3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
2J6WA 4IBZA 1HJBC 3ZMEA 5BUAA 1CMOA 4G83A 4AGLA 3WTYA 4GUQA 1TUPA 1HJCA 3KZ8A 2RMNA 3Q01A 3WTUA 4IBQA 4LO9A 2J20A 4IBTA 4AGOA 5AOKA 5ECGA 3IGLA 4HJEA 2P52A 4L0ZA 2PCXA 2BIQA 2BIMA 4XR8C 4IBVA 4IBUA 3Q05A 4MZIA 3D09A 2X0WA 4IBSA 2J1ZA 1CO1A 1H9DA 5ABAA 2XWRA 2AC0A 4L0YA 2X0VA 2VUKA 5AOIA 5AOJA 2IOMA 2OCJA 4AGQA 2IOOA 5AOLA 1HU8A 5LGYA 1YCSA 3WTXA 3KMDA 3WTSA 1EAQA 4AGMA 1EAOA 4IJTA 4GUOA 2IOIA 2J1WA 3D07A 5A7BA 3QYNA 2H1LM 4LOFA 3Q06A 1EANA 4KVPA 3VD0A 4IBWA 3WU1A 1E50A 2MEJB 1GZHA 4MZRA 2XWCA 1IO4C 3D06A 3EXJA 1GZHC 2ATAA 3D08A 4AGNA 4IBYA 1LJMA 3TS8A 3WTVA 4AGPA 2GEQA 5AB9A 4G82A 2J1XA 2J21A 3VD1A 4A63A 3D0AA 2FEJA 2BIPA 2BIOA 5G4OA 3WTWA 3VD2A 1T4WA 3US0A 5LAPA 2ADYA 2AHIA 3US1A 1TSRA 4QO1B 4L18A 4LOEA 3QYMA 2WGXA 2YBGA 2BINA 1KZYA 3D05A 5G4MA 3EXLA 2X0UA 1UOLA 5KBDA 5AOMA 3IGKA 2J1YA 5G4NA 3WTTA
chains in the Genus database with same CATH superfamily
3FSAA 2BS71 3DXAE 4GW5A 1ZT4B 4IEFA 4F15B 4PTTA 4PVMA 2XNAB 2EH7L 1WPCA 3KZ8A 3T0EB 1LD9A 4WV1B 3RIFK 1MCKA 2HX9A 1X7QA 1YMME 2J20A 4N87A 2Z8WC 3PHAA 4JPSA 4QRUA 5LG1A 3M6DA 3UP6A 5GZNC 2QSVA 2FX8L 2EZ0C 2BIHA 5G5DB 2RA1A 5IOPB 2DQIL 1YN6B 1II4E 2NDFA 4AUJA 2NNXA 3QG6A 2PABA 5D7JC 5E4EB 4GG6B 5EWIL 3RPKA 2OYPA 2KS0A 1BM3H 1NUDA 4ZO6A 5FIEA 3MLZH 5J1TC 1A6WL 1E6JL 3AY4C 4XN4A 1G0XA 3PFQA 1QFWM 4UCFA 1OP9A 5A6MA 3IJHA 3L6FA 2XIBA 3QI9C 3RVWC 3DOSA 1BBDL 3F65A 2GTWA 3BN9D 4NJ9H 3S4SA 3QUXA 3PP3H 2ZXGA 1SRDA 3K8LA 1S5HA 2IOIA 4WU7B 4IU2B 3LNIA 4KX7A 3RX8A 1U3JA 1N70A 2CDEA 2YD5A 4UV4L 2PYEA 5SX5K 3GT6A 4C55A 2FE0A 2RQ8A 3CPLB 1A4AA 2HLAB 1CK0H 3NGBC 1PZDA 1QI5A 5JW5B 2WKLA 1IVLA 5DZPA 2F15A 4NO5A 4YDKL 1XF5B 3B9DA 4JN1H 1ZLWH 1U6AH 1ZANL 3WN6A 2Z6FA 1XF4B 4NO3A 2ZF8A 1TMQA 4DW2L 1YEEH 3R8QA 3D08A 5HPMA 3ARGB 2MCPL 3MACL 3UO8B 4MJ5B 3QNFA 1D5BA 1NPNA 4M7JH 2ZWYA 5FYLL 4LCWA 2WANA 5DJAB 5C0GB 4N2AA 2VZ1A 3WJLA 1NC4D 1D5MA 3DX9B 3L4WA 4IRZA 4LLWA 4M5ZL 2RTTA 2N01B 1G0YR 1ZA3A 3NEXA 4KXCA 5E8OB 5KVFL 3OX8A 4WI8A 5E00B 1LK3L 4M48L 1NCTA 1RZQA 4WI5A 5BS0D 3US0A 1CFVL 1D7DA 4HW6A 1QBLH 1HQ4B 3RDTD 3VRIA 3MUHL 1WHPA 3QXDB 4OLXL 2VLLA 3HS0A 5LQBL 2BZ7A 1TVHA 1T5XB 5CR8A 5CEXA 2J2ZB 3K0YA 5ID1A 3GB7B 3N1GC 1KZQA 4GRWE 3PHQA 3T0VA 2DS4A 3U0PB 4OZFG 2B7DT 4UM9D 2DQHL 3FL7A 1JBJA 4OD1H 2G75A 1Z66A 4HF5H 1XGYL 4N28A 2WCGA 1F3DJ 3FH8A 5CWSB 2XQYA 2BOBA 4QCIB 3K5SA 5GGSA 5IZ7A 2FB4H 3F05A 3N43F 4H8HA 1OPGL 1IZKA 4XP9L 3VXPA 1UJTA 3QZBA 2VW7A 1MAML 1QABA 4ODSL 5B8CC 1BFOA 1CDJA 2GJZA 2HLFC 2IWEA 3GINA 1F3JB 1O5DT 1OB1A 2VISA 4GSUA 2UWEA 1H3TA 3L3OC 4L4VA 2XA8L 2NY4B 4XP4H 2Q20A 1GZQA 1ZT4A 1SN0A 5DGRA 2XNAA 2BP0A 2F74B 2YPLA 3K72A 4Z7OB 3P4MB 2VCOA 1QKZL 1PDKB 3O2WH 2IOOA 3A4EA 1WA0X 1KPRA 5DRXB 2BC4A 2EDKA 4PJBA 5IESH 1E28A 1X5FA 3BVTA 4JFQA 1YNTA 1L3NA 2A7BA 2WTPA 3W56A 5JQHC 4O9HL 3ELAT 2Y06H 5HHXL 3UG4A 3K6SB 4WW2A 2DM3A 2WQRA 1I8KA 4XTRD 5HHPA 3G9AB 2B0SL 4XPBH 2ZP9A 2FLRT 2DJMA 1ZTMA 3P73A 4RFEB 2Y6SC 3P4NA 2NYYD 5GJSL 4M6MH 3RWEA 1QA9B 1SDAB 1SNRA 4KKBC 1BIIB 2EIZA 4ZD3L 3EO1A 2C9AA 1KTDB 2YUWA 2XV6B 4X6CF 2BSDA 1QLFA 1WLHA 1H8OA 2XJKA 4ONGH 2MTPA 2XWCA 4PRBA 2UZXA 3BAWA 4P5RA 1WAPA 1SJVA 3LQZB 3S5ZA 2R1XA 5BRZE 4NQQA 1T7WA 4CC4A 4XVUD 2CIKB 2PCPB 5EUKA 4Z7WA 3OLEA 3TWYA 1BZ9A 2Y5QA 4I3RH 4A37A 1R3LB 4IBYA 3RKDC 3PP3K 2X4TB 3IU4H 4PIBA 1PFOA 1S7XB 4AGPA 2P5PA 5T1MA 2BERA 3UXFA 2EC9T 2R1YA 4MB4A 3SEPA 2HLEB 4DVBA 3TIEB 4ZUVA 4N3TA 4LLMB 2E8ZA 3RL1A 3CSGA 3UZVB 1ILUA 2WWMD 5ENWB 5I6OA 3ARDB 3IGAB 5DVOA 2FX7L 2WBKA 1XF5A 3L1OL 2X9YA 3NJGA 2WUBL 2AJYH 2I60H 4BXSV 1FNFA 1FDLH 1N68A 2IAAC 2BY3A 4MSWB 2HFFB 5GS0L 1TJHL 2HFEA 3SGEH 1U91B 3KG5A 1OAUL 2W1NA 5KUKA 3MV8A 2XVKA 4NKIL 3M07A 4JCLA 2QQNH 1JXFA 4IMLB 3ARFA 5D7SL 5DUBB 3C8DA 3CUPB 3OMZA 2HZHA 3QDJB 3S37H 4POZC 2CJ3A 4LT7A 3VI4E 4BELD 1S4IA 4AYEC 2OR9H 2ED6A 1HHGB 4YHZL 4UB0H 5EEUA 1Z0NA 3MX0B 2R2EA 3VM7A 2X6CA 3WEAA 4CN4A 4AYFA 1ADQL 1NC2B 3PE9A 1SY6A 3SZ6A 1CIUA 3IMTA 4KQ3L 5F9OH 3HC4L 4GIAA 1U8QB 3EGXA 4GLRI 4NDMB 5IBUB 1T5XA 4HBCH 5AAMC 1Q8MA 2AEPL 3WAKA 1GJIA 3QUZA 3M45A 4L0ZA 3GIZH 5T5NG 1DQMH 3IMWA 3RA7H 1E42A 2LU4A 1E5YA 2XZAL 3DIVA 1BG9A 4WI2A 1FIGH 3KPRB 1ZHNB 4XNYL 3GSNB 2BMKA 3WY1A 1DQDL 5DVNA 3V0IA 4ETYA 3BPNB 2FL5A 3QHFH 4G3YL 3MPCA 1L5GA 1RJLB 1GSMA 2XVBA 5DJ2A 5AOLA 1EHLL 1T20A 4L3FA 4QKXB 1YEKL 2Q10A 1WWWX 5DDHA 2YK1H 5EB9A 1WGOA 2ZG3A 2QVIA 4J6IA 1I82A 2FYYA 4OFVA 2BDNL 1GS6X 2J1WA 5AKVA 4ZI8A 1PY4A 2BOCB 2VQUA 3BRDA 3QHZL 2LOEA 4GAGL 5LO7A 3FCSA 2VC2L 4M4PA 5C0AD 4JDVA 3S3CB 1T1XB 3IN2A 2K8MA 3NFNB 2GIYA 1D6EA 3HUJA 3WIHH 4MQXD 3KNBA 3IJEB 3SOBL 2Z0UA 4WO4D 1MSPA 1IKFL 4Q2ZB 2EE3A 4HUMB 1ACCA 1OT2A 2VM3A 3GMRA 4K94C 4MD4B 2KZBA 3K6SA 5I71C 2HT2C 1FL6A 3V8CA 5I1IL 3MYJB 4BV1A 5MI0B 3GFUA 3HOGA 1R3KA 3AWFA 1M56B 4NRXB 4EN3B 4GFXA 4GMTL 4Y5VA 2AS5M 1AQ8A 2JKJA 2EACA 4IKIA 4IMKA 1JNJA 5BOJA 2Y7SA 1MFAL 4G7YL 1DFBL 1MWOA 4H5SA 4B9IA 5EEWA 3FU9A 3KPSB 5KYNA 3DMMD 1HXYA 5IFAL 2X4OB 3MR9B 4RNRB 5IGXH 5GGQH 3VX1A 2H32A 