1IJ9A

Highly hydrated human vcam-1 fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new conformation of the integrin-binding fragment of human VCAM-1 crystallizes in a highly hydrated packing arrangement.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords VASCULAR CELL ADHESION PROTEIN 1
total genus 40
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ij9A01
5F89B 5DFWH 5A16B 4MA3A 4YFDB 2AXFB 3FFCE 4NCC2 3DGGA 4G8GB 5IBTL 1ZHKA 3BWAB 3CUPB 5D1XD 5TH2B 1BLNA 4XRCB 1HHKB 3IVKB 4FXKB 5CWSA 2OQJB 4U1JA 1AE6L 5I8CA 4PB9L 1IEBB 3ZMRA 4AMKH 3MLXH 4MVBD 2VDNL 4HT1L 1OGTA 4XCEA 5EWIH 5DUBA 4MQTB 2HWZH 3MRIB 4N5ED 5TPWL 1WK0A 3CJJA 4M5ZL 1KFAH 2NY4B 2BXYA 3VFGH 3AS3A 4KRPD 3TYFA 1R3JB 3F65A 3H9SE 1EUTA 2OK0H 2DRUA 4YDIL 5FUZH 3VI4F 2XZQL 2FR4B 1RZFH 2B2XL 3L5WB 1FG2A 4LLVB 5LAXA 4XCYB 3I84A 1RHHB 2ZUXA 5JXAL 5SWSB 3BQUB 1XR9A 4G8EB 2V2XB 5BZWA 4ELKA 1T1YA 3DSFL 4PP1D 5TPWH 3ARBA 1LD9A 3LQAH 3MA7A 2DS4A 3JWDC 1MHCA 5ISZB 2CKBB 3RWHA 3NIGF 4G42A 3X11B 5JXEA 1XCQA 4Q9QL 1TVHB 4O2FA 1X5JA 3O45A 4LHUG 3ALXA 3HZMA 2EYRA 5DC0A 1FVEB 5INDA 4DUXA 1NANH 4Q2ZB 3P11L 1S78D 4WIQA 4XX1E 3VXPB 2CR6A 5C09D 2MSPA 2PO6A 3LN4B 4UT7H 2DDQH 1PJ9A 1WAAF 5HHOA 15C8H 1II4E 1GGIH 4L8SA 2DTMH 3OAZK 4WI5A 2ED8A 4LHQB 3VFMA 3UBXG 3O8XD 4XCNA 5F6IC 3QUZB 4HFUH 4RGNC 4RMSA 4QRTB 3F6LA 3IFNH 3MJGX 3SCMA 5TQ0L 4JZOA 3HG1D 3S4SB 4MJ5A 3U4EA 1IC4H 1CI5A 4L8BA 4NHCL 4X5XA 2RFXA 1IGFL 3MLWH 3O8XB 5JO5B 2BOBB 3UTOA 4YH6A 5ICZA 5L7XL 2QHRL 4KAQH 1DBJL 2DM2A 5IB4B 3BDXA 5ESVB 4MD4A 2V5RA 1RK1A 4ZD3H 3NZHH 2NY1D 1HI6B 2FEDC 4K9EL 3VXMB 4KDVA 1NBYB 2W0FA 1S9KC 3ULUC 4QWWD 1RV6X 4P9HH 4KH2A 3ILQC 2MKLC 4KJPC 5GGTL 2UZXB 5HHPA 2B5IB 4HLJA 4E41D 3IETB 4ZDHB 3FFDB 2WBJA 3I50H 1LEKA 3BD3A 1YNKL 1QSFE 4PFEA 1N64H 3AU1B 1SJHA 1P9MA 1RUAL 1L7IL 2MMXA 1OM3H 1UB6B 3NFNA 4CGTA 5LQBL 1UADC 1A7PL 2BOCB 5FA3A 5DQDL 1DQJB 2AV1A 4PJ9B 1EEYB 3PGFH 4KY1L 2AV7B 4JDZA 5C0RL 1JE6A 5E00A 4PRNA 2ZUYA 3NFSH 3K8MA 1KIPB 3MC0A 1I8KA 1QQDB 4PGCA 2CK0H 4TNWK 4WW2B 4LSDA 2C7UB 2IALB 4QRSA 1EEZB 1LEGB 3CFKB 2VLLB 3HPJA 5KS9F 1M05A 1QO3B 4WY7L 3PQYD 4MAYB 1IM3A 4G6JL 3QUXD 4DVBA 1REIA 3ILPB 3PWJA 3DMMD 3LS4L 1J1XH 2G9HA 3GMNA 3O2WL 1IEBA 3LQAL 4H1LG 3L3HA 3WIFA 1T3FB 5SWZD 5HYFA 5I1HH 3V0VA 3MNWA 5IJVB 1X5IA 4EVNB 1T1YB 2YRPA 4YHLH 4UNTA 1FC2D 2CK0L 2APTA 3ARSA 3BEWB 3O3BB 4KKAD 4GKZA 4I1NB 1UB5A 5IHUH 3JUZA 4XAWH 4PJ8D 5KSVB 5ECJE 3ILQD 3WBDA 4WFGD 4GQPH 5IUSA 2FHBA 2WUCH 4JFQA 5TE4L 4LVNC 1YMMD 4XWOC 3U30C 1FFPA 4JZNB 2UY7A 2NX5D 4YHOH 5B3NA 3W9EA 2V2TA 4CN1A 2FJHA 1IAIL 4U1GB 1U58B 4JFDB 4KMLB 5E8EB 4NNPL 5IEHA 1A6UL 4N1CA 5D1ZB 1YMMB 5IMKA 1UM6L 1NFIB 4ODVH 4ZS7L 5D7LB 3FO0H 3KPPB 3HCVB 1WQVT 1KGCD 2BERA 3V4VH 3MRLA 4MNQA 5F21B 3ZYJA 5CLTA 2Z92A 3CC5A 3G5ZA 5KSAC 1CL7H 4JGJA 1X5ZA 1FNGA 3RZCD 1Z0NA 1VFOA 5HYSG 5JW5A 5EO0B 1JIBA 3ARZA 4Y1AE 3O8XC 3ZL4L 1J8HB 4M4PA 1TENA 4WJ5A 5EU6D 1QPPA 3BISA 5SWQB 3FO9B 2FX8H 4YLQT 3VGDA 5JMRA 5I1AB 2PW1B 3B83A 4JQXA 2Q8AL 3IS0X 3RZCC 1RZFL 35C8H 2FR4A 3LH2L 4UOW1 3H3KA 1BZ7B 2EEBA 5ISZE 4OCRH 4MXWL 1IGIH 4OCWH 5C0CE 1NUGA 1F90H 3HMXL 4PP2B 4CVWA 1JYNA 5DMKA 1ED3B 4JCLA 4CVXB 3LKSA 5LGHH 5LQBH 2ZKHH 4HCRA 1VFBB 4ZPTB 1QSEE 1R3LB 4TVPL 3AS1A 4OI7A 5DJZB 3IF1B 1T1WA 4ONHA 3PHOB 4HK3N 1P7HL 2LFGA 3A6BL 4AJ0A 3ULUD 5D5MB 1DQJA 3BW9A 3J7HA 5EO9B 3HAEB 4XRCA 5CCKH 2F5BH 4KUZH 2GY7B 1K2DB 4HF5L 4YDLC 3ROOA 2GT9A 2VDKH 3WUZA 3A6OA 4EIZC 2BHUA 4Z77A 5E5MA 4HWZB 4HUWB 1LEKB 3MLVH 4UOW0 3PWUB 3C5ZC 1H3XA 4ZXBC 1YEKH 5DJCA 3S4SG 4M43H 5BO1H 1PKQA 2C4FU 5DRZB 1Y0LB 3RAJL 5GJTL 5A40E 4DKFH 4G3YH 1SVZA 2BVQA 5F1IA 4PJIA 3MR9A 3S35L 4FQCH 3OV6A 2F5AH 1MVFA 1YN7A 4Z7NE 2AJXL 4YC2C 5E6IC 1J05A 1YJDH 4N8PA 2A6KA 3VWKB 3MV8E 1MHCB 5BVJA 3EO1A 1D5ZA 4K9EH 5MENA 2PTTA 2EEDA 3RIFK 4POZC 5D6DC 1WT5C 4PYHA 3H6JA 4G43A 1T04A 4YHMH 3V6ZA 3TIDB 1TJIH 1I7ZB 3KLSA 3WIFB 1S7XA 4M7LH 1OP3K 3V6OE 1ACYH 1IRAY 1SY6L 4F37K 4NJAH 1IAOA 5GS0H 2SEBB 3U7YL 1FQ9C 5MEOB 2F5AL 3D3VD 3AB0B 1MHEB 2XTLA 2CMRH 5HI5D 3IJSA 1AE6H 3RNQA 2Y07H 4QXTA 1RFDH 1J0YA 3DVNA 5FK9A 1AH1A 4HWUA 1MLCA 5JW3H 5E9DA 5ICZB 2I24N 2DI7A 3O3EA 2AK4E 5GISL 3FT2A 4LSTH 3F12A 3U9UB 4YXHH 2P5WB 4LOUC 4JGMA 4X5XB 2DYPA 3O6FA 4NOFA 4KJQC 1KB5A 5AEAA 4WI7A 2IGFH 3GBLA 5GS0L 5EPMB 1XGYH 3ARBD 2D0FA 3RA7H 3ARDB 1RZKL 4AK1A 3CXHJ 4XPFL 4RAVA 1DBMH 1NKOA 4PRAB 1OSPL 1SJVA 4U05A 4LKCA 4Y16B 4K9EC 2AQ1A 4PTUA 1URLA 3QIWC 1ZS8B 3FT4B 1WWCA 1JNNL 1RVFL 1EV2E 2NTSP 2V7NB 4R0LC 4X6DF 3UTSA 5ITBH 1I1FA 4TVPH 3RPIB 3KGRA 3MV8A 2GSGA 1L4IA 2XFXA 2V2TB 1S8DB 1D3CA 5EZJA 1WEJH 4IOFC 3SGKC 4AG4H 5I15H 4EKXA 4Z7WB 2E5EA 1QEWA 1T83C 2ICCA 2XKUA 4N5UA 2P8MB 1HE7A 5L2KA 4CU8A 1ZVHA 1LWRA 3PXJA 1YEGH 1NDGB 3HE6C 2B39A 4OBSA 1D5MB 2V5YA 2MTPA 3K4ZA 1MCPL 1X5XA 7CGTA 3DROB 3CFIC 4XX1G 5DJ2B 4JFFA 4R90L 4TSAH 4WWKD 3P4NA 1KXVC 2EDDA 4PV9B 5FEBA 4JHWH 2V7HA 5T1LD 3FTGA 1PZ5A 3DRQB 3IAPA 1MI5A 3QQ3B 5J0BA 2E9WA 1WCQA 3U6RA 1Z9LA 5HHNA 4F33A 1CFSB 4FMKA 1H0DB 7FABL 5DD6A 4ENEC 1HNFA 3D25A 3L95B 1WF5A 4PJEB 2VAAB 5ILTL 3VWJD 4XNXH 