 3VD9A 4JRYE 1ACYH 1QLFA 2BSTB 1NEZG 1YY9D 5EU7E 2VNCA 1IQWH 3GRWA 4HH9A 5DR5H 5EZJA 1KIQB 1B3JA 3VFNB 1FC2D 1YEDA 4RAHA 5C0AB 3LIZH 3WFEL 3K2MC 4D9LL 3WNPA 2GUOB 4XNMA 2WIIB 3CVIH 4JM2B 5SWZE 3NZHL 3ULVH 2ITDB 2P7TA 2A6JA 2X4QB 4DW2L 2V5TA 5BVPL 4P2OB 5I1GL 2VN4A 4XH2A 5EWIH 4DAGH 5H94B 5FO7B 1R5VB 3ILPA 2CK0L 4LDLB 1OWWA 3ZHDA 1N59B 1ZT7A 1JHKL 5L0QB 3FQUA 1DANU 1BP3B 3V5DB 1II4E 4HUXB 2UWEE 1TZHB 2H32H 5DJ8A 5F1IB 1RUAL 2J5LB 4Q6IB 3FHQA 5IMMB 1G7IB 1S78C 3C6SB 3RWJA 1KENL 3SJVA 2P5WE 1DSFH 1TIUA 2DB8A 2BSSB 4JFDD 4R4NC 4MNHB 3VJ6B 1H3WM 2IBZX 4OGAD 1GOGA 1VHPA 5BV7B 5ICYB 3IKCB 1QHOA 3QZWG 4HV8B 5GS0H 4PYHA 3PGFL 3A6CL 1BIIA 1F6AB 4F58L 4YFLI 1ZT4A 2X7LA 2EE2A 3AVEA 2F74B 1ADQA 1JWMB 1QR1B 5DD3H 4IJ3B 1VCAA 4HIIB 4JCLA 5HHOE 5JHDA 4YEEA 3BPCA 5HDQH 4X4XA 1G0XA 2W60A 3RKDC 2HVKA 2LAAA 2X70A 3MBEC 3QUXA 4QOKA 4ESKA 5KSUB 4G6AD 1YMHB 3VXQA 2XTLA 1QO3B 3BKMH 4ODXB 3TVMA 3HMWH 4OCSL 1D5MB 4LP4A 1F6FB 2DDQL 4I5BA 4LRNH 5C70A 1CE1H 1U9KA 4M43H 3I6KB 1FLTX 5DWUL 3WFBH 4Y89A 2DBLL 1FFPA 4UT9H 5CEZL 2GJ6E 4NIKB 4YC2B 4Y88A 5JUEH 3QCUL 1FNLA 1WWCA 1A6UH 1EEYA 1SEQH 3QQ3A 5DHYB 1AKJA 4EQ3A 1AO7B 1R3HB 3PABB 4HPOL 2NY1D 3B43A 2R1WB 3UTQB 4MMXC 4U6XA 4FQIL 4KDTC 2PF6A 2H32A 4LF3A 4NQSA 1E6JH 5EBMA 5AZEH 2IFFH 1BFVH 2FECI 4KWUA 2EE6A 3WIIL 4I18C 1TCRA 1ZOXA 2RQ8A 5MERA 2FO4B 4M5ZH 4QHNA 5ALBL 2ZOLA 5MP6H 4M61B 1A7PL 3IDGB 2CXKA 4ZOAA 4EVNA 1GGYA 1UJTA 1T1ZB 4IDLA 1KUMA 3T1FB 2NR6D 4WFED 3DUUA 4P5TA 2CLVB 4NNYA 4X8JA 4M5YH 5EZOL 5I8KL 2IAND 5C0BE 1U8NB 5CEXB 3SO3B 5EIQA 3LQZA 1MJUH 4GRWH 3ZKXC 2RFXA 4HC1L 2D7MA 4O2EA 5EU6B 4H5SB 1SBSL 3UTSA 2CQVA 3V8OA 5ANMA 2YRLA 2X4PB 3O8XB 2NY6C 4PJ5E 2G2RA 1QFUL 3FKUS 4P23C 2PETA 3IDIA 3ZE1E 2R4SH 3O41A 2QQLH 2VR4A 2E7LA 1KXVC 5DRXB 4JHAH 1JE6A 5I15H 4KC3B 5E8OB 5GGTL 4OCLC 4XNYL 1J0IA 1RURL 1ORSB 2HG5B 4QT5A 4NC1E 1JZ7A 3D0VB 4G9DA 1BD2A 4LCIL 3RHWK 4JRXA 4DUVA 2AQ2A 4BJLA 1JV5A 1MWAL 5C07E 3C5SB 4R90H 1A7OH 2GW5A 2XWBA 1B0WA 3GO1L 1MH5B 3SE8H 1TJHL 1BJ1J 1S5IL 2EC8A 3PF2A 4M3KB 1A7BA 2VLMD 2IPUK 4Q7DA 4QYOB 1IKFL 3QHZH 1UWEH 5IKCB 4ODSH 1KCVL 2EDTA 3DJ9A 1T89A 3NTCH 4GBXA 4WY7L 3GMPB 2HJLB 3PWLB 2KPNA 4DEPB 2ZPKL 1S9VB 3VXRA 2Z31A 5DQJB 3SDAC 2Y06H 4NO5A 3V4PH 1U6AH 4U0QB 5DRWB 1OAXH 1TMCB 1ZANH 4HFUL 3U36A 5KANG 2DI8A 4J3SA 1KNOA 4FZ8H 4Z7UB 3V7AE 4OUOA 3QULB 1P7HL 3C08L 4U1IB 3VFSB 3MO1A 4NO3B 4KJYB 1JYWA 5IQ7L 1NFDE 3U7WH 5ACLA 4JY4A 1NCNA 3CGTA 3N1QC 5L2JB 2VDML 3T3MF 3MLVL 1YJDH 2MQ3A 3B6SA 4OZ4B 1CGYA 5FO8B 3P4NB 3QH3B 1A6WL 4NM8H 2JK5A 3OMZA 4ZTPH 1VGKA 2CUHA 5FAAA 3AS0A 3TBWB 4FXGB 4CL7A 2BNUA 1KELL 1BEYH 1PY9A 4KK9D 5MENB 4RFEA 3O4LD 4Z7WF 3OAYH 2VYRE 4WJ5B 5HYQA 4ISVB 3WDHA 3B83A 1I8LA 1UKQA 3F7RA 4Q9QH 25C8H 2BNQA 2QQQA 4QNPE 2EE3A 4AG4L 4XPHL 1LO2H 1T04B 4Z7QE 3HUJE 3IJHA 4GG8A 4F57L 4GKSA 1KT2B 2WBJD 4Z0XA 4BZ2H 1AGFB 5D1QB 1I85A 4HPYL 2Z93A 1Z9LA 1HHJA 1MI5A 4LOUC 3LS5H 5GRZA 3Q5OA 3GFUA 3CFCL 4JGJA 3BFOA 2P5EB 5KVGH 4OFIA 4XNUH 2EKJA 4Q6YA 3W5NA 4U1KB 2R0LH 2J88L 3QJHA 1I7ZB 2EO9A 4MJIE 5ELIA 1ZS8B 3EOAB 3KVQA 1QSFE 1RZ8A 1IM9A 1G6RB 3OAUH 3C60B 4L8BB 3X13A 3O4LB 2ERJB 2V6HA 3OKKB 4C54A 3LKSB 4ZUWA 3FQRB 1ZA6B 4XX1E 5GSVA 1CIUA 3LRHA 3CX2A 2GCYA 2R1YA 2ED7A 3BRFA 4MA3B 1RZ7L 4XPBL 1ZE3C 1CD1B 1JF1A 5IQ9A 2AVGA 5I2IB 4R2GC 1T83C 1UM4H 3TEUA 4WGVB 5I1IL 1NCCL 3S4SG 3S88L 3F7PC 3SHSA 3UYPA 5FUZL 1F3JB 3KPLB 2VAAA 2WBJB 2OS7A 5A16A 3UTPD 4D9LH 3WFEH 2GHWB 5I1CL 4I1NB 4OZGB 1MCLA 1CTNA 1IC5H 3PJSA 5F6IC 4JLRA 2V5SA 2DICA 1P4LB 2EXWC 1BZQK 3WJJA 2QHLA 1LDPL 1FO0H 3BRDA 5FUCE 1FFRA 4PJAA 2B7DT 3SPVA 4LSRH 2ZZUT 1I9EA 2CKBH 4R0LB 4LVNB 2PW2B 2X4TB 1A9BB 2XQYG 4GQPH 1MFEH 2B1HL 