3QIBB

Crystal structure of the 2b4 tcr in complex with mcc/i-ek
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
184
structure length
165
Chain Sequence
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPLLVCSVSDFYPGNIEVRWNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVTCQVEHPSLTDPVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 165
sequence length 184
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qibB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qibB01
4ETQB 5D93C 4FXKB 3V7AE 2W38A 1QR1B 2JCCA 4W6YB 3UO1L 3RHWF 3RI5F 3DROA 3QJFB 1NCUA 1ZT1A 1NGPH 2EIZB 3P77B 3MRPA 4OM1L 3L3KA 4U7SA 2XPGB 2ATKB 3TNNB 1NMBH 3O6KL 2Q8BL 5CIPH 5DHYA 4PJ5D 2QSQA 4PB9L 2OM5A 3IT8D 4CVZA 1E4XH 4Y5YC 4HJ0D 1YJDH 2NW2A 4LVEA 4NCC1 1L9MA 4G9DB 4NN7C 4PRHE 4JB9L 1ONQA 4K3GA 5FCUH 2R8SH 2X7LB 5I74B 2IADB 1I9RH 3VGEA 2EDKA 2YHGA 3K3QA 4KVCH 1XFPA 4BSJA 5C3LD 5C07A 2BHZA 5ICYB 5K9JL 1AHWC 4B0MM 3H9HA 1INEH 3LOWA 4JANA 4JY5H 4Y16A 3W0WB 1WF5A 1F11A 1WWWX 5FKAA 5DD5L 2YD8A 2VLLA 4G9FD 3T0VA 3V8OA 2WZPD 5GGUA 3V0WH 2RJMA 3U83A 2KKQA 1BVLA 3ZE0E 3EJZD 5L7XL 1S7UA 4JG0H 4LLUB 1T1ZB 1U8LB 4HIHA 4DOHE 1DBJH 3P9MA 5IROA 1LNUA 1MHHA 3QIBA 4NKDA 1XGQA 5GHWH 1IBGH 2P45B 3VWKB 3RVVC 3OJMB 3C5SA 4OD1H 4HUWA 5A2FA 2YUVA 1IAKA 3TH2T 3JWNC 3CC5A 4U1KA 4AIXA 3UJTH 3D85D 5C8JA 2W0FB 4PYHA 4PG9B 3HE7C 4FS0A 2Z8VC 2HFEA 3FCTB 2IBGA 1F58H 4P59H 3U6RA 3GIZL 3QJHB 4JCMA 1EBAA 4LU5H 4H0GA 2WQ8A 5IB3B 4ZPVA 3TV3L 3DIFB 4D2NA 1JGVL 3GMNA 4NQCB 2YN3A 2FR4A 1YNKH 1TTGA 3NVQA 3WKNA 1CK0L 4RGNC 1DN0B 1JGLL 5KSAA 3ROLB 2AJYL 3D3VD 4JPWL 4C55A 3UEZA 1BJ1J 2RAMA 1KB5A 5E6IC 1FNHA 2JCCB 4XBEH 3HG1D 3RGVA 3DROB 4G43A 1IAMA 5DRNA 3MRPB 3L3KB 4JM2C 3PGCA 3EJYC 3O11A 5CSZA 4HMCA 3GDBA 1MSPA 5TQ2L 4F7EA 5DHYB 4X83A 4ENEC 1FPTH 3PWUA 4CVZB 5E8PA 4R9HA 2NW2B 3MCLH 5FXCH 2EIDA 4P9MH 3U1SH 2QQKL 3K8KA 1ONQB 5JZ7D 1ZVYA 4YHKH 4HWUA 5C07B 5GIRA 3H9HB 5C0BD 4G6KL 4LGSB 3OF6A 4JANB 3UTSE 3HC4H 4NZTL 4PY8I 3ULSA 4Y16B 3FB7A 4XP9L 1F11B 4LDLB 4KTYA 4LPWA 5FKAB 5D7LA 2VLLB 4OB5H 4J4PA 4XMPH 4NOFA 2D3VA 5GGUB 3LQAC 3RZCD 1KCUH 1EAJA 1BVLB 1EMTL 3N0PB 4G5ZH 1S7UB 1CXEA 2J8OA 4HIHB 4HWBH 1J1PH 2VL4A 3P9MB 2EE6A 1UKQA 1CXIA 1LNUB 1MHHB 3WIHL 3QIBB 4NKDB 4YDKH 3IXAA 4J3XA 1XGQB 3NIDF 1I9JL 3JBG7 4JFDE 4HJ0C 5IBTL 1IC5H 3NIFE 1MIEL 1JZ5A 3OGCA 4F8TA 2ITCA 5B21A 4X9GA 3C5SB 1KCKA 2FGZA 4R90H 5CJQH 4HUWB 4LCCC 1IAKB 3LDBC 3K7UA 4UTBL 2Z8RA 3VE0A 2PXYA 3CC5B 4C58B 3QHZL 4U1KB 1VDGA 1AGEA 3TJEL 3DHMA 1G9NL 2NY3C 5C8JB 3VG0L 5EOQL 3HS0A 1QFHA 2HFEB 1QBMH 3CMGA 2EH8H 2F53E 3FN0H 3UTPE 4PRHA 4UNVA 4WW1A 5J3HD 3U6RB 4PGJA 3CFDA 3UCRA 2ZUVA 3FT2A 2FWOA 4ZPVB 3GMNB 1NANI 3MRMA 4LGRB 2FR4B 4UAOB 5C6TH 2B1AH 2VDOH 4XMLL 3WNNA 5KSAB 1T03L 4A2LA 1CFQA 4TNWF 2IEPA 3EJZC 5JXED 1QPXA 3MUY1 3U7YH 1KB5B 2WM0A 3P11L 3I75A 3QUMH 3RGVB 4G43B 5J1AA 5T5NF 1XGTA 5DRNB 3PGCB 3O11B 1SJEA 5CSZB 1FVCA 3OAZH 3IVKA 1NJ9A 4F7EB 4P99A 2E7LC 4ZOEA 1U8IA 4LHUA 4P2RE 3PWUB 5E8PB 5K9KA 3CVHH 3D5OF 3IDYC 5J1SC 2JELL 4KHTL 3ZDYF 1KB9J 2GUOA 5JOPE 4KC3B 2DM7A 2D31A 1OGTA 2VLME 1PGRB 4HPOH 4MB3A 4UOW0 5GIRB 4CBPA 2AJVL 4NP4H 4NM4H 4ZUSA 5ALCL 3ARFA 5T3XE 5JOEA 4S1QL 3ULSB 3HE6A 3FB7B 4ZFGL 4LNVA 3IS0X 1HCVA 4HBCH 5JUEL 5D7LB 4YPGA 2VR4A 3GSWA 1E6JH 4NM8H 3GGWA 4KMTH 5DJYA 5LBSL 4EVNB 1T2QL 4RAUA 1C16A 3LEVL 2FEEL 4OIIL 5DURD 1NAML 2JIXD 1OTUD 3GK8L 2O61A 4HCRA 1T1YA 3BD3A 2YD6A 4K3JH 4PJ7F 5C70A 4PLNC 2DQCH 1PKOA 1JPTL 1W72H 3IXAB 2QSVA 1RZFH 2NY0D 3Q0HA 3UZEA 3LKNB 4BK5A 4QXGH 1KJ2A 3OGCB 2ITCB 3TCLA 1IKNC 4ZAKC 4OJFH 1DFBL 2PXYB 4WUUD 3VE0B 2EDYA 1AGEB 1CL7I 4JO2H 1FIGH 4TYUA 3SOBH 2XY1A 1NANH 3HS0B 4IIQC 5JDSA 5DJ8A 3ET9F 4RRPA 5D8JH 4PRHB 4WW1B 2C4FU 2YPKA 1RVFL 4HXAL 5DO2C 3LH2L 3CFDB 4PJ7A 2H2PC 1Y18A 3FT2B 2DBLH 2FWOB 4LCWE 1OW0C 3NCCB 4LHUG 5EO0A 3MRMB 4GW4A 1V3JA 4P46D 4XPTH 1T20A 1T0NA 3RZCC 3ALXA 1S9YA 1CFQB 1UACH 3UTSA 5KVDL 5MP6L 4YXKH 1YYML 5GS0D 4PJHE 4CN4A 1MFDH 4PLKD 3I75B 1FNEA 1YUHA 1UA6L 4YO0A 2BVQA 5J1AB 2ADFH 1XGTB 2VR9A 3MRKA 4RISL 5T5NG 1X5HA 1SJEB 1FVCB 3RA7H 4HC1H 3IVKB 1NJ9B 3T0XA 3VGAC 2OL3L 2Y5EA 3OMZA 5IHLB 3CDGA 1IM3A 1U8IB 5GGTH 2DQIH 4LHUB 2AJUH 4ZNEE 4MZ2A 4YFLF 4GG6F 5JDJA 1U42A 5K9KB 5FM4A 1ORQA 2MSPA 2R0LL 4DAGL 5JR1H 1NKOA 1ZHLA 1CLZH 2GUOB 4QWWC 2D31B 5IGXL 1DBMH 2R4RL 2B1HH 2N1KA 4LSTH 4JQXC 5EIVA 3VXRE 5KOMC 4ZUSB 4M62H 2DTMH 3ARFB 3P0GB 3E8UH 3NGBC 4OLXL 4EDWL 5FDYA 4QGYA 3HLAA 3HE6B 3L1OL 4YPGB 3GSWB 3OWEA 4ELMF 3GGWB 2F53A 4WFEE 4IHOA 1FL6A 5CIPA 5DJYB 3EAKA 4RAUB 1C16B 1PD6A 3MXVH 2P5EA 2H9GA 4H20H 3KWWA 3DYMA 3S34H 3MV8A 2FHFA 3S4SA 4RRPG 1XF3A 2O61B 4I0PC 4X7SH 1T1YB 4QRTA 3CFCL 4YGAB 4JY4A 4DW2H 2NY6C 5L6YH 5J11C 5FUCE 5J13C 5I19H 3QCTL 4ZD3L 5CKGA 4FQ1L 1KJ2B 1SHMA 2LE9A 3MZGB 4Q9QL 4G6MH 4OLVL 1RI8A 2NXYC 4U0RB 2AK4E 2GSIA 3HHRB 4Q74A 3TCLB 3VDCA 4ELMA 3PABA 1FYHB 3OZ9L 3IXTA 4PJEE 5JW4Q 2E9BA 2AEPL 5JDSB 4IOFC 4R96A 5DJ8B 3W0WD 4MXVF 1J11A 3ARUA 1AR1C 3QIUA 1FORH 5HHXL 2YPKB 2Y6SC 4PJ7B 1Y18B 4J3VA 1T66C 1AC0A 4ZS6D 3U9PL 3RZWA 3JTSA 2GITA 3HCVA 5EO0B 