3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
1EANA 3D07A 3IGKA 4AGNA 4KVPA 1EAQA 1UOLA 3Q01A 5A7BA 1GZHA 3D05A 5AOMA 3D06A 3WU1A 4L0ZA 2XWRA 3Q05A 3IGLA 3Q06A 3VD2A 5G4NA 3VD0A 5ABAA 2X0VA 2BIOA 4AGMA 4AGOA 5G4OA 5LAPA 4QO1B 4IBYA 4MZIA 2BIPA 2ADYA 2MEJB 4LOEA 3US0A 3QYMA 2J1ZA 2RMNA 3D08A 3WTTA 5AB9A 1KZYA 2J20A 5LGYA 1HU8A 1IO4C 3VD1A 2XWCA 2J1XA 3KMDA 5BUAA 3QYNA 2J6WA 2AC0A 4LO9A 2J21A 3ZMEA 3WTUA 1TUPA 5G4MA 3WTVA 2WGXA 2BIMA 2IOIA 1CMOA 4IBTA 4IBVA 2X0UA 5ECGA 2YBGA 3WTWA 3TS8A 5KBDA 4LOFA 4AGPA 1HJBC 4IBWA 4GUQA 2BINA 5AOIA 1HJCA 4G83A 2J1YA 5AOJA 2ATAA 2J1WA 4AGLA 4IBZA 5AOLA 3WTSA 1CO1A 1YCSA 4IBUA 1T4WA 3WTXA 4IBSA 3D0AA 4G82A 2FEJA 2AHIA 4MZRA 2GEQA 1GZHC 2IOMA 4HJEA 1EAOA 4A63A 5AOKA 3D09A 2OCJA 2VUKA 2H1LM 3WTYA 4GUOA 2X0WA 2IOOA 2P52A 3KZ8A 1E50A 2BIQA 4IBQA 1TSRA 4L0YA 1H9DA 2PCXA 3EXJA 4L18A 1LJMA 3EXLA 4XR8C 3US1A 4AGQA 4IJTA
chains in the Genus database with same CATH superfamily
1FCCA 5AZ2H 3U30C 3QJHA 3GS0A 5DURD 1NGYB 3B37A 4QAMB 5F7UA 4G1EA 5F93C 4ODWA 5H2BB 3E38A 2VN3A 1UURA 3ARBA 3QC6X 2A6IB 2D4DA 2HT4D 1NLBH 3R4RA 4Q4EA 4TQEL 3D7PA 3QEHA 4PJ6A 3MOAL 1CGSH 2UX7A 3WMSA 3DMMB 3P1VA 3W9EB 4BFRA 1RUMH 4FTDA 4JPSA 5HYFA 4G8EA 5C8JA 4KY2A 1OAYL 4G7RB 5ISZE 3V8CA 5JIPA 2O5ZH 5FEBA 1JZ7A 3I6SA 3L4CA 4HFUL 2JKWA 3LIZA 2BY2A 1P6AB 1JFHA 3DX7B 4PS4L 5E5RB 4W9CC 4DN4H 1CD1B 1W6LA 2EACA 3EOAB 5D1ZD 1U2HA 3BDYH 1I75A 3W39A 4DK5A 1EUTA 1U6AH 4MAYC 5LGYA 2VXTL 3ATAA 2O61A 4DP0X 1SLXA 2IADB 2V8LA 3RU8L 2A6IA 1RMFH 3S36H 3LVEA 3WTUA 3TN0D 3BUPA 3LKNA 5DTFB 4U1MB 2X09A 3VFVA 1II4E 3EYVB 2MNUA 2R1YB 3PDOB 2XQBH 1F4WH 4Y1AA 3VMPA 4E9RA 1G1CA 4H0LC 4U2ZA 2ZIDA 4B9PA 1OAZH 1J8SA 3FZUD 4F33B 2PWDA 4R4FH 1KGYE 4WUUD 5FW6A 3UJTL 4JL1A 1CPUA 3BPNC 5GS0D 1QO3B 1S3KL 5EOTA 4TSAL 2BCKA 1BVOA 5A6LA 1EZVY 5GGQH 5I1AB 4LKCB 4P2QD 3WFEL 3TIEA 4GG6A 1BF8A 5J89A 4H7VA 2CCWA 2W81C 5SV3A 5LNDA 3P2TA 4BRJA 2L7EA 32C2A 5LB1A 2GI0A 1KXTA 2NRDA 1OE2A 1F97A 5BVJB 2Y07H 2AJZA 4AW7A 4YFLF 4WSKA 3P0VL 3KXFB 4EIUA 5EC1B 2C9QA 1MFAH 2FHCA 3HLAA 4LEOB 3TBCA 5C0NC 2FD6L 2VZ1A 1FORL 4N2KA 4OVVA 1NICA 4X8CA 2IPUK 5GHWL 1JZJA 3UBHA 3V5DB 3BSZL 4BK5C 1JHTB 3MRJA 1E5UI 3M7OA 5DMKA 3ZIYA 4V1DA 4LLYB 5DD5L 3VWKA 5T1JA 3ROOB 1J8KA 5H35A 4KZEH 3BGFC 2D7MA 5IHZB 4EN3C 2ADJA 2Q6WA 3QXAB 1C5CH 4ZJ9A 3IKCA 3QUGA 3X14A 1IM3D 1G6RA 1YC7A 4HWBA 5A1AA 4KQ4L 1KJMB 3QUYA 1Y6KR 1A7PH 2NY0C 2VH5L 3UC0H 3OG4B 1SEBB 2NW2B 3W0WB 2YHGA 4XE5B 2JFCA 2C9UA 5BZXA 3PWPE 4ESKA 4JUSA 3LZPA 4Z5RB 5TE4L 4MDJA 1VLXA 1QUNA 4JVUA 4OGXL 5IB5B 3RGVA 5JIMA 4OFKA 4O02L 5FV1L 4E9QA 3VWJC 1P1ZA 4NZUH 4XBPB 4YLBA 5TK4A 1BFVH 5DZNA 5EU3A 1PZAA 2WWMD 2G4GA 4OH2A 3GGWA 2ENQA 3LSOB 5E1GA 3KPMA 4RWYH 1ZIBA 5C0RH 3KG5A 1NUFA 4DGYH 3ZL1A 4ATTA 3M6DA 4HFWB 3VRJB 1P7KB 4UQ3B 1SBBA 3KYAA 1J5HA 2H8PB 1FA4A 4YEEA 5J8OA 3BUYB 5CR1A 2ZCKH 5FGBC 3RB7A 3F84A 4L1BA 2Y9RT 1ACCA 5AG8A 1NCDL 4S1QL 4RISH 4XP9L 1AQ8A 3IJEB 4ONHA 4YH6A 3GSUA 2R0ZL 1HDMB 1QBLH 2L3BA 2IC2A 2GTZA 3N1QC 2BNRE 1AZZC 2FRGP 2DLFH 3BKJH 3MLRH 1GOGA 4WTZA 3CSYA 4QYOB 1UWGL 1KFAH 1OTTD 3WY2A 2R8SL 2E6JA 1QEWA 2L8AA 5AKVA 3KL5A 4RDQG 4PRIA 3DRTB 3CFBA 4Y1AD 1OQOA 3OKLB 1BIHA 4H2CA 3FCSB 4K3EL 3SGKC 1T1WA 5BOJA 4BZ2L 5F9JB 1RUKH 4XNDA 4XNAA 4HAFA 2JXMA 4L0PB 3PGCA 2R29H 4XH2B 1TDQA 1XH3B 3TNMB 5AOLA 1N0XH 2VLME 3CC5A 4L8DB 4BFIB 3ZKXB 4Y4KB 4FERA 1ZLSH 4E9WA 2VLKB 2C9PA 5C3TA 4ANKA 3IETA 3FNKA 3IDGB 3DOHA 3V6OC 3CH8A 2DYPB 3SQOH 3BRFA 1OTUD 1YEGL 2GEQA 2HFFA 1FFNB 2OMXB 2FLMA 2NY0D 1AJ7H 1TKWB 4GRLB 2ZOTA 5CZXC 5GS0L 1M1XB 4LASH 3OKEA 4KX9A 3O9WD 3GXFA 5I1HH 3AABA 4LSUH 1TFHA 4N2IA 4ZMNA 4LSVH 2E7LC 3WDHA 4YSSA 2AMGA 4IBQA 1QABA 4ZMZA 4R6UA 3TBSB 2IXQB 1F4XH 2J44A 2ZAIA 4M7ZB 2Q2EB 3TL5A 4BK5A 1JD7A 2CSPA 5DRWB 3TJHC 2VDPL 2VMCA 1E2VA 3LIUA 2IV9A 3DRQB 3VFMA 3PPEA 2OXGB 2FO1A 1L9OA 1QNZH 4KJWD 1ZWIB 4FZ8H 4OU3A 4BQBA 3ARDB 5BJTB 3BW9B 2ARJQ 4S0SD 5IZ7A 1MY5A 1G0YR 3QWOA 4PBXA 4GG6E 5HDOA 3QEUB 3QZWG 1F86A 1EK3A 1IKFL 3QDMB 3HMWH 1BMZA 3L1GA 5I1GL 5JIDA 3KHOA 4QRPE 2XV0A 2WXFA 3ESOA 5SWQA 4R7DA 3WD5H 5IB3A 5D1ZI 4J1UB 1G5GA 2WZPA 1B6DA 3ZDYB 1RUAL 1C1EL 5B1KA 4XC3H 1V7NL 2C3GA 3MYZA 3MXVH 5D1XC 3WFBL 2YJLA 3DIFB 4LCCC 2E46A 2FSEA 1PQZB 2EIBA 2NXYD 5J3HD 1RZKL 4PUBL 2ZX5A 3V4LA 3X1BA 4G7YL 1JPTL 1F3RB 2Y5TA 5DRNB 2FT7A 1OM3H 2ZSWA 3PV6A 5F6HI 1RFDL 1PDKA 1N5YL 3LDBB 1V7ML 4YSUA 4ZD3H 1YLBB 4N3UA 4ODUA 4ZMVA 1OPOA 4AXWA 2J21A 2H1PL 3CNKA 4LLUB 3IT8D 5ICZA 2L7UA 1U8JA 3GRWH 1QSEA 4CVZB 2HG5B 5DFTA 1SJVA 2DI8A 4LF3A 5K59E 1J0IA 3SE9H 1A6WH 1YAZA 4POUB 4RMUA 5CHNA 4PVBA 3K6SA 3V4PA 3TS8A 4NSKA 3VXSA 3KPLB 1KBWA 2J8UE 4KK5D 2EDJA 4RX4D 4WK2B 3Q0HA 1U95A 2A77H 3X3GH 4YGVA 4GH7B 4N6QA 2YC1A 5KBMA 2XTLA 5KSAD 1OSYA 4KH9A 3L7FB 4UILH 5KSUA 4N2GA 1UACL 5FECA 3NFPA 5IB3B 4FNSA 1NTDA 1XL6A 2YK1L 2YZ1A 1AD9B 1XEDA 5JDJA 1GW0A 1P53A 5D7JB 2YQGA 4JFDD 4TNVF 4NP9A 2HX9A 2MRYA 2WBWB 1N18A 2FB4L 4DKEL 1Z5HA 3FT2B 3AG3B 4XMKL 1EERB 1D6VL 1OM9A 8CGTA 2OJ1A 2R9HD 2X70B 3BLKA 1AS6A 3FT1A 1F4HA 3LH9A 