3O6FC 3GI8L 4O02L 4WO4D 2VKWA 1NMAL 1TCMA 5IMOA 2HLAB 4GG6A 3CUPA 3RRQA 2BRQA 1WISA 1I1YA 2ICEB 3TCXA 5ALCL 1YA5A 4NYLB 1VEOA 1XEDA 3SKMB 2VRAA 3T77A 1J5OL 1QPXA 4XP4H 1A3LH 5CJOL 4WRLA 1OTUC 1U8HB 4AEIH 4PREB 3QO0A 3D5OF 1T66C 4S10A 3UTTA 1D5IL 1RZJC 2YA2A 4DVBB 1QSZA 4AIZB 2X4UB 3P11H 1T7YA 2VXQL 1ONQA 1KSRA 1OQOA 1ZT1A 4HT1H 4Z77A 3QSKB 1R3IL 1CLYL 4Y4KC 2YKLL 3KPPA 4JO3L 3T3PF 4PJBB 1HXYA 2B0SL 4TSBH 4JFHE 4WO4B 1YC7A 1IAIM 3PV7A 3A6OA 4Y5VA 4RGMB 2AK4D 3NVQA 5EU7C 4MCZA 4PR5A 4HUVB 2HVJB 4XMKH 5HI3D 1IAIL 3U79A 4HWBL 4OCSH 1FSKC 3OX8A 4L3EE 3CLFH 2BOCB 4KMLB 2JJTA 2G9HB 3KJ4B 4NO0D 3IT8D 1W0YT 1T0NB 4TSAL 5DS8B 1GC1C 3U1SH 4ELME 3WFHA 1V3KA 5CEZH 4MMZC 3CZFB 1FO0A 5C0NC 4WDIA 3GJFA 3QCUH 4ELKB 3I02A 3ARDA 5L2KD 1B0GB 2DQFA 3BHBB 3VW3L 4PRHA 2CKBA 2GIYA 3TPUB 2X4OA 4EN3C 2EXYC 1ZVHA 3AAZA 1FGNH 4FFYL 4UIMA 2A9MH 4FQIH 4XCEB 1JNNL 2Y6SD 5IMKA 4U3HA 5BO1L 4PGCA 5L9DL 4NQDB 3GMNA 4WHDA 5BRZA 3GUTB 1ZV5A 4HK3N 3WYRA 1DEEB 3QNZA 2IJ0C 2VXUH 1KN4L 1ZHKA 5ALBH 3SEPA 2W9DL 2ZKHL 1A7PH 1AHWA 3IDNA 3IS0X 3SDCC 3FMGL 3Q1SL 1Z9OA 3UDWA 4Y7MA 1WC7B 3OB0K 1F6LL 4LKXA 1XGYL 3BIBX 4KGJA 4NQVA 5I18L 3V5KA 35C8L 4S1QL 3BH8A 4N1HB 3UJJH 2J8UE 3O3BB 5L2KB 2IBZY 4KRMB 4HC1H 1AD9B 4YFDB 1ZLUH 4JM4H 3ZYOA 1F4WL 4JCMA 4HKJB 4W4NA 3H6JA 5DYOB 4HIEB 2Q6WA 1SBSH 3K4AA 3KPNA 4YXHL 3ZT7A 4WU7A 5HD8C 3PWPD 1QFUH 1NANH 2YBRA 3ZE2F 5CEZE 5KSAA 4KI5D 4GJTB 3U0TA 3OGOE 4YR6A 4ZD3L 5DQDL 3GNMH 5IBUB 1J1XL 2KZWA 2XQBL 4MZ3A 4G7YH 4F37K 5FEBA 4LCCC 4HLJA 4TUOB 1NGQL 4G6FD 1PQZA 3FO2B 3V5HB 4P3CL 2RB8A 1MWAH 3ME0A 5GRUL 5CSGA 3ZE0F 1NANI 4K07A 4OV6F 5B39G 4UTBL 1G7HB 3UO1H 3GSOA 2A0LC 3KPRE 1KC5L 2OP4H 2XIDA 4X7FC 3BIKB 3EDJA 3HZKB 3TGXA 4PJ8B 4CGTA 4QWWC 4GKNA 5HYSG 3JV5A 4QTIL 1TJHH 5DK0B 5TQ2H 5B38A 4MNQD 5DQ9B 3FN9A 4MD0A 4Y2DD 5AD0B 2W38A 3AROA 1IKFH 3R06B 2YN3A 3F58L 5I6XC 4FQXC 4QHMB 3QJFB 2VWEE 5CBEA 1ZHBB 1KCVH 4OD3H 3UPAA 5LQBH 1VFUA 2ZPKH 2APBA 4KVNH 1T1YB 5SX5H 5J9PB 3PWPB 2PN5A 4F2MB 3BQUA 3RDTB 3O2VL 3LKRA 3P77B 1P5VA 1H5BC 4OD2A 1JZ8A 3C08H 1FAIH 1ZMYA 3F7YA 3ZYZA 1JHTB 1C08B 1UA6L 3MRPA 2GTWA 5FHBH 4UDUA 4A6YA 1KEGH 3WD5H 4G6FB 5D7JB 2VDMH 5D8JL 4K23L 4LGRB 4HC1A 4JO2H 5HPMB 4UNTA 3IS1X 1A6WH 1FBIL 2P24B 3SQBA 4D9RE 2Z0BA 4P9ML 1Q9KB 4BH7A 1H3TA 3BGMA 4IS6B 3BDYH 5FGBC 1KELH 4HX1A 2G5RA 3WFDL 4OIIL 4PJIB 1BAFH 3IYLW 1VADB 4HJGB 3DX6B 4XRCB 1INQB 2VAJA 4QXWA 1IVLA 4LCUA 2J4WH 3IFLL 1CT8B 1XZ0B 4LRIC 5F1SA 3WFZA 1MWAA 1MPAH 4PJGF 1FCGA 3O3DB 7FABL 4LU5H 5CBAA 2QKIA 1FQ9C 1MAMH 1CF8H 4J2XA 4F57H 1HIMH 4Y4FB 1U91A 4IEFB 4N5ED 3BZ4B 2AQ3A 2XQYK 2DMCA 2JCCB 3EO1B 2QTEA 2FZ3A 3NIGE 1RJLB 5IV2A 3CFCH 3BT2L 4EI6B 5L88L 1KTLB 3ZTNH 3QFJB 4HS6A 1J18A 1WV7T 4G80A 2J88H 4LCWD 2EIDA 4UDTA 4EZMA 1N4XH 1C8PA 2BVPA 1F5WA 3WS3B 4CMMA 3VXMB 3T65B 1IGFL 1NGZB 1I3RB 4Q74A 2W1NA 4HIHA 1OTTC 3QXUA 4GAJL 5F96L 5HSFA 1BJ1H 1N7MH 3HB3C 3MV7A 4YBHA 2B4CC 4HKZB 1DBKH 5BZDA 2F8XC 1NCCH 3S88H 1WTLA 1AXTH 3MBEA 1KIPA 3MRCB 5GZND 4HK0B 1LEKA 3P9MA 3SDDC 2Y5TB 3LEXA 4C56B 4NN5C 4BH8B 1B2WH 2OTWB 4APQD 4RAVB 1Q9LA 2C3HA 5DK2A 3TO4C 4LCWB 4IMKC 5FM5O 4Z7WA 3MRIA 2K9UA 1AXSA 4KHXH 2MKLC 4LAQL 2DL9A 1MFDH 5L7XH 4HZLB 3H9YA 3OHXB 5EUOB 2B1HH 4O02H 2UZIL 5DZOA 1AGDB 2PW1B 2F54B 1G7JB 4UTAL 3K1KC 5KSBE 1PJ9A 2HH0H 1RUMH 4OLZL 3WKMH 3KPMB 1I9IL 4KDTA 2WAHA 3UBXG 3PL6C 5CLWA 4F7EB 1JNJA 1QVOB 2HA1A 5FCUL 5B21A 1J5OH 2CXGA 5CJOH 3QUYA 4YHMH 4P57B 4I18A 5E6ZA 5CJXA 4Z7VE 2CMRL 1JNHA 1Q0YH 2X1WL 3QDME 4I0PB 4ONFL 2Y36H 4G42B 5DD0H 3IDYB 1D5IH 1OOAA 2R0KL 5EZIL 4LLVB 3LN4A 1MLBB 3TFKD 4CN6A 2AV7B 5GSRA 2MPAH 3EKCA 2A83A 2Y07L 2VXQH 4NBZB 5EG6C 1A47A 5IVZA 5DO2C 4GAGL 1A3QA 