3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
3ZMEA 2X0VA 4MZIA 1T4WA 2J1ZA 1CO1A 2J1YA 4G83A 5G4MA 4AGNA 4AGPA 1HJBC 2AHIA 2J1XA 2ATAA 5LAPA 4GUOA 3TS8A 1GZHC 5G4NA 2BIQA 2BIOA 4IBYA 3IGLA 1GZHA 4LO9A 2MEJB 3WU1A 2J20A 2J6WA 1H9DA 3US1A 2WGXA 5A7BA 3D09A 1CMOA 3Q01A 3IGKA 2RMNA 3WTXA 3VD0A 1TSRA 2XWCA 2YBGA 4IBTA 4LOFA 5AOLA 3D05A 3QYMA 4L18A 2X0UA 4L0ZA 3D08A 4XR8C 3KZ8A 1KZYA 1HJCA 4IBSA 1TUPA 5AOIA 3D06A 1UOLA 5AOKA 3VD1A 2FEJA 2AC0A 2ADYA 3WTSA 2J1WA 1EANA 2XWRA 3D0AA 5AOJA 4MZRA 3WTWA 3Q06A 2VUKA 2X0WA 4AGQA 4HJEA 1YCSA 2PCXA 4IJTA 3Q05A 5LGYA 3KMDA 3WTTA 4IBQA 4A63A 4LOEA 4IBZA 5KBDA 1HU8A 2BIPA 2H1LM 4AGLA 2BINA 4AGMA 1IO4C 4QO1B 1EAQA 3QYNA 4GUQA 2J21A 5ECGA 1LJMA 3US0A 2IOIA 5G4OA 2OCJA 2GEQA 4L0YA 5ABAA 4G82A 4KVPA 4AGOA 4IBVA 1EAOA 2IOOA 5AB9A 4IBUA 2IOMA 3VD2A 3WTYA 1E50A 2BIMA 3EXJA 5AOMA 3WTVA 2P52A 3EXLA 3WTUA 4IBWA 3D07A 5BUAA
chains in the Genus database with same CATH superfamily
3RNQA 2TAAA 3BVNB 5TGBA 3OPZH 5IQOA 1CGWA 5BO1H 4DP5X 3AFLA 4PIRF 3FT0A 3QI9D 4XNQA 2YLKA 4I0PB 5F6IB 4ZMZA 4DGYH 4HLJA 3OKNB 2V3EA 2NXZB 4GEIA 2IAND 4H0GA 4YXLH 2ZCLL 3LQAC 4EBQH 5I28A 5I73C 1T1YB 3S48A 1JOIA 1YNTA 2A6KA 1LEKB 2Y36L 3DJSA 1MI5D 3WNKA 4N0UB 2ZD0A 4GSRA 1DUZA 3FO2B 4U1IA 4AUUA 5J5EA 1NDTA 4IOSA 2BXYA 1LO0L 1UUNA 2VABA 4ZMWA 5JLZB 3GIVA 1HL4A 4OIFA 2ZPKL 3I9PA 3CXHJ 2DIAA 4L4TB 1GW0A 2BVUA 4H1LB 4MVBC 4B97A 1ZHLA 3HFFA 3CBKB 4UAOB 2Q86B 5I1CH 2PPCA 4XCYA 1YMMB 4L18A 5E08L 5L2KB 1M7DB 3C60A 5TE6L 4OZFH 2HT3D 1UA6L 3B4NA 3ZKND 3L7FB 4KKBD 1M6OA 1BREA 3FT2A 4K7FB 5D7JB 3FUNA 3RUGA 4GRWH 4OBSA 4UTBA 3D0AA 2PETA 4OCRH 1PQZB 3KS0J 2XRAH 3QQ9D 3T8XB 1AAJA 4QNPE 2IDCA 1LDSA 4MGXA 3KPLB 1YUHA 3DMMA 2VYRE 5AVSB 1U3NA 5E70A 1N7MH 2JLPA 3D18A 4R5XA 2X1WL 4L8BB 5BNXD 4YDJB 2QV4A 4B5ZA 3MLPA 4N85A 4ALAL 2R56H 1W0WA 3KW8A 4NWTH 4P2AA 1VFMA 2FVNA 4Y8DC 1SDYA 4KJPD 4MNQA 5EEVA 4KNUA 3SGKC 3ZKSD 3HC3L 1UHVA 2VLLB 4JREC 2OMTB 3OR7B 3JUYA 3CX5J 3K5SA 3HHRB 2BVEA 2FH8A 1TVHA 1C16A 4OZHE 2IDFA 4JFOB 2DWXA 4QF1A 2ZJSL 4R4FH 5D70H 1Q4NX 4Z7VA 3CZFA 3ECUA 4E41D 2IOMA 3WTYA 3QI9C 2P5EB 5HHOD 5LQBL 3NIDF 4PV9B 5EHFA 1WGOA 4PWFA 2BSSA 4NUQA 2CSPA 5KOMC 4D0CB 1FVDB 2DMHA 4AIXA 4C56A 1S5IH 2XQYK 2WLIB 5C07D 5KUKA 4BZ1L 1A3RH 3UMNA 4PEEA 3O45A 4H40A 4NBZB 2YMXH 3Q6FB 4HD9A 1HKLH 3PWUA 1EPFA 4Z7UE 4NZUL 3V4UH 5IJBC 1AACA 5JOEA 4XMPL 5IB3A 2AHIA 2OS7A 3DGGA 4KFZC 3T77B 2OSLA 3I3DA 2ZE0A 4NM8H 4Y2DD 4A1RA 2YAQA 1FZKA 4HUCA 7PCYA 3AJ7A 5D2LE 4N2GA 4LEXL 2QMJA 1OKEA 3MOBH 2ZG2A 3H2QA 3MJWA 1H3XA 1DEEA 3FKUS 4G80A 4X9FA 3H4FA 1OAYH 1R5VB 2QPSA 3BAWA 5D2NA 3QAQA 3KDMA 4Y1SA 3GRWL 4HEMA 1R3KB 4FS0A 4OZGB 2G75A 4KJYA 3MUGB 5FW7A 5CN1A 2QTVA 4GFTB 4YE0A 5H8DA 4DSYA 3BUBA 4LQFL 4EIUA 4KKBC 3U7YL 5C8JB 1OY3B 4PRDB 3UACA 1LO2H 1UWGL 3BH9A 1JPGB 3OVUB 4UTCA 1RP9A 1YEGL 5JQHC 4M29A 1Q0XH 2IWGA 4ZMTA 2E3VA 4JPWL 2NY2C 1S3KH 2YC1A 4QHMA 4UZUA 1TTRA 1FIEA 4FEIA 2BIHA 2UZIH 4JM2D 2DMKA 3NIGE 1W8OA 2NZ9D 2DLEA 4QRPB 3C5ZD 3ME0B 2GCYA 2R0ZL 4XOEA 1PLCA 2B08A 1QA9B 5H4YA 4ATTA 3WIHL 1NINA 1AD0A 1L9NA 3MV9E 3GSVB 2E86A 2PXYC 4ESKA 2I69A 3EG9A 4K55A 1MUJA 1UH2A 1QRND 3CDYA 4YX2H 1G94A 4PLJC 2I60L 3VFVA 3ZTJG 4W9GC 5EBLA 4BKLA 1RI8A 4CKQA 3GMQA 5I76A 1XIWA 3DOHA 1SJHA 5LAXA 4GAFB 3NRFA 5IB2A 1DVTA 3B2UD 3GNML 5DS8B 5JDSB 4LCCC 2VDKB 5JMRA 4LIQL 3F05A 4LIQE 4YDIH 4H2AA 1IGTA 3SZKC 1F45A 2OV0A 2UXFA 1C08B 2JKRM 4LNRB 5BZXA 3LV3B 4S0TD 4X2UA 1YEFH 4CC0A 3MRHA 4ZZKA 2IDUA 2HJFA 1FUNA 4PUBH 3TBVA 1VESA 3HNTL 1X5LA 5CINH 3P02A 4PJFB 4BUQA 1ULVA 1G1OA 2ICEC 3BSGA 4WW2B 3QBTB 3FHEA 4S1SH 3ZRSA 5I0XA 4MXWH 1KY7A 3BW9A 2B7DT 3SCMA 1DDHA 2ENYA 5LCVL 1U3HB 1UD3A 4H8PA 3H54A 1YEHL 3B9VA 5JDJA 4QYAA 5AB0A 1WD9A 2GJ6D 3HA0A 4D9LH 3NGBB 5I19L 5J1SC 2VR4A 3OZKA 3HHSB 4NX0A 3K71A 5HHME 1TQTA 1G6RA 1PAMA 1VFBB 4ELMB 1CR9L 1CD8A 3I02B 3I6SA 3X3FH 4Z5RB 1RJYA 4QXWA 3PAZA 3CHPA 2AXHA 4QRBA 2IPTL 3IAPA 4IBYA 2OMZA 1ES0B 1IM9D 1B0RB 1S9XA 3K91A 1K4CA 4OLVL 4QPEA 3LKNB 4U31A 4UILL 2PYEA 3GXFA 3PXHA 1Y1UA 3SPGA 1QRKA 4I77H 4PWHA 1G5GA 4U4IA 2OMYB 5DRXA 4L8CB 2QLYA 4CMHC 4KH9A 2JXMB 4YHYC 4QRSA 1ND0B 1ZDQA 3BIKB 4G8EA 3ES6B 3MMEA 4DQAA 4MA3A 5AZEL 5CCJA 3C5ZC 3D48R 4AQ8C 4GG6E 1PLBA 3HVDA 4ZQTA 1S3RA 5E2WH 3O6ML 1BAGA 4FABH 4U6VL 4AQEB 3FN0H 4KKNA 1HJCA 1KTDA 3OB0H 2WTOA 4LSPH 5DTFB 3NIFE 2JB5L 4L1SA 4NS0A 4NCDA 1ZT4A 4TUKL 1L0YA 3S37L 1MJ7L 2YBRB 3NZ8B 3RVXD 2VRAA 5HD8D 5IOPB 2J8UF 3BKJH 3P0GB 1OAQH 2C3VA 1MAMH 1MCKA 5ITFB 5JW3H 3ZU8A 4TS6A 2PN5A 2VR5A 4QHKI 3TYGH 2FB4H 5D96B 4JHWL 4BRJA 3INUL 5G55A 3KR3H 1YCSA 4WRLA 1RHHA 3S35L 2AZAA 2ZG1A 3EDFA 2K4WA 3BE1H 4ONFL 3RTQD 3VE0B 3WD5H 3DETD 5MP6L 2EDWA 2J8OA 1QSFE 3WHXA 4J39A 4MCYB 5IJDC 3GBLA 2MOQA 2VAAA 3ZDXF 2VR6A 5KSBA 2YPVL 4XBPA 4RSYA 3C2AH 5JXED 1L7IH 5HI4D 1HWGB 3F85A 4YPJA 4N0CC 4XMZA 2XBZA 4AUJA 25C8L 2J6EA 5DJDB 3JV6B 4M5TA 2NY7H 1AXSB 5GGVY 1IAKB 3PNWA 1EVTC 4F2ME 4JFEA 5LGJB 3N04A 4XMKL 3S4SG 1KC5L 5GZOA 3BDYH 4M8RA 5BRZD 5DQ9B 5C0BA 3BI9X 3T04D 2BSRB 2X1OA 4P5KA 4QJ4B 