3D07A

Human p53 core domain with hot spot mutation r249s (iii)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
194
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of restoring sequence-specific DNA binding and transactivation to mutant p53 by suppressor mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Cellular tumor antigen p53
total genus 43
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3d07A00
1YCSA 4MZRA 3VD1A 5LGYA 4AGLA 2H1LM 2XWRA 4AGNA 4GUQA 4IBWA 4G83A 5AB9A 4HJEA 5G4MA 5LAPA 5KBDA 3IGKA 1T4WA 4IBQA 3WTSA 2RMNA 3US0A 2IOOA 1LJMA 3Q01A 4IBSA 3WTXA 2J1WA 5A7BA 4LO9A 5AOIA 4AGOA 3WU1A 5AOLA 2J20A 4L0ZA 3Q05A 1TUPA 4GUOA 1IO4C 4AGPA 4IBVA 2J6WA 4IBZA 3TS8A 2IOMA 3KZ8A 2GEQA 2OCJA 2MEJB 4QO1B 5BUAA 2AHIA 4LOFA 4A63A 4KVPA 4AGMA 2X0VA 2P52A 2J1XA 3D07A 3WTUA 3VD2A 3KMDA 5G4NA 2ADYA 1HJBC 3D08A 4MZIA 3WTVA 3IGLA 2AC0A 1E50A 2BIMA 2J1ZA 2PCXA 2YBGA 3VD0A 3EXLA 1H9DA 3WTYA 4IBUA 2VUKA 2BIOA 5ECGA 3QYNA 1GZHC 2BIQA 3WTWA 4IJTA 1GZHA 2FEJA 5AOJA 1TSRA 1HU8A 3D06A 1EAQA 4XR8C 4AGQA 3QYMA 3EXJA 3US1A 2WGXA 2J21A 5G4OA 4IBYA 5AOKA 2ATAA 3D0AA 4G82A 3ZMEA 1EANA 4L0YA 3D05A 2J1YA 5ABAA 3Q06A 3D09A 3WTTA 2X0UA 2XWCA 4IBTA 1CO1A 4LOEA 1HJCA 2X0WA 2IOIA 2BINA 5AOMA 1EAOA 1UOLA 2BIPA 1CMOA 1KZYA 4L18A
chains in the Genus database with same CATH superfamily
1SVCP 1XGUB 4GBXC 4QXWA 3T3ME 3GKWL 4N8CL 3B6SA 1SM3L 4KTDH 3QDMB 5E2VL 2EIZA 2CGRH 2VDMH 4FD0A 4ZS7L 3LKNB 3WNKA 5FYKE 3ZTNL 3MLUL 4FXKB 3KGSA 4LBAA 3PHOB 4GG6B 3IMBA 1JV2A 3FH5A 1HAWA 4FXLA 4AH2A 4Z95H 5D9SB 1EEYB 3GSOB 3S3BB 4HFUH 1CK0L 1IC1A 4Y8DC 3ZTDC 4J8RB 1B4TA 1KPRA 1Z3GH 1QTSA 2XWTB 4MXVE 4QF1B 4PRAB 3WYRA 3GUTA 5E08H 2UVFA 5DJAA 5E8EB 2AI0L 4PRNA 1G7QB 1XTLA 3B7YA 3NT0A 4D3CH 2UWEB 3HCVA 4PJFE 3PNWB 4O51B 4P3DA 1UEMA 5C0AA 3QZOA 1TTGA 1DQMH 5H4ZA 1AMYA 1KB5L 2AI0H 3F01A 4YSTA 3KPLA 1OP3H 4F7TA 1U6AH 3NJXA 3D3VD 1NAML 5C0FA 2Y72A 3RZWA 4YAQA 3JVFC 4H26A 4IKKA 2AJVL 1DJGA 5JPMB 4TQIA 3VFTB 1DBAL 2P24A 4U4IA 1HNFA 1U6AL 4P2QE 4WHTA 3EOAA 4QXTA 3W38A 2VN6A 3GSNB 3L95B 3LNIA 1I7TB 2R29H 1FZKA 3VWKA 5JNYB 1UOKA 3MR9A 5EU3B 2XSKA 1QLRB 2QPDB 4M03A 2ITCB 2C3HA 2ED6A 5DA4A 4NZTH 3HG1E 5EU4A 1N19A 3GJEA 4GXUM 4UQ3A 5ERWB 4WV1A 2E9IA 3QNXA 1J0IA 4M8QA 5DI8A 2IANA 1S7XA 3F12B 3VACA 2NX5E 4JDVB 4ELKA 4P9ML 1F4XL 2VDRL 4Z7UB 5T1KD 4HUVA 4BA0A 1S7WA 3MJGX 4BFIB 1TZOA 2XDHA 4KPHH 1YEWA 2N3JA 4S1SL 3TO4B 2F8VA 5F1NB 1B2WH 1N0XH 4X4KA 4LLVB 4KKPA 1R3IL 2Z4QA 4M6NH 3MNVB 5BZXA 2GK0A 2VDQB 3FB5A 4S11A 2FATL 5F7NC 4O2CB 3WE6A 4XPHL 1YG9A 2BW5A 4JQIH 2W9EH 3PV6A 4L4VE 4G8IA 4XHQA 1PGRB 4RMBA 3QJOA 3RRQA 2OXHB 1ZTXE 1R5VA 2E6PA 1L0QA 5GS0H 5CLWA 3VD1A 2F15A 2F1AA 4WI2A 5DO8A 3SOBL 3V9CA 5INDB 4FNQA 4RBPK 5KVFH 1ZXQA 4KO9A 1OSPL 1MNUH 2NSQA 2XHNA 3F6JA 1AP2A 4FFZH 5DVPA 2O61A 2DTSA 3FKUS 1FA4A 3APDA 3U9UA 3V9FA 3MLXL 4JG5A 3ABLB 1G6RH 4NHUA 3GDBA 3VDCA 4ZD3L 1JGLL 3MBEA 3QWRD 3U0TA 2QSCL 2EIDA 4WO4B 2G2RA 5E9DD 5J6HB 2KI6A 4EXPX 4NHCH 2X4OA 1IMHC 3EO9H 3OWEA 2J72A 4XX5A 4ANUA 5BRPA 3L6FA 1NGWB 3QO1A 1AANA 1I3GL 2IH9A 3MO1A 3W0WE 4F58H 4N0CC 1EUTA 2X44D 4AMXA 3WFBH 3ARDC 1TG8A 5EU6B 4KVPA 2B4CL 3U7YH 5I1KH 4PWFA 4HQQH 5JDSB 1DQKA 2CM6A 7PCYA 