3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
1T4WA 3D07A 1TUPA 4IBZA 4IBVA 2J21A 3VD1A 1EAOA 1TSRA 1GZHC 4IBQA 3WU1A 4XR8C 4G82A 2PCXA 3Q01A 2X0UA 3VD2A 4L0YA 1EAQA 2RMNA 2BIQA 2BINA 4IBUA 4AGOA 2J1YA 5ECGA 3WTYA 3ZMEA 2BIOA 3D06A 5ABAA 3WTWA 1YCSA 2VUKA 4IBTA 5KBDA 2IOMA 4KVPA 2J1WA 1GZHA 4LOEA 3US1A 5AOKA 2WGXA 3EXLA 1LJMA 4AGLA 4AGPA 3WTUA 1EANA 2GEQA 2OCJA 2MEJB 1H9DA 2BIMA 1E50A 1CMOA 3D08A 5AB9A 5AOMA 3KMDA 1KZYA 1UOLA 2ADYA 4IBSA 3D09A 1IO4C 4IJTA 3IGLA 2J1XA 4MZRA 2BIPA 3QYMA 5LAPA 3QYNA 4A63A 2AC0A 2J20A 3Q06A 3US0A 1CO1A 2X0VA 4LOFA 4AGNA 3EXJA 2XWRA 2XWCA 4MZIA 3VD0A 3D0AA 3WTSA 5AOIA 1HU8A 5G4NA 2P52A 4AGMA 3IGKA 4L0ZA 2H1LM 4AGQA 4GUOA 3KZ8A 2YBGA 4LO9A 2J6WA 5G4OA 3WTTA 1HJBC 2IOOA 5G4MA 4G83A 4QO1B 3Q05A 2X0WA 4HJEA 3WTVA 2FEJA 5AOLA 5LGYA 3TS8A 4IBWA 5BUAA 3D05A 4L18A 5A7BA 1HJCA 2J1ZA 3WTXA 2IOIA 5AOJA 2ATAA 4GUQA 4IBYA 2AHIA
chains in the Genus database with same CATH superfamily
2OI9B 2O5XH 4UT7L 4BH8B 3MJ6A 1KY6A 5CINL 3VNZA 3WIAA 1SNRA 4PRPB 3G04B 1BIIB 3TPUB 2F1AA 3D8MA 4KQ4H 2O6FA 5B3SB 3RZCB 1K8DA 2ORBL 2VQTA 3KM1A 2PYEE 3OJVC 1UG9A 4M6OH 4G42A 3EFOA 1L3WA 3JVGA 3VB9A 4DK3A 3DMMD 3LKOB 3S35X 4MBOA 2VW6A 4JO1L 3R7QA 3C2AH 4O02L 2JXMA 4LHJB 2CGRL 4P2YA 1CPUA 2HLFC 4X99B 5T1LB 3GRWL 2J8UE 3AC0A 2UZXA 1MIMH 2MHAB 5BXFA 3B9DA 2WXLA 4JG0H 4Q14A 5F7MC 5FK9A 2FCBA 4AUYA 1R34A 1B0WA 1OQXA 2ILLA 2ZSVA 1JV5A 2Z31B 2ZXGA 4HKZB 2D7OA 4M6NH 2DYRB 3KJ6H 2BVQA 3MHZA 1S7RA 3TGXA 4CMMB 4NKDB 1IAIH 1QATA 5GRUH 4FTVB 4F58L 3OGOE 4KXDA 4W6XB 3BDYL 3VXTB 3C6SB 3MRDA 1I7ZB 2UY7A 2XTSA 2WNGA 3ZSSA 2H3XC 3C6LD 1UZ8A 1ZLDA 1K2DA 2PTTA 3T0AA 3REVA 4EI0A 2X9ZA 4OFKA 4HHAB 4K8RC 1QQDB 1MCIA 1O9ZA 1U58B 1X9LA 2EP6A 3HG1E 3LRLA 2ZOUA 4KRPC 4OLZH 5E00A 4CC4C 5A3IC 2W0KA 3HC4L 3TBTA 3IGKA 3HE6C 3QB7C 2BY0A 5IESH 1MELA 3MRNA 5DHVH 4MA7H 4Q9QL 3S3CB 1PJWA 3ULAB 1R0AL 4LPTA 2HX7A 4J4PD 2WMPA 4YR6B 3FSOA 2UUDK 3TO4C 2X38A 3RVVD 4KJWC 1S9XA 1EHLL 1PLCA 4OY9A 1WHOA 3ARGD 4DGVL 4Y1TA 3M1BA 4GBXD 4WQOA 2DQTH 2J6EA 3KG5A 3UDWC 2XIIA 2AQQA 3GMMB 3T8XA 2XN2A 3EG9A 4LLYB 5J06A 3LPOA 4ANXA 2R69L 4PWGA 2XJKA 4OD1L 4K5OA 2AP2A 1S9KC 4P4KC 4X8JA 4PY8I 4GKZB 2R27A 5BOZG 4GI8A 3G6JA 1TJHH 5JHBA 1FV1B 1Q9WB 2X1WL 4BFRA 3IKCB 1NA8A 1J8SA 2R7EA 3U1SL 5CEZL 3RKDD 4P2OC 1TEFA 2K7QA 3PJNA 5BNXD 1KIUA 4GIPD 3CH1B 1A7RH 2IPTH 1LNUB 4OJFL 3SBPA 3VXUD 4NQEE 2VABA 4QTIH 3B7YA 6TAAA 4UILH 3RWCB 5IV2A 3P73B 4Z8FL 2P8PA 5BRZD 3VDAA 1Q94B 1A6VH 2CO4A 3O9WA 3UMTA 2J55A 2NX5D 5SWQB 4ILDA 2JVUA 3P4OA 1WCQA 4P5RA 3D2TA 1ULVA 1R75A 2WCGA 3BE1H 3FF8A 4N6RB 3RX5A 3NMEA 2AEQL 5CLZA 1EIBA 2ODHA 2BZDA 5CHNB 3FUMA 4XXDB 2RD0A 1C5BH 1PG7L 4WY7L 1JPFB 1IZKA 3IN2A 2IC2A 1FGNL 2J6EH 3GSUA 5AYUL 2OCJA 2X4NA 5D5MA 2XV3A 2ZUVA 4J3VA 4LEXH 3OG6B 1CMOA 1MREH 5C3LD 1PFOA 3QDGA 1YY8B 2Z35A 2I9TB 2WINA 2QSQA 2X4TB 1G43A 2BSRB 4MXQC 1L0XA 2QVIA 1QABA 4X6EB 3O6FC 2GBAA 3KBFA 4ICXA 1IC4L 2WUBL 3EF4A 4IOFD 4M00A 4WFEE 4F37F 4CRPA 4AXWA 3F7KA 4HIJA 4WHTA 3L2NA 3T4YA 3S88H 4F2FA 4X0KA 43CAA 4IDJH 1PMYA 4Y9EA 2C3VA 5F9OL 1PZAA 4ODUA 1DL7L 2WXMA 3GS4A 5E70A 5F1IA 1R19A 4PJ9B 1MFVA 4U6VL 4POYA 1QVOA 4XMPL 2GT9A 1LO5A 4GRLA 3GMRB 2GITA 3L3HB 2QADC 3TIDA 3DUUB 2H3NB 1GHFH 4MNGB 4R83A 1U8IA 4PJHE 3ZLQC 4DK6A 5HI3C 5BS0E 3W56A 4MKTA 4LO9A 4LSSL 4DP0X 3DJTA 3MRIB 3IDNB 3D50A 1QFUL 4MJIA 3GSRA 3WFCH 1T3FA 4F9PA 2P7TA 5EC2A 5I28A 5IBTL 5CGYD 5LBSL 4ODHL 1A6WH 4P23C 3UJTH 2TRYA 2N7AA 1T22A 4CBPA 5E4EC 1EZLA 2A9DA 5ERWA 3QIUB 3W82A 1LLAA 1I3GL 1KLUB 4DCQA 5LG1A 1FFQA 5EOTA 1F3RB 2G60L 5CSBA 4B9ZA 4P9ML 2ZWSA 3RY6A 4AKQA 4PLKC 4XZUB 2F08A 1DN0B 4I0PB 2YFNA 2X88A 3PXJA 1ZT1A 1CFNB 2DQUL 2VLKB 4GSXA 2AVFA 2XZAH 5CBEA 1HILA 2Q3ZA 2YZ1A 3GHBL 3VWKD 5HHOD 1WFUA 1KXVC 2YGPA 3ETSA 5EU5B 1CE1H 3ARFC 3FU8A 2XA8H 1VJSA 3MX0A 4L4JA 4YE4L 1WTLA 3QZWG 1G7QB 1UHVA 4U6YB 3O6KL 1HZKA 1BFOA 1W91A 3BIKA 3F84A 5DJYA 2YAQA 4HJSA 4HJ0D 4U1IB 1J5CA 2LTQB 1MSPA 3CVCA 3QGVA 3TN0A 3VJ6B 1O7DE 2XDHA 3GM0A 5EPMA 5C0FB 1KCKA 4PJ5A 5D2LE 3P9LB 3RG1C 3O81A 4QO1A 2W9EH 2E4TA 2ICWJ 4RESB 1Z9SA 2OQJA 5JUEL 1HCZA 3DTUB 3QQ4A 3WKMH 1QR1A 4LARH 3RZWA 1AGEA 1KCUL 1I7UA 4L4VD 3TBBA 3VGHA 4PB0H 3L5XL 4ACTA 1O7VA 3EYUH 3R4RA 2YUWA 3ZTNL 1PIGA 3O0RL 2R8SH 4MRCA 5K59E 3ROLA 2K8MA 1CD1B 1YEKL 1SXNA 5EZJB 1NKGA 2G2NA 4W9GC 1RULL 4AH2B 3VW3L 1B9KA 4BSWB 4N2MA 4XMZA 1JFHA 2IADB 5LCVL 2DLHA 5L9DL 2F7OA 3V0WL 3NGBB 4YHNB 4KNQA 3IGAA 1WP6A 4HD5A 1K3IA 1WCBB 4R90L 3SKMA 3HS0A 2DQCH 1NC2D 3KL0A 1VCAA 4APQC 2B1AL 3Q3GA 4KITB 3RPIB 4QF1A 4BCXA 1M3IA 1S7SA 3GXPA 4GINA 1UD4A 4JDVB 3I84A 3ZE0B 2DW5A 2ITCB 3OSVA 3FUEA 5A6LA 4ELMB 1R3KA 1OT2A 2C4XA 4L9DA 4OJDH 2ALAA 3WEBA 3CX5J 3GFUA 4OF7A 1PZCA 2RBLA 1HHJB 3TZVA 3CLFH 4I7ZC 5KZCB 1MCKA 5DHYB 4A7TA 3BEVA 3N04A 4G8IB 4H40A 4OUUB 1MCHA 4Z76B 2PLTA 3JWNC 3Q2NA 1HOCB 4UQ2A 1I1AC 1ZA6B 2NY7H 3S5LB 1VGKB 4YEEA 1B2WL 3SE6A 1WIOA 1AI1H 5DFWH 5A40E 1KJ3H 2KERA 2O5YL 5GGTL 3L81A 3D25B 2VDQL 4PJAA 4NIYE 4AEEA 5IMOA 3QH3B 3SE3A 3VFTA 4FQJH 1LO4H 5FKPA 2BSSA 