1CICC 4S1SL 4GW4B 4LDEB 1CDYA 1T20B 1T0NB 4Q97A 3ULVC 4PJIE 1S9YB 4MAUL 5DFVD 5T5FL 3UTSB 4OZ4A 4HIJA 5D6DA 3MLXL 4JM4H 2L7JA 1OTUC 2JLLA 1KT2A 1MRFL 4JJHA 4M43H 3UC0H 5MEQA 1FNEB 4M6MH 1YUHB 4YO0B 2BVQB 5DD0H 2D7MA 5F71A 3BSZH 4KKNA 3MRKB 3DX6A 3BD4A 4DQOL 5DYOA 2NY0C 3CX5J 3CDGB 1IM3B 3G5XA 4L3CA 5C92A 3WIIH 4WIQA 4OLWH 1A6PA 2BRRH 1ORQB 2OK0H 3RKPA 1QYGH 3C5ZC 2AP2A 2IF7A 3D69A 1ZHLB 4I3RL 4AG4H 2IPKA 1HI6A 2QKIA 3PWLA 2R23A 4UT9H 5HGBA 2YA1A 1MJUH 1BWMA 3TT3H 1X5ZA 2D0HA 4NQCD 3MV9A 4OFIA 2XTLA 4NQVA 3MOBL 2UY6A 4OCSL 5D70L 3HLAB 1UZ6F 4NBXB 4P5KA 5E00A 1JI1A 4LSSL 4XHJC 3CAFA 1LE5A 2HLAA 3GKWH 3T2NH 4JGMA 3G6DH 2F53B 5JA8B 4IHOB 1FL6B 1NPUA 5CIPB 3ZKMD 3DUHA 4BUHA 1DUYA 2YK1L 2JJUA 2O5ZL 2BZDA 2P5EB 2H9GB 2R0KH 5F9AC 3MLWH 4LCWA 4PLKC 3KWWB 4KDTC 3TA3C 4L4TA 3UZQA 1OARL 3MV8B 3RNKA 2Q7NA 3S4SB 3LKOA 1XF3B 5CILL 5C7XL 3CJJA 3SBWA 3WIFA 3MLVL 4QRTB 2OXGA 3R1GH 3TBVA 1U8KA 4JY4B 3DECA 1XH3A 5J12B 2WMPA 5E2UL 1J1OH 4JHWL 2V17L 3QHFL 4I0CC 1NSNL 1UWXK 4OCMC 2V5SA 2P24A 3MLZL 3F7RA 1ZLUK 1A64A 4FQJH 2GSIB 3O2DL 5C07D 5LXGL 4PBWD 4X4ME 4PGBA 3PABB 4ELMB 2DQHL 3HMXH 4H88L 1Q9OA 3IXTB 4QTIL 5IV2A 3HMWH 3AM8A 1TCMA 2VABA 1JI2A 4HQQH 3PV7A 3U7WH 3NCYS 2ZCHL 4ZNEA 4Y16D 4R96B 4Z7VF 3QIUB 3QUYC 1VESA 3QNYA 1KBGL 5DWUL 4HWBA 4LSQL 3BJ91 3JTSB 2GITB 4U1JA 4CU6A 4UV4H 2VMFA 3HCVB 1CQKA 3QUZA 3ME0A 5I1JH 3VRIA 2Q3AA 3GBLA 3OKKA 4PS4H 4RX4A 4KI5F 3VXRA 5GRVL 4XTRD 2CSPA 2M2DA 1BGXL 4WHTA 2A38A 2H8PA 4U3HA 2M8XA 3QUXC 2VXSH 4N1CA 4HIJB 4OZ4B 3PHSA 2WUBH 3K8LA 3QIBD 1WISA 1KT2B 3P0YH 5MEQB 5E5RB 2Y36L 1JZ2A 2V2TA 2Y23A 4O9HL 3DX6B 3KS0H 4JHAH 2VKWA 4Z7VA 3RQ3A 2HP4A 3WS3A 3CSGA 3VXUE 5DYOB 3PGFH 4L3AA 5GRYA 1M6OA 4UI2A 3G5XB 3IJHA 4L3CB 1DL7H 3ZL4L 4TRPH 3GKZA 1B9ZA 1F3RB 2AEWA 4KWUA 4WTWA 1KCSH 1TJIH 4YWGH 1XGRA 3D69B 1S7SA 4TUKL 4G7VL 5CGYC 2IPKB 1HI6B 2QKIB 1FHGA 4IDJL 1QD0A 3C09B 3PWLB 2P46B 2R23B 5HGBB 3L5HA 3VI4E 1MCNA 3IKKA 4PJIF 5AUMA 4N5ED 1D6VH 2GSGA 2B8OT 4DZBA 3MV9B 5EPMA 1XR9A 3MRRA 2EDNA 4X6DE 4XVSH 4NQVB 4BQ6A 4U2ZA 2FBJL 4GKOA 4ZS6C 5C0ND 4RMRA 5KSAD 1JHLL 3WNLA 4P5KB 4LSUH 5E00B 5TJWK 1NCDL 1J9CT 5EZIH 5BW7C 1LE5B 2HLAB 2A9NH 3NAAH 2LABA 4P3CH 5HPOA 12E8L 4KMQA 4HKZA 5SX4I 5LG1A 5T3ZL 1RHHA 3RGVD 5E95B 2APWA 2ZCKL 1IZKA 1DUYB 3N1GC 1Z9MA 2BVUA 4LCWB 4L4TB 3PGDA 3RNKB 3HB3C 3LKOB 3HAEH 3VWKC 3NZHH 3WIFB 4OFYA 5EIQA 1U8KB 1OWWA 3FRPA 4PJIA 5SWSE 3TBVB 1XH3B 1I7ZA 1RQ5A 1DANU 5GGVH 3MJ8A 2FIRT 5AAWA 5GRWA 2P24B 2F8OA 5T33H 1OAXL 4ACPA 3KG5A 2ARWA 1P53A 2BFVL 5GRJL 3HUJE 1OTTC 1KB9K 1KIPA 1CGSH 3L5JA 1X5IA 4PGBB 4X7DC 1S3KL 3BGAA 3GJEA 1Q9OB 4TPRL 5IV2B 3OF6D 5IVXE 2VABB 5EOCH 5LJYH 4F15C 1TQBC 1IAIL 3PDDA 1F5WA 5C0JA 3WLWD 3QFJA 4RWHA 5D7LD 2DQTL 4J3OC 1I75A 5FYKU 3NCJH 4OF6A 3QNYB 4J4PD 4YXLL 4YXHL 5I1EH 2LQRA 2E7BA 3HNVH 3RIFF 3NABH 2VLRE 3JWOH 1PEWA 3MJ7A 4U1JB 1NC2A 3QUZB 2XQBL 3VRIB 1WK0A 1WBXA 3OKKB 3VXRB 4S10A 2QQLH 1W72A 4WHTB 4RMSA 3ZKMC 1WVZA 4QXUL 2H8PB 4UMGA 5C08E 5IFHL 4XPBL 4J3UA 2ZOLA 2ZOKA 5EUOF 2IFFH 3WN5A 1G7JA 3BPNB 1C5DA 2V2TB 3I50H 3O3EA 4Z7VB 4KJYA 3WS3B 5HDQL 4YHMH 3PP3K 1NC4A 1M6OB 4JO4H 2PXYD 3IJHB 2BJMH 3BVNA 3D2UA 3MROA 3CLEL 4PRDA 4Y5VC 4APQA 3V6OA 5DGRA 1XGRB 1VPOH 5DMGD 1S7SB 4S11A 4PRHD 3O3DA 1A1NA 5D96B 5EU3A 4Y16C 1Y6MR 3L3IA 1LK3H 1XGYL 5AUMB 2GSGB 4DZBB 5F70A 3FRPG 5EPMB 1XR9B 2EYSA 3MRRB 5EUOA 5D2NC 4HLZG 2XZCL 4JFHD 4F58L 2AV1A 2PO6A 4XTRC 4FQPA 3TLRA 3MZTA 4HKZB 4DUXA 2CKBL 1RHHB 1BOYA 1UKSA 2J7LA 3S35H 15C8L 5CHNA 4KRNA 3PGDB 1YEEH 3W9EA 1NBVL 4LHUD 4PJIB 1I7ZB 4Z7NF 1JWMA 5FV1L 3MJ8B 2FX8L 4NO3A 4OQTH 1N8ZA 2H1PH 4WO4C 2GYSA 2OLDA 3QAZB 5KVMC 5I30H 1KIPB 4GS7B 2CXKA 3DURA 1KXTB 4P9HL 4UILH 2C3VA 5E2WL 1HINL 3GJEB 3TBSA 1S9VA 3U46A 5FGCB 3ARFD 2R56H 5BOPA 3LD8B 2V2WA 5C0JB 4POZC 2IMMA 3HE6D 3DX9A 5JXAL 3QFJB 4R0LA 4M7ZC 4UAOC 4Z95H 3MLSL 1LO4L 1UENA 4OZFH 1BAFL 5KSAC 3RJQB 1HNFA 5GZOC 2EH7L 5FYJL 3G08A 3MJ7B 3DJ9A 1NC2B 2F54A 3SKMA 1WBXB 4ZMAT 1W72B 3RGVC 2C7UA 1OGAA 1BHGA 3LKQA 1MFBL 4X6DA 1WICA 2HVJA 2R0ZH 3PDOA 4NHCH 4OCNC 1HHKA 2ZOLB 2ZOKB 2SEBA 1DP0A 1G1YA 3SY0A 1G7JB 1TJHL 3WN5B 5DJCA 1C5DB 3DSFH 5IQ7H 3O3EB 4HWNA 3S96A 3VFGH 3BQUA 2JB6A 1M1SA 1BQHA 4KJYB 4OTXL 2A9ML 5F97E 5HYJE 1CVRA 1NC4B 1JZ3A 1OAZL 3DUUA 3BVNB 4WDIA 3D2UB 1FAKT 3MROB 3EBAA 4PRDB 4K94H 4APQB 4M6OL 3D39E 2JB5H 2H32A 2R29L 3B2VH 4LHQB 2GJ6E 3P0VL 2FEDD 3O3DB 1A1NB 5EU3B 1NCTA 3L3IB 2OJEA 3LCYA 3HFML 4MVBC 2EYSB 3GMOA 2DLFL 4I13B 4P3WA 5EUOB 3BH9A 5GRXG 4MNGA 3V7MA 4X9FA 5F44A 25C8H 5IVXA 3UTSD 2AV1B 2BDNH 2DWEA 3G9VA 4MHHI 1A6VH 2PO6B 5CWSA 2AQ3A 2L7UA 4YHLL 4F7MA 2Q1EA 4BZ1L 2HH0H 3GHBH 2AW2A 4UV7H 4J1UA 2RCSL 5CHNB 4RFNC 2MCPH 3TGXA 5KVFL 4BJLA 3W9EB 5CJOH 1YEGL 1T4KA 1SJHA 3CX5K 1KENH 5C08A 1JWMB 4QYOA 1PKQA 4XRCA 1MCLA 4NO3B 1N8ZB 2DM4A 1J05A 5EG6C 1C5BL 3O2WH 3DURB 3V4PL 2C3VB 3D87B 1HQRA 3TBSB 1S9VB 4WEMB 3U46B 1HH6A 2XA8L 5DHXB 3QNXA 3K74B 2V2WB 1UWGH 3DX9B 4R0LB 3SE3C 1KCRH 3CK0L 3DUSA 1MIMH 4I9WE 1YECH 1QRKA 3SPVA 1BQHG 3E2HC 5EU6E 2F53D 1FZKA 3UTPD 5DSCA 3G08B 5BV7B 4NO2A 3GSXB 1XT5A 4HHAA 5DK0A 