1FYTD 1S7UA 4APQC 3ULVH 5T1KA 4FQ1L 4PBVC 4ZSOA 3F7VA 4N0CD 3VFUA 5M95B 1KLGB 2IMNA 3IXAB 3T4YA 1ZANH 3EYQD 2VLRA 4YDIH 5FUZL 4ONFH 2XN9D 4BA8A 4OBRA 3HFMH 5K33A 4UT6H 3QUKA 4Y5VC 4R4BA 5HDLA 2VLRE 5E8EA 1EFXB 2B7DT 2EE3A 4M5YH 3CVHH 4HHAA 1GGYA 1OAYL 1A6WH 2X05A 3TA3A 4YGVB 5FGRA 1KYOK 3MGOA 4R6UA 1WFOA 3PV6B 4RNRB 2VABA 5E99L 4ETYA 2HH0L 5AUMA 2A9ML 1BP3B 1LK3L 3A6BH 1DJSA 4KK8D 4KVCH 2V2WA 4LEOB 1AO7A 3RA7L 5IVNA 2D0HA 4F8TA 1LEGA 3FQWA 3TIDA 4RWYH 2NY4D 4NBYB 4YHYB 2FBOJ 5B8CB 3L3OA 3UPRB 4X4ME 3SKNA 1P4BL 1U6AH 4QO1A 4YPGB 1OT2A 1FL5B 4GXVL 4LHJB 3CXDH 4PD4J 3UTSD 2W1NA 4NO0A 3VWKA 5GZNC 1GYAA 3UAJC 3X3FL 4JPIB 4JDVB 1IAKA 3HNTL 2E8ZA 1NLBL 2DQTL 4L3CB 2H3NB 3DXAA 3PXHA 4LNVA 2QQLH 1WJ3A 5FDYA 1ZLWH 5EN2A 3KAAA 1OD9A 4WWKC 1X5KA 5GGUA 3BIBX 3WMSA 2HKHL 4KZEH 3ULUF 1JGEA 5E2UL 2DM4A 4OGXL 5EG6C 1BFVH 2C5DC 1FNAA 5HHVH 2GJJA 3BPOC 1HYRC 3OAUL 1FFPB 3QDMB 4U7KA 4N9OB 4ZFOL 5C0EA 1MRDH 3RPKA 1IFHH 4ALAH 3MRPB 3ARYA 3EAKA 2VH5L 3QG6B 4YR6B 3GBML 4K71B 5JPMB 2X1OA 2MQCA 1CU4H 4UV7L 1MQKH 4JVWA 1ACYL 3MV11 5I71B 5BQ7B 3CFBB 3QIWB 3JVGC 2AEQL 1GAFH 2XI9A 3FOLB 1O7VA 3JWOH 1T0MA 2GI7A 3D9AH 1MJJA 3KPOB 3ULVD 4CVUA 3ARDC 4N90E 2IH3A 3I6LE 3OAUH 4EXPX 3QPQD 3CXHK 1WBYA 2MPAL 5LCVH 4RFEB 4JZJB 4WU5A 4R7DB 5L8LB 4HIEB 4I5BA 4M93B 2GIYA 1F97A 1EJOL 3EYFB 3PDOB 2F74B 2Z8WC 4AQOA 4G9DB 3MXWL 3PGCA 3E3QE 5I1AA 3NCJL 4YHKH 5GGQL 1RZJL 2DQCH 5D70H 3FQUB 5EUOF 2DD8L 1JNHB 2F58L 4PRIB 4X99A 3HC0A 3EFDH 2LTQB 3H7BA 4I3GA 2ZOLB 4IRSD 4JRXE 3OKDB 1MY5A 4HULB 4QOKD 3NA9L 4OZHB 2JCCE 2XY2A 1ND0B 5E8DH 2OCFD 4EOWL 3DOSA 4LHUB 3O41A 1AHWA 2BMKB 4LGPB 4TUKL 4MXQC 1BX2A 5HDBE 1F3DJ 1FIEA 1T4KB 5FCUH 2P46B 4Y19E 1NANI 1RIUH 1G84A 1CQYA 4JJHA 2Y06H 4FS0A 3T1FA 3H8NA 1XGPA 2MHAB 2BSSA 3KPSE 4UNVA 1FVCA 1E0OB 1S3KH 5EC2A 4QXGH 5ACMA 3E0GA 1NC4A 5SV3A 1D9KB 3KPRB 1N2RA 1A6AB 3BT2H 5I1LB 5HDBF 3H3PL 3Q3GB 4PJDB 3HZYA 1YYLH 1HZHL 3MQIA 4R3SB 2Y6SD 4PGBB 4MNGB 2R1XB 3QDJB 1G7QB 4OLVH 1R24A 5EU5B 4JHWL 1VGKB 1CWVA 1QLEH 3MREA 1Q72L 5D1QC 4FQIL 3IXAA 1PG7L 1PKOA 5DJ6A 3RKPA 1YEFL 5J12C 3GGWA 2D31A 4JLRB 3R8QA 4WTZG 1WWBX 4GO6B 2BFVH 4BQ9A 1FH5H 1T20B 5JDSB 4UILH 3TZVC 3QWQB 4ODXA 3L95A 1YA5A 4KMTL 3BIKB 5BRZA 2BNRD 5JDJA 3WFCL 1EAJA 1UH3A 4CW1A 4Y19A 3RWFA 4XBGA 2DMCA 3JV6B 4PJXE 3GIZL 1VADB 4YHIA 4HSQA 1VEOA 4NZRH 5AG9A 3R0NA 2FGWH 3NCCB 3RWDA 1BD2A 4DGYL 4NJAL 2P8PB 3OJDA 4KKNA 1QLRA 1D9KC 5IEKA 2DWDA 3DGGB 4K3DL 4JY6B 4DKAA 1A7RL 3B5TA 2PYFA 3K80A 2GKIA 3LRHA 3WS3B 1Q9KA 1J1XL 4P23D 1S5HA 2P4AB 5C71A 3WIIH 5L2KB 3FRUA 5L9DH 1IM9A 2EDQA 4XPHL 4Z7NF 4YBQD 4KI5F 4D0BA 1J18A 1LK3H 2H9GB 1T5XB 4F15C 1GZQA 1DUYB 4J3TA 1MFBH 4S1QL 4L1HA 3BZEA 4PJXB 3JWDH 5F3HA 4TVPE 4WUUD 2YD9A 3GUTB 5JPMA 3KYNA 4P3DB 5EUKB 3VXNA 1OPGL 4QTIL 2Q8BH 1QG3A 1TZIB 3UYOD 4GOSA 1A3LH 2ESVB 4HKBB 3QQ9C 2LTQC 1T89C 1NH6A 2BDNL 4QRSB 3WIIL 1JNNH 3P0VH 3NPSB 1MCHA 4K7PX 2IANB 4IRJB 5D7SH 3VXRA 3K8KA 2VWEC 1HYSC 2VWEE 4MHHI 1C7TA 3HMXA 3U4AA 3WO3B 4LLMB 5KAQG 2H3NA 2H45A 3O0RL 5DUML 1EGJA 3D0LA 5FUCC 1BEYL 2HVJB 4M7JH 5H94B 4NM4L 3W39B 4BUGA 2JJSA 3WUWB 1BOGB 4JZJC 3FB8B 3ET9F 2O93L 1XH3A 4F9LA 5CSZA 4NWTH 2FIKB 3IETA 2K9UA 1ZHNB 3QNYA 1QTYT 1KB9K 1Y6MR 4BH8A 3B9VA 4NQDD 2BSTB 4QRQB 2XWBB 5C6PB 3LN4A 3TFKD 2YUXA 5E08H 3RIFF 3UBXB 1G7HA 3VGBA 3MRHB 5D5MF 1KTDA 3RGVC 5BW7A 5J3HD 1BGXH 4OLYL 3QDGB 1BWMA 3ALWA 1U8PA 1WT5A 1GIGL 4NC2B 2E3VA 5D2NA 4KHXH 1XR8B 2WQRA 4IOFD 3RL2B 1WFNA 3X14A 2HWZL 2YN5A 2EDOA 3TBTA 2BHYA 4EUPB 1FNEB 1I9JL 4OM1L 3O9WB 1EK3A 1OAUL 4YIQA 4ORZC 3QDMA 1C12A 1SYVA 3ZHLA 4LK4A 1FO0A 1ZLWK 4AT6A 4WHTA 3HMWH 3WUWG 3KLAB 3MRQA 1MAMH 5FOJA 2DBLH 5DHVH 3QO0B 3UTTB 5FYLD 1NLDH 5EOCH 4F3FA 4MXVE 1IEHA 4LFHG 1V3LA 3X13B 4D0DB 5K9QI 1RVFH 2CRIA 1CDBA 2W92A 4OZFH 3JUYA 4QXWA 1MLBB 2CKBA 2CUHA 2R29H 3C5SB 3CSBA 3KYAA 3AUVA 5J13C 4WVRA 4YGAB 4ZSOE 5K9KB 3OAYH 4ZAKB 4RMRA 1VGKA 1BBJA 3S7GA 5DK0A 4ZS6D 3BO8A 5C07A 3DV4A 1W0YT 3LKNB 1G1CA 1HINH 2CH8A 2IFFL 3ZDXF 3KYKH 4M3JA 1K5NB 1N2RB 5EOTB 2EYTA 4KGLA 5E70A 4NCC1 4JG1H 4IIQC 5GZOD 4F2MA 1OSZB 3WXWH 1AO7D 4X0KB 1HXYB 4XC3H 3U7WH 2G75A 5ESQB 1YN6B 1MCCA 2IBBA 5ICXA 2V9TA 3P4OB 4X98A 1DQMH 5IM7B 3RY4A 1J8HE 3VMPA 1NAML 3CFEB 1GZPB 1WFTA 3WFBH 4XP1L 2BRRL 2VL4A 2XQYK 5E03A 4X7CC 3SCMD 5JW3L 3P0YH 1IJ9A 4K3JL 4IMKC 4U1NA 4R8WL 5HYJB 1TZHB 1J05B 4JKPH 2J6EH 2BCKA 1OB1B 2VR9A 4MGXA 3QUMH 4XGZA 2XT1B 1Q9LB 1RUPL 2QQQA 4H88L 1OP9A 3UTQB 3IXTB 4ZO7A 4Z7OF 4FQQA 1I8MB 1CDYA 3C6SB 3SN6N 3PWVB 2FJHB 4M1CD 3QIBC 1FL6A 4ZUWA 3T2PA 2VLLA 3HPJB 1LDPH 3OKEA 3GSVB 4PY8I 2OTWB 3SE3A 4IEFB 5FYKL 1MNUH 4EN3D 2BSSB 4H8WC 1QNZL 5EH1A 4ISVA 2GT9B 4R7DA 3IJSB 1CTNA 2DQHL 1YEJL 1A9BA 4E41A 4TPRL 5C2UB 1FNHA 1N0XH 3CVHA 1NBVL 2ADIA 3MCKB 2FEDD 4H1LB 2ORBH 4JFHE 2J5LB 3IDXL 1D6VH 1P2CB 5T1MB 5F9AC 3WEXA 2DQEL 1DFBL 1HHJB 2EXYC 3K2UL 3BHBB 2VXTH 3MBEB 5CEZL 5HXMA 4WWID 2B20A 3ZLQC 5C0IA 4HKBA 3OKDA 4IIQB 3MRKA 1XGQB 1CDGA 1PAMA 4BELD 5IB1B 4DCQA 2QTEA 5F7DA 3MJ8A 1NCDL 3QDHA 1RZGB 1EFXD 1B2WH 3L3DB 2IGFL 3BXNB 4Y4KD 1UM4H 5IW1B 2R0WH 4UMGA 