3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
2AC0A 2MEJB 2AHIA 2X0VA 1UOLA 5AOLA 3US1A 2XWRA 2ADYA 3US0A 4IBVA 1HJBC 2IOIA 3ZMEA 1YCSA 4MZRA 1T4WA 3D08A 1HU8A 3Q05A 3VD0A 2J6WA 4GUOA 4IBYA 3QYNA 3WTTA 4QO1B 1LJMA 5A7BA 2WGXA 1TSRA 4MZIA 2J1WA 4G83A 3VD2A 1CMOA 3VD1A 3EXLA 3WTSA 2J1YA 5AB9A 4IJTA 1CO1A 2OCJA 2X0WA 5G4NA 2YBGA 3WU1A 4KVPA 3D06A 4LOEA 1H9DA 2VUKA 4IBQA 5KBDA 2FEJA 1EAQA 4L0YA 2H1LM 4LO9A 5AOJA 5LGYA 2GEQA 3D07A 5BUAA 4XR8C 1TUPA 3Q01A 2PCXA 1EANA 3WTVA 2X0UA 3TS8A 2BIOA 4AGLA 3WTYA 2BIQA 2J20A 4IBZA 3QYMA 1GZHC 2J1ZA 5G4MA 3WTUA 4L0ZA 5LAPA 4G82A 5AOIA 2J1XA 4AGQA 3D05A 4AGPA 4AGNA 4IBTA 3IGKA 3Q06A 2IOOA 2IOMA 5ABAA 4IBUA 1HJCA 4L18A 3IGLA 5G4OA 3WTXA 4IBWA 2J21A 1IO4C 4AGMA 2RMNA 3KMDA 3KZ8A 5AOMA 1GZHA 4LOFA 2BIPA 4IBSA 3EXJA 1KZYA 2BIMA 3D0AA 2P52A 4HJEA 5ECGA 5AOKA 4GUQA 1EAOA 2XWCA 2BINA 1E50A 4AGOA 4A63A 2ATAA 3WTWA 3D09A
chains in the Genus database with same CATH superfamily
5DJ0B 2DWDB 2VDLH 5A2AA 2HJKA 2F68X 5AALA 3QUMB 2QPUA 2M26A 2UX6A 3OB0H 2NXZB 3ARBB 4MCNA 2IOIA 2QMJA 2XV6B 4A2MA 1FFPB 3OWRA 2QQNH 5ID0B 3C6LB 5CD3B 2HAZA 4D9RE 2X12A 4WCYH 1IC7L 2YAFA 4TVPL 2JI3A 4ZW6A 4KV5E 2AEWA 4H26A 1PG7H 2X1QA 1JHTA 2DQUH 3VXNA 1N8OE 4EI5D 4YDVB 5IHUH 1VHPA 2FEEL 1BMWA 1EZLA 5D7LE 2OFQA 4PUBL 3KYAA 3S5ZA 4OV5A 1UD5A 4LSTL 1QLEL 3RGVA 5F0LB 2FGWH 5IHBA 4GP4B 4AJWA 3F04A 3FTWA 4IRSD 3RIAK 3QSKB 1FNGA 2OXHA 4LQFL 3BVDB 2DQHL 3C09B 1SYSB 3D0LB 4IBQA 3GZOA 2YD6A 4JFDD 3EH4B 2HG5A 4JZJC 2FNBA 4MJ2A 3UAJA 12E8L 4MJIE 4Y4FD 2XWZA 4PTUA 4DVRL 1FH5L 1SOKA 2D7OA 2W60A 3AS0A 3FFOA 3VFVB 1CURA 1ONQB 5FM5M 3GSVA 3WHE1 3Q01A 1WZLA 4TMPA 1CYGA 1UOVA 4MVBD 4RGMC 4IGBA 5DC4B 3Q8FA 3JXAA 3V5HB 5GIRA 1T03L 1XZWA 4JM2A 4MJ5B 1QFUL 2HVKA 3NSCA 2ADFL 1PZSA 3QXDB 4JDVA 1NUGA 5EU6E 3UTTA 5T5NF 3VH8B 4PJ9B 2PO6D 2YD2A 3MCLH 3DO7B 1NCHA 2QT6A 4AGNA 2EXYD 3Q2CA 4JL2A 4KKBC 1T3FB 3I2CH 3MRQA 1XGRB 2X4OA 4HBCH 5AL8A 4YDZA 2QHRH 4HJUA 3ERXA 4HPHA 4NWUL 3MV7E 3X14B 5INDA 3H3KA 3VXSB 4AQAA 1G6RA 1FN4B 1VGEH 3ZIYA 4AJYV 2BVTA 2NSXA 2O61A 1R3IL 3ENEA 2VDPB 1E9QA 1NPJA 2Y06H 1MNUL 4YHMH 2NTSP 2QL1A 2EE2A 3DPBA 4PWHA 2RTTA 3EFOB 3GBMH 4OFYA 4WDIA 1J05B 2B4CH 5IUCA 4NFCA 4ZXBC 5H2BA 4RAHA 3ORJA 1BM3H 5CSZA 2EDTA 1ETZA 3B2VH 4ELKB 4GRWE 4P2OC 4UM9B 3RDJA 4KNSA 3IRZA 4EI6B 4X5QA 1O0VA 3IGAB 4TLTA 1OCCB 3L4ZA 1FBIL 1KTJA 2XI9A 1RZKC 3O3UN 4A2GA 2XKNB 1OSPH 4L3FA 5D96B 3NEXA 2C3VA 4HJ1A 4LIQL 3VB8A 1PZUB 4ZYKA 3BZDA 3HHSB 1ZT1B 2YFOA 4L37B 5DQJB 3S35H 5L8JB 5EU7C 4LGPB 3TV8A 1WCBA 3ECWA 3FTSA 1BVOA 3IJEB 4XNXL 4LNRB 4BZYA 2JB6A 3RX7A 4P2AA 1ORQB 1IUZA 4ELDA 1D5ZB 1KIPA 3CDFA 5BS0B 3GM0A 3MXVH 5I9QC 4CMHB 4MS8D 3L95B 4EF3A 1AGCA 1XX9C 4GSUA 3HC0B 5C0GA 3BSHA 1CFBA 3LH9A 3R1GL 4PJ5E 3T3ME 1B0IA 1WGVA 2YKLL 1MRCH 1PD1A 2WBKA 4GFXA 3PP3K 1OAYH 5CMAB 2IBGA 4HEME 5D93B 4LXFA 4N3UA 4ZX5A 5GRXG 1GC1H 2X4TB 1VCAA 3QZNA 1L6ZA 5GGSB 4NQUA 1TJIH 4U1NA 4XI5C 3X2QB 1IBZA 3ZZ1A 2QPEB 2Y5QA 2AJYH 5E6IB 4XNXH 1RURL 2YQ2A 3TVMB 3KXFE 4OFVA 2BS71 3RY6C 4RNRB 12E8H 3PG2A 2P43B 3CV5A 1X3DA 2MQ3A 4AWJC 2A6JA 1KCVL 2LQRA 3QQ4B 5D6CA 1CTMA 4J39A 1KJMB 1T5XA 1KXQE 5DURB 3INUL 3LIZL 3AS2A 3VX0A 3IKCB 3OKKB 5IW3A 1E5ZA 4JFYA 3RHWF 4DCQB 1GMEA 1SDDB 2J8HA 2W59A 3OSKA 3X17A 3MLYL 4HUWA 4KITB 1X5XA 4FNUA 4QRRB 1LK2A 4CNIA 4Q97A 1D5RA 1EDQA 1MRFL 5HP5A 2VSCA 2F5BH 2OP4L 5I17B 2HKHL 5CEZE 4DGYH 4Z7UB 4NO2B 1XBRA 4Y19E 1JWSB 4BZ1A 4I7ZC 1SVCP 5I5IA 5JR1H 2IQ9H 2X1PA 3EJZD 1NMCB 4CUCA 5F3HA 2VJ0A 3TURA 5E8OA 4OFDA 5C0AA 5IB5A 4NM8H 5KSAA 5IB3B 5E4EC 4JFZL 1NFIA 2IGFL 1PW3A 4AGOA 5EOCL 2R51A 4M5YL 4QHKJ 5FUCE 4HSCX 1UXSB 2AP2A 4NT6B 1FNEA 2JV6A 3FQNA 3VW3L 1Q0XL 4OCRH 2HT4C 1A4KA 5JXAH 3GWJA 1TENA 1BFTA 3WNMA 3TYFB 1SJHB 4AQZA 5EN2B 4L9LC 1ROCA 3U7YL 5H8DA 2FYYA 1F3DH 2ILLA 1RZJC 1H6TA 1SQMA 3Q3GB 4XP4L 5DC2A 1BFSA 5A2LH 2YUVA 3H3PL 2WMPA 3VU1A 2AJZA 2G3MA 4RFEB 3TIEA 3NFSL 3C6EA 1WQVT 3JUZA 5CCJA 4DPCX 3C75A 5IWLC 3RP1A 5F89A 4M02A 2EVJA 3DX2A 5DO2C 1G7MB 2B0SL 1J9CT 3WN5A 2IIJA 4PRHE 1E6OL 4I87A 2BHZA 2EEFA 4Z7NE 1T4KA 2ZJSL 1Q9WA 2GBTA 4QCIA 2BHYA 2GTQA 5E8DH 4M7JL 1R75A 4X6EA 4K71B 2J57A 3V4VB 3HZVA 3T65A 3FCTB 2A83A 3BPCB 3OZ9L 1KYDA 1AVAA 3ULUL 4HAKA 2QLYA 2XPZA 4GRMA 3LQZA 2PWFA 3W56A 3VFTB 3MNZA 1J5OL 1L5GB 3QQ4A 1JF5A 2OJEA 2DYSB 4KMLB 2YZ1A 3R18A 3BI9X 4K07A 2A9AA 1H6FA 3SE9H 4JO1L 3REWB 1THCA 4MLIA 4UIKL 1S7UA 1LE5A 3CUPA 5DLLA 3SDXF 1NGXB 1JPST 4ZSOA 1KEGH 1PG7L 4KX7A 3H42H 3APDA 1I8KB 3SGKA 2BNRE 3C08H 4Y9GA 1ZSDA 3B9KD 4MSWB 1WFMA 3GB7B 5BS0A 1ICTA 1AQKL 4DP0X 3DV6A 4L8CB 5D7HA 2CH8A 4WY7L 5IT2H 4JFQB 2C9SA 4BSVA 1CGVA 4OIAA 4I18C 3D9AL 1ZTXH 1UVQB 5EIQA 2AMGA 2YS4A 3LD8B 1IV8A 2OCFD 5J12C 4F1SA 2Y72A 4DERA 5KAQF 4B9FA 3C2AH 4OFIA 3QH3A 2AQRA 4XCEA 1VFUA 3ATAA 2P52A 1KLUB 4MA3B 4HJEA 2E75C 3GJFB 1CD1A 1F1AA 3UDWC 3ML8A 1DVFD 1ZDQA 4ZFFB 3SGJA 5FK9B 1J8HA 5JHBA 3IXTA 4QHPA 4OI7A 1JK8B 1HKFA 3QHZH 1BOGB 1FPTL 1A7NH 4P9MH 2A9DA 2DLHA 4FTVB 2NXYD 2BSTB 3AT8A 4HUXA 4ZFQA 4AEFA 7FABH 4H40A 3WNOA 1LEIA 3AU1B 