2VRQA 3Q2LA 4NRYB 4ZW5A 2YFNA 3HAEB 2YD8A 3QEQD 2L04A 1NKRA 3LJ3A 1NLBL 4MAYB 5T3ZH 3TC9A 2Q76B 4AQAA 4BCYA 1R0AH 2L7QA 3KXFE 1YUKB 3CN4A 2Q8BH 2VABA 2BOBB 4YPJA 2D2CC 1EJOH 4XN1A 1QQDB 3VXOA 2GIYA 2R1YB 4HS3A 3OHXB 4GRLB 1BP3B 1VCBC 2JQAA 1OD7A 3I85A 1NBCA 3HC3H 3C6EA 5T1MA 1GXEA 2YR3A 1SOKA 4WIQA 2I5YL 3MNWB 3KLHC 3FCSA 3EGSA 4U3SA 5JORB 2I9LA 4JFDE 3QDMA 2J43A 3K0WA 3L3OA 1OP5K 1ASPA 1THAA 2YC1A 3KDMA 1TSRA 3JYCA 3M45A 1F1AA 4LGPB 5J13C 5KVMC 4K7FA 3O4OB 3L1GA 2IO5A 1TPXB 3P0GB 5CJ5A 3QWOA 5JHMA 2YXVA 4OVUA 5TTRA 1BVLB 3MRKB 1PAMA 1NMBH 2IALA 5DRXA 1UM4H 5F8QC 5I73C 1SRDA 2OKMA 1XCTB 2VQUA 1AXTL 4OV6F 1XH3B 4NWUH 4L37A 3C09C 1ACXA 1RU9L 4XRCA 2VAAA 1KLUB 3FU9A 4JFDD 2DD8L 5DHYB 5CP3H 2HRPH 5C92A 3VH8B 4AV0A 4LHJB 4PYHA 5BRZA 3TO2B 1FZMA 4TXVB 1RK0B 4FMFA 1SJEA 5FUZL 1PG7L 1D7FA 1UH3A 3RFZA 2DD8H 1I3RA 2MWCA 4BKSC 1F3DJ 5C07B 5D7KE 4YZWA 2GTWA 3ZZLA 2NY6B 4XOCA 4KWUA 2Y0SA 3MOQA 4RQQB 1U36A 3G08A 1MFCH 3GLEA 1JZ2A 5DD1L 3WFHA 2JB5L 2E7MA 2WXQA 1AO7B 3NH7L 3KPPA 2BVPB 1L9SA 1QTYT 3WCYA 4WDIA 4ZW3A 2Z4QB 1ND0B 1OTUC 3VXSE 3RWGB 3QEUB 4E9WA 2J20A 5LNEA 4BSJA 3SDYL 3BXNA 1X5KA 4GW1B 2Y25A 4H8WH 4JR9H 3OKKB 3FUNA 3QVAA 3KPMB 5ABZA 2NRDA 5EG6C 4N90D 4G5ZH 2WAHA 4FHKA 3OAWA 4N8VG 5DD3L 1IKOP 4JFQA 3LIZL 2AHIA 3D3VE 1KWGA 3FB6B 2KUTA 3OB0K 2ZOLA 1DJZA 4S0TD 1GGTA 3PP4L 4NFCA 2ROXA 1D2PA 5GRUH 4TVPH 1VFUA 1AD9A 5LCVA 2CGYA 4B7LA 2ZONA 2H0JA 4ZPTB 1CFTB 1AAJA 1OHQA 3BQUC 3IGLA 1R5IB 4Q2ZA 1XGQA 2PCXA 4YAQB 3P3SA 4IJ3B 2UX6A 1PD0A 4XX1G 2XN9B 2YAPA 4P2RE 3SOBH 2Z1KA 5BW7C 3D8MA 4HDIB 4K94C 2AS5M 2Y9RT 4LVEA 3S3DB 4AQAB 1IGCH 1T3FA 5E7BA 1GZHA 4BSWA 4QRRA 4FQHB 4KNTA 1MZYA 5JXEA 1L4IA 3INUH 2QADD 2VC2L 3CSYA 3BD4A 1TR7A 5KVFE 4QRRB 4O4YH 1J0KA 1U8NA 3QFGA 2ZNWA 1DN2A 4OD3H 1D7DA 1INDL 4OF3A 4A6YL 2WWOA 1AMXA 3H6JA 2V2TB 2GTZB 3B2VL 4PV9B 4O2CA 2XBTA 3FSVA 5IT2H 1NC4B 4XN9A 1FRGH 2Z64C 4MMXC 4YVUA 1A6AA 1TSHA 1AOHA 5MENA 4WO4A 4I1NB 3ROOA 2Z93A 2UXVA 4XN8A 3GXPA 4LEOB 1I85A 1U8IA 3TA3B 3GC3A 2XV0A 3Q7JA 5T3XD 1J5IA 4P5SA 1RUMH 3I2CL 3LQZB 3SKUD 4ADJA 3WNJA 1N68A 1E28A 2A4EA 3O11B 4FI7A 5DQ9A 5I18H 4LMQE 3WFDL 2AJUH 3DURA 4I88A 3UAJA 1CUOA 4UQ9A 1CI5A 5CJQH 4BZ2A 3VFUB 5FHAL 3S37X 1T0PB 1U8CA 2ZCKL 2V5TA 4YFLI 3SDDA 2IGFH 4QGYA 2Q7YA 2ZKHH 4G72B 3VDAA 1HVXA 1TTCA 1JNNL 4NQEE 2R59A 4WHTB 3PRZA 3TJHD 1N3NB 1N7ML 3BZFA 1GOFA 3LH9A 4MNGB 4Y9GA 3MRKA 3GBEA 4ONGL 3EOYG 4GT7A 5TH2A 4P07A 1RULH 1RPUA 4OZGE 1OAKH 3LXAA 4XB7A 1ETJA 4JDEA 4J3VA 1IGFH 1F4XH 2VDRH 4YFDB 5IBTL 4FQLH 1AGDB 4TQEH 4PYGA 3X3FL 4AENA 5E5RB 4DCQA 2JELL 2I9LB 4Y1AD 4UOW0 2ARJQ 2BSRA 2BMKA 1IC5H 2GSGB 3D39B 4Y16B 4C47A 1FVEB 1GGBH 2ZXWB 4LSDA 3ZHDA 4UM8A 4LFHG 1KBGL 2QV4A 2J1KA 3WMPA 1HNGA 1F58H 2Q3AA 4FYQA 3H8NA 3QUKB 4BE6A 3QFJE 4H1LH 4KKAC 4NHCL 4X9HA 3DRTA 4XP9L 1PKQA 1KT2A 1SBSH 3B2UD 4TUOA 3BGMB 4WV1B 5EC2B 5I74B 2WSPA 3OAUH 3RWEB 1NFDA 4Z23A 1BV8A 2PWDA 1MW3A 3O3BB 4ZX6A 2AKRA 2AMUA 1SBBA 1MLBB 4MHHG 5EBLA 5CS7A 2FR4B 4QEGA 5C3IA 3IFPB 4LCYA 4AIEA 4OZFB 3WTVA 1THCA 4L8CB 2PO6B 3OB8A 5J5EA 2BY1A 3AZUA 4GAFB 5IB1A 1H9DA 1IGJB 2DEWX 1J05B 3I50H 1AIFA 3ABGA 5KYYA 1I7RA 5BMFH 3A47A 1SZNA 3UP6A 4QHKI 4IJTA 1X9LA 1CFSA 4HLJA 4JJHA 2NY0D 