1KOAA 5F1SA 1M05A 3SKMA 4FNUA 2G60H 4M8QB 4Y2DA 5B1CA 1PCXA 1YMHB 3GSRB 4UQCA 2B59A 5JOFA 1YDPB 1PEWA 3J27A 3U7YH 1B90A 3K7UA 4NOBA 5D7EA 3UJTL 2UV3A 5JXEA 1U8NA 1G4MA 1SQ2N 4HWUA 4PGCA 2XUWA 2NSQA 5EV7A 5JW4R 1N12A 2VDKH 3BPOB 3HPLA 2P5WD 1VEMA 1J9QA 5C6TL 4IU3A 1B9ZA 1VACA 2GI7A 3BH4A 1RZJC 4QHLB 1U91A 2GJRA 2CUMA 4NM8L 4ODHH 3QORB 4CU7A 2VDNB 4PLKC 3ECQA 3D52A 2QJDA 4V2CB 3QDJA 2B20A 3E1F1 2ED9A 3EJPA 1IM9A 4KO6A 1N0XH 4M62H 3BP6B 4UQIM 3WXWL 1LE5A 1YNLL 1OSZA 1QQDA 1XGRA 3FYEB 4K9EC 1XAUA 3B37A 1OK8A 4PY8J 3TTSA 4IRJD 4UILH 1U8QA 3UYRH 4X8GA 1FA4A 2D7TH 2KUTA 4NDMA 4PVNA 2IIJA 4N2EA 4FLHA 5BVJB 4NS0A 3QIBC 4P57B 2VO5A 4S1QL 2C1PB 1DQIA 2ZJSH 3O41A 4Y2NA 5L0QB 3LN5A 1A7QL 4AYBA 1BG1A 4YZWA 4N26A 1MFVA 4APQB 5IMLB 3OWRA 2EH8L 4EDXB 3W9DB 5TQ2H 1C9SA 2WBXA 3Q6GL 1A0QH 4W9CC 2QTVA 3QZPA 1U8PB 4Y19D 5G55A 4JDEA 3WFCH 1ILSA 4MZRA 5IMMA 4F20A 3EOTL 1SJEA 1J5CA 3IDYB 3VM5A 4O02H 2OL3L 1T1ZA 3ATFA 2WLHA 3RY5A 4NNXB 2UYLA 4DQOL 1QFOA 1AO7E 4FNPA 2GUOB 4PJ5E 3EHBD 2R0LL 3ZKXC 4WW2F 3UDWA 4NQCE 1GHFL 2YUXA 5BXFB 1U3YA 5KEZA 2IWGA 1DVZA 4N6QA 1AGDB 1JGVL 2FLMA 3RWHA 3DXAA 1IGIL 5GGRY 5KG9A 2CR0A 1XWVA 4AJYV 4FTVE 4HEME 5I1EH 1WBXA 1BJ8A 1ZT7B 2DV6A 3U9WA 3JWOL 2OTWB 1YMMA 4NRZB 4ODWA 3TBTA 1R34A 1XB8A 3O9WB 2XLLA 1FHGA 4HKBA 5L6YH 3CZEA 4AQ8A 3SBWC 3WKPA 4Z7WF 2BSED 1MCNA 3SIKA 1WUNT 5GQBA 3WN5A 3L3GB 1LO2H 4X5RA 9CGTA 2EE9A 4PLJD 4L23A 3O2DL 3I84A 4NX0A 3GRBA 5LN8A 3SYAA 1JXDA 2JJTC 5CP3H 3B9KC 3MKKA 4R4ND 3NIFF 2ICEA 1IAIM 2I32A 1KT2A 2FR4B 4XCFL 5CBAB 1G9NC 3U9PL 3ULSA 3WMQA 4N20A 1FYHB 4YXHH 4DPBX 4FQCH 1CXLA 1XZWA 4Y2LA 3U4EB 2AANA 1CDHA 2CGRH 1GIGL 1IQWL 3LHAA 1P5UC 3RDJA 1A1MA 2W0PA 1HINH 4FCHA 4P9HH 4M8QA 4L8SC 1JNHA 2NMSA 4WUUD 5EC2A 4JO3L 4LCUA 3O2VL 1OP5H 1EHNA 3MN8A 1NWPA 3DYOA 4XO5A 6PCYA 1X5IA 5DD3L 4AYSA 1X5ZA 4B9CA 4Q89A 4W6WB 4RFNC 1O6SA 3S6CA 2VIRA 3PAZA 1KXVA 2YA2A 5HI4D 1MDTA 2FCBA 3ETTA 4TTDC 1AG6A 5DC2A 1U8CA 4FXGB 2VABA 1J8HD 1R5IA 2UZPA 5FHAL 1TKWA 3BP7B 4JHWH 4I9WD 2D3JA 1KYUA 2WUCL 2H9GB 3E1ZA 2RH0A 4HGWA 4YHPB 2ZP8A 5F7UA 1A7BA 1E4HA 2A9ML 3G5ZB 3QG7H 3BUYA 4JJ5A 5HHVH 3FFCE 1TETL 2VLJB 5LGHH 4KWUA 4UDUB 2W9DL 1ZPLA 1EEZB 1F45A 1WE5A 1JWUA 3CHPA 4WTQA 2ZTBA 2XWBB 1JTPA 2WINA 5CEZE 4P46B 5BZDB 4JRYE 2GSIA 3B4NA 4BFGA 1B0RA 4R0LB 3GD1C 4B6ZA 2OMTB 5JDSA 4CUCA 5BVJA 5JIIA 1F8TH 3KYOA 4HUXB 5IR1A 3G08B 4JPVL 3GQFA 4X2UA 4Q6IB 3GUTB 2D8KA 3ET9F 5DRNA 3IETB 1TTFA 2AABL 1E9OA 1TVDA 4JY5H 4XHQA 4QRSB 4KU1A 4LMQE 3GSXB 2NX5E 4YR6A 5F0LB 3H2WA 4DGVH 1NGZB 1TEFA 1V8HA 3FQUA 4FNTA 2HT3D 4X7SH 5HI5C 2ENJA 3SDCA 4YDMA 3OXSA 4LSSH 3EJYC 3HUJF 4FJ6A 3TBSA 1NFKA 4PD4K 4ZW7A 1U9KA 4G5ZL 4DP1X 1J0HA 1NEUA 4OJFH 5LBSH 1DE4B 2IPTL 2O6PA 4XN5A 2ITFA 5IEHA 1MPAL 1ZCRA 4OFYD 1Q0YL 2OYKA 1I9RL 3TJPA 3DHPA 4JQIL 4WFFE 3KLQA 1AGDA 1MY5A 5B4MD 2I85A 1NDTA 3BZ4A 4U1HA 3ZE0F 4WFGE 4I0PD 4HDIA 4LBEA 3MRDB 2X9XA 1UD8A 2ZYRA 3PWPD 5LBVA 5DTFB 3IM1A 4DOHE 1A5FH 1W0YT 2VR5A 4MWFB 3APCA 3KJ4C 1OQXA 5KBMA 1Z9MA 4UOQA 3V79C 4LNRB 1EO8L 4LP5A 2CCLA 1AH1A 4JFPA 5DUPL 1N3NB 4HWZA 4N9OB 3MNDA 4XH2B 5ETUA 2CM5A 2QDWA 3TN0C 3LKPB 3CSTA 4LPUA 3S5YA 2Z92A 2BWQA 2YD9A 4ZO7A 4OZGB 1HDMB 3MLXH 4P3CH 2CK0H 2X0VA 4TVUA 5BRZA 2Q86A 4KHTH 4YIQB 4YWGL 4A04A 4ZFZA 1C8QA 3FQTA 1CR9H 3GRWL 4APXB 2Y3NA 4Z77B 4MGXA 3V8OA 4MA3A 3VVVA 3H6AA 4RESB 3FT2B 3DX8A 3RYMA 3SE8L 1J1XH 4RFOL 2DQEL 5CNHA 5INDB 1RVFH 3HN5A 4FQIH 4JR9L 5D7LE 4LP8A 3NCYS 1T7ZA 1JPEA 2F68X 3SKUD 1NL0L 4KXAA 4AXWB 1EEQA 1EXGA 1NEZA 4JQXA 4NHCH 3UOAB 4EEEA 5J1SC 5SX4H 2WMPA 4KMTL 2HVKA 4LIQL 1DZ0A 2ESVD 2QQKL 3HG3A 5TE4H 3EYQD 3TASA 1TQWA 1MCOL 2FGWH 2C3WA 3ESVF 1DN2A 4PWIA 4GJTB 3LRSA 4CC1A 2V3EA 1RSFA 2HRGA 3IS0X 4L5FL 3HMXA 2H2PC 1DBML 1ACYL 3ARQA 3NP4A 4PI0A 4AMKL 5C1MB 3H42L 5L88L 3O6FD 4EQ3A 5CD5D 5EORH 2X6BA 3T4AB 4FXGA 1DLHA 3EJTA 3APMA 4F7MA 3DTXA 4I77L 3DBXB 1J88A 4MX7B 5JPNC 4L1LA 2LLNA 4H13C 3JTTA 1NPUA 3VI4A 4G6KH 1D5RA 2Q7AA 4HULB 5JIPA 3TF4A 4JFXA 4ZFGH 1PEZA 4OLYL 3VXSD 4AM0Q 2YAFA 4BUGA 3ULUD 5FM4A 5EO1B 1CG9B 1V7MH 1OKEA 3GMNB 4Z5RA 5F3HA 5L4MA 1BGXL 4ZX5A 1VLXA 4ELMB 1ZA6B 2FT8A 3C5ZD 4GXVL 4DUWA 5HYSB 4WWKA 4ZUUA 1M7XA 1ROCA 5CZVL 5EOQH 3M1OA 5CSZA 4BINA 1RUAH 3UTQA 4A6YL 2YIHA 4E42A 4JEGB 3UEZA 3GUTA 3SZKC 4HP5A 3LPOA 3FRPA 2DQTH 4MXVE 5FM5O 1RSYA 3D4CA 5FW8A 3QQ3A 5IBUG 4U6HB 1VPOH 3V10A 4EI5B 3QEGL 4Y4FD 5DD6B 2IPUK 3WD5L 1NCBL 4D9RE 1WD8A 2QQLL 4YE4H 4ATWA 5F8QC 3SGKA 1K6QL 1IC4L 4M7KL 4U7SA 4E9WA 4DN4L 3LS5L 4FNLL 4PJ5B 1PG7W 1T2QL 4FLSA 5PAZA 2C26A 2MIZA 3CSYB 1DVFB 3PAUA 4F27A 4XMLL 4ZUWA 5BQDA 4PY7B 4M8VA 1OCRB 2WO2B 2VYRE 5I74B 4MMYA 3NCMA 1ZV2A 4IBSA 3VUAA 2EJ1A 3DX7B 3INUH 3CJJA 1INQA 5CN1A 5E1GA 5TFSH 4BFEA 7FABL 1EZLA 3CVHL 4FHKA 5E6IA 4JAMB 4DP2X 1Y18A 1GGIL 4TL4A 3V9CA 3QSKB 5D72L 1MF2L 1WT5C 1ZS8B 4ZOCA 3W37A 1RPUA 4J3OF 1Q0XH 1GYVA 2G5RA 3U30C 2EYSA 3QEQB 4PJGE 1R17A 1JS4A 4NKOB 4J3XA 2BRRL 5K39B 4HCIA 2YFOA 3QUGA 3B7SA 5IG7B 4PB9L 1GXEA 4ZUTB 2EC9U 1BZ7B 1RY7B 5IJVB 4HCFA 1BVLA 4NQDB 3GS7A 4PQXA 3X13B 4OR1A 