5C3LD 1GVIA 4X5XA 1UQSB 5EOCL 1J0JA 1CLYH 2JTDA 4PJFB 1MIMH 5F3BA 2R1XB 4LPTA 3C8HA 2B0SH 4CBPA 4CU7A 1GPOL 4G8GB 4QRTA 3V95A 2EDQA 3DXAE 5JLZB 1JBJA 1J9CT 5EOQL 5JDJA 1OPGL 4LFHD 3CFDB 4OCWL 4LPCA 1RK1B 1IAIH 2Q1EA 4AMKH 4TTGA 2IBGA 1LNUA 4BQ9A 1MIEL 4DGIL 3REWA 1QA9B 4TSAH 4XZUA 5ITBH 1KULA 2EDXA 4XNXL 5FOJA 2DTML 3O0RL 2YSSA 4LSPH 5TH2B 3T0XA 3WO3B 1EHNA 5I1KL 4FQJL 5J3HD 1KPRA 3KS0J 2BC4B 2H2SC 2R9HC 4WHCA 5E1AB 1QSEE 1IAII 3FT2B 4L1DA 3L6FA 4XPFH 3RZCD 3X3GH 1RUPH 5IFJA 4MX7B 1IBGL 1W0VB 1OT2A 3C5ZC 3BKYL 2VDNL 2XA8H 3T0WA 2NY7H 1GGTA 5BO1H 2F8VA 5DZNA 5L9DH 5A40E 2GITB 3MLTB 3CXDH 4JE4B 5FGCE 1KJ2H 3O45B 4GQ9H 3D39A 4JANB 5F1OB 4OZIE 3N85H 1KN4H 2W9DH 3MRKB 1I8IA 3SDAA 3Q1SH 4ZFZB 1NCWL 3F7QA 4OZIA 5SWSE 3HPJA 1TITA 5F3HA 4UV7L 5JO5A 4S1QH 2WWMC 3ARGD 2OR9H 1U3HB 4LSQL 3PE9A 2WBKA 3D25B 4L3CB 3EFFB 1LMKA 4K8RL 1N2RA 1VFAA 3RZCB 1YYML 4YXHH 15C8L 2ARJA 4XCYB 4BFBD 2AW2A 3HI1B 5TGBA 4MCYB 3TESA 3DX7B 2N4IA 5I8OL 4KROB 1MFCH 2N7AA 5ESAA 1INDL 2CDEB 1J1XH 2OSLA 2XQBH 3QCTH 3AREC 5CFHA 4K71C 1BX2A 5D70H 1IM3B 2VLRA 1FG2A 2AJXH 1W2KT 5J1AA 5TDPB 2R2CA 1IC7L 3N9GL 1UM6H 4ZO6A 4UTBH 2VXVH 1MCWM 1MFAH 1KC5H 1XF5A 3ARSA 3VFMA 5TE7L 1I7UB 3SDYL 3ARTA 5K9OB 5I73C 4PJHE 4JDVA 3CIQA 1DP0A 3CFIC 4RMTA 4E42B 3PDOA 2R2EB 4P9HC 3H9SB 1KCKA 3MV9D 3HZMB 3V6BR 4JPIA 1MVUB 2WANA 1NUDA 4WI3A 5EIVA 1XGUA 3QIBD 1KJ2A 2HJKB 2NY4D 4NZJA 3FQWA 3A67L 3P0YH 4R7NA 5T3XD 5C0CA 4X7EC 5EN2A 5D93C 1CLOH 2MHAA 3F8UB 1CXIA 4F9LC 1DDHB 4TPRH 5EA0L 4LLUB 3BSZH 1I8KA 1LHZA 3C8DA 4JFED 1RZJH 1UA6H 2OL3L 5GJSH 3IGAB 1FZJA 2VL5A 4K23H 4OCXL 5HHNA 5GGUA 2ED9A 3IETA 4KRPD 4DZBA 5F9DC 5K9JL 1NMCB 1T80A 4WWKB 4AT6B 1A6ZB 1P7KA 1JN6B 5FM8A 5SX4H 4H1LG 5E6YA 2R56L 2DQIL 2PTTA 2Y7QA 1T83A 2R0WL 1FNEA 3QUKB 5E2WL 4BQBA 3QNYA 3KYNB 4ZUVA 3WFDH 4OIIH 4MD5A 1OARL 1MNUH 4YPJA 4ERSL 3MCG1 2OI9C 4N0CD 2A74A 2RR3A 1T03H 3I85A 4PJXB 1LO0L 5E94A 5DEGB 3L5WB 2ADJB 3IFLH 5SX4I 3QXTA 1U3ZA 2YUXA 3SCMB 5T1KB 1YECL 1U95B 2DQTL 2XXMB 2H2PC 3RVUD 1JPSH 4CMHC 4IRSD 2QHRH 2FX8H 1N0LA 5LBSH 1HHHB 1UZ6F 5IW1A 3L9RB 4ZUSA 3BUYB 3O6FA 5IFHH 4S1DD 4XWOD 4R4BA 3ARFC 4IRJA 4P2RA 5IHBA 2QADC 4U05A 1CICC 3UC0L 4H8WL 5FKAB 2IF7A 2DD8H 2YPKB 2VXSL 1NKRA 5CHNA 2BVQA 3BT2H 5L88H 3VFPB 1JVKA 3QDAA 2AXGB 1JGLL 1CE6A 6FABL 5HY9B 4UQ2B 4DGVH 3KYMA 4S1RL 5T1DH 4KZDH 1TETL 2CGRL 4DGYH 3CLEL 1D9KC 5M7QA 1R3JA 2WUCH 5CS7A 1FVDA 1XF1A 3OZ9L 1JUFB 5J56B 2R8SL 3JV0A 3UJTL 3TH4T 1IGFH 3D3VD 3U7YL 2DJUA 2VN7A 5HHVL 4H26B 1IQDB 2AABL 1NGYA 4L3AA 3N06B 5D4QA 3ZMRA 5HHMD 4Y5YB 3MJ7B 2X4RB 2XRAH 3FQNA 1NGXA 4OLYL 4Y4KA 4XI5D 1BWMA 1UYWL 4KKLC 3T09A 1L9NA 1U8QA 1TZIA 1A4KB 2MSPA 4IDJL 3OGCA 3VG0H 3VXUB 5FOBB 2C3WA 4JAMB 2M1KA 3V0VA 3QIUC 4I2XA 4LDOB 4L9LC 2HFFA 2IMMA 4O4YH 3HLAA 1AC0A 1MHHB 2X40A 2D9QB 2NX5B 4FA8A 4CVXB 1UJ3C 2C4FT 3E6FA 4OAWB 2FH6A 5GS2D 5L6YL 4M00A 4Y16B 1EK3A 3UYOD 3QUZC 3ILQC 4LAQH 1A6PA 3O2WL 1Z3GL 3NCCB 5JPNA 3K0WA 4JFPA 3GB7B 4YHKL 5D71H 5E9DB 4XWGL 5HDBE 4X99B 4GS7C 2R29L 4F9PC 4XMLL 1A7QL 4PJGA 1ES0B 4EN3A 1DVFC 3T2PA 4MXVE 3V2AR 3VI3F 3RVXD 3FO9A 3C09B 4BK5A 1YN6B 4OLZH 4QHUB 3RVVC 1I9IH 2LTQB 3MV8D 1QRND 4GXUM 4NT6B 4LVHB 3E2HC 3JUZA 4ZSOB 1V5JA 5FCUH 4KJPD 5ETUA 1MCCA 2CJUH 2J8HA 4PP1D 2SEBA 5ID0A 2YRZA 5IGXL 2C7UB 3L3JB 5DJZA 1KTKE 4ONFH 3ARUA 5DRNA 1FYHB 3NA4A 2NCMA 5CCKH 3MODH 3HE7C 3SDCA 5IESH 5HHXH 4ZDHA 1FLRH 1NC4B 1OF2A 2Y07H 1R0AH 4DOHB 1QP1A 3MRQB 3G9AB 4TTDD 4DN4L 1UADC 2DQGL 1T0MB 2GQHA 5GGRA 3RHWF 1A5FL 1ITCA 1WLHA 1KTDA 1J1OL 4QXGH 5FDWB 1BZ7B 3EOTL 1GH7A 2O5ZL 1SEBA 3AXLB 2W65A 3GSWB 4GRLC 5EOQH 3KLSA 4W6WB 3O81A 2LABA 4WHYH 5DMGC 4UT7L 3GMOB 4XMPH 4Y1AE 1IZKA 