43CAA 2P5ED 2F54B 4K9EH 3V4UL 3SKMB 3MV8D 2C7UB 4U6HA 1OGAB 3C6LC 3LKQB 4X6DB 4ZUUA 2HVJB 2NY5C 4WWKA 3PDOB 4ZTPL 4PJDE 1HHKB 4OSUH 3AREC 1CS6A 1NKRA 1MCIA 2SEBB 4FQXC 4CUCA 3SY0B 3PJSA 1YMME 5DJCB 1MCPL 4A6YH 4DVBA 1A0QH 3KNBA 3S96B 3BQUB 2VZUA 2JB6B 1NGZA 1BQHB 3CX2A 4QHKJ 1LDPH 2CUHA 3PF2A 5CFHA 1KELL 4U1IA 1G7IA 4EUPH 3NPSB 3V8CA 5I1KH 4X4ZA 1K85A 1MHCA 4WDIB 1WFNA 1WT5A 4HJJH 4ORGA 2ADGA 3H7BA 4JREC 5F93C 4EQ2A 2H32B 3IETB 2OMBA 1OCWH 3QIUD 1YA5A 4ODVH 1GOFA 5IP4A 1OTSD 5EBGA 5JOPD 2OX5A 1PY4A 2OJEB 3T0WA 3HC3L 1JNLH 2EXWD 1A7NH 3VRLE 4MJ5A 2WNGA 2VLMD 3GMOB 3HI6L 3BH9B 4MNGB 4XBGA 5DHVA 2DQGH 1C7SA 5F1KC 1UCBH 4KUZL 4K3DL 1JZ4A 5T3XD 5IVXB 2DWEB 2XXCB 5EORH 5CWSB 1B0RA 4RMWA 3ZSTA 4F7MB 1G7QA 5E2VL 4WGWB 2FGWH 5I8EA 1EO5A 4RWYL 1K3IA 4J1UB 1T6WA 4YBLC 1RUKH 5C09E 2Q76A 3KYOA 2LVCA 4NZUL 1T4KB 1SJHB 4N0UE 5C08B 4QYOB 1PKQB 4XRCB 3RIAF 3VFPA 2E27H 5F9JA 3MLRH 4DKAA 1E4WH 3RDTC 1A4JA 1MQ8A 4YHZL 2V9QA 4YQXH 1NL0H 1J05B 5FHAH 2DF3A 1DQLL 3HKFA 1AO7E 5AZ2L 2HTLD 4LOUC 1HQRB 1ACYL 1PJ9A 3MV9D 5AZEH 4L4JA 1HH6B 1MEXL 3SKJH 5CEZH 1KXQE 2WBWB 1P7QA 2R2CA 3QNXB 1JHKH 1LD9A 5HVHC 4P4RA 2DQEH 2ZSVA 3BPOB 3DUSB 3CLFL 3D39A 4JE4B 3SPVB 1EFXA 3ZTNL 2HTKD 1FZKB 2GJ6A 3AXLA 5DSCB 1I7UA 2HWZH 3HAEA 5HHOE 4NO2B 4HHAB 5DK0B 4KK6D 43CAB 4PD4J 4LCWD 1F4XL 4PLJD 4L4TD 4M9PA 3VJ6A 4U6HB 4ZUUB 4WWKB 3HZKA 5DEFA 3OKYA 1P9MA 3KAAA 2FO4A 4GKSA 4NYLA 1JYWA 3PJSB 3MRLA 4DVBB 3MRDA 3KNBB 5F3BB 5F1IA 1NGZB 2KPNA 3K0WA 3Q1SL 4PRPE 1QTYT 3T0BA 4U1IB 1G7IB 4AEIH 5CUSH 1J1XL 4JO1L 4DGVH 4B5EA 3GNMH 1AIFA 2XZQH 3WD5L 4ODHH 4Z0XA 3MV7E 4ORGB 4M7LH 1TZGL 2ADGB 3H7BB 3GSQA 2C3XA 3D9AL 4Z0BH 1VENA 2PR4H 1IGMH 4K3HA 4G42A 4I2XE 4MJ5B 3QUZD 4NN5B 4XBGB 3ZHLA 1B90A 4RX4D 1NBYA 5DHVB 4KDWA 3VXRD 2YPVH 1MHPL 2JTDA 1I3UA 2ZUXA 1SBBA 1QSVA 1VFUA 3JWDH 4EN3C 3MLYL 3B8YA 4PV9A 3I9GH 2BSRA 4LNRA 1MCJA 2FECI 5GRVK 1YJDC 2MFNA 4UIMA 2NX5E 1U8NA 4MXWL 1B0RB 1G7QB 5I8OH 4I3SH 5I8EB 1X5YA 4DGYH 4XP5L 4U0QB 5EU6A 3IDXH 4H1LH 1QSEE 4RGOL 3OR6A 1RU9L 3CMOH 4L1HA 1G9ML 2Q76B 5EO9A 1QO3A 5ID0A 3KYOB 2QHRL 4PJFE 3IU4H 4XNZB 1KTLA 4PJDA 3VFPB 5F9JB 3HAEG 4NGHL 1A4JB 4X6FA 3OB0K 2HFGL 2EE9A 2ADIA 1YMMA 3TEUA 2B4CL 2YD5A 4BSWA 4BYHA 4NBYB 5HYQA 5MENA 3UAJD 4DVRL 1A7OL 3BEVA 1XEDA 4OT1H 1OTSC 1DE4A 4YUEH 1P7QB 4HGWA 3T1FB 1LD9B 4R7DA 4B41A 4P4RB 5I71C 1U3HC 2ZSVB 2NY1C 3D39B 1EFXB 3QI9A 4M5ZL 2W0KA 3N85L 1HXMA 2GJ6B 3AXLB 1ZA3A 1I7UB 3HAEB 4XAWL 4X80H 4KHXH 4TN9A 1TMCB 4PJ9C 4UT7L 1T1XA 5F1SA 3VJ6B 4ZFOL 1A7PH 2ICWI 3FL7A 3DMMC 4IMKA 4OFYD 4ISVA 4GT7A 3HZKB 5DEFB 4R8WH 5H8DA 2FO4B 3F7VA 4GKSB 4DUWA 5I6XC 1CFVH 4NYLB 4LVOC 2EEBA 4Y2OA 3MRLB 3TVMC 3VW3L 3MRDB 4GRLC 5F1IB 4FFZL 4HSQA 2RFXA 2CK0L 4HGMA 3K1DA 4HIXH 3I2CL 1X6LA 4H0HB 3RJDA 4Z7UE 3BGFC 1NUGA 3C09C 1AIFB 2X70A 2CRZA 5C09A 4ZUWA 4Z0XB 1RUML 1L6XA 4WENB 2HFFA 2HMID 2HTLC 1CD0A 3CDFA 4LCIL 1K2DA 3GSQB 4N0UA 3QFJD 4LIQH 1EHAA 4OZGE 5EWIL 1NGXA 1JZ6A 3H42L 4K55A 4G42B 1NC2D 5IMKA 5FGRA 2HTKC 1AO7A 2RIKA 1NBYB 1A5FH 3B8SA 4GKZA 3SE9L 4PV9B 2C4FT 4NNXA 1TCRA 2BSRB 4LNRB 1A14H 5A40E 3OQ3B 4UIMB 3GMLA 4NWTL 4WGVB 1U8NB 4NC0B 1GL4B 2BERA 3IFLH 3SBWC 3MR9A 4O5LL 3FMGH 1F90L 3QDAA 2YKLL 3M8OH 3ZKQD 5EU6B 5C0RL 4PIRF 1CDJA 4RCAA 3OR6B 2WUCL 3RY4A 1JPFA 1NC4D 1FO0L 5EO9B 3F58L 1QO3B 5ID0B 4Y19E 2EDBA 2J8UF 4HS8H 3D2UD 4F57H 3ULUE 4APQD 3CU7A 1KTLB 3PL6A 4PJDB 4XVTH 5KSBE 3CNKA 2G2RA 4FQCL 4X6FB 1I3GL 1YY8A 2ADIB 1YMMB 2VH5L 4BSWB 5SX5K 2O5YH 4YPJA 1GVIA 5HYQB 5MENB 4PRPA 5IVZA 3BEVB 1DE4B 3V6BR 3ZDXF 4HGWB 3A6CL 4R7DB 4YZFF 5BS0A 4GRWE 2PO6D 1R3KA 3Q6GH 5J4MA 3QI9B 1GXEA 1DVFC 2VIRA 1HXMB 1ZA3B 2WW8A 4QEGA 3S3SA 3V4VH 3MUGA 4MSWA 5JMOC 5C2BL 5JA9A 3RWDA 1U8HA 4I77L 3ZT7A 1T1XB 4I2XA 1KC5H 3DVFA 1A1MA 3BPNC 5K33A 1SEQL 1R3LA 4B7LA 3ARXA 2Q87A 3VXQA 4ISVB 1RJZA 2DQJH 3DX8A 4DTGH 3RKDC 1HYSC 4NQEE 4UUJA 4L5FL 3MJ9H 4JPVL 3F7VB 3TFKD 2Q6WA 1F4WH 1SY6A 1XGUA 4RDQF 5HVWA 2RFXB 4HZAA 2UZXB 3RY5A 4KI5C 3EYUL 4K2UH 2X70B 5C09B 1TPXB 4ZUWB 4MJ4A 3QXVA 2VXTH 1MPAH 1I3VA 5HVFB 4JG1H 1YQ2A 3P73A 1K2DB 4PJFA 4N0UB 1HE7A 3UAJC 4FQHA 3I6GA 3RP1A 1NGXB 5TE7L 2YSSA 2QLVB 3LMJH 1JNNH 2OJZH 3ESVF 3MBXH 4MA3A 5H37G 4L9LC 2VJXA 4UINH 2Z31C 5IMKB 2K1MA 1AD0B 1YY9D 1AO7B 2F54D 4O2EA 3RVTD 1CXKA 4CU8A 3NOIA 4GKZB 4JN2B 1ZT7A 2X4PA 1OGAD 2D0GA 4XCCL 1AC6A 4NNXB 1GGIL 4A6YA 1TCRB 2YZ8A 5TPWL 4NZRL 1SM3L 1YEFH 1QKZL 3GMLB 3CDCA 2D03H 4YDLB 1NBZA 1MJ7H 1OP3K 3SCMC 5ENWA 2GY7B 3ES6A 3MR9B 1CIDA 4EUPA 5HJ3A 2H45A 4GSDL 3OJVC 2V6HA 3DVNA 3BQUD 3IFNL 5FUZL 1JPFB 5SWZE 1CGUA 3QWOA 1Q38A 1T7VA 1EAPA 3OPZL 3TIEA 3PL6B 2DMKA 1ZSDA 4IRSA 1H8SA 1PLGL 1YY8B 3LD8C 2GKIA 4YK4B 1NCAH 2KBGA 5DGQA 2XWTA 5IVZB 2MCG1 3QH3A 4XB7A 4HK3J 4Z7UA 1B4JH 1K5NA 1HKLL 5BS0B 1VGKA 5AWNH 1R3KB 1EFQA 3N1PC 2VIRB 1TJGH 5IT2L 3RL1A 2MWCA 35C8H 4I0KA 3T2OA 3MUGB 2J6EH 3A6BL 4MSWB 4WI9A 3LRHA 3RWDB 1U8HB 5MERA 5ECJE 3PHQA 4I2XB 4NNPL 3ULUF 1A1MB 3WN5C 4FQ2H 1R3LB 3VXQB 4ODTL 1RJZB 3DX8B 5IBLD 4UUJB 4DN3L 5C08D 3H3PL 1TQCB 3UYOD 1EK3A 2Q6WB 5FM5M 3UBXA 1XGUB 3T3PE 1AD9A 1MF2H 4APQC 3V6OC 