1CJYA 1D6EA 5A2IH 3VI4A 4OCRH 3MLYH 5JW5B 2NY0C 4HH9B 2E9JA 5I5IA 2NLJB 5IFJA 4PWFA 5EO0B 2HX8A 1NGWA 3QXDB 4ZZKA 4Y5YB 1KNOA 4NCC2 4NN7C 4JHAL 4BHUA 3SO5A 5D96B 3FONA 1FL3A 2AHIA 3GXDA 4N3UA 5KSVB 2Q8BH 4TUJA 4KX7A 1R3HB 2XVLA 2VMDA 4LLMB 2BSED 4I18A 3FU7A 2HFFB 5EBGA 4BQ8A 4FXKB 3RB7A 4RX4D 1L7TL 3NABH 3PDOA 4XGZA 5C9KA 1HSAA 3GNML 3V4PB 1RJZB 4M8RA 5DZVA 3S96A 3ZYOA 4PGDB 5IG7B 4BDVB 4N2EA 5I30H 3NFSL 1A1NB 1PAMA 5B3JF 3BP6A 5JIIA 3FXIC 4OKVB 1BJ1J 3CFUA 2WBJD 2V7NB 4W81A 2FEDC 4F7KA 4K9EC 4P3CL 1OP3H 1T7YA 4KROD 3IFOA 5I1AB 4K7FA 4HBQA 4YO0B 1EFXD 1QFWI 2F7QA 4UIMA 2GJZB 4OCNC 3HKFA 3OB0K 4J3WA 1VERA 3FTUA 4ZUTA 4Z7QE 4AIXA 2E56A 1IGFL 4QRRB 5DEFB 2XICA 4IBSA 3LRSA 5CD5C 1UH4A 1LDSA 1DN2A 5JNYB 3QZWA 1JCKA 2BHYA 3PUCA 5A2LH 4KK5D 1I82A 5I0ZA 4HG4K 3X14B 4RA0C 4NO5A 3RL1B 3S3SA 4OD3L 4JAMA 1WAPA 4Z6AT 3BRGC 3BLPX 5KSAC 3NP4A 35C8L 3IPBA 4X0NA 3P4MB 5JQIB 1ORQA 3DV4A 2FD6H 4FEMA 4WGKA 2P5WD 5DA0B 3U4KA 2AK4D 2NYYC 3MNVB 3SYOA 5I1LB 4KQ4L 5IVZB 4JJ5A 1E6JL 3QQ3B 4HWUA 1TCRB 2X2HA 5E2WL 4G8GE 3K6OA 1AIFA 1MHCB 1W0VB 4IU2B 2X9XA 3JWNE 4R97B 1E67A 2Y7NA 1NCDL 4HFWA 1L3NA 2D3JA 2PO6D 1IBFA 3OAUH 5E8NB 4RCAA 4WNJA 4URKA 3WI9A 3C60B 4XAKD 1FJ1A 2PYFA 3BP5B 4A2LA 3BUYA 4QTHA 1MFAL 2AV1A 1WBXA 4JM2F 4JN1H 1FAIH 4Q6IA 2BW5A 4UDUB 4JG0L 3TJEH 3VGAC 4ODBD 2ZXAA 1YPZA 5DUML 5EN2A 4WO4D 5D7LB 2QGEA 2AGJL 3UADA 1F90H 2F54E 2G4EA 1VKXA 5C07A 4Q52A 1YG9A 5TE7L 1BMZA 5F3FA 4XC1H 1IAIL 3P77B 1LYQA 3HA0A 5T3XH 3M1CA 3B9VA 3CV5A 2KS0A 4IOIA 4YC2C 1ADQA 2BOCB 1RD6A 2YSSB 1JL8A 2ZNWA 1O9WA 2H6PA 2W9DH 5JHMA 1UA6L 1X9UA 2ZOLB 3FT0A 4M5TA 4L1SA 1SDDA 3TPKA 5KYYB 1DFBL 3HZVB 3ZE1B 3ARVA 5D72L 3MLTA 3X3FH 2HCZX 4D9LH 3B37A 2ADJA 1QO3B 3HE7B 3JWDC 2XN0A 4OLZL 1MHEB 4AZ8A 1GW6A 4IOSA 4JFFB 3G5ZB 4LU5H 1DVFC 3JUYA 3T3MB 1MCBA 8CGTA 5CZXC 5E99H 1JF6A 3NH7L 4J39A 2OYMA 4N0FA 3UC0L 4WHYG 4YSQA 1JK8A 3D08A 2HZHA 1OY3B 3QUKA 4KGJA 2K9UA 4LCYA 1QHQA 2R0ZH 3KPLA 2L4OA 2NY4B 4S1DD 2J1KA 5IM7A 2PXYD 1TU2B 3FTZA 5JOFA 1U0QA 4OLEA 1PQZB 2GUYA 5D7HA 3BWAB 4FG2A 2EIKB 1WA1X 1FVDA 3PYCA 3HMWL 1P4IH 5KYWB 3KR3L 1KPUB 4XNZC 4WGVB 5BV7L 4XP4H 2X4PB 5EZPA 3GJEA 3KDMB 3RRQA 3KPRD 3EYFA 1KG0B 1ADQH 3HZ3A 2WVVB 1J0YA 3NESA 1PG7X 1ZHNA 4PRDA 3IFLH 5FYJH 2F53D 3QI9C 3ULUF 4N86A 3CFJB 2WUCH 4GXVL 5KTEH 2UWEB 1ZHBB 3T6XA 4QTIL 5JPNC 1T4KA 2GVYA 2CMRH 2KZWA 3L3OC 5GSVA 3KYMB 4FYRA 3SQOH 3MLUH 4UOJA 4NQVB 3CSFA 1VPOL 2B2XH 1H3XA 4EJ1C 1T0NA 4HCGA 1IGIH 1MCNA 4YZWA 1W9XA 3QJUB 1J18A 2XYBA 3O2VL 2OSLB 4ADIA 4XPHH 2X05A 4M7LH 3DARA 3ROOA 3ZZ1A 3D33A 3B9KC 4L3FA 1GR7A 5DD5L 4KDTC 2FX9H 4TYUA 3L4YA 3QDMD 3ZDXF 4BIKA 4PJEF 3KBPA 4ZRGA 3VDBA 1G6VK 2HVKA 3KE0A 5G55A 4XVOA 3TA3A 1REIA 4LSTH 4ENEC 4JMXA 3TO2B 4MCZB 1G7IA 4YGAB 2UZIH 1U8OB 5ELIA 2PYEB 3V0DA 2UWEF 4G71B 4LIQH 1J5OL 3MA9H 5A43C 4XX5A 3D85D 2RCSL 4N9OB 2DKUA 3QWRD 4RH4A 5BZDA 5CCGE 1OZTG 3HHSB 1XEUA 3ILDA 3ZKSD 3S88L 4KJQD 3UFIA 3NIDB 1T7XA 3BWZA 5F0MB 3JT0A 3RGVC 4ZS6C 4B9JA 2F8VA 3MRRA 3DNKA 5JMRA 4DKAA 1GGBL 1JN6B 3HI1A 3IE9A 4X6BA 2HT4D 5IHZA 1OGSA 3KYNA 4NLAA 4PTUA 4BZ2L 1JWSA 4DKFL 4HIXL 4YFEA 2Z64C 3LIZA 2RFXA 2AQPA 2IGTA 1S5HB 2WZ6A 4O02B 1H5BA 4PI2A 5DGQA 3EYVB 5AZUA 1KZYA 3RILA 3SGEI 5C2BH 1UADC 5CN3A 2N0MA 4AWJC 3FT3B 1A6WL 2NW3A 5C86A 2E5EA 4KFZC 4LHUD 4XNUL 1IBGH 3OXSA 3IF1A 4B60A 1D5ZB 3IMRA 4LOFA 1EK3A 4RGMB 4JO3L 5DFVC 2D8KA 2OMYB 3QRLA 4BH7B 1MWAA 3E1ZA 4HWBH 4NPJA 3VM5A 3CZKA 1G5GA 1A8JH 3MTXA 2FO1A 2QQQA 4PS4L 1I31A 1QWUA 2JKRM 1KGIA 1VCBC 3AT8A 5AVXB 3MTRA 1CE1L 4I3RL 4P5KA 3RWDB 2XA8L 1NMBH 4QHLA 3QNFA 1DBML 3V5HA 1DCEA 3MRLA 4OZHF 1HXYA 3GMQB 3PGFL 3WTTA 1FDLL 2OCCB 2YXVA 4GAYA 4TL4A 4N28A 3SDXE 3L3IA 3DSNA 4G7SB 4JM0A 4WSKA 2X3AA 3E2HC 3T0VA 3HFMH 1E9OB 3QCTL 4YSUA 4ZAKA 4DO6A 5J6GA 3RVUD 2XFGB 3LIZH 2BVEA 3KXFB 3Q8CA 3IDXH 4F2MA 4L18A 4YAQB 1E3XA 2FWUA 4P06A 4ZFOA 3IMBA 5FYLE 1INEL 4PB0L 3L6FA 3EYUL 3F7VB 2GW5A 3PABB 3WKQA 5AENA 4H20L 2R8SL 1YYML 3NCFB 1BW8A 5D7EA 4RAUB 4HK0B 3V0AC 3GUTA 1EZUA 3OKKB 3I2CH 5TF1L 4O4YH 1KXTB 3VFGH 5DDHA 2VLRD 4AENA 1YEFH 2F8XC 1V7NL 1PF3A 1WBZA 2UXGA 3X1EA 1ZXQA 1MWAH 5D1XD 2OYKA 2ZCZA 2DQCL 4XP6L 2HJKA 5TJWK 2JCWA 2AZUA 2C9XA 2ITEA 4QOKB 2E74C 1OE2A 3D5OF 2J1YA 3QEQE 1JIBA 5DR5L 5A1AA 2Y9RT 1JZEA 2C5DC 1P5UB 3D06A 2N01B 4YDIH 1NOAA 2VUKA 2MQ3A 5CIPA 2E7DA 2E9WA 1MFMA 2VN5A 4LFHD 4F8QA 4WHYH 4R84A 3RHWK 3CLFL 3QXAB 3OX8B 1CDBA 4QJ5B 1CFVH 4MNQB 3GZKA 5DQDH 1BPLB 2YRZA 2ENQA 2FYYA 3GJFA 4ISVB 5IR1B 3LS4H 4RZCA 5TDPB 4GRWH 4AEHH 1QPKA 4UNUA 1OM3H 3WD5H 3WIHA 4OI8A 4I2XA 4JFOA 4J3OG 1KB9J 4A55A 4CGUB 4XXCC 3UAJD 2ZZUT 5IJVB 1KDIA 1XBDA 5C6TH 1AI1L 1J1XL 2CR3A 2VE6A 4FJYA 2CRMA 5HPMB 4AI7A 2JELH 5KG9A 4I3SH 1JPGB 3CZJA 5EU7C 3QEHB 4LDEB 3HVNA 3FUIA 2DH2A 4GJTB 5AW5B 2DTMH 4LF3A 3NSXA 3ZHFA 2H26B 2BVPB 4H0LC 4RNRA 4LLVA 3F62A 5E03A 2IIJA 1OSZA 4QXGH 1FFPB 4LPWA 2EZ0D 5IB2B 2CU9A 4PJHB 1IZJA 1M9SA 1KIPB 2DIJA 4G6FD 4GW4A 5DCCA 5MEOA 4JFQB 5JHDE 1F1GA 1MFCL 2XQYG 5IB3A 3WFDH 1FE8H 1XGUB 1DUYA 4N1HB 1TITA 1UXLA 1YDPA 3E8UH 