3JV4A 2BXYA 5DI8B 3DVNA 3KPSB 1NL0H 4XVJH 4XNXH 2DQCL 2Y5EA 3O0RH 3HE6D 5I1KH 4FQJH 1NLDH 1FG9C 2EH8L 2QQNL 3T4AA 2BFVH 3TF7C 4M6ML 3V6OA 1PKQE 5A3IC 4Y4HD 4EI5C 1WAAF 2ZUWA 5IT2L 1JI1A 3RX8A 4UNVA 1A64A 1FE8H 5LCVH 3U4EB 4ZQKB 2NY5L 3DX8A 3PWNA 1X5JA 1LILA 4FQ1H 3S96A 4ACPA 4PRAB 5C0JA 3IU3A 4FQXA 4J1UA 3QEUB 5F44A 1OGTA 3MJ8B 5IEHB 4YHPB 1UWXH 4JZNA 4AQ1B 2BMKA 4PYGA 3OKDB 4XGZA 3KWWB 5JXED 4OF6A 2EEBA 3GSUA 2NY2D 4YO0B 2D7TH 5I1LB 2HFGH 1G1CA 4UV7H 2Y23A 4URTB 4MA8H 4JN2B 5TF0A 4RBPK 2GSGA 4CJ0A 3U9PL 4K8RH 5IEKA 4MXWH 3SDXB 1IL1A 1GAFL 4F8QA 4Z5RA 1YYMH 4RQQA 3QEQA 3ZKMC 4HWNA 5DMJB 2YEZB 4HGWB 2EYTB 4BFIB 5DJYB 5I8EB 3K8MA 1MHEA 4AM0A 3MGOB 2B4CH 5LAXA 2XWTA 3UAJC 5I8OH 4X0KB 1INDH 5DSCA 3QEGL 2DS4A 3RGVD 3OR6B 3BPOC 3TBTB 3TCLB 1S9YA 1S7VA 1P6AB 4PY8J 2O5XL 4OLXL 3X17A 3LS4H 2XA3A 1IC7H 2J12B 3FQTB 1EZVY 3BPLC 4PJCF 1EXUA 4OD1H 1JI2A 5DFWH 1AQDB 5BS0E 1ZHLB 4G9FD 4Y5XA 5IIEB 3EJYD 2D3VA 2NY2B 5TE7H 5IB3B 5A2LH 1EEZB 5FYKD 1JGUH 2HN7A 1HOCB 4JFDE 3S9DB 5E5UB 5BS0A 3HC4L 5J6HA 2XWJA 1T3FB 5DHVB 4QRSA 1WZ1L 2YK1L 4ZTOH 5MHSD 2DYPB 3CJJA 1LEGA 1XGQB 4CUCA 4GXUN 4NP4L 4LEOA 4M9OA 2Y9RT 3G04B 2Q76B 4NFCA 4F8TA 3FB7A 2ZCLL 3KS0H 5EA0H 3WHXB 3HG1A 4V2BA 3RGVB 4DCQA 5I1AA 2AEPH 1DQJA 3IU4H 1A9EB 5ID1A 1FYTB 1S7WB 1YEKL 2ZNXA 1CI5A 2CR6A 4GMSL 5IHLB 1HXMB 5MI0C 4AZ8A 4WCYL 3HPLB 5AUMB 1MQ8A 4EDXB 2V2XB 1ZGLB 3BPNC 4OCXH 1JMXA 1IEBA 2DLFL 4FQQA 4ZAKB 1EAJA 4MQXC 4QXTB 1OCWH 1U93B 4WUUD 2OM5A 1I1FB 4ZUTB 1DQML 2FEDC 3RY5A 4YXKL 1HCFX 5CGTA 5IM7B 4AK1A 2DQIH 2OR7A 4RZCA 1HINL 1OAYL 3CX5K 5E2WH 2YD2A 4NZTH 1HH6B 3U0PA 1TENA 4XB8A 4JQIH 1XR8B 4OB5H 4OGYH 1OARH 3QXAA 4ERSH 3MLWH 1EVUA 4DUWA 2CUMA 4Z78A 3R1GL 3RY4A 4P2QD 4M7ZB 3SDDA 4GMTH 1DEDA 1U8PB 1JGDB 5FK9B 4WU5A 2JJUA 1K5NA 1YECH 3TO4A 2K1MA 43C9A 4KK5D 4BZ1L 4O00A 1N0XL 2ESVD 4HUUB 3FL7A 4YDIH 4X6CB 1WBZA 4X7TA 5HJ3A 4PGBB 2Y72A 4NKOA 4WFEE 5K93A 4H8WH 1Q72L 2X89D 4CAGA 2VXSH 3BXNA 4HULB 4Z0BL 1CK0L 2IANE 4NCDA 3C5JB 3QWQB 5IVXE 3DV4A 2Y1VA 6FABH 3QDJE 1RZFL 3PL6A 4GXVL 1K4DB 3CC5B 4BSWB 5E8EB 4S1RH 4XPGL 1X5YA 1HHGB 1Z9MA 3BZEB 1K4CB 3BEVA 4QHLA 2E7HA 4JKMA 2CGRH 3T0BA 1WGOA 1LD9B 3B9EA 5IOPB 3OZ9H 4IHOB 3NH7L 4J3TA 4AH2B 5D7IF 4QHKI 2R8SH 2IQ9H 3UJTH 3UJIL 1D5XA 3DWTA 4F15C 1K2DA 4MB3A 2DKMA 4MQ7A 4U6YB 1KCUH 2VL4A 3CFJB 2PYFB 4K7FA 2AABH 3RNQA 5KVDL 3DECA 2OTUB 3LKPA 4K94L 4U1JB 3T0EA 3B9KA 4NFBA 3QUMH 5D5MF 2A9NL 3S35X 4OLYH 1ROWA 2ESVB 1KLUB 1GGIL 5F9JB 4KPHL 3MNVA 1BLNA 5J13C 3ARBD 1MAJA 2FJGB 5KVEL 3KJ6H 3P3YA 4JFFA 3KLHC 3M17A 3VDBA 1OQXA 4OCYL 3OJ2C 5DVNA 3RVTD 3FT3B 5H35B 4ENEC 1I1AB 1U8JA 1S7QB 4HXAL 3D9AL 3QHFL 3DGCR 3MCLL 1TQCB 1AY1L 2VLME 3D2UB 4JPWH 4KV5E 5E8NB 3R0NA 3SKOA 4LLMB 3Q5TA 1K8IB 5EPMA 3BP5B 2DOCA 3B3IB 1BVLB 1Z3GH 3O2DL 4YHKH 1ED3B 1S7TB 4YDKL 3RWHB 2MTPA 1LK2B 2R29H 2VZOA 3KDMA 1A7QH 3O3AB 5F7DB 4M62H 1SY6L 4FXKB 4RA0C 3IVKB 1MCQA 1VEPA 2PXYD 2FSEA 3G5ZB 5D7SL 4U1MB 1T22A 3ECBB 3G5XB 2KKQA 3OXSA 2H3NB 5KTEL 3G5YA 3IFPA 4JFQA 3MRMB 3ARBB 1R3KB 1S7RB 5DUPH 4XBGB 3BOVA 3QA3A 1J8KA 4XP6L 5DJ6A 1J1PL 1BQSA 2ICWB 2BRRL 1IAOB 1QYGL 2C1PB 4F37F 5BXFB 4HH8A 4EUPH 3V4UH 3MV11 3O4LE 2DQGH 3O11A 1XGTB 1A5FH 2VITB 4M93C 1FNGB 3QQ4B 3QUMA 3IRZA 3UP1A 3QIWC 4NNXA 1JTOA 3EOTH 4Y19A 4RGOH 4WGWB 3RL1A 3I6LD 4V1DE 3U4AA 4NUJB 3I6GB 1HDMB 2YPVL 4FXLA 4LHUG 1CDCA 3DO7B 4V1DA 1FORH 32C2B 4EEEA 4PLJC 4E41B 3M07A 4XNZC 3MCKB 4WI8A 2XZAL 4JR9H 2B2XL 1M05B 3OG6B 3AREA 4MWFA 4CRPA 3KHOA 3QEHA 4HH9B 3LHPL 3ZZ1A 4D0BB 2EH8H 2OMBA 3SJVD 5EZJB 5DTFB 4JRYB 2ZSVB 2YXMA 1BIHA 3IFNL 1YNKL 3BJLA 4PRNA 5C92A 4FP8L 1EHLL 3BP6A 2NY0D 5CLTA 2EDJA 2P7TB 1UVQA 1YPZF 4LSTL 3CFKB 