1HDMA 1AJ7H 1BFTA 4KKAD 3GXUB 2XZQL 1A3LL 3IYLW 3PDOA 3MODL 5HJ3B 4GRMB 1HK6A 1A3RL 4MAYA 2NW2B 3U0TB 1T04A 4CJ1A 3E7JA 2ZUWA 3RWCA 5I16B 4TL5A 2D0HA 3SKOB 4Z76B 3PUUA 2A2QT 1WZ1L 1VEOA 3BKYH 4K3JL 5ESAB 5IQLA 5C0AB 4HIJB 3VGAB 3BSZA 5ICXA 4HUUA 1BW8A 3BEVA 2KH2B 5GSVB 4CADB 3BI9X 2GQHA 5F7AA 4ZNCD 2XTJC 4XMPH 1IFRA 1QASA 3UIZA 3U6XA 4A2GA 4FD0A 4OAWB 3T6ZA 1VZHA 3GGWB 4NWTH 4CGTA 5DFAA 1AD9B 5C7XL 5CFHA 1B4RA 3KEDA 1P53A 2R56L 1BF2A 3FPYA 5AD0B 5HYFA 2DY2A 5J56B 2TRHA 2R1WB 4P59H 4S1RL 3IWUA 1LHZA 2LTQB 1AXSA 2QGBA 5IHZA 5GZOA 3QRGH 3B56A 4GW4B 5J9PB 1HYSD 1MJ8H 4GRWF 1L7IL 5ALCH 1B4JH 2X0UA 4O2FB 1UACH 2OJZH 2PCYA 3T6QC 3MUZ1 4D9QD 1TU2A 2VDLH 4PJXE 1GYWA 2BSTB 1NAMH 1NCWL 4FQLL 1XZ0B 4JGJA 1UB6B 3DMMB 3I50L 5EO1A 2XN9E 5F7LB 1U58B 4Q9QH 4DCQB 3KWWB 3OHMB 3MRBB 2Y7QB 1H3PH 2ZCLH 4G7QB 3TT1H 3TA3D 1N4XH 3RVUD 4FG6C 3TONA 2LAGB 4LCIL 3HNSL 4XCEB 5F93C 1BXXA 3PWJB 2GSGA 4AIEA 1QACA 3TEWA 3I3BA 3M86A 3I6KA 3CNKA 4UF7C 1E90A 4YHNB 5C3LD 5DJDA 2BSBA 1OW0C 5EF3A 4U6HA 2K1MA 5E2WH 1AOHA 1G6RL 2NX5B 3HB3C 5A2IH 4CDHA 1XCTB 2G2RA 4B95C 4QTIL 4PIRF 4M6AA 2L4OA 5I26A 4BEIA 2PPCA 2BNQD 2P5WB 1FFPA 3RIFF 1WAEA 2I9TA 1FSKC 4NP4H 1NFIA 1PZSA 3FKUS 5DEFB 1AO7A 2V5MA 3PGDA 4PJ5A 1TPXC 3MVSA 5CP7A 5GS0C 2J4WL 3UTSD 3U4BH 3IF1B 5IQNA 2EDTA 1J9RA 3K80A 4HV8A 4JY4B 4NQCA 4DGYH 4AOFA 1LK2B 2W07B 4H8VA 5DZNA 3PL6A 2AP2A 3O6KH 1R3IL 5GRZA 5GZND 3BW9A 1C1EL 4HFUL 4UT6H 3TBYB 3QDGD 2EZ0D 2ZYHA 2G3ZA 2VDRB 1W0VA 3MRCB 2JKXA 4LAQH 3DX7A 1TEYA 5JORA 4NP9A 4YSAA 4CILA 1PZUB 4FTVA 4HEMA 1RUPL 5TE6H 2XN2A 4JO8A 1LYQA 5D7JD 5ABDE 1ZDSA 4IRJB 3O6LH 1QI3A 4XNBA 3RNKA 3NA9L 2JFCA 1V55B 2ZYSA 3QWRD 5I73C 5JMOC 3ZR5A 4U7MA 4JFSA 3GHBH 4X9BA 3RFZA 3QI9D 1UOWA 4K23L 5E23A 5DQ9A 5E9DB 5J12C 1L0QA 3EFDH 3RVWD 3SO3C 4F7KA 5E08L 4PFEA 4AGNA 2EE6A 1I8MB 3BCFA 3L17A 3I02A 4PRHD 2M8XA 3KH3A 4WLCA 3WJMA 2FBJH 1UOVA 2HJKB 4KAQL 4AQAB 4Y19B 4IIQC 4Q14A 3IXTB 4WEUD 1Y1DA 2B3IA 4NSKB 4YK4C 4OZIB 4YGAB 4AV5A 2GKIA 2VITA 4EVNA 1MCWW 1MHPL 2HVJB 5A2JH 1PAZA 3E38A 5IT2H 1G7LA 2M1KA 4TVPE 2KKQA 3QVAA 5GS3A 2VLKE 4F24A 4PHXA 8FABB 3IKKA 1FGNH 4LEOB 3MA9L 5D7LB 3EYUL 3UYOD 4L4TD 5ESAA 4MQ7B 5KW9L 3L7FB 5EOTB 4YUEH 4ZRGA 5F71A 3VQ2C 2X53A 3A3YB 2AV7A 4N2KA 3IGKA 3VI4F 1NIEA 3OJMB 2BP3A 3KLAA 2VXQH 3MCKB 4PMFA 2WLKA 4OFIA 3ZW3A 3L4YA 1WISA 2GJ6D 5BJTA 4R4BB 4F2ME 2ICCA 5LWYH 2BVOB 4D0CB 3MNMA 4J5VA 2WPGA 5F7MC 4FYTA 5D71L 4G8GE 4S2SA 5LCVA 1AKJD 2X5PA 2DQDH 4DN3H 2D73A 1OIOA 3FFCA 1NBCA 4PJ9A 1MDAA 4I2XB 2BIQA 2AFNA 15C8L 1MRFL 5HGBA 4GIOA 3O81A 1HZHL 4HLJA 1KV3A 2DQGL 4NN6C 3V5KA 2OYLA 2Y2WA 4JRYA 3VWJC 2OMXB 2PW2A 2YPKB 3LQAC 5DLML 4PGDA 5EN3A 1SF3A 1S6NA 1UKTA 3LEVH 3JV0A 1RURL 2E59A 3AM8A 2Z65C 3H4HA 1V3LA 4LCVA 2YA1A 3GMOB 1EDQA 4XPTL 2VQ4A 4YHNA 1HE8A 4F9PC 2CQVA 7TAAA 3DROA 2I9LA 2HA1A 3LS4L 4ISVA 5F7NC 1PS3A 3BQUA 6PAZA 1AMYA 5ICZA 2JWYA 4IBWA 4RSVA 3WFDH 4ALAH 1IAKB 1KCKA 1QEXA 3S88L 4BRVA 1UJ3C 1Q1JL 2HYMA 3V5HA 1T6VN 1RZ8B 1JK9A 5KVDH 5IIEB 5DQJB 4NUGH 4LRNL 3LKNB 2LVCA 5JHLH 1RI8A 3MXWL 4DO4A 3I6GA 2W38A 2H8PB 1CICC 4M1CC 4JG1L 3U36B 1VKXA 2FT6A 2QADD 2BS9A 1LJMA 5HYJD 3Q2WA 3WIHA 1WFOA 3IDMB 3UACA 3FT3B 5J8OA 1IBGH 2CKBH 1XD1A 2AJSH 2Y6SD 4TQIA 1N18A 3HR5A 5A6LA 3BAJA 1RZ7L 4KKBD 5BZWB 2X6UA 4LVNB 1U3HC 1KIUB 3N41F 2ADFL 2FEJA 3D1MC 1V27A 1S3KL 4Y5YA 4AQ1C 4X8JA 3WNLA 3LKSA 2J7LA 3K46A 3HAEB 5C0JB 1T4WA 4HEPG 5GXBB 5FOBA 3KCPA 3P0YL 4U0RC 3U25A 5CLWA 1S7WB 4QUOA 2PR4L 1E8WA 1LO3H 4HC1H 5HDQH 3S34H 1KBBA 1XSKA 3TO2A 5ERWB 1QFHA 1VESA 3RKDD 1KC5L 1KBVA 4KI5C 4AIXA 2HJKA 3KPMA 5FYJU 5C3TA 1H9VA 3HE6C 4E9RA 1SOKA 4XB3A 4AZ8A 1J1OH 2Z1KA 3AMLA 3O3AB 4MS8C 3EFOA 4P2QE 4Q9BA 4WZ9A 3UZQB 1G7MB 3BKMH 4Z23A 4M61A 4GIPD 4AYID 1KCWA 4ZXBA 1QWHA 1PSKL 1DR9A 4M93C 2YEZB 2ICWA 3ZRSA 2F7IA 1L3WA 4G70B 5D7LA 3SJVD 4BQBA 4YSDA 2WYZA 5BUPA 5I5RA 3IRCA 4E9LA 3BN3B 2AKRB 1MWAH 1MVUB 3NABL 4MRCA 4MMXC 3NZHL 2UZYB 1I7TB 2KDGA 4I0PB 5F3BA 2AJXH 3SQBA 3HG0A 1HEHC 2B9BA 2OR8A 2UY6B 3L4XA 3OR6A 5AENA 2LT9A 1U33A 3FUNA 1VF5C 2E7BA 3MLUH 4OGYH 3EADA 3H7BA 2ERJC 1CD0A 2L8AA 3WNIA 3VDBA 2IMMA 4LVHC 2PUQT 2BVOA 4R84A 2DWSA 2GY7B 3POHA 2DD8L 4IRZL 3K91A 4X4YA 1FG2A 4ZS7L 1F97A 3SGJA 2ZX5A 2Q8AL 2DI8A 3QUKB 3WKMH 4H88L 4WIQA 3DJ9A 2VN7A 4QY8A 3KR3H 3DUUB 1EJOH 2VDPL 2D4FA 5AYTA 5FK9B 1ZLUH 2AV1B 4UQ3B 3R0NA 5H35B 4Z7NB 5LHDA 2YPKA 3JWDH 1LEIA 3D9AL 3SPJA 3CX5K 1EFXD 3EFFB 5JOPD 3P30L 1AS7A 2YBRB 4DAGL 4OGQC 3LDBC 4K7PL 1NGPL 4LLDA 4RCAA 1ITBB 4OM0H 1NIBA 3N9GL 1OCOB 3H2PA 2EEDA 1YA5A 4X4ZA 2RBLA 1EHXA 3QYCA 4HG4J 5HYSG 3C60B 1NFDB 2Z91B 1CZ8H 4YSQA 3B6SB 5EC1A 1SUJA 1PLGH 3V0AC 3FNKA 3UH8A 1PG7X 2EDEA 4WU5A 1MEXH 3EH2A 3O6FB 3ZMRA 2VMJA 3S9DB 1I85A 2YSSB 4L3CA 3BT2L 1J9TA 1KCVH 1ULVA 2DQFA 1YY9C 2R9HC 3K2IA 4NIKB 2OXGA 3L5WB 2HJLA 2X7LA 5JTWA 1JYNA 3RB5A 5D2LB 2CO2A 4WGVB 2DKUA 4UT9H 2HT2D 3O4OC 1TJGL 3DSNA 4I1RA 4JHZA 5FR3A 5SX4I 2AEOA 4JFFE 4NNPL 4ETQA 3VXSB 5J1AB 4QHUB 5DVKA 3EO9H 4MQTB 4ZAKC 4BA8A 2F2HA 4M03A 4PRAA 5CSBA 1KIUA 3GMPA 3SCMA 2YHGA 