3EW3B 4OBRA 4Y19D 3QDJA 4X7TA 1S3KL 4OFDA 2G9KA 4GSXA 3IKKA 2RACA 1VPOL 3CDFA 2OJEA 1KFGA 1R3KA 4P2CG 3EGSB 4U3SB 2VLLB 4XPTL 4LRIA 2X7LB 1A22B 4AKPA 4JFFB 4OFYA 5AKRA 3GSVB 1F11A 4WJ5A 3O6ML 1TQTA 3MLUH 4RAVB 1UQSB 1XMEB 4X6FB 3L4CA 3OAYK 1DTUA 2FSEB 4N5ED 4X6BA 1EMTH 5D7LE 15C8L 4ACTA 2DH2A 3H7BA 4FQ2H 4MMZB 4KPHL 5I18L 1XCXA 1U8PA 2FBRA 2OW6A 3NK3A 3U4KA 5FCUL 4BHUA 1P69B 3VRIA 1GCYA 2EKSA 2QZ5A 4G3YL 2IGFL 2Y7MA 3VTTA 5I1JL 1YN6B 3D39A 4N6QA 4D9LL 2HRHA 3MOAH 3APFA 4GB9A 2UWEE 3NJFA 2DYRB 5IQNA 2GUYA 5FW7A 1F6AB 3VWKD 3BP6A 1MIEL 4A2HA 1N7MH 3TBBA 1ZT1B 3K1KC 2D2OA 3RG1C 1HXMB 2JI2A 2AEWA 1XL6A 3MX0A 4GFTB 3O45A 5G4MA 5KSAA 2P80A 3UEZA 2SEBB 5TFSH 3LRGA 3RUGA 1WS7A 4JG0L 3IGAA 3BD3A 4XCYA 4N6RB 4Q6KA 3SCMD 4FN0A 4NQTA 3VWKC 3K6IA 5H35A 3HUJF 3EFFB 2HRGA 5L9DL 4WGKA 1A7BA 1MSPA 3GRGA 4MBRA 5H4YA 2Y5TA 2Y2TA 2HCZX 3IKCA 3RVUD 3ZGHA 3MRIA 4EI0A 2XKSA 5D1ZI 1INDH 1D7BA 5D7HA 1TZ8A 4RWHA 5CEZH 2NDGA 3GZKA 1E28B 2APWA 2X4SA 4AC4A 3K6SB 1W0WB 2UXGA 3QFJB 2FVNA 2DWEB 2VAJA 3VFWA 1HHKB 1T5KA 3CFKA 3OMZA 1Y1DA 1P5VA 1UT9A 5IV2A 1NBYB 3PHQA 3RA7L 2HT2C 3UGUA 1BGXL 1KXQE 1FPTH 1FYTA 2F53D 3VQ1C 5EZJB 5MENB 1IGML 2B3RA 3V0WL 4OTXH 3KH3A 4LDLB 2HT4C 2B08A 3SDDC 2BCKB 3HBGA 4WWKC 3C6LD 1RPQA 2VR8A 5TE7H 1UG9A 5J0BA 5CU9A 3DVGB 2YSTA 1BVKA 2X38A 2YPLD 5AUMA 1MHCB 5KOVC 1OXYA 4M1DH 1OV8A 2EIBA 5ANME 1ZLSH 4XNZC 3FT3B 4Y9BA 4HC1L 4KTDL 4XWGH 5L2KD 2IAND 3TCLA 1TIUA 3S5ZA 4X5LA 4X4XB 1SYVB 4OCMC 1P4IH 1ERNA 1S7XB 3F12A 3N43F 4YDJB 2X6BA 1GOGA 1W15A 2D3VA 2LU7A 4PLOB 4AX3A 4KKRA 5GRJH 5FYLE 2APFA 3WXWH 1KG0A 2VZSA 3W11C 1QASA 3HE7C 4OV5B 1AKPA 3DVGA 3T9WA 1R3HB 4G7VH 4WWID 2JIXD 1HWWA 5EUOB 2DQGH 4L3EA 4PJIB 2MCPL 1A21A 5IK3B 3WXWL 5GGQH 5SX5H 4A37A 3BCDA 3FU7A 3MBEC 3AVEA 4N0FB 3C60B 5DHVA 4I0PC 4OZIE 1H8LA 3KW7A 4M3HA 4DKTA 1XXDC 4ADGA 1MW1A 3P4NA 3PGFH 1QLEH 1QHOA 5CZKA 3PL6B 3RGHA 3LRMA 4GINA 4KMTH 2BSBA 4KO7A 2AEPL 2UY6A 4MXQD 2D7MA 2WQAA 1J8HE 5C0AD 4DO6A 1JCKA 3QDGA 1K8DA 3UZEC 3V0VB 3R8QA 5I5RA 1RU9H 1A7QL 2OMZA 1BIIA 2BNQA 3VYNA 5FYKU 1G9NL 4ZQTA 1EHXA 3AC0A 5DD5L 4I3GA 2WLHA 2J12B 3V0EA 3C8KA 1RZ7L 2YEZA 2XKNB 4U1KB 4WFHD 5HGAA 3TNMB 1KULA 2EH7H 1SLWA 2WINA 2XLLA 3FCBA 3HB3D 1ZV9A 4Z3IA 5IOPB 1CZ8H 4I2XB 5KYXB 4WW1B 3QQDA 1X5GA 3SGKC 3CN2A 5HHPB 3NFNA 3L3JB 4ZUTA 2W95A 4NQQA 3KYMB 3TO4A 2VT0A 3EDEA 4GSUA 3S35H 2DI8A 3FT2A 4U7MA 1WV7T 2CNZA 4M56A 1A1NB 1DE4A 1NJ9A 2BJML 2K7PA 5L7XH 4NJAH 3R8BB 2GJ6B 4UT6L 1DVQA 1FH5L 3D39D 3L4TA 1L7IH 4KV5E 4KHTH 1M7XA 4LKCB 5IJCC 4Z78A 4G2AA 4RZKA 3BQVA 5FUOL 1KY6A 3VXTA 4PGCB 4MJ5B 3KWWB 4POZC 1JFQH 1ESOA 1NC2D 4E9TA 4QRSB 3RVXD 1IU1A 4E41A 4MX7A 3LMJH 5SWSD 4CL7A 3CDGB 1ZPLA 4NO3A 1RD6A 2DW5A 4A7UA 1ZOXA 3BVWA 4YJZL 3ZYIA 1SOQA 2ZP9A 5EU7E 3OKDA 2AK4E 4D8PA 2ICEB 1P4IL 2ZUVA 7FABL 3EGXB 1F1DA 3H56A 2YC1B 3R7RA 4JRXA 3KM1A 5ALCL 5TQ2H 3S34L 1ZSDB 1NDGB 1YYLL 3FL7A 5CIPB 4MX7B 4CGTA 3MYJA 3VXRD 4QIRA 4APQA 2AEOA 3HG2A 1WVZA 2DEYX 2DI9A 3QIBD 1HK6A 3NN8A 2I7OA 4L8DB 3TT1L 1UA7A 4NT6B 4ZFOB 1F90L 1QR1A 4PM1A 5FUCE 3L2NA 4K07A 4HYTB 2OL3B 1HZHH 3HC0A 5AAWC 1NCCL 4UMSA 4R96B 2CDEB 2OX5B 4Z0BH 2VDLB 3UH8A 3BW9A 4GAGL 1KUMA 1U3HC 5TGBB 3ZDWA 4NSKA 5DJ2A 2DICA 1OAQL 