4X98B 4PGEA 1R5IA 3EGSB 3F65A 4FMKA 4XH2B 4MA7L 5SWZB 3WO4C 5IWLA 4HGMA 2DMBA 3GSVA 5JHDD 3GIVB 1RY7B 5CILH 1CR9L 1XIWB 4J4PC 2GYSA 3THML 3QUXD 4QOKD 5KSVA 3RAJL 1MCRA 5J89A 5HGDA 3TVMD 1MCJA 2IPTL 4YWGL 1A1OA 1ORQB 2YD5A 1YQVH 2Z35B 4JPKL 3ZKND 1G9NL 2VC2L 1K9TA 3UTPE 3ULVD 4X6DE 4MAYB 4WTZA 3WJLC 3HAEH 2GKIA 4EUPA 2HP4A 3DV6A 1EV2E 3RWJB 2UWEB 1J05B 1LO4H 3SJVB 1CGUA 1P1ZB 3CMOH 4MS8D 3EO9L 3U9PH 5I16A 2BVOB 4DN3H 2IEPA 1AKJD 1GAFH 3BE1L 1NH6A 2NY0B 3B2VH 2P5WB 5B38G 5J11C 1S5HB 1G9EA 1BFSA 4P4RB 2ZG3A 4DTGH 5GGSA 3S36X 1ZT4B 4OJFL 5C0FB 2APTA 2X7LB 4P4KB 1I7TA 3MA9H 4KGLA 1IEHA 1DLHB 4KUCD 1HK6A 5JHDB 4ZFOL 3BPCB 4OLXH 1HSBB 4XXCC 4WNQB 3V4VL 4QOKB 5EU5B 1E4WL 3VRJB 2N7BA 5HHOB 4I48B 2GJZB 3TVMB 4JM2C 1OP5K 1OW0C 3FZUD 5F7MC 4P5TD 4P2OC 2BSRB 2E9BA 3RPIA 5GS0D 3HC4H 1M7DB 4N0YL 3QI9D 2A6KA 5DA0B 1WAAA 1UM5L 2WM0A 3MRFA 4JO1H 3QQ3B 5L0QC 3ARFA 5DJ2B 4RGND 1AE6L 2VISA 2ZG2A 1CICA 1U8KB 2ATKA 2GJ6B 1CFSA 3OKOB 5F88B 4NFDA 4TSCL 1MJ7H 3A0OA 5FF6A 2J5LC 4Q6IC 5EORH 3OKLA 5BW7C 2BHZA 1IAKA 3I3BA 4LF3B 4QRPE 1UKSA 2AK4E 3LRSA 3TN0B 2EDYA 4HGKC 5DMIL 3EJZD 4H88H 3HAEA 5I6XB 5IK3B 3CCHB 4F33B 3MLUH 1T6VN 1YDPA 4WCYH 3OAYK 3CDGA 3DUHA 4P5KA 3VXPA 5MERB 1RULH 1JK8A 4LVOB 2JF1A 4QHNB 1BD2D 2UVFA 4JRXD 2DLFH 5F9WB 2ZOLB 5JOFB 1EDQA 3BWAB 4EJ1C 4OQTL 1QPPA 5BV7C 1CXHA 3SQOH 3DUSA 3MRJB 5T5NG 3MLZL 4FZEL 4X8JB 3GMQA 1CFVH 1OAYH 4U33A 3WL9A 2V2TA 3HCVA 5HYFA 4IJ3C 3NABL 3QI9B 3VXTB 2RFXB 3B5GA 5I9QC 5C0BB 2R2BB 2FD6L 4GBXD 3QIUA 4C55A 3MLXL 4L9LA 3GK8L 4KKAD 2XKUA 1EO5A 4PPTA 2GT9A 3OTTA 2Z31D 1QKZL 3SOBH 2NXZD 1UJ3A 4TVSa 1KPUB 3FB8A 5TDOA 3FFCA 3QUZA 3B9AA 4X7DC 5FO9A 3MGTA 4OLEA 4PJCA 2R4RH 2JJVA 4PJ5B 1SYSA 1CN4A 4MGXA 2AQ1A 5JNYB 4NM4H 4G9DB 1N6VA 5T3XL 2I27N 4PJDE 4MYWB 4PV8A 5FECB 3H3KA 1DVFA 2AJUL 2XZZA 3DBXA 5D6CB 1CBVL 1CK0H 1FVCB 1S8DA 1U8IB 1FL5A 3LN5A 4ZNEA 3ROOB 1LE5B 3O9WB 1NFKA 3RUGF 1RZFH 1WT5C 4M1GL 4HZAA 4XPGH 2KL6A 3LV3B 3PIQA 5C07B 5D7LA 3QZWA 3N0PB 4Z7NF 1BBJB 2BX5A 4ZUUA 2DF3A 3MZGB 4QLRA 1DFBL 3PWPE 1V7NH 3KPQB 3SKNA 3UJIH 1TZGL 4L4VA 1DR9A 4KI5E 4G6AC 1CG9B 3EUUA 4P59H 4GKOA 1DLFL 4X5WB 4XCCH 2E8ZA 5KVDH 2ADIB 2BNQD 4K94H 4PY8I 1G7PB 3SE9H 4NRZA 1F4XL 3L1OH 4CW1B 4WUKL 5EO9A 4L4TA 2HWZL 3O3EB 1U3JA 3BN3B 3U36B 3GJFK 1GGIH 4XXDB 1UEMA 3W9DB 4KPHH 4YE4H 2GAZA 2VE6B 4QGYA 5KVEH 3SO3C 1AI1L 2D7QA 1LO3L 2I9TA 1EIBA 2ID5A 4GRLA 4JY4B 5D1ZD 4YHZL 1YMMA 5B3JF 4OCYH 5E7FA 5CKAA 5ECJE 1MI5D 3B6SB 3D9AH 3QHFH 4HXAH 4NRXA 4U31A 1NFDB 4MNQE 3SO5A 1AY1H 2FX9H 3P4MB 1T0PB 4N0UA 1DQTA 3O8XC 5C8JA 2JK5B 1VGKB 4K7PL 2H9GA 5B8CC 3AY4C 2XNAA 4JVUA 1PG7W 1FJ1A 2D03L 1P84J 1N5AA 3O2DH 2BNUB 1CU4H 1IM9D 4R97B 4B41A 4D0CB 5K9KA 2JJWA 4YDKH 4LLWA 4HFWA 3BIAX 2AJZB 5D1XB 4MJID 1QFWH 5I0ZA 5CIPH 5MEPB 5HYQB 1CWVA 1MCEA 4EI5A 3R8BB 2MOVA 2VLJA 1CCZA 5D7SH 1NCBH 1OM3H 3H9HA 1DBBL 3OB0H 3DURA 2CKNA 4FOMA 4WW1A 4AL8L 5JTWA 4QCIA 2H26B 3E8UL 1E27A 2AEWA 4KKNA 1KIUA 2DQEH 1IKNC 1OSPH 2LU3A 4XTRC 4X6BB 5D1ZB 4UU9A 1J1PH 3QWRA 4E9LA 2VDQL 1RZIB 2BRRH 1EH9A 4KDWA 4DEPC 3HUJB 5DUMH 3NCMA 2AJVH 3EYFB 1DBML 4QKXB 3QJHB 1TJGL 2MNUA 5KANI 2XZCL 1RZ8B 3KYAA 1D3CA 5D7IA 4FFWC 4RNRB 3RWGA 5EBWB 5HI5D 1HKLL 5GS1B 4ZUWB 4AEHH 3DIFA 4MJIB 4HJJH 3ZDXE 3BYYA 1QSFB 2BY0A 1QBML 4RIRB 4XCFL 5H8DA 3MRRB 1BPVA 2R1YB 5D5MA 1YEJL 4W6YB 2BDNH 3STZB 3VXSE 1Q38A 1FH5H 1VPOL 1N8ZB 3PP3H 3VD7A 1KB5L 1JF1B 2XZAH 2B2XH 3LQAC 3PUCA 4ODUA 3VXSA 2OJEB 4ODTH 2O5YH 1UFUA 1OGAA 1MHCB 2XN9E 2WP3O 2F53A 4QY8A 3O2DA 4M7JL 5A16B 4GSDL 3JWDC 4FP8H 5D2LE 3UTTD 4J6RL 3CVHB 4RRPA 1ZSDB 1H9VA 2VIRA 2BCKA 3X11A 4LSTH 1IZJA 1YNLL 3LKOA 2WQ8A 5HHPA 4X8XA 4L8CA 2RBLA 2ZUSA 4LP5A 4JJ5B 