4HP5A 5IB2A 4JPWH 4ZMTA 3ARDD 1TEFA 3VSTA 1IM9A 4H13C 3AREC 3NZHH 2LU3A 3FTXA 2F2HA 3AB0C 1GW6A 4B9GA 3QAZC 1RP8A 2CK0H 4Y1SA 1JVLA 3P3YA 4A6YH 3ULVC 1HINL 1FZKA 2PR4H 4IJTA 3T3MB 3IF1A 3RGVB 1I9IL 1MWAB 1ZSDB 2P1YA 5CIPA 3DV6A 3SYCA 5EF1A 4MWFB 4JAMB 5IG7B 1HH9A 3AFLA 4M8RA 5EB9A 2N3JA 4K3JH 3BWZA 4ETQB 1QWNA 2DQEH 3N1MC 4PRPB 1WC7A 4R0LC 5AQ0A 5IT2H 3INUH 3R8QA 3VXRA 1JTTA 4PB9H 4U1KB 1CGTA 1IAKA 3SCMA 1VESA 5CSZB 4B97A 3OKOB 4JFXA 1DJSA 1FG2A 4RA0C 4YPGB 4OF8A 1E43A 2LTQC 4TV3A 3C6LA 4OF5A 1FZOA 1MRCH 4WUKL 5F0LB 3TO4A 4HIJA 3BN9C 3PL6A 4NUGH 4HKBA 3VFGL 3GLZA 3OKLA 3KNBB 4I3GA 1IGYB 4WNJA 3EOTH 4M48H 3ZW3A 1ZLUH 2FYVA 3FTSA 3NCXA 3SGKA 3NVQA 4LEXH 4FFVC 4Y9GA 5CN3A 4FYSA 3UEQA 1YN7A 2X41A 1HIML 4PY8J 8FABB 1QR1B 3EYQC 5CUSL 4D8OA 2YSSA 2PMZA 3QUMB 2GT9B 4JMNA 5EUOE 2ZXDA 3DUUB 3QNXB 3IJEA 2Y2YA 1SM3H 2ZWKA 2XWDA 4HJUA 2E47A 3Q43A 4EZKA 3TX4A 3EJYC 5DLMH 4ADJA 2C7UB 4TXVB 5DT1L 2JQMA 3I02A 4JFSA 2EEBA 4KPHH 4MZ2A 2VLJA 1UA7A 2X4OA 3VE0B 4CN1A 1U3NA 4G1MB 2JCCB 1P69B 1JWSA 2RTTA 3LSOA 1OV8A 1XGUA 2V5TA 2VUYA 3U0PA 1BG1A 3ARGA 1KIRB 2QELA 2G2RB 3PWLA 5HHOE 4B0MM 3TCLA 1P1ZB 2JJUA 4M7LT 5HYSB 4NDMB 3DDGA 2J7LA 1MELA 4C4KT 3I6GB 4X7SL 1N68A 5J06A 4E41A 3P0YL 2DMHA 3VGBA 4NKDB 4KU1A 4YX2L 3V52H 2UYLA 5IV2B 5LBVA 1MXDA 4N2NA 3DETD 4YHMH 3HG1D 1OZTG 4X7FC 4RAVB 3RGVD 4ZW5A 3DBSA 4JJOA 3EO0B 2HLEB 2XNAB 2Q8AL 1RJZA 2Q3XA 1SEBA 3QO0A 1ETZB 4L4VD 2B59B 2IANA 4JRLA 3KLLA 5C6TH 3TONA 2DM7A 3IBEA 3LZRA 5J6HA 1V3JA 3P9WB 2FL5A 2N56A 2AGJH 1PEWA 1Z1WA 4YJZL 4H8WL 4YFLI 2LU5A 3MNZA 3S96B 3KPPA 2P7TB 3FPYA 4JKPL 4JZOA 4PSPA 3VI3B 2DMBA 3FQXA 2ROYA 5DWUH 4MNQD 3LEVL 2X3AA 5H35B 1BLNB 1EJOH 1OP5K 3CFJA 3X1EA 5FUZH 2OP4H 4PP1C 2F7OA 1JZGA 2HKFH 5F7FA 3JV6A 3GSVB 4LLDA 3PWJA 4TMPA 5T3ZE 2DBLH 2Y06H 1B4JH 4LIQE 1U21A 3GMMB 1BZ8A 3Q2CA 3WMPA 1SOXA 4XXDB 2UZPA 5DJXB 7CGTA 5IROD 3NCCB 1RAMA 4OLZL 1K6QH 3ARXA 2CBTA 3WE6A 1ORQB 4TVPL 4XPGH 1J0YA 1JYVA 4Q52A 2UWEE 3WUWG 3QEQA 5HHXL 2NXZD 4XVJH 5I5MA 3LRHA 5EOTB 3PP4H 3A4FA 4EIBA 1NMAL 3O3EA 3MMEA 4PGEB 3S9DB 4P8QA 3UTTA 2C3HA 2B14A 5F1SA 3HNSL 2NY2C 2KS0A 4QRQB 1XAUA 5F72S 3U0WH 1QA9A 4F7MA 4ELKA 4NJ9H 2Y22A 3OKKB 4N8CL 4D0BA 1MFDL 3BIBX 1R4XA 2IAMA 4FYRA 1A66A 1JI1A 1PZDA 1UQSB 4X6FA 5EMYA 1R3IH 2CO1A 1AGDB 3Q5TA 4GT7A 4H26A 4NO3B 1LWHA 4F58H 3M1CA 1GGCH 4OZFB 5FO7A 2O6DA 1FIGL 3ME0B 5H8DA 4HD5A 4RFOH 1BGXH 5GGUA 1QRNB 5DGRA 1NAMB 4S1SL 4WDIB 2VXSH 3H3KA 4PW9A 2Y7NA 3BUQA 3IDNB 4KKAC 5KYUA 3EOAA 1HAWA 2YBRA 3TV3L 5IVZA 2RBLA 3H9SB 1R3LA 2NCMA 2ED6A 1GOHA 4KJQC 4EIGB 2XNAA 4BM7A 4YZFF 3X1FA 2BXZA 5GISH 5ETUA 5IV2A 4MMYA 2B20A 4UTAA 2DB8A 3ET9F 5GRZA 1PCXA 2P24B 2GCYB 2RALA 4YC2C 4E41B 3MCLH 3G6JF 5F8RC 1UH4A 5FHAL 1I4FB 4KDWA 4NDMA 1JPEA 3QJQB 1F6AA 1IC5L 4LPVA 3BGMB 3SDAD 3V5KB 4NZRL 1LDPL 5GZND 3DBXB 3BGFB 1TJHL 1A25A 4H8WC 4U3SB 3ZE2E 3IGUA 4AUUA 5BS0B 3L5HA 4G8IB 5D8JH 3VRIB 3VXUB 2OQJA 1HI6A 2JCCA 1XZ0B 1ZJAA 1KUMA 2R4RH 2ADFH 5DK2B 1MJ7L 1T2QH 5HYIA 5L4JA 3MRHB 1OGAD 4OAWB 3TH3T 4ZYKB 1U41A 4Y4FD 5AB1A 1R3HA 4PLKD 2GSMB 1E3XA 5KVFL 4WTWA 3TJPA 2C7UA 2VL5A 5FO2A 3RFZB 2ATPB 2F8OA 3MX0B 1L0YA 4OI8A 4U3XA 5E95B 1J9TA 1MHEB 2ZX9A 2WMPA 2DBJA 3HAEH 3SPIA 2YD2A 1Q0XL 3F58H 4AZUA 2QFRA 4XN9A 3EHBC 1ND0B 1A3ZA 3H9HB 4F8OA 2MOGA 2VDNH 4TRPH 4NUJB 5DJCB 4N5ED 1Z5YD 4ZSOB 5EN2B 3SOBH 4DPAX 3MBWA 1KJ2L 1E8XA 3F12B 1RZJL 2GYSA 3QBTB 1BWMA 1MJ8H 1AXTL 4LNRA 3O3AB 4KZ0A 5L6YH 3S37X 3F7VA 1GYUA 3VTAA 4EJ1C 4Y5YC 4KVNH 4TNWK 3T3ME 3VFWB 1GSKA 1HNGA 2A74C 1ORSA 1RV6X 3P69A 1MFEH 1TOXA 4XMLH 3MGAA 1N70A 1UOKA 1M42A 4GW1B 4K7PX 3QEGL 3M86A 1SN2A 4U1KA 2NTFB 3ELAT 1LO0H 1A6ZB 1JTPA 4MX7A 3TU6A 1I1YA 1IQWH 1OP3H 1UADC 3PF2A 4NAMA 3MU3A 1H3UA 3SDDD 4XTRD 5IKCB 1DVFA 5FYKU 1S9VB 5D5MA 3QYNA 4QHNA 1Q9WA 4RWHA 1J05B 3NQKA 4UB0H 2F54A 5AVRB 5IOPA 3P4LA 3OC8A 1HH9B 4DO6A 3LZFL 4UYQA 2ZJSL 2HT2D 1KB5A 2NPLX 4JY6A 1MWAA 1ZSDA 4B9KC 4EPSA 2ZKYA 1FZKB 4N2MA 1WTLA 2XA8H 4W6YB 4Z7QE 3N1GC 1B0RB 4L1TA 1BD2B 3HR5A 3MUZ1 2X1QA 3B9KA 1AG0A 2ZXEB 3JYCA 2WXJA 5KW9H 2W9EL 1X44A 2FH8A 3RY5A 2XFXB 5IB2B 5DO2C 2X87A 4I1NB 1CICC 3NDYE 4F15B 2HRGA 1C08A 1TQUA 4KUZH 1JGEB 3SYAA 2MMXA 3NP4A 4J4PC 3VFRB 3O0RL 5ITBL 3AU0A 3MBEA 4ZQKB 3TZVB 1KPVB 1ZHNA 3L3OA 2VB5A 3HG5A 3J27A 1MG3C 4JQIH 1FLTX 1DVSA 3UC2A 3SE3C 1I7UA 2K6ZA 2XY2A 3FH5A 4HXBL 4I13B 4QHMB 1CCZA 3ECBA 4XNYH 3S35L 3ZL4L 2W38A 1CDUA 2MQGA 5FECB 1TLMA 2H9GB 4P3CH 1QOKA 3ETTA 4DCQA 3WS6C 1QI4A 1NAKL 2F15A 2WXIA 4P4KC 3OPZL 3N1PC 3UTOA 1OCWL 2Y7OA 4C83A 1GHFH 2AXHA 4M7JL 4PEEA 4YGVB 5B21A 2IGFH 3QNYB 3MJWA 3EH1A 4PVNA 3O2DL 4QTHB 3W56A 1OAKL 3CMOL 4P46A 5D4QA 3JWDC 3VXSB 3L9EA 3W5NA 1IC4H 4FJ6A 4XBGA 1CZ8L 4W4OC 4I88A 1X4YA 2WWMC 5EC2B 4ZUSA 5HHOD 5TDNA 5K9KB 3HZKA 1XCWA 1U3HB 3AC0A 1IILE 1T03H 4U1SA 4N86A 3DX6B 4OQ1A 5IQ7L 4X6DB 2ADGA 1PL3A 2PW1A 3VX1A 4ES8A 4JN1L 3PV6B 3SE8H 1QPXA 5SWSA 1K3ZA 1EJOL 4XPHH 2WQVA 2QHRL 5F7EH 5ACZB 4ZK8A 1Q9LB 1ZS2A 5I16B 3D0LA 2E9GA 1DQMH 1U92B 3LS4H 3SB3A 5LAPA 3VQMA 2NY6B 4IGBB 4LLVB 3ESNA 4ICXA 