4AEEA 3HRPA 1X5XA 1BLIA 3GBDA 2X0UA 1E5ZA 4LDOB 3BJ91 4PRHA 1DHKA 3D3VB 4F3FB 2B5IC 3FQNB 2EP6A 2Z92A 2J71A 3FO2B 2MHAA 1E9QA 2BIIA 5I71B 4QY8B 1B0GB 1S9WB 3DO3A 4HUKB 5HYJA 4L3CB 4XMPL 3Q5YA 5ENWB 5AB9A 5I66A 3DJ9A 4XNUH 2M83A 1OW0C 3U25A 4E41B 4LAQH 4NZRL 1TTBA 3KBPA 2VN4A 3LIUA 2X41A 1S7QA 3RWCA 5LLIC 5JHDA 4X98A 5DD6A 1FG2B 4NRZB 4AGOA 4CU7A 1T20B 1PMYA 1U3ZA 1S7QB 1D2OA 1JZ3A 4W9LC 5JO5B 1JZIA 1NGQH 1B88A 4HIHB 1P84K 5DURD 4DP8X 5FC9A 2A6JA 4IEFA 1NGPH 3KZ8A 4FQ2L 2NLJA 2LGNA 4PB9H 1DLFH 1JNLL 4HJSA 4H8VA 4DKFH 4QRAA 1SGKA 3RGVD 1UTDA 3BVUA 1P4BL 3SIKA 3WY4A 3DC0A 3CBJB 3ARWA 1BHGA 1K2DA 1NKOA 2D31B 3PJNA 3OV6A 4ELMB 3CX5K 4AI7A 2IXQB 1T6BX 1OSZA 2H8PB 2V5SA 2H0FA 4HSCX 5JOFA 4LCIH 3ORJA 1I9JL 4XAKE 2Y7SA 5I17B 2VJ0A 4OGXL 3OAUL 3RZCB 3KS0J 4WFEE 4ELMF 4ZOEA 2MPAL 1ZHBA 3TX4A 3AT0A 4I77L 4PJAE 5DFVC 3DSFL 1BQHB 1L9PA 5AUMB 4K9EC 2NW3A 3VE0B 2WYTA 5F6HI 2YGQA 3EYUH 2ATKA 3K71A 5DCCA 1U92B 2CAKA 2UUDK 1F90H 3BPNB 3V5DB 1D6EA 1F3DH 3BUDA 2Z8WC 2EILB 4W9FC 4EVNA 3RGVA 2QDVA 4MSWA 4Z77B 3F6IA 4OLWH 5D2LB 1XIWA 4X7SL 2AANA 2NYKA 5E2VH 2KLTA 4ZS7H 3IETA 4K9EL 4J7RA 5F7WC 5AAPA 5AKVA 3ESOA 2FEDC 2VXSL 1A4JB 1BZOA 2CPCA 1B0IA 2R0LL 3HI5L 3O9WD 3ZXAC 1FAIL 1JBJA 1MWAH 4HLEA 5DD3H 1XGTA 2BS71 4K7PH 3HW7A 3NQIA 1CXLA 1CF8L 4ZFZB 3X13A 1U3HA 3RAJL 4ZMVA 2DMHA 3V4LA 3D69B 2FD6L 2BZDA 4IBTA 5F7EL 3KPMA 1N5AB 1HJCA 1ZK9A 1ETB1 3D5OF 5E6IA 3SYAA 3AQYA 2Z7ZA 5DJAB 2F5BH 4PJ9C 1LYQA 1TLMA 2FX7L 2OZNA 4MMZC 1MCOH 1IL1A 4LAQL 1Y1UA 1GTNA 1FO0H 2YA2A 3FU5A 3HMWH 5AQ0A 3UZVA 1VSCA 1KXVC 2BZCA 2YK1L 3HB3B 4HMEA 2CUHA 3QXVA 3DXAE 3QCUL 3SGJC 5DR5H 4UOZA 3PAVA 1M05B 3H2WA 2V5YA 2A6IB 4EF3A 1SXZA 1B3JA 1O9ZA 2HTKC 2VZVA 3ARGA 3MODH 1H5BB 1F3JA 1RJLA 4OCXL 4PI0A 4KVNH 4CW1B 3LYRA 5B7FA 2BNRB 3RTLA 4KQ0A 1IEAA 3IPFA 3L9BA 3SQOL 5BRZB 3HI6L 4LGSB 3DOSB 3KE0A 4WFED 3T2QA 3D6GA 3B3IA 4MCMA 1WC7B 5HHOB 4PMEA 2OK0H 2M26A 4PW9A 1LNUB 3UBXI 3UAFA 2Z31C 1HZHL 3UTQA 3ML8A 2ADFH 4BZ1L 4OVVA 4MA3B 5ESVB 3CDGA 2G2PA 4FS0A 2BNUB 1U30A 1B0GA 1S9WA 1WQVT 4U1IB 2C9VA 1AQHA 2O5XL 1P1ZB 2NUPB 1IAOB 2C8NA 2H2PD 4Z7VE 4HPOL 1KBVA 3TBTB 1TZIA 1HT6A 1I7RB 3QPQD 1TJHL 4LQFL 3HC2A 4F80A 1D6VH 4I18B 4D7PA 3WN6A 5MHSE 4F7MA 4NQDA 3V4PA 2IH8A 3DI2B 4XVUD 2B0SL 3GUFA 2BIOA 4I0KA 2XY2A 5INCB 2BX5A 2W60A 4R4BA 5IJVB 5IW1A 4HWBA 1XF2A 1I8MB 4FTVB 4XWGL 4TS6A 1YZZA 3LKRB 2YQ2A 3KAAA 1R3JA 3OX8A 1T5WA 3P73A 3EJJX 2DOCA 1C9SA 3C8KB 4DZBA 3WAKA 5F9WC 4E42A 3QCVH 1HSAA 4XWOD 5EZIL 3EHBC 4DO5A 4LZKA 1OAZL 2A74A 1T7XA 2ZXGA 3KL0A 5AAMA 5JW4R 1BF2A 4UV4H 1EFQA 4XPGH 5C09B 5IQ9A 2JSFA 3ESPA 1PZCA 3NBNA 4NQSA 1S9VB 1A3ZA 4AQ1C 4KX7A 1IEAB 3UG4A 1CYGA 1OL0A 3QYCA 4Z7IA 1AJ7L 2BNRA 3RWJA 5BV7H 4NBXB 3BP4A 1KJ2H 2B7DT 1SN0A 2P45B 4XMKH 4NN5B 1BPVA 1J8KA 2DTML 2Y6SC 4TSBH 3BAEL 4PJ9A 2HTLD 1T0MA 4XMUA 5FM8A 4JZOB 2JJTA 4Z77A 1S7TB 2J8UF 3VMOA 1R1CA 4UT7L 1NCUA 3A4EA 5I1IL 5ADOL 3I75A 2WZPA 4GI8A 1URZA 3U46B 2R9HC 1G9NH 3DXAB 1MHEB 1J8HD 3EIFA 1NGZB 2HFTA 4JFYB 4DGWC 4HZ1A 2ZWSA 4X0NA 2Y69B 3IAQA 4P2RB 4U31A 4GMTL 4JL2A 2LTQB 4PJIF 2PP9A 2QQLH 3UZQB 4HU2A 5F7AA 1WAAE 1C08B 3L3DA 1N26A 4DPBX 1D5ZA 4QXGH 4M7LT 1ZLSL 4B5EA 2P44B 4IBVA 1XR9A 3AROA 3CFEA 3NJLA 2R56L 