1NBVL 4JQXC 4NRXA 3AWFA 3FN9A 5CIPH 5AVYB 4XH2B 1YO4A 5ANMB 5TH2B 1IGYA 3GIVA 4P9HC 1YEHL 1C12B 4HHWA 2A6IB 5DXWA 5FCUH 2VUOA 2YPLD 5I1DB 1DEEA 4UQEA 5I30L 3GJFH 4LAJH 5FECB 2PPEA 3VWKC 4FQCH 4LRIA 1G7PB 4MYWB 5EUKA 3WIHH 3VXOA 3WKPA 1BZEA 1SVCP 5J9PA 3MJWA 1E9QA 3IJ7A 5DWUL 2FDBP 1BOGB 4HZLA 4K3DH 2OAAA 3ETBF 2JJTC 3DYPA 1PZUB 1GCFA 3IDMA 1KACB 2E9GA 3D69A 2Z7ZA 1TCMA 4WTQA 1TF4A 3O3AA 4P2OB 3WXWH 4ADGA 4NFBA 4LEEA 2VB5A 5AKVA 4CU8A 4H25A 4Y19E 2ZP9A 1GOHA 1S9YA 3VWJA 5D2LB 3ELQA 5DHXB 1WDAA 3OKLA 4ODWB 4PD4J 3DVNA 5F2FA 4C8XA 4Y2OA 4KY1L 1I7TA 3B2VL 2DQJH 3CLWA 5GHWH 3VD5A 3LVEA 1OPGH 4WCYH 5EFIB 1D5XA 3F5WA 1JDDA 4P2QE 3GSNA 1N64H 3BFQG 4HU2A 4JRXA 3UABA 1PZSA 1CR9H 2V3EA 4QRPE 1LQBC 2Y07L 5GIRA 4Q0XL 3HC0A 2MTPA 2ED8A 3MLWH 2NZ9C 1E65A 1T2XA 1TPXC 3IJYB 1NFIB 4UI2A 3GMPB 3SE8L 1E4XI 4JY4A 3VRJA 4WEBH 1S78D 4TNEA 3S3JA 5DO2D 4AW4A 4F7MB 3RNQA 2XG4B 2OMUB 5JQ6L 2FT8A 2AV7A 3MLRH 4HEMA 4WKXA 5T5NG 2X5PA 1YUHA 5HDBE 1L9PA 1O75A 3EXJA 1DE4B 4Q56A 1F0LA 2HN7A 3NTCH 3FFCA 1PDKB 3V6FB 3EHBC 1RHFA 4DTGH 4HUWB 4P46C 2Y2YA 3RWEB 1NUNB 1ZS8A 4HDIB 4IRSD 5EU7E 5I74C 3MXWH 3MBXL 2OMVB 2BHFA 2O5ZH 5B39G 2MFNA 3UBGA 3HG1D 1XGPB 2YEVB 1MPAH 2OKMA 2ZKWA 4DOHB 4L8CA 2A83A 2QADB 4NZRH 3LV3B 3QUXC 4N2AA 3GHPA 4O2CA 1QHOA 3M8OL 3TYFA 3FB6B 4CN4A 1I4FA 5IVXA 4FNLH 1ACYH 4C58B 3QWOA 3GSNH 2FJUB 2YA1A 3F58H 3LQAC 5HYFA 2CIKA 2UX6A 4GAGH 5GGQH 4ZSOA 5I5MA 1TMQA 1INQA 5HYJB 3MO1B 4JZNA 1CFTB 1U8MB 3BQUC 2FJGB 3WJMA 1S7UA 1OOWA 1Z9MA 2H2PD 3C08L 4XN4A 2W0FA 2R2HA 4UQ3A 2WLLA 1UJTA 3NAAL 1B3JA 1D7DA 1ZIAA 3ESOA 3PGCB 1GYAA 1ZVYA 4MQXC 2XV0A 3QA3A 3CHSA 4PGJA 5KVDE 5C3TA 4WWNA 3TH2T 1G9MH 1BG1A 5JHLA 1AZNA 3EBIA 5F0LB 5B7EA 2GAZA 2IALB 4BFIA 2HRPH 3F65A 1RJYA 3KPNB 4JM2C 4TVPH 4W6WB 2ZD0A 5FLVA 4XT1C 5F7DA 2Y5EA 2XQYA 3UBXB 3M45A 5BJTA 4PREB 3B2MA 3RTLA 4NRYA 1TTUA 3TTSA 4L0YA 1KIQB 4DNLA 1JP5A 4ORGB 4NQED 1S7VA 4YFLI 5JZ7C 2BFVL 1E27B 1NL0H 3V4UH 1AQ8A 5C0EA 4NRZB 2W59A 5J1AB 2F15A 1CE6B 1P4IL 4M43L 1IQWH 2ETWA 4NSKA 2FK9A 4KMTH 3II1A 2VSMB 2ZXEB 1GTNA 2BNRE 4J3OH 4ANWA 1BJMA 1BHGA 1VF5C 3VFRB 3I9GL 4W9ZA 1F3DH 3IFLL 4ZW3A 3LZFH 1DQQB 3OLDA 2WUCL 5KTEL 3Q5OA 2EDWA 4B7LA 1JOIA 1IAKA 4PY7B 2Z3FA 2KYIA 3A47A 4XX1E 3ZBMA 2HLFD 1SMDA 2BOBB 4AZUA 5KVFH 4QHNB 3O4LE 3L4XA 2R0WH 4FQXC 3SQOL 4QYOB 3H55A 4LLWA 3QNYA 5CSZB 5FOBB 3FFDA 5DZNA 4HKJB 5JHLH 3FQUB 2VMEA 1IGIL 1LTXA 1YEWA 3V8CA 4NQDD 4NQSA 4YGVA 2J12B 1XF5A 3GSVA 4WFED 4DAGH 5DJ8A 4JG5A 3SKNB 4KKLC 2H0FA 2C1PB 3CFBA 3TT1H 3V52L 4XNYH 5IOKA 4GYBA 1U92A 4U1MB 3S98A 2ADFH 4L3EA 4QRBA 3EH1A 2XXMB 4JFDD 5C0CD 4AITA 1F6LL 4NJ9L 1JHKH 5E2VL 1SJVA 2G3ZA 3AREA 2ZYHA 4WEMB 1XIWB 3VACA 1C5DA 3JTBA 4J1UA 4JRYE 2ZCKH 2XVBA 3MV8B 5FO2A 4P2AA 2XWBA 5BS0D 2GIXA 3L5WB 4UOW0 3GKZA 4RFEB 1IC5H 1Z6JT 4KRPD 2VXSH 5IEKA 3I75B 2XTJC 4JDTL 2JK5A 5A3ID 1IX2A 4MJ2A 4P2CG 4WK2B 4LHUG 4M7KH 3ULUC 1OAUL 1NCAH 3HE6D 2Y6SC 3A3YB 4UDTA 5D1QC 1HK6A 1AQKL 1T0OA 2GJRA 4IMLA 3JV6B 3GI9H 2Q5BA 1HC1A 4NP9A 5F0JB 2EH8H 4TNWF 1YA5A 2EDRA 3TO4D 4U05A 5HDLA 5I17B 4KJWD 2G3MA 4TUKH 1C9SA 4LOUC 43C9B 2F54B 3BRDA 5EDSA 2QKIA 3DK2A 3GBNL 3MCLH 1I9RH 1ASQA 1THCA 1ZJAA 2UXTA 1ZJBA 1XF4A 5B39A 3MJGX 1CG9A 3VTAA 5C2BL 4LLQA 4U49A 4AM0Q 5HD8C 1FNEA 4P4KD 1VACA 3CZFB 3QDJD 2C3GA 4ONGH 1YUKB 4Q74A 5FO9B 4KZEH 3IDGA 5C0IB 3GIZL 1EEZA 3ARWA 4TSCH 1AGDB 3SCMC 1J0ZA 5EC1B 4LB8A 3WEAA 2P5ED 3LN5A 1A2YB 3EZ8A 1HX0A 5J11C 4UM8B 1MH5A 2A5UA 4R5TA 3ZK0A 3GK8L 3IVKA 2CR0A 1YNKH 3ZOAA 3O8XB 5IBUG 5B7MA 3KGTA 3MKGA 6FABH 1HHKB 1U3HC 1M56B 1CIUA 3UPCA 2EO9A 1CT8A 2E3VA 2FBJH 1MQ8A 2WGNB 1EZVY 3DX6A 3FRPA 3WSQH 2EDEA 4R9HA 1FYHB 4YMPA 3UG3A 3DUSA 1CF1A 1GOGA 1HOEA 2NSQA 2EE9A 4R0LC 5ACZB 2DLTA 4JFUA 5IIEB 3PPEA 3APNA 1BQLL 1I1YA 3AS1A 3QAZB 3ATFA 3WYRA 1N8ZA 2I27N 2WBWB 4EN3A 1B0IA 4MB5A 4RAVA 1QRNB 3DIFB 3FBQA 3MBEB 2CPUA 4UF7C 1HXMA 2V2WA 2PW1B 2BIPA 5IVOA 1VFOA 5F97E 4QRSB 1RFDL 5IMLA 3EFOB 2YUZA 4M8QA 5E95B 2EKSB 2CD0A 3BWSA 4MA3A 5IQLA 5C0DB 3LIZL 2GI7A 5IHWA 1P7QA 3SKJL 4MMXA 1MVUA 5I15H 3FRUA 4UCFA 4KVNH 4XHQA 1RIVL 4HIPA 1WAEA 1BEYL 1OAKL 1WE5A 2FO4A 1JZJA 4PJCB 4JANB 3SDDC 5EEWA 4MXQD 5KSAB 4ZMVA 2BHZA 1CXKA 3NCMA 1FC2D 3HLAA 3O6FD 5FK9B 3ASNB 4F8NA 1KTCA 1QUNA 5B22A 4NNYB 3DO4A 3ISWA 1KLGA 4D3CL 4KNUA 4LBEB 5BV7B 1RK7A 2X4RB 4HP5A 2DQEH 5CN1A 1KJ2L 1BVNT 2B3IA 2Y25A 3NRPA 4OI9A 5K39A 1E6OH 1TDQA 2BY1A 2UYLA 1G9EA 3RGBA 4N0UE 3H8NA 1JXDA 3QFJA 1FSKC 1RZFL 1W0WB 2KC0A 5HI3D 5BCAA 1TETL 3REVB 2NNAA 4PJGA 5AD0A 1U4FA 1OO2A 3SGJC 2XTJE 1W8OA 3D3VE 4X5XB 1LL1A 4YDVA 3GSXB 2CJ3A 3ULUE 2EVIA 1YZZA 4K5LA 1RZIA 2X2UA 4JQVA 5DQDL 1OTSC 4P23D 5G5DA 5DUJA 5D1QE 5T8IA 3ZYIA 1TUPA 3RE0A 1XXDC 4IRZA 4M7JH 1TIUA 4ZTPL 3QUYB 1G9NC 2QPFA 1UTDA 5TTRA 4UQBA 3QK0A 3CHXA 2J2ZA 2IH8A 1XD0A 2L0DA 4ZFOL 4E0RB 1SEQL 4M4RA 4DGIL 4WF7A 2HKFL 2JELL 3KLQA 1NPJA 1IGMH 1NGZB 4KHXL 2ENPA 1IKFH 2BSTB 2FWOA 4HWZB 3ZDXE 1QLFA 1E5UI 3ARFD 2ENYA 4NUQA 4OJEH 4ZMYA 5GQBA 4GUCA 5D71L 4DEPC 2ZT9C 4PW4A 1SXCA 3J2PA 3DTXA 4Z7VA 3IFPB 4K3GA 4Y8DC 