1UENA 2X44D 3WO4C 1J10A 4FTVA 5KVEH 1MH5B 4A2MA 3T0EC 1MCWW 2W9DH 2AV7A 4JDZB 5BVJB 4HUNB 3C5SA 1RQ5A 2AP2A 1EJ6A 1S7SA 4Z0BH 5FDWA 2VIRA 5BCAA 1A1MB 3WN5A 3V0WL 1VENA 2HYMA 5IGXH 2APBA 1KN2L 2ITCB 5EBGA 3TBTB 1T5WB 4MCYA 1CZ8L 4YC2B 5E6IB 1MCFA 3C9NA 1SBBA 3DXAE 4XCCH 4G3YL 1E6OL 1KLFA 2X7LA 4Y16C 2P5EB 4KU1A 1V5JA 5I1KL 3KLHC 2XWTA 4W81A 4YXLL 4LLQB 1AXTH 1RHFA 1N6VA 1LDSA 2R2EB 4Z0BL 1TITA 4JN1H 1NGZA 2VSCA 4YXKL 3FOMA 4X6FB 3ZDYF 3LPGA 1INQA 3T2QA 5IHBA 3D3VE 3QIBD 3Q1SL 1QRNA 4JHZA 4QHMA 2K7PA 3VFWA 3NZ8B 1N4XL 3WKNA 1MHPH 1F2QA 1EZVX 3QPQC 1V7NL 4P5TC 1FLRL 2EDTA 5DFVD 3UYRH 5D9SA 1XH3B 3NABL 3NCJH 3SPVB 1FE8H 2ARJB 3E2HB 4M8VA 1CICD 3O2DA 4HCRH 3EYSH 4WV1A 5J7CC 2XV6B 4ZAKA 3MROA 5JR1L 3KJ6L 1V7ML 1G6VK 5KJRH 1ZLSH 3SO3B 1NFDF 1M71B 2EICA 4PJIB 4NN7B 1X6NA 4LPVA 3RHWF 4PV8B 1ZHLB 5AYUL 4NUJA 2IWGA 4XPTL 5DZLA 4XPAH 3SOBL 1H5BA 2OR9H 1YEIH 5CJ5A 2AQ3A 4KK5D 5C0AB 3SO5A 1EPFA 5E4EC 3OJMB 3T65A 3OKLA 4F9PA 5JQHC 4PJCA 3RP1A 1YEDB 1DQQA 2YPKB 4DWHA 2NX5E 1TZHA 1H3GA 1O7SA 2HFGL 5K9KA 4J3VA 4OF8A 1CGTA 3QO1B 1MREL 3DX8A 5EO9A 2VXTL 3TT1L 3QEHA 4DAGL 1BFVL 1F58H 2EE9A 3FRPA 3EOBA 1QA9A 3QXAB 4U0QB 4IJ3B 1GZPA 3FO2B 4Q9CA 4QXGL 4QNPE 4MNQE 3RVTD 4PJGE 4X6CA 4L3EB 5KSAB 1L0YA 5K9QG 3AXLA 3RZCB 4Y4HC 4LEXH 4MDIB 2Z31D 3LKPB 3U4BL 4WEBH 4YDVB 4R7NB 4LVOC 4QOKE 3T09A 3IFNL 4OLVL 4FMFA 2QQNH 2N4IA 3JSSA 4IHOB 5ESQA 3PNWB 2MWCA 4L8DB 1CTOA 2IQ9H 5CILH 5CBAA 1KC5L 3CFJB 3ALPA 2NY2B 2YK1L 4H20H 4LCWE 4ZO9A 1KN4L 2JK5B 4F15B 2BRRH 1JZ4A 1UM5L 3HE6D 4G8GD 4ZNEE 5HGHB 3V79C 3CZFA 4QHLA 2XA8L 1JF1B 5F1KC 3AM8A 4WO4B 4LSVL 3MGTA 5T3XL 1A7OH 3M17B 2YUWA 5I8CB 1G9NH 1JVKA 1E4KC 1TDQA 4Y88A 3QHZL 4Y2OA 1NGQH 3TBVB 4NNPH 4NYLA 5D7IA 2VUYA 4EZMA 2QSCL 5KZCB 2WUBL 3MRPA 4ZTOH 3DROA 1GHFL 1PLGL 1N3NA 1H8NA 2PW2A 3ARRA 2ERJB 3VJ6B 4ODSL 4PG2C 2UVEA 3QCVH 4LCWB 5I1JL 2KQMA 2WP3O 3HE7B 4YDJA 1N64L 3P4OA 5HJ3A 3LMJH 5CBEA 3SKNB 3G5YA 43C9B 5CEZD 4OLXH 1P7KA 3ZE1E 1N4XH 1N6QH 4TOYH 5MEQA 4P4KB 5E94B 1FLRH 4OV5B 1YY8A 4MAYC 1M7XA 1CU4L 4ZUSA 4CRPA 4KY1H 3TGXA 3WJJA 3RWIB 4G9FB 3HS0B 1JHLL 1GGCH 1W8OA 1JYWA 2Z31C 5MHSE 2WLYA 3P30H 3TVMA 4FZEH 1ZLSL 3EFFA 3DSNA 1CDIA 3WKML 1I85C 1ITBB 1NLDL 5EOCL 2IQAA 5GRWA 1OAYH 4P2QB 1DN0A 1VESA 5BZWB 3MLSL 1CG9A 2V9QA 2X6MA 2F9BT 4JKKA 3TH3T 3KR3L 5BMFL 2Q6WA 4BSVA 4BKLB 4JM2A 2AERT 4P9HL 4QF1A 1F5WA 4ISVB 3NBNA 4P2QD 3VFTB 3GKWL 5D1QD 2LU3A 4M6OH 4EJ1C 3V4UL 4JFFD 3ARDD 4A6YL 4GW1A 2AAVA 3LQZA 4Y5XB 3RTQA 4WHYG 5EIIB 3U2SA 2QKIB 4P46C 2H32H 2VSDA 1P4BH 3DO7B 2IF7A 2J4WH 4NWUH 4DKEH 4WTWA 4NWTL 4CDGC 3U46B 5KW9H 5C0GA 3G6JA 2A6JB 4UIMB 32C2B 3PP3H 2CKNA 4PRAA 3WN5B 4JDTL 4HZAA 4XCEB 1WBXB 5C1MB 1M71A 3FAWA 2FX9L 4WNQA 1OAZH 3EYUL 4GRWE 4TNWF 5HTSA 2W65B 5GGSB 1FYHB 4F7TA 3F7VB 3TO4C 2APWA 3KPOA 3MLRH 3H9HA 4NC1C 5FO7A 3MJ7B 4TULL 4ZS7H 3D3VB 4P4RA 3LKRA 3IU3B 4LCUB 1CDJA 4JR9H 4I2XB 1A4JB 3CFEA 3FQXA 3MCG1 1VKXB 4ODTH 1NAMH 3CX2A 2XXMB 3MBEC 2APXA 4NGHH 3EYFA 5DD6B 2DTML 1T80A 1A14H 5LG1A 2OZ4L 2X5PA 2XZAH 3FZUD 3QULB 2VZ3A 3I6GA 2JK5A 3EYUH 1KPVB 1GC1C 2Y1VA 5IVXF 4JRYA 1FYTE 5J1SC 4LF3A 2NXYD 2EIZA 2ATPB 5IIEB 4MD4B 4M8QB 2VOTA 1HDMB 1NCAH 1C08B 4NO3B 1ZT7B 2YRZA 4U3HA 4YDVA 3JTSB 2X10A 3QUKB 5AYQA 5E8OA 5EN2B 4NGHL 3QXVA 1LDPL 4C57C 1CD1B 1I8IA 2H8PB 2FO4A 5LWYL 4HH9A 2VR5A 4OIIH 2RR3A 2B0SH 3OJDB 1N6QL 4Y5VB 4YUEH 2DWDB 3D0VA 1MJ7L 3QUXB 4OFYA 1E4WL 2XKSA 5J9PA 1K4DA 1UKSA 2OK0L 3HRZA 3MFFB 1A1NA 2GCYA 1DQQB 5EFIA 5F1SA 5HHOB 2JIXA 3QSKB 4M7ZC 2ESVE 1B3JA 3NIDE 1OTTC 1M05B 4HV8A 2Y7QB 3O4LD 1MELA 1CXKA 5I76B 3T0DA 1AR1C 1I8KB 4P2RD 1T0NA 1JCKA 1TQCC 3UX9B 2DKUA 4HKJB 4XMKL 2NYYC 12E8L 3LEXB 3NN8B 1T22B 1H3PL 2HFEA 4KRPB 3G5XA 2XZCH 3LKPA 4XAKE 5ID1A 5KVFL 2ENYA 4EI6A 5IMMA 3QQ4A 5BRZD 5CD5D 4F57L 1U3HC 1RIHL 4LHUA 4HWEL 1RJZB 4RMQA 4X8XA 3A0OA 3PP4L 1I3VA 2LQRA 5CS7A 2ICWJ 3SDYH 1Z9MA 3O3AB 4HGWB 4U0RB 2ZSVB 1UJ3A 4MB4A 3MRRB 5JOPD 5LKNA 1F3RB 4XVUC 1KBGH 4M1CC 5C0EB 4PJCB 2UYLB 1XEDA 5ELIA 3HI6H 4ORGA 4YHLL 2GW5A 1LO3H 1QHOA 3WFHB 5FFLA 3ARGC 3VD9A 4Y5YC 2E27L 5E9DE 1MJUL 3H9SB 5GSRB 1MUJA 4YBLC 2EDHA 2XACC 4X6EA 5EZLA 1FRGH 4MMZC 2MNUA 4HUWA 1A7QH 2CUMA 4GRWH 4XVJH 2WQ8A 1Q1JL 4I0PD 3ZSSA 5DI8B 1K4CA 2ZOLA 4D8PB 1UVQA 4UNUA 5E8PB 3U79A 1XGTA 4KJYA 5BV7C 1F6LL 2ICES 1WZMA 3O3BA 4HX1A 4MDJB 3Q3GA 1XF2A 5JTWA 5ANMA 1KF9B 2AJZB 4Y5YB 4MSWB 4MX7B 4G6AC 1NEZA 2F58H 4JRYB 4NQDB 4GW1B 4KHXL 1V7MH 4BK4A 5LGJB 1G6RA 3NH7L 1RURL 3SDAB 3BRDA 3IAGC 1OTSD 1T0MB 2ZUUA 1JGDA 4GBXB 2O5XH 1VKXA 5D5MA 1PKQE 1F4WL 4M62H 3ARPA 2OR9L 1MFBL 5ADPL 4UUJB 5GGRA 5EU6E 3O41B 5FF6A 3QI9A 1OY3B 5GGRY 1J1OL 4OB5H 5CSGA 5EOCJ 4LPCA 2VDQL 3RIAF 4WCYL 4F7CB 1OW0A 1E4JA 4LLUB 4OCYH 4TQEL 3C08H 2NW3B 1CQKA 3LS4H 1FZJA 1IGIL 4Y4FC 1MEXL 5EU4A 2ZPKL 3VG9B 3G6JB 4WUKH 3AFLA 4HS8H 3TJHD 1DEEA 3KS0J 4FA8A 1AFVH 1A4KA 1OAKL 4NNXA 1S7RB 1ZSDB 1VGEL 1LE9B 2DQTH 3QIUD 1MWAH 3OB0H 1SJXA 4LLYA 3B9KD 5TGBA 2ENSA 2CGRL 3MZGB 3HLAA 1Q38A 1JWUA 1Z2KA 1EO8L 3HRZB 3VFSA 4X6CE 1LEIA 1R5IA 1NCWL 5FGBC 4I0CC 2IFFH 1AKJA 2DL9A 5IHZA 4MQXC 3GNMH 