5A43C 2JJSC 5FM5M 4NPYB 3THMH 1U2HA 3PNWA 5D1QC 1E6OH 4GO6B 4OFPA 3V7MA 4GG6B 5C0DA 4MSWA 2IPTH 3I9GL 4W4OC 1EFXA 2NXYD 1G9NH 4POUB 1CFTB 1X3DA 4NKMB 5C1MB 4GW5A 2VABB 1GOFA 5E2UL 1I75A 1YEGL 3VFUB 3C60C 3EO9H 3DSNA 4RMVA 3ARDD 3OQ3B 1XF2B 2E6PA 4PRHD 3G6DL 4XHJD 1OSZA 5C0EB 4J3XA 1MVFA 2IG2H 2M8XA 3B2UD 3EYUL 4DQOL 1TTGA 3FFDA 2XTJD 3TM6A 2RGSA 5J6GB 4OIBA 4Z77B 5H37G 3ABZA 3LMJL 1CZ8L 1DUZA 3L7EA 4TN9A 5IROA 4GRMB 4XVSL 5C9JA 2AERT 4NHCL 3L3OA 5IG7A 5BRZD 2FDBP 2FEEI 5CP7B 4TOYH 2WBJC 4PJEF 3V4VH 5FA3B 1JNLL 4YDJA 1D6EA 3HNVL 3OKMA 4KK8D 3TBVB 3VMPA 4PR5B 3OJDA 2V7NB 3ETBF 2I07B 5KS9E 2YA0A 4OM1L 2H8PB 5F7YC 1DBAH 2NXYB 1L0XA 4YBQD 4ZXBA 2DTSA 2YOCA 3VFRB 1QLRB 2YD9A 4L3EB 1FZMA 2BSED 4M3JA 1U92B 4R0LC 3I02B 4LVNC 1WCBA 1UM5H 1JYVA 4K3GA 4PRHB 4ELMB 4WI4A 1AE6H 1P4BH 1GJIA 2ENSA 2BOBA 2OJZH 2VXTL 4PUBL 1W8OA 4BQCA 2P46B 2XTJB 3TH3T 4TSCH 2VR5A 1D6VL 3WN5A 5KSAD 1GGBL 2RCSH 3IDXL 4JFYA 4XC3L 4JY6A 4K7PY 2EZ0D 5T1MB 1I3GL 1T2QH 1KLGB 3NFPA 4YX2H 4G8EA 5ILTL 1MCKA 2D31B 5CEZD 4Z7UF 3VGAB 1A7NH 3QNZB 3N1PC 1AHWB 1KXQE 3BN9D 1CTOA 3L5HA 5HYJA 4YZFF 5D2NE 2VDRH 5DURD 1B0RB 3ES6B 1H15B 3LDBB 3NCYS 4NQVB 1A0QL 2CIIA 4CNIA 3ARPA 2Z91B 3BH8B 3GM8A 4CVZA 4AIXA 3VFWA 3H7LA 3RKPA 2EDHA 4XBEL 5IVNA 4WO4C 4HSQA 1TVBA 1GYAA 2Q6WB 4RGMC 1EUUA 1GHFL 1FV1A 2HT3D 2J8UB 2HAZA 5DJ0A 4XP5H 3RWIA 5DJDA 4G5ZH 2WNGA 3BQUD 3QG7H 3U9UA 2WZPD 3KJ4C 4YR6B 1XH3A 1HI6A 2FBOJ 3ZKQD 4PGDA 3ZDZE 5T1LA 4OLWH 3L3GA 4NGHL 2EIEA 3TNMB 1LP9E 1NC2A 5DMYA 3RTQA 5J12B 4WEMB 1YC8A 4YHNB 3MOAL 3PHQB 3S5LA 4PB9L 3X12A 1IGTB 2DLEA 3IAQA 4M1GH 2ORBL 3RWDB 3BW9A 1K85A 2V2WB 2D7OA 3VXOA 1UH2A 3I3DA 4OGXL 2Z92A 3EAKA 3LB6C 5HI3C 2PYEA 2I5YL 1UT9A 4WUKH 2DJSA 3E6HB 3LKRB 1J86A 1DQQA 1T1WA 3MNZB 5AG9A 2A38A 3QIWA 4U49A 4UB0L 5DEZA 1NCDL 5CZVH 5GZOC 1LO3H 3VCLA 1U8LA 3TBYA 4LASH 3MFFB 4KI1A 3BZFB 1Q94B 3NA9L 2ATPA 4F7CA 2GFBB 2A6IB 2HKHL 2X9YA 2P44B 2IWGA 1N5YL 4OFYA 4OZGF 5E2TL 1A02N 1RZKL 3ALPA 4Y8AA 4BZYA 2DQDL 2X9WA 3MV9E 4JQXC 2PUQT 1OY3B 1S78D 5FA4A 4BH7B 3BGMB 2YUVA 2YR3A 5C09A 5T3XE 1XF4A 4L4JA 4D3CL 1SMAA 4X9BA 2WP3T 2YPLA 1DL7L 2Z4QA 2APXA 3LSOA 5KVMC 2DI7A 5J06A 2VERN 4JFEE 2W91A 4LIQL 4RMSA 3G6JE 1MWAB 3B5HA 3PQYE 4V2CB 2FWOA 2R69L 3VG9B 4PJ8C 4AL8H 3MV7D 4KY1L 4ODWB 2QL1A 3E8UH 3QP3A 1KJMB 3PQYA 4L29B 4H20L 1RJZA 4WHTA 4CN1A 3JTSA 3F12B 1U91B 4UT6L 1JRHL 3LPWA 5CGYC 3EO0B 4FTVA 5IV2B 3BJ91 5ENWA 2X4SB 3C2SA 3W2DL 3RDTC 3WJLA 2IH1B 3WUWB 2XZCH 1RZGB 3TIEA 4X4YB 2F9BT 2YWZA 3W39A 1HKLH 4X80L 1JPTH 3MLYL 1UZ8A 4UUJA 4G8FB 4XCFH 1DE4B 4PJBF 5BV7H 5D7JC 3TC9A 2HTKC 2YD1A 4M4PA 1OAQL 3HE7B 4OTXL 5DD1L 5INCB 5DJCB 1X7QA 3JTTA 1Q0XH 1I1CA 1VPOH 5L8JB 2W92A 5C08A 2GSIB 1J8HA 4ZS6C 4CU8A 2BSTA 4HUKB 3T2NL 5B39A 1PLGL 4RFOL 4FABH 3QUYD 5AAMA 3VFNA 4XVTL 4XXCA 4GSDH 2MWCA 5JQ6H 4WFGD 5C0AA 2HT4D 2GUOA 2C4FU 1G9ML 3GIZL 3I75B 2WIIA 3UPCA 1DQLL 1UH4A 1VERA 3VI4F 1OLLA 3IFOB 4NBYB 3U46B 2ITDA 1NFIB 2X4QA 5IP4A 4HUMB 4MD4B 3DRTB 1F8TL 5CSZB 5E00B 1F90H 4WW2B 1X4XA 3GRWL 4JVWA 3DYPA 3MRIB 4EBQL 5H94A 2W0PA 1WFTA 4RMUA 5F72S 3D3VE 1PY4A 1R5VA 4YK4B 3P2TA 4WHYG 2LU7A 4XNQB 5HTSA 1UACL 1N59A 4Y4FC 1FIEA 1RI8A 1LQSR 4YFEA 2W0LA 4PBVC 4R9HA 4F7PA 5HHME 2HT2C 3VD3A 3V5DA 2E9IA 4HUXA 1UG9A 3E0GA 1CFBA 2NY6D 1T1XB 2NY3D 4PP2B 4Q6IA 4FQ2H 5E2UH 1G7IA 3C6SA 3DTXB 3QWOB 1UGNA 1CQYA 3QUYB 5IJKC 3WKNA 3DMMD 2VUOA 3G6DH 4LGSB 4PG9B 4HBQA 2AV1B 4NWUH 1FFOA 1KBGL 3LN4B 4MNHA 1EO8L 3VJ6A 1JL8A 2B5IB 5ICYA 3IKCA 4Z7VB 4JN1H 2IQAA 4HV8A 3QDMB 5IVZB 4WTWA 1F6AA 4X5XB 2FHBA 3LMJH 3LZFL 1CZ8H 5E6IB 2RJMA 1QR1A 4XVSH 4NHCH 4FRWA 5GRWA 1MCOL 4IOIB 4NJ9L 5K59E 3D39D 1WTGT 1MUJB 3MV8E 3HNVH 