3SHSA 2Y5TA 2VQUA 2BVOA 4DVRH 1SPDA 3WFDL 3O45A 1B4JH 4FFZA 2CUIA 3WENA 2X6VA 5KYXA 3PF2A 2IAMB 3TJPA 3L4TA 5GJSL 4KQ0A 3BYYA 3FO1A 1J05B 2V2XA 2FWLB 3GB7A 2GUOA 2Y7MA 5FCUL 3GEWB 5KBLA 1QTSA 2DBLL 3N06B 3U6XA 1UWFA 1P5VB 4IRZH 1SOKA 1JNNH 2I85A 3HPJB 3D4ZA 1QWNA 2MCG1 3WIHL 5KOVC 5I1EH 5EEZA 2V6HA 2IANA 2OV0A 3AY2A 3EOTH 4R6UA 4KWUA 3TBVA 1EO8H 1UWEL 2VN3A 1FO0L 3UPAA 3G6JF 2FIKA 3RI5F 3BXNB 4CA4A 1DLFL 1OE1A 2AXWA 4LCWB 1B9ZA 2IPKB 2X4NB 1HEZB 3EYOA 3RUGE 1J12A 4AMWA 1CXEA 2VAJA 2BP3A 4APQD 4YWGH 2EE6A 2NCEA 1Z3RA 5ESVA 1BEXA 2KDYA 5HJ3B 1MCDA 2BNQA 2WINB 1LEIB 4MB3A 1QW8A 2E0PA 2P5PA 3CN2A 4EI6B 1VZHA 5JPNB 2DQHH 4ZXBA 3T4YB 4AIZB 4E5XB 4G8GD 5AOLA 5M95B 3JTTB 4XB3A 4FFZH 2ENSA 5FF6A 4DP8X 4LAQL 1R9FA 1Q1PA 1JYWA 4XMVA 5FB8A 1OCOB 1I1AD 5AQ0A 5F1IB 1MCEA 4NM8H 5CLWA 2GT9B 4JFXA 2FATL 3QIWC 2JMRA 4YH6A 3FQ1A 2GITB 4OZHE 2VERN 1CLVA 5T1JA 3TCLB 5FA4A 4MD0B 3B9KB 3DYMA 4GMSH 3CHOA 1E4KC 4UTBL 5D5MF 3E80A 3T9WA 3ZW3A 5D2NA 3U9WA 5IKCB 3CE1A 5L2JA 2NY0D 3VMNA 1D6VH 3NN8B 2GBUA 4HJIA 4MAZA 4O51A 5DJXA 4PG9A 3EGDA 2MRYA 4JKMA 3PIQA 2V5RA 4N25A 3QEQB 5FFOA 3RDTC 5BQ7B 4PS8A 5FHBL 4JCLA 1ES0B 5IQ9A 5HVHC 2FLMA 2ZXDA 5T1MB 4FQ2H 4KBPA 1MOEA 1FFNB 5C0JB 1BZ9A 5DVLA 3G5YA 4MCYA 1T1YB 2JI3A 1N3NA 2ZSWA 4JLRB 3ZHKA 4JKWA 5FECA 3BSHA 1UWGH 4OFVA 1KTDA 4DTGL 3BMWA 1RZKL 1W72L 1VLXA 2NUTB 5CGBA 1IGCL 4PR5A 1IAIM 3EYSH 3K6DA 2JNZA 4N2CA 4HUXA 2O5ZL 2AQTA 3O0LA 4UTAA 3VFPB 1YNTA 2OMWA 5IMKB 1M05B 4TNVF 4NZRL 3DGCR 4YVUA 5LAXA 4WI9A 2I7OA 1IILE 4F7EA 2NYZA 4KPHH 1RUAL 2VDNL 3MUY1 4FNLL 4EDXA 3VFVA 1BM3H 3CFCL 1M6UA 3BIKB 4KAQL 2FEDD 4O58H 5DO8A 3WAJA 1M7DA 3V8OA 4GUPA 3FB5A 2VMFA 3ARDC 1M1XA 3FCTB 3K2KA 3KPMB 3FQ4A 4KVCL 4PJDA 1U8QB 1MLCA 3FTWA 4UOW1 3REWB 4GEJA 4DVBB 5I5JA 1D9KC 2JQZA 2CBTA 5F7YC 3KYKL 5AAWC 3K72A 4WUUD 5CD5D 1XCQB 1G9ML 2OYPA 3OMIB 4I0CC 4A2MA 2BP0B 1IM9D 1YEDB 2AJUL 3CIAA 3JV5A 4LCCA 4CVZA 1I85C 3AG3B 4TVPL 1KPVB 1VFUA 4ORZC 1H8NA 5B8CB 1CICA 3JTSA 4AE0A 4UM9B 3MFGB 5C8JB 5F9AC 1GMIA 5E8DL 3KLHC 3TVMA 3GMLA 4JBSA 5CBAB 1P1VA 3FYEB 4UTAH 4U1HB 3UTZA 1JZGA 4FFWD 4GS7C 4HXBL 3WLBB 3L4WA 4YQXH 3WFHA 3ZRFC 3NIFB 2X1XR 1NCOA 3C5ZB 3SE9L 2NYYD 2N4IA 4NWTL 1ZLEA 3SDYL 4JO4H 4KMTL 5I6KA 3EUDA 2ATAA 2WK2A 4N5EC 2IQAB 2HG5B 2AQRA 4JFSA 4X9IA 2AABH 2HUEA 3ZIYA 5DC2A 4G9FA 1CU4H 4V33A 1MFEH 2A3TA 4EI6A 2EYTA 2Q9OA 3GLEA 1RPKA 4KHTH 4L48A 4LCUA 4BYHA 2HVJA 3QIBB 5JR1H 5E08L 3EO9L 2ED7A 1FL5B 1BV8A 3FO2A 3QPXL 3RLSA 2MOQA 4F24A 3PL6A 4JZJC 1FNSH 4DZ8A 4Y19B 3DO7A 4LOVA 1ZLWH 3D34A 1X4XA 1CBVH 1NJ9A 4NN5C 5KVFL 3MXVH 3OF6D 2CCVA 1IEHA 2G2RA 3MU3A 4BK8A 5JW4N 5BMFH 1C08B 2ZAIA 3EFFA 5LNDA 1K4DB 3DRTA 1NAML 4TQ8A 1J1OL 3WGVB 4NWUL 2XG5A 4YN3A 5C0AE 4RISH 3RVTC 4P2QB 1F97A 3BD4A 1BF5A 4QDGA 4ETQB 2Z65C 4TUUA 4WEEA 4IU3B 5EO9B 1OGAA 3KJ4B 2D7TL 3RFZA 3IDYB 5EZOH 3FONB 4HAFA 4FGMA 4H5SA 1PKQA 4U7MA 2CKBB 3DX8A 1AY1L 5KVGE 2NPLX 5DJCB 3TWYA 1FZJB 4JMNA 3FU7B 4OVUA 1ET8A 4Y2DB 4DEWA 4K3JL 2JTDA 4N6QA 3AXIA 2DQGL 5D6DC 2GIMA 4JDZA 1QFWH 3CFDA 4ONHB 4XGZB 5AYTA 5HDBB 4KUCF 4QNPE 4IRJA 5K9KB 1XGQA 3ARBA 1IQDB 4PJAF 1GZQA 1UT9A 4G59C 1HH9B 2HT3C 1DVFD 2IDUA 3HNTL 1XF1A 3O2DA 2MNJB 4WI4A 4CAGA 5L7XH 1INDL 1Q1JH 4KX8A 3VI4F 3MV9E 4E9TA 1I7RA 2AK1H 3VGEA 4FXGA 1B90A 2JJWA 4K0OA 2JCCB 2ESVA 2EH8L 2ZAHA 3GTNA 2FTAA 2CK2A 5ILTL 4TUKL 3O11A 4I4WA 2NQDA 3II3A 4HUCA 1FPTH 2XA3A 3IFOB 4G8FA 4GEIA 3DHJA 3WNMA 1N5YH 1MCPH 2VGLM 3MCLL 1YMMD 4C4UA 3SBWC 2F7PA 3DX2A 5FO8B 1BAFH 1OSPH 5IMMB 4AK1A 5AB0A 4EEEA 2XRAH 3KVDD 3GGWA 2ICWA 5MP6L 3NDYE 3OLGA 1WT5A 3N43B 4GSUA 4R8WH 1RP9A 2W94A 5JOEA 3W9EA 5JIDA 2MOVA 3VXMB 4NQCD 1AR1C 2VDRH 3FN0L 2CBMA 3L3GB 4IBLT 3D39E 2XETA 2B4CC 2JQAA 5E9DE 4ALAL 4PJ8D 4AYBA 5TDNB 4JAMB 2WQRA 2FBJL 2JCCF 3QI9D 4GG6A 3ILPB 5HYEA 1L9TA 4B3EA 3CAFA 1RHHB 4RDBA 3V0HA 2LV4A 4FG0A 4JO2H 1Q9KA 3HRZC 3TV3L 2FUTA 4PW9A 3WHE0 3N6YA 4L4TD 4NKOA 2W88A 4HUVA 2HTKC 4RFOH 2HVBA 5FYLD 4UV7H 4O9HH 3QNZA 4HMEA 1VSCA 4K5NA 4FC3E 3UTPE 2Z7WA 3TF4A 4LSRH 4GFTB 5BZZA 2LHAA 3QJVB 2WKGA 2BY2A 5SWZE 3M07A 4U1GB 1A9BA 3C12A 3B1TA 2NUPB 3QARA 3V95A 4Z77A 3OMNB 4AQ8A 2B15A 1CVSC 4ENED 3SDCC 1QSFE 1XO8A 2FR4B 1ZVHA 3MGTA 3GHEL 1WBXB 1XH3A 2XN9B 15C8H 3S34H 4CNIB 3L5HA 5EV7A 2BNRB 3F6JA 1Z9OA 3LYRA 5HGGS 3L2LA 2QQKH 4KXBA 5F6IB 4N20A 2EXSA 2PTVA 4X7TB 1SLUA 1MRCH 4XN2A 1FFTB 1F45A 2GSGA 5EU6E 3U2SA 1F4YL 1E8WA 4DUVA 3MUJA 1M2OA 4HF5H 4NNXB 2V5YA 5EIQA 3BN9C 2DQEL 4IOIB 1IEBA 1MRFL 1TPXB 4LZKA 4LKCB 3AY4A 4GFXA 2WQVA 2XZZA 3AB0C 1TFHA 2VDLB 1FLRH 3PHOB 5CJQL 3IJEA 3T65B 3VSVA 1TJIL 1A65A 3MLTB 2ZG1A 1XGYH 4X6FB 5C09B 2ADJB 2DQMA 2LLNA 5FGBC 3MR9A 1CQKA 2ZUYA 3QO1A 1BREA 4AKPA 5FM8A 5I66B 2DWSA 3IS1X 3ME0B 1E4HA 2DI7A 1R5VB 1YPZF 4BA8A 3SKUD 3EHBB 4UB0L 2DYPD 2EDJA 4PGEA 3P11L 3OKOA 4M7JL 1ODUA 3H9SE 2FZ3B 4ZX4A 4R26H 4Y5XC 1MUJB 5KN5B 4P07A 4B96A 4KO5A 1AQDB 1GCYA 1EO5A 3DOIA 5DFVD 5JHDD 1TTGA 5BZWB 1PJ9A 3DROA 1KTLB 4ANKA 5BVJB 4YBQC 4PMEA 5AL0A 2Y2WA 5GGUB 4YLBA 1A9VA 2F5AH 3HZKA 2W80C 4L1DA 4HUMB 2GC4C 2E4FA 