3GSNA 5B38A 3IJSA 4RDQG 5GGVY 4F37F 4MB4A 2CIKA 1YC7A 5M7QA 4G8FA 4XNYL 3VFRB 2ICCA 1P4IL 1D5MA 4XP4L 4Y19A 3P73B 4PBVC 4PJFB 4FQHB 1MY5A 3I6GB 3EO9H 4GMTL 1G0YR 2YSSB 5CEYA 1IAIM 2A6DA 2ZWLT 1J0YA 2DMCA 3TM6A 2VXQL 1WAAE 3CFJA 4FQLL 4MA3B 1FLRH 4V1DA 3DRQA 5F1NA 2PO6C 3RTQC 4TVPE 2X5PA 4PP1D 5I1CL 1B2WH 4O2EB 1UGNA 3TNMA 1LMKA 2ICES 4AEHH 1ZT7B 2X4PB 4LSPH 2AGJL 4NOBA 4PD4K 5BO1L 4YDIH 2CPCA 4WWKD 3L3OA 4A6YB 4U1MA 4WFHD 4WV1A 4L3EE 1RIUL 5L8LB 1NBZB 1INDL 2EXYD 1EDQA 3SGEI 1XAUA 3UO1H 3EOTL 3ES6B 3QWQB 4EUPB 5HJ3B 4RMTA 4RAHA 4I3GA 3DVNB 4OM1H 5FYKE 5GS0L 5A3ID 2W9DL 1CL7L 4UB0L 1IGFL 3O6KH 3GMPA 1B0GA 3D6GA 5ADOL 5L8KB 2Q8BH 1EV2E 2IPTL 2QEJA 4LEXL 3GRWL 4PB9H 5IFAL 5CGTA 3QWOB 1PSKL 1N26A 3ZYZA 2VLKE 1EAPB 3TIEB 4JKPL 2W65A 1JK8A 4IRZL 2BHUA 4HKBA 4KK8D 1ZLUH 3N9GL 5KG9A 4JB9H 1ZSDB 1NUDA 3QG7L 4IRSB 4M1CD 2APBA 2VO5A 2VZOA 2DLEA 3CSYA 3JTTA 3LKRA 1HWHB 5A2JH 3OG4B 5K9JH 4R0LC 2XWTB 3TWCL 1P69B 1JPST 1U91A 3MOQA 5SV4A 3QH3B 1JTPA 4Z7UB 4MGXA 1BF8A 1K5NB 1A9EA 3UBXG 5EBLA 5DD5H 1VGKB 4OI7A 3M45A 3RVTC 4H1LA 4KJPD 3T0EC 5B38G 5IVNA 4MQXD 2F58L 2HLFD 3RL1B 1RURL 4G3YL 3R0NA 2YWYA 4OCLC 1MJ8L 4X8XA 4ZOBA 5IWLC 1U6AL 2X2YA 3K80A 5L7XH 5MEOA 1IC1A 5MERB 1GAFL 3VG9C 3BO8A 3PHQB 2DOCA 1KCLA 4GRMA 1BZ9A 3WFBL 1M4KA 5CZKA 3BQUC 3B9KC 3VU2A 2VITA 2DD8L 5BZDA 1FDLL 3UBXB 3WXVL 4IRJC 5E1HB 1AD9B 3AY4A 3GFUA 3GSNB 5B38B 3IJSB 3T65A 2FDBP 2CIKB 1CTNA 4AH2A 4G8FB 4OQ1A 5ITFA 1DANT 1CBVL 1D5MB 4AEFA 5JLZA 5SWZA 2X1XR 1P7QD 1B6DA 4Y19B 4OCWL 1IEAA 5BJTA 4PJCF 4JN1L 3D39D 4MLIA 1EFXD 2WWMC 5CEYB 2A6DB 4OGXL 3GIZH 5T1MA 2GJ6D 3CFJB 4LHJB 3TV3H 4GUPA 4V1DB 5B39A 3DRQB 1CCZA 1JGVH 3VXME 5F1NB 5EU5A 4BUGA 5GGQL 2ZG3A 5F96L 1CK0H 1WGOA 3TNMB 1WLHA 3H9SA 1VERA 1JGLH 3KHOA 5J0BA 3L3OB 4U1MB 1OAYL 2AJYH 3PWJA 4LSVL 4WV1B 4JPWH 3M07A 5EBWA 3BN3B 5TFSL 4Y2DA 1SYVA 3QR2A 5F7LB 1Q0XL 1N6UA 5IBLC 5IEHA 4CADA 2Z4QA 5CJXA 4TNVK 4PJCA 3GMPB 5TQ2H 1B0GB 2Z8WC 4ODWA 1CDBA 4NNYA 4H1LG 3DETC 4N68A 5LWYL 2W65B 1JK8B 4HKBB 1RUPL 5KG9B 2QQKH 4R4FL 2K7PA 4LSRL 3SDAC 3UDWC 4F7CA 1LP9F 2F19L 4NZDA 3JTTB 3LKRB 2VDKL 2W1NA 4ODUA 4HPYL 4EXPX 2VOTA 5MHSD 4KKCD 4G6KH 1U91B 4GAFB 3VDBA 5C0IA 3OG6B 4NZTH 1A9EB 4XP9H 5EBLB 2QQNL 3TT1L 3FONA 1FFOA 1OM3L 1BECA 4H1LB 4D9QE 3STBA 3QT2A 1A02N 2CK2A 3RVWD 1VGEL 3PWVA 3F7YA 2C1OA 1EMTH 5EU6D 1I1AA 2OTUA 1VCAA 3KGRA 5CGMA 3BO8B 4GRMB 4LLAA 1BZ9B 1A3LL 1LP9A 3DYPA 1FFRA 3WIHH 2VQTA 2VITB 2FEEI 4L3EA 5BZDB 2D7OA 3QDMA 1I9JH 5IBTH 3H3BC 4FQIL 1WT5C 3AS1A 5BXFA 4H25A 1YMMD 4BQCA 5CLWA 2MTPA 5D7IE 1CDGA 1U3ZA 3T65B 4M1CC 3KPPA 4AH2B 4UTBH 5MEND 5ITFB 4EZMA 3QHZH 5JLZB 3TJEH 1G9NH 3ILPA 5SWZB 2HT4C 4MLSA 3VG0H 1WEJL 5EOQH 4Q6IC 3WJJC 1IEAB 2ADJA 4NN5C 5BJTB 3KLHC 3QDJE 3SGJA 1W0WA 1A9BA 4ESKA 3QI9D 1QBLL 1MOEA 1D9KA 4DKDC 5H94A 5T1MB 1VADA 1NEZA 3P9LA 4L29A 3FOMA 4GUPB 5LGKA 5B39B 5KZCB 4KTDL 5IHUL 2YD2A 5EU5B 2Q3ZA 1L9NA 4MQXC 3H9SB 3RU8L 4XMLH 1T03H 3VD7A 2WBJC 5HYSA 1DBKL 3PWJB 1OT2A 5INDA 5EBWB 1CDHA 4X9HA 1UWEL 4Y2DB 1SYVB 3P11H 5F7EL 5K9QI 3LPGA 4HDIA 5IEHB 5ANME 4CADB 3ARGA 4MD5A 4C4KT 4ZXBA 2Z4QB 4WI3A 4PJCB 3C8KA 3R4DA 4Y8DC 1AXIB 4ODWB 2Y07L 4YHNA 3RBGA 3S36X 4NNYB 5C09D 4D9LL 3JZ7A 2JELH 3I6KA 1SBSL 1X5FA 4KHTH 1YEHL 5D7JA 4F7CB 4KK9C 5EU7C 3JVGA 4YHYC 3ZT6A 4RGNE 1QFWI 5I2IA 4ODUB 1N5YL 2AJVH 4LPCA 2E9IA 5ALCH 3SQOL 1AO7D 3GMQA 4NQDE 5C0IB 4S1QH 2GQHA 4PJGE 4ZFGH 3FONB 5JUEH 1FFOB 1X44A 5DK3A 3TZVC 2B7DT 4LLMA 4FP8L 1FVEA 5D7KE 1AY1L 1Q72L 3PWVB 2Z8SA 2C1OB 3F7YB 5LBSH 1T2QH 3LEVH 4JKWA 1I1AB 2OTUB 2ZUQB 4JKKA 4RZCA 4OIIH 1P9MC 1NAMH 3VXMA 1KB5L 1H3TA 4OFKA 3GK8H 1LP9B 2QSCL 3W11D 1FSKB 1HHGA 3BE1H 4QXTA 4NT6A 3IDMA 4LK4A 4S1DD 3PL6D 1NEZG 1F02I 3ARTA 4L3EB 5D6CA 3UZVB 2V5RA 4U1GB 3QDMB 3O41A 5BXFB 5E99L 1FNLA 1H8NA 3LEYL 4H25B 3QYCA 3JWOC 1YEIL 5HYSG 3KPPB 2RR3A 3PXHA 5KVEL 3FJTA 1DFBH 4JGUA 4PRPD 1QFOA 1WUNT 5I16A 3ILPB 1ZVSA 1NCNA 4FNLL 5E0QA 5BS0D 2ADJB 2X1QA 1WBYA 3UYRL 1E4JA 1W0WB 1A9BB 3S8WA 1D9KB 1DQML 1RVFH 4HXAH 5H94B 1VADB 3LH2H 5JIIA 1NEZB 3P9LB 4L29B 3I84A 3FOMB 4NUJA 3O8XA 5DDHA 2CGRL 3RVWC 4LRIA 4W4OA 1FLTX 1EHLL 4G6AC 3WFCL 3QG6A 3QQ9D 5HYSB 3GJFK 5E8EA 5KVDH 4KROB 4X6CE 5MP6H 1YYMH 3JV6A 5INDB 5C71A 4JGJA 3QO1A 1C5CL 1UA6H 3VGFA 4HDIB 4RISH 2ED9A 4ZXBB 3ARGB 4MD5B 1EGJA 3C8KB 2OL3H 2W59A 4YHNB 3RPIA 5J9PA 1EJ6A 4A2MA 2GI7A 32C2A 3ZKND 3I6KB 3KHQA 3O9WC 2R0LH 3ZDZE 4DAGH 5C6WH 4HWEL 5D7JB 4TVSa 5IGXH 2R4RH 1UVQA 2J12B 4WW2F 5I2IB 3CZJA 3QI9C 2CUMA 3GMQB 2X44D 1NCCL 4OLXH 4BZ2L 4EDWH 4ZQKA 1JWUA 1ZOXA 5J8OA 4J2XA 3L1OH 1A6TA 5B3JE 1HOCA 3S37L 4LLMB 1FVEB 2H26A 4IMKC 4RZCB 1RMFL 4PBXA 3WHE1 4G6JL 3VXMB 4N0RA 3B3IA 3K4DA 1TFHA 1QNZL 1QLRA 1HHGB 2OS7A 4QXTB 1H3XA 3CFCH 4NT6B 4HK0A 3IDMB 3MGTA 2VXUL 3DRTA 3DGCR 5D6CB 1M7XA 4AYFA 4IRSD 1DQJA 3O41B 1RZ7L 4X99A 1TPXC 1FNGA 4JQVC 4XCYA 3QCTH 4ZD3H 4FQ1H 4Q9QH 4OLVH 1RZIA 3X11A 4P2QE 3OZ9H 1KGCD 2H3NA 5I16B 3HE7A 4PJBE 5ISZE 1NCWL 5FK9A 1ZVSB 2AEPH 3UBXI 1A6WL 1WBYB 2VDPL 5L2JA 5HHXH 4QO1A 3E6HA 4UOJA 3U9PH 1RZGA 4NUJB 3O8XB 5DDHB 4LCYA 1S5HA 4S1SH 3ZE1E 4ZO6A 