2W60B 5DJDA 4KTYA 3EJZD 2HMIC 3W0WD 3SE4C 5KSVA 2QADB 4PR5A 5ITFB 1NMCC 5IFJA 1IKFH 3D85D 3GMQA 4NQSB 4ZUTA 5C0ND 3FRPG 1W0VB 1LO5A 3MSPA 2DQFB 2XOTA 3UEZA 4S1RL 4QRRD 4QYOA 1MCNA 1C08A 3QZWG 3LHPH 1BJMA 4KQ3L 1NJ9A 3M1BB 1UZ6E 4LARL 1TJHH 5CGTA 2QQKL 3QH3B 3LIZH 3WD5L 1FV1B 3V6ZB 1KG0B 2UUDH 3WIHH 2HTKC 3FB6B 1HILA 2APFA 1D5MA 4PY7A 1IGTA 4CVZA 3AC0A 4AEHL 2J8UB 5H37G 3PL6A 4UB0H 5K9OA 4JKPL 2VNCA 3MUGB 1IKFL 4HWZA 2VQUA 1HSAA 1ODAA 1KLUB 5EIQA 4NP4L 4WDIA 3U0TB 3BH8A 4JJ5A 4NJ9H 4P4RB 4FFVC 4I3SH 8CGTA 1NFKA 4FXKA 2GCYB 5JW4R 5JW5B 2OR7A 3IT8D 3RWEB 1AGEB 3DJ9A 3NFPB 2UY6A 2GSIB 5EBMA 1T1ZB 4TRPH 5J6GB 3I3BA 2OSLA 3TT1H 4MNHB 3ZKMC 1JL8A 2DYPB 2MKWA 3O6FB 3QIUB 5F3BA 2XY1A 4FQXC 2ICWA 3PHQB 1NGPL 2LVCA 1I1AB 4XP6H 5C7XH 3IDGB 12E8H 2UVFA 4F58L 4JFZH 1DDHB 1H3PH 5LGKA 4TNVF 3X3FH 5JHLH 5EA0L 4RMUA 3GJEA 4W4OA 4TSAL 1PG7W 4MWFA 3QHFH 1I1AD 1R3HA 5I66A 1MCIA 2YWZA 4JO3L 2NY6C 4O02L 4U1LA 1KIRA 1HCFX 3DX9B 3QDME 5CGMA 4TUJB 3STLB 4O9HH 5F8QC 3PHOA 4ODHL 5IBUB 3FB7B 3RWJA 4P2RB 3BN9C 1J0HA 3ES6A 1WCBB 3FQNB 5DEFB 5EOQL 5F7YC 4LSVH 4ODWA 1A47A 5I18H 2LV4A 2QL1A 3S35X 1EHXA 5DS8A 1PY4A 1LE5A 2P5WA 2CGRH 5I76A 5JIIA 1YUHA 5DUBB 2NY1C 1X4YA 1HEZA 4POUB 1ZWIA 3GIVA 4OZIE 1FRGL 2HJFB 1EH9A 4LNRA 1CFSA 4K3HA 2V7NA 2VDNH 2X7LB 4KDWA 3C6LA 2AJUL 4DEPC 3CVHL 2HRLA 3OGOE 3L5XH 3W81A 4XMPH 4DTGL 1FZJB 4PRHD 5DK2A 4KJYB 3SOBH 5KVGH 1UWGH 2CXGA 2Z91A 5HGBA 2XQBL 2MCG1 4I48B 5F97E 1RUKH 3GRWH 3UDWC 4G43B 1SEBA 1DBAH 5D1XC 1KCLA 5DJ8B 4X6CF 1OOAA 5E6ID 3GM0A 4MJ6B 2FWOB 4HXAL 5SWSA 4YR6A 1ZVYA 4AEIL 4P46D 1AO7B 2DTSA 1S78C 4O5LL 4GBXA 3RRQA 3TNNA 2VH5H 2ADFH 3RNQB 4TPRH 1GRWA 4Y0GA 2R2BB 1NBVH 5H2BB 3B9KB 4NKDB 4EI5D 5IB3A 2ICEB 4KTEL 3VWJC 3X11A 3CVIH 1DQDH 3P4MA 5A3IC 1PEWA 3L5IA 3FMGL 1JJUA 1JYXA 4WHCA 3N1GC 5HHXH 3RVXD 5HPOA 3V4UH 3O11B 4HUUA 4U1KA 3GO1L 2HKHH 3ECBA 2GK0A 2Z31B 2R0KH 3DUUA 3GK8H 4PJBB 5C9JB 2IADA 3OL2A 4ZNCD 3WHE0 4R97C 3S3JA 4DZBB 1F13A 2BOCA 3MYZA 5KS9A 3TH4T 4MJ5B 3OF6D 2ADFL 3ARFB 4LU5L 4LGSB 2DI9A 4C83A 1KLGA 2HH0H 1ORQB 2OBGA 2C3VB 4KVCL 2EKSA 1CIUA 1NEZB 1K3IA 1AXSB 3CFKA 2DYPD 3O6FD 8FABB 4FQJL 4WW2C 5I8KL 2Q86A 4UINL 2QSTA 4L5FL 4G9FD 1F58L 5JXAH 3MACH 4WU5B 2BFVL 2X4QA 4KZDH 3MCLL 2W0FB 4PJ7E 4WI2A 1EERB 5DJYB 4LSQL 3PV6A 1T2JA 2G5BA 5H35B 2XZAL 1KCSL 1KIUA 5DQ9A 4PGEA 5CJQL 2OQJA 1MFNA 3KG5A 4HKXA 2NX5A 4HS6B 3MODH 4MD5A 4ETQB 4I0PA 1F8TH 4RA3A 3BEVB 1LO5B 4G8IB 1A6ZA 1NDGA 2ZNWA 4H1LA 4XC1H 5E2UH 4G8EA 4NQCE 5DVLA 3IU4H 1HHGB 5D2LB 2NNAA 4ZMAT 1MHHA 4BSWB 1FSKB 1R3HB 1N26A 1G0YR 5I66B 2NY0B 3FB6A 2JJTC 3V8OA 2P5WE 4Z7VE 4EDWH 3V4PL 1ZGLM 3QUZA 3ARQA 2MQ3A 4Y4HB 1YYML 4KRLB 1TQBB 3BPOB 1R5IB 2DQHH 3S9DB 5AAMA 5K59F 3FFCA 1KOAA 4P3CH 3CSGA 1RJYA 1KJ2B 1MJ7H 4LCYB 1UJTA 4HLZH 4D9QD 1NFIA 25C8L 4WWKB 5IBLC 1C5BH 4NBZB 3SDCA 5F7KC 4PR5B 4L3CA 5ITFA 3GKWH 2MCPH 5DQJB 2IALA 3WNLA 5DJDB 1ND0A 1MAML 2I9TA 3MRMB 2K1MA 2WINA 1NBZB 4JAMA 4V1DB 3T2NL 3KJ4B 4N0FB 3WSQL 1NC2D 4WEMB 5I8EB 4JPWH 4C58B 4U6YB 3MA9L 4JVUA 4MA3B 5D71L 4LKXB 3GHEL 4PRIA 3QDJE 1PDKA 1UB5B 2FD6L 2PO6B 3DLQR 2VZSA 4X5WB 4NN7C 1UT9A 2VERN 1K6QH 4ZDHA 1U2CA 2NY6D 1H5BB 1YPZA 3WJLC 2FZ3A 3QJHA 5CHNB 5D6CB 1NUNB 1YEFH 5C0BA 1U8JB 3QWRD 4QT5B 2ICEA 4G42B 1NJ9B 3T1FB 3R1GL 4P5TB 5EOQH 3AROA 1JMXA 4ZO6A 4FQ2H 4NN6C 1S7VA 1NEZG 5BMFH 3T8XB 2CRYA 1I7TB 4MJ6A 1KB5H 4GBXD 2R4SH 3WNKA 4RFNB 5HSFA 1IAIH 3ZHKA 1TCMA 4HGKC 1KCRH 2VXQH 2X9WA 3C60C 3VXSB 3C09C 1F11A 2J12B 3TBYA 2PUQT 3CGTA 2YWYA 4JN1L 3K3QA 4GG8A 5BZDA 4F7TB 4DUWA 4MNQB 1AP2B 2HVKB 5DWUL 1DDHA 3BUYA 1KIQB 3DRTB 3DX7B 3PV7A 5HYQB 4UDUA 4JRYD 1V3JA 3DWTA 3RBSA 2PCPB 1FYTB 3QRGH 1HZHH 3KPNA 3QIUA 5DJXB 3F7RA 4HJ0D 3VI3E 2EDWA 4M1GL 4NBXB 1CFNA 2J6EA 2AEWA 5DR5L 4I18C 5TE7H 3HI5L 3SDAC 1VERA 2O5YL 5C0RH 4GRLB 4UOJA 4KVNL 4NKDA 1GVIA 4LCCC 3VXQB 1F4HA 4UBDD 4RX4D 5JR1H 1DBAL 4E9LA 3VFTA 1B0RB 2Q8BL 1G7JA 3C8KB 4L4VD 4NSKB 3B4NA 4ODUB 4EIGB 4PJBA 2Q6WB 1A3RL 2IAMA 2IJ0C 4TUOB 1CR9H 3JV4B 5D7JC 2OLDA 3D39A 5D2NE 4BZ1H 4G7VH 2BSRA 3GIZH 1U93A 3U82B 4XNMB 1T1WB 4ONHB 5EIIA 2PR4H 4PGEB 3DO3A 5DQ9B 3SKMB 1BBDL 1EAPA 5GGSA 4ZUVA 4I18B 4PJFB 5GGVH 2A83A 4HC1L 3VXNB 3PP4H 5CBAB 3RWIA 2DM7A 1D6EB 5ETUB 3I75A 3K2UH 4Z76B 4Z7UB 1ZE3C 3MRBB 4HJJH 5I9QC 2B4CL 4HC1A 1ZEAL 3GHEH 4OGAC 4LLAA 3U0WH 4G5ZL 3PGFL 3VA6A 3L9RB 4AIZB 2C3VA 4DGIH 1ORQA 3F7QA 4HQQL 2A6IB 5EBLB 5KSBA 5I16B 3ARED 4OD1H 2AS5M 4U0RC 1EVUA 1ZA6A 4YBLB 3HB3D 3OR7A 1AY1H 3Q5YA 4XMLL 5CAYB 3GSQB 3BP6B 5DURB 3NAAH 4RBPH 3LY6A 3FZUC 1AD0B 2BNQB 4P2RA 5DQJA 1AGCB 1WGOA 4D9QE 3GNML 1WZ1L 4GKSA 4JQVC 5IOPA 5JQ6H 4RA0C 5I73B 3EFFB 4K7PL 3MGTB 4EXKA 5SWZA 1YNTB 4OGYH 1QR1B 3RNKA 4P5KA 3PWPD 1OWWA 3QDAA 3IDIB 1MI5E 1CD9B 3KYNB 4O58H 4P3DA 3CMOH 5SX5H 5HYIA 1I7ZA 1K85A 4U7MA 4YZFE 4XTRD 1AY1L 1KTRL 4QHUB 1U2HA 1Z3GH 3HUJA 1M6OB 2BRQA 4LARH 5CCKL 3DMMC 1FH5L 5JLZA 4C56E 1Q94B 3FRUB 2NNAB 4JRXA 2EYTB 4KHTL 1IM9B 3QAZC 1JWSB 5SX4I 4P59L 4PLNC 3FAXA 4YDJB 4FP8H 2Q3AA 3HZKB 4QXUH 4K07A 3WXWL 4DOHB 1QSED 5HGHA 1CLZH 4HIXL 1N8ZA 2VXSL 2Z92B 3DMMA 