2H1PL 3G3LA 4JG1H 1TJGH 1B4RA 3P4NA 3STZB 3GZPA 2SODB 4FQIL 3ML8A 4PRIB 3DX9A 1X7QB 3QORA 5K69A 2F74B 1TVHB 3JVGC 5I6XC 4Y2NA 3L9YA 5DRNA 2MPVA 3FQ2A 1AO7E 4XVUC 2NY3C 2HFEA 2H6OA 1ED3A 4ATWA 2OMXA 1EAOA 1BVKB 3NT0A 3GQFA 3NJXA 1MIEL 5DK0B 4M8VA 1IE4A 4S1RH 1SM3H 2Q20A 4M5YL 5T5FH 4S1SH 2Q2LA 5DRWA 3IAPA 2L3BA 2QVKA 2ADGA 2HMID 2R2EA 2A77H 1L6PA 4FI7A 4IRZL 4HJGB 5I1HL 4Y1AD 4Z9KB 4WSGA 4G9DB 5F1NA 5I1EL 3AGWA 5EF0A 1X5FA 3D9AH 2LE9A 3V0FA 3ROOB 1JNLL 4GKNB 4PJ7B 1WIUA 3OJDA 4Y4KA 5H8DA 5KYUA 2X4OA 2DLGA 2GJ6E 3T2LA 2YRPA 5J3HC 3FCBA 3DJSA 3ARTA 3ZO9A 2AERT 4YSDA 1AFVL 3T4AB 1KBBA 2ICCA 1OD9A 3OKDB 4QRPD 4E68A 4YDKL 4MB4A 5K9JL 3LPPA 4AT6A 4OZIA 4PBDA 4BKSC 3SGEH 3W0WA 4R2GC 2P9RA 4WW1A 4HPYL 4U1SB 2DS4A 3IE4A 3FTGB 4FQXB 5D70H 1B0GA 2IXQA 1F1DA 2Y4SA 4AY0A 3L2MA 3ASOB 3BH9B 3BX7C 1KB5B 4OU3A 1I3UA 5IHZB 4XO4A 4DKEL 3IU3B 3C5SA 4OTXH 3DHMA 1DQDH 5IOPB 4PTUB 4GMSL 3T1FA 1CD0A 3GZOA 4UQCA 4W70A 1P2CB 4BK5A 1J11A 4OSUH 2X70A 4DW2H 4EMZA 2H8PA 1N10A 5KJRH 1QZNA 3DPDA 2X42A 2DJSA 2VITA 5I73B 3SY0A 1E3ZA 1OAYL 3NPSC 3COOA 3OXSB 2H0PA 1DFXA 3IF1B 5KJ7E 2WXFA 2A74A 5T1DH 2XTJB 3D3VB 3MLVH 2WLIA 1NWPA 2P48B 3LZOA 4DT2A 1P9MA 2H45A 5T33H 3D0VA 1KJ2B 3MLZL 3LAFA 4KK8D 2QGDA 1P7BA 1K4CA 4ZJ9A 3U4EB 3H6AA 2D9CA 4GXUN 1JXJA 2H41A 3MRLB 5E94A 3CFTA 3DRQA 2OMZA 4HK3N 3GBLA 2BHUA 3RQ3A 4CW1A 2YD1A 1MI5A 4B5EA 5DVPA 1KYOK 2HAZA 4L8SA 4N1EA 2RMNA 4N8VG 3BKJH 5DRXB 3V4VL 3EYQC 1JTTA 4G80A 1N0LB 2H4EA 4S1QH 5HJGA 3UZEC 4FCAA 5J6GB 3FQNA 2LW3A 3HZYA 1JNHA 2VXUH 2VDKL 4V2BA 3F83A 1VZGA 1OCZB 4HQQH 2FX7L 3QISA 4MHHI 5I26A 4YXLH 3SPVA 4RDQG 1LMKA 1AKJB 4KJYA 3FSAA 4F37K 5CSGA 2NY2C 4Y5VB 4HT1L 3UACA 4IKLA 2A1WH 4R7NA 2OZNA 3FQXA 3RWIB 1PIFA 4FRWA 2P1YA 1OCWH 3OAZH 5MENE 2GCYB 4AENB 3AMLA 4XVJL 1GXEA 4XNXH 1WBZB 3NIGB 4R3SB 4B27A 1KULA 4P5TA 1SJHB 3PQYA 5ID1A 3KGSA 1IIIA 3OC5A 1MEXH 1KGUA 5TFSH 3WKYA 5BW7A 4PBVC 4TLTA 3BAKA 3O4LD 3UIYA 2OX5B 4F9PC 1WFTA 3CZLA 2NZ9D 3KPPA 3I9AA 1AXSA 4MDIB 5HDWA 3R0NA 1LO0H 3X3GL 2X2IA 3AJ7A 4BWUA 2VZOA 3RUGB 1ZT4A 1H3PL 4LEOA 2A99A 3T0EA 3SDDB 3A4FA 4GT0A 4NOFA 4W9IC 1LO2H 4P5SA 3OKNA 3RY6C 1HKLH 3CVIH 1DQMH 3KBEA 3Q6GH 7FABL 4N90E 1V3LA 5FYKH 1FNSL 2J6WA 2XWTB 3EF7A 4FX5A 3T3PF 1T20B 3WHE1 3CBJB 1CBVL 1NDMA 1QFPA 4WI0A 1FO0B 2XNAA 4WVRA 1JGVH 1AGBA 5IT2L 5FOJA 3NCYS 4P46D 3DA0A 1N67A 3HI6L 5BMFL 4L8DA 4NUGL 2ROXA 4M62L 1ZHLA 4JRYD 3DSFH 1FVCA 3UTTD 4ZTOL 3SDAB 4MSWB 1FH5H 4RNRB 4LLVB 2WIMA 1J9SA 2AJ3A 3QUXD 3UJIL 3S8WA 1K8IB 2AEWA 3TN0C 3SD5A 2Q3XA 3ZE2F 4ES9A 5EZOL 5DVKA 5CCJA 3QCUH 2BCKB 3UTOA 2KPWA 4GW4B 3D18B 1T04A 3U0WH 4HCFA 4UQ9A 4FADA 4HFUL 4FYSA 5D9SA 1IU1A 3BQUD 4X4KA 4LVOC 5IROA 1S7QB 2SEBA 4PCKA 3ZDZF 4JKLA 2Y36L 3S36H 3H0TB 1BQRA 5HHNB 4FA7B 1QNZH 2DQDH 5FM5O 4XCYA 5F89A 1PY9A 4MQXD 1EAQA 3I50H 5GISH 1A6PA 3PUUA 5L2KA 1DSFH 1I3VA 1TZ8A 1VFBB 3DO3A 4AGOA 4F33A 3UYPB 3H4FA 5L7XL 2FSEB 3CMOL 4QJ4B 3FULA 4IGBB 4HS3B 5EUKB 1J48A 4JM2D 4N9GA 5DYFA 1A6UL 3PWPB 4BKLA 3OAWA 5IGXL 4WZ9A 5DJ2A 3AU1B 2CE6A 2VN7A 4GH7B 5F3BA 4WWKD 5F7EL 1FORH 2J57A 4G6KL 1TENA 5F9JA 3F7YB 4XTRC 5ALBL 3RX7A 4N0YH 2DZEA 3QFDA 4J3SA 1OSPL 3VXSA 4QCIA 5M94B 5LGHH 4H7VA 1NC4A 2Z4QB 1I8LA 4EF3A 2R9HC 1G7LB 4H2AA 4WUKH 1W72B 3TZVC 1VFMA 3WIIH 3GBDA 3DXAA 1FHNA 4JZOA 2LVEA 1CGSH 3ARXA 3F6IA 3NVQA 1I9JH 5DEGA 1CFQA 1E4XH 3CNKA 4EKJA 4PCTA 3DVNB 4Y2OB 5J7CC 2R2BA 2Y7QA 1AYOA 2FJHB 3LKQB 4N8VA 4OVVA 4HPOL 1P7HL 4Y4FB 2UZYA 4GB9A 5L8JB 2VDNB 3D0AA 3ECUA 1BJ8A 4HBCL 2N1KA 4G1MA 1KTKE 3GUFA 2L7UA 2PPAA 2VN6A 3QXTA 2FNWA 2OXGB 1IBZA 3B4NA 1KGCE 3MUHL 3O2DL 3N5AA 1TKWA 5E8OB 5CP7A 2C9RA 1IFGA 5JMOC 3OXRB 4IK7A 3VRJB 2YJLA 4LLUB 3W11C 1KMGA 1MJUH 4JFED 5E0QA 4UZUA 1DBKL 1UB6A 4KKLD 4ODXB 2BMKA 3U46A 3U7YL 3EGSA 5C0BE 5AUMB 4BFGA 3IDIB 4OGXH 4U7SA 4Y9CA 3IFNL 5JPMB 1CFMA 2MSPA 4I18C 2RACA 3VH8B 3TEXA 2X89D 4LLAA 4U7KA 5CILH 1A5FL 2JIXB 1SJEB 1MY7A 5I5RA 2HN7B 4HJJL 3JZYA 1SXZA 1RUML 5ACMA 1T1XA 1ZLVK 5HYQB 3KGRA 2VZVA 4BEIA 3S34L 4NBXB 4XXWC 3GSOB 5I24A 3GS0A 2HYMA 1ZS8B 3DOSB 1ZV2A 1N5AA 1WD8A 3BVWA 1UM6H 3OMZA 2XT1B 5D7JA 3RNKA 3TIEB 1UCBH 5LWYL 5EORH 4QHMB 4MB1A 2C9PA 4U3CA 2EAEA 3ULUD 2ITFA 3NQIA 2Y6SD 1MG3C 4JGUA 1RJCA 3BPNB 3R7RA 2QV4A 1IGTA 4PJ5E 1D7CA 5E6IC 2PCXA 1U93B 1DJYA 1Y6MR 1O6SB 2PF6A 3MV7D 3FU3A 4Y16A 3LKNB 3VSUA 4D9RD 4ABUA 1RZJH 1WTGT 3OR7A 3AADB 1N6UA 2FQGA 4LOUD 1KSRA 1FF5A 1IVLA 3ZN6A 5MEPA 3SYQA 2D2OA 2OA9A 3AAZB 4ZW5A 3IMSA 3KLAB 4E9XA 1BCIA 1QLEB 1U6AL 1TVBA 4OAWA 2R56H 4UZGA 3FAWA 4TSAH 4Z78B 5HD8D 2OK0H 1HKFA 2ZF9A 2WLNA 4EI5A 2FL5A 3LQMA 4YLQT 4AJVA 2GHZA 2ICEA 5AB2A 2NMSA 4AQEB 3SCMD 1NAMB 1H3TA 4TRPL 2WJ5A 4S10A 1U8PA 2V5SA 4MZ2A 2O4EA 5C08E 2AI0L 3TNMB 4I13B 4BH8A 8FABB 2CCLA 4MJHA 4F57L 3CSYB 4Z3HA 1U3HD 3V6BR 3F3HA 1F11B 1BIIA 3G04A 4PRPA 3TPUA 3IPEA 3RZCA 2EQDA 4J3OF 3EOAB 2V37A 2FGZA 1GIGH 4PYGA 1HINH 3A5VA 5ISZB 4FQLH 3IXTB 1J8HE 3ARDB 3VVVA 1PW3A 3LKOA 2KHAA 4NSKB 3H42L 3X1GA 4OF8A 2PN5A 1DBAL 1D9KB 3C8HA 3LB6C 4J6RH 1ZK5A 3D87B 4X99A 5T1LA 3CHQA 5DFTA 