5D6CB 5HGDA 4HC1L 5DFWH 1LP9F 1MCPH 5CZVH 1FI8C 4HHGA 4ZDHB 2NQ3A 3ZE2F 1E4HA 4P3DA 2ZCKL 4WFGE 2F58L 3X13B 2J1ZA 2R39A 2J1YA 1FJ1B 2WAHA 1S46A 3F64A 3MX0A 4ZFOA 2F7IA 4G83A 2DOCA 3LMJL 4YZFE 1S7WA 5E99H 1SN5A 2D31A 1FL6A 4APXB 5FWRA 1WA2X 3NBNA 3BPNC 1U3YA 3MLSH 5EH1A 2OXGA 3TBTA 1LQSR 1EJ8A 1X5YA 4YWGL 2Y6SD 4YFEA 1FH5H 1E9QA 2BSEA 2CBTA 2BDNH 4K5MA 4EI0A 5D71H 1NTDA 3BOVA 4E2OA 4X6BA 4HWBA 5I26A 4R5VA 1FZOB 5GS0C 4MB4A 3HRZC 1JUFB 5EO1B 2WQAA 4R0LC 4NKOB 3A23A 1K2DA 4KHTL 1JGVL 1TT6A 4I4WA 5CILL 1WVZA 3UP1A 1ORSA 1DANT 1J05A 4QY8B 3RE0A 1JNHA 3DV4B 5FUOH 2PTVA 1M53A 1WAAA 3RVXC 1J1XL 5HD8C 5AAPA 1RZGA 1NBYA 4OBRA 4GSDL 3WIFA 4E9SA 5F7UA 1I4FB 1YEDB 2WBJB 4IK7A 4GLRH 3BLKA 4L0ZA 1CDBA 4TL4A 3K6SB 3G5VB 3RHWK 3TZVD 1M42A 35C8L 5J12C 2ORBL 3ZQ9A 2VDOH 3B9KA 5IR1A 5ENWB 2VCOA 1HESA 3H7LA 1P7QD 4G9FA 4NFCA 1UFUA 4G7SB 4NENA 3T65A 4RGMC 3M1BB 1U92B 2EE0A 4FYSA 4OZFB 3CVIH 2HFEA 1PZDA 4LVOC 5JXEC 1JD9A 3JWDL 3WNOA 1CICB 1SXSA 3IWVA 2DQCH 1F2XK 4GRWB 3U30B 2F18A 3D4ZA 3VFTA 3X1BA 3U0PB 3Q2WA 2EEDA 3VSQA 2E9JA 3CZSA 2ZAHA 3EJTA 1GS8A 3QSKB 4H7VA 3P30H 5GRJH 1FG2B 1P7BA 3QUMH 4LVEA 1MQKL 1B0WA 1NGQL 3FONB 4ODXB 2W0FB 3ILEA 4YPGB 4G1EB 1KUMA 2J72A 5JZ7D 2PR4L 5HTSA 1INDH 2IOIA 1P6FA 2O30A 2Q3AA 1A6PA 4EZLA 5KVGH 5E9DA 3VXTB 3D39D 4LSVH 3O8XA 3SJVA 2QPFA 3IFLH 5EUOA 4N9GB 1ZS8A 3FU9A 3ZHKA 4RFEA 3VGDA 1DL7L 4XP5L 2B4CL 4W68A 4WO0A 3JWOL 3FSVA 1IM3A 1C5CL 1YNTF 5HI5D 4YSQA 2YWZA 4JFQB 3G6DL 1Y0LB 5DFVD 1DJYA 5LVEA 3VFPA 3CPUA 3H56A 2DLHA 1RERA 3GFUA 3B56A 4GW5B 2IV9A 3E6HA 4AMKH 4FA7B 4HV8B 5C7XL 3MJ7B 2GTWB 3BH8B 1NEZG 4MXVE 4XN8A 3EH3B 1CVSC 1G9NL 4QRRB 5DK3A 1NEPA 4O02H 1A2YA 4G8IB 2YAPA 3HFMH 3I6GA 5A3IC 3SZ6A 5KBNC 3CXDL 4N0FA 5A2LH 3N40F 4L8DA 5SWSE 2ATPA 1FORL 2CJUL 3SY0B 3S36L 5K1JA 2MQ3A 4P4KA 1JFQH 5BVPL 3L9EA 1N0LB 1Z6JT 4Y19A 5HPMB 4L8SA 4KUCF 3OX8A 3RUGF 3EGXB 2GTZA 1Z9SB 3GPEA 3ML8A 5T3ZL 1N26A 2MPVA 2ID5A 1XSJA 1U8IA 1ZJBA 1OCWL 3TM6A 1HHJB 1CBVL 3D3VA 3PFQA 4L3AA 3TT1H 4XMVA 5AKRA 1OAXL 4AL8C 3BZFB 2QLVB 4IKLA 1L9TA 1XMWA 2BH0A 5KEZA 1KPRA 4R6UA 1O7VA 5EBMB 1Y6NR 2K6ZA 1B0IA 5GRXG 2XWDA 3MREA 1D9KC 1XDTT 3QJZA 3RWHB 4RIRA 5EIIG 1DLFL 3A24A 5HDOA 3H2WA 3SOBH 1IT9L 1I7TB 3QDMA 3HAEH 1P6WA 2WB7A 5CZRA 1UM4L 4BM7A 3H0TB 3IU3B 5DJ8A 4LL9A 5KW9H 4PS4L 4I2XA 3E2HB 3N42F 4JRLA 1V3KA 1ERNA 1D7FA 2BSBA 1XGRB 2VDQH 3MCLL 4QHNB 4Z7VF 4KAQL 2DQGL 1JFHA 4ZAKB 5L8LB 3C9NB 3RDTA 4ZMNA 1DE4B 4TOYH 2YARA 3VFOB 4P5TB 3U1QA 1NFIA 2HFTA 3ZZ1A 2F5BL 1O0VA 4ZX3A 4UMSA 3B8YA 1GCYA 3Q6GH 3IDXL 3LD8C 2XXMB 4BA0A 2ZCHL 2AQPA 3MJ8A 1JWMA 5HI5C 3W5NA 1Q1JL 1ECZA 4BHUA 5JW5A 1OCOB 1AD9A 2E47A 5FW6A 5AEAA 2F8XC 2XCMC 3QG6A 1XGPB 4CSSA 1JGIA 3GSXB 5DD0H 4GMSL 3B43A 3UTTE 5LGHL 3DX7A 5AVWB 3CFEA 5C6TH 5T5FH 1LO3H 5E00B 5CP3A 3KW7A 5I17B 5DD3L 5GGTH 4NJAH 1ZLWH 4X6FA 4A7GA 4M8QA 1OPOA 2HTKC 2UWEA 1AMYA 3ZE0F 2YKLL 1R17A 3DX9B 1MW1A 4B41A 5C0CA 3F04A 2P3YA 4KKRA 4KTEL 5E2TL 2NXYD 3WFBH 2IAMB 4GO8A 4L4VA 4TL5A 4PVBA 4LLQB 3EBAA 5B1KA 1W0YT 1RK1B 2V7HA 1S7XB 2R29L 1OM3H 2WY3B 4JVWA 3RWEB 3TN0D 5EEUA 5E6SB 2BOBA 4DUWA 3KEDA 1JF5A 4X80H 3CC5B 4XPFH 1CFQB 4CA4A 2F68X 3O6KH 1SM3L 2ZUVA 4OF5A 4BE5A 4QD2E 1VACA 3ECQA 3IDNB 2NY5C 5E1AA 3FMGL 1MOEA 4BA8A 5JPNA 1CXHA 1QABA 3N5AA 4CGTA 4Q9RH 3VI4B 3P0YH 3UAJD 4BWUA 5F89A 1YN7B 1J8HE 1VADB 2X4OA 4X99A 3GC3A 2YRZA 1I8KB 4FFTA 5BV7H 2OAAA 3LCYA 5AOLA 4WSKA 5JNYA 4LKXA 1AGCB 4X9HA 5EZJB 5IMMB 3RX8A 4TSAL 3IFPB 2OPCA 4S10A 3DJRA 3P11L 4FLRA 3T6XA 1A3LL 1NMBL 4RFNB 4ZMPA 5L7XH 3QUGA 2KQMA 4C58B 3EJCA 1V7ML 4NN7C 4L37B 3MXWH 1NGZB 4PJ5B 4DETA 1B0GA 2H8PB 3RTLA 4CRPA 3C08L 3WLBB 2J71A 3T0EA 4J5VA 4RRPA 4OGXH 3DMMC 1CGUA 5HGBB 4WNQB 5AW9B 5KJ4A 3KPOA 3BUIA 4F7PA 4NKIL 3ULUH 4IU3B 4L3EA 5IB4A 5AW7B 2DIJA 2Y9RT 3KVDD 1HXMB 1E30A 3L3JA 5EEXA 2CBPA 5JIQA 5HGAB 5E4EB 1AO7D 2Y2TA 3UYPA 2DL9A 4UUJA 5I82A 3IJSB 4I1RA 2AK4A 2XPGA 4NZTL 3QEQD 1NCBL 1L5GA 2HH0L 4HGKC 5BRPA 2EDNA 3QB7C 2F53D 2LAGB 3L4VA 4TTGA 5E4AA 3CVHL 1Z5LB 1AH1A 1KV7A 4LLUA 3J8F7 4G8FA 1S9WB 1T0PB 2I85A 1AKJB 2P52A 2NXYC 2XQBL 4JG1H 1YMHA 3RVWD 3GZKA 1MVUB 3Q48A 1W80A 2LVEA 4G7VH 3QULB 4GKZB 1SY6H 2MHAA 2AKRA 3N55A 4Z7NF 3TN0C 1N70A 5LBGA 2FBRA 1UEYA 2K3TA 2K8MA 3Q9PA 3PQYE 5HGGS 1KFGA 4KI5E 5CLTA 3HNSH 4U2ZA 4MJID 2ETWA 3QRFM 3ZGIA 2ZSWB 4L3CA 2ENJA 1N5YH 1X7TA 4BH8A 5FYJD 1GTFA 2O5XL 2NY6B 5D1QB 3EUUA 4ONGH 5JHBA 3DOSA 5B1CA 4JY6A 2HKAA 4JW3A 4FTVA 1EVUA 2B5IC 2CBQA 4OM0L 5EZLA 1E9PB 4WWID 3MXVL 4ZW5A 3U0TB 5C0DB 1ILUA 1GY2A 5DJ0B 5F93C 3BT2H 3VWJD 5JYLA 3X11A 4DP0X 4Z7IA 3MACL 2EDJA 3WGVB 1RZ7L 1U58B 4NZRH 5KSVA 1KBKA 2B77A 2X9WA 1IV8A 1MJUL 4I48A 4K8RH 4EQ2A 1IEHA 1ET7A 1WBXB 2X7LB 2OMVB 3V79C 4PD4J 2P7TA 4K94C 3PREA 1N67A 5D4IA 4P46D 3GSQB 3FTZA 3K6DA 1UXSB 4OLXH 3FCBA 3RGVC 4B5EA 1CGSL 4XT1C 1BOGB 1G87A 1F3DJ 5C0EB 4N68A 2Y5QA 5KSBF 4OKDA 3VYNA 5DD6B 5ABDE 3KWVA 1TENA 2XN9A 1RUQH 2BNQD 4JFDB 1AIZA 4LPTA 4XPGL 1U8MB 3OKYA 2IGTA 2JF1A 1KSRA 2HLEB 3MLWL 4M3KB 4TNVK 3EO9H 3MA9L 5GSRA 1Q9WA 1MI5A 4EZJA 4HUUA 