5E1HB 1QRNE 3Q6GL 5KSUA 1MOEA 5E8DH 2APWA 1QO3A 4FQLL 4KZEL 4ODXA 2VH5H 2Z8RA 1D5MA 3CDCA 3DXAB 3SDAD 1LNUB 3REWB 1ADQL 3L7FA 2LU4A 4KQ3L 5DLMH 1ACYL 3HZYB 4NHUA 1IQWL 2NW3B 4OCRH 4RX4A 3QR2A 5DR5L 4HF5L 3GSQA 4A2LA 3DMMB 3EFDH 4NQXA 3LIZL 4JG1H 1AO7A 2ICCA 1U41A 1R3HA 3L3IA 4PUBH 3PABA 3OJVC 3CVIL 1BWWA 3P30H 3D85B 5GS3A 3ULVL 2R1WA 3UTQA 4LARH 2P48B 1WT5A 3E3QE 4OIAA 3UBXI 1C12B 3DOSA 5EWIL 2OK0H 1L6ZA 5LGHH 2XT1B 2VLRD 5ILTH 5JIKA 5HYEA 5IJVA 3RA7L 4JZOA 5CGMA 1PFCA 3IDYC 3G5VB 3K7UA 4YAQB 5GZNC 4M61A 3IDGA 4U1HA 1T21B 3R0MA 1T1ZA 4APQC 4L9DA 3T1FA 2UY7A 4OZIB 1R6VA 2CLVA 3NZ8B 1U8NA 2VR9A 5CEXA 2R39A 2VDLH 5SWSB 2YN5A 4LKCB 1DSFL 1MCDA 4XBEH 1I9JH 3W11D 1HQRB 2J1KA 3BPNB 1N2RB 5EU6A 4PJIF 1GHFH 2VQ1A 4LOUD 4JREB 2AAVA 3QHTC 2EDDA 5C0CD 2X4PA 5E08L 3L3HA 4ALAH 1P7QB 3O8XA 5GS0L 3AY4A 3RVWC 3ULUC 3IJSA 5J8OA 4B7LA 1YEFL 4I3RH 4PJEA 5DRXA 1V7MH 3IXAB 5DD3L 2AEQH 4MJ5B 5F9AC 1I3VA 5E8OA 1JGEB 2HG5A 4XX1G 1ORSA 3FQXB 2MQCA 3D0VA 5KZCB 3KPOA 5EO1A 1I7RA 3MOBL 4N8CL 1JPST 3MOAH 3C5SA 3HMWL 4PB9H 3RWFB 2JCCF 3TYGL 2ORBH 3QFDA 1MJJA 1CE1L 4B53A 1MCBA 1NGWB 1UB6B 1MH5A 4R2GD 3QBTB 2FH8A 5DD5H 4UT9L 1IKNA 1XMWA 2DL2A 4PRIE 3V0WH 4QYOA 5JUEL 1M7IB 1BREA 2XACC 3KLAA 4MZ2A 4PJHB 5IKCA 1SEQL 3BISA 3D0LB 4OGXH 2FECL 3MSPA 1XGUB 3GMPA 3PWLA 4PRIA 1S9VA 1P69B 3GMRB 3HI5H 5CINH 5C0CB 4C4KO 3EYVA 3PWUB 5DQJA 2I5YH 1LK3L 1Z9SA 1Q8MA 1ZTXL 4RDQG 4HG4J 5DRWA 4LLDB 1G6RH 1GZQA 3Q6FB 5DJAA 4Z7UA 1E6JL 1I3UA 1I8KB 3WS6C 3AGVA 4ONGL 5AZEL 4U1IA 4WV1C 3VFSA 2IFFL 4KJYA 1U3HC 1NBVH 4YH6A 4G9FE 5I1DB 1UCTA 1G1YA 1ETZB 1FZJB 3O6FD 5ACZB 2OLDA 5F7NC 4IRJD 4P2RD 5L2JA 4M5ZL 5HHNB 2Q8AH 3GHEL 3RZCC 2ZJSL 4PJ9B 4LCYB 5MP6L 4OZ4A 2UY6A 1P7KB 3P4NA 3QH3A 4K3EH 2ZCKH 1RZKH 1H3GA 4NZDA 2P1YA 5MHSE 1J0ZA 4KROC 3TBWA 2HMID 3OAZH 4M5YL 4YDVB 4WENB 2IPKB 3QNYB 1IGYA 4PFEA 5MENA 4D3CH 1MJUL 4TRPL 3UZVB 4R26L 1T66D 1CXKA 3O6LL 4NOFA 4ISVA 5E94B 4I3SL 3S6CA 3L5IA 4Z7OF 1DL7H 1KEMH 5EUOF 2Q8BH 4C59B 1TFHA 1BF8A 4OZHF 3VD4A 2F15A 3W81A 2R69H 3TT3H 2EDEA 3T0AA 5DVLA 3AC0A 4Y4KD 2R4SL 3FRPG 1ND0B 2QQLL 3DVFA 5HI4C 3ARGC 1IEAA 1T04A 4JHAL 5I15L 3JWOC 4TUKL 4WUUE 2JJSA 3ZTJG 4RBPH 1KT2A 2CSPA 1AGFA 4IRJB 5D1QA 2COQA 4MB5A 2DLIA 2BVQB 2P5EA 3HMXH 1A7OL 1JWUA 4U1KA 3JUYA 3VWJA 3EOAA 3QRFM 1FGVL 3SE8L 2M26A 1FNFA 4P2QE 1CDGA 5IBLD 1G6RA 3C60A 4HKBB 2QR0B 4X80H 1I8MB 3MLYH 3OKKA 4PJFF 4ZG1A 3LKSA 3QHZL 3FQRA 1ZA6A 4ODSL 1OAQH 3NTCL 4EN3D 2FL5B 2ESVE 1NMCC 4WWKC 3LQMA 1T7WA 2W9LA 3HN3A 3PP4L 2D4FA 2Y06L 5T3ZL 4ORZC 3V4PL 1P2CB 1U6AL 1OAXL 3FB6B 3FQNB 5I2IA 4W70A 4FZ8L 3C6LA 4LQFL 3QAZB 4RFOH 1QOKA 4KHTH 4NDMB 3ULUF 1TZIB 4XVTH 1F3JA 3GBLA 3KPLA 3TJHD 4YGVB 1FPTH 3U7WL 4UV4H 2HKFH 3FB5B 1UWXK 1G9MH 4OZGA 4WTZG 3V0VB 2NY4C 4LIQE 1DQLH 4EUPG 3EYSH 3SDCD 5AZ2H 3SGDH 2E27H 1FN4B 3HI6H 1C5BH 1P4LA 1KJ3L 4N90D 4X4MA 2CLZB 2GK0B 4EBQH 4MVBD 4R0LA 4RFNB 3UTZA 2PW2A 2X4TA 1A9BA 1UACH 3QDHA 3TV3L 4S0SD 1CXEA 1WZKA 3SGDI 2APVA 5F93C 3VRLF 5CWSA 1YUHB 4I13B 4P3DB 5EOTA 2HLAA 25C8L 3FO9B 1WWAX 5HD8D 2ICEA 3FAXA 2QLVB 3HMXA 4YPGA 1HHIB 4LPWA 3SKMA 1SYVB 3RFZC 5F70A 5ID0B 1U8HA 4PREA 3GM0A 5DRNB 1RIHH 1KBGH 4DVBA 3M1BB 3RIFF 3LS5L 3OL2A 2FJFB 4JZJC 3PXJA 3UYRL 2R0LL 3RVUC 4Y5YC 1PDKA 1KTDB 4IRSC 3SGKC 3AB0B 4NWTH 1MCOH 3PDDA 3R4DA 4FQXD 3AS3A 3NN8B 1I4FB 3Q6GH 3B4NA 2H6PB 4KZEH 2HVJA 4AENA 43CAA 5EIIB 3HAEG 3PHOB 3JV4B 5CD5D 2BOCA 2LQRA 1ADQH 3S97C 3T4YA 2G9HA 4KQ3H 4O51B 5DS8A 1T0NA 1YNTB 5JMOC 4DJMA 3KYOB 1H3PH 8CGTA 1J11A 4Y16C 4Y1AB 1UM4L 1MQKH 4HF5H 1RK0A 5F9OL 4PS4L 1B0GA 1G7LB 1QBLH 1VFOA 4U1SB 3TPUA 3W9EB 1SJHB 4RSVA 1GGCH 1IC5L 3QEQD 2IBBA 5ITFB 3C09C 1PKQB 3I6LE 2LTQC 