3S37H 2MHAA 3O6ML 5B21A 2YMOA 4NHUB 4PJAE 2HH0H 5EG6C 5GS0L 1YHPA 3GDCA 4ZPTB 5CCKH 3VQ2C 2DLFL 3BEWB 2DKMA 3BVXA 2QEJA 2NXZD 2Z31A 4HKZA 2A77L 4H0HB 4TUOB 4CMMA 4OD2B 3T1WA 4G6JH 2MPAL 5E9DB 1C8QA 4QXUH 4FTVA 3HJ0A 1BIHA 4JEGB 3W37A 3VXTA 3LPGA 1DZ0A 2I25N 5ADOL 3C6SA 4WENB 2FWSA 4YK4B 5TQ2L 1I7ZA 3QQ9C 1W2KT 3RWHB 1QBAA 3IDUA 1SYSB 4OB5H 1U92B 3QO0B 4CN6A 1BGXL 4HHAA 1DJZA 1QQDA 1U58A 2MMXA 5E5UB 2F58L 3KPSB 2OJZH 3OAYH 2EADA 4FL4B 4FTDA 2IGLA 2QMKA 3K6FA 1F13A 1JPEA 2O6PA 3QJRB 4GO9A 4OZGE 5I1GH 5I8CB 4OFYA 4J1UB 1DDHB 1TQCC 4NKMB 1W0YT 4W9LC 4YR6A 1DTUA 4BFNA 3L3KB 3U7AA 1KCWA 4W6YB 1G0YR 1OTSD 2O26U 4NN5B 3WTYA 25C8H 5D70L 3Q9PA 5F71A 2BIOA 3GMMA 4LLYA 5I75B 3HCVB 1WH0A 4WU5B 1DQDL 1JRHL 4UBDC 4GKZA 5EU6B 4KTGA 5J13B 1KYOJ 4ANUA 3K0WA 1E0OB 1E5ZA 1GKEA 1FV1A 1Q9WA 2BIMA 3AZUA 1U30A 3GLZA 3IKCA 4WI6A 2CBOA 1XF4B 2N0KA 3HN3A 4LVHC 3A22A 4F15C 1C16B 4ZK8A 4LLQB 3MI6A 3S48A 1LP9B 4MAYC 1IM3B 4S2SA 4HAGA 1KT2A 2E27H 1CTOA 5H37G 3RU8L 3IWVA 3ET9F 3VDCA 4G5ZH 4IJ3B 2YR3A 4LESA 4WEUD 5T3XE 1HHIA 1IB5A 1THAA 1RH8A 2VSKB 2J20A 3A4DA 4NXSA 1IBHA 3V55A 3RTQC 1BVNP 3P73A 3RWCA 3UTQB 4MX7B 2XIBA 1CGUA 3Q8EA 1Q94A 3ALXA 4JFZH 3DOHA 5SWQA 5ACLA 4ATTA 3SEPA 3NBNA 3L45A 2APSA 3Q9QA 4N6RA 3EJYC 4N4YB 1NEUA 1F4XL 4NYLA 1NFDA 1TTCA 1MFDH 3OPUA 2AJZB 5CHNA 1VDGA 4XXDA 3QJSB 4MA1C 3N85H 3NOIA 1JPFA 3L4VA 1D2PA 3WLWC 2APXA 1JVLA 1ZVNA 3RY5A 3S5LG 2P45B 4RAVB 3UTSB 2EE2A 4OCXL 3LKRB 4XPTH 5AW3B 3Q48A 3TA3C 3WN5B 3LPFA 3BKJL 1A64A 1YY8A 1NAKH 4LRNL 2I9TA 2VXTH 2X4TA 4W9JC 3KNBB 2BSRA 3J8F7 1RKRA 3FQWB 3BUBA 4MA3B 5HHQA 4X6EA 1Y18B 2D3LA 4RA3A 2CIIB 4G7YH 5I1IL 4EVNB 4V11A 3SYPA 3S8GB 3ULVH 2VXUL 2WO2B 3Q13A 4X4YB 4HQQL 2XU9A 3LN4B 2PABA 2UZPA 4OLWH 4O2EB 1AO7B 3BYTA 1SYVB 7PAZA 5C07E 2AJXH 4ZT1A 5LXVA 2AK4A 2RR3A 1RZGB 3MOBL 4PJ9A 2C3HA 1QFHA 2CLVB 1BD2E 3BUQA 5BPPA 3GMRA 2QLVB 4Z3JA 3L3HA 1OTTC 3DUUA 4R5VA 2H3NA 4MNGA 4UT9A 5SWSE 1QSEE 3K2UL 3LD8C 5FYJE 5BUPA 5FPIA 2QT6A 4X6DB 1OL0A 3MRIA 5L6YH 5JORB 3IDNA 1GPOL 4XOEA 3QIWD 5HGHB 1MEXL 2BINA 5PAZA 1H5BC 2GK0B 2UYLB 3NJLA 5KOMC 4NAJA 3BPOC 3WJJC 1UWXH 3QFJB 1IUZA 4B50A 2PR4H 3C2SA 3QIUA 1LO0L 1WG3A 3BGAA 2GJ6B 4S0TD 1RVFH 5C0AD 3SDCB 4XCFL 4U4BA 4UV4H 3O3DA 3FU9A 4XZUA 1P7KB 1DN0A 4PQXA 3RDTD 3WV0A 5FA3B 1Q9OB 4Q9RH 4GBXC 4I0PA 1WA2X 3D2UB 4PJBB 3RGHA 1HKLL 3CVIL 1DQML 2VLKA 1CFNA 5FYKL 3VGGA 2Z8SA 1PSKL 2CRZA 5L8LB 1J1PH 3UYRH 2B20A 4RWYH 5GS3A 2PETA 5EU5A 1QBML 4I48B 5HYSG 5KANG 1DQJB 1GAFL 2A9MH 3FCUB 2VLJD 3X17A 3DC0A 1G7QA 2CHZA 2R0LH 2YEZB 4U6YA 1G7JB 4LIQE 1MNUH 3DUHA 3Q06A 4BUGA 1ZKAA 4C56E 1KWGA 4HK3J 3VJ6A 4OQTA 3BKYH 3WAKA 5C0FA 1ZIBA 4PJGF 1IT9H 4UT9H 4HGKC 2K6YA 4NO2B 3MV9D 2UVEA 2ZG2A 4ZAKC 4X9GA 4YSEA 3AXHA 3Q44A 3STLB 1EX0A 2ALWA 3SJVB 5KYNA 4HJ1A 4K71C 4WW2B 4Z3IA 4J5VA 2BRQA 3O45B 1JFQH 4AYSA 2G5UA 3S36L 2ERJC 3LZQA 3GS7A 1QNZL 2DQDL 5L88L 5EZJA 4AC4A 2CLZB 4Y5XB 4AH2A 2V2XB 5GISL 4BSWA 1IJ9A 2FHBA 2VDPL 4G83A 2IADA 1GA2A 4YHNA 1JGIA 3NCWA 4KZDH 3WO4C 3KCWA 1WCBA 4H13C 4X9HA 2OXHA 1E2WA 4FOMA 1T6VN 4X4MA 3QNXB 3N42B 4XC3H 3RPIA 1MQKH 4JDVA 3D39D 4PYHA 5JDSB 1JYVA 1FORL 2LU5A 5FLUA 3BRFA 1FG2B 2ITCA 3NZSA 4BK4A 1KGYE 2WOYA 3KLHD 1Y07A 2E8ZA 4Z7VF 4ELMA 1K9TA 5SX5K 2E59A 3CQQA 5JW3L 1F56A 3RFRA 5EULV 5IB4B 1BG9A 1T7ZA 2J21A 4IOFC 1HHJA 3B5TA 5DHYA 4OQTH 2JKNA 5ESVB 1XL4A 3K4ZA 3LPWA 4WUKL 3AWEA 4G8IA 4HZAA 3KLKA 4OUUA 2D2CC 4Z76A 1E43A 3KVQA 1HOCA 3U2JA 1ZA6A 2EYSB 3AROA 4N5ED 4NHCL 3S5LA 1VGKA 5ITBL 1NCWL 5B1BB 1L4IA 3F12B 4WV1B 5SWZD 1PZ5B 2Y3NA 3D25A 4DGYH 4L5FH 3SOBH 3IB4A 3QH3A 4F5CA 5FF6B 5CFHA 1YYLH 5HGBB 4FXTA 5AKTA 3WTWA 1VGEL 4WU7B 4LOEA 5JW5A 4HH9A 5AOKA 5LB1A 3C75A 1QSFD 3BKCH 4CU6A 1R3IH 5EO0A 3QS2A 5FUOH 3V4VB 1FL6B 3QXDA 3FCGA 1G7HB 3CBRA 1FP5A 4Y5YA 5MEQB 1KCSL 5MENB 5H37H 3G6DH 5D2NB 5KSVA 2VDKB 1W8NA 1MJUL 5DD3H 3RVTD 2GTWA 4BE6A 4JKPH 1R3HA 4LLMA 3EGDB 2CQVA 3LXCA 3WHXB 3OJMB 4FG6C 2HFFA 2WN2A 4LNRA 4OGXL 4FXKA 3JQOB 1ZSDB 3JUZA 5DQ9B 3F7PC 3CBKB 3FH7A 5EOQH 3BISA 1DJXA 2AAVA 1BZ9B 5FHAH 2PUQT 1MNNA 3V4PA 1L6ZA 1RJZA 1N6QH 4GIOA 4PGDA 5FW7A 5IG7A 2Z4TA 4R2GB 1A1NA 3U6RA 3BLKA 1ORSB 4Y7OC 4B0MB 4JGJA 1CL7H 5DD0L 1ZLSL 3KS0J 4OKVA 4HUXB 1FI8C 4OCSH 1UYWH 1WC7B 2V7NA 2VLLB 3QRBA 4J3TA 5D7IE 2B0SH 5EORL 5T1KB 4CVXB 5K1NA 4LRIC 1HYSD 1OF0A 1SQMA 2HT2C 1OF2B 2Y06L 5I8KH 5I1AA 4B53A 1ZVSB 2EIZB 4OF0A 3WNNA 4YO0A 3UBHA 4HLEA 1VFAB 1ZHKB 2OM5A 1T89A 5KBMA 2GJZA 1NIFA 4GRWE 4LQ1A 4FHJA 3H9SD 3ZVVA 2X6UA 4OI7A 4QRRA 5DEFA 1M7DB 2XJLA 4X6CB 1J10A 5BRZE 2IWFA 2PP8A 5KS9B 4KRNA 4UNTA 5JNYA 1OARH 5DVOA 5C0GB 1UD5A 4LSVH 1MLCB 5DURB 4AYFB 4DESA 2OK0L 3N55A 1N4XH 4TSAL 1ZWIB 3RL1A 4U4IA 3VWJC 2LAGB 5DLMH 1G1OA 2IWEA 3Q8BA 1JF1A 4RSVA 4P2RB 1BXVA 2LGNA 3QC5X 3P4MA 1KN2L 3BO8A 2YMTA 1AR1D 3I74A 1F2QA 3UIZA 3V4PH 1R17A 2VM3A 2Z91B 1H6FA 1GGIH 2IMMA 2M1KA 4YHIB 3MNVA 4M1CC 4MJ6B 2VL5B 3VFOB 4BHUI 4MRBA 5I1LA 5IVZA 3TVMB 2RJMA 4TLUA 2VMJA 3GMLB 3QQ3A 4HIQA 3B7RL 4HUKB 5AW2B 5GZOA 1TCRA 1IC0A 4N8CL 1T83C 4K2UL 4HYTB 3P1VA 2P80D 