2I5YL 4QTIL 2HUEA 1NGPL 3FUKA 2VDOB 4ZPTA 2QR0A 2BVYA 2FEEI 3FQ1A 4UDUB 4TQEH 4AE0A 2YA0A 2YXFA 4I3SH 1JTTA 3V7AE 5DUJA 3P0VH 5DT1L 2QBWA 4TULH 1ZGLM 1FLRH 3U1SL 4HJGB 3K7UA 3DBXB 4NFBA 2CXGA 5IBLC 1FAIH 5I6NA 5K1VA 3IDGB 1VKXB 1JZ4A 3RVWC 3H9YA 3O2VH 5D7KD 1QSED 4KOCA 5C0JA 3AG3B 4G6FB 2DH2A 3CE1A 3QUMB 4CVUA 4BFRA 4KDWA 1UENA 2NOYA 1ZLSL 3TIEA 1RURL 4OKVB 1HFUA 1KJMA 1XZWA 2I26N 5AOMA 1TSHA 1WS7A 2EDKA 5E5MA 5KBKA 5GRUL 2JB6B 1I1AA 4NQSB 1RZIA 4LLVB 4Y4FA 3N2JA 1DJZA 2OR9H 3HPLB 1H8NA 1J0IA 4PAZA 5LO7A 3WJJA 2LFEA 5KYYA 4PGDA 2QQLH 5ETUB 4ADIA 2YAFA 2VZVA 2X4NA 3PWLB 2VISB 3RIFK 3VGHA 1TCRA 2H0PA 2OTPA 4ODVH 3VFRB 1K4DB 3QIUD 3W38A 5EF2A 4BINA 4UZGA 5DLLA 2FT6A 2HWZH 4UINL 1WAAF 4DKEL 1D5XB 4OCSH 1RUPL 4HIJA 1RVFH 1AS6A 1X4XA 3OJDB 5EOCH 3CQPA 1ADQA 4O02B 1H3GA 5TF1L 3PRZA 4NM4L 5MENB 1XMEB 1HN1A 2Q76A 1QEXA 4JY5L 3IVKA 1N59B 4E41A 1H5BA 3VXPB 3QWOA 1BJ1J 1EDHA 3TCLA 1B3IA 1L6PA 4YR6B 3EHBB 5FECA 1UJ3C 1USQA 3GF8A 3WS6A 3W9DA 2NNAB 1JXFA 5ESAB 1CDGA 2Y06L 1KFAL 3FSWA 4BCXA 1URLA 1T4KA 1BFTA 5FO7B 5C07A 3ULVL 3ULVE 2KERA 4RMBA 4XO9A 5I6MA 3VSTA 2LFGA 1T21B 2R2CA 4RAHA 1FG9C 3LKRA 5FGBC 2EXYC 4B0MM 4XP4H 2HFGL 1MWAL 4XPBH 2H6UA 1PVHA 2VXSH 3FRUA 5E5UB 3V7AG 2APTA 1IC5H 2VLRB 3CUPB 2FJUB 5TFSH 2YD3A 3K2MC 3MLTA 3KYNB 3HS0A 4D9QE 4UNUA 4XZUB 4YHOL 3RWJA 3HI6H 1JHTA 1OGPA 2CGRH 3QR0A 1CD0A 4I3RH 5TDOA 5IGXH 1QP1A 3PUCA 4XAWL 5EUOF 2YO3A 5HHNB 2V7NB 3N50A 1HYSC 3N1PC 1GGBH 1A1NA 1UD6A 3QPQD 3WY2A 4OZIB 2A2QT 3HAEB 1DVFB 1E5BA 3OKOB 4RDQG 3AMLA 2X70A 4ELDA 1RIVL 5C9JB 2JKWA 4ABQA 5M95B 4WLCA 3OXSA 4U33A 3K2UL 2K4AA 5DMIL 4P2RE 4R97B 2VDQB 4F7PB 1OV8A 4QCIB 3LQZA 5AVUB 3L3KA 2OYKA 4JANA 1H3PH 5HDBF 4EI6A 3Q44A 4PP2B 1V8HA 2VXUL 3ASWA 5IUCA 1QACA 2VXQA 3O4LE 4HJUA 4PJCE 4TTDD 1NAKH 3POCA 1BD2B 5DRZA 2E75C 3MRQA 1AXTH 3MZTA 1P7KB 3ABLB 3L3IB 3PJSA 5F7AA 2WNGA 2A9CA 5K9KB 3QIWD 2UVFA 5T1MA 2ESVB 5ICZA 2X12A 3MZGB 3QIUC 4W9HC 5JR1L 4KRPB 5EC2A 3WXWH 4XMTA 1H6EA 5ANMB 4D2NA 3LIUA 1MFBH 2VLME 5FKAB 3M8OL 2AVFA 1LTXA 3F7RA 1U36A 4FFWD 3VXMB 2NQCA 5I1LA 5J56B 5FK9A 4MRBA 2J88L 5J6GB 1N8OE 5IFAH 1UOVA 2BNRB 2B16A 1SUHA 1JXJA 5DZAA 4GUOA 1DN2A 3QNXB 4X7EC 5JHDA 3NJIA 5G4NA 4FQQA 4LARL 3ILQC 4PVNA 5FKPB 4LRIC 4TUUA 4OY9A 2GUYA 1IILE 1UWXK 4NDMA 4UV7L 4C4KT 2VSDA 4ABWA 4MJHA 2BP3A 2XA8H 3RVVC 1ZLDA 3JXAA 3K81A 3I6KA 3IFOA 1MQ8A 4P5RA 3DRQB 4K3EH 4DFHA 5FB8A 1O6TA 4FQIL 1TTBA 3G6JE 4P59H 3IKCB 2PWFA 4FP8H 5GZND 5J0BA 3DPBA 4E9QA 1S9YA 4PI0A 1PD1A 2BP8B 2BX5A 2OK0L 4JPKL 5DLML 4HZAA 1KTJA 4DZBB 1UCBL 1GOHA 5AENA 4HS8L 5D5MA 1MFNA 3VVWA 1SJVA 1VJSA 1EXUB 1RUAL 4R3SA 5E8OA 1IAOA 5CN3A 1HEJC 1K8IA 1A8JH 4NC0B 5SX5K 1KIUB 4PJAA 3KPPB 1XTLA 1A14L 3UABA 3QUYD 5GSVA 2A1WL 4OJEH 2RA1A 5T1JA 3ZTEA 3FO9B 4QYOB 1KBVA 2JLLA 2W9EL 2Z93B 5CUSH 4MLSA 5BV7B 1JPST 2PCPA 3SYQA 4FFZH 4ANKA 2WQXA 3QPQC 1HQ4B 3RJQB 1BQRA 2VXVL 5FYLD 4O58L 4N2NA 4MS8D 3RWGB 4OD1H 4PG2A 1IM9A 4HP5A 1KCSL 2VDKL 4LSQH 1HHGB 4GW4B 5FM8A 3SD2A 4OR1A 2UZXA 3Q1EA 1DSFL 4RMRA 3NT0A 1VEMA 4YBHA 1OGAB 4B50A 4WUUB 1IB5A 2BVTA 2ZOKA 4Y5XB 3TJHD 1ICTA 1MIEL 3FU7A 2YPLB 2VMCA 5FXCH 1W72B 3DHPA 2MCPL 5KG9A 2DIEA 2EH8L 4EMZA 5IB1B 1NCTA 2FJHB 1ETB1 4JFHD 3EYSL 3I50L 4OFYA 4A7GF 3UBGA 2UWEF 4JZJC 2IFFL 3CN4A 4OM1H 4ZNCD 2R1YA 1I1CA 2CIKA 4HWEH 5D1XD 3QIWC 3QA3B 3WMQA 2WYTA 4NLHA 4OD3H 2Y5TA 4DPCX 5A7EA 2J8UE 3QP3A 4P3CH 5T5NF 4JGUA 5I1EL 1JWSA 2Q10A 2BZCA 1A6VH 1T0MB 4FFWC 3EOTH 5C09D 5DD1L 4RESB 3GO1H 1YY9C 3SD5A 1KELL 3TA3B 3SE8H 3O2WL 3C5SB 3LPWA 4N2BA 1MHPL 4UIMB 5DHMC 3ZN6A 5DEGB 1PEWA 2XTJD 1CF8H 4I85A 1TEYA 2PP7A 4JLRB 2I9LA 3IE4A 3U46B 4E0RA 3L3GB 3S8GB 3BEVB 5HHQB 3HKZA 1HH6A 4JRWA 1RZKL 2GW5A 2XWJB 1FNSH 3L3HB 5EORL 5F1KC 3RTQA 1TZIB 3GHBL 2CA4A 1KPVA 1E5UI 1G9ML 2HPOA 5D1ZA 5DURB 2V6HA 3OZ9L 2BIQA 4RGOH 2W9DH 3X3GH 5IW1A 3UBXA 3LEXA 1G1KA 3VFMB 5ICYA 1CGXA 4KVCL 4L8SC 5E0FA 3WE6B 2O61A 2GSIA 1EDQA 2H1PH 4X4ZA 1QTYT 2WIMA 1BQUA 4Z76B 3VDCA 2WVSA 1I9EA 4L5FH 3OMAB 2W80C 1HL9A 4IK6A 2AXJA 3FQRB 2ZWZA 2V3DA 2B39A 4RFOH 5I71B 4GAYB 4QR7A 3EGSA 5ERWB 5BQ7A 2YBGA 2IBZY 2D73A 5C9KA 3T09A 2H3NB 3HI1A 2YRBA 4OAWB 4NHCL 3TV8A 2EEXA 4WWKB 1RIHH 3T0AA 1S7RB 4JZOA 3U79A 3NFPA 3BYYA 1LO4H 3M1OA 1JGUH 3AM8C 3Q2VA 3SDCC 4BQ6A 5KJRH 3OMNB 1QD0A 3CH1A 2FX7L 4PG9B 4GG8A 2VJ0A 2WBKA 3B7YA 1ZXKA 4ZMQA 1FYTD 4LLAA 5C0RL 2HKHL 3NJGA 4ZS7L 3TJHC 3MRKA 3WEXA 3QG7H 1T1XA 3MGOA 3G08B 3UDWA 2BS71 1PZ5A 1UUSA 3QXUA 4S1RH 1S7QA 3PHQA 2ICWJ 4PJ8B 1O9WA 1R9FA 2APWA 2P5WB 3BZEB 5JHLH 1S7SB 1VZGA 2DY2A 3GMLA 2HX8A 2P47B 4WTWA 2OMXB 4J3OF 4WTQA 1E90A 2IH3B 4NQCE 4EXKA 4UNIA 3B3IA 2NX5E 1DR9A 2Z7UA 3EADA 2CBOA 4HK0A 2Y22A 3LRKA 5B39A 3NP3A 4K2UL 1QHQA 1QWUA 2EQDA 1LDPH 3F84A 3QDJA 3ZT6A 1HK6A 4FHKA 4FFVC 4HUXA 3VH8G 3UYRL 1UA3A 3RKDC 3W2DL 3S2CA 3HC0A 1OZTG 3G5YA 4XRCB 4ZUVA 5J6HA 1ESOA 3TZVA 4P9HL 4H8WL 4ZUWA 1OLLA 3KWXA 3MJ9H 3PWPD 2BVPB 3HG2A 4LCWB 4X7SL 3R1GL 1PEZA 3QFJD 4HHAA 4FEMA 1MPAL 3U36A 1T0OA 5LHDA 3GSUA 4J6RL 4RA0C 1HL5A 5L8JB 1DUYB 2YPKA 4RWYH 4PTTA 4CU6A 