4LF3A 5DVMA 2HN7A 3LPWA 3ARSA 4P3DA 3QG6B 1GGUA 4U6TA 4XPHL 4JAMA 4MAUH 5E8EB 5T5FH 3JV6B 2ZJSL 3MLXH 4K94C 4PJGA 5F21B 3I3DA 5IW3A 3S3PA 1MRFH 3H9ZA 3QO1B 4HCRL 2APTA 1ZVHA 3FO9A 4DQOH 5LGJA 1E28A 3FB6A 1QLEL 2NPLX 5FFLA 4X7CC 5T1KA 3RPIB 5J9PB 5C0BE 3O45A 3C2SA 4YK4C 4NN7B 1KJ2L 3NZ8A 32C2B 5HDBE 4Y19D 4XP6L 2YD4A 4MXQC 3RWHA 5LGHL 2GTWA 3PHOA 2V7HA 4I3RH 3ULUD 2YUZA 3NCMA 4NRZA 6FABL 4QT5A 1OAUL 1UVQB 2N7AA 1LK2A 4V1DD 5C2UB 2BVTA 4X6CF 4Z76A 4HUXA 3MOBH 1KPUA 4OCSH 5D70H 4ZQKB 1IARB 1JWUB 2X1OA 1FBIL 3RUGF 3MBEC 4JFOA 1A6TB 4GMSL 1HOCB 5DT1L 4R2GC 3G5ZA 2H26B 1HCFX 1QBAA 5F7HA 3ETBF 5HI3D 2YK1H 1E4KC 2O5ZH 4KKAD 5TF1L 1TQCC 4GXVL 4GFTB 1OARH 3B3IB 4BELD 4WI8A 5AYUL 8FABA 3OJ2C 5CILH 5C7XH 5A43C 1QLRB 3DTXA 3MLVH 1IFHL 4WW2B 4HK0B 1QPPA 3MGTB 5E2UH 4JHWH 1V3KA 4X6CA 2V17H 3DRTB 3QHFH 1H3UA 2P42B 1NSNH 1CD9B 1DQJB 3MLZH 4X99B 4XCYB 1FNGB 1RZIB 3O2DH 5LXGH 2YPLE 3GO1L 3X11B 1F3DJ 3CD4A 3JUYA 2DQHH 4H88H 2P8PA 4K9EC 2H3NB 3OAYK 2Q86A 3E1F1 3NIGF 4QTIH 5FGSA 3HE7B 1CU4L 2DQDL 3BT2L 5FK9B 2ZCHH 5HTSA 1U2HA 4NKIL 2OTWA 4OAWA 5L2JB 3FQXA 1HSAA 5GGRY 1KBGH 1S7WA 3E6HB 2LAGB 5DK2A 5DWUH 1RZGB 2AXJA 4JZNA 4LSQH 5D1QA 3NN8A 4LCYB 4TTGA 4OCXL 4RGNB 1S5HB 3BN9D 4LF3B 4K7PY 3VWJC 2DI8A 2HN7B 1BGXH 4P3DB 1U93A 3L5WA 3NFPA 1JV5A 2FX7L 4JAMB 3ZHKA 1IEBA 3TESA 1HH9A 1NLBL 4PJGB 3EYQC 3W2DL 2FCBA 1MJJA 4IOIA 5J06A 1A8JH 2Y36H 1CLCA 3QXUA 2VN7A 4O9HH 2ILLA 2B5IC 3FO9B 4JCLA 5LGJB 2E7LA 1E28B 4YFDB 3FB6B 1N0LA 5F7NC 4CN6A 3BAEL 5T1KB 3O45B 3ZL4H 1WZLA 5SWZD 3NZ8B 3TO4C 4AENA 1XR8A 1VFOA 3RWHB 3X13A 2GTWB 3PHOB 2V7HB 4G7VH 4TUKH 1QUNA 1I3RA 4IDJH 4NRZB 3BPCA 4HAGA 1D5IL 4QT5B 3QXTA 4Q9RL 3ULVE 1LK2B 3EHBC 2BXYA 3ZZ1A 5KZCD 4MD0A 4Z76B 4HUXB 3WMSA 1KPUB 1V8HA 1SYSA 2FBJH 3H9SD 4P2QA 3IDJA 3MUHL 1A22B 5LAXA 1JHLH 4PJBA 5ISZA 4JFOB 1NCDH 4N8CL 4UQ2A 1CFSA 3G5ZB 5E94A 1O7VA 3V95A 12E8H 4Y2DD 5T3ZH 5FO8A 1CLOL 4EBQL 2ZCKH 4CJ1A 5T3XL 1LO3L 1Z6JT 2XRAL 2E8YA 4GXUM 2QTEA 1PX3A 3LPFA 8FABB 3PUCA 4OF7A 4CN1A 3DTXB 4GAJL 4WUUE 4NO5A 2EDJA 1SMOA 4X6CB 2Z92A 2MOVA 2R0WL 1OAXH 1LVEA 2BFVH 5GRJH 1A1OA 3WFEL 1IKNA 4ZAKA 3LDBB 1DUZA 1S3KH 2NY3B 2P8PB 3LN9A 2Q86B 4TPRH 4IIQA 1IAIH 5CP3A 4XVUD 2YS4A 2OZ4A 2OTWB 4OAWB 9CGTA 2DQTH 3LSOA 3FQXB 4W6WB 1HSAB 1NAMA 4YXLH 1S7WB 2NZ9D 4YXHH 5FECA 2OP4L 3GJFA 5DK2B 1TVBA 3P4MA 1RIHL 1EEYA 4JZNB 5D1QB 3NN8B 4DN4L 3RY6A 4F9PC 1I1AD 1V7ML 4PV8A 2XQBH 1UYWL 3B5GA 1NMCC 3FB8A 3MCG1 5DI8A 1U93B 3L5WB 3NFPB 4LRNL 5HI3C 1JV5B 4QXUH 4NC1C 3WHE0 4S0TD 5IFHH 1IEBB 1HH9B 4KKAC 4XPBH 1I4FA 2A77L 5CZVL 3UPCA 1ZGLM 4OGAD 1MJJB 4IOIB 4L3ED 2NTFA 3QDMD 4KK5C 2XV6B 1CIUA 4J6RL 5HDQH 1UKTA 5FYKD 3V5HA 4JDTL 1O7SA 1TNNA 3VRJA 3CLEH 3JWDC 3IB4A 4AENB 1MFEL 5I15L 2NY7L 1XR8B 4QHKI 5DFTA 4XCEA 3X13B 1TXKA 1I3RB 3BPCB 1D9KD 4XH2A 4XB8A 5HHQA 1XGYH 1AH1A 3RHWK 3RI5K 3DWTA 4MD0B 2YPLA 4YH6A 1SYSB 2NQCA 4P2QB 3IDJB 2FL5A 4HXBL 5LAXB 2XZCH 2B39A 3UJJL 4PJBB 4QNPE 5ISZB 2UUDK 4F58H 4KROD 1BFSA 4WHDA 1N0XL 2NYYC 1KOAA 4LLDA 4UQ2B 1H3VA 5FYLE 1CFSB 5E94B 5DJ0A 2CKBH 5FO8B 1RUAL 3R0MA 1RZKL 5F6HI 1JF1A 2X1WL 15C8H 4ZXBD 3ARGD 5DRWA 1ZANL 3D0LA 4HFUL 5I1HL 4I0PA 5CBEA 2EDXA 1BREA 4UDTA 1JNHA 1UCTA 1NBVH 3T0AA 1DDHA 4U7MA 4NO5B 3NACL 4O00A 2Z92B 2YA2A 5AYQA 2FX8H 3GMRA 3W0WE 2ENSA 2MNUA 5D7JD 1OF2A 5E03A 2X10A 5EO1A 1A1OB 2BNQA 4ZAKB 1KYOJ 5E2WH 4P9HH 1DUZB 1HINH 1KN4L 3FQTA 4FN0A 2FLBT 4IIQB 1X6NA 4KV5E 5JXAH 5GXBB 4KXZI 2LFGA 3UPAA 5I75B 3MLSH 3G5YA 3LSOB 1LO4H 4J7RA 1NAMB 1BAFH 5FECB 3GJFB 3MRIA 2EH7H 1TVBB 2IFGA 3P4MB 1EEYB 5FYJH 1CICA 3NFNA 5L0QC 4PV8B 4UT6L 4HUVA 3AMLA 4LVHC 3ZE2E 3FB8B 4BM7A 1W0YT 3VXMD 5D1XC 3ARPA 5DI8B 4P4KA 1MFBH 3F12A 1I4FB 3QISA 5CJXC 1S7XA 5E8DL 2NTFB 4TSCL 1QHOA 1TJHH 5I1IL 2PW2A 2WQRA 3VGAB 4LVNB 1FZOA 3O6ML 4OTXH 1Z9LA 2A9MH 3L7EA 3RAJL 4OGYL 3BXNA 4YGVA 1OAZH 3V5HB 4ZFZA 3VRJB 1MCHA 1UJ3C 3C5ZA 4PJXF 4M6OH 4OUUA 4XCEB 3W5MA 2R29H 1IQWL 3VXNA 1OD7A 3P0VH 4LCUA 1WWCA 3OTTA 4XH2B 1XF1A 4XVUC 5HHQB 4LEOA 4M48L 2KUTA 4K7PL 3O8XD 4NKOA 3HFMH 4XC3L 2DLFH 2YPLB 1XF5A 2Y4SA 4ZUTA 5KVGL 3U9UA 2FL5B 1TLKA 5FM5O 1MHEA 4AY0A 5KAQG 1G0DA 1I1AC 4NQUA 4LLDB 5JQ6L 2P43B 4PRNA 2GTZA 5I76A 5DJ0B 3BRDA 4YHLH 4D0DA 1FSKC 5I8KL 5JHLL 4BZ1H 1JF1B 3TA3A 4KDTA 4PJXA 4OGAC 2RCSH 5DRWB 3D0LB 4I0PB 4KJQD 5CBEB 5C07E 2F5BL 4U1GC 3DGGA 5KVFH 4UDTB 3KVQA 2NY6B 1JNHB 1QLFA 1BPVA 1YEGH 5J11B 1EVTC 1BEYL 4X5WA 1UQSB 2H6PA 5J13B 4YAQA 3GMRB 3QQ3B 5C0DA 1GGBL 4WVRA 4MQ7A 5DEZA 1OF2B 5EO1B 2NXYB 1BZQK 5D2NE 2BNQB 1C5BH 4JKMA 2B0SL 2AJXL 3KYAA 3V4PH 2O5XL 3EYSL 3FQTB 3SGJC 3WFZA 2XA8H 4NC2B 1D9KC 4KRMB 2V9TA 5A2KH 5C0FA 5TE6L 3QUYA 3MRNA 1ULVA 1ZLVH 3CK0H 2DS4A 2K3TA 3G5YB 3SDCA 3CH1A 4H8WL 2HA1A 5CSBA 4X6EA 3MRIB 2XACC 1CICB 1VFBA 2I60L 2BXZA 1QFUL 3NFNB 4HUVB 3V4UH 1T89A 3BJLA 1FJ1A 4P4KB 3F12B 3QUXA 4ZTPH 4M8QA 5E9DA 3O81A 1Z5LA 2AI0L 4ZXBC 3T3MF 1S7XB 3BKML 3O2DA 4OLUL 5FAAA 1ACZA 1MCPH 2PW2B 4LARL 3ARBC 3RVVD 2CDGA 1KCVL 1ZA6A 4XWOD 1FZOB 3L7EB 4WEBL 1TENA 2UZIL 1A7RL 3BXNB 1KELH 3IYLW 1Z3GL 4YGVB 5D7JC 4OCYL 1MFCL 3MLTA 4L8SA 3JVGC 3HE7D 