5AZ2H 2XI9A 3ZE2E 1W0VA 1MHCA 2WCSA 4PJDF 2PPFA 3NA9L 4IU2A 4EZMA 5DVMA 3VG9B 4NQQA 1TT6A 2NTFB 1MVYA 5GRJH 5C0RL 2OP4L 3TBWB 3SB3A 4JPQA 5E8NA 4UMGA 4Y4HB 4Z0BH 1G9MC 1I1FA 1AE6L 3C60A 2EO7A 3MJ8B 4W93A 3ZDZE 3BP5A 2ZX9A 4G9FB 2CBPA 32C2B 2GG1A 4H8PA 1AXIB 4V1DB 3QG7H 2HVJB 4B9GA 4UDUA 2HH0L 3FO2B 2DDQL 5E1GA 3U79A 4C54A 2WZPD 4H8QA 1GOFA 5DA4A 5CCKL 4GAJH 5D7LA 4A68A 4HOZA 2AXFB 4E2OA 4NKQB 5EZIH 4U6XB 4E41D 3OKMB 3P77A 4PRHB 4MVBD 3K81A 4K3EH 3ETTA 3PWUB 3CGTA 2XBZA 3H9HB 2YSSA 4NM4L 2EVGA 4FNUA 4JQIL 2R0KL 2ZOLA 3V5KB 4NN6B 5KYYA 4J3OC 4AKOA 5IREA 3HZVA 2H47C 4PRAB 1OP5H 3E38A 4K94H 3ATEA 1RU9L 4A38A 3NCXA 1QO3A 3HE7A 3BZFB 5HHOE 1MHEA 4RMRA 3K8KA 3V7AG 4J8RA 5IHUH 4YZFE 1H8OA 5EWIL 4JFFA 1WWCA 2CWRA 4Z95H 1CN4A 5I1GL 4UMSA 1G6RL 3FCSB 2DM4A 1YEJL 4YHKL 1IC7L 2JI2A 1X7SA 5D7SL 5DYOB 5C0BB 4Q6YA 5F7WC 2IOOA 1F42A 4XVTL 5I8EA 1QI3A 3GTVA 3P0YH 4QYAA 3TWCL 2WXNA 1OAJA 2JLPA 2JTYA 2ZQKA 4OT1H 2LAAA 3WTVA 25C8L 1TU2A 4QXVA 2E75C 3HLKA 1PQZA 3BWAA 1XBRA 3O6LH 4PG2A 3U4BH 1AHWB 5CD3B 4KK6C 4BZ1A 1Z66A 3QUZB 4U3XA 3LN9A 4Z7WE 4I4WB 3VXRE 2Q7YB 4NP4L 1M6OB 5KYWA 1KPUA 3D07A 4X5RA 3L17A 2X4PA 1LGVA 5IVNA 2Z8RA 4RIRB 1KG0A 2WVVA 3MLSH 4KO7A 3VRIB 3MRCB 3ULSB 4DN4H 2Q10A 3GGWB 1A1OB 4FA8A 3KPTA 3UAEA 1HCVA 2YC1B 3CFJA 4Z18A 2L04A 4GQPH 2UWEA 1ZHBA 4CVWA 1N2RA 2AQSA 2IGFH 3W9EB 1J5DA 2XPGB 3MPCA 2BPBA 1FYTE 3QPQC 2NY3D 4JRXE 4XVUD 2MNUA 5T3ZH 3TA4D 4O00A 1UH3A 3KYMA 3MYJB 4GQ9L 1PD0A 4NQVA 3VXQB 2PWDA 3R19A 4Y9BA 2X9WA 3A23A 1SFHA 1U8NB 1BFTA 1EQWA 1WS8A 4XPBH 3KWTA 3N44B 4JPKH 3CN4A 4FQ1H 2OSLA 4N2HA 2BSBA 4FKHA 5C08B 3WL9A 3ZR6A 5I82A 4IHOB 3RYMA 5F7UA 2R83A 1KN4H 3N85L 1LK2B 2X53A 4HEME 1E42A 2Y7LA 4AMXA 4BA0A 3K71B 4XPGH 2KPNA 1I75A 1R5IB 1NINA 3TO2A 3ATDA 1UURA 2B7DT 4H8WH 4MCZA 4X50A 4MHHG 4QT5B 1PFCA 1OALA 1U8OA 1UUNA 4N2DA 2PYEA 2FQEA 2ZWLT 3FFCE 1BXXA 2VXTL 3MJ9A 2KDGA 5FDWB 5HGDA 3EJTA 3CC1A 5J3HD 2EVJA 3LTVA 5D1ZB 1CLZH 3HHSA 2XWCA 3MRFB 1D5IH 1HCYA 2YD8A 5D4JA 4R7XA 3S5ZA 1XH3B 4K9JA 4ERSH 5B1AB 4HSCX 2AJXL 3HOGA 4OLUL 1BECA 4PWJA 1JN6A 5IVXE 2IFFL 3Q1SL 1RZPA 1XVSA 1U8JB 4PB9H 3TXAA 1CGXA 5AWNL 3I6GB 3BZEB 4XPFH 2G9HB 1S5HA 3VYOA 3GKWL 4O02A 5L6YL 2IBGA 2VWEC 1NIDA 3EYVA 3CN3A 4N90D 1Q8MA 2QKIC 1U8LB 1A4AA 1WBYB 1JZ8A 4FJZA 3IS0X 4ZMTA 2YA2A 1A3LL 3ZDYF 3NPZB 1JMXA 2ZCLH 3SQRA 3TC9A 2PR4L 3FQRB 3BAEL 3I6LD 2NQ3A 4K23H 1D5ZA 3MMEB 4GUQA 4S1DC 4UV4L 3PGDB 3V2AR 4OGYL 2OMYA 4ABQA 5C9JB 2CHWA 1UD3A 4AG4L 4KUZH 4BH7A 1NCIA 3MJ9H 4XMKH 4ADJA 4ZS7H 4RGND 4NO0B 2DF3A 3BPCB 2QQNH 4QXTB 2VDOL 1H6UA 3AUWB 4AM0B 5AKRA 1JXFA 1PX8A 2ZWYA 3KH4A 3RAJL 1KB3A 3RWDA 3FT4B 3S36X 1DEDA 4AQ1B 4WTZG 4F92B 4PGBB 4ZI8A 3GMQA 3IU4L 5TE6H 4C57C 4DHLA 1J87A 3O9WD 5E6IB 4PVLA 2ORBH 1DQTA 2G0LA 1ODAA 3DVFA 3IRCA 4U6HB 2YD2A 3NJNA 1E9OA 3HI5L 1IT9L 5IW6B 2C34A 2WZ5A 3DX9B 1CB4A 5EUOE 1LILA 4JO1H 3KXFA 3DHPA 3NDZE 2V17L 5E2TL 4O02H 5HGAB 2Q8AL 4YAQA 4Y2LA 2V9UA 3EYQD 4MMXC 5CR1A 3F7VA 3PABA 2YD4A 3HRPA 3QDGD 2YAMA 4RAUA 4JNXA 3OKKA 2CO1A 4NGHL 3DWTA 5EBLB 4A2EA 1EV2E 5F8QC 4Q4EA 3L1GA 3GBML 3TBSA 2QSCL 4KZDL 2WN3A 3MYZA 4PPTA 2NY2D 2PCPB 4K73A 4DPAX 4W9KC 4XAKE 2ARJQ 3BDYH 4L3EE 5F1NB 4QOKA 4TQEH 2VQ1B 4FF9A 1MQKL 4N2LA 4RMUA 4GRLD 1KGWA 4FG4A 3WTSA 3QHFL 1P5UA 3B2XA 1NM4A 1H3VA 4YBLB 1RK0B 1JGDB 3PU7A 3U0PB 5HTSA 3BSGA 3B8SA 2N59A 4GUOA 3QXAA 3OX8A 4UAOB 3SO3C 4MNQA 2YGNA 3HC4H 4MJID 4MD4B 4ISVA 5IR1A 4JQVC 3CU1A 5TDPA 3EO0B 5IJVA 4AT6B 3MCYA 4M61B 2PPDA 1E4WL 1EHLH 5HPMA 4DGYL 1UVQB 4DGVH 4ES8A 1MF2L 1JPGA 2VWEE 5DMJB 1DQIA 2DWTA 3QEHA 2R69H 3MOQA 2H26A 2BVPA 1P4LA 2HUHA 5KVEL 1JGEB 1NSNH 1FFPA 4LCIL 1SBSH 5IB2A 3KLSA 1CDJA 3G6DL 5SWSB 4PJHA 1KIPA 3AVEA 5CEZH 3U1SH 4JFQA 5ICZB 2BVTA 5EU4B 5GRXG 2WLMA 1XGUA 1TYJA 4GO6B 2DYSB 3JBG7 3TN0D 3U30C 4OJFH 4QY8B 4DH2A 3L13A 4PJ5D 1MN4A 4OZIF 5EOQL 1TQCB 4XH2A 4XNBA 5F7FA 3ZL2A 2WYIA 5ANMA 5TH2A 4G2AA 1BBJB 1T21B 4Z8FH 1UOKA 1C12A 1EJ6A 3E6HB 2A6IA 3QQNA 3N9GH 4KZCA 4FLSA 3QUMB 5DHMC 5TE4L 3TO4A 1IEAB 5I1DA 2WLIB 3N1GC 4KU1A 3T2PA 4XNQA 4BE5A 3US1A 4HH8A 4KKQA 1FFOA 3KPRE 1CL7L 4LDLB 3UDWA 4NEHB 5GXBB 3DV6B 1UYWL 3CDGB 4GI9A 4TPRL 2YD6A 4YPGB 3FYIB 3I02B 2XWJB 4M5SA 4KTYA 3AUVA 5LBSA 3CZUB 1BOGA 1U95B 5D4HA 1N7ML 1J9RA 4RMWA 4WY7H 5I6PA 1S5IL 2AJSL 2EKJA 1FGNH 1HIML 3IRPX 3RVUC 5FR3A 1UA3A 2IV9A 2WW8A 3FZUC 1N0XL 4RMQA 1MDTA 4NB7A 4N2GA 4LVHB 1NKOA 4WGWB 4P2OA 4ODSL 3TESA 4MAYB 3WY4A 1UOWA 2BZCA 3TBYA 1UASA 3CPUA 1OARL 4WTZA 3VAEA 1CO1A 3N91A 4LSVL 2F9BT 2OJEB 4XTRD 3WNOA 5DUPH 2YHGA 3IJHA 5D2LA 2WVUA 1IC4H 2WUBH 3AACA 4RVBA 4ODWA 4K8RH 3RTQB 5DLML 2NR6A 1YAZA 2R9HD 1EEUA 2XLLA 4PV8B 3TZVD 5F9OH 4WKZB 5E9NA 4ZXBC 5F72S 5KSBE 2X6CA 4KJYB 3EZJB 1DL7H 5EFIA 4L29B 2F8OA 3N50A 5D1XC 2BY3A 3LEXA 4U6VH 3S37X 4OZFG 3V4PL 3AT0A 5I8OH 3BPLB 2AVGA 1GGIL 3VI3B 1P84J 3ECQA 4KUCD 1N59B 3IJYA 1NFIA 3DMMB 3GMPA 1IJNA 1MDAA 3ESNA 4Z7UB 4PJGE 1QFUH 4F7MA 3A4EA 3WFEH 1OQOA 2XG4A 2OMUA 1CCZA 5LBSH 4ODHH 2IQ9L 3ZUNC 1KELL 4U3SA 1JWMB 3DGDA 1AXSB 4Z0BL 4M29A 1I3GH 3BUDA 1CYXA 