1N6QH 1NGYA 3SDXE 1A6UH 4NT6A 4YHMH 4EQ3A 3L95A 1N3NB 1XF4A 5D7LE 1J5HA 3OPZL 4N26A 5BO1L 1W9XA 4XPHH 4Y1AB 3O9WB 3FAWA 4EF3A 1NJ9B 1FZMA 4L05A 2YAEA 4DGYL 3MNMA 3FHQA 1BG9A 1D5IL 4EBQL 2W07B 2XZCH 5BO0D 1I8IA 3SGDH 1Q0EA 2AQSA 2OTWB 3CZGA 4EN3C 4LOVA 3RYMA 2HVBA 3IGUA 2HKFL 2G30A 1FE8L 4EZKA 4FNTA 4NC1C 3H9SE 4OLWH 3TBBA 1FYHB 3KBEA 4QAMB 3D39A 5JORA 4K3HA 3FTGB 2HVJA 2E7DA 5FHAH 1V3JA 2AW2A 4WWPA 3BPOB 1QTSA 2EYSA 4HJ1A 2CZNA 8PAZA 1AR1C 1E27B 3DVIA 3L17A 3X14A 2VM3A 4JUTA 3VWKC 4XODA 2C26A 2FSDA 4UQ3B 4UT6A 3KYKH 4JKMA 1TFHA 5ICXA 5I24A 2AANA 3B7UX 1F2QA 1M1XB 1FDLH 2HT4D 4WU7A 2C7UB 1CN4A 2AVGA 4F27A 3HLAA 4TPRH 2ZXBA 1F8TH 2ZOOA 3HR5B 3BUYA 1BBJA 3QQ3A 3BIBX 1LK3H 1KXTA 3WNNA 1EH9A 3F5WA 3OR6B 1HL8A 4YHIA 4IOFD 4OQTA 3SKOA 1DVQA 2CQVA 3CHSA 2YGOA 4U0QB 2VUKA 3EJPA 3HPJB 4F37K 5C6PB 3T0EC 3D69A 1R75A 1FCCA 2Z7WA 4BJLA 3RFZB 2DMGA 1OGTB 4AK1A 1NIAA 2V2TA 2QSVA 3N0AA 4UF7C 5I16B 3QXAA 4U4BA 4DEWA 5I15H 1YPZA 1BPLB 3NRPA 3MODL 4XE5B 4LP5A 4X0KA 1CFBA 1CF1A 4MD4A 5BVJA 2NLJA 1BFOA 4KPHL 2R56L 3QDGA 3NTCL 4NWTL 5CEYB 1F4AA 1H6FA 1I7ZA 3NRQA 1QPPA 4YQXH 3U6XS 4GUQA 3RL1B 4P2QE 1PY9A 5I5JA 3QJSB 3GM8A 1X5HA 3BFOA 1FNEA 5IVXE 4RETB 5D70L 5D72L 4OFKA 3I2CH 3AMKA 4FCAA 5LBVA 2NY5H 2VR9A 2BFVL 5E8EA 1T20B 3HMXL 3PL6A 3TJPA 5BW7C 5I6XC 3NIDB 4K7PX 1T6WA 3W39A 3VSUA 4O2FA 3DXAE 4QIRA 3F7LA 3LSOB 1SJEB 2DQEH 4NO2B 3OF6A 3GUFA 5EG6C 1SYVA 4N86A 1AGEA 3D4GA 2EUWA 3C6LC 1RZJL 2X2IA 5IROD 3R4DA 2EIEA 1MELA 2ZX7A 2YMXL 1HKLL 3THMH 1OCCB 2P8MB 1INQA 4LL4A 3V4UL 3SBWA 2NY4B 4UTBH 3SO3C 1TYEB 4QRAA 3CPLB 4Q97A 4NM8L 5KSAD 3H85A 3II1A 1XCTB 5D93C 3NEEA 2M2DA 4IGBD 3ZL2A 2MIZA 5DHYA 3MOBL 4WAFA 4J3BA 3KPRE 3QAZC 1OAYL 1RY7B 4X7CC 1JJUA 1NGWB 2Z92A 3IT8D 4DGUA 3CSYA 2HT4C 3ETBJ 5E8DL 4MWFB 2WUCH 5HYFA 1HSBA 1TSRA 1GAFH 1OT1A 2R23B 3L16A 5HYJD 5F9JB 2X1XR 1A66A 1RMFH 1LO2L 5C7ZA 3HUJB 4FFYA 1G7PB 1MW2A 3ZMRA 3ARSA 4ZO6A 1X6LA 5DA0B 1IKFL 3FO0L 5KSUB 1DQJA 3WUWB 3ZO9A 4NQEB 1CLZL 1NEUA 1S3KL 1HAWA 4GMTL 4HG4K 5JPMA 4KQ4L 4OJCA 2DH3A 4Y4HA 1OD7A 3C8HA 3G6AB 2QDVA 1URIA 4HXAH 1SHSA 3AXHA 2R2HA 3ZKMD 4AIZB 2HCZX 4YHLH 3KCPA 5IMOA 1PX3A 4LASH 4OJAA 5K93A 1I8UA 1MF2H 1AP2B 4HMEA 4WI9A 3T1FB 3DK2A 3QJTB 3MV9D 1DLHB 5CCHE 2F0CA 1R5IA 3UAJA 2NW3A 4KWUA 1AZRA 4JUSA 2F7QA 1Q1PA 4LF3A 4JRYD 1OAZH 2G2RB 3ILPB 4YDIL 1HI6B 1CLVA 2YWYA 4RMTA 5EU3B 5ECGA 5DYOA 5KBMA 3D0VB 4R7NB 2N1TE 3L4CA 1NMAL 2O5NA 4G42B 1R3LA 2OCJA 1GY1A 3ZRCC 4BFIA 2GEQA 2GITA 2E9GA 3QXDB 2GBTA 2OW7A 4XNMB 4F9LA 4AQAB 2ICWA 1X7SA 2JJSA 4KX8A 4S1SL 3MCYA 4N90E 1TKWA 3QQXA 5IV2B 1VPOH 5IG7A 4TUOB 3FQWA 4Y9FA 4FXGB 4AYDC 1MFDH 2DB8A 3DHUA 3EUDA 5FGCB 1T4WA 4JFZH 2FNWA 3UG3A 1TXKA 2ENSA 1F90H 2VUOA 1DVZA 3AZUA 4CC1A 4WI2A 4IGBC 3L3OB 4C83A 3EF4A 5FO2A 5T8IA 1DBKH 3P3RA 2X4QB 4FI6A 2OCCB 4AKPA 3H9HA 2Q8AH 5F1IA 4WK2B 1IKNA 4CVZB 3U4EB 3FW6A 2Q7AA 4HKZB 2GK0A 1AO7A 2FWOA 2JCCA 4PJIA 5D5MF 4Z8FH 4V1DB 1YNKH 1LO5B 1MHCA 4RAUB 4TF4A 5HHMD 4MDIA 2EE9A 4CMMA 4PJAF 3MGTA 4MTMA 1S7TB 3E9TA 1LGVA 3L4WA 2X10A 2OZ4A 2YGPA 4I77L 2AK1L 1PDKB 1JPFA 2E7LC 2E56A 3DECA 1B2WH 5F7YC 2V9RA 2W59A 4LLYB 3U4BH 4X5WB 4NQQA 2HJLA 4AZUA 3MRDB 2YEQA 1TQBC 3DVGA 1JVOA 3L9BA 5E2WL 5JIDA 4WW1B 3B2XA 4FABL 2NY3D 4I5BB 3T4YA 3E8VA 3FN0L 3ZKMC 5KYXA 1HINH 4LSPL 4JPIB 4YHKL 3NSYA 4OIIH 3BWAB 4EI5A 4GINA 1YNLL 4GLRI 3VXSD 2LGNA 3EFDL 4HAGA 2ICES 1C7SA 1QZNA 1OAQL 1XH0A 1MAML 5JW3L 1U41A 3HS0C 2MH4A 4OLEA 4DP6X 1KN4H 3TYGL 1UVQB 2NYZA 3KXFD 4LNVA 2NZ1A 1HEHC 3KR3L 1JV2A 1RXLA 5I1IL 4OW6A 1FF5A 1HAUA 1U8CB 5IQ7L 2Z7YA 4CJ0A 4PR5A 3HI5H 5F9AC 3BE1L 5LNDA 1TQVA 1U8LA 3WD5L 3CCHA 2XICA 4L29A 3VWJA 3ZDXB 1NMCB 3II2A 4U1MB 3RIAK 1I31A 2C4FU 3BQUB 3MBEB 3C2AL 1L7IL 3CG8A 3U48A 1BQLL 3HZKA 1FFOA 1FL3A 5EOQL 2CDFB 1N10A 1MFUA 4P46A 1A4KA 1BCIA 2PTTB 2NY7L 4U1KB 2VR3A 4TLSA 4MD5B 3MBWB 2E8ZA 3FCUB 1T04B 1XAUA 4JFSA 3FH5A 3V55A 2D7PA 1ZVHA 3VFUA 4C54A 2VB5A 1A6TA 5AFAA 3ISRA 1IFGA 4XNXH 3UPRA 2LTQC 1YJDL 3BDYL 1N12A 4KMTH 3QUKA 3MU3A 1LP9B 2BNQA 3ZE2B 2DQIH 1MCPL 3FOMA 1BVNT 1A7QH 1KY6A 1LE9A 4Q2ZB 2AS5M 3CIQA 3WMPA 4UNVA 3VXOB 4IRSA 1S7VB 1NCAH 4JHAH 4X7TB 1KEMH 2DI9A 5E99L 2MNWA 4ZMYA 2R9HD 5JIHA 1P5UB 1A7RH 1AYOA 1GL4B 1A4CA 1GZPB 3QUZA 4KU1A 4JFFA 3MLSL 1I85A 2DQJH 1BFSA 4X83A 2RFXA 1DBAH 1DDTA 5FHBH 1FH5L 5SWZE 4PRAB 2VZ3A 1J8RA 5DVOA 4YGVB 2BDNL 2E9WA 1KYFA 1I7RA 4U1JB 3LKPB 1FP5A 1IAIM 1QUPA 1CDIA 2WXGA 2A74C 2C9SA 2CA3A 4ZO7A 1QSEA 3MSPA 2I07A 5KS9E 4HSAC 4L1LA 5B8CC 3HIZA 5DJYB 3CFKB 2EYTB 1AZNA 2WYHA 3IMUA 2WLKA 1T5WA 5JO5B 5FUOL 3CBJB 5H35B 2NTSP 4A2MA 2J6EH 5I1AA 4GUPA 4Y4KD 1QHPA 3KS0H 4MJ5B 1PZUB 3P1VA 2ZSVB 4F8QA 3IS0X 1NANI 3VD1A 3N9GH 5DDHA 43C9A 1IAIL 4MJ4A 4POZD 3C09C 4KQ3H 2MQ0A 1TMQA 3ARDB 4OD2A 4HIEB 4PJEE 3WDHA 3QWRD 1D6EA 5I6PA 4X98A 1KNOB 1WA0X 1KOAA 2O6EA 3S5ZA 3R0MA 3LKSA 3QHTC 4LVNC 5AW2B 3ZKQD 4DK3A 3QQDA 2ZF9A 1P84K 2NMSA 1JMZA 2FIRT 2DQCL 1AHWA 4IBZA 1EEYB 1BEXA 3LNGA 1EHAA 4U1SB 5E94B 4BH7A 1EEQA 1QYGH 3U82B 1I1YB 2HG5A 3P30L 3WY4A 3FCTB 4EVNA 3QUML 4XVSH 