4ORGB 1K8IB 1PJ9A 5FFOA 1BOGB 4E9YA 1FVDB 4FXKA 2V5YA 4KI5C 4PRBB 3FONB 3P9LA 4OM0L 5TJWK 2HP4A 1E9QA 2PYED 3LY6A 2YFOA 1K9TA 1NINA 2CZNA 1A02N 3OAZK 4OZFH 4YHIB 4S0HA 3K8KA 2V5SA 4YUEL 4OGAD 5CJOL 5C0FA 3IGAA 4NHCH 3SDDA 3KBFA 1CFVL 4E41E 4WJKB 5JPMB 3ARDA 3HN3A 1MREL 2VC2H 4YHKH 3LD8C 1NCWH 2FIKB 2AXGB 3KWTA 3RA7L 1PLAA 3TP4A 4N8CH 3KPRD 3K80A 3RWJB 1QLEL 1QZ1A 3SODB 4LBEA 1FVDA 4FXKB 4XRCA 4ANWA 5F21B 5JQ6L 4TL4A 4X0NA 3FHQA 5D2NA 5DHVB 4LEBA 1JV2A 5E8NA 3CXFA 4KDVA 4H25B 2QPFA 4LRIA 2J1WA 5LGJA 1BREA 2JJTA 1USZA 4G5ZL 5TDPB 5HDRA 5FYKH 3WKML 2F7RA 1OOWA 5EIIB 2Y7MA 4O2FA 1C9SA 2EDKA 4OBSA 4G6MH 3O3UN 3GXTA 5DR5L 4XPTL 1CURA 3ULVH 1P5UB 1XAKA 4U2YA 5G5DB 2EIZB 4G8GA 4ZFFA 4JVPA 4K94L 4KXDA 3C87A 4UQEA 1FAKT 3DUSB 3QUMH 4X2UA 2X05A 3UAEA 4EZMA 4Z7WF 2AKRB 2QADD 3GKWH 1ED3A 1JYXA 2NNAA 3KR3H 2D0GA 5DD3L 5KTEL 3EFDH 3D6GA 3R1GL 1XV8A 2WYHA 4YSDA 5F9JA 1IZKA 4O5LH 3OMNB 4XP1L 1JN6A 3EBGA 2W92A 3MLVH 2X9YA 3QR1A 5DUML 3QCTL 2ISDA 2R15A 3R06B 5E2TH 4E2OA 3O8XD 4DVBA 1D3CA 5T1KB 1NC4A 1T20A 1NIDA 4NQVB 3GHBL 4QIRA 3RZCA 1WT5A 5IF0B 1B0IA 4NP4L 3JT0A 2CR0A 2XVKA 4UM8B 3FU0A 1HZHL 4FZEL 4I9WE 2OI9C 1ITCA 3I6LD 1KPVA 1ZHNB 3L3OB 1FWXA 4DJMA 2B8OT 1I1AD 1KTLB 2Y1AA 4OT1L 3IWUA 4XO4A 4ZBJA 3JWOH 4G7VH 3BAXA 3KJ6H 3NESA 1ZRUA 4IBYA 1PLBA 4M62H 3ZT7A 3MXWL 4ZS6D 3KPMB 1HN1A 5DD1H 4E0RA 3GSWB 4HIXL 4Y4HD 5F7NC 3WELA 5L0QB 2GSGA 1XF2B 2APVA 1XGPA 2YN3A 4MJ6B 2IG2L 3G5VA 5IJVB 1W0WA 3GXDA 3JXAA 2OKMA 5HJ3B 3D2TA 3ZDXB 3S3BB 3AUWB 4JRXE 3PJNA 4MDJB 5I1LB 1MCHA 2ICWB 2ZSVA 3PNWA 5FUOH 3UTQA 2CG9X 2Q2LA 5ADOL 3N44B 8PAZA 3PE9A 4DEUA 4Q0XH 2V3DA 3RVUD 1MW3A 2O26U 4J3BA 4NKMB 2ZQKA 1AR1B 3L4YA 4HGWB 2CUMA 5BVPH 1IKNC 4JEGB 4J8QA 1P5VA 2ITFA 4KKLC 4FXKC 2COVD 4M5YH 2FE0A 3JZ7A 2K6YA 4HF5L 5CR8A 4KAQL 1W16A 2V9RA 3E3QE 5T5FL 5EDSA 4O9HL 5IROA 1MLCB 2BSCA 5IESH 1JE6A 1EUUA 5JW5B 5AB2A 3C5XA 4MCMA 2WCGA 2GBAA 4NRXB 5GS1B 5GZOD 4LNRB 2V17L 2EECA 3P02A 4M1DL 3T5WA 4HUNB 2QQNH 1BECA 3K5SA 3WS3B 3X3GL 3E7JA 3LRKA 2E74C 3MNDA 1EO8L 4CMHC 4ENZA 5IVXB 3BH9A 3WJMB 3N0PB 4KRPC 1JHLL 3KBEA 2OR7A 3Q6GL 2AJZB 1A4JA 4Y5XB 2H6OA 2VDOL 3P4OA 1QFWM 1ADQH 4FS0A 1XTMA 4WW2F 5F7LB 1AGCB 3U1QA 2Z8VC 5HDQH 2VRAA 1DO6A 1JRHL 2CJTA 4OI9A 4K5LA 3ZN6A 1VF5C 1KTRL 2F5BL 4ODTH 4OZFG 4UTBL 4MKMA 2PKDA 3JWNH 1BZ9A 1AHWA 2DYSB 4PGJA 4PJAA 2W5PA 3RP1A 5FO8B 5SWZB 2WXNA 3MA7A 2DKSA 4OAWA 5GQBA 3TF7C 5L4IA 1TEGA 4CILA 1FVCA 1LO5A 2Q5BA 5JUEL 1T89C 2OQJB 4JCMA 5LCVA 2ZUSA 5IY5B 15C8H 3DV4A 5F9WB 1GZHA 1Q9KA 3MFFB 3EH3B 2EIEA 3WFCL 2K3HA 4HSAC 2VMJA 4OUUA 3FAWA 4TUOA 3EG9B 4EOWH 5LWYL 3AJ7A 3FQ2A 3AG2B 1IVLA 1M4KA 2JJTC 4RISL 2IADA 1E67A 4MAUH 1MFCL 5G4NA 2RAMA 1M2OA 2OTPA 2ZPKH 4XN2A 1MWAH 2WQUA 1T89A 5DO8A 5ABAA 3HC2A 1JERA 2NXZB 4YQXH 3MRQA 3P30H 2D0HA 2I69A 5KG9B 4Z7AA 4YFDB 4F1SA 3QS3A 4NI6A 1OE1A 3FTVA 1RUQL 4PJXF 5KG9A 1T0NA 2OXHA 1N64L 3H4FA 1HK6A 1GC1C 4MDRA 2HB0A 1GGYA 3LXCA 3G7TA 5F6IC 1G9MH 2ZCLH 1IAII 1OGAB 1YEIL 5GGUB 4ACTA 1U30A 3G04B 4AITA 4PJDB 1NKGA 5FA3A 5J12C 1NFKA 1N19A 4PJBB 1U91A 2WUCL 3L13A 4TUOB 4NO2B 5E00A 5JPMC 5EEVA 1JBJA 5H2BA 4NX0A 1Q9KB 3MFFA 4RDQF 2IANE 5FB8A 2WUBL 4WNQA 7FABL 5FPIA 3QUXA 4NQCB 1QVOA 1IEHA 3ENEA 3LQMA 1YPZF 3QQ4A 4RMWA 3QORA 5E9DE 1HCZA 4BINA 4ERSH 1AQMA 4LCWE 4NFDA 2XXGA 2MH4A 5DJ6B 5EUKA 3V4VH 4WUUE 2VSMB 2YUWA 4H5SB 4H8HA 5ENWB 5T8IA 4JFOA 4F7CA 4HEMA 3QS2A 4EDWH 4GAYB 1WDAA 35C8H 2PO6C 3QT2A 3NA4A 1AGCA 1SEQH 1EGJA 1E0OB 2ZXBA 4S0TD 4Y7OC 1IKNA 3OXSA 2DOCA 4LL1A 5SWZE 2NY3B 3P4OB 5CINL 5AW3B 2A4CA 5B3NA 5I2IB 1C16B 5KJRL 2YRBA 2KT6A 1TF4A 1NOLA 1R3JA 2KPWA 2P3YA 1FLRL 4FG6C 1DSYA 3FUKA 2VM9A 3T77A 4PREA 3N0AA 3K8LA 4XCNB 2DIEA 5HYJE 3VSQA 5GS1A 2FNBA 1Z5LB 5EULV 3AVEA 4PJIF 4NZFA 2YPLA 1UCBL 3G9AB 1RIUH 3MJ7A 5CN1A 2IO5A 4XVUC 2IV8A 4IW4C 3FQXB 1O6SA 1A4KB 3ABLB 4APQA 4B9CA 2WTOA 1UXWA 2JIXD 2JKJA 4HWUA 2H26B 4KQ3L 5EBWA 4HJSA 3TN0A 3KL0A 4BQCA 4AEHH 1NEPA 5LNGA 2Z64C 3O6FD 1PD0A 4HPOL 4ZUUA 1VDGA 5CAYB 2I60L 3NIFF 5B1JA 4QJ3B 5ISZA 4HH9A 3N6YA 5KVEL 2X4RA 4FHKA 3IDJA 2B39A 4TVPE 4DO4A 1PIFA 5IR1A 3L1EA 4HCRL 3UH8A 1DBJH 4F2MA 3I6GA 1Q38A 1GH7A 2QV2A 3G08B 5CD5C 5CCKL 4A7GA 1V7MH 3QDME 2NDGA 3V0GA 1T22A 5IJVA 3FBQA 2ICEB 5I6XC 4W9GC 1CIUA 4G59C 4TTDD 1XGPB 5GJSL 5KWYC 1XGUB 5EU7E 3NCWA 4P9HL 4YDZA 2YA0A 3T0EC 2FBRA 5K39A 3S5LA 4G1MA 2DI7A 2FX9H 4KX7A 1YEKL 4GMSH 4NPYB 4WFGD 5FW7A 1JUFB 1IAIM 5HP5A 4MSWB 5T3ZL 3UCQA 4FQXA 3PL6D 4JFYA 4PLOB 1QFOA 4MNHB 5TF1L 1CF1A 1KC5H 3V4PB 1UWFA 4QRSA 5T33H 2XWCA 3DX9B 1A6VL 1MUJB 3NCYP 3ZDXF 2H4EA 3QH3B 3RWIA 1QEXA 4Z3FA 4I9WD 2ZXGA 4NQVA 5DVMA 3V0WL 1L6ZA 3E6HB 4DK6A 4IKLA 4XB3A 1IBFA 1LLAA 5CGTA 4XVTH 5IVXE 5T1LD 5T3XD 2IDSA 4MQTB 1GGIL 3BO8A 1YEHH 4M4RA 5LXVA 3QNZA 3TGXA 4EKJA 2DIAA 1ANUA 3KYKH 4ZAKA 1AC0A 4PJHB 3FQUB 3GBNH 5TPWH 4OB5L 2VDLB 1YC8A 4FQ1H 5ESQA 5ICYA 3Q8BA 3TO4B 4KKNA 4X80H 3G5WA 4OLUH 1BGXL 5HJDA 3BQUD 3DVGB 3LS5H 2QLVB 5LO7A 2ZWYA 3LN5B 5I8KH 1CO1A 1WG3A 1AXSA 4TUJB 2JIXA 2DQDH 2GIXA 1QNIA 2CGZA 3WFZA 2J88H 1FCGA 2V2XA 