4P06A 1EHNA 2HRPL 2F5AL 1J10A 3O9WD 4N0FB 3UX9B 2IAMA 1I9IH 3JV6A 5LNEA 3TBTA 5L8KB 3VFMB 5I1EL 1OE1A 2NXZC 3ARBC 5D2NA 2NR6A 3FBQA 3GF8A 5H37H 3BPNB 3DTUB 4QXGH 4A7SA 5DRZB 1NJ9B 4PP2B 1DFBL 2FZ3B 2ZPKH 1BZ9A 3KVPA 4MZIA 3E6FB 3FB8A 4L05A 4D8OA 1OY3B 3GRWL 3MCKB 1EV2E 3MLSH 1S6NA 4P2RA 2BDNH 2X2HA 3SD2A 4G7SB 3LKOB 4LOEA 4M1DH 3EOBB 1PLAA 1UC6A 3PQYB 3A4AA 1H6EA 4UU9B 5BJTA 3DV4A 4AKPA 1GGUA 1M3IA 3LB6C 3DLQR 1OSPL 2F7QA 5E2UL 3REVB 4CADA 1DJHA 2OULB 2X42A 1CD8A 2B8OT 2VN3A 4BUGA 4QWWD 2NTFA 4WGWB 5AENA 4E9LA 3LPPA 4E9XA 4AUUA 5DO2D 4N2IA 1V27A 3KW7A 1WZMA 5FGBC 5IVZB 2NY5C 2EEXA 2CKBH 3GSWB 3WTYA 4PJEA 1ACYH 1IEAA 4OJEH 4P5TA 5AVZB 1RAMA 2GIYA 1ZHLA 4RQQA 4ONHA 1QBLL 2C8NA 4R2GC 4BFNA 4GKLA 3T3PF 3VGBA 1S7TA 3SKMA 3VFNB 1H8NA 4XXWC 3Q2WA 1TVHB 2JH2A 3VWJC 4F7KA 5BVPL 2IOOA 4H5SA 3ZTEA 4ZPTA 5EUOA 1CD0A 4OV5B 1CF8L 2QADD 4Y1TA 2FSEA 1LQBC 1X5GA 5MENB 3BDBA 1ADWA 3SJVD 5DLMH 5I1AB 1PYWA 3IJHA 4OCNC 3RVUD 3ZTJG 2BVPA 4DP8X 3EJQA 1UD3A 4YSUA 1P6AB 4PJ7E 3G5VA 1ZY9A 5JUEH 1AFVL 1N2RA 2Z0BA 5C0FA 3WNNA 4XPTH 5FDWB 1IVTA 3BQUD 2BPBA 1UB6A 4P5MA 1HFUA 4KROB 4WO0A 3UJTH 2WINB 3HRZC 4YAQB 2YD3A 3MRPA 3NJHA 3SY0A 4FNTA 3EW3B 3UZQB 2JMRA 1S7QB 4HALA 2D2CC 4I3SH 4JPWH 1DLHB 3IM1A 2VLJB 5HHQB 4PR5A 5C0JA 4IEFA 1QRNE 3HE6B 2MPVA 1C5DB 4GUPB 4JZNA 3MNDA 3QUYD 1ZK5A 4CVUA 4XP1L 3NCYS 2EUXA 3T6XA 5DUJA 1JUFA 2ICWA 3M45A 4KDVA 2ATKA 1I85A 2RFXA 1K2DB 4PJEE 2CA3A 4BA0A 5H35B 4QRAA 3ZE0E 3QQ3B 3KPMA 2DMHA 4Y4FA 1JGVH 2FIKB 1UD4A 2V2TB 1JHLL 3GXUB 3LKNA 5GSRB 4JHAH 1HINH 3QEQA 3N43F 4F2MA 1VAHA 3CX5J 4Y5XB 3K1KC 2VMJA 4QRUA 1C12B 4ICWA 2NYYC 1Q90A 3H9SD 5JO5B 2R1XA 4KVCL 1KPVB 1MCNA 4N8CL 4BH7B 3B7YA 3GDBA 5K9JH 5F7NC 3QNZA 1T6BX 4XCFL 4N28A 3EOTL 5FPIA 1ULVA 1A5FL 2PP9A 3A67L 2R83A 2ZIDA 3L5HA 1TR7A 1NICA 4IMKA 1NCIA 2AK1L 2KQNA 4JB9H 2G3NA 1IM9D 4GINA 3VD9A 4OLUL 3HI5L 2PCYA 3WGUB 4IRJB 1JD9A 3VD4A 2ESVE 3QGVA 3WXVH 5MEPB 2D7QA 3G6JE 3ZDZF 4HOXA 4APQA 3SCMB 1Y7VA 2P9RA 3VXUB 3BIKB 1A1MB 4LSTH 1G7QA 3GUTA 2AKRB 4U6HB 1RFDH 2BWQA 3G04A 4HS8H 3I84A 4KX8A 5J6GA 3L3DA 4G9FE 4N2AA 1ZA3B 5FYJD 1MWAA 3VYOA 3ECQA 5IHUL 3OAYH 5CHNB 3MOAL 5E5MB 4RA3A 4IBUA 3IVKA 4WKXA 2AJUL 2YGOA 4NZRL 4WY7H 4PJCA 5E8NB 5LN4A 4GAJH 6TAAA 5HHPA 3KEDA 3KZ8A 1PKQA 1Z5LB 2XQ0A 1ASPA 3AFLA 1E2VA 4MQXD 1WIPA 5EEWA 1A5FH 5KYWA 1JTPA 1BJ1J 4MB1A 4W9ZA 3JT0A 1GPOH 3TNMB 3BKMH 3T0EB 1SHXA 3V5KB 4YL4A 1OAJA 2UUDH 2IGLA 3L4YA 1M7DA 4RZKA 4N0CD 5I1GL 5JHLA 1HKLH 3UOAB 2CGYA 4LP5A 3Q13A 4BKLA 3GK8L 4R2GD 4K9EH 4MS6A 2K70A 2ZWKA 3BSGA 5C97A 3TVMA 1FG2B 3P9WB 4JZJA 4G5ZL 1HH9B 5J1AB 2ADGA 3A6CH 3K72B 3HZMA 3UTQB 1HX0A 3ZXAC 1MW1A 1M7UA 1F6AA 1KLFA 5ID1B 4AQEB 2XPYA 1JFQL 5DHVH 4NPKA 4ODTL 2IALA 4DPAX 3GIVA 3CC5A 1Q1JL 3UP1A 5HDRA 2VRAA 2ZICA 3MGAA 4CGUB 2VXTL 4WUUD 2M83A 1R5WB 3QJTB 4WSGA 1EWHA 2G2RA 1O7VA 4MQ7B 3NIFE 1XGPA 1RZFL 1KTBA 5HYFA 1DANU 2OX5A 2PF6A 3T04D 4EOWL 4A38A 2QVFB 1TZHA 1QHQA 5JHLH 3F7YA 2IPKA 3O2WH 4ADIA 1TJGL 1KIPB 1T1YA 4MB5A 1S7RB 5EZOH 4N8VG 3ARBA 2OCJA 1UKSA 3QUXD 1RZGB 4GJTB 3OKEA 3ZE1B 2R2HB 4BK5A 3FQYA 2OYLA 1H9DA 2ZUWA 2AXGA 2JJUA 2UWEB 5MEPA 1XTMA 3EH5B 1NGQH 3Q43A 2OMTA 2DIBA 4UB0H 1IMHC 1RU9L 4G6MH 4HPOH 1FAIH 1S7VB 4H8WC 1RSYA 4GI8A 3ETTA 1DTUA 1RJYB 1U6AL 3T0WA 1B88A 2BSED 1A6TA 3QWQB 4LZKA 3JTTA 4EXPX 5CINH 2IWFA 3HR6A 6PAZA 4B9YA 1ET7A 2IGFH 2WK2A 1N6UA 3MNVA 2NY5H 3GMOA 2IWKA 5IJVA 3PIQA 2AXGB 4RWYH 2YPKA 2IO5A 4LLMB 4QTIL 3AMKA 5F96L 3CMGA 3D8MA 4JY4B 4XC1L 3QZOA 4WQOA 1GZHC 2UZYA 1JPGB 5DT1H 1S3RA 1JSYA 2DQ6A 1REIA 1MH5B 1S46A 3WUZA 3EYVB 4X6BB 5ICUA 4OR1A 2WTRB 4LRIC 5I1JL 4KO7A 3VG0L 2EH7L 4NZTH 2NDGA 4H20H 5ACZB 1SMDA 3GXDA 2D0FA 1WZ1L 1CYXA 4P2OD 4U1JA 3UC0L 1CLOH 1ZA6A 1KGYE 1BM3L 1NTDA 1TCMA 3FRUA 3I9AA 3L2NA 4QRRA 5KZCB 1BXVA 2VR9A 5EU6A 3R4DA 4MJ5A 3T6VA 4RDBA 3MJ8A 5CM1A 4JY4A 2PWDA 3F7VB 4FQ1L 2ZOKB 2ZYRA 2FBOJ 4JDZA 4S2SB 2PO6B 2NSMA 5D2NE 3TA3A 4F33B 1G1YA 1G7HB 3PDDA 2COQA 4AEHL 2IH8A 2BVOA 2WBXA 5DFWH 5DK0B 3GSOA 4U3SB 4ILDA 3LTVA 3FONB 4PVMA 4AI7A 3QS2A 1OAKH 3BPLC 1EGJH 1JPTH 2APSA 3GMQA 4O02A 3ARZA 1RZGA 4OZHE 4L8CA 3I6GA 3CK0L 4WIQA 2F58L 2WKOA 4B96A 1NMBL 1JCVA 4RDQG 3ZO0A 2OMZB 5T1LD 1MVFA 4P23B 1ZLWH 2V7NA 1AHWC 1YEFH 1MFEL 2QQLL 3GLDA 2BCKA 4HJGA 5HDBF 2JLPA 2J73A 4EOWH 5JW5B 4NBYB 3FK3A 5A1AA 1B2WH 4KHXH 2EXSA 3ZDXF 5E6YA 5F3BA 5D4IA 4YSSA 1AQDB 2DYRB 1R3HA 2E7MA 2QJDA 5J6HA 5K1JA 4LPWA 5LAXB 3SOBL 1JCKA 4U33A 5HY9A 5D8JL 1U8IA 1F3JA 3KGSA 4OGYL 3D85D 4PJ7B 2CG9X 5DI8B 4AM0A 3LQZB 2AQSA 1KCBA 1BZQK 5D93C 4WI5A 3HPLB 4UQBA 5EA0H 2E27L 4N0UE 4JVPA 4ANXA 4OD1L 5AVUB 2CJTA 2FSDA 3OAWA 4UTCA 3RVWD 1P4BL 2C1OB 4RBPH 1XGUA 4KO5A 2C7UA 2ZXGA 4F8OA 1LE5B 2YK1L 1SXCA 4X5WB 1BZ7A 1BLNB 3IT8D 4ACPA 2ZXEB 3SDAA 4IKLA 2GTZA 2VMFA 1D6VL 1F1GA 1B9KA 1JNNL 2UY7A 5I0VA 1IARB 5DJ2A 1E7UA 3LQAL 5HHOA 4QF1B 1NGYB 4C8XA 4HP5A 4WGKA 4Y5YA 3T3MB 4NGHH 2EYSB 3RA7L 4IBTA 1DQML 2VDQH 4U1NB 3G08A 5FDYA 1BQ5A 4HWBL 3FOLA 4LP8A 1DQVA 4KNQA 2K4WA 2BVOB 2D7NA 1IEBB 5ABAA 1G7PA 2WGNB 3ZHNA 3ZMRA 4EXKA 