1OWWA 1WUZA 2W9LA 5E5LA 5E6ID 3RNQB 4G59C 2VXTH 3JWNE 5TGBB 4DF9A 4NAMA 5CU5A 4XNQB 1NM4A 3QNFA 1INDL 3LXAA 2YUZA 4TSCL 5KVGL 1WH0A 4IS6A 4LSVL 2WP3T 1HE8A 1YAZA 2X3BA 4WSGA 3IFLL 1MFAH 3FQ2A 1MNUH 2FT7A 4NOFA 1YNTB 1QEWA 2A6KB 5EMYA 3VXRE 3EFOA 2AXFA 4O2CA 1RP8A 2XBTA 2DLFH 2GG1A 2R9HC 4XNUH 3SJVE 4J3SA 2JK5A 4LFHD 5DD5H 1DUZB 4R9HA 2ZKHL 2N0MA 2Z4TA 3FT1A 4U1IB 4H8VA 3VI3A 4AMKL 2VABB 5AKVA 2G5UA 3GIVB 3V52L 3KE0A 4F33A 3KPNA 5MEOA 3RGHA 1MH5A 4WJ5A 4PRNA 1ZHLB 3HFML 4B9IA 2BZDA 3MC0A 3BCDA 4XCYB 2J20A 5T3XD 3S5LG 1IE5A 4PRHE 4KY2A 3ZZQA 5PAZA 3BKCH 3C60B 1ACXA 5GGUA 1W0VA 1EJOH 2RACA 1OSPL 1SNRA 1JFQL 4G70B 2IVFC 4AJVA 2IH1A 1M6OB 2CHXA 2WTPA 3KD4A 3FT2B 5JQIB 5CD3A 3RUGB 1XSIA 1UQSA 3JTTA 2R83A 4N9OB 5SX4H 2BOCA 1KCUH 4R96A 3OMZA 3DYPA 4FLSA 4NO0D 3G04A 2VN6A 4B9ZA 3NJLA 1JHLH 4TSBL 5EU6A 4IBTA 3JVGC 4PB9H 2XQ0A 3FU8A 4JGNA 5J7CC 4JQIH 2ZUXA 4POZC 2EKJA 2OQJA 4E9RA 4F15C 1YUHB 3DMMB 4HFWA 4LAJH 1T3FA 1YPZF 3D18B 1EXHA 3TYFA 3VO0A 3GJFA 3NESA 3FUJA 3PABA 5T3ZD 1W0WB 1MY7A 2EVJA 1EZSA 4MNQB 3N3EA 3T2OA 4Z3EA 5F7LB 1WZKA 5L4FA 1WFUA 1PJWA 3SOBL 3IMVA 5HHPA 4Z7WE 5B7MA 1T2JA 5EWIL 5AB1A 1TJIH 3ESVF 2NDGA 3QRLA 4G6MH 1TVHB 4LCVA 1C16B 3N42B 5CJQH 5GS2D 3WL9A 4QF1B 1CFTA 3APFA 4HZ1A 4Z7VB 3FU0A 1R6VA 3CZFB 5EO9A 3JWNG 5E6IC 4EIGB 4HF5H 4A63A 3JWDC 4GT0A 3DDFA 3GDCA 5GZNA 3ATFA 4TOYL 5C1MB 5AAWA 1FC1A 2BSSB 1H0DA 2D03H 3JYCA 4GIOA 4XX1E 3OXRA 3V6OC 3NZUA 4C56B 5C0AD 1EZVY 3HMWL 3E3QC 1TLMA 4OIAA 4K71C 1G7MA 2H3XC 3O45B 4HBCL 3PWUB 3ARGD 4WNJA 5IB3B 5AB9A 3QUYA 2GVYA 3DGGB 3VD2A 5AW3B 5DD0L 7CGTA 2OSLB 1RJCA 2W60A 5C6TL 5T5FL 1FZKB 3ZL4H 2A73A 3VGFA 4BQ8A 3EXJA 2BY3A 5AG9A 5GGTL 4NJAL 4XO5A 4R2GD 4G80B 2C9AA 2E7BA 1BQHA 2IPUG 3V0WH 5D2NB 5I8KH 3ZE0B 1DJWA 3KDMB 1QFHA 4KROB 2KT6A 2YSTA 2G75B 4KJYB 3AS3A 4LHUG 4EIZC 2C9UA 5C08D 2DQFA 4YZWA 2CRZA 3MRCA 3H55A 2YHGA 5IESH 3BH9B 2NY0B 1U8JA 3NCYS 2FE0A 5DRNA 2YC1B 5I6LA 1OM3L 4QHMB 5K5YA 2PCFA 2Y7NA 1AI1L 3W9EA 2AJ3A 2X38A 4NEHB 4X80L 5I18H 3BN9D 1A8ZA 3O6KL 2GCYB 2O6CA 2WO4A 2FTAA 4M6OL 1C5DA 2RMNA 2ZWYA 5ADPH 2WLZA 3H4HA 3RY4A 1AD0B 2BIIA 4ZUUA 5C09A 4ISVA 5INCA 4MQXD 3P0YL 1V3MA 2B1AH 3EG9B 3EYQC 1MUJB 4LPCA 5BV7L 1T80A 1TQSA 4I1NB 4UWQB 3VFVB 4NI3A 3UMTA 5EBLB 4BKLB 2K6YA 3GMQB 5I76B 2WWNA 4YFLI 2CUHA 1XIWB 5EZOH 1SJHB 5LAXB 5IB2B 3P4NA 1QFWH 1BGXH 1KCWA 1IGTB 2WB1A 1PG7H 1A7PL 1KLGA 2VO5A 4P4RA 1U6AH 5CP3H 3IRPX 1UYWH 4NXKA 3VW3H 5AW8B 3MXWL 5T1DH 3O2DA 4N5EC 3ARFC 2ZZUT 2DQ6A 3FAXA 3MRHB 5FFOA 3TLRA 2B8OT 2HJFB 1V55B 3MYJA 1MDAA 3Q3GB 3TBVB 4OGXL 1A21A 3J07A 5LKNA 2W5PA 3ROOA 3TC9A 1MEXH 5LBSA 1DZBA 3BW9B 1N0XL 4N5UA 3SCMB 1DDHB 2Y6TE 3QORD 3RZCC 1HS6A 3JV5A 3NFSL 3NEXA 2HVKA 2ZX5A 4F7EA 4X5LA 3CN1A 5AOZA 5FC9A 4LK4A 3K71B 1KZQA 5I30H 4U1HA 5IHUH 1G6RB 1KJVA 4L0YA 1R47A 4R2GC 3UTPD 1KIRA 3ESUF 3FO1A 5AVTB 2IOOA 5EA0H 3V0JA 4B96A 3PL6C 1RJLA 3EBHA 1RJYB 4F7TA 4PRPE 4PJIF 4DGVH 3F7YA 1J0KA 2OMZB 2FX9H 2DEXX 5I0DA 2WBXA 1S9XB 1SXZA 2GI0A 2EILB 2WINA 5DU7A 1P4BL 3C6EA 1K4CB 1GIGH 5BZWA 4OSUH 2GJZA 2I32A 1HNYA 2R4SH 2PYEB 4HOZA 1VERA 2XIIA 4G8GD 2B2XH 3EJYD 1MCJA 1SY6L 1EO5A 4Z78A 4IU2A 4Z7NB 1XF2A 5DRXB 2ADJA 1PSKH 1K5NA 5IJKC 5T5NG 4QRSB 1XGTA 4G8EB 3VTTA 3MMEB 4YVNA 4JG0L 5HJBA 4MA3B 1YYLL 4UTAH 5DRWA 1F3RB 2VWEC 3NK3A 4PJ7A 1JV5A 1JPEA 1BAWA 3BESR 4WTZG 5I1JH 3OB0K 4LVHC 5KZCD 3HS8A 4GSQA 3W57A 3DGDA 1ASPA 1GSMA 1KTDB 4ONGL 4JM4L 3W11C 2YRPA 2Z31D 1RL1A 2R8SH 4M5YH 3KLDA 1ZT4B 4NUGH 2FJGA 4X42A 2L3BA 5GRVL 5AYUH 4K5NA 4A66A 2CK2A 3ZL1A 1KIQA 2C3VB 3PWPA 1AOHA 1J12A 3BT2L 3QFJA 2NNXA 2AEQL 3GPSA 3HG1A 4GRLD 1LWRA 4XMUA 4RMUA 2Z65C 4LOUD 4R7DA 1RHHB 2K8QA 5FA3A 3RZWA 1FO0A 3WDJA 1IZJA 3EOBA 3B2PA 2ADGA 3CDFA 4MD0A 5FA4A 5BQDA 2A77H 4OLXL 1CQYA 4W9IC 2KKQA 3WHXB 4ZW8A 5ID1A 4PGJA 2Q6WA 3DYMA 4OCWL 3WTSA 2VAAB 3DX4A 5KSBB 4XBPB 1YEWA 3M1CA 1VCAA 3LKOA 1GGYA 1HZHH 5BZZA 2XN2A 2ENPA 2NUPA 1WZLA 2FAUA 3PNWB 3V2AR 5HI3C 5KAQF 4JFEB 1KB5A 4G5ZL 4L1BA 3GSOA 1IMHC 1BF8A 2IANE 1S5HA 1B9KA 3KWWA 4KKLC 2P45B 4NN5B 5D7HA 2XWBA 5AL0A 1J86A 5C0BB 5J11B 2PPAA 4P5KB 5L88H 2YOCA 5HGDB 1K85A 1MI5E 3CWGA 1TZ8A 3P0VL 4OGYH 2RTTA 4P3DB 3GXIA 3WSQH 3D7PA 1S6NA 2DWEA 3MX0B 1FAIL 4ZFOB 3QJXA 2ADFH 2CDEA 1S7WB 3GGWA 2D31B 2ITFA 1FL6B 4WI5A 2XYCA 9CGTA 5A2IH 1IVLA 4TNWF 3O2VL 4IRJC 5F7BA 4J4PD 4PJBE 4B3VA 1T1ZA 4D9RE 2DWDA 3UBFA 2OXGB 4J3OG 3TBTB 1O6SA 4WEBH 3BVTA 1E9QB 3T4AC 4KXCA 1VB9A 4RSVA 4NN6C 4X6BB 1ADWA 4Y9CA 3TO4A 3WO4B 3VU2A 2OR9L 3G7TA 1QHOA 4BDVA 3VXUE 1XH3A 4HD5A 2QFRA 4FD0A 5F7HA 1IKNC 1K2DB 4I0PD 4ZK8A 3SPIA 4I4WB 5IGXL 3ZX1A 1ORSB 4ODVL 1D2PA 3TEXA 3BPLC 1J05B 1ACCA 1JNHB 1MVYA 3STZA 4Q0XH 1VA9A 4A7QA 1RZGB 1NBYB 3WIFB 4GBXA 4M6AA 2V9TA 5G2NA 4BYHA 2FL5A 1TITA 2K6WA 2QPEB 3WI9A 3T3MB 2G0KA 5EOCL 5BRQA 3D9AH 5FO8A 1TJHH 2DICA 3B9KB 5CR1A 3NCJH 4O5LH 2VMJA 2R27A 2A4EA 5IR1B 2A9BA 1ZE3H 1G1CA 4PJDE 5TTRA 4G9FB 2IGFL 3ETBF 3IDUA 4NENB 3T65B 5DF0A 5IMLA 3B7SA 4XPAH 4L4TD 3GSNH 2HFEB 4ONHA 3ZW3A 2DN7A 2ZUUA 4OZHA 1YMMD 4E41E 2F8OA 1QLFA 