3KWUA 3QRLA 3U2JA 2JQAA 1N4XL 5KVGE 3TO2A 1RMFL 4F8TA 5E8DL 3FUJA 5EIIA 2QZ5A 1IAMA 3V7AE 4JAMA 4X9BA 4ANVA 3SO3B 4HUKB 2YPVL 1OAZL 4G6FB 1QKZH 2H0PA 3EAKA 1RZ7L 2OK0H 4MA7L 1N0LA 2F1EA 4MMXB 3NZHL 4XB7A 1DTUA 1T04B 2X2JA 3BUTA 5JR1H 2EVHA 4LPYA 3RWJA 3QO1B 1JRHH 5DK3A 4I9XA 2W95A 1CG9B 3T4YA 4XO3A 2DQTL 3QORD 3CDGB 3Q01A 1E9PB 4YXLH 1C12B 2E6PA 1D2OA 1U6AL 5CCGE 5FCUL 1QFHA 1E8ZA 3P73B 1YEEH 2F7PA 4HCGA 3FUHA 4PIRF 4PRPE 5HGBA 3LMJL 3EDDA 1E9QB 2A9DA 4X7DC 2H47C 1A7RL 1OXYA 4HAGA 4JKLA 4RBPK 4Z3HA 3W37A 2JVUA 1MWOA 3FONA 4YAQA 5D7HA 3PQYD 1OAUH 4O00A 1ZDSA 5AW1B 5AEAA 3U82B 1K8IA 1M6UA 2FJHB 4X4XB 5GGVY 2OX5B 4WFEE 5IQMA 4TQEH 4BH8A 1NGWB 1LP9F 2KLSA 4JHAL 5LKNA 1WS8A 2ADYA 1IBHA 3GTVA 1P4UA 5D1ZC 2LOEA 3S35X 1ZY9A 3GNMH 43C9B 1VKXB 1EXUB 3W9DA 4LCIL 4DUVA 1NGXA 4XBEH 4TSAH 1YEDB 3P30L 1L9SA 4NSKB 5D7KD 2ZXCA 1WWCA 1ZVYA 2B1AL 2WO4A 1B3JA 2Y6TE 3MFGB 4FCHA 3NFSL 4WI7A 2NZ1A 4UU9B 1FZJB 2WNKA 3FUEA 1JMZA 5T1MA 1I8LC 1C8QA 4YXKL 1MJJB 2DS4A 5HJGA 1U58B 1TJGH 3CXDH 3TO4C 4EUPB 3DXAB 3NP3A 1YUKB 2KPNA 3DSNA 4P5KA 1VCAA 5K9QI 4UU9A 1WZ1H 3Q8AA 4OLWL 1SXCA 2ZSWB 1WBZA 2P8LA 1BFVL 2X42A 3P0YH 4EIZC 3CTTA 3MLXH 3QIWB 2RCSL 4NQDD 5DVOA 1FL3B 1SDAB 1SVZA 1W72H 3TASA 3ZLQC 3MRNA 5HHPB 1F00I 1YZZA 2HTLD 1I85C 3HE7A 4MKTA 2MCPH 2IPTH 4HK0A 1U8NA 1G7QB 1J1XL 5D5MF 3UTTD 4HBCL 4QHMA 5DUPL 4NJAH 4PMFA 2LFGA 4A38A 1KCVH 3RAJL 4WZ9A 1UFUA 4UBDD 2CKBB 2HRLA 3TIDA 2W60A 2X4SB 1JK8A 5ADPH 4J3XA 1RK7A 4M5ZL 4QHLA 1D5BB 3OV6A 4J28A 2HX7A 3E1ZA 3SQBA 3D09A 2GIMA 1R17A 5I6XB 3DRQA 5GZOA 5ANMA 3GSXA 3QR2A 3BE1H 3S8GB 3RX9A 2AK4E 3STLA 1HILB 2AGJL 4JRXD 1MCPL 4QTIH 1QD0A 4Y5YA 4ZW8A 4KK9D 1O9WA 3GPEA 4BZ2A 3MA9H 4PRNA 3B7UX 3QZNA 4QXWA 5FYLD 1TKWA 4FL4C 1KN2H 4GRLA 5A7BA 5J4MA 5KN5A 5LGHL 1MCWW 3AU1B 4AI7A 3RBSA 4F8QA 4BJLA 1G7HB 4ODXB 5CEYB 1FZMB 1BX2B 3G5ZB 4CKQA 1ZHKA 2R0ZH 4HJGB 2WYZA 3BZFA 3CXHJ 3OX8B 3SGDH 4E42A 4N9GA 5IHWA 2ICWJ 2RJMA 1SZNA 2OMWB 3BKML 3QZOA 4PCKA 3ZHKA 1ZS8B 4GNKB 2E8YA 3ZOAA 4PRHE 1QI5A 4JO4L 4MJHA 3GI8L 3B2VL 3IMRA 4XX5A 4MJID 1WBYB 1Q0EA 4MCYA 2P43B 4Z0BL 4Z95H 2EDMA 3F7VB 3IJ7A 3ROLA 3ATEA 4PRIB 5EIVA 1SY6A 5AB9A 1GC1H 4HHAA 2P44B 2VJ8A 2XVLA 4PU2A 3FRUA 1LILA 1MY7A 3DTUB 1H6EA 4FZ8L 2NW3B 5LAXB 5JNYB 1OPGL 2R4SL 2NUTB 1DDHB 1QW8A 1XGRB 1ND0A 3FU3A 3VG0H 4S1DD 3GSUB 1VSCA 2BP5M 4HWZA 4ZT1A 1R5WB 5F0JB 3UBXG 4OZ4A 4WGKA 3DX9A 1EFXA 1WUNT 2X4PA 3GKZA 3JV5A 3ZRFC 4CW1B 3VFNB 2YD7A 4MD5B 3BUYA 3BRGC 1A1NB 3HHSB 3D39E 3LH2L 5D8JL 1ROCA 3RFZA 2A1WL 2VL5B 1AJ7L 5KSBA 4H8VA 1T5XA 4NQEA 3WKQA 2QPUA 3DX1A 4G83A 1UZGA 3W3BA 3V8OA 4A2HA 4LGPB 3WTSA 5CCHE 1NBYA 4BD4A 2IDCA 1CLOL 1G1YA 2BVQB 3BWSA 2E86A 3VRIA 3WEAA 5IW6A 1MF2H 5DQJB 3MUUA 4H88H 4NN7C 2YAMA 1F6AB 3D12B 3TO4D 1LQSR 1FNLA 3EJPA 2OCCB 5H94B 2YO3A 3ZYOA 3FTGB 4Z5RA 1C5DB 1ZDQA 1NIFA 4ALAL 2DKMA 4UDTA 1XWVA 4HH9B 4F5CE 5BMFL 3E9TA 3UTZB 1SPDA 2H1LM 2PF6A 4KKZA 3H9SA 1ROWA 4ATWA 5FX3A 4BV1A 4FRWA 3A21A 1JOIA 3KYOA 1C1EH 3L45A 3VI4E 2FWOA 3O9WB 2QMJA 2XFGB 1QRNA 4UTAH 3WXWH 1CGXA 2GFBA 2ATKB 3HC3L 1OARL 2L4OA 3QIUD 1E6OL 3EBAA 2XUWA 1QSFD 5L2JA 3B6SA 2ICWI 2DEWX 1L9RA 3BD5A 1H3XA 5AOMA 5BV7C 2F54E 4L2YA 4XCNA 2TSAA 5CEZD 3OSVA 3DIVA 2XQBL 5FYLH 5JHDB 1MFMA 1KPRB 1OSPL 2DD8H 2IFFL 4DOHE 4KROB 3VSVA 1IM9D 4UB0L 5I30H 3F7QA 4OLYL 5BVJA 2WAQA 3WD5L 1HSAA 3IKKA 3N3EA 4AYFB 1AXTH 4I0PA 4FZEH 3QC5X 1IKFH 2MHAB 4HUUA 1H6FA 2XZCL 2XJLA 1U8HA 4FL4B 1ZXQA 2BSDA 4Q56A 4XOEA 2ZOKA 5CILL 4KO6A 3WE6B 2LR4A 5D7IA 4AYFA 4YSEA 3HI5L 4GAAA 2A77L 3LKSB 1XCQA 1UT9A 3B5TA 3HCVA 4F33A 2VXQH 4PP2A 5E7BA 1N6QL 5LXGH 1EEQA 2NY5H 5JO5B 2D7TH 1ACYL 2HT3C 5CP7B 2FUQA 5T1DH 2BWQA 3RUGF 2AQSA 4M4PA 2ODHA 3PDOA 5GPRA 2XT1B 1OHZA 2YPVA 3M8OH 5L2KB 4AE1A 4URTB 4GOSA 5EOQL 3AQXA 1FN4B 4XP6L 1KLGA 3HZMB 4QY8B 3F62A 4PB0H 3SBRA 1BQHG 3NRPA 1JNNL 4YDLC 1J87A 2X6VA 5HHOA 4K3DL 5K9OA 4FG2A 3BQUC 3P77B 3PWUA 4KKBC 3CAFA 3MRFB 5F70A 5E2WH 5TDOA 4AKPA 1RJZB 3ZR5A 5CBAB 2YA1A 2NNFA 1B4TA 5DS8B 2VR8A 5E2UH 3OJDB 3OR6A 3RKPA 5E4OA 1HWGB 4F9LA 4E5XG 3KM2A 4AOFA 2MSPA 4TNVK 5EF3A 1QTPA 3QAQA 3VA6A 3L3JA 2GC7C 2P5WE 3QEHB 3EFOA 4NNXA 4A7VA 3FCBA 2ITDA 3BD3A 4OD2B 4OUUB 2E7CA 1UACH 1CD0A 3ARGB 1JPSH 3T9WA 4XNZC 4JM2B 4DAGL 1NAKH 1MHHB 3IRCA 1FFRA 3UTTE 4IU2A 4PB9L 1KLFA 3RKDD 3OTTA 2MQCA 3VWJB 1P4IH 1VEMA 1IGIH 4KOCA 3SPHA 3ZK0A 4UIKL 1NGQH 4JHWH 5FIEA 4F8NA 5IMLA 3VFNA 3EXJA 1S7TB 1GSMA 3FT4A 5EPMA 3FHEA 1H15B 3DUUA 3ULUH 3MUHL 1YDPB 4R26H 3QJOA 3O2WL 2D7OA 3I3DA 2LQRA 2YSSB 1F4YL 1FNGA 2ED8A 4E36A 3WXVL 2X7LA 2WINB 1FFQA 2OPCA 5CF3A 1YN6B 3L08A 5E0FA 5AVVB 3U46A 2LLNA 3HI1A 5CEZH 2Y1YA 3WJJC 4OZIF 1FFTB 1KCUL 2O72A 2V8MA 2VZVA 3CK0L 4KGLA 2NNXA 1F5WA 5IIEB 2PXYD 3SZKC 5ALBH 5SX5H 3AWFA 2WQWA 1U8LB 1XH0A 4AQ1C 2EXWD 5AW7B 3O6KL 2X4QB 4XI5D 3BPCA 2J1ZA 2OMVA 3WJJA 1TZGH 3VQ1C 4IK6A 4B41A 3EJTA 2EIDA 2J2ZB 3EKCA 2QDVA 4QRFA 2VH5H 3UC0L 2PXYC 4HJGA 2ZD0A 4QI3A 1S9WB 3G9VA 1YY8A 2D03L 3ECUA 4XT1C 2AQ3A 1KCRH 3WJLC 5EU7C 2AJSH 5EU5A 4LSRL 3AU1A 1D5ZA 3F05A 1SDYA 3IFPA 4DKFL 