1KENL 3TX4A 3AAZB 3TBYA 1UD8A 5IQ9B 5E6RB 3PQYA 2I24N 2G5RA 3LV3A 4P46C 3WN5C 4FQ2H 3DA0A 1CE6B 4M03A 4QY8A 1E2WA 1WBYA 2Z9TA 3QO0B 4IU2B 4YSEA 4PJXB 4JKLA 4ZO7A 4QXUH 2DQFB 3I6KB 4XBEH 2E47A 2VDOH 2VITB 5IBTL 1VCBC 2G2PA 2WMPB 3MOBH 1CXEA 1FZOB 2NMSA 4JAMA 4KO9A 5LNGA 3U9PH 2E9JA 3WXWL 4PIRF 2J3SA 3KDMA 5EC2B 3R7RA 3PP3H 1V55B 1SY6H 2Z91B 3QCUL 1NOAA 1G87A 2VR5A 3OX8B 4ELMA 4PJFF 3IXTB 1HK6A 1WCBB 3PY9A 4JRLA 4OI9A 1JG9A 3KJ6L 1OGAB 3QWOA 5BUGA 1EXUA 1CGYA 1JHKH 3S8GB 3HZKA 3GMLB 2QADC 3MVSA 3ARGB 4G7VL 4UIMA 4FNSA 1IL1A 4PHZA 5KJ7E 2JKRM 1G9HA 2EIDA 1DJYA 1E9PB 1ZGLB 2SODB 1U41A 1ILSA 4FLHA 4E0RB 1E43A 1NDTA 2Q8AL 2JI2A 3CFCL 4FG2A 4ELMB 2AFNA 5T3XE 4EI0A 3VD7A 3V4VH 3VSUA 4RH4A 4IIQA 1F6FB 2Q87A 4ACTA 4X7TA 1IC7H 5CSGA 3UZEA 3NCXA 1QSEB 3OSVA 43CAA 3UEQA 1UH4A 5A2JH 1I1AD 4JFFE 2AK4B 4YE0A 4PCTA 2PW1B 3FT2B 4GW1A 2ZNXA 4F3FB 1A7RH 4MSWA 5F9JA 1KPUB 1M1XA 4HGWA 4ATTA 1FORH 4YX2L 4U1LA 1BXAA 1G7MA 4NC1C 4BHUA 4Y4KB 2A6KB 4WV1A 5KBKA 2X3CA 2EYSA 5CSBA 3GTTA 4K7PL 3VSQA 3CDGA 3NACL 4UV7H 4X9YA 5C07D 4M8QA 1KJ2L 2CK0H 1QLRB 1RFDL 4HS8L 1PZ3A 4JG0L 3L2LA 3UO1H 2XWJB 3CFUA 1JS4A 1OSZA 3O3AB 3V52H 3SD5A 2VSKB 1F90H 1KOAA 4H25A 4ODXA 2B7DT 3N1FC 7PAZA 5IJKC 2YN3A 3PL6D 4QRBA 5FYLL 4QJ5B 5J1TC 4AGPA 4LIQE 4GG8B 1ZANH 4KJQC 1D5IL 4LF3A 1G7IA 1TSHA 2LT9A 4Q2ZA 4AIZA 1K6QH 3JZYA 5BXFA 5FYJH 4J27A 2A2QT 3GMMA 1IC4L 4NBXB 3WMSA 1NBZB 1UZ8B 2LOEA 3RPIA 1XV8A 1CF1A 2NRDA 1IM3B 1SVBA 2CDGB 3HN3A 4Z0XA 4J1UB 4MVBC 5CZVH 3JV6B 5IB1A 1B0RA 3B2MA 3ARGA 2EE9A 4DK6A 3DOHA 1HCYA 2KDYA 3N06B 3VI4B 4WHTA 4N68A 5I8CA 1EEZA 5C6WH 1E9PA 1SJMA 2FWLB 3TPUB 1NJ9A 4ZFOB 4DPBX 1QZ1A 2PO6C 4LARL 2P5WE 4XPHL 3AQYA 4PY8J 3N50A 3BX7C 5C0AD 4ZT1A 3T1WA 2JB5H 3V4PA 1HZHL 2NNAB 3BIKA 3EDJA 3HN8A 4HXBL 4NPJA 4LEXL 1AR1B 1GGTA 1R1CA 2O6DA 1ID2A 4ODUA 1I3RA 3NEEA 3NJIA 3HVDA 1JK8A 5DD5H 1UJTA 1HSBB 3MV8D 3VFUA 1JNJA 1K4DB 1HHGA 5GRZA 3RIAF 3TT1L 3T77A 2YK1H 4K15A 3BZFB 4JPQA 1OTSD 3ZO9A 3V5DB 3WJJA 4ZOEA 2WY3B 1CLOL 3RVVC 1IM9A 3RIFF 4B50A 4HMCA 4N2LA 3AACA 4ZZFA 3U30B 1D7BA 4YSRA 3F58H 4FTVE 2XLLA 1NKOA 1DCEA 3SBWC 4IKKA 1JZIA 5LCVH 2HVJB 4JFFD 3HNTH 1E6JL 1CDHA 3FB5B 5JDJA 32C2B 1GW0A 4N0YH 2AJXL 4PN6A 1LEGA 3SOBH 2BNRA 1IT9H 2EE6A 1RIUH 5FAAA 4Q9QH 2JKSA 3CSYB 5DUPH 4Y16C 1CGUA 2WBJB 3DV6B 1M3JA 3MV9E 5IQOA 2FIRT 1QTPA 2QQLH 3RKDD 5E23A 2KLSA 3B2XA 5BW7C 3UERA 1T0PB 3B2PA 3VXUE 4PS8A 1F3RB 4BD4A 2GUYA 4N0YL 5DUMH 1BYOA 1DSYA 2BIOA 2GK2A 3EAKA 1TU2A 2YUZA 3JVGA 3P4OB 3VXTA 4ABVA 4ELMF 5IB4B 4G1EA 2WB7A 2CDGA 4Z0XB 3QH3B 1A3RL 1FF5A 5G5DA 1OM9A 2R23B 4NWTH 4WHYH 5FO9B 2J44A 1G7QB 3GUTB 4YS4A 4QRTB 3AREA 4AGQA 4Q6KA 2I9LB 1QYGH 4QD2E 1MJ8L 4BCYA 3DVGB 3IRCA 3S0PA 1IKNC 2GUOA 1I8MA 4Q14A 4BFFA 3CZKA 3MTXA 4IRSA 1TJMA 2IH9A 5TH2B 4OKDA 1QAWA 4YSQA 3FO9A 2UWEA 5KTEH 3HR5B 1QFHA 3WO4C 5AVYB 2FJGB 3GKWH 4Y2OB 4Q89A 5EU3A 3CFDA 3I3DA 4JLRA 2ICEA 1YN6A 1SXAA 2A38A 1XH3A 5AG9A 4LARH 3TP4A 3ZPDA 4WWID 3FO9B 3FUNA 3QDMB 2EYRA 2YMTA 4LNVA 4JQVC 3BN9C 4HCRL 1QR4A 3PV6B 4B97A 4YHYC 1RXLA 2XWTA 1CFSA 2XYCA 3BZ4B 2EIZB 3OJDA 1YC7A 1NIBA 1R6VA 3LS5L 3MROA 3QRLA 1VGEL 5GS3A 2N59A 3RVWC 1P1ZA 2MPAL 3R0NA 4MHHI 4JVUA 3QXUA 5BOPA 1IGJA 2V2WB 5A7BA 5F7WC 4CADB 1MFMA 3MJGX 3W11D 3RFZA 5HHQA 3MJ8B 1ZANL 3BWAB 2OR7A 2ZSVB 3QC6X 5HDQH 4HG4J 4KZEL 2FD6L 3U36B 5DJAB 3E1ZA 4LCIH 3ZOAA 4PFEA 1HAUA 2C3WA 4FMVA 2HVBA 3QJUB 1K4CA 1A6ZB 1XWVA 2A99A 5D4HA 3W3BA 1YJDL 3ETSA 1JRHH 4NUPA 1PJ9A 4YFEA 2JJSA 1DVYA 2WYHA 3EGSB 3ZE2B 4CDHA 5HDQL 3FONA 5IMMB 5KG9B 4NZJA 3QNXA 3HI6L 3HNSH 3IGAA 3P69A 1FFTB 3OXSB 1ILUA 5JOFA 1EANA 1ONQA 1ZIAA 5EUOB 1FH5H 5CZXD 4Z8FH 4EI5C 5AD0A 5DEGB 2C4FU 4K7PX 3RWIB 5GIRB 4NIKB 5I19H 2XTLA 1HAWA 1SM3L 3O3BB 1JZ2A 2JF1A 4G82A 2VXQL 1HWHB 4GAFB 1FFQA 1TMCB 3N42B 3IBOA 4GG6F 2Q3AA 3L3KB 2CM6A 1QBBA 4X9BA 3MBED 5IQNA 5TDNA 1TOXA 1CXFA 4NKQB 4PJGF 1ZV2A 3RDTC 3IETA 2WZPA 4FCAA 3LXCA 1XGRA 2DQUL 4P2QA 4W9FC 4UQDA 3VI4F 3NESA 1UTDA 2FO8A 1Z0MA 3KPQA 3PDGA 1AY1L 1LP9F 4JS7A 4PWIA 5HYSB 1J0HA 4B3EA 1LMIA 5I1GH 2Y6SD 1J18A 1KJ3L 1DBJL 4G9DB 1MWAB 2EIBA 3LKQB 1P0SE 5SX4H 5I82A 1SF5A 1KNOB 3QUZC 1OP3H 1CFQA 2LFGA 3RQ3A 1JIBA 3BH4A 1S5IL 1MHPH 1CYWA 3PRZA 4B53A 5GGQH 3A0OA 1AZZC 1SFHA 1WIUA 5H35A 2QVTA 3MA7A 1VFAA 3GNMH 1OALA 3OKNB 1TQSA 2DQJH 4K4KA 2OAAA 2CBMA 1MHHA 1YPZA 1E3FA 4CL7A 1KCRH 3QBTB 1G6RH 3KXFB 4CSPA 4E36A 3BKYH 3MJ9H 2GITA 3RGBA 5B8CC 1YEEH 4Z77B 5CBEA 1BECA 4N6RB 5I5JA 2EH8L 3D08A 3HI5H 1CL7H 3CHXA 3Q05A 1U0QA 2GG1A 3MXVL 4I5BA 3WXVL 1RK0A 1OEZW 1N67A 1N59B 3D25B 1IBFA 1KG0B 4U1KB 2OYPA 2VN7A 5C0DA 2WGXA 1JERA 2VMCA 5AVWB 1BW8A 3D3VD 2AITA 3ZKXC 1X4YA 1YMME 5KVEL 3S3PA 4ZQKB 4NGHL 4Z7VA 3WTSA 2DL2A 1LDPL 5HHVH 4PJHA 5CBAA 1Y6NR 1RK1A 3ZTJH 1G84A 5C08B 3U1SL 3U46B 4BFBD 3SQOL 2VUKA 1CICD 1JZHA 2VQ1A 5CUSL 5L2KE 1M42A 1P4UA 4UDUB 1WLHA 1WZKA 1Z9PA 4L9LA 8CGTA 5MP6H 5ITBH 4L5FL 3G7TA 3MLWH 4RISH 2AKRA 3A6BL 2ERJB 2Z35A 2ZWNA 2Z8SA 3VGAC 4DO6A 1AR1D 1PY9A 1JTTA 1KMGA 3UBXA 2FO4B 4UIMB 3VQ2C 4CVXA 1YSOA 2Y2YA 5E9DA 3CPLB 