4ZFZB 3C5ZB 4JPKL 3KJ6L 4H8WC 4OUUB 4DFHA 3VXNB 4TNWK 4LCUB 5IFJA 2HRPL 1MWAL 4LEOB 5FOBA 3BUYA 3HC3H 5J6HA 4NKOB 4RGND 3HI6H 1XF5B 4ZUTB 2QJDA 3Q48A 1FNSL 3U9UB 5ACMA 2DB8A 1MHEB 3FRUA 5BW7A 4KUZH 3VD4A 4K3DH 4FMKA 5BV7L 1HNGA 4LLUA 3OKEA 3DXAE 5E6ID 2EDLA 2IQAA 4PRNB 2GTZB 5I76B 3BGMA 2GCYA 4D0DB 3B9EA 5E2VH 2CRMA 3EJYD 3TA3B 2I26N 4PJXB 4RWYH 3M1BA 4ALAL 5I1DA 2E6JA 1GOGA 2ZUWA 3VWKA 4ENED 2AEQL 5JNYA 1EIBA 3DGGB 3MACL 1QOKA 5T1KD 1QLFB 3OKMA 2YA0A 4NZUH 4X5WB 2IGFL 2H6PB 3EW3B 4YAQB 2EDRA 1OSZA 5C0DB 4YHZH 3HNSH 2W0FA 3HRPA 4MQ7B 4Y5XA 3BRFA 5DUML 4QHNA 1S7RA 4RGMC 1DQLH 2E7CA 3D48R 2IANE 1JL8A 3MMEA 5AZ2H 3RWIA 1ACYH 2XYCA 1MEXH 3DIFA 1HDMA 3SHSA 1NGQL 1OSPL 1YYLL 1HHJA 1F8TL 5C0FB 2YMXL 2X05A 4O2FA 4OBRA 3QUYB 1LWRA 3MRNB 3CLFH 4W4OC 2MPAL 3ZTNH 3SDCB 3CH1B 3VXPA 3VFOA 3WV0A 4X6EB 3EO1A 1VEOA 1VFBB 1ZEAL 1N64L 4GAGL 1F4XH 1VFAA 1W8NA 4U6YA 5C86A 1FJ1B 3QUXB 3BZFA 4YDVA 4M8QB 1PQZA 4GAYA 5E9DB 1Z5LB 1BD2E 2I5YL 3S35X 4KJQC 4CDHA 1SVZA 3NA9L 5KJRL 4OIBA 5EUKA 3EDJA 4ONHA 5C0AA 2CDGB 3CFEA 1ZA6B 4NQSA 2XZAL 1IEHA 1IGYA 3H3KA 5IUSA 3Q1SH 1BM3L 1RV6X 1J1XH 4JO1H 2NY3D 4Y5VA 3MLTB 4L8SB 1WZ1L 4UDUA 3WD5H 3NBNA 1KTRL 3NIDE 1OQXA 3TIDA 1GC1L 5M94B 1TZGH 2J2ZA 1SJVA 4Y88A 4JFHE 3D9AH 3UPRA 2G5RA 1LO0L 4XX1E 4WWID 5IFJB 5FOBB 3MA7A 4DK6A 3BUYB 1DBAL 3VMPA 5D1QD 5D2NA 5J6HB 4MA8L 5DLML 1VSCA 2ATPA 1MHPH 3FRUB 3ZO0A 2ESVE 3MLYH 1OLLA 3WXWL 3OKEB 5GISL 3S5LA 2IQAB 1UEMA 4MXWH 1G7MA 2GCYB 3BGMB 3RWGA 5DZOA 4XXCA 3S37X 4WW2C 4XP5H 5IJVA 3BPLC 3M1BB 1BFVL 4RA0C 4RGOH 5I1DB 4JLRA 2QR0A 1JYVA 1RU9H 5JNYB 4FOMA 1ZLWH 1G9MH 3HZYA 2DWDA 3OKMB 3GHEL 4XWOC 3VI3F 1O0VA 2QHRH 3D18A 5ACLA 1QG3A 3DX7A 1JUFA 4NGHH 1OSZB 4WO4A 5GPRA 2HFGH 2RBLA 4Y5XB 1MRDL 1UB5A 2VR5A 4QHNB 3QB7C 2R4SL 1J0ZA 3GI9L 4EIZC 1S7RB 2B4CH 3MMEB 3LKPA 3KPMA 3RWIB 5JIKA 4F15B 4DVRH 1A7OH 1TQBB 3ZDYE 4X98A 4P2QD 1H3GA 1HDMB 1L6ZA 2HKFL 3TYGL 1HHJB 2R1WA 5ISZD 3OJDA 4O2FB 4XHQA 1MFNA 3LZFL 1CT8A 1F4YL 4LMQE 1T5WA 3N85H 3VXPB 4EJ1C 3VFOB 2EDDA 3LN5A 3EO1B 4QXWA 5J1TC 4NWUL 4XAWH 3LV3A 3FT3A 1U92A 2WP3O 2X9YA 4UT7H 1VFAB 2X4QA 4U6YB 4POUB 3BZFB 1MH5A 2V2XA 4YDVB 1PQZB 4GAYB 4WI4A 4I4WA 4N9OB 2KQNA 2G5BA 3DXAA 2DKUA 2BC4A 5EUKB 4HKXA 4RMQA 1K4DA 1FE8L 4ONHB 3VW3H 5C0AB 4KQ3L 3CFEB 4X9BA 5HHVL 4FFZH 3MUZ1 4NQSB 3MRFA 2CK0H 1IGYB 4OF0A 4PJ7E 4ZAKD 4ZUVA 2FHBA 3SO3C 4GLRI 3FO0L 3I2CH 4K71C 4FFYL 5FUOL 4XPAL 3S5LG 4Y5VB 1KYOK 4DUVA 4UDUB 1ZXQA 3TIDB 1GGYA 1Q94A 1RUMH 5KTEL 4MJ6A 1IL1A 3BMWA 3VFWA 4LCIH 5E8NA 3QRFM 3UPRB 4BKLA 1ROWA 5EWIH 4DEPC 5DO2D 2H2PD 1GYAA 3H42H 4C59B 5ID1A 3MA7B 4WU5A 1AXTL 5D2NB 1A3RL 2W91A 2ZUUA 4FABL 3S88L 1ZTXL 3RBSA 2IANA 2ATPB 4KFZC 4EVNA 3SE9H 2YC1A 4YBHA 4IM8A 4JPIA 3OX8A 3S5LB 1MCQA 4NWTH 1DQDL 5DTFA 1A4KA 2BNRE 1G7MB 2FATL 3RWGB 3RWCA 4O5LH 1F90H 3W9DA 2OSLA 2YKLH 4PJ8A 5C0RH 5IJVB 2R69L 3S98A 1UM5L 2QBWA 4JLRB 4Y1AE 3VFUA 2QR0B 2WUCH 3LKNA 1FO0H 3A67L 1J8KA 3HZYB 3F58H 2DWDB 4ERSL 2VDNL 3D18B 4YX2L 4PGCA 4QWWD 3DX7B 1JUFB 1BD2A 4FQCH 4WO4B 4HKJA 2XT1B 1I3GH 5B3NA 1UB5B 3MOAL 2VH5H 1J0JA 3LKPB 4GG6E 3KPMB 2AXFA 3BKCL 1EH9A 4L8CA 2YPLD 2P5EE 4RBPH 2YUWA 4X98B 1NFKA 4G8GE 3MV8E 3SE3A 5D1QC 1ZHBA 4M7ZB 3A6CH 2R1WB 3OJDB 4N8PA 4K07A 1CT8B 2GJZA 1T5WB 3K2UL 3LN5B 5JHDA 2VKXA 4YBQC 1T2JA 3LV3B 3FT3B 1U92B 1P2CA 5C2BH 3C6LA 3OKLA 3KS0J 3MA9L 4I77H 4LDOB 1K6QL 2X4QB 4I0PD 4ELME 1MH5B 1SEQH 2NY6D 2V2XB 1G9NC 4I4WB 3AREA 4FQXA 2ESVA 4L5FH 4Z7WF 2G5BB 3DXAB 2BC4B 4JPVH 4HKXB 1U8JA 2G60L 4O2CA 1K4DB 1BBJA 1KTKE 4ZODA 2NXYD 1MRCL 4PJAF 2BNQD 3PXJA 3MRFB 5GGSB 1A7BA 4ZUVB 1HKFA 1NDGA 4U05A 2NXZB 3PG2A 4YIQA 4NRYA 3CPLA 4JDVA 3GEWB 2F15A 1JZ7A 4PB0L 1Q94B 4IOFD 2KZ1B 4MJ6B 1C8PA 1IL1B 3VFWB 1JHTA 1AR1D 5E8NB 1P7KA 4I18C 2DBJA 4BKLB 4KZDL 2Y6SD 3V0VA 5TE7H 2Z93A 1T66D 5GZNC 1KJVA 5EFIA 2VWEC 1TIUA 5ID1B 3EDFA 1P6FA 5IEKA 1FAIL 4WU5B 2CQVA 1CICD 2CKNA 1MCKA 1RIVL 1H9VA 2IANB 1CFNA 3R06A 3ULVD 4MXVE 3THML 2ICEA 2YC1B 4P4KD 4XCCH 5E24E 1PY9A 4DKFL 4FFVC 1MFAL 4OM0L 1GGIH 5TPWH 4JPIB 4NZRH 1SM3H 3OX8B 1QKZH 5IKCA 5B8CA 3OAZK 1N6VA 1P6AB 5DTFB 1A4KB 2NZIA 1PG7L 4I5BA 3RWCB 2EKSA 4KMLB 2OSLB 3W9DB 4GSDH 4PJ8B 4RFNB 2HT3D 5E7FA 1G6RL 3VFUB 4IOSD 3CH8A 4CU7A 3IFNH 5FUZH 5DVKA 4DKEL 1T04A 3MV9E 4POYA 1U58A 2V9RA 1SEBA 2VUYA 3C5ZD 3OPZH 4PGCB 5IB4A 3RDTA 1WZKA 4XX1G 5EOCJ 1BD2B 5C0CA 4HKJB 5EC1A 4J12A 5DA0B 1PLGH 2FSEA 3LEXA 3EFDL 1H3PL 1RY7B 3DI2B 5BZWA 3IU3A 4XNQA 5I75C 1D5XA 2AXFB 2DL9A 2D7TL 4L8CB 4KJWC 1RD6A 3BDBA 4L4TE 1WWAX 5JW4N 3G9AB 2ZNXA 4XHJD 1ZHBB 1HKLH 3RY6C 4S0SD 4U49A 3E2HB 3DYOA 3LKSA 4TSAL 3QDHA 2GJZB 5A16A 3QDGE 5IT2H 1Z9OA 1JNJA 5JHDB 3TA3D 3ZTJH 3NA4A 3A6BH 1P2CB 1UZ6E 4M00A 4CMMA 2NMSA 1NUFA 2CLRA 3C6LB 3OKLB 4NNPH 2CUIA 2J5LC 2QHLA 3BP4A 4M6NL 4ODTH 3AREB 4LVNC 4FQXB 2ESVB 4DN3H 1PG7W 3H3PH 3OGOE 1U8JB 2OR7A 3SJVA 1QFWL 4D9RE 4O2CB 3S97C 1RSFA 1U8OA 2BNRA 1BBJB 5CSGA 3AB0B 4U6XA 2A0LC 4XNUL 2EZ0C 5DUPL 1NDGB 3RIFK 3G6JF 4Y1AA 4YIQB 4NRYB 4OGZA 3CPLB 4JDVB 1P4IH 1UH3A 4GKNA 2XTJB 4JREB 4XP4H 1CGYA 5D1ZC 1JHTB 2P8MA 3QQ4A 4XNXL 1P7KB 4MA7L 3QUYD 