2EH7H 2DQUH 2XNAA 1FORH 5LXGH 3MLTA 1T0NB 4U1IB 2Z93B 1GOHA 5C08E 4K94L 1D9KD 3KPRD 5DVNA 3O4OB 1RUMH 4QRQA 1JPGA 4D2NA 4BM7A 1B9ZA 1N7MH 5CJOL 4I2XA 4MA7H 3CSYB 5D71H 3LPFA 5B39B 1ZHNA 2VKWA 4K94C 2W38A 5DT1H 1RZIB 3HAEA 1AI1L 1JUFA 1ZK9A 4GAJL 3PDDA 3WXVH 1FORL 4PJ8C 1HHGA 5A16A 3X3GH 2DBLL 5ENWA 2F53E 4J8RA 4M61A 1A64A 3SBWC 4XWGH 3TN0C 4DUVA 4IRSB 4K8RL 3BYYA 3EJJX 3D69B 2Y36L 5F9WB 1P1ZA 1CT8A 3I75B 4JY5H 4LSTL 2PYEA 1Q9WB 3Q6FB 5BJTB 4K3GA 1U8OA 3TA3D 2VQ1A 3LHPL 3VXRE 1RK0A 4WU7A 2Q86B 4NNXB 4CU7A 4W6YB 4HIHB 3SDXA 4F7EB 3RGVB 1A4JA 5E2TL 4X8JB 1IC5H 4X4MA 5EZIH 4HEPG 3HI1B 1CICB 1WZ1H 4HS8L 4P2QE 5D7JA 3J8F7 2R39A 3ZO0A 2WLZA 4P9HC 3U36B 4DQOL 2A6DA 4JG1L 4ZPVB 4YHOL 3FB8A 2R2HB 5KS9E 1MCEA 4ALAL 3VXMD 1B2WL 1UXSB 1AO7E 3ZZ1A 5T1DH 2EC8A 3NGBC 3CMOL 4P46B 5D96C 3B9EA 1UYWH 1G6RH 5TF1H 4X9HA 5IR1A 4IRSC 1FZOA 2HJLA 2GTZB 5IV2A 2IC2A 4PJHB 4H5SA 3TC9A 1F6AA 1UXWA 1EEQA 1EVTC 1WC7A 5E24E 3T2OA 3RUGE 2DQJH 1B4JH 2X4RA 1Q9LA 4S0TD 1RZGA 3M1BA 4RFOL 1RUQH 4LVEA 5TDPA 3DBXB 4GG8B 4O5LH 2F8OA 3SJVB 4OLXL 4J3SA 5C0FA 2XKNB 5SWSE 2H26A 4MA8H 4OFPA 1UJ3B 1XGRA 1CXIA 1HSBB 1D5IL 3OAYK 3HC4H 2PXYB 4YPJA 4PRDA 5J06A 1S7TA 2ZZUT 4OM0H 4S1SL 3CFDA 1JZ5A 3U4EB 4LF3B 2ZUTA 1JFQL 4OCRL 5F7MC 3ABZA 2H1PH 1IQDB 2YZ8A 2NY2D 1U91A 1VEMA 3MRDB 2GY5A 4X7TA 3MGAA 2GQHA 3CH1B 1R3JA 4FQHB 2NR6C 5CP7B 1OAQL 5EU7E 1F4XH 3B2VH 5MERB 5DJXA 3UYPA 5C0DA 3NCFB 4ZUWB 4HUVA 4GRWB 5IMMB 4XPFH 2DQEH 4PRBA 5CKGA 1UEYA 5GRVL 1ETZB 4NUJB 1AD9A 3C5ZD 3IDJA 5F70A 5DZOA 4PLJD 4PRID 5MHSD 4JKMA 3FT3A 4I77H 4F58H 3ARWA 1DUZA 1ZLUH 5B4MC 5EU6B 5GS1B 4XNXL 4DFHA 5BO1L 2X4TB 1YEDA 2YPKA 3EUUA 2ARJA 4FQ1H 4OCXL 1BFTA 4Q74A 5F89A 2ADGA 5HBBA 5FYJU 1IGJA 1YECH 4OT1H 2QADC 3OJ2C 4U49A 1KCVH 1GHFH 2PYEB 5DD0H 3MLTB 4NDMA 5CD3B 1VACA 4FG6C 4KROC 5AZEL 5DRNB 2JJWA 4M93C 3MGOB 4GMSH 4Q97A 5DO2C 5DHVB 3UP1A 5CEYB 3BHBA 5CMAA 5EUOB 4W68A 1MFAL 1WBYB 4N9GB 3RY6C 3CNKA 5C0AE 4J4PC 1KCUL 4LEXL 4FHBD 4M5ZH 5HY9A 2XN9A 3TV3H 3PJSA 5I1DB 4G80B 4M6NL 4KPHL 4KUCD 4N1EA 2WBWB 2HG5B 5B22A 3L7EB 4OD3H 1IBGL 2VLRB 3VFWB 1AXTL 3GB7A 2E7HA 3K1DA 4LRIC 3HLAB 4MA7L 3KDMB 2LVEA 4RFOH 3M17A 4XI5C 4D9RE 4EQ3A 5C9KA 3RNKB 2D7QA 1T1XA 2Y25A 1TIUA 5KVGL 1EXUA 4EEEA 4N0CC 1WC7B 5IKCB 3LB6D 5IBTH 3G6JF 5GRVK 4BQBA 1PZ5B 3DRQA 2BMKA 1KIPA 4NFCA 2QSCH 4WW2A 3PWLA 2H2PC 2X1WL 4HCRL 3K2MC 1OSPH 1RIUL 1N8ZB 3W82A 5I1EL 3KPQB 3MV9D 1QFUH 2XICA 2EDYA 4PJ9A 2VDOH 5HHQA 1OWRM 1LO2H 4ODWB 1A3QA 4Z7QF 3VGAC 2BNQD 2DAVA 3MUHL 4E5XA 4LCCB 3I2CL 4NO0B 2YXMA 3GSUB 4LSQH 3V6BR 4FXGB 3DXAD 1JWSA 4OF5A 3SKUD 5GIRA 4PJ5E 3T0BA 4P2OC 2X4UA 1QA9B 1FP5A 2X9XA 3M45A 3QXAA 4FFWC 5I1HL 3QFJA 2DQGL 3H0TA 4YBHA 5HHXL 3N1FC 4I9WE 4MLSA 1INQB 2W9DL 3SDDC 5MI0C 3DI3B 3NTCH 4N5EC 3T4AA 4NUGH 1CD0A 1DVFB 3DYOA 4P9ML 4Y2DC 1AR1D 4KRNA 1YQVL 1VFUA 3QG7L 3DI2B 3RDTA 3UROR 1C5CH 2A77H 3WLWC 4GT7A 1FGNL 4EOWH 3FOLA 2F54E 1RJCA 4FRWA 3KLDA 3EYOA 1EJOH 3ARGB 3ZYIA 3SE9L 2V5MA 3WNOA 2B1HH 5KAQF 4MB3A 1QRNE 2NY5L 1WITA 3I9GL 1XGRB 3RVUD 3ROLB 4KQ3H 1YMHB 3LKOB 2PYFB 4KVNH 1BOGA 2VE6A 3BPNB 5CGYC 5TDNB 3ZT6A 4ZOEA 2R69H 1NCBH 2DQJL 2AI0L 2QBWA 3QG7H 4JDTH 4Y4FD 1PGRB 3ZYOA 2ZP0T 3TVMB 4I5BB 4LNRB 4KGJA 4LSPH 3FOMB 2CDEB 4PBWD 2ARJQ 3V6OA 4YFLI 5J4MA 1NAKL 4ZYKA 4R2GD 1DLHA 1IL1A 3OKKB 3C2SA 3CDFA 4PRIE 4Y4HD 3SQBA 2PN5A 2ZJSL 2H41A 3D9AL 5F9JB 1TQCB 3S36L 4KC3B 5JORB 1MFCL 3RL2A 3CDYA 2HG5A 1P4LB 3BGAA 4FTVE 4P5MA 2BJML 1JYVA 2A6KB 4XHQA 3VXRD 4YNYA 5FV2A 3RWGA 5A2KH 1WFUA 4JANA 2HT3D 5B3JF 4POZD 3CK0H 3P77B 1D7FA 1GXEA 5CP3H 1Y18B 4L4JA 5IVZB 2P47B 2Q3ZA 3V6FA 1FFOA 1ZT1B 1S7WB 3KPSB 3ULVC 3CCHA 4N0UA 3IB4A 5L6YH 3O6KH 3BKML 3GIVB 5BS0A 3EO0A 3RX8A 3BSZH 3ZKND 4JFDE 1MEXH 5E5MB 5HD8D 4WUUB 5FKPA 5CJXA 2HTLC 4UAOB 5JQ6L 3FCTB 3PP3K 4G6FD 3KPMB 5F88B 4MNHA 5GS1A 4FXLA 2NMSA 1FAIH 1FDLH 3ZKXC 5DFVC 4KKBD 5J1AA 2GAZB 5E56A 2B8OT 5HGGS 2ZCKH 4X99B 5EUOE 2OYPA 1IKNC 4U33A 2EH8H 3HRPA 2VRAA 4H25A 4JN2B 1JZ6A 4BUHA 4S10A 1R24B 5FYKU 2GEEA 5C0DB 4MQ7A 1Q9OB 1NGYB 4KXZH 1KIRB 3REWB 1BECA 3RVTC 2W91A 1KCSH 4PPTA 5H37H 5C08D 3VGEA 5HHQB 1LHZA 1MLCB 3KDMA 1HXYA 4N9GA 4JFPB 2NY0C 1BD2D 4EI5B 2CK2A 1QZ1A 3OKMA 3MRDA 4KPHH 4OGZA 3MOQA 1A7BA 4YHZH 1N5YL 2VXSH 5FKAA 2D03H 1RJZA 1VADA 2PXYD 4YQXH 4HPYH 1RIHH 3QULA 3ZSTA 2OP4H 1T7XA 4X5WA 5JW4M 2DI8A 5E7FA 4JEGB 4XZUB 4E0RA 1CBVH 4XBGB 1T0PB 3EO9L 4Y1AA 1T04B 5I1CH 2I9LB 1HH9B 4NKIH 4G8IA 1QSFA 1QLFA 1YYMH 4XI5D 4U1NB 2ZKHL 4RDQF 2X89A 1IGYA 3GM8A 2NXZC 4MS8D 3W39A 1PD6A 1I8IB 2H8PA 5J57B 1MUJB 2APVA 1HNGA 2BVTA 1DVFC 3MNZB 3MRJB 4WGWB 4DGYH 5C09B 5EFIB 3MXVL 3STBA 1RJYB 2DD8H 3O3EB 4JFED 3V52L 4LCYA 1VCAA 1KJ2A 2DB8A 4PJ5B 4ZUUA 4HWBH 4P23C 1NAMB 3I2CH 4P23A 2CJUH 4AIXA 1UZ8A 4Z77B 3ARGD 4F8QA 1A0QL 1Y6KR 4Y4FA 5F96H 3VRLF 4Q9QH 4M43L 3CK0L 1VGEH 3QFJB 5L0QB 3BEVA 3BP5B 3L3JA 1JRHL 4FTVD 5IK3B 4CU6A 4BZYA 3BKMH 4U4BA 2YPLA 3SGJA 3W11D 1M7DB 3MCLH 2BY2A 5IBLD 1JGDB 4P0DA 1H9VA 2ERJC 1TPXC 2GSGB 4ZQKA 3IKCA 2SEBA 2FLBT 2DLTA 2FHFA 2PO6D 2VTFA 2W59A 3RIAK 1HHHA 1AGCA 4KWUA 3Q2CA 4BH8B 1A1NB 