2XTJB 2ZCHL 1JGVL 4UMGA 2ORBH 4HWBA 1QEWB 4R7NB 3SDDD 4FQXC 4AY0A 2CXKA 2DQTH 5E2UH 1TQUA 3V5HA 5L4JA 3MCYA 4ISVB 4TNFA 4RGNE 4X8XA 3WIHA 4M1CC 5J89A 4YBLC 2FAUA 3DYMA 5ICZB 1GGBH 1IE4A 4EIBA 4U6TA 1M56B 1FV1A 3K0YA 1G1OA 2GJRA 2R1YB 4AT6B 4HJ0D 2FR4B 4PJBF 1OZUA 1C16A 2W94A 4YSAA 1OW0A 3EHBC 2ORBL 2F15A 4Z7OB 2DD8L 5F7KC 4E41D 1FHNA 3ILDA 4G11A 1MJ8H 5A2BA 4QWWC 3MRQB 4A39A 3G6AA 2Y5EA 4TUJA 3L4WA 2PXYA 3BAXA 3D6GA 1A1OA 2HRHA 3W57A 4YK4B 5KS9F 2XA8L 1S9XA 1L5GA 3SGEI 5F8RC 1FC2D 4MBOA 4KAQH 1WH0A 1JPEA 2GPZA 5DUML 5SX4I 5I1KL 4GUQA 5JHDA 5C0AB 4Z77A 4K8RL 1WS8A 5FO7A 4K3JL 2VQ4A 4QXTA 3NP3A 5D7JD 2OQJB 1F58H 1RUPL 5FLVA 4EZKA 5LXGH 5DQ9B 4W9CC 3NRFA 5GGTL 4AG4L 5A16A 4G8IB 2NY1D 3HAEH 3KVQA 4E41E 4A6YL 1LL1A 3QHZL 2WW8A 4JO3H 5F9OL 1BPVA 1W15A 4JFXB 5F7EL 3QDME 1WA2X 1W16A 5GRUL 1IL1B 3PWLB 1AACA 2NY0C 4JFEE 2FEDC 3RUGB 1BGXH 5EU5A 4X0KB 5TFSH 2VDPL 1WIOA 4Y16D 2BJMH 3ESOA 5LDUA 4ZW7A 1FRGL 1UWGL 3HLAB 1Q0YH 4LT7A 5DQ9A 3SKOB 2ZF9A 1IGIL 3AXLA 3T9WA 2AABH 1WD9A 2XTJE 2N7SA 3PL6B 2D03L 1U58B 3HB3C 1IM3A 4KXZI 3KPRA 4JNXA 2EZ0C 1RUQL 2F1BA 5GZOC 1KELL 4MWFA 5ADPL 1OGPA 4X7TB 4RGNB 1Q9WB 3N1MC 5LBVA 2YSSA 4DP5X 1HSAB 3LMJL 3P4NA 1XGQA 4ZTOH 3NCCB 3PU7A 3V4VA 1NEZB 4MMZC 1SLVA 3FT9A 3D4ZA 5E5UB 5AVSB 4XHJC 3BHBA 3L3GB 2EYTA 4PJ8B 2LLGA 3A4EA 4UZSA 4KDWA 1I8AA 2IAMC 2YD7A 3ZHDA 1S2EA 4WKZB 4N87A 1A8JH 5ABDE 4IKNA 5C0RL 3PL6A 2QR0B 3O9WA 4XAKE 4XMVA 2IQAA 2NR6C 4FQCH 4FS0A 1SN0A 3T2NH 4PJ6A 3CH1A 1JF1A 2NX5E 1X5JA 3C5ZB 3SE9L 2ZPKL 4MNQB 1MIEH 4ODUB 1NGQL 1GGIL 1CI5A 3T0EE 4QY8B 2X89D 1G6RB 3H2WA 3I75B 5KUKA 4PYGA 1FZOA 4ZXBD 3ELAT 5CFAA 1R3LB 4ETQB 3TA3B 3TCLB 3WLBB 2AAVA 1ZT4A 4JPSA 1HI6B 3MGTA 5KVFH 1MJ7L 4LP4A 1LP9E 3G5ZB 1SOXA 1P2CB 1MPAH 5TJWK 2YHGA 3ALXA 1E65A 1NGPL 1KYOK 3J2PA 3E80A 3TESA 2X4SB 4EDXA 3EOBA 1UCBL 1A14L 4WZ9A 3KPLB 2VDOL 4H8VA 3PPSA 1T7YA 3CZSA 3KH4A 5FLUA 5DWUH 4M61B 4FDWA 4UUJB 4WJ5A 4JCMA 4QT5A 4OM1L 2F0CA 3L8QA 4JFOA 4LSSH 4MA3A 4M93C 1B6UA 2G2NA 2NXYB 4PJCF 2R2CA 5EU6D 3AG2B 5DZNA 5HDBE 3QUKB 3AITA 3GJEA 3ZW3A 1EZVY 1Z7JA 3C60A 1J8HB 4PCKA 3UTZA 3SGKC 1ZIBA 1I1AC 3T0BA 3TIDB 2J6EA 5B4MD 3P30H 4PJXA 1H0DB 1YAIA 5IB2B 3T3PB 5K9KA 2WXGA 4KXDA 4TSAL 3ULUF 4FXKC 5BZWA 3FYIB 4BE5A 1WT5A 3QFJE 5CKGA 2J6WA 4R4ND 2VMDA 3JV4B 1BIIA 3MGOA 2CUMA 1W0WA 3KWXA 3VB9A 4YIQB 1PYWB 1EXUB 2WQVA 3HBGA 3IJHB 3DROB 2WUCH 1MKFA 2APXA 2XJLA 3IU4L 1XGUB 3HE7C 5H37A 3GMNB 5I1DB 1NC2A 4ZO8A 3KR3L 1TZGL 3IJ7A 1ACXA 1SJVA 4HH9B 4J3OD 4P9HH 3VG9C 4MB4A 3ALPA 4JM2F 4PJIB 1JXJA 3RWHA 3PL6C 3GSUB 4EAEA 2WQWA 4FQIH 4PB0H 4Q0XH 1O7DE 4Z7WF 4OVVA 1SLUA 4KI5F 3WKMH 4NQDA 1K5WA 4C83A 4QF1A 3UZQA 1AO7E 3ZT5A 2DTML 3FB6A 3QEGL 3DTXA 4LO9A 2NSQA 1PY4A 3P4MB 3ZE1E 1E5BA 2H5UA 3QJFB 2VL5A 3L7EB 4AZ8A 3D85A 4F2FA 2GBUA 4FQJL 3VGEA 1NDGB 1FCGA 3I02A 3HFFA 4QLRA 2JQMA 2PW1A 1NAMA 3CPUA 1YECH 3DECA 4HIXL 4LHUB 2HA1A 3L6FA 3M8OH 5I9QB 3Q8EA 5A6MA 1EEUA 3SKJL 4ZQTA 4NKMB 3MLTA 1FNSL 3LOWA 4GFTB 4MJ4A 1L9QA 2W65A 3HCVB 5I24A 1MY5A 5IB5B 3TEXA 4PJAB 4I3GA 3T4AA 1J5HA 4IRZH 1IZKA 2Q86B 3G9VA 3V9EA 5HYIA 2VDNH 4OGAC 5FOBA 3QPXH 4FL4B 4URTB 2H3KA 3VFNA 3Q06A 4JFQA 2FD6H 2VLKD 4M1GL 1GYCA 2YBRA 4OH2A 4R7VA 1LD9A 4PRHD 1N10A 5JIHA 1MCKA 5BVPH 4U1SA 1MELA 3BCDA 4PJ5A 5I6XC 5CCHE 3HIZA 4JJOA 3O4OC 1G1KA 3WD5H 2ZONA 1MCIA 4HFUH 3OVUB 3U0TA 3KPSB 3TJEL 5EBLB 4DGWC 3ATFA 1NAMH 2DQDL 5IMMA 5DDHA 4M4RB 1YDPB 1HCVA 1QFWI 2Z31A 3N1QC 3TIEB 1WJ3A 1Z9SB 4CU6A 4WTZA 4K94C 4KK5C 2HP4A 3TO2A 4AZUA 2PTVA 3APNA 3D34A 3ROOA 5A2CA 2H6PB 4I48B 4F15C 3FB7B 1I1FB 3MLYH 4FQCL 4F20A 1M9SA 2BSTA 5E1AB 2VIRA 4OUOA 4Z7OF 1T21B 3VRJB 4BUHA 2TRHA 1LO3L 4J3BA 2OSLB 1QWHA 4OUUA 3SDCA 2CR6A 1XSKA 1QQDB 1ZHBA 2BNQA 3TN0C 1YPZF 2E9WA 2A3TA 3EO0A 2ROYA 3RUGE 2ED7A 2W0FA 1PMYA 1U92B 4OSUL 1VZGA 3O6FC 1OP3K 2K6WA 3DVNA 4H1LA 4LCVA 3KGRA 4W9EC 5ESQB 1AOHA 5DURD 2OMVB 1HXKA 1UA3A 2LW3A 5TGBB 3WI9A 5GS2H 1HYSC 4CC0A 1IIIA 3TNMA 3NK3A 3T8XB 1BA9A 1MVYA 1R4XA 2WXOA 1YEGH 3BUQA 1ZJBA 2ED9A 3CXHK 2MWCA 4PHXA 4LHUA 3IFLH 5CN2A 3TVMD 4F9LC 5FO9A 3CDZA 1NDMA 1RJZA 3VXMB 3TBBA 3HS0C 3FQWB 2Y1ZA 4WUUB 1TF4A 2V9RA 2BMKB 2A77L 4FCHA 3WDHA 4YN3A 3MNMA 4B7LA 4MJID 3SKNA 4Z7QE 2K7PA 3Q8CA 1J9QA 5D7IF 4HDIB 3QYCA 4JZNB 4QRRE 1K6QL 4J8RB 3S3JA 4OLEA 3FSAA 3F7RA 3H85A 4E9SA 2OTWA 5LDSA 5CBEB 3FQTA 1BXUA 2DKUA 1EJ8A 4G80A 4NXKA 4XCEB 2JNZA 1ADQH 2BOBB 4I5BB 3GSRB 4EVNB 1T20A 3RTLA 3THMH 4JFEB 4APXB 4KKAD 3ZKQD 4PJBA 1TZHB 3LYRA 1WWCA 3TV3L 1B4TA 1H3PH 3WMPA 4X9IA 1YYLL 1KJ2H 2NY1C 3EUUA 4FOMA 2GJZB 4C58B 5B8CB 5HVHB 1AKPA 1PDKA 3GBML 5ES4B 4C56E 3IJ8A 1KLGB 4PJCB 4M5ZL 5CU9A 4HOMA 3V6ZB 2NQDA 2R1XB 1OWWA 2VQ1B 4XNYL 4RLDA 3KYOB 2G30A 4NHUB 4OJCA 3NT0A 1C1EL 2F7IA 1MCQA 3AREB 3O0LA 2MRYA 4OZFH 3UTPE 4PJ9A 1N2RB 1OAZL 25C8H 4JPIB 4MCYB 3QS3A 3P73A 2HT2D 5J11C 4B9PA 2BNQB 1PD0A 4QO1A 3H9HA 2X4UB 3GRWH 4XVJL 1ZSHA 3ZL4L 3F5WA 1BZOA 4N2FA 4LVHC 3K72A 3UTQA 3V5DA 3LZRA 4QGTA 2H4EA 1N8ZB 2VO8A 2CDEA 4XMUA 1URLA 1FN4A 2WVTA 1MWOA 1ZA3A 3KXFA 4AYGA 5EMYA 5HHMD 1NCAL 