1UURA 3GI9H 2FWOA 1G7PB 4QRRE 3SPJA 2XZCL 2DM4A 5CD5D 2BCKA 2IWKA 2Z34A 3L7EA 4FERA 4JAMB 4OD1H 3SKOB 3WKMH 4OFKA 3STBA 2X4UB 4OCNC 1G1YA 3ULAB 2BVTA 1TU2A 4EN3D 5CKGA 4O5LL 2BNQB 2DIAA 2L4OA 3I6KA 1VEPA 4L5FE 4CNIB 5DMIL 3HI1B 3BISA 4OZIB 1ONQA 4XCFH 4HWUA 5K9OB 4TSBL 1CXEA 2CO3A 3LH2L 1H0DA 1Q1PA 2GFBA 2VLRD 3GXNA 3OJVC 4PP1D 3ZO9A 2ATPA 3OL2A 2BP8B 3F84A 4Z7OB 3ZDXE 1CFVH 4L9DA 3SD5A 4N5UA 4MWFA 4XODA 3QXTA 1IKFL 1IZJA 1SHMA 1T6WA 1YEFH 4NN5C 4NXSA 5JNYA 3WHE1 1TU2B 5GGTL 1U8JB 4I3RH 1VERA 4GKNB 4Y16D 2P28B 5IK3A 5CEXB 5JIMA 4RZCA 4TN9A 4ZMPA 3F05A 1WCQA 4A6YA 3GJFB 1FN4A 3DIFA 1GS7A 3TBWB 4ABUA 4MMYA 4KRNA 5GS0D 2C1PB 2D3NA 1KMGA 3DGGB 4AK2A 3K3QA 3CMGA 1DVZA 4HUCA 1CB4A 4MJ4A 3WSQH 3V6ZA 4C56E 5T3ZD 4G7SB 3U0PA 1GC1H 3D05A 3BH8A 2XWEA 5CD3B 3U1QA 3V4PH 2WLJA 4X5WB 5F93C 1GJIA 2IFGA 2P43B 1TVBA 1G9ML 3M8OL 3V52L 1J7VR 4PCYA 5D71H 1A7OH 1H3TA 5F9AC 1FAIH 2EXSA 2Z91B 4APXB 1K3ZA 2WM0A 5AZEH 3E8VA 1LE9B 1HN1A 1MRFL 2XBZA 4LDEB 3UTSD 2A77L 2H2SD 2CCVA 4UTBA 3D51A 2K0RA 1VACB 1KTRL 1PG7X 1M3JA 1XB6A 4KXZH 3DMMB 2R4RL 4DEPB 2J2ZB 5HYJD 4FABH 3PHQB 2OSWA 5ICXA 2A83A 5IBUG 4Y16A 4OM1H 4Z5RB 4A66A 4R5XA 4PAZA 5ISZB 3LIZA 1CGXA 1OQXA 5D7JC 2I32A 4J1UA 2E9WA 1KV7A 2E46A 2W38A 2WLLA 3K91A 4RRPA 3V95A 3WKYA 3GWJA 3IJHB 2ZZUT 5D72L 5D8JL 1MQ8A 2I07A 2CR0A 2V6HA 3TFBA 4BBWA 3HB3C 3UBXB 3ZYOA 3PWLA 4PRHB 4EO5A 2ZUXA 4GQRA 1QMUA 3SDCB 1RPKA 4IDJL 4F57H 1Q72L 3JWDH 4JFUA 1BG9A 4WY7L 3RWIB 3MLSH 2VLKB 4K8RH 2YMTA 4AGPA 4HGMA 3FTZA 1YMMA 3RNQA 2J8UE 3OX8B 1C5DA 3IK2A 1EDHA 4GJTB 1KCKA 5AVZB 5C97A 4NFDA 4K8RL 4GIOA 3X11A 2GI0A 3CDZB 2AJ3A 1A7RL 4H44C 5JQ6L 4LKCA 1BBDH 4MLIA 2X4TA 4TTGA 1IX2A 5KVEL 3Q9PA 5E4AA 3VCLB 32C2B 1KC5L 4KZCA 5F3HA 3MROA 2Y6TE 1KELH 1CIDA 1UWEL 2XNAA 1PZSA 2Z93B 3ESUF 3KGTA 3VCLA 3LEYH 3CFCH 3JWOC 1JWSA 1WS8A 4JRXB 1TNMA 2FWSA 3O8XC 1FNSH 3CHSA 1B6UA 1XFPA 1HL4A 2BERA 2CBOA 1MELA 4X6BB 1N2RB 1AQKL 2WXNA 2A7BA 2G9HA 3EO1B 5EU6D 2J8UA 3HS9A 3TNMA 3TYGH 3NESA 1UD5A 4ODUA 2NX5A 2QQQA 3FTUA 3HC4L 3BDYH 1E9OA 3QFJD 4JDTH 1J5DA 5F9JB 1XAKA 5KVGL 4XPBL 1KJ2B 1WHOA 2YPVA 3IDNB 2W0PA 5EEUA 1YEKL 4P04A 4WTZG 1IM9A 4N3UA 2Y1AA 4D8OA 4P4RB 3PDGA 4FQXC 4Y5YC 4TUKH 4AXWB 4HKZA 4JFHE 3C08L 4H5SA 1N6UA 1SQ2N 4Y4KC 3CFDB 3AU1B 1JGDB 3D50A 1HE8A 4NI6A 4BQBA 2ADJB 3IXAB 4ORGA 5E8OB 2ZKYA 4OGZA 4QDGA 1IM3B 3RBSA 5ITFA 1KEGH 1ZK5A 3FULA 1R5WB 3H4FA 3HG1D 4PVMA 2AVFA 4R90H 2Y7QB 4YDMA 4Q74A 5AWNH 1RUKL 3QHFH 3X17A 3VFRB 4RGNE 5IQOA 3MCYA 2ZOLB 2I60H 5DMKB 1R3HA 4GQZA 5BS0B 2QVIA 4XMVA 1P7HL 2AQ3A 3UOAB 1ZGLM 1WITA 4NGHH 3VYPA 1ED3A 3LS4L 3RKDD 3D2TA 3OC8A 5IFAL 5DK2A 3CLEH 4PIRF 2P8PA 1WG3A 3QEHB 2MRYA 3D33A 1XF1A 3V79C 1C12B 4XP1L 4MQSB 5ALCH 3ARTA 3DROB 4HETA 4WY7H 3ZR6A 5KBNC 2LU4A 1GGCL 4WJKB 3T3PE 4U1LB 5ANMB 1E4JA 1E4WH 4NZRH 4WDIB 5LG6A 2PP8A 3GNML 4HXBH 4OJFL 5IG7B 1NMCC 4BEIA 5GSRA 4OFIA 4CMMB 4ODHL 2WBWB 1IM3D 4AEIL 1X5JA 4ORZC 4JW3A 4YMPA 4LVHC 3X1NA 1RZFL 3GI8L 4Y4HC 1UACL 4P99A 4UZGA 5IFJA 4J39A 1Z9LA 3FQRA 2WOBA 1KBKA 1AP2B 1T2QL 4YSUA 2O61B 5C9JB 1J1PL 3QIUB 3FRPB 4PTUA 3P2TA 2XZAH 1KN2L 2A6KA 4WUUE 1KG0B 2ZKMX 1SBSL 2DRUA 1T04A 1Q0YL 1NIAA 4YHLH 4WWKA 2ICWA 3CVDA 4DKEH 5AKSA 4MZIA 2R7EA 