2XFXA 4P04A 3B5TA 1WGVA 2O93L 3F7KA 5M95B 2WZPA 5LVEA 2FLBT 2D31B 3LJ3A 4PJGA 4GG8B 1UB5A 4YBLC 5CEYA 2YUVA 3SODB 2ZSWB 3HZVA 2VXVL 5F9DC 1AGCB 3HZMB 3IMUA 2VWEE 1A7PH 4NQEE 3V6FB 3BWSA 1TITA 1P7BA 1I3VA 4LSPL 5DVPA 3EYSH 1QSEB 3CPUA 3QUMB 1CT8B 1GW6A 5IMOB 4X5XB 5CP3A 3GJFB 1F6LL 1TCRA 4YXKL 4Y4FB 5C0RH 3QFJD 4YHLL 4Q8BA 1NUGA 1FFNB 5DS8A 2OMVA 4ZQTA 1YYLH 1XIWB 5DD0H 3IMBA 4YE0A 1TSHA 3HMWL 1G7MA 5GGRB 5MHSE 2PP9A 3BIBX 1J1PL 3LMJL 5GS1A 4JHAL 3K71A 4YSCA 4UDTA 4C4UA 3SDYH 1U8MB 4OU3A 4BM7A 5IREA 5B1KA 2N7AA 1I8UA 1EEYA 3BDXA 1OPOA 1OP3H 3B43A 2HUHA 4AW4A 4S11A 3DO7B 3ZYOA 4ZMNA 1RFDL 3ARBB 1P2CA 3PV6B 1A14L 1RHHB 1YEFL 2YQGA 4KK5C 5I0DA 1HEZA 1WHOA 4NC1C 5AVSB 4K7FB 2C9SA 4RAVB 1PZBA 3HJ0A 4AIZA 1T83C 2L7JA 2DICA 2ZOOA 1EV2E 4JZOA 4PSRA 3ZT7A 3KXFB 1UXWA 2PXYA 3WFBH 1W8EA 4IRSC 2EVFA 4GQ9L 3ML9A 4BZ1H 3OLDA 1KYDA 1KN4H 3QIBD 5E95B 1NUNB 1SY6L 4PJXA 3S3SA 3VCLB 4DK6A 5IHBA 3GTTA 3F6JA 4JANB 5IMKB 1YYML 3VXRE 2XN9A 5I0WA 3AQDA 3D50A 3G04A 1AE6L 1F90L 2XXFA 2ZUYA 4DKEL 5DSCB 4RBPH 3NAAL 3VW3H 5J13C 5GHWH 4ZYKB 4NQXB 4CRPA 2OX5B 4TF4A 1XB6A 3CZUB 4ZK8A 2G4GA 2P44B 1YN7A 3MRQB 3QQ4B 3FFOA 3BH8B 3FH7A 3FSWA 1JGDA 1BSIA 4MD0A 1L7TL 3VFWA 3FQ4A 2VMCA 1E9PB 5KVDE 3E6HA 1JFHA 1G9ML 4J4PA 2L7QA 2X6MA 3UADA 3A24A 1BD2D 1SQMA 2IFFH 4N8CH 2YSSA 5LBSA 3KYNB 3T8XB 3CH1B 1S7TA 1WA1X 3QPQC 1I75A 1K5NA 1JTTA 4IGBB 3OHXC 1P4LB 3AXHA 3OKNB 5GS2D 3VFMB 3C5SA 1FZOA 3I9GH 2EDQA 3B34A 3GSVB 3ZDZB 5EOCH 1DYZA 5D7KE 5J1AA 2JK5A 4W9FC 1N6UA 3ATBA 1X9QA 5FB8B 4PV9A 1N5YL 4RSYA 1XB3A 1NMCB 3P11L 2H1PL 4LSVH 4ECNA 5AL0A 4ZPVB 5FO2A 4PLOB 3W2DL 4DQAA 1AC6A 4PB0L 2XG4B 3QIWC 2AK4B 2B15A 4XWGH 4JO1L 4QRQB 1FV1B 1XL6A 4J3TA 5A2FA 3RURA 2D31A 3B9KD 3U4KA 5ICYB 5F88B 3EG9B 1ZLSL 2JB5L 4YC2B 3ZDXB 4UINL 4YLBA 1ZHBA 4JFDA 2O5ZL 2W65A 4X7EC 4X5XA 3KBHE 4XBMA 4XOEA 2VE6A 5GSRA 3O8XB 2VLRE 3NRQA 3RY6A 3QNYA 3V52L 1A7OH 1R0AH 3BIKA 3OD3A 2QDVA 3S35X 3H9SD 4KZDH 1D5ZB 2FWSA 1RZKL 3MUGA 1XEDA 2AXHA 4KTDL 4LARL 5GGRA 3CC5B 1CN4A 2ZKHH 2P5EE 2Z35B 4PJCB 1I8LA 1NDMB 2YJQA 4R90H 4PTUB 2VLKA 2WXRA 3FO1A 4P5SA 3UPRA 2A74C 3H0TB 3GK8H 3RG1C 1XCWA 2F53E 3EF4A 3NUKA 3GO1L 3QJXA 1KEML 3V4PA 5A40E 4XVJL 1YEDA 1WWAX 3VXTB 3RFRA 1MFEL 3QWNA 3VTMA 4MHHG 1KBGL 4O4YH 3IE9A 3PV6A 1FRGL 5D1QC 5D7JB 2NXYD 5C07E 3GSUA 4WEBL 5TD4A 3ESNA 3NIDE 3L3KA 1FNGB 2E75C 4LSRH 4F2MA 2FZ3A 3X1EA 5BV7C 3MCLH 3QI9B 3X14A 3BO8A 2X6VA 4Q52A 5D7IE 1TTGA 1CU4H 2MKWA 4G8GA 4QHPA 3VXUB 3DGGA 1TLKA 4M1GH 1TZAA 4PRNB 4PRHB 3OKEA 2V2TA 3U82B 2PO6A 5AW0B 2G3MA 4XC1L 2Y36H 4YLQT 3BJLA 3RUGE 3GXIA 5I1AA 4YO0B 4HOMA 4MXVF 1PVHA 2CIIA 3NGBB 4X7TB 4XT1C 4PJ7E 5D1ZD 3IDGB 3N0AA 2Y0SA 1FJ1A 4NUMA 3KL0A 1GGCL 3JV4A 5JLZA 2O5XL 1G5GA 1UGKA 3PPEA 2Z31C 3N3EA 3WO3B 1AQDB 2EDRA 4CKQA 2CHDA 2D7NA 4WKZA 3AJ7A 7PCYA 1CBVH 2IAMA 3LD8C 4HFWA 1UZ6E 2YKLH 4JFHE 5HI5D 4DERA 1IT9H 1OGAE 4WY7H 1TJMA 3EJYD 4L4TB 2CDFB 2UXTA 4XO3A 2EDXA 3UO1L 1JZEA 1O7DC 5EBMA 1BCIA 2JJVA 3QQ4A 4JPQA 4NUJA 1MHHB 2GTQA 2D3NA 3GXDA 1D5XB 2PCXA 4H8WH 4HIPA 5J0BA 5L2KD 1H19A 5I15H 3HHMA 4QXVA 1CD9B 1OCWL 2CA3A 2ZUSA 4GINA 5FM5M 1IIKA 4PRID 1J8KA 2P7TB 3T0DA 5EU5A 2Y1YA 3TIDB 3VFVB 4IGBA 1P4LA 3BE1H 2ZG2A 2JB6A 1FP5A 1W6LA 5J4MA 3N6YA 1LEGA 5CINH 2FSEA 4JO2H 3NJXA 4FQXA 4R83A 2A9CA 1E5CA 4XMZA 2COQA 2BPBA 3MBEC 2RIKA 3PQYD 3KWXA 3NCCB 1UKSA 1BQHA 4NYLA 4ZPVA 3S96A 1BLNB 2ATPA 2A9NL 5J5EA 4ZFFB 4QRQA 4UU9B 2XXCB 3ZO0A 3U79A 4GH7B 4NZDA 4LKCA 4BCZA 1NBZB 1G7PA 1I53A 4A1RA 5KSAB 1ID2A 4KUZH 3RWJB 1MJ7L 5SWZD 4FQ1H 3O6ML 3BZ5A 5I5IA 2E7CA 5B8CB 3HAEG 2JTYA 3B7TA 3O8XA 3OSKA 4EDWL 5KSVB 3FU7A 4TLSA 3DX3A 2E7LA 2MPVA 3L3OB 5FO8A 4ANVA 1HTYA 2KHAA 4P2QA 1XO8A 2Z35A 3Q44A 4UYQA 4XC3L 1URIA 3D2UD 1B0IA 4X99B 3X1GA 4P2OA 1QRND 2FTAA 2H2PD 2NDGA 3V6ZA 3TYGL 3WUZA 2EXYC 2IALB 5GRUH 2VDMH 4HSAC 5HHNB 3ARTA 1SXZA 3L4CA 2AHIA 3FBKA 4F57H 5GGVY 3GLAA 4FQQB 4PGBB 3V4VA 3HZKB 3QO0B 2E74C 3VXTA 4CL7A 1I9IH 1GTNA 1QR1B 1G7QA 5FYJE 1X5YA 1NBYB 4KZCA 1EIBA 5FUCE 3CFJA 4W9DC 3MRKB 1UOLA 3L54A 2CLRA 2NW3A 3BGAA 1MCEA 2VDNL 4GEJA 4RISL 1X5LA 4Z7NF 3HEIB 3ABMB 5DD1H 5EFIA 4AV0A 1GC1H 3MGTB 2WXOA 3OG6B 4KY1H 4HWEH 2WD0A 2VXTH 4ODXB 3MRLA 4G6FD 5BS0E 4F37K 3OKMB 4M6OL 1IZJA 3NQIA 2CA4A 4R7DB 5DZ9A 3SDXB 1LP9E 1KJVB 4C83B 5KANG 4WWOA 1KELH 5LKNA 4LOUD 2ROXA 1P7QD 3A22A 1YEIL 3C6LA 3DVNB 4X7TA 3LPFA 4ZX6A 3RGVC 1AVAA 3KW8A 2X4SB 3ZE1E 4P3DA 2YGVA 1AXTH 1XHHA 1KN2L 1CGYA 4AQEA 2R0KH 3M8OH 2DLHA 3WNJA 5CBEA 3WELA 1R1CA 2AGJL 3IDJB 4ATTA 5C0FA 1PJWA 2IBBA 3I85A 1JI1A 4Y5XA 1OM3L 3SJVB 2X3BA 3JT0A 1HILB 4PD4J 5F97E 5D2LF 3VO0A 1I9EA 4YS4A 4UTCA 1HWHB 5K9JL 1IFHL 1PD6A 4XBGA 5C0CE 2DWXA 3ML8A 3Q2LA 5DK0A 3T04D 5IQOA 1HHJA 3CXFA 4U1JB 3OV6A 2WWKT 3S8FB 3DGCR 1WTGT 5FA4B 5HGAB 1QLEB 2YAHA 3EH4B 3FB6A 4Y4KC 1NPJA 4MCYB 4BSVA 1SLXA 4BHUI 4DWHA 3CLFL 3O4LD 5F1IB 1KNOA 1OANA 4JFFA 1AFVH 3A67H 1R24B 5D93C 2NY5C 3T2PA 1S9YB 1KTJA 2ZOLB 1WA2X 3DV6A 1I8IA 2JKTM 4GOSA 3TZVC 1FYTD 2G2PA 3CHQA 3PJLA 2XRAL 4P5TC 2FECI 2X2HA 1MLBB 4QLWA 3VWKC 1K2DB 