1MCFA 1D6EA 4G6ML 3DV6B 3KPRB 1T3FB 4V1DE 2QGDA 5BPPA 4Y5VB 3IFLL 3D3VD 2AV7A 1G43A 4QXTA 1HQRA 3MNVA 4Y5YB 2WLIA 4BGDA 4BFGA 2K8QA 1ZJBA 1N5AB 3WO4C 2X2HA 1Y6NR 1E4XI 4OKDA 4R84A 5ECJE 3WUZA 3GHEL 4NHUA 4U1LB 5DJ8B 3S4SA 3QXWA 4N90D 2WWOA 1L9MA 3DK2A 4R4FL 3VGEA 2DQFA 3FC8A 5DLML 3OXRB 4R7NA 3D9AL 4MNGA 2GABA 5ERWB 5HHME 5DD0H 3VGGA 4JPIA 2VISA 4ZO7A 1FYTE 2O5XL 4J3OD 1E7VA 3EGDB 5EOCJ 3TA3D 4AV5A 4UM8A 2VAJA 4U1GC 2AJUL 1UXSB 5F7YC 4MBOA 2FK9A 1T7YA 1G7QA 1A14H 4XC3L 1I3GH 4TOYL 1W15A 3K72A 1TTRA 3ILQD 4AQEA 3S98A 3SDYL 5JOPD 3U7WH 3BZ5A 5E9NA 3UFIA 5KVEE 1JGDB 1ASQA 1D5MA 4G7SB 1C7SA 2BIQA 2WO3B 1SY6L 2OJEA 3OJ2C 5FDWB 4HV8A 3TV3H 1U8PA 2OYLA 5KYNA 2PP8A 5CHNB 3F04A 5C08A 4DTGH 3VI3F 4IOFC 1WJ3A 1ESOA 1JZDC 1GIGH 1RFDH 2WO2B 4TTDC 4YBLC 1N5YH 2WZ6A 3J7HA 3OAZH 4HG4K 2AMUA 2EE9A 1UUSA 4RETB 1AHKA 5D2NE 4PV8B 4XNBA 3SDXF 4EAEA 4ZFOA 1U9KA 3A4AA 3FTUA 4ODUB 3AROA 5FHAH 5CM1A 2OLDA 3MV7D 3L6FA 3O0LA 4HUXB 3PAUA 5CJBA 3SGJC 1PG7H 1PDKB 4YO0A 3ULVF 1J5OL 1MFDH 4N24A 4XMTA 2APTA 3CX5K 1FRGH 4OFVA 1N26A 1YEDA 5FF6A 1HHIA 3PY9A 5BRZE 2ESVA 2WWKO 4A2LA 4OGXH 4LRNL 4QRUB 4PJ7F 5IW1B 3RX5A 3BKCH 4JHZA 1JPST 1NBVH 2MKWA 4AL8C 1HXMB 1NKOA 1PW3A 2VXSL 4MQSB 2OX5A 2Y3NA 2I9LB 1PZ3A 1KXVA 2QEJA 4X7TA 1KJ2B 2CJ3A 5B38G 4PJXE 4PYHA 1T6VN 2FECI 3T6WA 3OMZA 3RNQA 1S9XB 3L7EA 4PIBA 1EJ6A 3FQTA 1GGBH 3LH8A 3NQIA 1I9RH 2V7NB 4MGXA 4NT6A 3FQNB 3THML 3BW9A 4OR1A 1U8KB 4AC2A 5KSVA 1FYTB 3EOBB 4EI5A 1IBGH 1DLFL 4HFUH 4AVJA 3BUDA 1IGMH 5T1DL 1KJ2A 3NUKA 2MNJB 3FTWA 4W70A 3ZHDA 4BA0A 2CO6A 1WYJA 3HI6L 4Q7DA 3SDXB 4UT7L 5I6KA 2VO8A 4MMXA 2XTJD 3GMLB 1WAAE 3ORJA 5GRVL 3WN5B 1UB5A 2UZYA 3IXAA 2EYRB 2YPKA 4G2AA 4J6RH 4EZLA 3GXUB 2DL2A 1AGEA 4GB9A 1G7LB 2WB7A 4NQDB 5EO9B 5HGGS 4C56D 2K0RA 3D0LB 1MCSA 2Q3ZA 1KLUA 1YCSA 2VXVL 1ICTA 3IAGC 1T66D 3QEGH 5CFHA 4MA8L 4QD2E 4ZTPL 5C3LD 4I77H 4B9JA 1ZPLA 4WV1A 4L5FL 4QHPA 3EJRA 1ZT7A 3WJLA 3QG6B 4EKXA 3FO0L 3WFHB 2KHAA 2OSLB 2JKIS 3DLQR 2H2SD 1QPKA 1RZGB 4LVOC 3FKUS 1ADQL 3DA0A 4GSQA 4B96A 3V6OE 1AFVL 1GY1A 3D85B 2CRMA 2JLLA 3IFOA 4BK4A 4M29A 2NYZA 4JRYE 3L9YA 4XBGB 1BLIA 1MCIA 5C08B 3KZ8A 4X5WA 3ZZ1A 1ES0A 3N9GH 1WWBX 1FI8C 1TQBB 4BKLB 4ZAKB 2FZ3B 5AYQA 3GJFB 4MNQE 2XG5A 3HE7D 2MCMA 1QEWB 1D5MB 3BIAX 4JG0L 4OZHE 2P28B 3K72B 43CAA 4GPVA 3LRSA 1NCOA 1EAQA 4U7MA 1TNMA 1P4IL 4K55A 5ITBH 2ZCHL 2EADA 3UO8B 3WYRA 2ZCLL 5A2IH 3VH8A 3KH3A 3MN8A 4OQTA 3LZQA 4X6BA 1TTFA 4YDKL 4GXVL 4NC2B 5C0BA 3MV8B 4OCXL 5BZWA 1TZIB 4AEIH 4KWUA 2ROXA 5EU4B 3D34A 1T1YA 3ZUCA 1EBAA 3M1BB 4Y2OA 4U33A 4ZQKA 3VD0A 1WFTA 4P57A 3ABZA 5EUOA 4UNVA 3S5YA 1JGEA 5D93B 1IAOA 2A2QT 3DHJA 1I85A 1SMOA 3HE7C 2ICES 1CXHA 2XFXA 4QMEA 3S4SG 3NJFA 3S6CA 2IVFC 3S5LB 5C9KA 5I76B 4LIQH 1W72A 4KZDL 1RUQH 3GGWB 4LHUA 4E9VA 1KIUA 3RFRA 4KMQA 4HLEA 1CDJA 2Y07L 3FB8A 4Z78A 1KWKA 1HQRB 2WLLB 3QWRA 1IARB 4LAJH 4MJ2A 4ZSOA 4F8PA 5BCAA 4FKKA 1KYFA 3D33A 3LV3A 1QUNB 1J11A 1FORH 2BWIA 2IBZX 2VR6A 4BWUA 2YGVA 4GEIA 4X4ZA 1FL5B 2X4RB 5ALCH 2WBKA 1OM3L 1Z3RA 1I7TA 3DVNA 5B4MD 3VTTA 5KANI 1MIEL 2VLKE 2I5YH 1RD6A 4OQTL 1XBRA 4YBQC 4ELMA 4HLZG 2NTFA 5DD5H 1LWRA 4G8GD 4LCWB 3ZPDA 4IS6A 4HIPA 2JB5L 2SEBB 4HZLB 4JKPH 4HQQL 4TUKL 3VSUA 5IHZA 4APQB 5EEXA 3MLXL 3ETSA 4EBQH 1O9ZA 4KUZL 4BK8A 4KXBA 2NY2B 4I2XA 3FB5A 2CJUL 2BOCA 5HPOA 3MTRA 3GMQB 3ZMRA 2EUWA 3S3JA 2DQUH 2KLTA 2R9HC 3O6MH 1J88A 3ZKND 2VLRD 3AT8A 2NUPB 3IAQA 1UD5A 5EA0H 3T3PF 1AIFA 3NJLA 1WIOA 3R7QA 3IJSB 2A6KB 1S5IL 2ARJA 2PYFB 1Z9MA 1LK3H 2RB8A 3WSQH 2CH8A 3OXSB 4D9QE 2HLAB 3DX8A 4P2AA 1YMMA 1LEIA 2DJ4A 3QJFB 3ARSA 4PJIA 1MHEA 5C0RL 4LKCA 5DI8B 5DJ6A 3ULSA 4JRFA 4YVNA 4OD1H 3MX0A 4CJ1A 3AG4B 4P2QE 1E4HA 3VW3L 5IB4A 4JJ5A 2WLMA 5DGQA 1P1VA 3KYNB 3UPAA 4RX4A 3RX7A 5B3JE 1E65A 5A16A 3SYOA 3BI9X 5GSVA 2KZ1B 1SY6H 1ZKAA 3EGSB 3FO9B 1T5WB 4LKXB 3RTQC 1F18A 5GRUH 5BS0A 3NSDA 5MHSD 1T1XA 5E00B 3WU1A 2KQNA 2VDKB 4HEME 1KGJA 5MERB 3G04A 4UZSA 1UKTA 2YOCA 2B16A 2JCCF 4QHUA 1XEUA 1KN2L 1OGAA 1KCSL 3AZUA 5LGHH 3T0VA 5C0EB 5E08L 5IUSA 3DKHA 4XP5H 1GAFL 5D72H 2ZX8A 4YVUA 1SXSA 2NT1A 3GUTA 5FOJA 4KROD 4ZOBA 1INQA 2BOBA 3BP5A 3C12A 3BAIA 4JHUA 4K3EH 4HOWA 4HPYL 1CBVL 4LHUD 3ARBD 3E8UH 4QUOA 5D2LE 1F02I 2QVTA 3QRFM 3U6XA 4N0UE 4KI5E 1RZFH 3D3VE 3BPOB 3GUTB 2AEQH 2ZICA 4PGBA 4WW2C 5IBLC 5C0EA 4DO5A 2QADC 3CFKA 4N8PA 1A9EA 4GO8A 4XGZB 3HRZB 3HZMA 4Y2NA 2H1PH 4XNZB 5KANG 2WBXA 3RVVC 1PBYA 5IQ9B 1NEUA 1JF1A 5DUJA 4H8UA 2QSQA 3ZTDC 1CR9H 1F8TL 3WFBH 1AAJA 1OT2A 1L3WA 1THCA 1M71A 4UMSA 4Y19D 3J2PA 4AQOA 2R4SH 4L05A 1A1OA 5IB1B 2V3EA 4NBYB 2FYYB 1X7TA 3GKWL 3BDXA 4JJHA 2ZOKB 1EHAA 3KJ6L 4O4YL 3ULSB 3AM8A 2HWZL 4NN6C 4L9LA 3B8SA 4LU5L 1Z9NA 5C08E 3QJFA 4PJIB 3NJXA 3H54A 4GW5B 2BOLA 2XBZA 3A0OA 2C9VA 3RJDA 3NAAH 4XWGH 4JLRA 3K5RA 1OB1A 1P4LA 1L9PA 3OL2A 3MRLA 1EO5A 3NT0A 3WGVB 2CWRA 4BH7A 3O11A 1QBML 2ORBH 5JDSA 3UYPA 1JRHI 5DZLA 1NEZA 3MLZH 4PJAE 2ZTBA 3NK4A 1W6WA 2F8VA 1EAOA 2UY7B 1HCYA 2ESVE 5FR3A 3KAAA 1P9MA 5I0VA 4F37K 1OKEA 1P84K 1OWWA 2GJZB 3NRQA 1IGJA 1X5AA 4YGAB 4HLJA 4CVWA 1M2VA 5CKGA 