2WUBH 1I8KB 4CNIA 5HPMB 3BKJH 1QFHA 2ZXDA 4MB3A 2X89D 1YYMH 4OGXH 2FO4B 1N12A 3VFTA 1G7IB 3GMRB 3HE6A 1IAKA 2K6WA 2F58H 2DN7A 2ZCLH 3SQRA 5AD0A 4M5TA 2Q2EB 1NICA 3NFSL 1MI5B 1F56A 3QORD 4AGQA 4LSUL 5KSVA 2WN2A 2OYPA 3QJHB 1P5UB 5JW5B 1U42A 1WEJH 4Y19B 1UGNA 3VRLE 3VI3E 1MHPH 2XBDA 1A7PH 3EYOB 4WGWB 4LSUH 4K94L 2EADA 2NOYA 5IHHA 32C2A 5F3HB 1H15B 2WYIA 2HWZH 4PRAA 3GUTB 3VXOB 3L3KA 5CCHE 1N8ZA 3HZYB 2GYSA 2JJSA 4JFYA 2A99A 4XPFL 4FQIH 3PDOA 1RURL 4P9HH 4FKHA 2BSTA 4MFHA 1A2YA 3UJIL 2FEDD 2XYCA 1OTTD 4FZ8L 3B7SA 2H6PB 2JQZA 1JD7A 4XVTH 5D96B 4QJ3B 2XZQH 5AL8A 1EAOA 4K7PY 3TOPA 3GS0A 2CK0L 4HBCL 5C08E 1Y18A 2XTLA 3F7KA 4RDQF 5M7QA 3HBPA 3WELA 4BXVA 5JPMA 4EZLA 2VZ1A 3AAZB 4TNVK 1G6RL 3U6XS 4IRSC 1RP9A 1JZDC 1QBLH 3TNNB 1PQZB 2FECI 4GKSB 3VSTA 3BWSA 1DZ0A 4I9XA 3UBXG 5LNGA 4P4RA 3DX9A 1RY7B 4ENZA 4XXCA 2TRYA 3F7QA 5AB2A 1RIUL 3P02A 2EYRA 1YC7A 1MFEL 3AWGA 4B5ZA 1X5MA 1ZVHA 2JWYA 3GF8A 3H3PL 1AQMA 4U3HA 4KZ0A 5AENA 4IRSD 3GYRA 3I9AA 4NUJA 4YX2L 4DK5A 1MCBA 4QPEA 3LHAA 2QSTA 3F7YB 2GUOA 1S3RA 3FOLB 3IU4L 1X7QB 2V37A 3GMLB 5JW4N 2W65A 4Y9CA 4IRJC 1U9KA 4C57C 2X4RB 5J4MA 3HNVL 5DQDH 3B1UA 4MTMA 5K9JH 1J1OH 4GG6A 4I8DA 4V1DD 1HEZA 2FECL 4LU5H 1Q90A 3JTTA 1BVNP 4Y19A 2DQGL 3AT8A 3FCGA 1NBVH 4MDIB 3V0IA 5I2IB 2X3CA 1UJ3C 1GSMA 3HN5A 3HNSL 4HBCH 1TMCB 4I3SH 5E9AA 43CAB 2FCBA 3O8XA 4UQDA 4X6CA 1S7RB 1OKEA 2ENJA 3CDCA 3MV9B 4MXWL 5IB2A 3L4ZA 4CILA 3PP3K 3T0ED 5KWYC 1MCQA 1R17A 4TVPE 1QBAA 2XTJB 5E4EC 3MV7D 5DEGA 1EXUA 1INQB 3H53A 2F7QA 3CV5A 4ABQA 4FTVD 2FR4A 4YBHA 4FLQA 4L3AA 2ALWA 1I1AC 2K4AA 2XQYG 4HKXB 3NACL 4AUJA 4EDWL 4ERSL 1C16B 1DJYA 4FQIL 3L3OB 3QZNA 2EC8A 1Z5HA 3SYQA 1AHWA 5GGRY 5J9PB 1TTFA 1MCCA 5ISZA 1X4XA 2DWSA 3PP3H 1FLTX 2DZEA 3GSNA 4N2HA 1G6RA 5KZCD 1FVEA 2B77A 5HHMD 4FXGB 4UNIA 5LGKA 3RZCD 4JN2A 5I76B 4UI2A 3G7TA 2FNWA 5A2LH 4MZ3A 3WHXB 4IQHA 4WCYL 2YD7A 3CC5B 1NC4A 3CDZA 4G1MB 2X40A 3ULVL 4FQQA 5F1KC 1KELL 1LP9A 4HPOH 1A6VL 4HZLA 5KS9E 4RFEB 3GXMA 2B4CC 3UADA 4YQXL 4YHLL 3B2XA 1JPEA 1T1WA 3ZKQD 1AKJA 1YMMB 3QO0B 3VI4E 5AZ2H 5HJGA 4K3EH 3GMPB 4F93B 1TJGL 4AEHL 4B3VA 1KTLA 2DL2A 1RZ8B 4Y2OB 2MQCA 3MFFB 2Y06L 3IXTB 1NGWA 4P2OB 1PY0A 1Z3GL 1ZJBA 3HS0A 3NJNA 3TZVB 4XXCC 2EDDA 1OB1B 4BQ8A 4PW3A 5L4IA 3SDAD 3AMLA 5F7EH 4OJYA 3RYMA 1E4HA 4YHML 1XR8A 1I8AA 3GB7A 5TF0A 2KQNA 4D9LH 3VB8A 4PVNA 2HUHA 5KVDH 1BREA 4BYHA 2BVQB 1G6VK 3TT3L 1Q9OB 1Z0MA 1NIEA 3RVWC 1NFKA 1MCEA 1MXDA 3GGWB 1CN4A 1JGUL 1JUFA 2F53B 2XIDA 2WSDA 3ZE1F 2XN1A 1FNEB 4J2QA 3W9DB 1CL7L 4QUOA 2NY7L 5E1GA 3WDHA 3NEEA 3QISA 3W0WD 3V2AR 3VWJD 2CM5A 4OI8A 2Y5EA 1F4AA 4MA1B 4OIBA 4PRNB 3IJSB 4HSQA 4M7LL 2P8LA 5HXMA 4GXVH 1AI1L 1UJ3A 4Z0BL 1MF2H 5C8JA 1HS6A 4R97C 3L9EA 5E08L 1UCBL 2ZYIA 4JB9L 5CP7A 4M8VA 4IKLA 4DKEL 1N70A 3HBZA 3WDIA 2PO6D 2VLJE 2WBJA 1NTDA 1FRGL 1FE8H 1T6VN 1S7WB 1RJYB 2DIEA 3QJFA 2CR3A 4UB0L 1FNAA 4PWIA 4DQAA 1SOSA 5GZNC 4L1TA 3EGDB 1OE3A 1I1YA 3Q2VA 1FZMB 3UP1A 3DXAA 5D2NC 1BOGA 43C9A 4F8NA 3GJFH 3UERA 4L0YA 2R2EA 1IKNC 3ZTCC 1YEHH 3E6FB 2ITCA 3HHSA 5JHDB 1VF5C 5DRZA 5I9QB 1Q94B 1VEMA 1COBA 3X14B 5F89B 2WXRA 3GZPA 3DV4B 1LK3H 4GXFA 5LDSA 1YEJH 1VESA 4O58H 1Z9PA 1MH5B 2CKBB 2FJFB 4FHJA 4I4WA 3RU8H 4EIZC 4RRPG 5EUOE 