1ADWA 1A6UL 3BD5A 2W9EL 1PKQB 5INCB 1QNZH 3RTQC 1KJ2H 5I76A 4HH9A 4G8FA 4O00A 4DGWC 2UXVA 2BIOA 5A2BA 4NQEA 4MJIE 5A2KH 1JTOA 3WTWA 1U4FA 5DXWA 3V0VA 1UYWH 1P4BH 4GUPB 3BISA 4PVLA 2F6AA 4XX1E 3UAEA 2WP3T 4M43L 3U9UB 2KQMA 1KBWA 3G6JB 4NT6B 4HHWA 3VG0L 3HG5A 2P43B 1A9VA 4G1MA 4LPCA 4N0YL 4UUJB 4OT1H 4HPOH 3MRRA 5I30H 2FD6H 4LSQL 5IKCA 3UMNA 2VZSA 5IW6B 3KW7A 5DHDA 5F7EH 2XTJD 3WLBA 1HJBC 1BDYA 1CCZA 1G1YA 1ZSDA 3HC3H 1TENA 2IALA 2P8PB 2X1XR 43CAB 4ZTPL 2EUXA 5I71B 1FVEB 2FK9A 4R8WL 4GSQA 4UQ9A 2LU5A 1IKNC 4AH2A 1FC1A 3FN3A 3HMXL 5KUMA 1UXSB 1YEGH 1TNNA 2H3NB 2NY2C 3SE9H 4R96B 3IJ9A 2Y2YA 4JDTL 4LDLB 1KCSH 5C07B 2CHWA 4KQ4L 2W81C 3LV3B 2AVFA 2F19H 5D1XC 1FFRA 3NJJA 3MREA 3GZPA 4XI5D 1PZCA 2BJML 4Y2OB 4YAQA 3OKLB 2WIIB 4JM2B 2IH1A 5AVZB 1CIDA 5D7IB 5I19L 4BK5A 4OCYL 5IEKB 5MENB 3OGOE 3CZKA 3OKMA 3ZZSA 2VSDA 5C0EA 4L8CB 3GKZA 2J8OA 3GMLA 1SYSB 4R7DA 2NY1B 4Y88A 2DBLL 4FG6D 3MFFB 1XGQB 3MLYL 4N0FA 2EEAA 3DVNA 5HDBB 5K9KA 1FAIH 4LEEA 4NLHA 4HS3B 4Y4HA 3VXRA 2D3LA 4D0DA 3ULVE 3HAEH 2P42B 1AGEA 1F4XH 3P4OB 4RGNC 5A7BA 4ENEC 2I5YH 2X4SA 3QUXC 3Q6FB 1D7BA 3MRPA 4UV7H 3UG3A 1MAJA 1QBMH 3MJ9H 2D03L 4LL1A 4ZTOH 2FQDA 2WAHA 2OJEB 3RWFB 1OB0A 1UQSA 3QUYC 4HPYH 4KVNH 4Z3EA 3LKRB 4I5BB 2C4FT 4Q9RL 1DJGA 3C8KB 5GS0D 2Z93B 3TU6A 4AK2A 2EDBA 1AI1L 2DF3A 3OKOA 3LXUX 3ZDZF 3IPFA 4XVSL 1D5IH 1F00I 5JHLA 3BGMA 4G43B 4A68A 1R3JA 1XTMA 3JZYA 4ADJA 1ZVNA 4BKTC 1QYGH 2E27L 3WJLC 2FJFB 1KTLB 2W80C 3QWOA 1M42A 1NM4A 1BXAA 4JFYB 2GTZA 2CKBA 2GIMA 4G1EB 2X10A 3AU1A 3TNMB 3ZDXF 4MJHA 3LN9A 2FSDA 4FG4A 3Q1EA 4CJ0A 1S9YA 2XVGA 4LZKA 3V9EA 2DWDB 3KPOA 4I88A 3ARUA 5J6SA 4DZBA 3SDAD 1KDIA 3H9ZA 3FU6A 2K3HA 4HWBH 5DMGC 2YMXH 3SPVA 3V7AG 4MD5A 2AAVA 1Q94B 4LLUB 2WWNA 5AALA 1KEGH 5KVEE 3RIAK 2F5AH 2XIIA 3W0WD 5T3XD 2RCSL 4HC1A 4QT5B 1NCIA 2LLLA 5IWLA 3TVMA 4WF7A 4CN6A 4KRPC 5DWPA 4MNQE 5E2TH 3T3PE 2FVNA 4I3SL 2WCSA 4NJ9L 2VLRA 4RGOH 3ZKXB 5JR1L 3WHXB 1B3JA 1BX2A 1D9KC 4OZHB 1PX8A 4OY9A 3WE1A 4JPWH 1BD2B 2LU7A 2P5EA 1CK0L 1DBJH 5EUOE 5F9WC 2GT9A 1NGYB 3BLKA 3PLYA 1QPKA 4MLIA 2CLZB 4FXLA 3WNOA 3KPNB 4LKXA 4X5WB 1MWAA 2F53A 2PPFA 1U6AL 4LVOC 3BSZL 3K2UH 2VR8A 1WS8A 3O3BB 1GOGA 4HT1H 3BKJH 3FN0H 4OSUH 3T0EC 4WV1C 2H3NA 2W0LA 2DWEB 2OMYA 3E8UL 2I26N 2OKMA 4LPYA 1UXLA 2X4UB 1GY1A 1HSBA 1E4WH 2BS8A 3HI6H 4WW2C 1BQKA 1Z32X 5KYUA 3CBKB 3LVEA 1XH3B 3B9KB 5LN4A 2AEQL 3U0WH 5LAXA 5D7IA 1A2YB 2OCCB 2EO9A 4IOSD 1YSOA 4C54A 3VWJD 5E4EC 2V5TA 3FHEA 3OSVA 2VSKB 5KVMC 3IDIB 4W9LC 4FKKA 3ULUH 1P5UB 3RUGA 1LP9B 5K33A 5I0ZA 3L7EA 2Q7YB 5EU7C 2GBUA 3ARPA 4L8SB 3BUDA 1FN4A 4PJ7A 1MREL 3WO4C 3FTGA 5MEQA 2WSPA 3Q6FA 3ZE1B 1ZE3H 2VN5A 3OG4B 4Y7MA 5KYWA 5I6NA 1HI6B 3VGFA 2CUHA 3VTTA 3R06A 3ZN6A 2C7FA 3RWFA 1OGAA 4FG2A 5D5ME 3N85H 3LKRA 1SVBA 1RULH 3EJQA 2EIJB 2DLGA 2Y07H 3EO0B 5D6DC 5C09E 4Y9GA 2FB4L 5DT1L 1NBVH 1GGUA 3DRQB 2IAND 1CICD 4M1CD 5JA9A 5GISL 1NCNA 1S7SB 3D12B 3G6DH 2O72A 4EXPX 3C6SB 1D7CA 2JV6A 1H3VA 1E7VA 4JB9H 5BVPH 1S46A 9PCYA 2NNCA 1OY3B 5HDRA 1HZKA 1B9KA 2BVUA 4YPGA 5I17A 5AW2B 4XCYB 4GAYB 2C9PA 5HY9A 3ARFC 4XNAA 4AYMC 1U3HD 2JQZA 4Z7QE 1JHTA 4HCRH 1FNSL 2SEBB 2GUYA 4LGPB 2P8LB 4M1DL 1KB5H 3WFHA 3L95B 4FZEH 3A6OA 1KFAH 2FIKA 1KCLA 4UMGA 3HFML 4HJEA 1C16A 2LU3A 1FZJB 3CFBB 4QRRE 4QYOA 4X4ME 1Q0EA 2ZOTA 3MV7E 4KI5D 1RZPA 4GS7B 2IADB 1HQRA 3H8NA 3HE6D 4ABUA 4JFOA 1A25A 5FPIA 4HD5A 2MNUA 1B2WH 4MS8D 5I9QC 3PWNB 3UIYA 3CDZB 4MJIB 4ONGL 3T4YB 5T5FH 3CBRA 1XF2B 1AZNA 2G9HB 4PS4H 3OB0H 1JPSH 2J43A 5IBLC 1XR9A 4Y1AE 3IGUA 5FKPA 5E1HB 3IU4L 1JZ2A 5DU7A 4ZO8A 3MO1A 1S9VA 2R4RH 1T1WA 5DEJA 1G9MC 2Q0ZX 2ZUVA 3P9LB 1SDDA 3ESUF 2KQNA 3ROOA 2CLZA 4U7KA 2NT1A 3KJ4B 3AWEA 2ZAHA 2NY4C 5KOVC 2J73A 2JI1A 2CJTA 3OXRA 5I6PA 4OI8A 2Y24A 1DBAH 3FB5A 3O0LA 3ARSA 3PQYB 1J8HE 2YQBA 4G6MH 4I9WE 4I48B 3V0JA 2M83A 3VNYA 3W57A 3SDXF 1MG2C 4WJ5A 2CR6A 4ADGA 2JH2A 3V0WH 1NC4A 2C4XA 3TN0B 1DDHA 3OKKB 5AW1B 5LCVL 4M7LH 4WI7A 2VRKA 2OR9L 5GRYA 2YWYA 5BS0A 3M17B 4BZ1A 3RDTA 2RB8A 1F4YL 2RFXB 4G9DA 4OCMC 1IGML 2XTSA 4EIBA 4F93B 4KJYA 1TZIB 1LP9A 2HX7A 5CEZL 4BDVB 4TNGA 4HUKB 2DEYX 1PQZB 4HBCL 3U1SH 4HKXB 3BXNA 4ELKA 2AJZB 3LKOA 2NPLX 2VN3A 4OD2B 1DQML 1RZKC 3RA7L 4PGEB 3D39D 5ANME 1SOQA 4G7RB 5CMAA 3VH8B 4PCKA 4WKXA 5FFOA 5EZOH 1PW3A 4POUB 5JA8B 5T1LD 4LHUB 3WDJA 5AW8B 4LLQA 1YY9D 2R9HD 4BUHA 2O5YL 2OBGA 5BO1H 4GO8A 2YK1L 3ASOB 1QO3A 3F58L 4WFHE 2VH5H 5C6WH 5ESQA 5C0CA 4NZ8A 5ECGA 5JHAA 4Q74A 2V9RA 4WNQB 4FGMA 4G80B 4ODTH 3FQ1A 2NTFA 2HWZH 3NRPA 1ED3A 4KZ0A 4ZAKD 4XNZB 4WEMB 3MV01 4UYPA 3WBDA 3MLVH 4ANKA 2JXMB 5TGBB 5HYQA 4GPVA 3R7QA 1YC7A 2ZT9C 3PGCB 3R1GH 3WIHL 2EO7A 4EJ1C 3PWPE 1SM3H 3S37X 3Q8BA 1UZGA 2GC7C 2SEBA 4N1EA 3FF8A 1J05A 4MDJB 1G9EA 2IMNA 1ICTA 5JHDB 1P7QB 2YN5A 3QQDA 3K6NA 1GS7A 2C34A 4JVPA 3UTOA 4OIBA 3G6JF 5FYKD 1RK7A 3L3DA 2AQTA 1TZOA 2WC7A 5E8EA 4PGJA 3CZLA 4B9YA 2ZIDA 3KH4A 4IK6A 4H1LB 2ZP0T 2R23A 1K72A 2AI0H 5EZPA 3PJSB 5FDYA 1RZIB 1AQHA 2HSIA 3EGDB 3KAAA 4MDIB 4MJIA 3ABZA 2WNWA 1E3ZA 2V2XB 1CFTB 4NQVA 2L3BA 4OLVL 2G9HA 3I9IA 3IFOB 