4NKQB 2EIDA 5CGYD 4F7MB 3T0EE 3IFOB 4HIIA 1VB9A 4KXZI 4PB0H 3P9MB 2EKJA 1AR2A 2E7CA 4YWGH 4N0FA 5CJOH 3K1KC 2PKDA 4YPGA 1FNEA 4P5MB 1T2QH 5BS0B 1YEEL 1IQWL 2CIKA 4OI8A 4UU9A 2NTFB 4ERSH 1XR8A 1J5OL 1WLHA 1XIWB 5HI3D 2KQNA 3UYRL 3VFVB 1JPTH 4OZFG 5EDXA 2ORBL 5FUOH 5I30H 3HFML 1JZ7A 4U1GC 1FIGH 2WIIA 5F7DB 5FKAB 4YIQB 4U1SA 4DEPB 2VZVA 4S1DD 3A6CL 4R4FH 4HGWA 3V5KB 5E6YA 3MA7B 4A6YB 1EFXA 5TQ2L 1WBZB 5DUPL 4CAGA 5DMIH 3IXTA 3DV4B 2I07B 4N8VG 3EGSB 1J9CT 1XR9B 1D5XB 3HR5A 2VLKD 1OPGH 2YMXH 4KKLC 4QTIH 5INCB 5ACZA 3L3GB 4C55A 2D7NA 1YMHA 2RAMA 3GI9H 4QHUA 4MHHG 4R4NC 3PF2A 5IWLA 1IC5L 2OI9B 1G1YA 4L8SB 3TA3B 1QNZH 2PYED 4DZ8B 1ZVSB 2I9LA 4N8CH 3FCTA 3REWA 5I75C 3V2AR 4K3JH 1S5IL 5F96L 4MJ2A 2PCPA 4XPGH 5HI4D 3BO8B 5DF0A 4LDLB 3C6SA 2C1PA 2DLHA 2V2WB 4LEOA 5GHWH 3KPLB 5IG7B 2OL3L 1CIDA 2YS4A 2I27N 1OQXA 1T6WA 4MJIA 4ZOCA 1X7QA 4LQ1A 3RWHB 3FTGB 5D93B 1XCQB 1SMOA 4Q6IA 3O4LB 4L9LC 4N0YH 4PJ9C 1CDCA 4WI4A 3P77A 3OXSB 5E5UB 2GJ6A 3U0PB 5T1KB 3MRCB 3DPBA 1NGYA 1XT5A 3VFOA 1UWXK 3L3JB 4L3AA 1FAKT 4X7EC 3U0TA 3R4DA 1A9EB 3OKNA 3QFJD 3RQ3A 4PJGA 1KT2B 3S34L 2V17H 4KKCC 4HAFA 1I7RB 3QWOB 4M9OA 4ZO8A 2VAJA 4MZ2A 2P45B 2VDLL 3ARTA 3QHFL 1HILB 3LKQB 3SO3C 1JF6A 3KXFB 3QEUB 4HJ0C 4ONFL 1FE8L 1ZT4B 3TCLB 3CDGA 1QACA 3O2VL 3BKJH 3W5NA 1MFEH 1EUUA 5E2TH 4NKIL 3FHQA 5T3ZL 3IDIA 1KEGL 4P2CG 2YPVH 3AREC 1DQTA 4TTDC 4IM8A 1BZ9A 2FJFA 4JPKL 4M02A 1KTLB 4R26L 4JN2A 3U7AA 5IB4A 1I4FB 3BGFC 5DVOA 5EBMB 4JRXB 4ERSL 4M48L 1P53A 1DANU 1I3RB 5L2JB 3STZA 2NXYB 5IROC 1BBDH 3RY6A 2E6JA 4W70A 4NCDA 3MOAL 1QKZL 3KYMA 4GH7B 2BY3A 4R96B 4WFED 3HMWL 5I16A 3QXDB 3SCMB 3P30L 4N90D 1JN6A 1OLZA 5FDWB 1VSCA 1HSAB 3E8UH 2FSEB 3ARUA 2QJDA 2ARWA 5ESAB 3VRJA 2E9IA 1F45A 3GSOA 1OQOA 2EXWC 3NZ8A 3F7PC 2MJWA 3FFDA 1JGVH 3BAEL 1EEZA 1KACB 3NA9H 1MWAB 4NZTL 4S0SD 3MPCA 3QDJD 1RPQA 1FNFA 3TN0B 3VFRB 3CU7A 2RGSA 3EZ8A 3BMWA 3MO1B 2QQNL 3HZMB 4JFOB 4GUPA 1NBYA 4TSCL 2DQFA 1DFBH 3TEUA 4GQ9H 4M1DH 2FH8A 3SEPA 3VXTB 5DD0L 3UJTH 1T21A 5DEGB 3KYKL 1Q94A 1C5DB 2B4CC 2YHGA 4DKEL 1A6VL 2VLJD 4AEIH 2WBJB 2AJUH 1BJ1H 1WCBA 1GSMA 4OZHA 3Q1SH 4X80L 3H2WA 3VXOA 5E99H 2OMBA 4HPOL 4OZGE 4LLWA 3P4MB 4BQCA 3RUGB 1S7SB 5C0FB 5D2LE 4P5KB 5FV1L 4KK9C 4Y16D 4UZGA 1G9MC 1D5BA 1BAFL 3TM6A 1CT8B 3VFVA 3EHBC 5JHDD 5F3HB 3JWOL 4AL8H 1JGLL 1HIML 2YZ1A 5JXED 4PB0L 3U48A 2R69L 3P2TA 4QRUA 2NYYD 2JB6A 1DLFL 3MV9B 4G6MH 3OAZH 4CW1B 5IROA 3NZHL 2KZWA 2X4NA 1IQWH 2JJTA 4X6BA 5CZKA 5HI3C 3P9WB 1CCZA 4P48A 5B8CC 1JNHA 4NO0D 4OUUB 3GZKA 1TJGL 2X4OB 5DFTA 3EBAA 2I07A 1U8QA 2RQ8A 2X89D 2Y9RT 1GGUA 5GJSL 2HFGH 4NRXA 3VH8A 5MEND 3QZWA 5CP3A 1CFBA 3LAFA 3LV3B 5BXFB 1CE6A 2PF6A 4J6RL 4MS8C 2WM0A 1LO2L 1CLYL 2VDMH 1BVLA 4JPVH 3AMLA 4WO4A 5HDQH 2HA1A 5IB3B 5DHYA 2UZYB 3QIWD 1IFHL 3HR6A 3ZKMD 3HKFA 1FPTL 1OARL 1G9MH 1QLRB 1NC4B 4UQ2B 1ADQH 2CUIA 1XGPB 2MHAA 2E7LC 2DKMA 4NIKB 2C3XA 4IDJL 3S3PA 1GAFL 4QRRB 1TZGH 3Q6GH 4UT6L 3EYSL 1QSFD 2CIKB 3DUHA 3E8UL 4Z95H 3NTCL 1AGFA 1JHTA 4Q6IC 3FO9A 1IMHC 1A21A 3VDAA 1UQSB 3LMJL 3V4PH 3ROOB 5C7XL 3FO2A 3MRCA 3QCUL 4HS6A 3TWCL 3P9MA 5C6TL 3ZT5A 5CEYA 2C4FT 3U36A 3BW9B 2YD2A 1HKFA 4JREC 1H8OA 1NC2A 3HE6B 5EBWB 3QUYC 2DMKA 5DXWA 4HK3J 1QFWM 5B39A 5IG7A 3NCYS 3DYPA 2B2XH 1NCTA 3ETBF 1AXIB 5KANI 4NHCH 1JRHH 5SWQA 3WFDL 2UZIL 3DETD 4PJ9D 1E6JL 3QA3A 1ORSA 3DIFA 3KLAA 1T20A 4WI8A 4LKXA 1BD2E 1HWGB 4Z7OE 3HG1E 5D7JB 2NY3B 2I25N 4RAUB 1QBMH 3L7EA 3IDJB 2NY7H 5M7QA 5HYJE 4IRSA 3GMMB 4XP9H 4OCMC 5C07E 2YXFA 1OF2A 3VI4E 5FCUL 3EOAB 5I1KH 3IF1A 1MCSA 1A6ZB 3G08B 4HMDA 2G60H 1S5HB 3O2VH 1ZHBB 4Q9BA 4XBPB 4O00A 2UZIH 3AS2A 1PSKH 5C09E 3T77A 3JTSA 4P5TA 1VA9A 5DD5H 4U6YA 4MD5B 4ETQA 3BE1H 3KPQA 3TJHC 1A7QL 1A6AA 4KHTH 1NGXB 1GC1H 4GFTB 4OJFH 1OGAB 4P2OD 1IQDA 1QBML 1A7PH 4K7PY 3F8UB 3UBXA 2UUDK 1A22B 1F8TL 3SDDB 3QWRA 5A2LH 3VGAB 1YMMA 2YA2A 3IDNA 4FQIH 1LP9B 2IBGA 3AGVA 1G7PB 3QFJE 5FUCE 4KAQL 2C1OA 1U3ZA 3IDUA 2D7TL 4FN0A 3CIQA 2D4FA 1U8IB 2XTJD 1A14L 2L0DA 1BFOB 3KWWA 1FGVH 5IW3A 4WHYH 2NW2A 2B1AL 1NFDB 4PRHB 5DTFA 2VLJE 4P57B 4YK4B 1BQHA 1I1RA 1YEHL 3GBNH 2AJYL 3HI5H 1QSEB 3CVIL 2AGJL 4AT6B 2VDRH 5GSVA 2H6PB 2DQCL 1R5WA 3LRGA 5D70L 1T66C 3OKYA 4F57H 4Z7WA 4EUPG 4UQ2A 1S7VB 1I8LA 2EO1A 4JHBA 1BQLH 5HYQA 1W72A 4I9WD 5EU7C 2WAHA 3RHWK 1YY9D 2XWJA 5A43C 2XFXB 3LEYH 4PP2A 1MHEA 5DWUH 4DK6A 4U3XA 3KNBA 3MV7B 1HINL 1I3GH 4XVSL 4IRJC 2IANE 5CZVH 5C0BB 5HGDA 2DMBA 4HHAB 2X4TA 4M1GH 4QGTA 2IAMD 2QR0B 5TE7L 3K74B 5DRWA 4WO4C 2ILLA 3CVHB 4LVHC 3MV9E 4XXCA 4NKOA 4UT7L 1S8DA 5EPMA 3W5MA 5ALBH 5I8EA 1EBPA 1O5DT 3SGDI 2EDFA 3ZHDA 4ZFGH 3PWPE 1JI1A 4PJFF 4QHNB 3O6MH 4ONGH 1KPRB 4UDTB 5B8CA 2ZNXA 2FNBA 2PETA 1KJMB 4EDXA 5FYLH 4XBEH 1ZS8A 3KPNB 4QY8A 4DGIL 3UXFA 3ZL4H 5HVHC 3SE9H 4J3WA 3WV0A 3SKJH 3HPLB 1WV7T 4HGMA 3DX7A 3O0RH 5DUMH 2GJZA 4PLKD 4QNPF 3WUWA 1OGTB 3H9YA 4H88H 3GHBH 4YE4H 5JPNB 5GJSH 1E4XL 4GAGL 3U7YH 5IP4A 35C8L 4OLUH 5GPRA 4BFBD 4XNMA 5CZXD 3B2UC 1RUML 4PJIE 2DWEA 2HAZA 4FFZH 1MNUL 5I1IH 3T77B 5DEGA 1X3DA 4U1HA 2A73B 4Y1AB 4OZIF 4KJWC 4GAFB 5FGBA 4QXTB 1LO3L 4LRNL 3TZVB 1KXQE 