3VFTB 4N8CL 2C8NA 2ARJA 2WXQA 5HHOE 5IROA 5L9DL 1DJIA 1JTPA 2IPKA 5CFAA 3CLWA 5D7JD 2KZWA 4X8JA 2CD0A 3HE6C 3KVPA 4XP4L 3VA2C 4CU8A 4XPBL 4A38A 3ENEA 4MNHA 2JJTC 1IC5L 4U7MA 1N68A 5E9DB 4NKDA 4BZ1A 3JUZA 1I8LC 3O8XB 3SJVB 1EUUA 5EUOB 1WITA 1ZS8B 4WHDA 3HI6L 2CGRL 2EDBA 4RFEB 4Z7UA 3RX9A 1YA5A 3ZDWA 1GGBL 4UYPA 1IM3B 4FQ1H 3BDBA 5I8EA 3AABA 3VFPB 2BNUA 5IWLA 5BPPA 5D2LA 3WKML 3E6HB 4QRFA 1OALA 5HDBB 4QHKJ 3VI3F 1F00I 1H3PL 4QGYA 1ADQH 1A2YB 5HYQA 2N59A 3I6GB 1IC0A 5CM1A 2AJVL 3IXTA 4AM0A 3ARTA 2A0LC 1V3LA 4N0FB 2Y1YA 4L8DB 3MV7E 1MFCH 3REVA 2ATPB 4GEJA 3VQMA 2GAZA 2P5ED 4O9HL 5F6IC 3DHMA 4P4KB 4Y19B 3V4VA 3I9AA 4WQOA 3O4LD 2NXZC 5HY9A 3LXCA 4L8SB 3UG5A 3K4DA 4FYQA 1MFBL 3BC9A 3OX8B 3A6BH 1J48A 2GTZB 4ZT1A 4DZ8A 1U3ZA 2UZPA 4NGHH 2IQAA 3OC8A 1U8IB 3UTZA 5IFAL 1ZDSA 2VDML 3D3VB 4JO5A 4M8VA 5CD5D 3MV9A 1QRNE 2BIOA 1RZPA 3K2KA 4ZO8A 1KPRB 2VLMD 2GEEA 5DZJA 1XTMA 4MCMA 2CNYA 2DM4A 1F1GA 3IYLW 1IJNA 4LBAA 3MREB 3VFSA 2XA8L 3C5JA 4RIRB 1FVEA 5TQ0H 3ZT7A 2J2ZA 4TMPA 1Q90A 1FFTB 1RJZA 1YY8A 2WUBH 1B88A 2CR6A 3O0LA 4M4RA 4UAOC 1AIFA 3QDMB 2BZ7A 5F1IB 2ZXGA 2FH6A 3BLPX 5DJ8B 4RQQA 1M3IA 4I2XB 3QJQB 5D7JC 2ARJQ 1FN4A 1QNZH 3MLZH 4KXAA 3RDTB 4KHXH 4E42A 2X6MA 4GKSA 3TBSA 1OPGL 2QADB 4QRPD 1NFIB 5CUSL 5LCVA 4GI8A 2GJ6E 2Q7NA 4S1DD 4FFZL 3RY6A 2AF2A 3MJ8B 5KN5A 1JWMB 3KJ4B 2JWYA 4A39A 1VZHA 5JW5B 4LSQL 1AD9B 5BS0E 2GK2A 2PWGA 3S4SA 3QG6B 3TNMA 4AVHA 4Z7OE 3US9A 1U8KA 1GGTA 4ZX5A 1AHWC 4P2CG 3MRPA 3DX7B 3CFEB 1F58L 3ZO0A 1ZLWK 4XNZB 1BECA 3D0LA 4WI3A 1HU8A 2OYMA 2OA9A 1ZTXL 1ZTXE 3TA4D 4X6FB 2IO5A 1X5FA 1CK0H 3WY1A 1YC8A 4M8QB 5DGRA 4RX4A 2UWEB 1CWVA 4MXQD 4OJYA 3BRDA 5C0CB 4OM1L 2PO6D 1OAUH 3QO0A 4RDBA 4AM0Q 4Z1PA 3LZLA 1DVUA 4PBDA 4YMPA 1EHLH 4OD3L 3RI5K 4L4VB 1E50A 1FZJA 2LV4A 1D5MA 5DVMA 2V7HB 1LMKA 1A6VL 4HX1A 3EOTL 4KTDH 5GS0L 4GG6A 1H8LA 4FC3E 1TR7A 1DQIA 2I9TA 2B14A 4KZDH 4FNQA 3TNNA 1MCLA 1KYUA 2BOBB 3GO1L 5CF3A 5JA9A 1W16A 1U3HD 4NPKA 1UKQA 1D2OA 3FT4A 1VACB 1DQLH 1YVLA 5CLWA 5E1AB 4TNFA 4FQXA 4ZI8A 3PLYA 4IMKC 5JPNB 2QPUA 1ZLVH 2ZP0T 3UJIL 3VACA 2E76C 2EP6A 4JZNA 5F89B 4B53A 4UB0H 1RK7A 1FNSL 2PWDA 2X4OB 1MJ8L 4X99B 1EO8L 3CSTA 4MB3A 4POYA 4FXKA 1W8EA 5CLXA 3BQVA 1MJJA 5JNYB 4LKXB 2VN3A 4LRNH 4AYBA 4RGOL 2H41A 3X3GL 1JYNA 5EF1A 4LDEB 3SQOH 3FDWA 3OAZK 2AJYH 5B1JA 3SGDI 2H1PL 4L9LA 2DKUA 4RBPH 1ORQA 4JRFA 4RGNB 4ZMOA 1QSFA 3DIFA 3DIVA 3QZNA 1T1WA 3CSBA 2CRMA 3S3BB 2XWTA 1B0GB 3X2QB 1X4YA 3T0EB 1BZ9A 3U9PH 3BAEH 1F3DH 4DP7X 2R69L 3SE4A 1FV1A 3KPOB 3OQRA 2F19H 2MPAH 4PTUA 4FQJH 4F2MA 1BVZA 3BP4A 1RIHL 4L3EB 1IGIL 2VDNH 4YDVA 3TH2T 5IB4B 4PYGA 5BRZE 1LO4L 2P9RA 1JGUL 3PNRB 3L3JB 1ASOA 2FWUA 3O41A 3V5HA 4GP5B 4UOZA 1MRDL 4UUJB 3UYPB 4ZMAT 1SFDA 2HG0A 1E6OH 1ODAA 4HC1A 3DRTA 3Q1SH 3QG7L 2AK4B 3BUTA 2XPGB 4EPSA 1MLCA 1L5GB 4U7SA 4DKDC 1Q9OA 5AALA 3QXVA 2HB0A 4OGAD 2UY6A 5HPOA 4MXQC 3WTTA 4IBQA 3KH3A 4HGWA 1QBAA 4JFWA 3EDEA 4ORGA 4LLUB 1UWEH 1UADC 4G8FB 1E6JH 3SDAD 5GS3A 2BRQA 3GBEA 1EWHA 2HUHA 1YMHB 4H8QA 5EOTA 1IC7H 3DUSA 1NEZA 1NBZA 4Y9GA 2OLDA 2MHAB 2QMKA 4WW2C 2AKRB 1AGFA 5IEHA 4HFUH 5ANHA 4W6YB 4AZ8A 1U8OA 1U8QA 4CNIA 4Y4KA 3UTSD 3QJVB 1U3HC 1QNIA 2DQMA 2M83A 1Z2KA 5TE4H 4NQCD 3STBA 5IB5A 2NX5D 3NGBC 4L3CB 3UIZA 3GB7A 4Q6IA 3MJ9L 4G9DA 4PJ7F 2C5DC 1ZV2A 3HR6A 4B9KC 1GR7A 4BH8B 4PGEA 2ZG3A 4HWZA 4JMNA 3CZUB 1AGBA 3DOSB 2BS8A 5D93B 4JY6B 2D3JA 5GRVK 2VKWA 1BAFH 3DTXA 3K4ZA 1MCFA 4FTVB 4GB9A 4E5XG 5C2BH 2MOVA 5EZLB 4F91B 1N6QL 1A6UL 3AS2A 4GIAA 4ANVA 4YHML 4AL8L 4NNYA 3IMRA 5JA8B 4JNXA 4MB1A 3A21A 2P8PA 4JO4H 3L4TA 3X11B 4XPHL 2NZIA 4Q9QH 3MRGA 3OG4B 4G3YH 5KSVB 2IDTA 3NSJA 4I48B 5C97A 4PS3A 3V0GA 5LDSA 2N7BA 3UBXG 2P7TB 1TTCA 2XZCL 4ZFQA 1J18A 2EUXA 5EIIA 1NKGA 4HWNA 2VH5L 3OWEA 4MDJA 4FCHA 4OLWL 3PV6A 4OB5H 5HDLA 1NCUA 1X7QA 3QXWA 2Z64C 2XN9B 4MMXA 2ZNWA 2F8VA 2H2SD 2V3FA 4OCYH 4U1NA 4W4OC 3SYAA 1Z3GH 1CXIA 4GH7B 5GSRB 4DP8X 1Q9WB 1MI5B 4HUUB 4OVVA 4M03A 3H9SD 3V4PL 2M26A 4ZPTB 2QR0B 1FDLL 1S78D 1GGIL 2WBJD 4HKXA 1C9SA 2V17H 4TPRL 3Q8CA 1TNMA 1F8TL 3SEPA 3MRBA 1S4IA 3CLFH 1ZOXA 3OQ3B 1LK3L 4K3GA 5D96C 1NDGA 3CLEH 1ONQA 2EVIA 2W88A 5DS2A 3L5WA 2DYRB 5F97E 3T3PE 1CD1A 4TRPH 2YFOA 3UAAA 3I74A 5JTWA 1CYGA 1KYOK 5C0JB 4Z77A 2XWEA 1CICD 2XY1A 5I15L 2F7PA 3TP4A 3TIEB 3ASOB 4V2BA 1KJMB 2B9BA 4ZZFA 1E4WL 3RX5A 2O6PA 5E5MB 3P4LA 1VAHA 5SWSA 1WBZA 1WEJH 1I1AB 1MCSA 1RZIB 2DQDH 4Y4FB 4KKQA 3VUAA 3M88A 3NYKA 4YQXL 3HG4A 5DHEA 1J1PH 5KYYB 4PGDB 1ZVNA 1A4AA 3SPJA 1N8ZA 1AG0A 2MSPA 2X4NB 4IBVA 1TCRB 3PGCA 2XACC 4PLKD 3S0PA 1DQQA 4NBXB 1OARH 2EC9U 1RHFA 4JDZA 3I2CL 1A0QH 3DARA 4GO9A 3ARYA 1EA9C 2XVBA 5IMKA 2NY5L 4GT7A 3WYRA 2WYZA 3SGJA 1B90A 1UKSA 2DQTH 4HIJB 5C6WH 1F42A 1UT1A 3T2QA 4UT6H 4A2FA 1EO7A 2EO1A 4LLMA 4LZKA 3MROA 4A67A 1QKZH 2Q76B 3IVKB 4UM9D 4E41B 1H5BB 2I7OA 2F5AH 4QRRD 3QWOB 1IVTA 3DPDA 4NYLA 3HVNA 3TCLB 3J2PA 3THML 4CL7A 2R0LL 5FECB 4UTBL 4OQTH 4GAAA 3FTYA 3W9DB 4OLZH 4OZHF 2H2SC 1DQKA 1T4KB 5C07B 3VFWA 2EICA 4PJHE 1SQMA 2XV3A 3ARGA 1T22A 3LKRB 5DQDL 2ZNXA 1ZHBA 3WXVH 4ZW7A 3FRUB 