4XOBA 4NN6B 4AX3A 3FQXB 4PS4L 1N5AB 2CMRH 1CE1H 3IWVA 5E7BA 3DPBB 1CFVH 3FB5A 3L16A 5B3SB 4U1MB 5E5MA 4LOUD 3UXFA 1TJGH 2QZ5A 1KIUA 2J88H 2EEAA 4X80H 2AW2A 1G6VK 4N20A 3SDXE 2GFBA 3NG5A 3PAUA 1AJ7H 1KGWA 2XXCB 4PJ7F 3AG3B 3U6XS 2G60L 3BAJA 2P8MB 4JDZB 4FFTA 1ZVNA 3CVHB 3DXAD 5CBAB 3OKEB 1O5DT 2ZXWB 2ETWA 4HKBA 3D0LA 1DQLL 1H8LA 4GBXD 4JJ5B 4KK9C 4XP4H 4B27A 3ZUCA 1MJJA 1R34A 1YUHB 4XGZB 4X99A 5BRZB 2OR9H 1DBAL 1MCSA 4G7QB 2DQEH 5B3JF 3QO1A 2E7LA 1TG8A 5CJOH 3D18B 4GO6B 5TDOA 3RYMA 4Y1AB 2PCXA 2DKSA 5K59F 4LLVB 3HEIB 4JN2B 1XL4A 1WFTA 3IMWA 2Y36H 2UZIL 2G3ZA 4YDLC 2PXYD 3LKSA 4OW6A 1JI1A 4JUTA 1E3XA 5DHVB 3ZJAA 3RVXC 5FECB 4K8RC 5HJDA 1K8IA 1IBYA 1D5BA 1DBKL 4JFZH 4LLMA 4TPRH 1NPUA 4YBHA 5FGRA 3UJIL 3WEAA 5CEZL 3QUXC 3VYNA 1DUYB 5B7MA 3EJJX 2RIKA 4I1NB 1Y18A 5CMAA 2C4XA 4Y2OA 1MW0A 4DEPC 4L3EA 4PIBA 3NJJA 2K6ZA 3KPRB 4F80A 2EIJB 1JMXA 4WU7A 4L1LA 2HKHH 2JJTC 4MCYA 3S48A 4JN2A 3UJTL 1X5ZA 3NSYA 1XGZA 3OKNA 4JO4H 1U4EA 1E8WA 3L3IB 4YDVA 4BWTA 1XL6A 4JKPL 3VXQB 1N7MH 1E2ZA 5HHME 1N68A 4JQVA 2VXUH 4LSRH 1KBVA 1G6RL 2EP6A 1EERB 1EFXB 2BFVL 1MIML 4QRQB 4D9QD 1UB5A 2QGBA 4FHKA 4KDTA 4XN7A 4JFSA 3ZKNC 4O00A 1T7ZA 3LKRA 4OLUH 1SXNA 2X6BA 1RHFA 4OCRL 2IH1B 2D9QB 4U4IA 2X44D 4KKQA 4Z7UE 4PJHE 3IJYA 3EDFA 2ATAA 5B7FA 3C87A 4HCRA 1F2QA 2G5BB 4PRPD 3EZ8A 3I6SA 1N6QH 2YMOA 3S6CA 2X4QA 2EIKB 2ZKHL 3QEQB 3IFNH 3QXTA 4G6AD 4OLVL 4P2CG 2FJFB 2GFBB 5DGRA 5IREA 2X4PB 3IDYB 3OM3B 2AHIA 5FA4B 4B6ZA 1OOAA 2E76C 1TKWA 2WZ6A 1AGEA 3NFSH 1EEQA 3OKOA 5MI0B 4YHPB 1Z3GL 1KC5L 2A74A 2KPNA 3O0RL 3T8MA 5DMIL 1KXVA 4EE2A 1P7HL 4N85A 4JKNA 1BHGA 1HE8A 1JPTL 4GLRH 4X0KA 4XOAA 3PQYD 3CD4A 5D7IB 3CQQA 3T2NL 3GS7A 3J27A 3L54A 3QARA 5E1HB 5IQLA 1V3JA 5AW5B 5T3ZH 2AQTA 1QSED 3AM8A 1B0GB 1KYUA 5EF2A 2NNCA 3HRZB 4O58L 1OW0C 4UUJA 1PL3A 1Z6JT 3OXSA 3RPBA 3TH4T 4QPEA 4YHKH 4Z23A 3LRKA 4XVSH 4AV5A 4ISVA 5T1JA 1J8SA 4YPJA 4NM8L 1AGDB 1NZRA 2DI8A 3MI6A 4XXWA 5GRVL 5AAMC 2OXGB 1VACA 5J6GB 3CX5K 3O3BA 2UWEF 7TAAA 5EUKB 4YWGL 1E7VA 4L0YA 5F7LB 5TE7L 1H5BB 2IPTH 5JTWA 1BWMA 2EKJA 3O4LB 4QI3A 3EJCA 4P2YA 2QR0A 3O9WB 5LGYA 5GQBA 2R0WL 3O6KL 4FULA 2GEQA 1IGIH 2LVEA 1ZS2A 3KPPB 1IAOA 2Y5TB 4UQ3A 2APWA 5L6YH 2HX8A 1PEWA 1ZHKB 4YL9A 4LAQL 5JHDE 1YNLH 5JUEL 1KCWA 3MLRH 3NIGE 4ZAKD 5IMOA 5A6LA 3SDAB 3IDMB 4N86A 3UPRA 5F9WC 4XRCB 4FLRA 4J5VA 1AE6H 1KCVH 4KK5D 4PBXA 4PRBB 3P0GB 2Z1PA 3K6NA 2J4WL 4AKQA 4DCQA 3PF2A 2XN9D 3D39B 5ACZA 5ESVB 2MQ0A 4JHBA 2Q76B 1RVFH 2XHNA 1CFMA 3GI9H 4YHLH 3AREC 1ZHKA 2WANA 3LEYL 1V10A 1I8LA 1YEJL 1B3JA 3OZKA 2KHAA 3NZHL 1U8IB 4XRCA 2OK0H 5K93A 2CHXA 5I30L 1E9OA 1RERA 4LDEB 3F7QA 3TWCL 5I1KH 5KSAB 3L08A 4K8RD 1SMAA 1ZKAA 5CD3A 1BD2D 4PB9H 3G5XA 4MNGE 3UCRA 4AZ8B 4D0CA 4GSDH 3R4RA 3GIZH 4ZX3A 4IS6B 2K8MA 3HKFA 1M53A 1GHFL 4AMWA 2XN9E 1GZPB 1R3JA 2BOCA 3SPGA 4KFZC 4KKBD 2G4GA 2VM4A 1T5KA 4R3SB 4XXDA 3V0AC 5AKTA 2A74C 2AVGA 2WV3A 1OAQH 5I73B 4L3CB 3AB0C 4KJYB 1RZFH 3ZDZB 4POYA 4OT1H 1MCHA 1HOCB 2OTUA 2YXMA 3GBLA 3ARFD 4JHWH 4ZYKB 4HIHB 1P69B 4YDKL 2QHRL 1KY6A 3HPJB 4GI9A 2HLAA 2KLTA 1HWGB 2IG2L 4Y8AA 3WTTA 2XVLA 4PUBH 4JX0A 3NMEA 1RZJH 5T1MB 3BJ91 5HPMB 2WLHA 1PZCA 1SGKA 4HUXB 5KWYC 2DWEB 3TEYA 4IRZL 2MCG1 4PV8A 1KGXA 2E3VA 3QQNA 5IMKA 1QASA 3MU3A 1HOCA 5IQ7L 3BT2L 1MI5E 5D1QB 2A83B 1DHKA 4FYSA 5IEKB 2ROXA 4JRYB 1TTGA 4MA1C 5J6HB 3AADB 4F1ZA 2XN2A 4MFHA 5BV7L 2UZYB 5KSBF 1KT2B 5E2VH 2CD0A 3NP4A 4PJBE 5H94A 1FGNL 1E6OH 1KF9B 2FZ3A 2P44B 2NY5L 1MFAL 4YVNA 3QG7H 4I0CC 4AYSA 5F0MB 3K80A 5DZOA 1T2QH 5HDOA 1T1XA 2VAAA 2W9DL 4G71B 2KS0A 5DS1A 3ASWA 3GHBH 3WE1A 4L48A 4JR9H 2N3JA 1QQDA 1ZHBB 4UILH 2W0LA 5TE4H 5AKVA 5A40E 5JLZA 3O6FB 4QMEA 4JG0H 3F58L 5E9DD 1F8TH 4F33A 1HN1A 3GHEH 2OMYB 1VF5C 1ND0B 4YMPA 2NX5A 5JHMA 5ESQA 5DJZB 2OSWA 3RWGB 3V0EA 4GG6E 3AXHA 2Z34A 1KIQA 1BBJA 4TNWK 2QDWA 1U3NA 4FFZH 3MUY1 4FQJH 1NGPH 3T8VA 3GC3A 2HN7B 4XX1G 3OKLA 3F84A 2IDUA 4K7FA 2G0LA 3CLWA 4R26H 1FVEA 1QO3B 2XV0A 5K33A 3FT4A 5I74B 4KJWD 3SSGA 4F8QA 2Y7MA 1J5CA 1YDPA 3L3OB 5E00A 3PWVA 5DJ6B 1E4XL 5MENE 3BPCA 2B15A 1TTFA 1YMMB 1YY9C 2BNQD 4N9OB 5EC2A 2DOCA 2EC9T 2V37A 1PZ5B 1ZGLM 2GT9A 2V5SA 4NP4L 1JYWA 1SEBA 4FNPA 4L5FE 2UVFA 5E6ID 3QWNA 4G1MB 3O4OB 4HBQA 4X2UA 1A4KB 3ARED 4ESKA 1ZSDB 4G43B 3RDTD 1ETB1 3PDOB 4U49A 1I9JL 3K1DA 3WKQA 2G75A 3QRGH 4PJBB 3L1EA 4Z7VE 3QDGE 2PPDA 4YNYA 4Y4FC 1HU8A 1UVQA 3LZLA 4KQ0A 1YEDB 5E94B 3Q1EA 1TEFA 2EKSA 3QUZD 2G4EA 5CLYA 1S9VA 1LJMA 2EDFA 4Z8FL 2IFFL 3X3FH 3TIDA 3RWFB 3OAZH 4KI5D 2FBJH 3OJ2C 1VLXA 4P3CL 5D1ZD 1BAFL 3CH1B 1KXQA 3U6XA 1OPOA 4BA8A 1KCUH 3FTGA 4NZFA 4V2CB 5J13C 5E4EB 2WOBA 4RETB 1PKQE 1KB5B 3NDYE 1JPFB 3EJTA 1N7ML 4PJEF 5I18L 2GSMB 2WLJA 4PJFE 4Y4HC 4Z7AA 3MJ7B 3M1BB 5JXAL 5JPNC 1GAFH 3RWFA 3CLEH 3L5WA 4TNVK 3MSPA 3BWUC 4AVJA 3B3IA 3FOLB 5HDLA 3WJMB 1MCJA 4LOUC 5FA3B 3WBDA 4HWBH 1B2YA 1S9YA 3GMNA 5I1DA 4PRIB 1SHMA 4LCCB 3OR6A 3CFKB 1YHPA 1TZIB 1DLFL 2FO1A 3UL4A 1KB5A 2B3RA 4NCDA 3FO0H 4H8WL 1ZLEA 3PE9A 1XCQA 5EZLB 5JW4N 2GI0A 5D1ZB 3TCTA 3LMJH 4LGSB 1EJOL 1NCBL 3MREA 1AHWB 1X9UA 3H0TB 