1XB8A 4N68A 3O2VH 3SJVB 4F2MA 3R0NA 2BIPA 1Z7JA 2FGZA 1GKOA 2BVOB 5KJRL 1NDMA 1NCJA 1QX1A 2XQBH 4BFEA 3KWXA 4E5XB 4OKVB 4TUJA 5F7LB 3NAAL 3ZIYA 3UTPE 3BAYA 5IMKA 4PB9L 2DS4A 3GBMH 4CGUB 3PXLA 1NEPA 2I60L 3SO3C 4JM2D 4AVHA 5EUKA 2N01B 2XNAB 2NY2B 5C0AE 1HXYA 1MCJA 1NCWL 3S4SG 5BQ7A 1MHHB 1YEFL 5EORL 5L2KA 2R1WB 2OX5A 3VSUA 3L54A 3SGEI 3CC1A 5TJWK 4IS6A 3VFNB 1URIA 4ISVB 1RVFH 2YAFA 1Y6NR 2CDGB 4HWZA 5AOLA 5CILL 1RZJC 2YPLA 1SEQH 2X2YA 1UZGA 3KPNB 4ZW7A 3NACH 1N64H 1T5XA 2VMEA 1SY6A 1UB5B 3B3BA 1IBBA 2OR9L 4EOWL 1KYFA 2WJ5A 3RVWD 1R5WA 1FYTE 1WSST 3LQAH 5F0LB 4YDVA 3BH8B 3MLRL 1H3UA 1SDDA 4F7PA 2AJVH 5CD3A 3VXRA 3LEXA 4JDTL 1ODAA 3TL5A 2VDRB 2VMFA 5K1NA 3H9SA 2XI9A 4G6JH 4N24A 3O8XB 1P7QB 3VW3H 2WXFA 3QORC 2ADYA 5TD4A 5I9QC 3C12A 5D7IA 3WUWG 3QUYA 1A64A 1H3VA 2D4FA 3AFLA 3VJ6A 3VD0A 4P06A 4WVRA 2PN5A 4GAGH 3EYSL 5EEXA 5BV7B 4KITB 5DZLA 3JZYA 2J2ZA 2DMKA 2NX5B 5JOPE 4GS7C 1A14L 3KYAA 5E2TH 1OZTG 1W16A 1JZ4A 2FEJA 4NCC1 1XF4B 1CIUA 3OM3B 1G4MA 5DQJA 4DF9A 1EAQA 5IVXA 3D4YA 1RI8A 4I9WE 5D1XB 2YUXA 3EXJA 1HH6A 4YSRA 4NP4L 1KYOJ 1NWOA 4ELDA 2IG2H 3QXUA 1CXHA 2ZXAA 4KKZA 5I1DA 4KDTA 2VXUH 5DHMC 3ULUD 4GKLA 1XD0A 1DVFB 1KLFA 3MLSL 2BP0B 1U93A 3LH2H 1FVDA 2HPTA 1JDAA 1KB5B 4UM9A 3MJ7B 1O7DC 2CZNA 3O3EB 1UKTA 5KYXA 1T0OA 1LDPH 3QWRA 5D6CA 3HC3L 4JE4B 4WFGE 4PSRA 4Y1AB 1X44A 4ZMZA 2MTPA 1BD2B 2XWJA 3D0VB 4P5KA 2XV3A 5ESAB 1RJZA 1ZHKB 4PBDA 1NBVL 2KH2B 4X50A 5CEXA 3VD4A 4XVOA 5EWIL 3VI4F 1U8JA 3IDYC 1YUHB 2EVIA 3UCQA 2IDCA 1A6ZA 4I2XE 4ZPVB 2RFXB 3NP3A 5IB3A 1OCRB 3CD4A 3QUYD 1MHEA 2A6KB 5B22A 3VFVB 1T20A 4BWTA 2IPTH 3DGCR 2EYSB 3B37A 2JJVA 2PW1B 3ECBA 3D52A 3GBNH 5DA0B 1YN7A 3MRRB 2LAGB 4TOYL 1XHHA 5I8CA 2W9DL 1U2HA 1RQ5A 1HI6A 1JYNA 4GRMA 2FGWH 3QPXH 1U2CA 4W9GC 3SEPA 1GY1A 4Y4FA 2BPBA 2FIKB 2UZXB 3FN0L 1VKXA 1Q0YH 12E8L 3CSTA 3L8QA 4G7YL 2OW7A 1XVSA 2LVCA 2YGPA 4OQ1A 2OMYA 4MQTB 3DBSA 5FX3A 4GAJH 3VVWA 4YHYB 3QQNA 4TSAL 3TF7C 2BK8A 2R0WL 1PIFA 1MI5A 2G75A 3OXSA 4FG6D 4JVUA 5HHQA 4QHLA 1SHXA 4P5RA 4GW4A 1EEQA 3QI9B 5TDOA 5B7MA 4NO5A 2GCYB 4Y19E 3KLAA 3NFPB 3RVTD 3IU4H 2HFGH 4E9LA 4YSAA 3T5WA 2KLRA 3F8UB 3G6JB 2PW2B 4L29B 3NDYE 2R7EB 3Q44A 4OZ4B 4WJG3 1U21A 2MTAA 2G75B 1MIMH 4PJXE 5EC1B 2V7NA 4S1DD 3L4XA 1KB5A 2WYHA 5TDNB 5JMRA 3NAAH 1EVUA 2VDNB 3DI3B 4K4KA 3OQ3B 2VE6A 5C08B 4XCFL 4D0BA 3QXAB 2XWDA 3CLEL 3L95A 4TL5A 2LE9A 4HCGA 1G4RA 4TNVF 2ED7A 4C83B 2R4SH 3OR7A 3HE7A 3WJLA 5BZWA 3B9EA 5IKCA 4S1DC 4HISA 1KV3A 1NMBL 3VQMA 2J6EL 4D9QD 2PYFB 3EGXA 2BY2A 1IAMA 4PJ7B 1PYWA 4DIXA 4PJAB 5D2NA 1CL7I 2G60H 5FK9A 1IVTA 2H26A 2VLRE 1BQHA 2FBOJ 5EOQH 4HKJA 3U4EB 1AQDA 1TQSA 1G0YR 1LQBC 4PBWD 4Y5VA 5C0RL 5LGJA 1H6TA 4ZSOB 3NPZB 2I9TA 2DQTL 5IFHH 3U30C 5LUMA 2B15A 3MUGB 4KX9A 5ICUA 3W1ZA 2YO3A 3L7FA 2VLJD 3MLZH 4WNJA 1NFAA 5CM1A 2X6MA 4P8QA 1F8TH 5MEND 3HE7D 3VXTB 4AY0A 4PY8I 3WFHB 4RMTA 4MCYB 4PV8B 3JWNC 4PCSA 4F15B 2XZAL 3CZGA 2DJSA 3MV8D 1EAPA 1ZEAH 1FVDB 1JRHI 2JJTC 3DJRA 4J3OG 4UZSA 5CSBA 2YPKA 1HFUA 3P9MB 1RUPH 2HZHA 4IEFB 2E3VA 4HUMB 2ADFL 4BZ1H 2ZG1A 4HIPA 4I48B 4LL4A 2AP2A 1CYWA 2BC4A 4QRTB 1MLCB 2MIZA 4PGBA 1U8OB 1TZGH 2JB6A 1E8XA 3FBKA 3P54A 1JGLH 5I16B 3FHQA 4BFNA 3EKCA 1ZWIA 4NBZB 5KBPA 4I13B 5AW8B 4U6VH 