5DUPH 4LSUL 1LNUA 3C5JB 3VXPA 4EQ2A 1CK0L 3ULUL 2ATKA 5DC9B 1EAPB 1ZTXL 3H0TB 1FV1A 4RISH 1QFUL 1LMKA 4CN6A 3T1WA 3MRRA 4RNRA 3CH8A 1FN4B 2I26N 4HJGA 2X9YA 2LU4A 3ZYZA 5TE6H 5HHMD 5C09A 3LKNA 2J8OA 3O2DH 2CDFB 4GRLD 3QB7C 3DUSA 1YPZF 4UDUB 5BRZE 1KXTB 3WDHA 2HJKB 4P2OA 1DANT 5DLMH 3EDKA 1OCWH 4ZSOB 4A6YH 6CGTA 3LH2H 4JO4L 3VFMB 3HG1A 1W72L 3VFSB 2J4WL 4CMMB 4JQIH 3ZTNH 2J8UE 2V2XA 1ORSB 3KXFD 4D0DA 1QBBA 1H0DA 3DVIA 1QFHA 3DTXA 3WL9A 5IOPB 4CBPA 5JHDA 3VXSE 2BC4A 4B7IA 3EYVB 3WCYA 1PEZA 5E0QA 3U30B 1QEWB 1NMBH 1KV3A 2UWEE 3JV0A 1TVHA 3OTTA 3IGAB 3NACH 5ANME 4D9LL 3NCEB 3L5HA 4KK5C 2X1QA 5FYJH 2BHZA 5EORL 1D5BB 4XVTH 1VFAB 5SX5K 1ZLVH 5KANG 3VG0H 4DVRL 5L88L 1KELL 1S9XA 1MJJB 3TNMB 5C0BD 3WE6A 1KLUA 5DRWB 4WTZA 4O2CB 2AXGB 1KJ2L 2YKLH 4WUKL 1N6UA 4HAGA 2DQIL 3S36X 4PTUB 5IQ7H 5BQ7A 1U8KA 5T3ZE 3G5XB 2DJ4A 3V6OC 4LP4A 3EOBB 5I6XB 5IT2L 5C07D 4CNIA 4LMQE 3NFPA 3CLEL 3VE0B 2YN3A 1MWAL 3S4SA 4OUUA 3KPMA 1BGXL 1M1SA 1G6RB 3KPSD 3WNNA 1QYGH 4PJEA 3QA3B 1RMFL 5L8KB 3S88L 2AEQH 3H42L 5T5NF 3MRIA 3EO9H 2Q76B 4LOUD 1MFCH 4OKDA 1AGBB 1M7IA 4NQED 4KK9D 1V8HA 3OB0K 5D2LF 3RL1A 3UJIH 2OSLB 4YX2L 4MDJA 5GGVY 3VG9C 5E00B 2J5LC 2MPAH 5T1LB 1QQDA 5J8OA 1BIIB 3VXME 4PJFE 4OAWA 2HTKD 4P46A 5GS3A 4W6WB 4LDOB 3WJLA 2XXCB 4G8FB 2AKRB 4H0GA 4OF6A 2KBGA 3IDYC 1JPST 1LO0L 1X5HA 3SPVA 5F1NA 4PJ8B 1MCJA 4X6EB 1A2YA 3TBVA 4D0CB 4A6YA 3LCYA 2M1KA 4PLJC 4PY7B 1MPAL 2I60H 3GRWA 2R1YB 4EI5C 4J12A 3V0VB 1RJLB 1K8DB 1U8OB 1I85A 2N7BA 1T89A 2AJSL 1KJVA 3T0EB 2RJMA 1X5GA 1JWUB 3B9KA 3QJFB 3RI5F 1X5AA 1P69B 2EXWD 4DN3H 3WO4B 5C08A 4MA1C 4GAJH 3V5DA 4OLWL 4IOSD 4MSWA 3FHAA 4S11A 4GG6E 3QR2A 4OZGA 4LGRB 3VXSD 2A38A 4ZUSB 1EDQA 1JFQH 5F9DC 1JGLH 4NUGL 1XZ0B 3MNVB 4CL7A 2FEEL 1JTPA 2D7MA 3OQ3B 4LCWA 4M7KH 1FJ1B 2HFFB 1DLFH 3TO2B 3VWJA 3HC0B 2A6DB 5IF0B 3INUL 4PJ7B 4OGYL 2FJGA 2OMNA 4PRHE 2H32A 3U83A 1UM4L 3HPLA 3GMOA 4QHKI 1NGQL 2P7TA 1YY8B 4I3SL 3GHBL 1CGYA 4YE4L 5FYJD 2OZ4A 2NZ9C 4GKNA 4JO1H 3TCXA 5ADOH 4PJBE 1Q72H 2HJKA 1T7WA 2VL5A 4KRMB 3BP7B 5C3TA 1F6FB 3JV6A 2OTUB 3BDYL 5J6HA 2UV3A 5KOMC 4Y4KA 1O0VA 2G2RB 2YPLB 4U2YA 3BKYH 1FL5A 2NY4C 5JDSA 1OTUC 1S7TB 3VU2A 4NZTH 2VYRE 1CG9B 5ESVA 4NYLB 2QSQA 3L3GA 3TJEH 4S1RH 3TBSA 1LNUB 3C5JA 1RMFH 5BV7H 1LP9A 4FNLL 2MFNA 4LBEA 3C6LC 5HHOE 2J8UA 1G7QA 5F7UA 5BJTA 3TO4A 3RWJB 4OTXL 3SDCD 4M1DL 1IAIM 2XKNA 5DA0B 4MVBC 1SM3L 1VFAA 4ZFFB 1VPOH 3MOBH 5LVEA 4NN5C 2YEZA 3BKYL 4X83A 4JHAL 5DT1L 2C3GA 3WHE1 1CXFA 3TV3L 1X7QB 1VFMA 5FM8A 3SE8H 1KULA 1QSEA 4Y19B 3RWFB 2HT3C 3NABH 1I7RA 1BX2B 1E4XI 1QFPA 1T4KA 3SDDD 1G7MB 2A73A 4YEEA 5HYSA 5FO9A 5J13B 4K7FA 4JM2C 1UA6L 1QFWI 1AHWB 2DWEB 3D3VA 3TT3L 4ZPVA 5F44A 3EIFA 3RFZC 1FL3B 5DK2B 2XG5A 1EMTL 4ELMF 1TETH 1UH2A 2X70A 3BAEH 4OLEA 5AAWA 4OZIB 5D7LA 5K9JH 4O4YL 3V8CA 4ZAKC 3UMTA 1BZ9B 2FJFB 2R1XA 4GRMB 3QDJA 4R2GC 3CFCL 3QNZB 5EA0H 1G7IB 4PTTA 4O51B 1RIVH 2DICA 1FFNB 4L29B 3U46A 4RMVA 1CD8A 2CDFA 5KVEL 5D1ZA 5IQ9A 5CJBA 1JHKH 1I9RH 2QEJA 3ARFD 5EZOH 1QR4A 4N0YL 1QBAA 2GYSA 3B6SA 1FLTX 1RI8A 5DD3L 4GXVH 2OR8A 1L0QA 3GMLA 4ZG1A 4X7TB 2HKFL 4UILL 1BVKA 3TPUA 4G6AD 3OMZA 4U7SA 3I6GB 4MDIA 4HPOH 4NN6B 1E28A 2JF1A 1OARH 1XZ0A 3DARA 3IDMB 5AZ2H 1S9WA 5JA9A 3QUML 5HVFB 3G04A 5B3JE 5IFHL 4FQLH 3FN9A 1EO7A 4Y16A 3C87A 1XIWA 4NC0B 5D72L 2IQAB 4Z7VA 1ZT7A 3JVGA 1FNGB 3LN5A 2FGZA 1BFSA 2P8LB 3IGAA 3EKCA 3QEQA 4YXKH 4D3CH 4YDLB 5GRUL 4DGVL 3DECA 2G5BB 2HLFD 3MV8B 5FGSA 3C6LD 3L5XL 1FVDA 1ACZA 3ESUF 2AK4A 3IJYB 4NZDA 1OM3L 2OXGA 3OHXA 2YD3A 1BIIA 2WV3A 3QCUH 5GGTA 4H5SB 4NP4H 1BQUA 1F6AB 5DO2D 3MRQB 4POYA 5IMOB 3QO0A 1JZ8A 2BSTA 2ZCHL 1JNJA 1HDMA 4GLRI 5CJXC 4ZFOA 1XGYL 5HVWA 3O6LL 4TUKH 3G9VA 4AIOA 2CIIA 3GJFB 2WUBH 1RZKH 3MLYL 4QF1B 3T0WA 1OB1A 4ENED 2LAAA 4HC1H 4AQ1B 5ACZB 3HTLX 1F42A 1MAKA 1XGUB 4J1UB 3VI3F 5IW6A 2FL5B 3QCTL 4LLWB 2OX5A 3MNVA 3FQXB 2AJSH 5C0GB 2ZUVA 4XVSH 3VFGL 2A1WH 4PRPA 1FGNH 1G7LA 2D3VA 2CKBH 4M7LT 5A3ID 1KB5L 3B8YA 4KTEH 3V5DB 5FA4A 1GGBL 5IVOA 1VFBA 4ZPTA 3MLYH 5DLML 4PJCE 1LO4H 4QCIB 2IPTL 1BEYH 3AAZB 3MRNB 5FOBA 3LEXA 2R0KL 3TN0A 3QUYA 3NPSC 1ZT4A 3TCLA 2FWOA 5DD1L 5E2WH 5T1LA 1IE5A 3BP7A 3O3AA 4JE4B 2AXJA 5E1AB 5D1QB 5IVXA 2BNRA 4D0CA 3MJ6A 4PREB 5E8NB 2BC4B 3O6ML 2IBZY 4OI9A 5C07B 2AK1H 1DSFL 1T21B 5F1NB 3HI6L 4M6MH 4NHUA 4P5TD 4OZIA 2P43B 2GHWB 5SWSD 2P42B 4U6HA 4KDTA 3KYOA 1MVUB 1ZGLP 5CWSB 3KYMB 5C9JA 4N68A 1Y0LA 5FECA 5AZEH 2NZIA 4OFKA 3SJVE 5EZLB 2HT2C 4FTVB 1UCBL 1ZHKB 3BZFB 5HHOD 5FO8B 4KKLD 4NT6B 5KSBF 2R23B 3P0GB 4X5LA 5GRYA 4R26H 2VXUH 5EU4B 5IB2B 3B5GA 3MV7D 2XQBH 4M6NH 3QUMA 5INDB 4M6ML 2J6EL 4S1QH 1NC2B 1OL0A 1QYGL 4MX7A 4OTXH 2F8VA 4PB9H 3DHMA 1IGML 4LFHD 5DJ0A 1FIGL 3ULUE 5ESAA 4OJFL 3WFCH 1A6TA 2DLFH 3WN5C 2J8HA 4J23A 1U0QA 1MJ8L 2CQVA 5J12B 3GMLB 4OLZH 1QRKA 2D9CA 3GSRB 3LD8B 3CMGA 3E6HB 4JRXD 4Z18A 1OD7A 1UACH 2ATPA 25C8H 4QEGA 1WAAE 2WINB 2XTJB 1ZA3B 1ITCA 1DQDL 2Y6SC 1KEML 2AJZA 2EDRA 4GG6A 1IC7L 5B38G 2DBJA 4NM4H 3SHSA 3B9KC 5HYSB 2YMXL 4NPYB 5I1CL 3W2DL 4WW2F 1CN4A 4G6KH 4FQQB 1I8MA 4HZLB 3QCTH 1H15B 2FYYB 4Z7VF 3EO0B 3FB5A 