3NCFB 4GMTH 3V0VB 5KSVA 2FNBA 2Z93B 5ALBL 3SDCD 1KJVB 5EFIB 2VXQH 4FQLH 5IEKB 3BEWA 4DGIL 5JW4M 2EYRA 2E9WA 2BHYA 1CFNB 3R06B 5I1CH 4Z7VE 4GG6A 2BVYA 4EN3A 5FHBL 2YEZA 2ICEB 2AGJH 5BO1H 4ZSOE 3QUXD 4LKXA 4G8GA 3UX9B 5E9DD 5IKCB 5B8CB 3TJHD 1RIUH 3DV4A 1INDH 4MJIA 4IJ3B 5FYLD 4O02L 3EOTH 4I5BB 4KI5E 2EKSB 2UVFA 1AR2A 4K8RL 5GS0H 4YBLB 1UH4A 2W9DH 1CL7H 5JW3L 4UB0H 1IGFH 5F8RC 5ADOH 1MVUA 2CIIA 2IPTH 5I18L 4CKVX 4LEXH 3GRWH 5IFAH 3UTQA 1SY6L 1T04B 5CCKL 1U58B 1SEBB 4PG2C 1PSKH 4JKPH 5IB4B 3RDTB 4IRZH 5CGYD 3N9GH 5C0CB 3QG7H 5EC1B 2FB4L 1UM6L 5HDOA 2FSEB 3LEXB 5BZWB 3IU3B 4XNQB 1GZQA 1D5XB 3S6CA 3U0WL 4WI6A 5HVGB 3TWCH 1INQA 5IB1A 5ESAA 4U31A 5HVHB 2ZCLL 4FZEL 1QA9A 1U3HA 4Q0XL 4MDJA 4MNQE 1RHFA 4LPVA 1P4LA 3LKSB 3FN3A 3NFSL 4P4KC 2F58H 5A16B 2BY0A 1RURH 4N0YL 2X9WA 4PJ9A 4G3YH 1MJ8H 3LHPL 1U6AH 4CMMB 2VLJA 2WANA 5DC9B 2CLRB 1GAFH 3F6IA 3HB3D 4WFGE 4R26L 3VWKD 3DMMA 4HT1L 5HDLA 5CKAA 1E6OL 2X4NA 3BP4B 3WFBH 2HT3C 2JE8A 5FGCE 1CDCA 3TBWA 2ERJC 2DD8H 4JRWA 3SJVB 3TVMA 1PEZA 1FDLH 3ARDA 3WXVH 4GRLA 1U8OB 3QFJE 2BNRB 2K9UA 1OTTD 3I85A 4U6XB 5I8CA 1E0OB 3QEQA 3G04A 2VZ3A 3SO5A 4Y1AB 1CBVH 3S4SG 4GKNB 2P8MB 1U3YA 3QQ4B 4OCWH 1KSRA 1HN1A 2ZNWA 5DZLA 4JN1H 5EZOL 2DQUL 5KSVB 4M7KL 4OGXH 2BOCA 5GGSY 4M61A 3BEWB 2EYRB 3HR5A 5GGQH 4GG6B 3QCVL 4N1HB 4EN3B 2L4OA 1F6AA 2YEZB 2PNDA 4K7PX 1KLGA 1RZJL 1OAYH 4LKXB 4G8GB 3C60A 4LSVH 2HVKA 3AC0A 3DV4B 4F3FA 4MJIB 3REVA 3V6OE 4JRXE 5TFSH 5FA3A 1IQDA 1Q0XH 1OY3B 2VDLL 3QDGA 5C0AD 1IC4L 5A1AA 5JPNA 1MVUB 2CIIB 3UTQB 4Z8FL 5EUOE 2ENYA 3ALWA 4Y4FC 5DQDL 4XBPA 3EOBA 5LWYH 4XGZA 3GSNL 1IRAY 1Y6KR 1U8QA 1FNAA 1RUPH 5E5MA 4R4FH 4LSRH 2E7HA 5KW9L 5DQJA 2F19H 5J7CC 1R5VA 2VDKH 3EZJB 1P5VA 4HPYH 1BVKA 1GZQB 1KF9B 2VSCA 3CSBA 1INQB 3MFFA 2IJ0C 3ULUL 3SDCC 5IB1B 2P1YA 5ESAB 1QA9B 1S78C 5I71B 1ETZA 1U3HB 3RRQA 5HYEA 1CFBA 2NY1B 2QQNH 4MDJB 3TT1H 1OM3H 1T89C 1DVFA 1P4LB 4FMFA 3B5TA 1JRHL 4WRLA 4WJ5A 5ITBL 1FO0A 1VGEH 4RIRA 4PJ9B 4BFEA 3TJHC 4MAYA 2VLJB 5DD1L 4CL7A 4HUMB 3DMMB 3TH3T 2X4NB 2CLZA 1GZPA 1A3LH 1Q0YL 4OLZL 5CUSL 5FB8A 1MCOL 4ZSOA 1FVDA 4XP1L 5I6XB 4LVOB 3TBWB 2UVEA 1HIML 3TVMB 3ARDB 1JGDA 4GRLB 4WO4D 4L8SC 4J3WA 4FQIH 2A83A 3FQWA 4P5TC 5I8CB 1K3ZA 3QEQB 3G04B 3MV01 3DSNA 3BGFB 5D4QA 2DLIA 4EI5C 4Z7NE 4UTAL 2YD9A 3NMEA 4OKDA 2F54E 4FZ8L 5HI5C 1O5DT 3ZSSA 5FM8A 4POZD 2VYRE 3FN9A 3T0EE 2PETA 1WEJH 1QSFA 1OGAE 1IC7L 5DD3H 5D5MF 3KYMA 3QUMA 1QBLH 1YEJL 3WSQL 5GZOD 2BOCB 4L9LA 1KIQA 3O3UN 1AGDA 2Z31A 4M61B 4HEPG 3S9DB 1OHQA 1GHFL 2BNUA 3B9VA 4KTDH 4PP2A 3DO3A 5IHUH 3LY6A 1H8OA 3HR5B 4I48A 1YNTA 2OR8A 1F6AB 3RU8H 1CFTA 1KLGB 1NUNB 3CVHA 1DBKH 3HC0A 3C60B 2HVKB 3U0PA 3SCMA 4F3FB 4MNQA 3DXAD 3REVB 5CS7A 1UWEH 3T1WA 4S1RL 5F7EH 3U36A 5FA3B 1IQDB 2P44B 1KFAL 2HYMA 1EZVY 3QDGB 5JPNB 4WHYH 3H7LA 2F74A 4V2CB 2UWEF 5D5MA 4M5YL 3SGDI 4OV5A 3GSRB 2Y07H 2NXZD 4Y5XC 1Q9LA 2EDFA 3TN0C 5AG9A 1MY7A 4MNGE 4D9LH 4XBPB 3EOBB 4XGZB 4Z6AT 2GK2A 1U8QB 2HRLA 3D1MC 4LP5A 1HYRC 5E5MB 5FYJD 3MQIA 4MZ3A 5DUBA 1SBSH 4UNTA 4OI8A 1YEHH 3WS6A 1R5IA 4NFCA 5DQJB 1R5VB 2HT2C 4MVBD 1N5YH 1BVKB 3MFFB 2IAND 3SQOH 5ICZA 2XN9E 1PZ5A 1FZMA 5B22A 1ETZB 5I66A 2UWEA 1CXLA 4O4YL 1DVFB 3ILQC 5EA0L 1ED3A 3CXDL 4U4BA 3RX7A 3BZEA 4FP8H 3K2MC 1PKQE 3RGHA 1AY1H 1UB6A 2QV2A 4WJ5B 1Q72H 5I1AA 1FO0B 3RIAK 4RIRB 3WYRA 3ELAT 4ZOAA 4PJ8D 4MAYB 5F9WC 1MCBA 2A6IA 2EC8A 1TNMA 4KVNL 1KB5H 4BK4A 1LEIA 2CLZB 1GZPB 2QSCH 5FB8B 2D9QB 1JPSL 3L3GA 1AJ7L 4ZSOB 1FVDB 4HFWA 2WLYA 3L9RA 1JGDB 1BD2D 3N1QC 4AMKL 4JRXA 2A83B 3FQWB 5E99H 3LEYH 4NZJA 2RGSA 2Q7YA 3JUZA 4DCQA 1YEIH 1LDSA 5KVEH 2LAAA 2EO9A 4FTVE 1RAMA 4MX7A 3KPNA 1ZV5A 4MS8D 1QSFB 2Z0BA 5SX4H 4FNLH 3WCYA 4ORZC 1G7HA 4WFHE 2HKHL 3UYRH 3KYMB 3QUMB 3KXFA 1DQMH 4L9LB 1ZGLA 1KIQB 1KEGL 1AGDB 2Z31B 3O6FA 5JHDD 3RTQA 3L6FA 2NW3A 2BNUB 4PP2B 1OAQL 4HC1A 4AEEA 2CGRH 4I48B 3C6LD 1YNTB 2DIBA 5GGTA 1EHLH 4Q9BA 3WFCH 4U6VL 1CFTB 1BFTA 4XXCC 3HC0B 3CVHB 3AMKA 4WFFE 5DVLA 3ARED 3I6LD 4FQXD 2ESVD 3U0PB 1WIOA 2IQ9L 3AFLA 3QULA 3SCMB 3V0AC 4MNQB 3SGDH 5GS2H 3U36B 1OLZA 4RQQA 4TVPL 1C5CH 2DIAA 4D3CL 3LS4L 1HHHA 2F74B 3FQNA 5D5MB 5M95B 4OV5B 2RHEA 1Q9LB 1RUQL 2PYEE 3MODL 4LQFL 4CW1A 2XTJD 2ZUSA 4QRSA 2ZKHL 2VDQL 4C56A 3IDGA 5FYKL 5DUBB 2I07A 4HWEH 2EC9U 1QFPA 2DQFA 1R5IB 3C9NA 4M03A 1XF2A 1YN7A 4HV8A 1X5GA 2W9EL 1AFVL 3ABZA 5ICZB 1PZ5B 4LFHG 1NCCH 1FZMB 4JFFE 5JIHA 3GSXA 3UP1A 4BZ2H 5I66B 1C1EL 2UWEB 4FXGA 3V6ZA 3T0EA 3S37H 1ED3B 4U1LA 1WWBX 2EE3A 3BZEB 4M1DL 1UB6B 5IW1A 5I1AB 5IWLA 3GRWA 4YC2C 1NBQA 2FJGA 1J18A 3B9AA 2A6IB 1RMFH 2P49B 4G6JH 5TDPA 4P9HC 1AI1L 2PTVA 2D0FA 1LEIB 5GS1A 1QNZH 3UYPA 3B9KA 3BUTA 7FABL 3L3GB 2VXUH 4JJ5B 4HFWB 3RDTD 5EU7E 1KPRA 4IRJA 2NXZC 3L9RB 4Z7OF 5BQ7A 5C0CD 1J86A 1AE6L 1RZ7H 4JRXB 2GK0A 3IETA 2Q7YB 4LOUD 1KV3A 5GJTL 4DCQB 1N2RA 4P2OC 1T5XA 2PKDA 3SDXF 3EJJX 4MX7B 3KPNB 3RWFA 1OT1A 1NCWH 1K4CA 2APXA 5GJSL 1A6WH 2CRYA 1G7HB 2VDPH 4WCYL 3KR3H 3O0RL 3KXFB 2IPUG 4OD3L 4EDXA 1MLBA 1ZGLB 4OLYL 3O6FB 3RTQB 4NKMA 3L6FB 2NW3B 5ACZA 3T08A 2YXMA 2XN9A 4F80A 2NLJA 3KLSA 4PJ8C 4XPHH 5E2TL 2ZJSH 1TETL 3QULB 