4BD4A 4FNLH 3RP1A 3MLYH 4P2OA 4H4NA 3MLTB 3HS0B 3RWJB 1RMFL 5SX5H 1MCCA 1JHTB 4NKMA 1PL3A 5TDOB 3MVSA 4Z7UF 4FGMA 1A1NB 3VGGA 3I6LD 5EBGA 3LHAA 5JHMA 3UTTA 1R1CA 1EEUA 4ABVA 5DGQA 4MHHI 1KLUA 2X70B 1B6DA 1CFNA 3OXSB 2Y1ZA 2G9HA 1ZGLP 3II3A 1CICC 2X88A 4JMXA 4GKNA 4R90H 3VG0H 4R26H 3U30C 3GEFA 3LQZB 1UB5A 3L3KB 2BFGA 4JANB 4HXAL 4EI6B 4FQ2H 5DHVA 3ZYOA 1EGJH 2X89D 5HJ3A 3SDYH 4NRXA 1HC1A 1Z5HA 5DRZB 1F02I 1QSVA 3EYFA 2UUDH 4ZX4A 3MRQB 4LP4A 5GS1A 3E80A 4ZAKD 3CQFA 3PJSB 4JKPL 2E27H 4PQXA 5F3HA 3FB8A 3MKKA 5CZXD 1LEGA 5T1MB 3SHSA 5ICZB 3GMPA 3U1PA 4Y5VA 5EC2B 4P5TD 1Z3RA 1OAZL 2J8HA 4DP4X 2MNUA 2XFGB 2WXLA 1FBIH 3NIGF 5I1LB 5FK9B 2F74A 4YXKL 3SBQA 1INEH 1DBML 1EAOA 4QRQA 4KV5E 5DWPA 1OAJA 4EXPX 2WD0A 2WKGA 4MASA 4LPUA 5JHDB 1J8HA 4FQQB 3KPSD 1X9UA 15C8H 1XCQA 3AITA 4MJJA 3JZYA 4QGTA 4I13B 4LDOB 1ILSA 1PF3A 1SF5A 1VPOL 4XBGA 4NDMB 4Z18A 3UO1L 4P07A 5IJVA 4KJWD 4PFEA 1IC4H 3TO4C 1OF0A 5DO2C 3I6KB 3IFOB 3HZ3A 4FFYH 5C70A 3SE6A 4ERSL 5FB8B 2GBAA 3INOA 4S0HA 4JFZL 2XKSA 1F90L 1TYRA 4K94L 3B83A 2VTFA 4XGZA 4YBQC 1E40A 1LD9A 3DPBB 3PS6A 2BWQA 4N90D 2WQRA 1S9YB 2MQCA 1DBKL 1PKQE 2D9QB 5EUKA 1L3WA 3QORA 2Q8AL 3LVEA 2IAMD 3LZQA 5D5MB 5LJYH 2WVVA 2XSKA 2VZUA 2ZP9A 2RD0A 3BSZH 1ZK5A 1R19A 4Z8FL 4R3SB 3IETA 2V33A 1IAOB 2DKMA 5E8OB 1K8IB 1YNKL 1JZ2A 3US1A 2W65A 1R33A 4PJAB 4YL9A 5HYSG 3PE9A 1DJSA 2FO8A 5GSVB 1JWUA 1ZV5A 5CNHA 4QAWA 3NN8A 1OEZW 4ZOAA 3WFHA 4M7KL 2PCPB 3DSFH 2WZPD 5F9OH 4FADA 3SN6N 4MCZA 2Q9OA 2P24A 4YDNA 3QEQE 3KJ6H 3V10A 4Z3HA 1IM9B 3WNIA 2F53E 2UZXB 4G7QB 4MAUH 4XC1H 3E7JA 3CFCH 1UT9A 3NABL 2ZOKB 4TVPH 3U4BL 5DA4A 3KWTA 2YA1A 3CFTA 3FU7B 1SLUA 1AZZC 3O4OB 4KFMA 5KG9B 3CVHA 1JK9A 1M2OA 3QZOA 3T2LA 1F1AA 3KG5A 2VDLL 3JQOB 1HINL 1ITBB 3E2HC 4H2CA 4OIIL 4QWWD 2DJ4A 1TYJA 4IKNA 4JO2H 3RIKA 5J06A 2WC7A 5ES4B 4ZAKC 4PJXF 4UCFA 3OSKA 4BXVA 2R1YB 2CIKB 1CTOA 2VDNB 1MCEA 3R8QA 5JOFA 1QBBA 1U91A 3DX8A 1ZWIA 4JAMA 2Y5TB 2PP9A 4LCIL 1R0AH 4P5TC 4MJIE 4IOIA 5JW4Q 1KXHA 2CO3A 4JFPB 3MHZA 1NCNA 1JWSB 3PQYA 1YEEH 1TDQA 3VQ2C 3CTTA 5J3HC 1FGVH 5FYJE 3CBRA 1MZZA 3HI5L 1QPKA 2RGSA 5E4OA 2ZWLT 5MEQA 3QC5X 1LNUA 2NNRA 2X05A 3ZQWA 3LPFA 4TXVB 4V11A 5IBUG 2Y7QA 4Y16A 2ZUQB 5GXBB 2IWFA 2V2XA 2I9LB 5EPMA 4E0RB 1AFVH 1KXVC 1MCIA 4NFDA 4R4BA 1FLTX 3NIFF 1HH6B 1E7UA 3GZPA 4HPYL 3RTQB 3EZJB 4NO3A 1KPVB 1ZPLA 3K8MA 2OZ4H 1X9RA 3ESPA 3FFCE 1UH4A 5D1ZB 5FGSA 5IW1B 1MREH 4XNXL 3UBXB 3LEXB 2FR4A 5ICYB 3GSRA 2A83A 1AKJD 2F1EA 2VL4A 6FABH 4KKAC 4EUPG 2GSIB 3CIAA 1NCHA 4FG0A 3IJ7A 3HHMA 1A7QL 4RNRA 5E2VL 3T6ZA 1GYUA 5AAMA 3U9UA 1NCCH 2Q2LA 3OLIA 4WO4A 3S37X 2WCSA 1NCAL 4JHAL 3GUTA 3H1ZA 3EGSB 5BQ7B 5I23A 1QR1A 2AXGA 2J5WA 2H7WA 1A7RL 4U6HA 3HI1B 3WJMA 1P6AB 1DBAL 4JZOB 2CAKA 3IB4A 2NY6D 5D1QD 3NFPB 2WO3B 1E5YA 1JCKA 3CH1B 3HBQA 1GHFH 3L81A 3MNDA 4GG8B 4TNVF 2DWTA 3S35X 2HT2D 1HT6A 3MOAL 3DO3A 3WEAA 5IHHA 4J4PA 3MRKB 3A3YB 3WEXB 1T1XB 3OMIB 3MGOB 3K80A 3E0GA 5SWZD 1PZ5B 1NOAA 1RUML 4RFNC 1S7QB 2X0UA 2HRGA 5SX4I 3PHQB 3WMSA 4C55A 3DVNA 1GGUA 4YN3A 1C1EH 3NK4A 4YZFF 4NB7A 4AC2A 1A7OH 2J6EL 3BJ91 3GMLB 4X6DF 4XPTL 2A6IA 2YUXA 5E56A 1ACYH 4KO5A 5ESVA 4WSJA 4IBLT 5L2JA 3B3IB 3N9GL 1LVEA 1E8XA 2VDPL 3BWUF 3FQTA 4HK0B 3RWCA 3QIBA 3RKPA 1SN2A 4KQ3L 5B39B 2FEDD 3L45A 4JPQA 3QDJB 1NUNB 2JIXD 4HUXB 3TCXA 4M02A 4CKVX 5DJ6A 1ZGLA 4JFDD 3L9YA 4IJTA 1NLDH 3HC0B 3WHE1 5KVEE 3BZ5A 3G5YB 4TQPA 3NCMA 4ZUVB 4KNTA 5PCYA 1EBAA 5J6HB 4XNYH 4S11A 2ZUWA 2F9BT 1XGQA 4ZUWB 4YSOA 4HJSA 4JO1H 3AREA 4HHAB 4HOMA 3U36B 3WAJA 3GSUB 1CE6A 3RIFF 2YPKB 5EZIH 5GJTH 2Y1AA 4PTTB 3UCRA 2FQGA 4ZFFA 1EAQA 2G3NA 1NGYB 4ZSOE 3TF4A 1KJ2A 4NT6B 4PGZA 1EMTH 2X4PA 3VM7A 3L95B 4XVSL 3L08A 1U8HA 3FRPG 1XF4B 4BFJA 3S88H 2VXTL 2WWKO 3APMA 3BEWA 4BIKA 2AXWA 5KAQG 2X4TA 2DV6A 2A38A 2VM4A 3LNFA 1FZMB 3U0WH 4DP9X 2BSTA 3K5RA 4B9FA 2CWRA 4H1LH 2VLJE 3ETTA 4ENEC 5BZDA 1CI5A 4BK4A 2YFNA 4G6FD 4XWOD 5GISH 2XZAH 1TZAA 1MFAL 2IBGA 1MNUL 3KAAA 1I8IB 1QPXA 4JL1A 4YC2B 1MXDA 5KBPA 3FUDA 3H8NA 4NQTA 2XI9A 4JGMA 3TEYA 1L9PA 1Q9LA 2AQRA 3CH8A 2DLFL 4AYGA 4XNUL 1BYNA 2VE6A 3OAUH 2GIMA 3EYUH 1WT5A 2PMZA 4FQXC 5I5IA 5IFHH 3WFDH 3D39B 5JORB 2EEFA 2HVJB 3N1QC 1IL1A 1T7XA 2D3LA 4BSJA 2NY6C 5D1QC 2X2UA 2EYSB 1P9MA 5ISZE 3VXRD 6CGTA 3WIIH 3FK3A 1MWAA 3X14B 2AERT 2Q1EA 4PYHA 3ZDZE 2YAHA 5ICXB 3FTVA 1LXMA 4WU7B 4MFHA 1BZDA 3HLAB 2KYIA 3ABKB 3BUYB 1BBJB 3QQ3B 3PP3K 4IJ3B 4L3FA 1NOFA 1KXTB 1XEUA 3F5WB 2H6PA 2WLJA 2GUOA 1OTTC 1K8DA 3PIQA 4YHIB 3CMGA 3SKOB 3TH3T 5MEND 1KTKE 4P2RA 2WLMA 4FAAB 4PRHD 1FWXA 1E65A 1JHLL 1X5GA 3D69B 3IJHA 4LHUD 1NICA 3WJLA 4JQIL 3TEUA 2V2TB 4HVBA 3FB5A 3R19A 3QXAB 3O4LA 4M62L 4PJCA 1YPZB 3EOYG 2YJQA 4Y2OA 1W6LA 4B7IA 3SKNA 1YDPA 2WYIA 4C47A 3L4XA 4X0KB 4X6EA 4MD4B 4H0LC 3OHMB 5BVJB 2NLJB 1BFOB 1BZ7A 1I9JH 4WFEE 4G11A 3QDGB 1M71A 4AYFA 2X4RA 3ZDYE 3GXPA 1I7ZB 3CZKA 1DQTA 4PY8J 3MNVA 4P5MA 4M7LT 4BHUI 4DT2A 5I1DA 4OUOA 1NUDA 2D7TH 1QFWI 1TJIL 4JVUA 4NXSA 4D8OA 3IF1A 4K3JL 2VLRD 1WSST 4M1DL 3MV8E 2XNAA 1FNEB 1YEIH 1REIA 5CWSA 5KYNA 1OTUD 2X4SA 5DMGD 4LSUH 4WI8A 