4QTFA 2HKHL 4UV7H 4FNUA 3MLUL 4KAQH 5C0GA 5EORL 4ELMB 2IANB 3DVFA 1BYOA 5DUMH 4LLQA 3T2NL 3UTZA 4AUJA 3ZUNC 3MLVL 2YXFA 4L3EE 1R19A 1YNLL 1KGIA 3BJLA 5E8OB 3UTQB 3RWFB 5I6MA 5CBEA 2DQEL 4FTVA 4TNGA 1TEYA 4PJGE 1X5YA 5HYSA 5HTSA 1SYSB 3HZYA 4YOKA 2ZYRA 3BJ91 3D85D 3TCLB 4F9LC 2Q7YB 1OT1A 1S9YB 5IBTH 2Y4SA 1XSJA 3CVHH 2PLTA 3V2AR 2EE2A 4H0HB 3EO9L 5BQ7B 1I3RB 5KW9L 1DQQB 3MUY1 3RILA 1YYMH 3MGOA 4MS6A 3MXWH 3KDPB 4FMKA 4Y2DB 3QDGD 2FCBA 3RKDC 4B50A 1K6QL 3L3HB 4BCZA 1E5CA 2WYIA 5JXAH 2PCPA 4Y2OB 4N0YL 4A6YB 4AKOA 4XHJD 5FO9B 1F90L 5E24E 1ZT1B 5A2AA 4U3HA 4ECNA 1TYRA 3NIDE 4X5XA 3UZEC 1EEYB 3L9RA 2GT9A 4J3OC 1RUPL 1I3VA 3RNKB 5E8EB 5LAXA 5JNYA 1NC4B 1T20B 4W9EC 4U6YA 3UL4A 2X3BA 1YN7B 3UABA 2GTWB 1OF2B 4XP4L 2PWFA 2FB4H 4PWIA 1JHKH 4YNYB 2OI9B 2CHZA 2XG5B 3EYSL 4ZPTA 5JZ7C 2IWFA 4HSQA 1JDCA 3BVUA 3BWAB 5D7IF 4HIJB 3IDIB 2F18A 4POZD 1TVHA 1EJ8A 3GLDA 4PI0A 3DYMA 2XTJE 3EH5B 2ZXQA 3K1DA 4YL9A 4AH2A 1Z9LA 3CHSA 3OKOA 3WKNA 3DUSA 1W80A 4L4JA 3TBTB 5CIPH 4N9GB 3QCUL 2C3XA 2V17H 3EJJX 1E28B 4JKKA 2J8OA 3CZFB 2O1AA 5L7XH 1H3GA 1XGTA 1PGRB 4NKIH 3AW5A 3U36A 4FABL 1JVOA 4MNQA 1ULVA 4Y4KC 2AEWA 5C07A 2KERA 2ZOOA 3TA3A 4KFZC 3K81A 4N4YB 3WIIL 2HMIC 3C6EA 3NJKA 3L4ZA 4K3JL 2FHBA 3BX7C 1BBJA 1XH1A 4GO9A 1T6WA 2NNCA 2EYRA 3KPNA 5I8CA 3M17A 1I8AA 2IAND 5I0ZA 1H5BB 1HE7A 2HCZX 5IBUG 4ODSL 4NCDA 4XVUD 4I89A 2EH8H 1R6VA 1WA0X 3T2PA 4FNTA 3K3QA 3GI8H 4FD0A 4KKCD 4XCFH 3PXHA 1KJ3L 4ODTL 2RH0A 5D71H 2AXFB 5GS0C 3SQBB 3GJEA 4OIBA 4XZUA 5CSBA 1EANA 2CDEA 3B3IB 2E4TA 2X70A 2DY2A 3K74B 4XXCC 4ZXBB 5HDWA 4FQXC 3RL1A 1AHMA 2WN3A 2W91A 2VRKA 1S6NA 5HVWA 1LD9B 3IK2A 3D30A 4PP1D 5F96L 5I71C 2JKXA 2ESVD 2FX7L 3GO1H 3INOA 1NFAA 3TBVA 3INUL 1HL4A 1OAXL 3ZRSA 5L8LB 3TV8A 2K7QA 4YSQA 2JJVA 4ZNEA 2JJSC 1AOHA 4PTTB 4ODHL 4AT6A 4F7KA 3SDCA 2YC1B 1OB0A 4WK0B 1BV8A 4P06A 5JHLH 4KQ3H 3ZIMA 5DVKA 3MRPB 5DJZA 3P2BA 2CRIA 1FL3A 1Q9LA 1BM7A 5I1EH 1HHIB 1DJXA 3O2DA 1MRFH 4CGUB 1WFJA 4X9FA 5LVEA 2UWEF 35C8L 3L6FB 4HUXA 5GZNC 2HG5A 2HTKD 5L88H 5D7JD 4P23A 2BIHA 4PRDA 5T1MB 3QGVA 1T80A 2OR9H 3HHRB 1XIWD 2E27H 4QXVA 4RMRA 4KJPC 2BSRB 4PG9B 4PG2A 1WCBB 4R97B 4Y16D 3UP6A 2IQAB 2EDHA 1E30A 3O8XA 4OF7A 4Z3TA 1U8MB 2YN5A 1S2EA 3QNYA 4GP4B 2BINA 4Y1TA 1VKXA 2C1PB 2VO5A 3Q44A 3H7LA 1D7FA 2FSEB 4QDGA 4WO4A 2JK5A 4AT6B 5E1HB 5SX4H 1G9NL 1F4AA 2Y3AA 4XCYA 4KNSA 4X4XA 2FJHA 2M8XA 3H1ZA 3OLGA 4Z3EA 3PRZA 4J1UA 4YAQB 1P2CA 3EJZC 4JFZL 4RZCB 1DVXA 3CZGA 1GKOA 1KEMH 1E6OH 4AGNA 3BT2L 4F58L 3DJSA 5CGYC 1TJHH 4NYLB 2NY3D 1TG8A 1YJDH 5IVNA 1MCEA 4PRIE 5J1TC 3NIGF 4WWNA 4YX2H 4IRZH 5DFWH 1MREH 2PYEB 4N0UA 2O6FA 2R59A 2G3ZA 4TN9A 2OL3B 1YEFH 4D0DB 5BMFH 2I9TA 1U42A 4GBXB 2MQ0A 5KVFH 2E7DA 4M3HA 1Q94B 1NOAA 1QPPA 3PP4L 2BSTB 3TBSA 2VDLH 2DJMA 2XPGA 1H5BA 1UZ8B 5J9PA 4JFFE 3QDHA 2BVPA 3IDXH 5E51A 4OLVH 2M1KA 1GZPB 5EO1B 1F2QA 2CM6A 2HKHH 4GJTB 4NC1C 3KLHD 4JDEA 1A7NH 3GSRB 2F54B 3IBOA 5DVNA 1DSFH 2DYPA 3OKDA 4KNTA 4MDIA 5D6DA 3Q2VA 1XGTB 4XPTH 1NANI 2W07B 4DOHB 1MJ7H 1NCBL 1XCXA 4ABWA 4YBHA 2JCWA 2J2ZA 2WVVB 1KF9B 2G5UA 2DQ6A 2HH0L 1UCTA 4X4YB 1KZQA 3CC5B 5IQ7H 2Y7LA 3LN5A 4AQ1B 2EIMB 3EO1A 2YD1A 3TC9A 3LN9A 3VXSD 3VXQB 1ORSB 1JJUA 1UD6A 1T1WB 2D4FA 3ARED 1I9JH 3H42H 4GMTL 3VXUD 5CILH 3MREB 1SJHA 4YDMA 2CDGA 4JO8A 2V2TB 4ZO9A 1JZ5A 5I1KH 5I1JL 2XZQH 3B2UD 3FCTA 3OLEA 3U4KA 3RY6C 2DWYA 1JK9A 3FQWA 2DQTH 2VLLA 1RZJH 3BYTA 2YIHA 1KGUA 3QWRD 4NQED 3NJMA 3S5ZA 1WTGT 3GHPA 5DZAA 3CZSA 4J3OG 4NQCE 1CGUA 5E23A 4X5XB 1ZLWH 3F3HA 1ZSHA 3GRBA 4J4PA 5SWZD 5KVGL 4WJG3 5I5IA 1S7TA 1YEGH 4QOKD 1ODAA 2NLJA 2WXRA 4GRMA 4U1GB 5ID1B 1T2JA 4NHCL 3BVVA 2C9SA 4A2FA 2YPVH 4L4VB 4Z7OB 1KLFB 3REVA 4L5FE 4JM2A 5I73B 1TETH 1JHKL 3J07A 4LCIH 5D7LD 1N0XL 2FJGA 4HDIB 4X50A 1H0DB 2PPCA 4U3SA 4WO4D 3GSNB 5FYJH 1D9KA 1P4BL 3LKOA 3BGMA 3PIQA 1ZA3A 4MJIA 4W6WB 2FQDA 2XA8L 3OHMB 2B15A 3JBG7 4ZS7H 4H2AA 3OJDA 3OR6B 2FR4B 4I77L 1JD9A 1Z9SB 5ETUB 3FOMA 4N2HA 1G7IA 1IIKA 4X9YA 2R4RL 1N59B 3D2UA 4U6HA 1KCUH 4UZGA 2D3JA 2JKNA 4JMXA 4P2RB 3STZA 5I1HL 1LK2A 3GJFK 4LQ1A 1NWOA 1DQJB 3QPKA 1CF8H 4JE0A 3ZDYE 3K2KA 1G4RA 1A22B 2Q6WB 3TH4T 3US1A 2Y6SC 4G6FD 1T4KA 1PSKH 1AGDA 2XWTA 4HT1H 3CFDA 1PD6A 1QNZL 4KVPA 1MAKA 4X99B 4WFHD 4JRXA 4UWQB 1Z3GH 4QOKE 3HG4A 3CHPA 4OKVB 4X5LA 5F9DC 2YK1H 3WXVH 5IT2L 1CXEA 4FLHA 5JO5A 3HVDA 4LEOA 2JWYA 2UZXA 2X10A 2GSIB 1QSFB 2VDOH 2X4UB 1OB1B 5GRWA 1FFPA 3GRWL 3TZVD 5A2LH 1M7XA 4I5BB 1IC7L 4JZJB 3SHSA 1CK0H 1PFCA 4JQXC 1HHKA 1WZMA 3C6LC 4MS8D 5HGHA 1U8HB 3O4LA 2EVIA 4G7QB 4JZJA 3MO1B 5DYOB 4OZGE 1ORQA 1TTGA 4RMTA 5IMOB 3AQYA 3MRCB 1BM3H 1A1OB 1HYSC 1QSFA 4C56E 2YAQA 3C9NB 4J27A 3BC9A 1B0GB 3GIVA 3CZUB 2QGEA 3L5WB 1JZ4A 2XJKA 4LIQL 5JHDA 4XBEL 2LW3A 4DGVH 1IUZA 4BQ9A 3H9SD 1SHMA 5LWYH 1U91B 4PJBA 4M93B 1BLNA 3EJZD 3B6SB 3KPRE 4U31A 2Z31C 4LCYB 5D96B 1G7PA 1MFBL 4L37B 4NKOB 4LL9A 1F3DH 5ADPL 4PY8I 3WBDA 2DQGL 5D7EA 3H53A 4XMKH 3TH2T 5F3BB 4JHBA 3ILPB 2GJ6A 4NNPL 3UJJL 4K71B 4IOFD 1YO4A 4I3SL 5I26A 2KYIA 1R34A 2DQCL 2WBJD 3NK3A 1ETZA 2CHXA 2CBMA 3B2VH 5AAMA 1I8MB 