3SDXA 3SJVD 4RQQB 3RVXD 2BNRD 4HCRH 3TPUA 1HHHB 2J88L 4YFLI 3SEPA 3FQNB 5D72L 2WIIA 5FA4A 3ROOA 5BRZA 4TULL 4L1DA 1QLEH 4Y7MA 5MHSE 4Y1AD 4MCZA 1ADQL 1UH2A 1GOHA 4CW1B 4QRSB 4TSBL 1KJ2H 3CFBA 3EKCA 4PRAA 2XKUA 4XP6H 4C56B 3SDAA 3IDGB 3UDWA 4P2CG 2I07B 5LGHH 3QRGL 1CF8L 3SE8L 2DQFB 1QBBA 2FO1A 1YQVL 3C9NB 6FABH 1CTOA 1OAUH 4MS8C 4BFIA 1XF2B 3QFDA 1IILE 1YN7B 1ZHKA 4HV8B 1OPGL 5HGGS 1MELA 3T77A 1JP5A 4EN3D 4AZ8A 5FGBC 1P4BL 4FTVA 5C6PB 4FXGB 1FBIH 3V6ZB 4G8GD 3T0EB 1G1CA 4GMSH 4XPGH 5CZXD 4U1LB 4KRPC 3P9WB 2BP3A 4O58L 4MJID 2EDQA 3VXSA 2FH6A 2D7QA 1HZHL 5IW1B 4WEUD 5F89A 1EXUA 1FFNA 3VG9B 2FJGB 4GBXC 5TF1H 4GXVH 4OKVA 3WNOA 3HMXA 5TDPB 2PTUA 5F3BA 4KAQL 5I73C 5AYUH 5GS1B 4W4NA 3B9KB 3AB0C 5MENE 1IFHH 3LIZL 2JCCF 4ZNCD 1ERNA 2VAAA 3SGKA 1KPRB 2C3HA 1EGJL 4IRJB 4Z7QF 5BQ7B 2OMNA 4HUKB 2DDQL 2XTJC 5A2IH 2GK0B 1EPFA 2MJWA 2D4DA 2VSDA 1DSFL 1N2RB 3GO1H 3UJIL 1T5XB 2FD6L 3RWFB 1CU4H 4Q6IA 2DQDH 3BT2H 4Q2ZA 1K4CB 3WJJA 2PYEA 1U3HD 2NY1D 3FFCA 4NKIH 3EUUA 1LGVA 5B4MC 2EEAA 4KGLA 3LRGA 1HK6A 4EDXB 1MLBB 2XI9A 2FH8A 1LILA 1R3HA 4NKMB 5C3TA 5DA4A 4PJ9D 4OCXH 5B8CC 3QUKA 5HPMA 1WFOA 2VLJD 4IJ3C 5ACZB 2WBJA 3DMMD 2XN9B 5F72S 2NLJB 2FX7H 4QOKA 5D71H 1IAOA 4JFFA 4GH7B 3GI8H 1NLBH 2HAZA 3ARYA 4LPXA 1IGJA 5MI0C 3W2DH 2JF1A 2E9JA 3SDXB 3TVMD 3ARDD 5EIIA 4GRLD 5TDNA 3TPUB 2R9HC 1J10A 3Q5TA 3QEQD 5FA4B 2WIIB 1PG7X 4HZLA 3ROOB 5BRZB 3BAEH 4Z77A 5C0EA 4MCZB 1IGIL 2VN4A 1FG9C 4ONFL 3CFBB 1T22A 2QL1A 4PRAB 3WDJA 3SDAB 3C08L 5EC2A 3DI3B 3T1FA 4DK3A 1D5IH 2E5EA 3VGGA 1EEUA 4BFIB 4Q9RH 3QFDB 4ZO7A 4BFBD 4QF1A 1ZHKB 3T77B 4ELKA 1RFDL 4JO3L 1X5LA 4FTVB 3UTTE 3PP4L 3BDYL 3IF1A 1IMHC 2DLHA 3TZVA 4XPFL 3C60D 4N8CH 4LLVA 3GBNL 1Q9WA 3ARZA 4HJGA 1GIGL 4P5MA 3VXSB 4M1GL 1LO5A 1CLOH 2FJHA 4EBQH 5F89B 1EXUB 1CLYL 1FFNB 1LO3H 1TVDA 5T3XH 3QDGD 2XRAH 4AIZA 1X4XA 4OKVB 5HXMA 3RVXC 1EO8L 4JEGB 1XF4A 3X3GL 1NQBA 4PREA 1EEQA 4GAJH 2PTTA 4TOYL 1QP1A 5FO7A 5IVOA 2VAAB 1PYWA 4LP4A 1B0WA 5BS0E 2R0WH 1AQDA 4D9RD 3WFEH 1NH6A 2J8UE 4C54A 2M1KA 1TVHA 3JV0A 4IS6A 1UJTA 1MAJA 1NEUA 2G75A 4Q6IB 4Q2ZB 2PYEB 1JGUL 3FFCB 1DVFD 1IVLA 2P47B 3BOVA 1I8KA 1MREL 2OP4H 4OD2A 4R97B 1RZ8A 1R3HB 1RIHH 3C2AL 3EYOA 4PTTA 3X12A 2NNAA 3JV4A 5CZXC 3T04D 4DN4H 4GJTB 1DLFL 3QUKB 1V7MH 3ZDXE 5HPMB 4MAYD 1ZT1B 1UYWH 1J8HE 4YZFE 1MVFA 2WBJB 3LQAL 4LRNH 5E08L 4QOKB 3RKDD 1IAOB 4F37K 1HYSD 4JFFB 1A7QL 2A77H 5CZVH 1DLHA 1IGJB 3WJLC 4E0RA 2XICA 1FV1A 5EIIB 2N4IA 4ODBD 5TDNB 1G7PA 1KEML 4KI5D 4J6RH 2BVEA 4HZLB 4U33A 1QFWM 1BJ8A 4Z77B 1F42A 5C0EB 5L88L 5GS3A 4ODSL 4JDTH 5HYFA 4WHYG 1C08A 3IJYA 3O9WA 1NMAL 1T22B 4H0IA 3WEXA 1QSFD 5I15H 1MFEH 2NY7H 4M8VA 5SWQA 5EC2B 4M93B 3V5KA 4YHYB 2GHWB 4HF5L 4QF1B 2Z31D 3DARA 4ZS7L 3BDXA 5CINL 2M26A 3H0TA 1KN2L 1WCQA 1U3JA 4ELKB 3TF7C 3MX0A 4BFGA 4OV6F 4GOSA 4HXBH 1G9MC 1FC1A 2Q8AL 3IF1B 3UJJH 5DMYA 3TZVB 4XC1L 3E0GA 1N0XH 1JYXA 1R3IL 4LLVB 3SCMD 1Q9WB 4OQTA 4MNQD 3LB6D 4HJGB 4P5MB 4GQ9L 4TQEL 1LO5B 1RUAH 1RZKH 5L9DL 2FJHB 3BX7C 4FRWA 2A6JA 4AIZB 1ZANH 2B4CC 4HFUH 5I1HH 4RMVA 3WKML 3ARDC 4YLQT 1XF4B 1EHNA 1J7VR 4PREB 2BVOA 3DNKA 3HPJA 4WFGD 1KGCE 4YJZL 1R0AL 2J8HA 2PTTB 3MGAA 5FO7B 3NACH 5F1OB 5JTWA 1PYWB 4JQVA 4OZFA 2VUOA 1WSST 5TQ0L 3HZVA 4AT6A 3ZE0F 1AQDB 5DJAA 5EDXA 1TVHB 4IS6B 1KN4H 5DRXA 1CD8A 1ZLSL 2G75B 1AD0A 4N90D 3REWA 2ZUYA 4JN2A 1LE9A 1I8KB 1ND0A 3U4BL 4OD2B 2P7TA 1RZ8B 4PTTB 3EYOB 3C60C 3X12B 2NNAB 3JV4B 4PGDA 1B88A 1A47A 1EERB 4UT6H 5CEZE 3PE9A 1WC7A 3NCYP 2VDRL 4KUCF 1L7IL 1N59A 1WQVT 1GPOL 2E6PA 4Z9KB 1T83C 1OP5K 3UTTA 1DLHB 1SMAA 4LFHD 3FAWA 4P57A 4E0RB 2IBBA 5E8DH 2X9XA 1FV1B 1PVHA 4TSCH 5I1IH 2R15A 4JRXD 3T4YA 1G7PB 4AQOA 3O6MH 3RAJH 3AU1A 4OGYH 4HLZH 4NFDA 1OOAA 4V1DE 3KYKL 1URLA 1N6QL 2A2QT 1C08B 3IJYB 3O9WB 3WEXB 3JXAA 5DMJB 2EIEA 4YFEA 4XZUA 3NH7L 2LU3A 3V7AG 1IQWH 5SWQB 3IDIA 3V5KB 4BH8A 4HH9A 3KXFD 5AG8A 4M48H 4G7YL 2CH8A 3O6FD 1F3JA 2XY2A 3RTQD 4K7PH 4NC1E 2OZ4L 3H0TB 3CVIL 2J8UA 4XC3H 2VXVL 4NRXA 1KPVA 5KVGH 4OBSA 3MBEA 4MJ2A 3U30B 4OZFG 3ALPA 1BBDL 4MAYC 4MDIA 3BE1L 2C5DC 5JQ6H 2QSTA 3BYYA 3T4AA 2OR9L 3BESR 3QWRA 1E4KA 5I8KH 5C0GA 5JHLH 5AEAA 2A6JB 1RPQA 2VZVA 3WFHA 2NR6D 3C8DA 5IR1A 2VDML 1MAML 2F5BH 1J8HA 3QHTC 2BVOB 3HPJB 5JZ7C 3U4AA 5IB5A 5CD3A 3ZKXC 1BEYH 1P84J 4P23A 3VFRA 5I17A 4C56D 4OZFB 3CDYA 1U41A 3P40A 1GGBH 3HZVB 4AT6B 3MJGX 3MLUL 1SQ2N 4RA3A 5DJAB 5ESQA 2B0SH 2AJXH 3V79C 1KUMA 2YOCA 1BFOA 2MKLC 2O5XH 3EYSH 5DRXB 4KDVA 4KTEL 3DO7A 3ZMRA 4BQ9A 2D7NA 3REWB 1BX2A 4LASH 5TE6H 3T0ED 1OL0A 5E4EC 2LTQC 5F7MC 3LRSA 2YWZA 1LE9B 3NIFF 4H8WH 4MA1C 4G8IA 1ND0B 4WHCA 4LGPB 5IMOA 2P7TB 3BD5A 2I60H 4PGDB 5HGAA 1QFUH 3VWJA 1NLDL 4JR9L 3LB6C 4YHPA 2XWJA 1WC7B 2MHAA 4M7JL 1N59B 3B9KD 2JJTC 2AI0H 3UTTB 3GB7A 1CI5A 2BSTA 4P57B 3BKMH 1VEPA 4J3SA 4K3EL 4OLUH 4DOHB 4IRJD 4LARH 5E56A 1KCVH 2I25N 3T4YB 1KLUA 4LBEA 1OGTB 4EIGB 4WEBH 2UZIH 1A7RH 3AU1B 2AABL 4JFDA 1Z3GH 1H15A 5F7DA 3WS6C 4EOWL 2OQJA 4OCYH 1I9IL 1MFCH 4QTHA 3TO4A 5J3HC 3WNPA 3H9SE 4JPKH 1L4IA 3KJ6H 2YD7A 4U7KA 4CMHC 4XZUB 2ZP0T 1FL5A 2WWMD 3IDIB 2KDGA 4M7LT 3T2PA 3V52L 4BH8B 4HH9B 2HRPH