2PWDA 4FQJH 3VI3B 5IGXL 4QR7A 1BFVH 3SSGA 3PGFL 2A6KB 3OC5A 4PCYA 5F6IC 3UTZA 4BIKA 3GBMH 2R29H 3TCTA 5H2BB 3ZKMC 3WG7B 2O30A 4H20H 1EUTA 1JIBA 3FOMA 1KCUL 4N90E 3PHOB 1RK0A 3UAJC 2CRYA 3FCTB 4PM1A 2ISDA 1KF9B 3THML 4CU6A 5LNGA 2B16A 3U7YL 3ME0A 3NIDF 3QAZC 4L1SA 4KK5D 3VXOA 3OAYH 2NQDA 4AWJC 1PJ9A 4JM2F 3BH9B 5E2JA 3U30B 5D7IF 3N44B 4FNRA 3LXCA 1RMFL 2X9WA 2BX5A 4L8BA 1OWWA 3BQVA 1BLIA 4W1TA 4AC2A 4IRSD 1OARH 1IAOA 4EUPA 1PF3A 1T0MB 3IDUA 4M7ZC 4XRCB 1TT6A 2VL5B 2J8UE 5EO0A 2YBGA 4GUCA 4KBPA 3Q2CA 5CZKA 2BCMA 7PAZA 4MHHI 1BOGB 4AQ8C 5C0BE 3K1KC 3CQQA 3WUWA 3QGVA 2A4CA 2XV0A 3WNMA 3RJQB 1KLFA 5IV2A 3T1FB 1P1ZA 4M62L 3L9RB 1E40A 1JN6A 4EN3C 1NMAH 2OR7A 3ULUE 3N04A 2W5PA 4U1IA 1UZ6F 4PREB 1F4AA 4FN0A 1H6EA 2YXWA 4UILL 3G5XA 4BDVA 5AVWB 1Q9LA 4U05A 4J3OC 1ZHLB 4WSJA 3AUWB 3TYFB 2ICEC 1M1SA 1MHEB 4CVXA 1UD2A 3C2AH 4IYKA 3WHE0 4YFEA 4WUKH 3BKCH 2ZJSL 1CPUA 4XAWL 2VGLM 1LE9A 4PJIB 4XB8A 1UH4A 1OT4A 1C5BL 4FLOA 3EGSB 5BRPA 4ACTA 3DO4A 1A0QL 1P6AB 3JV6B 1D3CA 5C8JB 5C09B 4LHUA 2Y7LA 8PAZA 4JO4L 4QAWA 3NN8B 4JZNB 4GSRA 2H0FA 1KPVB 2H6PB 4MJ4A 2QSTA 1GR7A 3QPQD 4WW1A 4YX2H 5HGGS 5FO7B 1AGBB 2GFBB 2YGNA 5J89A 5D6CA 2Q2LA 3JWNG 4WCYH 4AGMA 1IBYA 2VLMD 3LOWA 2FATH 4ODUB 3RX5A 2X1WL 1J0KA 4KO5A 1Z5LA 3TT3H 3UX9B 2VJ8A 4Z7QB 3QIWD 2K3TA 3LIZH 4XOBA 2FO4B 4K8RD 3VA2C 1M6UA 1LMKA 2WQAA 3G5WA 1T7XA 4KK6C 4MDJA 4ZO9A 3V4UL 1WIOA 1U8OB 1J12A 5JO5A 4QXWA 2VO8A 5L6YL 2DIAA 3RGBA 1EJ6A 1W8NA 1KYAA 3LNHA 3CFKA 1IM3A 4LSUH 1MFBH 4EI6A 3HB3B 1B88A 1S7RA 3QDMD 2J5WA 3LTVA 2YAOA 3T77A 1ETZA 5L0QC 3DV4A 4YHMH 4FFZA 1FSKB 3HHSB 1AZBA 2YC1A 4JMXA 2Y72A 4G5AA 1DUYB 2P49B 4U6YA 3E2HB 4MNQA 4HUVA 6FABH 1TPXB 4LB8A 3PY9A 4Y1AB 1ONQA 2DDQH 2Y1ZA 5FO9A 3T6WA 4FQCL 3UBXA 3QCVL 3WXVL 3LIUA 1OAKL 2MRYA 3IDYC 5FHBH 2MCG1 3EYOB 3VFTA 1RU9H 4U1SB 4WI4A 3E6FA 3REWA 4ACPA 1E4XH 3QJFB 5JIMA 4OB5L 4PG9A 5EUOA 2BSSB 3GLDA 2YOCA 1FAKT 4B50A 1NEPA 3CSBA 3VFSA 5D1QD 3RVXD 3ARYA 2AQQA 3CFEA 4IOIB 5I1GL 5IHUH 3OAYK 2VNCA 4YEFA 3IBEA 5EEYA 3F7VB 3CZFA 3BDBA 4DPAX 3OMNB 1NGWA 3MHZA 3H3PH 5J12B 1DN0A 5GRJH 3SO3B 5DI8B 5K59E 5EIQA 3FOLA 1UCBL 1KGCD 1XBDA 5GRWA 4JHWL 1TJIH 1NCCH 1LP9F 3O9WC 4NO0D 2G5BA 4R7NB 4WSGA 2J44A 1UM5H 2HH0L 3AC0A 5HHVL 1LLAA 4IIQB 2DJUA 4BH8B 3UROR 2FH6A 3VACA 2H41A 5BUGA 2VQ1A 2X87A 4U3SB 4YK4B 3ZE1F 1MJUH 4UTAH 1CF1A 3ESMA 1EMTL 1CLZL 3WMSA 1FORH 3ES6B 1EZSA 2Z31D 2VUKA 4PREA 4XPAH 1IGFH 4FERA 5HGDB 2XVLA 4PWKA 1P84J 4FL4B 5TE7L 2C4FU 3EH5B 1AZVA 2A83A 1Q9WA 2X3CA 3H54A 1EHKB 5A2CA 5DEGA 3WMPA 5ACLA 5I8OH 3MCG1 3NJMA 5FA3A 3HI1A 2VC2B 5KANI 4Z7VE 5IUCA 1UD3A 3AY2A 3ZKSD 1JZ7A 1E5BA 4GAFB 4MVBC 3Q9PA 5F7YC 2IXQB 5D5MA 4KPHH 2BSRB 35C8H 4JQXC 3O0RH 5F1KC 4A7VA 4PJEB 2BNQE 3QNXB 4X7SL 2R0ZL 4PV8B 5BZZA 1ZGLA 2PWEA 4QEGA 3E3QE 4LSSL 2X6AA 3FFDA 4GBXA 4FRWA 4AEIH 1OGSA 3RZCD 4I87A 3UMTA 3S3DB 1E2ZA 1GPOH 3TWCH 3UTSE 4OJFL 5LBSL 3T0BA 2NUPA 1FNAA 2ADGB 3S5LB 3FTVA 1XF3A 4AT6A 5KAQG 4FXGC 4U1LB 1MCJA 2DQCH 4ODUA 3KBFA 4MNHA 3MBED 5CILL 3MDJA 3QDGE 1FH5L 5AB9A 2VUOA 4NN6B 3VWJB 1QTSA 3IS1X 1JF5A 4F7CA 1OAYH 3FQ2A 3A4FA 5E03A 1JFQH 1ZWIB 1A5FL 3U2JA 1VIWA 4NO2A 3EAKA 5FM8A 4Q56A 1U8OA 2Y22A 1IARB 3KWVA 3VD4A 1JPFA 1CGSL 1BF5A 1UCTA 3FO9A 3P77B 3TPUA 3SYPA 3F7YA 2EDMA 4P46C 2IDSA 4X4MA 4QRRA 1J10A 3MV7A 1MQKH 3DPDA 3GHPA 1E30A 1KJ2A 3N55A 4JDZA 4R0LC 3TO4A 1JZHA 1SGKA 4J28A 2R69A 4WWKC 1OSPL 1GMEA 3FU5A 3P3SA 2D4DA 2CDGA 3RI5K 3LKQB 4JFEE 3Q5YA 1NWOA 1L6XA 1RIVH 2X89D 3DVGB 4Q6IC 4Q4IA 1YAIA 3UJJH 1UJ3B 1CFSA 4QOKD 1V54B 4K7PY 4YOKA 4BE6A 1G7IB 4P3CL 4Z3HA 5KJRL 4M5YL 4UT7L 5DF0A 4W9KC 5B39B 1CQKA 2C5DC 3VFOA 4KKLC 4KHTL 1CR9L 1H15A 4Y1AA 5TDNB 1AXIB 4I18A 5DJCB 4FMKA 1CICB 1KDJA 2IPKA 2JIXA 2EXYD 2OM5A 1HCYA 3VFNB 1N8ZB 5TF1H 3SGKC 5A3ID 4OCXH 4TVPL 5B3NA 2PN5A 1JV5B 2FBOJ 4FQIL 4UZGA 5ESVA 3WE6A 3EOYG 3Q8CA 1ZLEA 1S7QB 3ZLQC 4MMZA 3P4LA 5TE4L 1R5VA 2F58H 5SWSB 1M1XB 1KGXA 1U3HB 3V4PL 3AAZA 4AYDC 2FGWL 4AQ1B 1B4LA 3HG1E 4NCC2 5L4JA 1LO4H 1A7RH 2WTRB 3N1QC 4BYHA 1BEYH 1LO0H 4NFDA 4U0RB 3VMOA 7CGTA 5EORL 1J8HA 1DJZA 2PCFB 3MOAH 5CJXA 5E6IC 1VCBC 2CXKA 3LEYL 4K9EH 4WTZG 1ZDQA 3DPBB 1WITA 3TNNB 5DVMA 3C5JB 3HE6B 3ULVF 1V3KA 4NZFA 1CL7H 1HT6A 3CX2A 3DECA 1R5WA 2PPDA 4OLWH 4ZFGL 3RGVD 4KY2A 1T22B 3KGUA 2Y4SA 4V2BA 2OL3B 4BK8A 3MRJA 1HHHB 3MNWA 5TDPB 1SMOA 4M93B 4NJAL 3P0GB 3KLHC 2DQJH 4PBDA 5F9JA 5H4YA 3GMQA 1HKLH 3PFUA 4OD3H 1OTUC 4PEEA 1SBSH 5I1LA 5C3IA 1RUAL 1HH9B 5CCHE 4C56E 4MAYC 3P9MB 2H6UA 4HKJA 3QR0A 5ANMA 2DQTL 3BWAB 3CHRA 3FSVA 4GQZA 4NXKA 2IXQA 1MUJB 1WBYA 2AERT 2ERJB 3QNXA 2QPFA 3PF2A 4H25A 4LVHB 2HKAA 1IBZA 2ZXCA 1K5WA 4MRBA 3STLA 2OTPA 4BKLA 1JNLL 4UQDA 2H47C 5AUMB 3VH8G 4Z3GA 4P06A 4Y4KD 4MJ6A 1ZHKB 5LLIC 1KLGA 2NY0B 1WC7B 4GT7A 4YDNA 1NMBH 4QWWC 1NKGA 4XXCA 4JKWA 5LAPA 2C7UB 5EZJA 4OFYA 2J3SA 3H6JA 4XMVA 2QKIB 1Y07A 5CZXC 3V95A 5GS2H 3HS9A 5DJYA 5JYMA 2WN3A 5EOCJ 3RIKA 4UIMB 1J0JA 1DSWA 3W81A 4WHTB 5I0YA 2ENPA 4PJHE 1ZK9A 2ZUQB 2X1QA 4ZUSB 3EIFA 4P5TD 2QFPA 3CFIC 4XN2A 5GZOC 1DQJA 4MAUL 2CJUL 3PWPA 