1M7UA 1G7IB 5FWQA 4LEXL 4WTXA 5JZ7D 1PZUB 2X1XR 3U2SB 4NWUH 4AVIA 3E1F1 3FULA 3VGDA 1MCJA 2VQ4A 1AE6H 4G8AC 4NKDA 4JRYD 1LWJA 3FTGA 4Q9QL 3CIAA 5CD3A 1XQ4A 3ZKSD 3L3OC 4DN3L 3AT9A 3LEYH 4MJIB 1MZYA 3C08L 2RQEA 4X7SH 1AKJD 3RU8H 3S36L 3GSNA 1T1XB 3TA3C 6FABL 3SDAA 5IW6B 1QLEH 3IDYC 3GINA 2QQNL 2W9DH 4MA3B 3EGSA 3FQRA 3OD3A 1JWMB 4CA4A 4XHJC 3F65A 3QJHB 3VFTB 5E94A 2X4OB 3VE0A 5FLUA 4XPHL 5B1BB 1YEKH 4GMSL 5J3HC 1ZV9A 3A6CH 3RVWD 4IIZA 4OF0A 5KSBB 1H3PL 3E6FB 2EINB 2EEFA 4Y5XC 4P4KD 3WEBA 1A1NA 3HHSA 1B2WH 3LS4L 3BSGA 1JFQH 1JZIA 4JY4B 5DHVH 5DT1H 4IKJA 2Y5EA 4BSJA 3KM1A 2CK0L 1BJMA 3LB6C 2PR4L 4K7FA 1T83C 5DRZB 3QNXA 3NJJA 3PHAA 2PO6A 3VWJD 1E3ZA 3NCJL 2CCLA 4GKZA 3KBPA 2NUTA 1DQVA 1J1OH 1A4JB 1CLCA 4Y5XA 2CO4A 3FL7A 1N8OE 2IPKA 3QFGA 4OIIL 3WJMA 2ZX7A 4DP2X 1I1RA 4WHCA 5D7LA 1I9RL 1MH5B 3CSTA 3I75B 5JW4M 3JWDL 3QORC 4HUVB 2FH6A 1JV5B 1PY0A 2YMOA 2Z4QB 3R0NA 1SJHB 4P2QA 4WTQA 4YE0A 2QHRH 4TVPH 5F9OH 2BRRH 4NUPA 4ZXBC 3CVBA 4BZ2H 4KKQA 3NG5A 3L8QA 1FNHA 4MAUL 4MD4A 4WUUA 4HIXH 4K23H 2FJSA 3UMNA 4WUKH 2XN9B 2HJFA 1CXLA 3GC3A 2NX5E 4GXFA 2ETWA 3EFFA 4A04A 3MRMA 1P5VB 3MGTB 1EZVX 4YDLB 4GT0A 3SKJH 2FGWL 3QJRB 3WIHH 1N3NB 3QHZL 1WC7B 3I74A 3EGXA 4JPKH 2AEPL 4X7CC 1ZHLB 1FL5A 1HIMH 1F3JA 4HJIA 4P3DB 1DBJL 2EUXA 5TH2A 2HVKA 3QIBC 3BRDA 2BVPB 2IOIA 3BLBA 2XBDA 4RFOL 1KBVA 4JUTA 1UZ8A 3L48A 2FO8A 1W0WB 3LN4B 4V1DD 5D70L 1HILA 2E76C 3V6BR 5TQ0L 3STLB 1HTYA 4UQ2B 5GJSH 1IFHL 4ALAH 5FS5A 3WG7B 4EUPH 3VG0L 1HJBC 5INCA 4E0RB 3F8UB 2BMKA 4L4TE 3FFDA 4OV5A 3F85A 1ZTXE 1IAOB 3CUPB 2VITB 5D7IE 2OW7A 2P48B 1BQRA 1N8ZB 3FMGL 1T21B 1LQBC 1PYWB 5C0DA 2VKXA 2X9WA 5JA8B 1NJ9B 1SXAA 2TAAA 1D6VH 1WISA 3AB0B 5EBLA 1X4ZA 4P3WA 1S78D 2VQTA 5EU6E 3TIDB 5GGTL 2IPUG 3ALXA 1TZIA 4L3FA 2ALWA 1HVXA 5C0BB 3TNNB 5PAZA 1G94A 2H6PB 3G5XA 2W8CA 4K8RH 4C4KO 4JANB 5E9AA 3ULVL 4BFBD 4LQFH 1XR8A 1U3HC 2VR3A 3C5JB 4XCYB 4PJFF 2BNQE 1WFUA 4MAYD 3OZLA 3KPOB 3WAJA 1QBMH 2ORBL 4RSVA 3PL6C 1M7IB 5AKRA 1TYJA 3GNML 1Z2KA 2EXYD 1NCAH 4NC1E 4PJ8B 2Z31A 1QTSA 1JGVL 2R7EB 3BEWA 3QDJE 4W9ZA 4X5WB 4ZW7A 2APFA 4X80L 3B5HA 4KKAD 1R5IA 3VXTA 2IH8A 5ABDE 1Q0XH 3IU4H 2NX5B 4PRDB 2H32B 1AO7A 3B8YA 4NKQB 2VDRB 4PR5A 2X89A 3NSFA 3RIAK 1PZBA 2ZUUA 3M46A 4XAKE 3AWEA 3WXWL 1CT8A 4LPTA 1P5UA 3SD2A 2VDPB 7PAZA 1AP2B 5DMYA 5KS9B 2P5EB 4OZHF 3O3BB 5DRNA 1MRCL 4HH8A 5GGTA 2WXQA 4O2FB 3POHA 3NCBB 1IRAY 3VXSE 3U9WA 3MOQA 1NEZG 3NN8B 3JQOB 4E5XB 3FU5A 1QX1A 5C7XL 1MLBA 3KGSA 4HULB 4H25A 3VFUA 1UGNA 2ZCZA 2GC4C 4BH8B 5J7CC 4K3DH 3MBXL 1IGIL 2XX0A 1XZWA 3QHFH 3C6LD 4FG0A 4EZJA 1MAJA 3QJUB 2KQMA 3HI5H 1LGVA 1WWAX 2YD8A 3N50A 1HU8A 3Q8CA 4M61B 2Q8BL 4R7DB 5EBMA 5GSRB 5T5FH 3VD1A 1RZQA 4L8CB 3QZPA 1SM3L 4FLRA 1AQKH 4HJJH 3SOBL 1CFNA 1ODUA 4I4WA 5C0CB 3VB8A 4D9RE 5I17A 1VFAA 3FH8A 5AYUH 4JGMA 1OLZA 3DTXA 1UC6A 4AG4L 3S2AA 5C70A 1A6AB 1M9SA 2DPKA 1C12A 3SKUD 3VXOB 4YHIA 4ZTEA 3CCHA 3VD4A 5I24A 3RNQB 1ZV2A 3T4YB 5SWSE 2OMUA 4Q89A 3V5HA 3ZKMC 1CIDA 1U4EA 1KIQA 2PTUA 4W93A 4PRBA 5DC0A 4ZMQA 1NCHA 4ORGA 1Y0LB 4I0PD 3O6FA 3TEYA 3WFEH 1U2YA 2WIIA 3H56A 1HINH 3LIZH 4XHQA 1WE5A 3BGAA 1NCUA 2BZDA 3HZ3A 4RNRA 5GRJH 1CBJA 2YR3A 4NN6B 1EHLH 1CQYA 3AS0A 2GHZA 1F45A 1YNKL 4GW4A 4UMGA 5FF6B 2H3NA 4BHUA 1JF6A 1D9KC 4J3VA 4NRZA 4JFPA 1QLEB 3U36B 1SVBA 3IDGA 3QJXA 4WY7L 2P5EA 2QQQA 5HYQB 2XRAL 3CZFA 2NXYB 3F7LA 4DESA 4X6DA 1KXQA 3LD8B 4BIKA 2HJLB 1JL8A 2DJSA 2CRYA 1TJGL 4KZCA 4N25A 5IEKA 2FLBT 4OD3H 1DBAH 5DYFA 3UG3A 3WSQL 1CGYA 1X6NA 2CLZA 4K8RD 3L3KB 1P7BA 1MFCH 4HD9A 5CEZL 4PJXB 3P3TA 5BZZA 2JXMB 3WTYA 4DKDC 2VLRB 2GAZA 1T6BX 4ZODA 2LE9A 3VA2C 4KMLB 3DXAD 4ORZC 5FDWA 3QZBA 3FQUA 4PJ8A 4ZS6C 1FH5L 1G7JB 1N12A 2CR3A 1ZLDA 1AD0A 3IPFA 1LE9A 3FF8A 5GGRB 4F57H 4ZUVA 4HPYH 1PLGL 3HB3D 2EE3A 2F74A 2QADB 4HUWA 4AQEB 1I1AC 3KPOA 2GTWA 5H4ZA 4WWKA 3X3FL 2I7OA 1NCTA 3QZMA 3SDXE 3AQZA 4U1IB 4ZTOL 4D9RD 4Y19E 5CCKH 3L9RB 5I6OA 4OLEA 1MJUL 5J0BA 3BP6B 4PRAA 3TTSA 4GAFB 1D7BA 3ILEA 4HISA 2C26A 4H44C 5FO9A 4R7NB 3AUVA 3O4OC 2EH7L 4RMQA 1NMAH 4CSZA 1DQML 1G1OA 4N90E 2VCOA 1RJYA 3B2DC 3ARGC 4LVHB 3X1GA 5KEZA 3AAZA 1HEZB 5DJ8A 4O2CA 3HKZA 3DWTA 2DM3A 3BUBA 4G6AD 1OAKH 3CMOH 5JXED 3APNA 3FO1A 3VMOA 4TS6A 2OSYA 1ZAGA 4I48A 4JFVA 4P2RD 5AAWA 4K23L 3HC4L 3QI9D 1KYAA 3N1FC 3QDJA 4A7QA 1JCKA 1H8OA 2N4IA 4JG5A 2WWKT 1NUDA 3DDFA 5EZPA 2NR6C 2B1AH 1NCWL 1UJ3A 2BVEA 3I9GH 3RA7H 3O6LH 3EGXB 3NA9H 1CR9L 1DVFB 3Q9PA 4RWYL 3MCG1 2Q8AH 3QQ3B 4IIQA 2FATL 1P7QB 4P3CL 4RGMB 1YSOA 4BSVB 2XXCB 1S7XB 1MI5B 2H26A 5EBWB 3IN2A 4OLUL 3JV4A 3F7PC 3B43A 3BHBB 1NBVL 4OM0H 5BO1L 1A4KA 2W9EH 4FQCH 2AABL 5JHDD 5IQOA 1R3KB 4IMKC 2BIIA 2EYTB 2YPLB 3MJ7B 5DMGC 6TAAA 4MXQC 1IQDA 3Q3GA 3L5IA 3LNHA 5BOZG 2Z4QA 3UIYA 4TLUA 5IGXL 3RVUC 5FYLL 3ZE0F 1NFDB 3COOA 2K3TA 3I3EA 2A73B 3MBWB 1TJXA 5HY9A 2ZP8A 2B9AA 1QFWL 4HJ0D 4HBCH 3MYJA 1LE5A 4JB9L 1IC1A 5DD3H 3FU7A 2OMZB 3FUDA 5TE6L 1BHGA 2OYKA 4H5SA 3S88H 3HAEG 1FRGL 1BG9A 2P47B 3VH8G 4QRTA 4NNYB 4MLIA 4R8WH 4C4UA 3SE3A 3N42B 5FYLE 1ZOXA 2ZG3A 1R3HB 5D7LE 2FX9L 2BNRB 4IU2B 