3W11D 4LSPL 1FGVH 1K72A 1S7TB 4OM1L 3UAJC 2G60H 2PTUA 5JIPA 1PDKA 2VDPB 2K70A 3V6FA 1I3RA 3NZ8B 4HUWA 3ES6B 3RWEA 3WBDA 2D03L 1QTPA 2W60B 3GMOB 4HDIA 1HTYA 1UM5L 2DQUH 2OMVA 1M9WA 1USQA 2ZF8A 4GAJL 1JZ5A 1XGPA 4FYTA 4XP9H 1I8AA 2Q76B 3LV3A 1QX1A 4YE4H 5EZIL 5IUSA 2J71A 2QVFB 3ELAT 3FB6A 2DL2A 2EZ0C 3C6LB 3FTSA 3VXNB 3O6KH 3QQDB 4DUXA 4QHPA 3K80A 4TNVK 1KBWA 4QRUB 4AE1A 1ZV5A 5ABAA 5HYJA 1NCGA 3MO1A 2TSAA 1CFTA 1U8MA 2FJGA 3MACL 4N2OA 4XCCL 2KZKA 1UXWB 4MMZB 4TVSa 4NX0A 5H2BB 2WGXA 3TM6A 1WITA 2NW2B 5E2JA 3ABMB 5F9WB 5CMAB 5JUEH 3PGCA 5DC9B 1YVLA 2W5PA 2XPZA 4U0QB 2EVFA 1KCUH 1N9PA 3ILQC 4HD9A 5E1AB 2IPUG 3L5XH 3WFZA 2J5LB 3ZTNH 3ARGB 3GINA 3O0RH 4GBXB 3AG2B 4X4ZA 4P5MB 3IGLA 1YEKH 2NY5L 1RULH 3ECBB 2A4EA 4GLRI 4HJTA 5B7FA 2IANE 2XC8A 4LCCC 3IPFA 5CJOL 5LO7A 3UBXA 4F33B 1DP0A 4GOSA 5LCVH 5I0DA 4PREA 5L9DH 3V0WH 1EFQA 4DGWC 3LRKA 1LVEA 5MI0C 1TG8A 1KIQA 4R90H 5GRVK 5T3XD 5H94B 1E27A 3U4BL 2VIRA 4BKLB 1EXUB 3CN1A 4ZX6A 4NRZA 2WYHA 5D7IB 5J1AA 5ID0B 2FLBT 1CE6A 1YN7B 2QDVA 1COBA 2XKNB 3D48R 1EAJA 4AGMA 5L0QB 5LGJB 5JA8B 4PJXE 2BNQE 3JV0A 3ZU8A 12E8L 3NJMA 1ETZB 4GW5B 5ANHA 3VXUB 5E6RB 4HA1A 3MLSL 5ABDE 1NMCB 4O5LL 3VFRA 5AAMA 2ZXQA 3ECVA 5DRZB 5BRZB 1ZTXL 2CLRB 4U2ZA 5D1XE 1DQQA 4Z7NF 2OBGA 1JBJA 3O41B 2NX5B 4IHBA 4NIKB 4J2XA 1J0HA 4PY7A 4JN2B 3LB6D 4LASL 1B2WH 2BOBA 1FNHA 5T3ZL 1C5CL 4QHNA 4TQPA 3UP1A 2O61B 1J86A 2O5YH 4FP8L 4QYOA 5GGTH 3QQXA 1KFAL 5FOBA 1QMUA 4HKJA 2Y7SA 3FQUA 4R4FH 1Z5LB 3CFKA 2VERA 4MS8C 3BW9B 4JGMA 3OR6A 5FM4A 2C1PA 4P59L 1ID2A 4PTTA 4JHAH 4U1MA 5C07D 4EZLA 5DEJA 2D7QA 2XWDA 5E5LA 3SIKA 3RFZC 1BD2D 1SQ2N 2GEEA 3FTXA 4H8WL 3WXVL 1XIWA 4PJIE 3QQ9D 3L08A 4BZ1L 3U46B 3JYCA 2EECA 4NUPA 1QSED 1V5JA 5EBMB 3MV8A 4BCZA 2X7LB 3CVBA 5FYJD 3HB3C 3L5WA 4RFEA 1AS6A 3DI3B 5EBWB 1I1AA 2YFOA 5I16B 3ZMEA 3GNMH 3I75A 2YAPA 2YLKA 4WNSA 1IIKA 3MREB 5DJDB 1GS8A 1AG0A 3WN6A 4BUHA 2DEYX 1OP3K 4IRJC 3ARBC 1XGRB 3NFSH 4IOSD 5ESQB 1NGYB 4UYPA 4OBSA 3EJPA 3UJJL 3BCFA 4JFTA 3ZTJG 4A7QA 1SHMA 4FXGC 5I17A 4P3CH 5DMIL 1N68A 4AMKL 4EOWL 4F3FB 43C9A 4FFVC 2F54A 1E7VA 1QP1A 3ALPA 4DPRA 1JV2B 2H2PC 4YFLF 4FLOA 3DJ9A 3PWNB 1SHSA 1CUOA 1LK3L 1IGFH 1UC6A 2Q0ZX 1D5RA 1OAXL 1ZCRA 3R1GL 3CZFA 1UB5B 5FO9A 5IB5B 1JTOA 5C0IA 3MRKB 2ZCLL 3SGKA 1AGDA 1UD6A 5EC1A 3B8YA 3F05A 1MG2C 1RURL 1A2YA 3DK0A 3MRHB 2XKUA 4KI5F 1WT5C 4RBPH 4UM8A 1NLDL 1ROCA 3M17B 3O8XA 4C56D 2EIBA 4L1HA 3TASA 3VWKB 1BQSA 4OZFH 4FFTA 5HHOB 1HHKA 4OD3H 1G4RA 2ICEB 3AM8A 3N40F 35C8H 4M7ZB 3QXVA 1TMCB 1TQBB 2AQ3A 1TNMA 3BFWA 5ACZA 1A47A 5IIEA 4FABH 1U8CB 4J3XA 3G5VB 4ZW8A 2B39A 2WXGA 4OIAA 4Q2ZB 2JB5L 2G5RA 3GO1L 1E6JH 3F00A 5TE6L 3Q05A 5AEAA 3EJYD 1QRNA 1A6ZB 3DIFA 3MBEA 1A4JB 1F8TL 1KPRB 5E2WH 2CDGB 2PW1A 2GQHA 3IGUA 4LSDA 3L48A 4E5XG 4EIBA 4QRSA 5I9QC 4XO3A 4L4VB 2EKSA 1JAEA 1G6RB 5CAYB 4M48L 3LHAA 4Z7WB 5C0DA 1NCDH 3WLWD 4L8BB 4XVSH 2JKTM 2XY1A 3OZ9L 1U91B 1HZHL 1OLLA 3TA3D 4PJCA 4OH2A 2V2TB 1MFAH 2K0RA 4JANA 3HS8A 4ACPA 5DUMH 5KSAA 4HV8B 4Q7DA 5DSCB 4U1KB 1L7IL 3LXUX 1NC2B 3WMSA 2AGJH 1T80A 1DBBL 2OSYA 4NNYA 2Z93B 5E1IA 3ZHLA 3KEHA 4LBEA 1WZLA 5TE7H 2X4RA 2NY6D 3GSWB 3H3PH 3NFNB 3T6ZA 3VD3A 2VO8A 1MJ8L 2R2CA 5C71A 1YQVL 4YX2H 2AKRB 4TQEL 3US9A 4IS6B 1HXKA 1OTTD 1VIWA 3WS3A 1PKQE 1UA6H 5DQJB 1OB1A 4YHYC 3AY4C 1DFBH 4I87A 1W0WA 5D72H 5AW9B 3WTUA 3SSGA 4NZUL 4PUBH 1E28B 4X5XA 1QR4A 3GSXA 4AVHA 4AUJA 1IAMA 1BVLB 3FQTB 3OJ2C 4KX9A 3C9NB 4EO5A 2XWZA 3NH7H 3QUYA 3UC0H 2Z8WC 4XOAA 4YBHA 2ESVE 3M1OA 4PAZA 1R5WB 1FN4A 4G3YL 5LGKA 3ZX1A 3T2QA 2DI9A 4E0RA 1YC8A 4P05A 5DJZB 2I26N 3WNJA 5DJAB 3BP7B 4MBRA 2VR3A 1X44A 1I1CA 5L8KB 1NGZA 4HXAL 4OM0H 1CYWA 2BSTA 3FB8B 1FLTX 2E7HA 4HWZA 2OSWA 3FN3A 4RZKA 3FOLB 3INOA 2OR7A 1U9KA 3HMWH 1NSNL 2B5IC 2ZAGA 1QA9A 2WTRB 2DICA 2ZUXA 3CTTA 2EC8A 1SBSL 2VJ8A 3HJEA 3KR3H 4C59B 3LDBC 5BV7H 4E9SA 1E5BA 1MFBH 1IL1B 3IFPA 4XNAA 1N18A 2F5BL 5I6NA 1TYRA 5JOPD 2L7JA 2GTZB 4GQQA 4RGOL 2FJFB 4S2SB 4KQ3L 1KT2B 2BZ7A 4UWQB 4W4OA 5C92A 2IAMA 4GXVH 4DPBX 4GG6E 1HHIB 1GRWA 4HJEA 4ZAKD 4B9FA 2I5YL 4Z5RB 5A2AA 4MAUL 1J05A 1FFRA 3Q5TA 2WBJB 3N9GL 2WBKA 1WAAA 3T71A 4BZ2A 3BD3A 1A7NL 1AP2B 1P5VA 4KROB 1VPOH 1CDCA 2QFRA 2YD3A 4CL7A 4PLJC 1ITCA 1HI6B 4M1DL 3GSQB 1EFXB 3HPJA 3LEYL 3FT9A 2IO5A 4NYLB 3O2VH 1NFDB 5B4MC 3CDZB 4ZDHB 3OQ3B 2R4RL 3GEFA 1F6AB 3BXNA 5DD5H 2ZYIA 1ZT7B 2VZ1A 3ULVF 4LCWA 1WFJA 2IPKA 2VRQA 3OL2A 2VYRE 4Y4KC 1HEZA 3ZDYE 3B6SA 1DVSA 2P8LB 5AVWB 1VAHA 1PZ3A 1MCFA 3NEEA 4UUJB 5HJ3A 3SDXA 1LEIA 4LQFL 5HHQB 1J5OH 5TK2A 1XF3B 1XTLA 2CNYA 2EDLA 1A8ZA 2CXKA 3Q2WA 3NEOA 3LMJL 4NQDE 4PIRF 1TZIB 5DUPL 5PCYA 2RCSH 2GFBB 2VDOB 5EUOB 5JXEA 3BKML 2BS8A 4N2IA 5K1VA 4K8RL 5JPNA 3WY3A 3ZTJH 4AIZA 4E5XA 3PNWA 1A4CA 3JTTA 4NC1C 2P5WB 4TNGA 2APFA 2MIZA 2AK4B 5C0CE 4JFDE 1NFDF 2ZUQB 1GGBH 2VAAB 3FUDA 1H8LA 4I3GA 3NFPB 3R8QA 4QAMB 3ZSTA 5I8OL 3UL4A 1IAOB 3TCLA 2AQ2A 1BQUA 3MJ7B 1QACA 4MD0A 1WHPA 1BZOA 3B9KA 4BZ2H 5I0XA 4DKFH 4HIXH 2G9KA 2ZXBA 2HB0A 4HIIA 3U36B 2F19L 4H2CA 2LLLA 5IKCA 1RMFH 1AIZA 3PREA 2PO6B 4QI3A 2N56A 4R5XA 3NN8A