4XTRC 1CXEA 2DLFL 4OF0A 4CN4A 5BXFA 1AD0A 1KG0A 4UTBH 3QEQB 4PV9A 4PGJA 2ITCA 1E4WH 1HHKA 2DLGA 4MZ3A 3JWDL 3WFEH 4I13B 3UTPD 1KEMH 2DF3A 4NZUH 2IPTH 4LRIA 2ZOKA 3BPCB 5F9OH 1OGAE 4F7CA 2YD6A 2YSSA 4TSBH 3U9UA 3S35H 3IDNB 1Z9SA 1CBVL 1U8MA 1ZLUK 3T8XA 1RAMA 3O6KL 1ZSDA 3CD4A 5I74B 2XRAH 2CRMA 4LHUD 5F93C 2BVEA 2J88H 3P0VL 5C70A 1HXMB 1DEEB 5JUEH 1I9EA 2CDGB 4B0MM 5CZVL 4L3ED 2E8YA 3NMEA 2JIXD 3T0XA 5FHBL 2XZCL 1F4AA 1YEEH 1LILA 5IB1A 1NGZB 5ERWA 1IAII 4OIAA 1X6LA 3I6KA 4NRZB 3VXOB 5L2KD 1GOFA 4H0IA 1B4RA 2H6PA 1NCBL 3VH8B 3IRPX 3GMMA 1H3WM 1J0IA 3NAAL 3WEXB 1QFWL 2JLLA 3WIHL 4X6DB 3RX7A 4MXWH 5D6DA 3KYOB 5DDHB 4Y4KC 4Q0XL 2IAMB 4TUOA 3K0WA 5EO1A 3UBXI 2DN7A 3SDAA 1HOCA 5KBNC 3HC3H 4IRZH 3MV7A 3V7AG 1U8HA 2R8SH 3DIFB 5DZNA 5AD0B 1A1MA 1A0QH 5F7EH 3K8LA 3D87B 4KJWD 4WDIB 4C4KO 3S8WA 3QIUC 1AI1H 5GRZA 4ZODA 3P4LA 2NXZB 1JK8A 2CIIB 2KL6A 4U6VH 4RRPG 2CLRA 4HW6A 3V4VL 5CSBA 1J7VR 1ZXQA 4OZGF 1EEYA 5I8OL 4ACPA 3UPCA 4ZXBA 3V7AE 1U3JA 3D1MC 4RFEA 2NW3A 5JHDE 4FFZL 4Q0XH 1DEDA 3MROB 2YA0A 1ZLVK 1K8IB 1JZ3A 1W0WA 1C1EH 4Q7DA 4HS3B 2W07A 4BZ1L 3WLBA 1OVZA 1U8IA 5A1AA 1R3IH 2NQCA 5IK3A 2BP3A 3QYCA 1IC1A 4F7MA 1N59A 2W9LA 1MCLA 2ED7A 3UAJD 2OL3B 4XCFL 3REVB 3D85B 1A7NL 3WFDH 1Z3GL 3MV01 1MF2L 3RWCA 4XP5L 5DC4B 1LEIB 2BDNH 2VIRB 3BT2L 1R3KB 4YHPA 4UTBL 3BN9D 4YWGL 5C0NC 3U0WL 3X17A 5CUSH 4DW2L 4Q9RL 3B3IB 2Z8VC 1KJ3H 2GTZA 4HIXH 1IAMA 4LIQH 4OZ4B 3KHOA 5KVFH 3F5WA 1NLBH 5CFHA 1GPOH 1IC4L 1HHHB 3ARXA 2G60L 1IGFH 4LPTA 3RZCA 5IHUL 4JO4H 4KI5C 1PSKL 1IAKB 4M03A 4NQUA 1N3NB 3C08L 4XWGL 1DVFD 2KKQA 4DZ8A 4MJID 3Q0HA 3KS0H 4ZFGL 2GSIA 3ULSA 4XH2B 3SDCC 3OX8B 3U1SH 2PNDA 3MBEA 3IAQA 4PLOB 1SY6A 5JMOC 1PG7X 2X42A 6FABH 3UTTD 1I1YA 1UWGL 1G9NC 3DVGA 3LS5H 1CF8H 2BY0A 5KOVC 4WU7B 3AVEA 4NJ9L 4XCYA 1LVEA 2A9NH 3OXRB 3MOAH 1T7ZA 3VRLE 5T5FH 2BVUA 4U1IA 4KQ4H 1X44A 4H26A 3LN9A 4PG2A 3RZWA 1SBSL 1L7IH 5EUOA 3VA2C 5LWYH 5CEZH 3P0YL 4JM2F 1I1CA 3BZEB 4XB8A 5EWIL 5LCVL 2VLKB 3PABB 5TFSH 2DIAA 1E4KA 1HH9A 2VZ1A 4L3EA 3L5JA 5HI5C 3OZ9H 4I48A 1VDGA 1V3KA 3C9NB 3V5KA 5JLZB 3BKJL 4MLIA 4I0PB 4PJEE 5IEKB 5C0CB 3G5ZB 1T3FA 4L4VB 3QXTA 1DTUA 3AB0C 3FB5B 1G7PA 4YO0A 1KCKA 1I4FA 3TIEA 3QUMB 4HUXB 4RAHA 1I8LC 3TWCH 4BK5A 3KHQA 4W4OC 1L6XA 3ILPA 1L7TL 1BM3H 1TTFA 3WDJA 4QY8B 4YAQA 1FZOB 3UC0L 1AXSA 2C7UA 2FIKA 3D0VB 3C09B 1LK2B 1DZBA 1LO4L 1K4DB 5TDOA 3W0WB 3E6HA 3F7YB 2D31B 4JLRA 4JREB 1BREA 2ZPKH 3F58L 4WW1B 4DZBA 2ZSWB 3RVWC 4K2UL 5ITBL 1CS6A 1KTKE 1WBZA 4FG6D 3RDTD 1S5IH 1DN0B 5IJVA 4WEUD 3RGHA 3C5ZB 5HHPB 3U0PA 1D9KA 3KPRA 2NXYC 4NO2B 4BFEA 1HQRA 4UV7H 4N8VB 4AG4L 3LRSA 2OS7A 5IIEA 4NRZA 4FQCL 3OJVC 1DVFA 5GRJL 4JM2B 3DBXA 5F7FA 3TP4A 3IU4L 4KK6D 1JPFA 2P5WD 1I1FB 1KJ2H 2YKLL 5D7IF 5GZND 2GITB 1NUFA 2H2PD 3NCBB 4M7KL 3IU3A 2R1YA 2XWBA 3D48R 4RQQB 1DQLH 3VGGA 5JZ7C 5J11C 4KDTC 4KKBC 5DK3A 1A5FL 3WIHA 3OX8A 1FHGA 2IMMA 3ULUH 1ETZA 3SGJC 3EOTL 2W65A 3T0ED 1MFEL 1OTTD 1JTTA 5I1EH 1CFQB 3FT2B 1EGJH 2JB6B 1EZVY 1UKTA 4MA1B 3STZB 3MUY1 4ZXBB 3WKMH 3RWDB 3VWKC 4Y19D 3KJ4C 5B21A 5MERA 1A6VH 3BVNA 3PQYA 1GL4B 1NSNH 4YFLF 2BVOA 4XNUL 1JF1A 4YUEL 3B8SA 1DE4B 1FSKC 4XXCC 3BKCL 4BKLA 1IKNA 2ESVA 1LO0H 4X9FA 5FB8B 5DMGD 3VD4A 4OKVB 4A2LA 1U8HB 2R4RL 2WSKA 3W9DA 2EXYD 3QEGL 4OM0L 5KSUA 3N85L 3MZTA 4U2ZA 4JB9H 5T33L 1TVDA 1XF2B 1MCWM 5GS1C 2GUOB 4JO2L 5E2JA 1OW0C 2KUTA 4LAQH 1C5DA 4O2CA 5BS0D 3BESR 3WNMA 3N1MC 4PJAB 1MFDL 1U8NB 2ZCLL 1KCUH 2GTWA 1Q9KB 1OAXH 1RU9H 2HLAB 3EDDA 4HDIB 4M6AA 4WV1C 5I19L 1YN7B 3PWPB 5GJTH 3RX5A 3UC0H 1TVBA 4XVTL 4FQLL 2DKSA 1U36A 3RU8H 3UO1L 1WUNT 32C2A 4OFVA 1N0LA 2CSPA 4YDKL 4ODHH 4APQA 2EH8L 1LGVA 3GSOB 4IDLA 1NL0L 2C1PB 4IS6A 2AABL 4ORGB 5GRUH 3EDJA 2FSEA 1KIQA 1F02I 1TLKA 3DNKA 1K4CB 1ZGLB 3S34H 3T3PE 5C8JA 3LEVH 2GJ6B 3E3QC 4G6FB 3QXDA 4RAVB 3PL6C 1XIWC 3SKJL 4MYWB 1T66D 1F11B 2A9NL 1SYVB 1HH6B 3OF6A 1NBZA 4NZRL 1WIUA 3DGCR 1QFOA 2J7LA 4YHKL 1KCVL 2YD5A 1E4XH 3TYGH 3MACL 3RDTB 2R2CA 2VITA 3GSUA 1YQ2A 1MCOH 5ACLA 1FG2B 4GJTB 5I1DA 3MJ8B 1OHQA 3GI8L 3RKDD 4K3EH 4WGVB 3B3IA 4QRRA 1HCVA 3CDGB 4YO0B 5DVMA 4H0HB 3QHZH 2XG4A 4LSSH 3OZ9L 1ZANL 4U1MB 5D1ZC 5EC1A 5D72H 1UJ3C 2WK2A 2V9RA 4Z5RB 1CGUA 3LDBC 4XBPA 1IAOB 4L3EE 1MSPA 3VFNB 5D2LA 1CGXA 4FXGA 5F7LB 3E6FB 4TRPL 2CLVA 3MX0A 3HB3C 1RZ7H 4P4KD 3UTQA 2F53B 3FQRB 2X09A 3MFFA 2EC9T 1CGVA 3LKRB 4RAUA 3PHSA 3JV4A 4R96A 3RDTC 4K8RD 5J1AB 3CUPA 5TH2A 3WLBB 3OPZH 3L3KA 2NY5C 4KKCD 1FFRA 4LLQA 2E7BA 3LD8C 3OKOA 1QR1A 1TZGL 1I9IH 5L8JB 2W9EH 2X4SB 3WFHA 5DA4A 1OLLA 2BVPA 2A0LD 4MCZB 1QRNB 2JELL 4GW5A 3BXNA 3FT4A 2F5BL 4AH2B 4ODTL 5HYJA 2ADJA 4L4TB 4LAQL 1SJEA 4WHTB 1BZQK 2X1PA 2F54B 5F7WC 1R3KA 3TA3C 1A02N 2IG2L 4UT9L 5C6TH 2P24B 5FHAH 2B1AH 1CVSC 2XZZA 3OR7B 4ONGL 4HWBA 5IF0A 5I19H 3U4BH 4MAUH 3MRKB 3OB8A 1NCNA 5MEOA 3N06B 1EA9C 1PYWA 3VCLA 4BYHA 1GGBH 3QUZC 2EDKA 1UWXH 5FYKE 5I71C 4NO2A 3S3SA 1MH5A 2AK4D 3FN3A 1I9RL 3TBSB 4QGYA 1CGSL 5FF6B 2YK1H 4L5FH 4P9MH 5E9DB 2AABH 3S96A 3P73B 2AEIT 4NWUL 4LCCA 1NCWH 3S5LG 2BSED 4WFEE 1U3YA 3PG2A 4LVOB 3ULSB 1RUAH 5J6HB 5F88A 3OKKA 2XWTB 4LSRL 1OAZL