2IGFH 2NZ9C 4GP5B 5LBGA 3X1NA 4V1DE 1TVBB 3RTQD 1ZGLP 2B1AL 5E94B 4C59B 1F6FB 1Y0LB 4HWBA 1Q0XL 1A4JA 3T3PF 2WVUA 2MNJB 1HC1A 3CVIH 1DBKH 1SXBA 2A1WH 1MIEL 4JFVA 1N2RA 2HG0A 4LNVA 3QCUH 5IW3A 3VI3F 2H2SC 3II3A 1C12A 1XCQB 2BVPA 1G9NH 2P48B 2BFVL 3GJEB 3Q1SH 5J6HA 2BNRD 1PG7H 4JCMA 3TBWA 4Y0GA 5E7FA 3T6VA 2EKSA 1PAMA 3BZEA 5T1LB 4NHUB 1SFDA 4FNQA 1JD9A 3PWVB 1TQSA 1PYWA 5EEVA 4OLZH 4EI5C 4H1LG 5IF0A 1AR1B 1QI4A 1BVNT 5AOIA 4DTGH 4G2AA 4NKMB 3SBQA 5IW1B 4HJJH 2QPDB 4F8PA 4YDVB 3N44F 5DGQA 3O4OB 1I7RB 2DLEA 5I1HL 4RLDA 3QPKA 4RA0C 4CMMB 5DK2B 5IQ9A 4DEPB 3GS0A 3Q43A 1NLDH 2NY2D 4FS0A 3CCHB 2ZSVA 3WKQA 1AGFA 4JKMA 4FQHB 4LRIA 5E9AA 4XZ4A 5D1XD 4E36A 3V4VL 3PL6C 2JJWA 3N1FC 4JN2A 3I3DA 3MBXH 2BOLA 2MWCA 2FHBA 2OYMA 5I74C 4RDQG 3DRTB 4YBLB 5DUMH 2E9IA 2PCFA 1T6WA 1P7KA 5A2LH 1IGJA 3I6LE 2N0KA 3IT8D 3QZWB 4P59L 2J8UA 3S48A 3WKYA 4RWYH 5EIIA 2OZ4A 1T21B 1U8LA 5C0BA 3O3DA 1AYOA 1F18A 1HHKB 4M4RA 5FGCE 1U2HA 4HK3J 4ZW3A 5IB3B 1FLTX 3HE7A 2CRIA 3Q3GA 2VDQL 4RGND 4PJIF 2OJZL 3D0VA 1EAJA 3I6SA 4ENED 1KPUA 2VDLL 1LWJA 3QUXD 1N0LA 1W91A 1DUZB 2OCFD 5HVWA 3FUFA 4Q9QL 2WQVA 1QFWH 2PYED 1ZS2A 5D5MF 3C5ZA 4FFVC 3SKJH 2KPWA 4AKQA 4OJYA 2ZCLL 1H3PL 5F89B 5JOPE 3QUYD 1KY7A 4XNUH 4YGVA 3VXME 4J1UB 2ADJB 5IP4A 4L18A 1X4ZA 3MA7B 5ACZB 1WIPA 3BWAA 5GJTH 1S7VB 2IWFA 3TV3L 4LDCA 4G8EB 3QXTA 1KJMA 4G42B 3WEXA 5KWYC 3RJOA 4AKPA 1IILE 2K4AA 3A47A 4HJGB 4R3SB 4DH2A 3CMOH 3HZYB 2J25A 3FT4A 3INOA 3VGAC 1DQTA 2ATKA 2JI2A 5ADOH 3ECBB 1UM6L 5IJBC 5AUMA 4AV4A 3LNDA 5GGUB 3CLEH 2DB8A 4Z7QF 2XWTA 4YSRA 2BK8A 4JPIB 2HMID 4IRSB 4ODVH 4R5VA 1RXLA 1R3HB 4X6FB 3U4BL 5K9QG 3N40P 2QKIA 4PJFE 4K4KA 4TNWK 4BSWA 2GCYB 1QLRA 1JZGA 1T03H 2P52A 3RIAF 1F1AA 4ORGB 1K4DB 4LAQL 1A1OA 4AEFA 4NM4H 5DMGD 4B96A 1LILA 2X0WA 5TE6L 8CGTA 5AW3B 1P9MA 4RAUA 2YMTA 4JG0H 1KB5A 1NCHA 3O6LL 5J13B 2BHZA 4N2CA 5MEPB 2V17H 5J57B 1CLOH 1URLA 2JCWA 4A7TA 1MRDH 4WDIA 4B9KC 3GHBL 1T1YB 1YAZA 4QMEA 4HXAH 3MLRH 3ORJA 1XR8A 2AXGB 2R2BA 1W0WB 2VAAA 4G7VH 4H0IA 4JFEB 3WIIH 2FBJL 5JW4N 5KYYB 3UYPB 1YNKH 2IG2H 2FUQA 1D9KD 1ORQA 3BP5B 3QFJE 4CVZA 3D3VE 2I07B 2Z1PA 2G0LA 3PWVA 4NKQB 2XWJB 4Z0XB 1H3XA 2MEJB 4WWPA 2QKSA 5HDLA 3OHXB 2AK1L 1JYXA 3T8VA 4L4VD 4NQUA 2B39A 4YXLL 5MERB 4P9MH 1YECL 4D0BB 2BW5A 1WFNA 3AZUA 4ZMLA 2YPLD 3CDGB 3ILDA 3KGTA 1A64A 3T0ED 3LXBA 1ZEAL 1RZGA 1E2WA 2QVTA 5FW7A 5CJOL 1OAZL 2GHZA 1T89A 2CK2A 1NCGA 1SYVB 4N2HA 4UM8B 3BVNA 3QIWB 1OCZB 4E9SA 2FX8H 3ZT5A 4AM0B 3QEUB 2AQ1A 4RZKA 4R5XA 5IB4A 3H85A 2HCZX 2X70A 5E2WL 1UEMA 5I2IA 4GRLA 4XPFL 3LSOB 3EDEA 5EWIH 1Z0MA 4A6YB 2UUDK 5LWYL 3L1GA 5T33L 4N86A 4CA4A 1CI3M 1E6JH 4Y5YC 1AQKL 2GITB 2QFRA 2GJJA 2DQDL 3BOVA 4CSSA 1F5WA 5TPWL 4AJ0A 1BBDH 4AG4L 1F1DA 5BPPA 1GOHA 2C1OA 3ARZA 4YSSA 1JV2B 3BAXA 4B5ZA 3QARA 1F2XK 3HJEA 3LEVL 5F89A 1EERB 4OIIL 3WOVA 2VRQA 3HW7A 3W9EB 4DP0X 1IIIA 4YDKH 1GY2A 3MA7A 4ZXBC 4Z7VA 1ODUA 5FEBA 5CIPB 3NDYE 4DW2H 1RJYB 4HIQA 5D1QB 2GK2A 3UTPD 1AP2A 2V8LA 3CVHB 3IU3A 2H1XA 1FH2A 2BNQA 5FW6A 3WFDL 4ALAL 2YWZA 2WOYA 3ECBA 1SHWA 4M5ZH 4N6RA 1C08B 5KVDL 3ARFD 5SWQA 5JPMB 2HN7A 3GNML 4JCWA 3UTSA 4GO9A 1R3HA 1YG9A 1IC1A 1LK3H 4NO0B 4QTHA 4M48H 5JHMA 1DTUA 1JK8B 1QSFE 2FNWA 1WZAA 4AX3A 4F33B 1JGLL 3QDGA 1A9BA 2NZ1A 3MMEB 5E4AA 4OLXH 3SGJC 4FMVA 3GLEA 2CKBL 5LQBH 3S5LG 3W38A 2AJSL 3BAEH 2Z31B 4Z7UB 3DX2A 3Q06A 4CSTA 3RWDB 4LBAA 5I5MA 3QWRA 3LD8B 3LZPA 3ROLA 1M7IA 3AY4A 4XZUB 2DQHH 2BHYA 4GKZA 2RACA 3S3JA 3OKDB 1MN4A 4QRTB 3VFUB 4X6EB 3T3ME 5IBLD 4HC1L 3NSXA 1P6FA 3MRFB 3RWIB 3S34L 5HDQL 3LPPA 1E27B 2QV2A 4G9FE 3GSWB 1W0WA 4JFEA 1WCBB 3O3EA 1MY7A 4JKPH 1OPGH 3W39B 1RUQH 1A6AB 4KXZH 4X4XA 4XP9H 1UUSA 3V7MA 5ANHA 5IQ7L 4ODSH 4ANXA 1G9HA 5TK4A 3L3HB 3BKML 1I1FA 4I9XA 1OF0A 5DYOB 1UWXK 3B7UX 1EAPA 4U49A 2OXHA 5B7MA 2R29A 3QXAB 2XA8H 4FA7B 1N9PA 4XMXA 2NY4D 4FFYH 3D0LB 3D34A 2AMGA 4I4WB 5MERA 4ZW6A 2HAZA 5B39G 1IGTB 3CDGA 3FTUA 1I85C 1RJZA 1U92A 1ZVYA 3X12A 4EZKA 5EZIL 1MWAL 1OAXL 1MCBA 2EEFA 2XKNA 3GF8A 4LEXH 3DTUB 4QHMA 2J8UF 4TM9A 3AREB 5DRZA 5EBWB 4O9HH 1SYVA 5HHXH 2Y5TA 4Z3TA 5CD3B 2AJXL 1FFTB 1U8HB 5DQDL 3HG1A 5E6ZA 2B0SH 1ZIAA 1BAWA 1KCBA 5HYEA 1EDHA 3K4DA 5JMRA 5F9AC 3BHBB 1CE6A 1XGPA 2GJ6A 3LSOA 4GKSB 4XP5L 5GJSH 1I1RA 4TXVB 4PWHA 3RTLA 3VRJA 2DI7A 2XACC 4ZD3H 1SFHA 1AHWA 3F5WA 4PN6A 1AKJA 3MNVA 3DK0A 1QMUA 1FL3B 4H8UA 5AZUA 1TZHA 3UPAA 3DIFB 1G7JA 4YDIH 3STZB 4QF1A 1G6RB 3WKML 4D7BA 2QZ5A 1KENH 2JKLA 1PZ2A 4WI3A 1WDAA 5ID0B 4QOKB 2EE2A 4WTXA 1MJJB 3KR3L 3NFPA 1JV2A 4M02A 1D7FA 5DD5H 1I1YB 2YA0A 3LRHA 2YKKA 3JWDL 3ZSTA 4BQ9A 4BJLA 3NCBB 2KT6A 4PH8A 1IGCL 3ZRFC 2WAQA 1WBZB 2FWUA 4RRPA 4F8LA 4KHXL 1U42A 3T2NH 2FX7H 2FQFA 3ARDD 4ZQKB 4C56A 4WK2B 5MEOA 1I3UA 2KC0A 4P5KB 4OM0L 4QHKI 4A2LA 5HGHB 4RMUA 4PW3A 5CIPA 3FO2A 5GS1C 3T9WA 4L9LA 3F6LA 1W80A 1CZ8L 5GS0H 1E6OL 2JCCE 4GXUM 3U6RA 5IB1A 4YDJB 4F80A 2XZZA 2NY3B 3IAGC 1Y6MR 1UT1A 1OVZA 4PPTA 3F7QA 5D7SH 1XCXA 4PRIE 3W5NA 2RGSA 4BFKA 3QDJD 3IKCA 2ZKXA 2M2DA 3NQKA 4HSQA 1ODAA 2HG5B 4YL4A 1IM9D 3X11A 2K8QA 3ZHDA 5CO1A 3VU1A 5HYJA 