4HF5L 5FV2A 5E8EB 3PL6B 3AWGA 5EFIA 3W39B 1R46A 2VZ1A 5I74C 3FQXA 3CDGA 2Z0UA 4O2FB 1GZQA 4D0BA 2X2JA 1WLHA 2D03L 4AXWA 1SYVB 3DV6A 5K9QG 1AGEB 3O3UN 5D4JA 3S36X 4J2XA 1ID2A 4WNSA 4CC4C 4DN4L 4ZTPH 3G6JA 4PSPA 2XQYG 3TIDA 1INQB 2IBBA 4ZTEA 5MI0B 1AC0A 4PV8A 5L4IA 2WCGA 3HW7A 5C0NC 1NIEA 1H3TA 1ZEAH 5H94A 2GTQA 4YHZH 5F2FA 3GLZA 1L7TH 1NGXA 4WHYG 4E9LA 2GC4C 5DHYB 2QKIA 4I18A 3C5XA 2N4IA 1XD1A 2ESVD 2C4XA 4FNUA 4KRPD 3FSOA 2Z92B 1LE5A 1FL5A 4LGSB 3CSYB 3F7VA 5CGMA 2RHEA 1VFOA 3GJFH 2EDHA 3VXMD 5IHLB 1HSBB 4MMYA 3EIFA 3IN0A 1E5CA 3ZRFC 1IQDA 1LMIA 2OW6A 4QXTA 2O61B 2IQ9H 2EH7H 4D3CH 4HJTA 1DQJB 1U42A 2FRGP 1F13A 2V0AA 1HCVA 1OTSD 5JPMB 2WWMD 1FFPA 3NJXA 2PO6A 3MQIA 4WKXA 4Z9KB 4X9IA 5I18L 1E3XA 3EHBC 4Y4HB 4JFHE 4PS8A 3S9DB 3B1TA 4KUZL 4YSCA 3VD0A 2FLBT 5KYUA 2AEIT 2VJXA 1DQVA 2ADIA 5FF6A 1ZT1A 2ED9A 4W6WB 1UD5A 4ZPVA 4KGLA 5D1XE 2R2HB 4BZYA 2B1AL 3FPXA 3W82A 3O3BA 4IHOA 2CO2A 4FXLA 3KCPB 4PJGE 5IMOB 3GRGA 4LSSH 3CFNA 5AOIA 4MAYA 4P57A 4E9TA 4KH2A 2J8UA 4HLZG 1UZ8A 2YQGA 4RH4A 5EZOL 1HIMH 4CDHA 4M7LH 3TVMD 1R5IB 1GYWA 1OP9A 1EBPA 2NW3B 1QBLH 1QFWL 3LX9A 4LF3B 3VH8A 4QKXB 4JGJA 1Q94A 3RVTD 2XTJE 1PG7L 3KVQA 5DYOB 1A6ZA 1U6AL 5GGVL 1UYWL 5FYLH 5LG1A 3QW9A 3HCVA 5T1DL 1R3LB 2EE3A 1X5ZA 5E4IA 4BFIB 5DZLA 1DVFC 2J4WH 1KGUA 2GITB 1I9RH 5CEXA 3KMDA 3KPTA 3N1GC 1NFAA 4R97C 2ICWB 3ATEA 4U1LA 4DGIL 1TKWB 2YPLD 3MUUA 3OJMB 5IG7B 3H7BA 3NOIA 3QARA 4PWEA 3FQWB 5JYMA 1X5KA 4WHTA 5DEFA 1SRDA 5DEZA 3ABMB 5DK2A 3WNMA 4HU8A 4FQLH 4F7KA 4C83B 1OOWA 5I30L 2E4FA 2VW7A 2O4EA 5IHUL 1G84A 1VF5C 5I1GH 1OHZA 4APQA 3U9WA 3H9HB 3TESA 4YNYA 1DP0A 4XC3H 4KRPC 4ODUA 2GY7B 1N18A 1R3IH 1XWVA 1QLRA 4NC1E 5I66A 2GK0B 1AO7B 2FWOB 2JCCB 4PJIB 3BAIA 3T71A 3BP6A 1H15A 3UZQA 4LEEA 5CFHA 1MHCB 4DGVL 1BQHG 1Q38A 4MDIB 4EDXA 1U93A 4JFTA 2CKNA 3EJJX 3TA3D 4CMMB 2B1HH 2A6DA 3MGTB 4S0SD 1GIGL 5TE7H 4N1CA 3IBEA 2R4SL 2FDBP 1FYTE 3HEIB 1OWRM 5HHVH 1KMGA 2Q7YA 5CGBA 2YD2A 4YXHL 3PJLA 2FGZA 1JPFB 2QDWA 2C9PA 1PSKL 1OTSC 2VOTA 4IKKA 4KZCA 4POUB 2Q87A 1J1OH 4JBSA 2E5EA 1T03H 1BOYA 4XO4A 1PYWA 3CHOA 3KPQA 3SDAA 4CSZA 4UTAL 3IU4H 4MVBD 2HJLB 4DW2H 3O2DH 4FI7A 5I1JL 3GMRA 4RZKA 3DVGB 1KCVH 2X2HA 1GPOH 5AVVB 2H6OA 4PJ6A 3T4YB 4HEPA 1QG3A 1MRCH 2GYSA 4RCAA 5KYXB 3UTSA 3VD4A 5IBTL 1YLBB 4XCEA 1CYWA 2R8SL 4EI5B 4NUGL 5E23A 4NQCA 4ETYA 1PLAA 1TEFA 3NZSA 2VSKB 1CURA 2VQTA 4HXBH 5LBSH 5LGJA 2NX5A 4WFFD 1WZMA 3KDPB 2OJ1A 5IP4A 2X5PA 5L6YL 1GJUA 1U9KA 2V5YA 3EBGA 3CZLA 3PGDA 1JV2B 2JKLA 4X6CE 4PW3A 5BV7C 3RVTC 1XGYH 1WGVA 1WZ1H 1WFNA 3CD4A 4WWKD 4KI5F 1WF5A 2DBLH 5C2UB 3KYAA 3L13A 3QEGH 4PR5B 2DTMH 4I8DA 2EDXA 1U8LB 3CCHB 3AXLA 1GGCH 2KS0A 2LR4A 3CN0A 4L29B 4PBWD 3VWJB 3FQUA 4KQ0A 2QT6A 1JXGA 4LEOA 4BQCA 3IJYA 4K8RD 4Y5XC 2K7QA 1A65A 3NJNA 4HJEA 1WCBA 3SDXA 3HZKB 2WMPA 1FFOB 2BVQA 1FL3B 4UQIM 5FYKU 2YD8A 4AG4H 4P46B 1A4KB 2XIDA 4XXCC 1NOLA 5D7LA 2VR8A 4PJ8D 3EJZC 1BWWA 2NW2A 3VFUB 1A6TB 5E1QA 4XP1H 2JKSA 5FYKH 2KDYA 3UPRB 3RPIA 4PCKA 4HLEA 4IM8A 4KZEH 1UACL 3ULUC 1E5AA 2C1PA 3QUKB 4KK8C 3TX4A 2BNQB 4FMVA 3FFDA 2EACA 4GXUM 4J3VA 4GXVH 4NLAA 5L88L 3FOMB 2BM3A 4GKLA 4OGYL 5BOZG 3LEYL 3OKDA 3WSQL 1J10A 4KO6A 1LE9B 3H9SA 4X9BA 1ETA1 2ADFL 2N7SA 3P9MA 4IRSB 3HKFA 3TA3C 3VCLA 2HFFA 2ZOWA 1EDYA 3QUZB 2RQ8A 4JFFB 1XBDA 3DI3B 4CSTA 4RZCA 1KENH 4FQHB 4LCWD 2RFXB 3FQYA 3ARZA 3AG2B 3NCEB 4WEBL 2DLTA 1AOZA 1TMCB 3DURA 3QEUA 1RULH 3FH8A 1I7RB 5DUPH 1OF2A 1A9BA 1BXAA 1FO0H 4D9RD 1QSEB 3A67H 2I07B 1ZANH 3BFQG 4ZUTA 5AW5B 4XH2A 3PWNA 3UROR 1MFVA 4H25A 1FPTH 2FQEA 3LVTA 1UZGA 4LO9A 3ZZSA 1EFXA 5T1KA 1CCZA 1L6ZA 1T5WB 1MIMH 5I1AB 4MNGE 4Q0XL 4GUPB 4JFUA 3LYRA 3LNEA 4RA3A 3RPKA 2CKBL 3QPXL 3VXUD 2OX5A 5I71C 4RDQF 2AI0L 4GQQA 5J8OA 3A6CH 2NY2D 1KB5H 5DDHB 1TZHA 43C9B 4CADA 5EC1A 3TJEL 2HSIA 2P80D 1A6AA 4MBRA 1I8MA 2BY1A 3NCJL 4WWKC 4OD2B 4O5LL 1D6EB 2ED6A 4X98B 1XFPA 1PZSA 3OGCA 2XU9A 3MRLA 2Z91A 4P2QA 2EVHA 3LKSB 2PXYD 3GSNL 4K8RC 1XGUA 3QQDB 4NQDE 4W9CC 2QQKL 4DFIA 5DC2A 5IVXA 1AQKH 3GXTA 3CMOH 1AHWB 4PLJD 4U7KA 3T6QC 1LO0H 5CJOH 2BSDA 4UM9A 4IRZH 4BH7B 1IEAA 4X50A 4DGWC 1JZ8A 2ZPKH 3HMXA 4C57C 2HG5B 4MMZA 2BWIA 4PJ8C 3CDZA 5TF0A 4EVNB 3DXAA 3SY6A 4Y5YA 5D4HA 1IFHL 1BJ8A 2GC7C 2OXHA 3KBFA 1XAKA 5TE6H 4IS6B 1PFOA 5T1LA 1NC2A 2FNBA 2FZ3A 4ZQKA 4P2YA 1QEWB 1MCDA 4WFHD 3EFOB 4O2CB 4FQ1L 4AT6A 5LNEA 2JK5B 5FS5A 3SE3A 3V0AC 4LPVA 3VI3B 3WKNA 3ULVF 3KPRA 4NZFA 5J4MA 4Z7QB 3GQFA 5TK4A 4ZOBA 1HOCA 4AGOA 4F33B 2R0KL 3KPNB 1ADQL 5MEOB 1MH5B 4WJ5B 4PRNB 4ALAH 3O6FA 2UXVA 3VFNA 2Y23A 5HYJE 1RZQA 1N6VA 4QXUH 2WLHA 2AQTA 1MFCL 1BVNP 2LU4A 3B7RL 3O9WC 5GGUB 3ZTJH 1W0VB 1K5WA 1TTUA 1CO1A 4WKZA 2IH1B 3OTTA 1NIFA 4R5TA 5CD3B 5ADOL 1EJ6A 3WV0A 1WYJA 2EUZA 1UQSB 3JTTB 3QUHA 2XDHA 5DI8A 2BOCB 4R96B 4DOHE 3G04B 4LBEA 4WI7A 1V10A 4B6ZA 2UX7A 5EU6B 3MV7D 5K1NA 3IDIA 2A9ML 1NFKA 1T89A 2XV2A 2OQJB 3PHOA 3X12A 2NY4D 4OLYL 1A3ZA 1RIUH 2LHAA 4OUUA 4XHJC 4HFWB 1T3FB 1CFSA 3BPOC 4PJCF 1GJIA 4GQ9L 4KC3B 2Q8BH 3TYFB 1JP5A 3GJFB 3PABB 3D09A 3DUUA 5CSZA 2V5MA 4BZ1H 3UOAB 4QTHA 4F5CE 4NZUH