4U1HB 1P5VA 3X11B 1LWHA 4TUKL 1BP3B 4R8WH 3IK2A 2Z91A 1M71B 3MV8E 1VEPA 4HCIA 3O11B 4K5OA 4PVNA 5L2JA 3HC2A 1FNHA 1N64H 2ZXCA 1BZ9B 1WWAX 2XN1A 3KWTA 5HYQB 3H9SE 4QOKB 3FH7A 1BMGA 4NKDA 4UQ2A 4XVUC 4FADA 1A6AB 5BO1H 3G04B 1NCDL 2UX7A 2WWOA 4JY6A 2AJZB 2AJYL 3QFDB 3TWYA 4YNYB 2XBZA 4FG6C 2R4RL 3EO0B 3D0VB 5D6DA 1EXHA 3WNJA 1AZRA 1DQDL 2D4FA 2NZIA 2V8MA 3CFEB 3WEXB 1SXBA 2BSSA 2H2PC 4UI2A 4JHVA 3T71A 3VXPB 5EU7E 4ALAH 3VO0A 1ECZA 1A1NA 3CZJA 4FXLA 3OAZK 3MKGA 4NAQA 5B21A 3C5ZC 1JGEB 2QKIA 2CE6A 2QQKH 4FZ8L 3PAYA 1Z9SA 2NY3B 3H8NA 4XC3H 4PRHB 3RB5A 1MUJA 4DAGH 5GGRY 1ZS8A 1OVZA 4IRSB 4AYID 4DGVL 3KPMB 5HHNA 1L4IA 4DOHE 4FYRA 3EO9L 3DMMA 2HXAA 1Z0NA 2IBZX 4KC3B 5I1AA 4WNQB 3L13A 4X5RA 1DQMH 2VDQL 5AYQA 4MMZB 3KJ4C 2VYRE 5ACMA 2A4EA 3MRFB 4PJDE 3OQ3B 5DHYA 1KBWA 4XVTL 5C6TL 5EDSA 2QHLA 1W0VB 4DVBA 4UM8A 1TVBA 1GYAA 2OJZH 1MHCA 3VMOA 3GB7A 4W81A 4XO4A 1P7BA 2VE6A 2PYEE 3BKYL 3B3BA 5E9AA 5I6OA 2WTPA 3QE5A 3RLSA 1BBDL 4LF3B 4AQ1B 3MNWA 5TF1L 4JY5L 2HUHA 4KY1H 1YYLH 4OCYL 3V0VA 3ZDXB 4NC0B 4AIXA 3QG6B 1IGYA 3V7MA 2GSIA 1UYWL 3A6BH 4NZTL 4ONGH 4JFDB 4HX1A 3HN5A 2OKMA 1GSKA 3TS8A 2NUTB 3ULUE 1JUFB 2EADA 3WFZA 1PS3A 1ADQL 1PSKL 5E1GA 1AOZA 4M43H 3IS0X 4NAJA 15C8H 4O5LL 1DUYA 1GYVA 1DJWA 5AWNL 4EI5B 3DBSA 1RH8A 5D70H 7CGTA 1L7IL 1H15A 2CO7A 5DRNA 1WICA 4F57H 1U8CB 4U3HA 3N40F 1P84K 2WWMD 4PRPA 3STBA 4FZEH 4YFLI 3M7FB 3KMDA 4GLRI 2H3NA 3S34L 1WZ1H 2V9TA 3V4LA 1BQHA 2N0KA 4QR7A 4I3RL 2F58H 1HHIA 3VFOB 3ULSB 1K9TA 2EECA 3TC9A 3O6MH 3STZB 1YECL 1RZ7L 4A7UA 2VH5H 1U3YA 3RGVC 2QKIB 4QHKI 4YSCA 4YZFE 3L81A 3FFDB 5JO5A 3F12A 4KJPC 3UBHA 5FYKE 3UFIA 1HOEA 4JRXD 5C0IB 3PABA 8FABA 5F70A 5KVDL 4UNUA 5CXPA 2XVKA 3MBEC 1HIML 4K23L 2V33A 4PGZA 4MXVE 3VI3B 1TFPA 2EABA 2K78A 2WXQA 3CFMA 4KNUA 5AB1A 3NYKA 3VXSA 4AQAB 5I1IH 4XNUH 5INDB 2VO5A 3CVHA 3DGCR 4N2DA 1X5AA 3DKHA 3T8XA 4NDMB 4XOEA 4S0HA 1OTUD 2FX9L 3ARVA 5DFAA 4N6RA 1FZMA 4XNBA 3JWDC 2V6HA 1NBYB 5CHNA 1WD8A 2OL3L 3JWDH 3PABB 1UQSB 2WUCL 3C2AL 4PSPA 8FABB 5ISZD 2Z31C 5JIQA 2KZWA 3AU0A 4LPUA 3O2WL 4NQQA 4QJ3B 3HTLX 1KCKA 4Y1AA 5GSRA 3RVXD 5C0BE 1NAKL 4M00A 3ZYOA 3CVIL 4PQXA 5D71H 2PCPA 4Z95H 4ZQKA 4BXSV 1UD6A 3T0EA 4YO0B 2G0KA 2B3IA 3VD5A 3QJRB 1ASQA 5D7JA 4YXHH 3K3QA 3G5XB 4BV1A 1NBYA 3HZYB 4PV9A 3C5ZD 3QPKA 1HC1A 2AJVH 2ERJC 4NXSA 3VGAB 3P3YA 4BIKA 5I6NA 1R3KB 3EYSL 5D7SL 1XF4B 4WEUD 3QDHA 2C9XA 2DY2A 2ZUQC 4XNZC 1QUNA 1XH2A 3KYMA 1U6AH 5DHMC 2W9EH 2YC1A 3V4VL 2DAVA 1DQQB 1YPZB 2WLMA 3MNVB 1GAFL 5IM7A 1C5CL 5GRVK 1NQBA 5B8CA 5JA9A 1MW2A 1G5AA 4YHOH 3SBQA 2FQGA 1F8TL 2BIIA 2OTUB 4PRPB 5I5RA 4GY4A 5F7AA 5JIKA 1YJDH 1E4JA 2BIQA 4WO4B 2VM3A 3OQRA 2UYLA 3MUZ1 3GHBL 4WFFE 5C0FB 4TLSA 3ZL1A 4GMTL 3VE0B 4MAUH 1WAAE 3POHA 1IGTA 3Q5YA 4GSRA 3IE9A 1E5CA 3BN9D 5D2NC 3FU9A 1HSAA 3P4NB 2AJUH 4NZRH 1MCCA 3PXHA 3SJVE 3WFBH 4Y16B 1ET5A 2WLNA 4X5WA 2VLJA 4OU3A 1UATA 4P2QB 4AM0Q 1D5BB 1K8IB 4PWGA 4XBEL 3L48A 1TKWB 4LCWB 1VADA 3U9PL 1KTDB 4M3KB 4K9JA 4OIBA 3U4EB 1GGIH 4G2AA 4G8EB 1CUOA 5AOKA 3OKDA 5T8IA 2ZXAA 5HYJB 4FZEL 3W11C 3MLUL 5J06A 4HGKC 1OAUH 2X3BA 1CFTB 1RZJL 3MKKA 4KI5C 5FUZL 4D0CB 5AW2B 3HG4A 3Q2NA 2ZOUA 3UTTE 1MWAH 1YQVL 1B90A 4PV1C 4TNEA 2ADGB 3E8VA 4X6FA 4CBZA 1OCOB 1IILE 2F8XC 2NW2B 3BVWA 5LB1A 1T1ZB 1XMEB 1OAXL 3FO2B 1N9PA 5DRXA 1U9KA 2AXWA 4L3CA 5HGBB 2FR4A 5E2VL 1CBJA 1FJ1A 2SEBA 3QW9A 4M3JA 4TNVF 4MJJA 4DN3L 1FL3A 1RD6A 3T5WA 5KYUB 1F3DJ 1PSKH 1X6NA 3A4DA 2BK8A 2CDFB 2O5YH 1K8DA 1OGAE 3FNKA 3CFBA 4P5KA 4TS6A 5C6PB 5FO8A 1OHZA 1IAIH 2NY2C 5GSVA 4MYWB 3DXAB 3O4LA 2BP5M 3OMIB 3UYOD 4XAKD 3KPLA 5H37G 3DIFB 5C71A 4ZK8A 2ODIA 2PTTB 3EBAA 5JOFB 2IXQA 2YPVA 2PPAA 4NLHA 4U1JB 1M6UA 2RD0A 3GSNB 5EIIB 3TJHC 3EYFA 4HEPG 1KN4L 5TE4L 1NFDE 1D9KB 4X8JB 3BRGC 3MDJA 3FFCD 1FSKB 4JHWL 4PP1C 1DBMH 4NAMA 4OZFB 4Z7WB 3ARYA 3MFGB 3LRSA 1SEBB 3O3EA 5GS1A 1E4KC 2PNDA 3U1QA 3ZU8A 1R0AH 5L0QC 4GKSB 4X7FC 1B2WL 3EO9H 4KHXL 3T0VA 2YMXH 2UY6B 5BUAA 3D5OF 1XEUA 4K8RH 4E9TA 2DYPB 2YD1A 6FABH 1NEPA 3NZUA 1MFBL 2P5ED 3BDYL 4YH6A 3HZVB 3T65B 4IHBA 2P49B 4KK6D 5DEFB 1DVTA 1SFDA 5BPPA 3NJMA 1VJSA 4XPTL 4B0MM 4PY7A 2EDDA 4XN9A 1KNOA 5INCA 1QSFD 5BQ7B 4WRLA 5I15H 1MH5A 5ETUB 3PGCB 5CZVL 4PRAA 3QDJE 4D9LH 5DJZA 3W1ZA 3FT3B 4QOKD 2D0GA 3L3HA 4G42B 2ZCLH 2YSSB 3S36H 2IEPA 3QNFA 3U2JA 2ENSA 4RMBA 5CEXA 3JTSB 5E6IA 2F53D 2VLRD 4BFGA 2H8PB 2OW6A 5C1MB 3FTYA 2V7HA 2Z4QB 1SY6A 2X88A 5DZPA 3RDTA 4GQPH 2PR9A 3D48R 5FCUH 5F3BB 2WZ0A 2WVUA 1E28B 5B38G 3BP4B 3NABH 1KJMA 1PLCA 3HAEB 4CN6A 2ZCHH 5FA3A 1HESA 3OAUH 2OSXA 5E0FA 3VNYA 1G7IB 1NPNA 1NEUA 4U6VL 4FLOA 3W0WD 3ULUC 1OHQA 1BBDH 1DBBL 1DQJA 4H20L 3OXRA 5KANG 3TFKD 1CBVH 1NBZA 3NAAL 4G8IA 4OCSL 4PRID 3HG2A 1UA7A 4YE4H 5FUOH 5D1ZA 5JYMA 5D1QA 3OAUL 3PHAA 2CKBA 4X7EC 1CICA 2JVUA 4HJSA 3RVTC 5KSVA 2QQNL 4POZC 3HMXL 2E46A 3FDWA 4NRXA 4HEMA 3TBWB 4DP9X 2K7QA 3K4AA 3O11A 4FMKA 1WFJA 5CR1A 4G8FB 2ZKHH 5T3ZD 5JDSA 3WDJA 2K6YA 4KHTH 4PGDA 4NJ9H 3WDIA 5FWQA 2BCKB 4MXQC 1LE9A 1O9WA 3WHE0 2NYKA 2UVEA 5DMGD 1RY7B 3MFFB 4ZDHB 5EUOE 2AGJH 4UB0L 3O8XC 4WI4A 