4DKAA 3D18B 1NC2D 2P3YA 4HIEA 4KQ3H 3MJGX 4R26H 4PJHA 3VXQA 4LF3B 3LIZA 3RGVB 2PXYC 3UBFA 2AQRA 2AEPH 2ITEA 3P3TA 2YAQA 1GJUA 4V1DA 2JJUA 5HHQA 2B2XL 2EYRA 1GGYA 1BVKB 3U1QA 2QPEB 3JT2A 4X6CB 1JXKA 1PLAA 1P5VA 4XZUA 1BQUA 2FUTA 2XZAH 4HZAA 3UEQA 3GTVA 3FQXA 3KPRD 1KXTB 4X6EA 1ZY9A 1DQDH 3FDWA 5T3XH 3HNVL 1NAKL 1QBAA 4QJ5B 4G3YH 4XN9A 3IVKA 1ASPA 5EPMB 3EYSL 3O11A 5A2AA 2X1OA 1YEKH 1CL7I 4F7TB 1T4KB 5C0RL 2WBWB 3D3VB 2BHFA 5H94A 1A4KA 1KZYA 4J3VA 3VD3A 3ZKMD 4DF9A 5C0IA 4NNYA 2BDNH 4NQSA 4N68A 3C60C 3UAJD 1CTMA 1TLMA 2DN7A 4Y4KB 3QJUB 1GW0A 3QHZH 4GAGH 3QXAA 4OQTA 3FSOA 2VC2H 3KEHA 3DOHA 3KPLB 3D0LA 3AG2B 1HSAA 1W8OA 4J4PC 2MJWA 3HRZA 4J6RH 4F1ZA 1WYJA 2C9QA 3RBSA 1S8DB 1E9QB 2XDHA 3SOBH 5K59F 3B3IA 2W60B 1M7DB 1I9JL 1S7UA 3EYVB 4OZ4B 3AG1B 3NOIA 3NP3A 2BNUA 2Y1AA 3KM2A 3TZVB 3PWUB 1JZFA 4P5TB 5CD3A 4L37A 3VWKB 5I1IH 2GSMB 4N24A 5FYJL 2ADIA 4MS6A 5IFJA 1KIRB 3LH9A 3EZ8A 2XPGA 1LO5B 2YRBA 3L3JB 2YAEA 3M88A 2HTKC 2PP8A 3ZL1A 1CYXA 3QDHA 3GBLA 3VGGA 4GMTH 4EN3D 1CLCA 4LSDA 5E8NB 5DFTA 3P2BA 4MDRA 3QS3A 3WEMA 3UAFA 2JELH 1FL3A 2X4NA 3IDXH 1MFAH 2E7MA 1DFBH 4G7YH 4KO9A 1IE5A 3LQAH 1EDYA 4EIGB 5AAMA 3POCA 4J3OD 4N22A 2JKWA 3S36X 3KPSD 4KUCF 4BZ1L 1KN4L 1MJJA 1SEBA 1QBBA 3B8YA 3WY2A 3N42F 1EXUB 3QZWG 4Z7VF 1A6ZA 3LN4B 4N8VA 4JFZL 2JJSC 3M1BB 5ISZB 1J11A 1UWGL 4LOFA 2VZVA 4ONHB 1X4YA 3RY6C 3VD0A 1BQLL 1IL1A 1Y7VA 4OCNC 3WU1A 4YVNA 2JVUA 3VXMA 5KBNC 2AITA 4ZQKA 4GW5B 1WFMA 4HS8H 4PTTB 4WNSA 4FF9A 1I8LC 2AXJA 1LD9B 3BVDB 5E6SB 4EZLA 3KPPA 4HZLA 1X7QB 4R7VA 3K6OA 2ZPKH 1IQDA 3QH3B 1U21A 4QRUB 5FFLA 2F7QA 4B7LA 3OF6D 1M2VB 4KJQC 1CFNA 4PWEA 5FYKU 4ORZC 3I2CL 2YZ8A 2Z7WA 3MLPA 3ARBC 4RGMB 4FE9A 2IFFL 1KACB 3QG6B 5FV2A 1TFPA 1ML0A 3GUFA 5AB1A 1WIUA 4AVJA 1CDIA 3VXNA 1JPTH 1KJ3L 1JG9A 2CPUA 3E9TA 4F58H 2PP7A 2HG5A 2LAAA 1YNLH 3F12A 4KK6D 1B3IA 1HOEA 4PJFA 1QHQA 3AITA 2ZUTA 3SE3A 4AIOA 3IJHB 3L6FB 2YSTA 2FJHB 3DOSB 1BQ5A 5EOCL 2GTWB 2FDBP 2WZ6A 2ZNWA 2Q76B 3OQRA 5AYUH 3QUXB 3S4SB 4ZPTA 3EOAA 4DKFL 2V6HA 4HKZA 1S5HB 2JQMA 1YY8A 2PO6C 5EO9A 1BVKA 4M3KB 2CDEB 2PYEB 1J5IA 5IJCC 1A7QH 4XWGL 2IH8A 2ITDA 2EH8H 4APQD 1GGBH 1E65A 2KLRA 3HHRB 2W0FA 3MJ8A 3Q6GH 2VB5A 5DR5L 4NO5B 4QHNA 3CK0L 5IBTL 3EOTH 3QFDA 1ZD6A 2IAMC 2VXSL 5CAYB 4F1SA 2OL3H 1TQUA 1U93A 3NK4A 3QFJA 4FI8A 4TQPA 5DHYA 1U3NA 5HPMB 4X7CC 2YD3A 4DQOH 3JUYA 1JGEA 4D8PA 1A7OL 1PFCA 1R0AL 2D2CC 1KBPA 4LHJB 5IJDC 3CMGA 4KZDL 1D5BB 1KLUB 1DDTA 1QUPA 3REVA 2R0LH 4LCWB 3ZZQA 2MQCA 3VFPA 5IJKA 1D5MB 2ZKHL 3DUSA 1QFWI 4J2XA 5C9JA 4LLWB 4PR5A 1DSFH 1JGVH 1F4WL 1ZA3B 4R90L 4RZCA 1IGIH 3OX8B 5KJ4A 2AC0A 3H4FA 4RH4A 3IXAA 4G8IA 4WHDA 2CUIA 3EYVA 3OJDA 4PG2A 5AL8A 5CGYC 4OZ4A 3VRIB 4ZSOE 2VDPB 4IGBC 3WTXA 5I6XC 1Q90A 1KXQE 1KWKA 3SPGA 3O9WD 4YFLF 1RK1A 1A9EA 1A6VL 3GS4A 3GI8L 3HS0B 1RZFL 3JZ7A 1TVHB 4O4YL 5L7XL 5IVNA 5CEXB 5ID1B 4FQXC 4LSTL 3L3JA 2IEPA 3V0HA 2WOBA 1I7ZA 1DO5A 2EDDA 2EXSA 4LSRL 1ORSA 3GPEA 3B2DC 3QBTB 3O2DH 4KRPB 4M6NH 1DL7L 3ZTEA 2F54E 1CU4L 1AQMA 2BOBB 4R7XA 5C70A 1INEL 1E4KA 2CZNA 2Z8RA 5FGSA 1H6UA 5GGSB 1TYJA 5BRZD 3QIBA 3U9PH 1IU1A 1GIGH 1IQWH 2R2CA 3MBWB 3O8XC 1BFOB 2GJZB 3ULVL 3IAPA 2XG5A 4MVBD 2QR0A 1KYFA 3GZOA 1OB1B 4LLVA 2VISB 2C9XA 3KE0A 1CB4A 2UWEB 3QW9A 4L4VB 4LVOB 4XMWA 5DMKA 5IB2B 1PZ5A 3TGXA 1CBVL 1GZQB 3MZGB 3M46A 5DD3H 2BP0B 2YPLB 3K72B 1MW3A 4X7FC 2HJFA 1KPRB 1T6BX 2BC4B 4P2OC 4MCZA 4PJBB 1BMZA 1E28B 1TSRA 1AG0A 3A6CL 4JFQB 1YNTB 3QH3A 3NCYP 4LDEB 4CNIA 2WBJB 4WW2B 5D9SA 5FHAH 1I8KB 3QHTC 1CC3A 1M2VA 1SLVA 5HHPB 3KBEA 2O6DA 3P73B 1M57B 3P4NB 2E56A 3NJVA 4Z7UF 3RWEB 3S8WA 2NNAB 2QVKA 1IC5L 2EIZB 3EO1B 2VLJD 2H7WA 1QLFB 4YBQC 1QSFA 4A7GA 1F58L 2V4LA 1JF6A 4PRBB 2UZXB 1TOXA 1IBDA 1AY1H 2AXFA 2FJHA 2R1XB 3EJUA 5DMIL 4P46D 4PCSA 5EUKB 3WO4B 1SLWA 2Q76A 4Z7WB 1BZ9B 2HFGH 5DA0B 1EJFA 3RVTC 2C3GA 4O58H 3IJYB 5T1MB 1E0OB 4OV5A 1WK0A 2R1YB 1GCFA 2KLSA 2G5UA 5FYKH 4DVBB 4ZOAA 4ZUVB 2Z4QB 3C6LC 5IY5B 5HVHB 4BWWA 3HPJA 3W0WE 3RL1B 5T3XE 3NIFB 5KVEL 2E4FA 1UZ8A 3OL2A 4BGLA 1RV6X 2CJSA 4KUZL 2HTLC 4L1BA 4G9FA 5H37G 4FFZL 2I7OA 1U0QA 3SGDH 4Y5XC 1CGXA 1YEJL 5GPRA 1OTTC 3KL3A 3QK0A 4P48A 5FFGA 3OR7A 3QS2A 3PIQA 1OF2A 3KGRA 4XN7A 3U7WH 1A3ZA 2HFEB 2WLZA 5C97A 1HXKA 2AJ3A 1KLUA 2IPTH 2NLJA 3MV8B 1NA8A 4PRDA 3Q13A 3VSQA 1MPAH 1Q0YH 2DYPA 3ARFB 1N67A 3T0WA 1SHXA 1SVZA 1OOAA 4HIHA 3CFDA 1KGIA 2ALWA 2R59A 5GRUL 2R2EB 2VDML 4CVWA 4AYFB 4F57L 5JQ6H 1CGUA 1QVOA 3ZR6A 5E6ID 2WVVA 1CQYA 4N85A 2OTUA 4ZMYA 1E5UI 1JVKA 3EGXB 5E6YA 5J06A 3LH2L 3QUZB 1INDL 3KCWA 5DMJB 3AGVA 2YD8A 3MRMA 4RIRA 4W4NA 5I9QB 2X1PA 4X0KA 5HVGB 5J11C 2QPUA 5FECA 2AW2A 2BMKB 3LEXA 2VXTL 3CN2A 2YLKA 5I8CA 2FL5B 3KLHD 5DJ2B 1L5GB 1MRCH 2B8OT 4YWGH 1T20B 3ZE2E 1DBBL 5J3HC 3RLSA 1OTUD 3GRWH 2VWEC 4MZ2A 5KSAC 4DP6X 2B08A 2XQBL 4Y9FA 2X4RA 3RWGA 5DDHB 1CBJA 3PXJA 3ZL4L 4Z7IA 5FF6A 4HG4K 1TQCC 5D1ZA 4E41E 3MBWA 2FYYB 4IM8A 2ENSA 3SE8H 1I3RA 2DQEH 4RFOH 3WS3B 5KSBE 4AEHL 4IS6A 3ZHFA 5IB2A 2R0KL 2IJ0C 1TQVA 3NYKA 3FCSB 1JVOA 4KMTH 1ES0A 1DSYA 1NDGA 4KH2A 4JDVB 4XVTH 1WEJH 3R8BB