4AGQA 3F83A 1O7VA 3KLAA 1HHHB 4MB4A 5GJTH 5HDBB 3DUHA 5CN2A 4BQ8A 4TUUA 3PHOB 1MJ8L 3VFVB 4MJJA 4FLSA 3DOSA 3GMRA 2VLMD 4PJDA 2X6MA 3HRZA 4HAKA 1YMHB 5MHSE 2FT6A 4LASL 3GSQA 4OLVL 1H3WM 1NWPA 4MA7H 3VYNA 2VN5A 2BVTA 1L7IL 1UOVA 1LO0L 5IUCA 3FXIC 5CBAA 3QG7H 1YEHL 4MZIA 4UOJA 2HRPL 1UFGA 3JT2A 4BKSC 2QZQA 3RDTD 2R39A 1IU1A 4NENB 3SSGA 3W82A 5HPMB 2P45B 4J12A 3ZYZA 2VXUL 1ZLUK 3ZTEA 4WGWB 2FUTA 3TEWA 3DMMA 1QHPA 4FP8L 3QA3A 3KVDD 4GI9A 3ME0A 4D9QD 4RH4A 2MIZA 4CBZA 1A6VH 3FJTA 3CSGA 4NXSA 2J6WA 1YMME 4LL4A 5FFGA 3F6IA 2VJXA 3DOSB 3MJGX 5E70A 2HVJA 2ZWZA 3QUKA 2HKFL 4A67A 3EJUA 3RVXD 4F7MB 3OVUB 1G0DA 2VW7A 1T2QL 4IJ3C 3JV0A 5IVOA 4AM0B 2ADIB 4RZKA 4L3CB 1IGML 4LVNC 3BH8A 2X1OA 2QR0B 5DZVA 4LMQE 5FYKE 3EH2A 3GTTA 3ZQ9A 3B7YA 3B34A 1UOWA 4IQHA 2CD0A 2GVYA 4RSYA 2A83A 5E8PA 1VGKB 3DX0A 4M62L 1SOQA 2A74A 4YDVB 3WUWA 4GLRI 5JMOC 4HUUB 1LE5B 4H1LA 4DIXA 1YUHB 1CFSA 2PCFA 1J8HE 4XN7A 2WNGA 3VVVA 2PYFA 4GIOA 4BUQA 1SYVB 3GDCA 3GMMA 5A2KH 1EO8H 1CDIA 3WTXA 1DJIA 4WHDA 4IKNA 1WPCA 1YPZA 4WFED 1S7WB 4NO5A 5EN3A 2O6EA 1UATA 3FB5B 1EIBA 5ESVB 1VIWA 4GXVH 1XFPA 4B9IA 5F1NA 3QIBB 5I5JA 3B7TA 1MLCA 3EJQA 5GGSY 4TQ8A 2P7TA 3S96A 2P4AB 3IM1A 3UO1L 5L2KD 1S7XA 4RGMC 4PBWD 4BSVA 2YRPA 1BFOB 3DO3A 4AJ0A 4EE2A 2VAAA 4ZW3A 4GBXC 3VU1A 3MC0A 3C09C 3VDBA 4NKMA 1I7TB 3DVNB 3RIAF 5AENA 4N2OA 3H6AA 3HMXH 2BNUA 3LPFA 4J2QA 1XMEB 2AQRA 2PPEA 3LZFH 3UYOD 4HIIB 1GA2A 2D2OA 4ICWA 1B4RA 4AIZA 1D5IH 3PIQB 2BJML 2W1NA 3ZTCC 5HYJA 4KHTL 4P5TB 3ZZQA 3FN0H 2CUAA 4Q0XL 2OBGA 4YK4B 1F58L 1KJVA 4OJAA 1W72B 1BQUA 1JWSB 2Z4TA 1ZVHA 1XXFC 3HPJB 2VLJB 2NY7L 1SGKA 3SE6A 5E6YA 3GF8A 5ESAA 3RZCD 1EQWA 1RJYB 4LESA 3ILQC 1JPFA 5T1LA 3KEDA 3O0RH 3N41B 4ISVA 4M8QB 4Q58C 3CVDA 4ENED 2DQJL 4H20H 5HI4C 4CSTA 3P4NB 3HS8A 4L9LC 2YD6A 3VX0A 5CUSH 3DJTA 4LFHD 1U8IA 4NRYB 2XWZA 2WPGA 5MP6H 3TBWB 5IWLC 3QUHA 3ZRCC 3VYOA 4X98A 4QWWD 4QPEA 5HVGB 1RVFL 3FRPG 3M1OA 4JO4H 3DPBA 3LEXB 1A21A 2W65B 2F8XC 1BJ1H 5BVPL 4WW2A 1AD0B 5DD6A 1HXKA 1RHHA 2YGQA 2J8UB 4R7VA 4HKBB 3QR0A 4XP6H 1I9EA 1L5GB 4MCYB 5C0JA 1W8NA 3FT3A 4HF5H 1A3LL 4PJGB 1G9ML 4UCFA 4XNMB 1NMCC 3QXDA 5AOJA 2IGLA 3EO1B 3ZSSA 2UXVA 4WVRA 1IGCH 1DJHA 3DMMD 2W9LA 4MQ7B 3RVTD 2NQCA 2YXMA 4HUCA 3TVMB 3MROB 4RLDA 1HFUA 2K70A 3QIBD 3QNFA 4ZFFB 3VQ2C 1HOCB 1TQBC 5IJDC 5JUEH 1M05A 5KTEH 3QE5A 3T0BA 1FZMA 3RG1C 2EQDA 1RURL 3WNPA 4GW4B 2XPZA 2V9QA 5B8CC 2QQLH 5EO1A 3O6FC 1KLUB 1HNFA 5KN5B 5FYJE 3IU3B 4DP9X 1AZRA 2YPKB 4JE4B 4L9DA 2WIIB 4XB8A 3K2MC 4K9EH 5FYJU 1AIZA 4JREC 4EN3D 5DEGB 1RERA 1KGWA 4XRCB 5L4MA 2EDTA 2Z91A 4AW4A 1GTNA 2VLJE 4M9PA 1AZCA 1LJMA 2JJSA 4WU7B 3S88L 1MEXL 3BZ4A 3CQPA 4AQ8C 2FIKA 4D0DA 2XYBA 4NQCD 3CCHB 1MCQA 4TQHA 5IHHA 5IFAL 3Q13A 2ZOWA 2X6BA 4N8UA 3VNZA 1ACXA 3D9AH 1GKEA 2V2WA 2DH3A 3LXBA 4OVUA 5FXCH 4YHML 2PP9A 3GMOB 4BE6A 4PWKA 3H85A 3P9LB 2F53A 2IBZY 2Y6SD 4BCXA 3IMBA 1BOGA 1OGSA 2A1WH 2XVGA 4W4OA 1KTKE 1M1SA 4DGYL 1DANU 4UT6H 2BWDA 5DA0B 2WAHA 1U95B 4ERSL 3MRNB 5HHPA 5EF0A 2IQAA 3QARA 2WNXA 3P4MB 5E6UB 2H41A 3LNEA 1XGQB 4ONFH 2KZKA 3VXNA 1GZQA 5HHVL 5I15L 3N40P 5F6IB 3DI2B 3NEOA 4LF3B 3UROR 3PHQB 3R18A 2RGSA 1U93A 1MPAL 2C1OB 3ATDA 1D5RA 4EUPA 1U3HA 3S0PA 4QJ5B 4G5AA 4JFDB 5DLLA 4XWOC 3EF7A 4MXWH 1HKLL 5MI0C 1ZANL 1GPOL 3TESA 1OCCB 1ONQB 2KC0A 2YBGA 4G8FA 4YSPA 2EXTA 4NOBA 1K3IA 3BYYA 3KS0J 4P46B 3P4MA 1RIUL 3VQLA 1M6OB 3W9DB 2HFGL 3K8MA 2MTPA 1USQA 4L8SC 2YAHA 5KBKA 3B5GA 1IZJA 2B77A 2CCVA 3QRGL 3CHQA 1MAML 2WXKA 4KXZI 4QR7A 1XR8B 3BISA 4QHKI 2EIKB 4PJ9C 1MFNA 2XN1A 3AGVA 4JANA 4V11A 1KTJA 3BZDA 1L0PA 1UZ6E 2VISB 4Z7VA 3SQOL 2F5BH 2ZNXA 5KVEH 3CVIL 1CS6A 3N85L 2OAAA 1OL0A 3LCYA 3S8FB 3MV7B 4F37F 4R96B 1C08B 1F56A 4PTUB 5F0MB 3ZO9A 2OXGA 5I30L 4MJ5B 5DRWA 1E50A 3EYSH 3QO1A 2WVTA 4Z7WE 1AVAA 5E99L 4C8XA 5AG9A 2ENSA 2GUOA 1N10A 3V0IA 1I3UA 3M17B 3KPNB 4EN3B 4QXTB 5I8CB 4HPOH 1M57B 4Z6AT 5J6GA 1P7QD 1KB5B 5CGMA 3PREA 3FU8A 3U2IA 4C54A 1NCAL 4M7LH 2BRQA 4PRHA 4X83A 1J5IA 4L4VE 1JGVH 5EU5B 2NYYD 1I7ZA 4RGOH 5H37A 1S9VA 5I1GH 1M05B 4G6JL 4HWEH 2LAGB 2LT9A 2K9FB 5I71B 3IGLA 1FGNL 1KENL 2BS9A 1HOCA 4FN0A 1K2DB 2B3RA 3FN3A 3EH4B 4B5EA 3MXVL 1D7CA 4H8QA 4JR9L 2L7JA 3EO9H 1JNNH 1T83A 3D4CA 4P4RA 4U7KA 2FT8A 5ACMA 5ICYB 4QLWA 3DX2A 1RHHB 3C6SA 4OW6A 3OWEA 3NEEA 4PJ7B 5JW4N 5C92A 1MW0A 3CD4A 5B4MC 3ARGD 4HUVA 2WUBH 3SE4C 3GMNB 3K6FA 3LS5L 4ES9A 3F12A 5HYEA 5T33L 4OCWL 4U7SA 2NY5L 1AQHA 1RIHL 4U6YB 1BAGA 1LDPH 2J6EA 3DO4A 4GRLC 4D8PA 3GEFA 5FK9A 1QTYT 2EJ1A 4P2OD 2AVGA 4UAOB 3RRQA 1BVNT 1ZT1A 1GOFA 4OY9A 4UTBH 4JG1H 4WI3A 4XP4H 3GJFH 4LP8A 4NFCA 2JKTM 1TPXC 1WAPA 4ISVB 1JGUL 1XMWA 5CXPA 1VZGA 3ZYJA 5KSAC 5JOPE 5AKSA 2HTLC 4HFWA 2VZUA 1MCLA 3AM8C 3LKQA 3VRJA 1I1AA 1JUFA 1RVFH 2OMBA 3U48A 3VXRE 4ZYKA 4LGSB 5FCSH 4LARH 3D4GA 2AK4B 3BSHA 1PTZA 1DLHA 1MHCB 1E2ZA 5EU3B 2HAZA 2LLLA 5FHBL 2VN4A 3EFOB 4NNXB 5IK3B 4FHBD 4TQIA 4OZIB 1I4FA 2UUDH 4OZGB 1DN2A 1NDTA 2VXVH 3HG1E 4JK0D 2MOQA 4F2MB 5FUOL 5F6HJ 5FFLA 3K1KC 3BFWA 3ZQXA 1I3GL 4G71B 4I0CC 4IJ3B 3WNIA 1D9KD 5I6PA 3U2SA 5K69A 2G5BA </