1CO1A 1QMUA 1KV3A 2IH3A 3B8YA 2HH0L 4JVWA 4U6XA 5DVMA 2VGLM 1I4FA 3EGXB 4MKTA 3RURA 3FN0H 4G3YL 1JGDB 4OF3A 3WE6B 2E7HA 4U7SA 4PJ7A 3BSZH 4MJIB 2FWUA 4I2XE 2NNXA 5EZOL 5F7HA 5EG6C 1A1NB 4KGLA 3N9GH 1T21A 4LU5H 1MHPL 3FQRA 3O2DL 5E99H 4UM9D 4C56A 4OFPA 3AWFA 4KKRA 3B2UD 3WFEH 2X4RB 4JM2D 3SN6N 1DBJH 1FVEB 3QEHA 4Q9RL 3GBNH 3WJLC 2OMUB 4DN4L 4S0TD 4N0CC 1PEZA 1CDUA 2PO6A 2YARA 3Q6GH 5I6PA 4C59B 1U91B 2FGWL 1O6TA 1OPGL 1P9MC 4RIRB 1DE4A 4G5ZH 5IFJB 3G08B 1DZBA 5I8KL 1DO6A 2Y07L 5SWZA 5IJBC 4UDTB 4LFHG 1GW6A 2CAKA 5LNDA 3VFRA 3UBXI 3JVFC 5LJYH 1MHCB 3VXSE 2FEDD 2BVQA 1DJGA 2XN9A 3HG3A 3B4NA 3CX2A 2PWHA 5KVEE 4PS3A 3BCFA 3C8DA 3D2TA 1S9WA 3TZVB 4WHTB 2XNAA 1LYQA 4BQBA 5DDHB 1A7BA 4GW1B 4BFIA 4EBQH 1Q9KA 1E30A 2W07B 4BINA 2D7PA 1GSMA 4HA1A 3CSPA 3PV7A 1NMCC 1ITBB 2A9MH 2VDKH 3K91A 4GP8B 1XIWD 3HFML 5E8EB 4B7IA 2Y3NA 3FB7A 3O3AA 1QLEB 3SKUD 4R84A 4LSVL 1OANA 2N7AA 1KXHA 1GRWA 3DHUA 5DYOA 4ZO6A 3A3YB 4PG9B 3VX1A 1IBDA 4Z9KB 1QSFE 1MCFA 1YCSA 3ZMEA 4DK5A 3U0WH 3GJFA 3CN2A 2E7DA 4CW1A 1JV2B 3SKJH 4GIOA 2WCSA 4B9GA 2BX5A 3RY5A 3IDXL 3MOQA 1VKXA 3TLRA 4HMDA 4XBGA 2A6JB 2J55A 2ZUYA 1JDAA 1DEEA 3BUIA 4M7JH 3P77A 5D2LE 4FFVD 2R2BB 3BPOC 4IMLB 2WWNA 5AW6B 4PR5B 3VD1A 1TTAA 5B1BB 4C56B 2WSPA 2X89A 1NMAL 2ESVB 4K5NA 2PYEB 5HGHA 1QFWM 2C9AA 1MAML 2P8LA 1RULH 3US9A 5I1HL 4L3AA 1NUDA 2CMRL 2B1AH 4JGJA 3COOA 2XX1A 4ZOCA 4EQ3A 1RZPA 2ATKB 1QNIA 4P3DA 3LCYA 4F8TA 5GS0D 5LGKA 5T33L 3D69B 1P4LA 2HFEB 2ZX7A 3NFNA 4FKKA 2W0PA 4Y4KA 1OF2A 5D1XA 2OZNA 1UENA 2EIMB 1IGYB 1DDTA 1E4XH 4J8RA 3NJKA 3I74A 4HIJA 5GGUB 4Z5RB 1INEL 5IB4A 2HJFA 4NQCD 4J6IA 2WYIA 1L3NA 5EZIL 3ZDYE 3BKJH 2DJUA 1UH2A 2BVQB 4OIFA 3B6SA 3O8XD 1P84J 4I9WD 3WFHB 2IQ9L 4JAMB 5D7LB 3DVNB 1RSFA 3GZKA 4Y9FA 3RZWA 4GRLD 2QKSA 5JIIA 3MBXL 1S9YB 3C60D 1UKTA 1EAPA 1F1DA 3BGFB 2R7EA 4QHNA 1U8JA 1NAKH 1UWFA 1F02I 1WZAA 4ONGL 1MNNA 4HHAA 3IGLA 5C07E 2VJXA 4D9LL 4JY5H 4NBZB 5I0DA 3GMMB 2HVJA 3WMQA 3MRRB 2F54D 3D12B 4MGXA 3H4HA 3D39D 2XQBL 3SCMA 4OQ1A 4NQDE 1DVSA 1MCWW 3KE0A 2BWIA 4U6HA 5GGVY 4ZXBB 2XY2A 4UINL 5F96H 2W8CA 4L4VA 5DC9B 5L2KA 3ZL4H 4WW1B 1T66D 3SDAD 5ESAB 4OF5A 2MOVA 4YOKA 4XB3A 1KGIA 3K6DA 3IDGB 1NWOA 4IW4C 1JN6B 4MNQD 4HKJB 1TQCC 2Q0ZX 3CDCA 1MPAL 3P77B 4L1TA 2VZOA 3DRQA 3CC1A 5I5MA 5BV7H 5EFIB 4OJDH 3QZBA 3F7PC 4IBVA 4OZGE 1FE8L 2KUTA 3VRJA 3L1OL 4PGBA 4A67A 4XC3L 4V33A 2CZNA 3JWNE 1TVDA 4NQDD 2EE3A 2PCFA 4WAFA 1M1XB 1BZ8A 1FZMB 4JFVA 4LCUB 5F6IB 1MHEA 3IDGA 3G3LA 2QMKA 1JZ4A 5GJSH 1G43A 2MJWA 3BP5B 2A73A 4LAQH 3L3IA 4LLUA 3SYPA 4QEGA 4XN2A 4W1TA 5FOJA 4BQCA 4XNDA 3MCKA 4OIIL 2HT2C 3ZDYB 4LLQB 4LCCA 1BFOB 4WW2C 1EFXA 3VFPA 2RACA 5EBWA 2ZYIA 1K3IA 1U4FA 4LRIA 2QGDA 1HT6A 4A1RA 1Y07A 4QTFA 3UTOA 2Y3AA 3DETC 3FKUS 5FB8B 1BWWA 2B4CC 2VXTH 3SO3B 2R56L 1SF3A 3QIWD 1KBKA 3QDMA 5F9DC 4W4NA 1UACH 5L4MA 3VXNB 1X7TA 5DRNB 5T3ZL 4NPYB 1JK9A 4HF5L 2KERA 1EEYB 4MD5A 3H4FA 5I1CH 3QPXL 3ULVC 3QHFH 2WLLB 1GIGH 4IOSD 3MLXL 4PJ8D 1KB5L 1NLBH 4DO4A 1Z3RA 1KACB 4ZUWB 5B39G 1L7TL 1WA0X 2FEEI 1OAYL 1M2OA 2A74B 2CLRA 2AQPA 2F8VA 4KRPC 3PNWB 3BDYH 4AMKL 1D5MA 1GPOL 2IBBA 3DK0A 3EGDB 3NCMA 4HCFA 5BS0D 3O2VH 4ZOBA 1W2KT 1Y18B 4R97B 3VTTA 4EZJA 1XF5B 3VGHA 1CU4L 3GJFK 5MEOA 1QZNA 2JCCE 5GS0C 5I0YA 4KO6A 1II4E 3QCVL 2YPLD 5D1ZI 2DTMH 2FSEB 3MUHL 1EO8L 3UJJL 2RMNA 4GT7A 4UYQA 3PFQA 5KSUB 5TQ0H 4LOFA 4HKBB 1QG3A 1NGZB 4D8PB 1JBJA 3J8F7 4P48A 1OT4A 3RNQB 1CL7L 2HJKB 4EIGB 3DBXB 4ZUVA 2VXVH 5J5EA 4JKPH 3ISWA 2QQKL 1JFQH 4FZ8H 5FDWA 3EYVA 4X6BA 5ICXA 3RBGA 2YSTA 4R97C 2AVFA 1NWPA 4GAYA 3WFDL 2R0KH 4P3CH 4ZAKA 4MLSA 4OD2A 4R0LC 2R0ZH 1B4JL 5DEGA 1SLXA 5IT2L 5DK2A 3HRPA 2VLKE 3BDXA 2AC0A 3GMPB 4O2FB 5CCKH 4ZFZA 1MCOH 3ZRFC 2X0VA 4UV4H 4O02L 1E0OB 4J3OH 2F54B 3KWWB 4X6CF 4MA8L 3ASOB 4PV9B 2DLIA 4XPAL 5BVJB 5AW1B 4E41B 1I9JH 4Z0BL 4BQ9A 1N59A 3AQDA 3D25A 2ZSWB 5IHLB 3ARDD 4HKZA 1AG0A 2OI9B 1RMFL 3Q5OA 3FQ1A 4Q58C 4Z7VB 5CAYB 3VFGH 5KSBB 2IADB 1AAJA 2YD4A 3BP6B 1RIVL 2E6QA 3B83A 3GSVB 3CMOH 3NIFB 5AYTA 4JQXA 2K4AA 4BWWA 2R9HD 3UZVA 2RQEA 2HMIC 3EYOA 5C0CD 2IANA 4NX0A 3IB4A 3KPQB 4UDUA 4ANVA 4EUPH 3IPEA 1UJ3A 1L9MA 1T0MA 2V8LA 1C8PA 1MAJA 1KN2H 3VDCA 5F9AC 3OLGA 4Y1AE 1MCOL 5FV2A 4LOVA 1MW3A 4HZAA 3WFEL 4PLNC 1TZAA 2BY2A 1DLFH 3VFSB 1MHHB 2LLNA 2BSRB 5JIPA 3EYQC 2B0SH 1CICB 1PLGH 2F53A 1LO0H 3MA7B 4HJJL 1AP2B 3NSDA 3ZKSD 3KYOA 2FQDA 5CZRA 5LAXA 4LCWA 5GGVL 4OLXH 3RWIA 3DJZA 2Q9OA 5C0JB 4WO4C 2C9PA 1MJUH 1FV1B 4YHNB 1TCRB 4AM0B 3ZYJA 3VFGL 4BFOA 1U95B 4WI0B 4ZFOL 3LPFA 2DB8A 4TVUA 2IQAB 5DLML 4KNTA 2K45A 4PWJA 4S11A 5T1LB 5FGCB 2V2XA 1A6VH 3VSTA 4XVJH 1Z5LA 5KUMA 1UWXH 4QTHB 4R4FH 3IETB 1FWXA 1JYVA 4KHTL 1CIDA 1S9XB 2CDEB 3KXFD 1RHHA 25C8L 1IB5A 3T6WA 4N5UA 3BEVA 3WUWG 4NO5B 4JFED 3BP4A 2YJQA 3LIZA 1UB5B 3JZ7A 4H0IA 4FFVC 2OQJA 3OGCB 4L8DA 5KS9B 3K5SA 5HI4C 3ILQC 3H1ZA 1BQRA 2PTUA 1JV5A 1W6WA 2PPEA 2X4RA 1MRFH 4MMXC 3T4AC 4ES8A 4M4PA 4NO3B 1N0LA 3NGBB 4OCLC 4N1EA 3FHQA 4KZDH 2EDRA 4LMQE 5ICZA 2Q2LA 5JZ7C 2QPDB 1JZEA 3PWLA 5LKNA 3VRIA 2J6EL 1OP4A 5GRUH 2R56H 3ZZLA 