3ULSB 4LVHC 4XCEA 1FO0L 3FT4B 1UWGH 4Z76B 3P4LA 4R4FL 1KPVB 3S96B 2K7PA 2DWEB 4LSRL 2IAMD 4NQDA 5C0JB 2CKBL 4BA8A 4J1UB 1PD6A 4FFVD 3A6BL 1MFEL 3RA7H 3HR5B 4LHQB 1DEEA 2EDOA 2Q20A 3MREB 1G84A 1KFAL 4NRYA 4X7SH 5DUBB 1CDIA 1BQHG 2XZQH 3PV6B 1M6OB 1T20B 3PXHA 1WC7A 3SJVE 3TJEH 3ORJA 3FONB 4C4KT 4OFVA 3KXFE 4QRUB 5C0GB 5BQ7B 5BS0D 1SJEB 4PV9B 3MACL 2N56A 2WWKO 5EZLB 2KH2B 3O3BA 1A3LL 4XP4L 5L2KA 1EO7A 5T5FL 2NNAB 3WEXB 4AEIL 1AD9A 4X83A 3KXFA 3MRLB 1UEYA 4HKJA 2EDFA 5DYOA 3WUWG 4HIEA 1CGWA 4NQTA 1RUKL 3GMMB 5E08H 6CGTA 4PJXF 1KJVB 3P11L 1N26A 5JHDE 2XWTB 1Y18B 3SKJL 5FB8A 2HYMA 3NCYP 4HT1L 1DTUA 1YEFH 4QOKE 4KJPC 1X6NA 2IAMB 4P46D 4NQEA 4K9EC 4N1CA 2BVYA 2G75B 2AP2A 4TSBL 4TUOA 2FNBA 5I9QB 5J1SC 3MOBH 1EXUB 3FO2A 4HUNB 4N8CH 3V5HA 3ULVE 1DN0B 4K8RD 5E8PB 3GJEB 1G7HA 4Y5XB 4XMKL 5E5RB 2CDFB 1L0YA 4QTHB 1CDJA 1CYGA 3TYGH 2JB6B 3BIKA 3CLFL 3HZKA 2OZ4H 4PJ8A 2X4NB 2NLJB 2K3TA 1JYXA 2GTZB 4CDHA 4RWHA 3U1SL 4POZC 5DK0A 4H0HB 5BS0B 2AI0H 5DQ9A 2XWJB 2EC9T 5C6TL 3R06A 3K4ZA 4QHMA 1ZHBA 3U48A 1R24B 4JFDB 1V05A 2FLRT 4LPXA 3SDDD 1IGJB 3DRQB 1AD0B 3EBAA 4LEOB 1T1YA 3S98A 1XR9B 5J9PA 3TO4D 1LK3H 1FGNL 1ZTXH 2OQJB 4F2MA 3N1FC 3RDTA 3OB8A 1URLA 2A9ML 2C3VB 3W5MA 3HE6C 5I1AB 5GRJH 4ONGH 4P46B 1N64H 1JHTA 1C08A 5GGVL 1CIDA 1AIFB 3TLRA 2I60H 3WNMA 1EEQA 5D7JA 4WEBH 3GHEH 2VXUL 1IEBB 1RJYB 2ZJSH 2ZWLT 4H0IA 5SV4A 1HH9B 2P24A 1T5WB 2KQNA 3UZEA 1WBYB 3PL6D 5F97E 1ODAA 4N8VB 1Q9KA 4FFZH 4RGNE 2XFXB 5K9QG 4IS6A 3UTSE 4A6YL 5C71A 3QDJD 5ANME 3UJJL 3QXAB 4TRPH 4R26H 1VADA 4HJGA 3O6LH 3DX6A 1S9XB 1INQA 4JM4L 4XRCA 1BMGA 4I3SH 3Q2CA 1M1SA 3WXVH 3FRUB 2NY1B 2DQHH 4N9GB 4QRRA 1CT8A 4J23A 5JXEC 1XZ0A 3NIFF 2NY2C 12E8H 1JZ4A 3O3DA 3T0ED 3B9KD 5B4MD 2DM4A 5B8CB 1M71B 3GI9H 1W72L 1BD2E 2G5BB 3GNML 2OZ4A 4JRXE 3U30B 5DRZB 5DVKA 1JMZA 4POYA 3CFEA 4G7YL 4TUKH 2X05A 4A2MA 4Y4FA 5EFIB 4JFFD 5AYQA 1WSST 3F7VB 5DDHB 4F3FA 1F11B 2JCCA 2VZUA 3EO1A 4HXBH 4MJ6B 5T5NF 1RJLA 3BEWB 5IVOA 3UO1L 1NBYB 3QFJA 3JBG7 2OP4L 1WBXB 2XG5A 3QT2A 1FGVH 2IANB 4RRPG 4QHLB 5TQ2L 3RGVC 5IVXB 1CFNB 5IJKA 2H2SD 4KKBD 2X1PA 3QDJB 5JDSB 3VXRE 2ADGB 2OL3B 3WS3A 4OD3L 3VXMA 3WLBB 5LQBL 4ZO7A 4N5UA 1NGZA 5DZLA 2R2HB 4ZAKC 4K7FB 1UKTA 4KVNL 1HHKB 3CK0H 3PP4H 3EJYC 4YUEH 1OP5H 3B9KB 5T3ZH 4G7VL 3M8OL 5FFLA 5F1KC 5F6HJ 1CXFA 3IDMB 4P2YA 4LQFH 4GRWE 4OF5A 1FAIL 3KGRA 3MOQA 3ROLA 2VZSA 1MSPA 4PRBB 3WNOA 5FHBL 1KEGL 3MRCA 3WD5L 2YUZA 4HK0A 1IGMH 4L8SB 4NOBA 1U8JB 4JO2L 4M7ZC 4C56A 2OTWA 3MRGB 3ULUH 1KF9B 4G8IB 4RAVA 1KJ3H 2C26A 4OF7A 3G6AB 5GJTH 5I1HL 5JW3L 3SKOB 2OTPA 1FZKB 1RV6X 1BFOB 2WWMD 3D87B 3BDYL 4LSUH 4HZLA 4S2SB 3TV3H 4Y19D 3OHXA 4JFOA 1BAFL 2FATL 2BNQE 5EUOA 1BQUA 1AGDA 4OZHA 4JHWL 3H3PH 4MB4A 3TH2T 2PW1A 2F54A 1X9QA 3IAPA 2J4WL 4V1DD 4GW1B 5IHZB 2IGFH 4EIZC 4YIQB 1MPAL 1ZLWK 4WIQA 4KJQD 4TVPL 4JJHA 3WE6B 5C7XH 1QVOA 4LU5L 1MAML 2XG4A 1CF8L 1MI5E 3HNTL 4P57A 1HZHL 1G7QA 1HIML 1O5DT 4YBLB 3QA3B 5F8QC 4I0PA 3K74B 5DVOA 3MQIA 3DSFH 2F19L 4LLVA 1MLBA 2IC2A 3CSBA 1LE9B 2AV7A 5JOEA 4M7KH 4B7IA 1SM3L 3ZSSA 3SDXF 3ZTNL 1H3UA 3UYRH 3ZL4H 5E95B 3O11B 4JO4L 1UQSA 4MA1B 1B4RA 4PJFA 1Z6JT 3IJYA 1N4XL 2R1XA 1TQBB 4Y19B 4BSVB 5FGSA 3SGJC 4G8GA 5JLZA 2WWKT 3MC0A 2ZUUA 2DIJA 3CFDA 3TZVA 2FIKB 1I1AC 1RK1A 5C3TA 4V1DB 4OI9A 5D72H 1TQCC 4ZPTB 1G7MB 1QA9A 1Q9WB 2A73B 3E1F1 1N7ML 4C58B 1CD0A 2IFGA 5TH2A 1DBKL 3QEHB 2BC4A 2PO6A 2HRLA 5F9OH 4PS4H 4ZOCA 1AXTL 1UENA 3GKWH 5E1AA 4HS3B 2EIBA 1DUYB 3FT2A 1RIUH 4IIQB 2HFTA 4PJAE 1LWRA 2VLKA 2Q3ZA 3QB7C 4MX7A 1B2WL 3MUY1 5HVFB 1I1RA 1W0VA 4PGEB 1R5IB 3ALWA 3VH8B 3SY0B 1SVCP 3JWOH 3WFCH 3GJFH 4R4FH 5ESVB 5HDOA 4FG6C 3TYFA 2ZUVA 3ARBC 4KHXL 2GITA 1MFDL 5L7XL <