4GBXA 1J0JA 2FH8A 2DBJA 4EIUA 1OLZA 2WQ8A 1RLBA 1NL0H 3VXUA 1I1CA 1NINA 2Y6TE 3Q8AA 4XT1C 3MBEB 5HYEA 4ZMOA 2LR4A 4K7FB 5EEUA 2P5PA 4JPKH 1VFBA 1CU4H 4D3CL 1M7XA 3AG1B 4DGVH 4GW5A 4UM9A 5E2TH 1AQHA 4OLZL 3L2MA 3RGVB 2BY3A 1RQ5A 2H2PD 5ISZA 5IV2A 5IB2A 1UWGH 3WU1A 3KGTA 1OE3A 3CAFA 4RFNC 5AW9B 2QPSA 2CGZA 4FN0A 2H6OA 2OMTB 1A1OB 3IMRA 2MCPL 1DJZA 4NFDA 1JGLH 1H3WM 3RWDB 3QP3A 3V4UH 2GTWA 3ABLB 2JCCF 2GY7B 5EIVA 1VFBB 5J12B 1IQDB 1RJYA 4XMZA 2W60B 3VFVA 4LCIL 6FABL 1JTOA 5I6KA 1UURA 2PWGA 4MD0B 3EFFB 3WNPA 2ADIA 3C5ZA 1UACL 4X6EB 3QZPA 2HTLD 3GMOB 1J8KA 3T2LA 4ZTPL 1FH2A 3V0JA 2D9CA 3FU0A 5BV7B 15C8L 4O5LH 4M9PA 4IDJL 4ORGB 3WNIA 1EDHA 2ADJB 3LEXB 5TPWL 1IGCL 3DX4A 2FT6A 2R9HC 1XO8A 3ES6B 3DO7A 1YNTF 5DI8A 4J23A 4DETA 2Y7QA 4HXAH 1FBIH 2X4TA 4J3UA 2EVGA 1OARH 2IH1A 2V5TA 3K7UA 4G6AC 2W91A 3M86A 2BNQE 3ECUA 5DF0A 4L18A 1WG3A 3SZ6A 1JV5B 1JHTB 2O72A 4FFZA 4N2GA 2P5WA 5JPNB 4IM8A 3C2SA 2IPKB 4NOFA 3WY3A 3H7BA 1MFUA 5D8JH 1FNAA 1O7DC 1ZTXE 3D0AA 5AOZA 2MOQA 3PGCA 3U82B 2GJ6A 5ECGA 4DN3H 3HG1B 4P5SA 3DX0A 5CN1A 4HFUL 1MQ8A 1TYRA 5H2BB 1SRDA 2DJ4A 4ENZA 4HJ0C 4N24A 2AERT 1T1XB 3V6OE 4O58H 5C2BL 5A2FA 1XCTA 5D7EA 4HWUA 4X6CE 5I17A 5C3LD 3FHAA 5D4JA 3K71B 4XMKH 3ZHFA 1EFQA 4J3XA 5GGRA 1ITCA 4JE4B 1KBBA 5AW4B 4CVZB 3IFOB 3N42F 4UT9H 5C0BA 2KBGA 4HIEB 1SPDA 2HFFA 5AZ2H 2AQ2A 4ZMTA 4M6NH 4QRFA 5JIDA 2J2ZB 4GRWB 2EIEA 5KVFE 3P02A 5SX5K 3SKOA 3QXAB 5MEQA 4MTMA 1F4WH 4NM4H 5KANI 1P4IH 5D1QE 2JXMA 1R5VA 5JHLL 2FL5A 5D7JC 4XNQB 1I1FA 4B5EA 1P2CA 3CNKA 3T09A 4D2NA 3FUFA 5DVNA 4QJ4B 4ELME 2YBGA 2FYYB 3MR9A 3GTVA 3RWEB 4MAUL 4HIIB 3BP7A 1HWWA 3UZEC 3QRFM 4Y19A 5HHOE 3EBIA 4PB0L 3HA0A 5DJYA 4X7SL 2WXJA 4LSRL 3MJ9L 3T6QC 3CFEA 3U83A 4IJ3B 4JFOB 4ZMLA 2BCMA 2WBJD 1CDGA 2BSEA 2W0FB 1P5UC 4PRAB 4JO4L 3V10A 1QFWL 1UEYA 4ODWB 4AYMC 1EQWA 5HHPB 4TUKH 2EO7A 3DJSA 4OCXL 2JK5B 5DUBA 1OM3H 4L4TD 3R06A 4ETYA 1HYRC 1NBQA 5I1HH 1BLIA 2XBDA 4E5XB 1MHEB 4UV4L 1G5GA 1IZJA 5E94A 3RZCD 1CXKA 5E08L 4E68A 2FUQA 4PJAA 1JNLL 3IMTA 3SE6A 4CSSA 2H32H 5I28A 3HKZA 3C08L 4YIQA 3CZFB 2D0HA 2NTFB 2XOTA 3KGUA 1EDYA 1O6VA 4XHJD 2V5YA 3WLBA 5FV1L 2A6KA 4WV1B 3QR1A 2O5XH 4BSWB 1BQLH 2X70B 1BX2B 3G6JA 3QORB 4AVIA 3DRTA 2HTKC 4ODHL 1JRHL 4X8CA 3KPSA 4YDIH 1I1RA 4QOKA 4UILL 1BEXA 2VE6B 2XY1A 3GSXB 3TA3D 2LGNA 2XRAH 3X1NA 1URIA 1E5YA 4A2FA 1DQTA 2MKLC 1SM3H 3AS1A 4MQ7A 1KB9K 4HIEA 1EEYA 1BJ1H 4MD5B 4PRNA 5D2LF 2IDQA 4LSPL 3RWHB 3HFMH 3AC0A 3IFPB 3UMTA 3PGFL 5HHXH 1G0XA 3QUKA 4BZ1H 5IF0B 2YUXA 2CLRB 3OHMB 3HC3H 1FQ9C 3CZLA 1KFGA 1TJIL 2DWEA 3FS9A 2ITEA 1T04B 3VXOA 1Q4NX 2X9YA 2HMID 4KTEL 4NKMA 2ITDB 4R5TA 5DU7A 1YAZA 4IQHA 1XGQB 4K3HA 4K0OA 4JGUA 3ZZSA 3IDXH 3KH3A 3L5JA 1CFVL 3OWEA 3ML9A 4HWNA 4JRYA 3HMXA 4LGRB 4PRNB 2RH0A 4JFWA 2BY1A 3KLDA 3ZT7A 1J8RA 2GY5A 3BHBB 3L3GA 4DUXA 4C4KO 5I0WA 1JZ5A 4P3DB 2QADB 4TTDD 2F5BL 2OP4H 4M62L 1CZ8L 3D51A 3A6CL 4YAQA 3QQXA 3MLTB 3UAEA 2TRYA 3S4SB 2VDRB 4NP4H 4ZPVA 2AS5M 1NIDA 4B3VA 1RUKL 3T4AB 2JKNA 1H3TA 3SDDC 3VA6A 4F7TA 1INDL 2VKXA 3B9EA 1TT6A 4KUZL 2VWEE 3CU1A 4GO8A 5C3TA 4TUOA 3QUHA 4MAYB 3VTAA 4PG9A 4Z3TA 2A9NH 5TK2A 5BCAA 3NPSB 4KPHL 3FTGB 3DTDA 4RA0C 1FORL 3DXAE 3L1GA 2CR3A 4GIPD 4Q74A 4WSKA 1KPUA 1P5UB 4OFQA 3VXMA 2IWEA 3WEMA 3CZEA 1W72A 3DYOA 2X4NB 2Y7OA 4HSQA 3VCLA 3WY1A 2LHAA 4HUVB 1KELH 2BH0A 2P1YA 3IE4A 2R7EB 5E5LA 3GO1H 4AQ1A 2F2HA 1SEQL 4WK0B 2OL3H 3JWDL 1QYGL 5CWSB 4UOW1 1A8ZA 1YJDC 1ACCA 4XPBH 3B7UX 5TF1H 4BM7A 2BJML 2CCWA 2EUVA 1N3NA 2F8OA 3T1FA 3KBHE 1Q0YL 4PJHF 1I3UA 1BG1A 2AK4D 3LKOA 3L4UA 2OA9A 1XF1A 4HLJA 4Z76A 3MJWA 3INUH 3LIZH 1BF8A 1ZS8B 5I30H 3GMLA 3KYNB 3PHQB 4TQIA 4PLJC 4LDLB 1TLKA 3K2IA 1G7HA 2V4LA 1PD6A 3Q3GA 5CR8A 4LLDB 2XYBA 4S10A 4HWEH 5C9KA 4XVTH 4FKEA 5C6TH 3QWRA 2M8XA 4H1LH 4NRZB 3LN5A 2AANA 2P4AB 1KGCD 4M5TA 2EJ1A 1ACZA 1F4WL 1H5BC 4NM4L 1EZSA 4ZZKA 2VH5L 1JZ3A 4IIQB 1WITA 4KVCH 1WO2A 4KH2A 4Q8BA 3WXWH 3HC4H 2ITDA 4NZUH 5AW0B 1XVSA 4M6NL 3ZT6A 2AK4E 3QI9B 3U79A 2WLIB 2WKOF 2EVIA 5KBNC 5IY5B 5DFVD 1BVNP 2ICWB 5AZEH 3R0MA 3O8XB 3RZCB 3PJLA 3CXFA 2OZ4L 3DVIA 4GQZA 2CJUL 4JMNA 4R4BB 4ZFOA 3HUJA 4M7LL 3H9HB 1TO5A 2OS7A 3FH8A 5D1ZC 4L0PB 5T3XL 2EXYC 4GG6B 5ANMB 1IAKA 3JWOH 3V4PB 4JGNA 5SWQA 5IBLC 1OP5H 4ONOA 2YAOA 4F7TB 3NH7H 5I2IB 4S1DD 2R27A 2GQHA 1I1YB 3C6LC 4FF9A 5AZUA 4AEHH 1U8KB 3LB6D 4Q6IC 1HJBC 3I3EA 5L2KB 4D0BB 2J6EH 4FQ1H 4FNRA 2KT6A 1QLEH 1AXSA 4XMPH 2HTLC 2DLTA 3K2UH 2CJUH 5D7LD 1YVLA 4O9HL 3TCXA 1OF2B 3STZA 2AEQH 5GRJL 2NY7L 4LSQL 2VSMB 4YC2B 4AIZB 2AV7A 4FYQA 1YY8A 1N3NB 3KEHA 5DA0B 4Z5RA 3T1FB 1UWXK 3SYCA 3V6ZA 2VOTA 1EMTH 2NZ9C 5GHWH 2DTSA 3BWUF 2W65B 1XF2A 3QDGD 3WGVB 3UYPA 1OAXH 1JZ7A 5KYNA 3SPHA 3U4AA 1XMWA 2E0PA 2C3GA 2WYTA 3K6FA 4PS7A 5C0DB 1KGCE 2GKIA 1W72L 4H8PA 4WW2A 3OF6D 1EBPA 3D07A 3RX5A 4I13B 2Z6FA 1OL0A 1D7CA 2NY0B 1JGUH 3MRKA 4ZFFA 5D96C 4WK4B 4BJLA 2GAZA 1FLTX 4F93B 1AE6L 4UAOB 3IDNA 4X9GA 3FQTB 2ESVD 3W9EA 1E4WH 3LN4B 4MMXB 2WIIA 1MFNA 4ZUUB 4EEEA 4JO2L 1DZ0A 3ILPB 2VR8A 4JY6B 1AD0B 1G0DA 1NSNL 2CLZB 4HZLA 3H7LA 4JFEA 4K5MA 4V2BA </