4YLCA 1GIGL 1A3LL 4ICWA 3C8HA 4Z7WA 4HLZH 4Q6IA 2VLKA 1YJDH 4JFHD 1C5BL 3AJ7A 3O4LB 5C71A 4YLQT 4Z7QB 4HFUL 4OBSA 4FULA 5BJTA 2VXQL 1MI5D 4R2GC 1YNTF 5MI0C 5G2NA 5KVDL 1I1RA 3CHPA 3FPYA 4AJYV 3X1BA 4DP0X 2BWQA 2UUDH 3BPLB 4AK1A 3IU3A 4LVOB 1KB9K 5IHWA 4F7PB 2D8KA 4PJ6A 4BFJA 1PY9A 4PRHE 2UYLB 1XEDA 1IEHA 3MODL 4WHYH 5A40E 2JJUA 1I4FA 4KAQL 5IBTH 3AS0A 1WE5A 4P57A 2PR4H 5FYLH 3WN5A 1RFDH 2QGDA 5T1DH 4Z7QF 3CZNA 4OF5A 5IHZB 3RE0A 5A2KH 2VUKA 2EICA 1Y0LA 2Z91A 5IGXL 4TUOB 1NC4D 2WUCL 3GSXA 4LCUA 2DJ4A 3NN8B 1ET5A 3S37L 1PCXA 5A3IC 2H32A 5L2JB 2WQRA 1SJHB 5B3JF 1OT1A 2E6QA 5FYJD 3RZCA 3QHZH 1PKQE 4B27A 1G0DA 3WLBB 4NO5B 1PX3A 4YSCA 4Y4HB 3L3JA 4G9FE 5C0CE 2W0FA 4LPUA 1SXAA 5EN2A 1VJSA 4DGVL 3U6RB 4IGBA 3FQUB 1BZ8A 2AXFB 4RMVA 5J6HA 4BQ9A 1JMXA 1REIA 2FHFA 2WLNA 1DQML 3GZQA 4ZSOE 3RKPA 4L4VA 3TGXA 3BX7C 1EO5A 4HJUA 2ZUQC 2EIEA 5DJCA 3L48A 1JK8B 4DP1X 2MJWA 2DWYA 3C5JB 5E8DL 1WICA 3E2HC 1DANU 3QIUD 3FTWA 1AYOA 2M2DA 5GRUL 5CD5C 5DJ0A 2F7OA 3M6DA 1T66C 4CC4A 4HWEL 4AT6B 4IHOB 3BZDA 2W0LA 4PS8A 3PHSA 4AYFB 3NTCH 5HHNA 3L13A 2FBJL 1CGVA 2FYVA 4A2DA 1ZT7A 5DJZB 1BWMA 1U8MB 1YAIA 2L0DA 2UZYB 1RZIB 2C7FA 1VGKA 4MJIA 1A6TB 1MXGA 5I6KA 4NQDD 3O9WC 5D4QA 5IY5B 4KH2A 25C8H 5FA4B 1WTGT 4XNXH 2JI1A 2B1HH 4X6EA 1BYPA 2DI7A 2NLJB 3ZMRA 4ANXA 2NR6C 3POHA 4GIPD 2CO1A 2CO4A 2WHVA 2WWMD 3W56A 2JCCF 4X99B 4OCWL 2GSIB 1QI5A 1XAUA 3FRUA 4OY9A 5T5FH 5E70A 3VXMA 2BVUA 3EBIA 1S9YA 3FXIC 4P9HC 5JPNB 1XB3A 3MYZA 1ICTA 1E2VA 2DLIA 1AFVL 1AQ8A 4UQCA 1IARB 5B39B 4JKNA 5C0GB 3DV6B 2WIMA 4E0RA 1UQSA 1NBZB 1EZSA 3FFCD 3FNKA 4GMTH 3CX5J 4WEBH 4ZI8A 1G6RB 3MXVL 5I6LA 2GTQA 4NWTL 2V4LA 4PJEE 3DRQA 3F7VA 4HJJH 4LLQB 1ZLUH 3T08A 1E4XI 3DETC 3NCYP 5KAQG 1TJGH 3QDME 4KK5C 2R69H 2FJGA 3E9UA 1SQMA 3RGVC 3ZDXF 5HD8D 3I9PA 1KJ3L 5IT2L 1QLFB 4HT1H 4XP5L 2O6FA 1A47A 2QKIA 2Y2WA 3IXTA 3MRCA 3LHPH 3QUGA 4PG2A 1D9KA 3KJ4C 4OLUL 1ZTMA 3MRDA 3S5LA 3EUDA 4NERA 2VW4A 2OFQA 3SGEH 1KCSL 2M8XA 3K74B 3DHUA 5E5MA 3B9KC 1JYXA 4J12A 3X3GH 4XBGB 1S9KC 1M7DA 3ARZA 2AMGA 1BQLL 4LLAA 4WI6A 3KPPB 5TF1H 4Q97A 1TPXC 4UOW1 4R4FH 2XVKA 4A2EA 1A3QA 4XHJD 2C7UA 2IQAB 4R4BB 4L9LC 5FDWB 3B9KD 3S4SA 4MKMA 1R0AL 2HJFA 3BDXA 3PHOA 4I48A 4ALAC 4M5YH 1LDPL 1BZ9B 1F5WA 2XYBA 4NQDB 3V4PB 3N1PC 2ZF8A 3MV11 4EUPB 4LPXA 2C5DC 4F8LA 2HG5B 4LCWD 1RH8A 2RHEA 4NQSB 3IM1A 3JTSA 4ETQA 1BD2D 3VH8A 2ZIDA 4GUPB 4HAFA 5HYSB 3BN3B 4QHMB 3C6SB 3S35L 4XNDA 4S10A 3GRWH 1DO5A 4M43L 3GSNH 2RA1A 3KCWA 3H3BC 2WVSA 4P3CL 4FFVD 3WU1A 3TBYB 1MFVA 3WI9A 3WFEH 4EMZA 4N0RA 2P5EA 3N3EA 4YE4H 5ESAA 5I1GL 4XC1H 2YD3A 1KIUA 3QXDB 3HRZB 2VCOA 1MRCL 4JFPB 3G3LA 2PYFA 4JFZL 1MREH 5FO2A 3O6KH 1OE2A 4M48L 3O3EA 2O5XH 3C6LB 4MJ2A 2VIRB 3QJTB 2NY6D 3T3MF 3VXRB 4Y4HA 2NY5C 4GAJL 3TJPA 1OLZA 4OF0A 2LTQC 4G6KH 5G55A 1N10A 3SE9H 3ZQ9A 2DKSA 5IM7A 1WRFA 1J8SA 1DVYA 4HHAA 3AREA 4YHPB 3HAEG 3ZKXB 1WFIA 3MBXH 1ZD6A 4F27A 1M6OB 1PL3A 3EJYD 3NIDF 4ALAH 2WWKT 1M1XA 4NDMA 1WAAA 4LEEA 5F1OB 4PD4J 4ZQKA 5HHVH 3TEWA 4ZFOA 2YRPA 1E50A 1M7DB 2WLKA 2WXJA 3VW3L 2FX9H 1RL1A 4LNVA 1TT6A 1KPVB 4UTBH 1NPJA 3GSVA 1IQWH 4JVWA 1B3IA 1BLNA 1A6WH 1FP5A 1TKWB 2XETA 3U6XA 1JTTA 1LD9A 3BH4A 2YSSB 4GBXB 1RLWA 3B2PA 3ZJAA 1S7SA 4Q8BA 2QBWA 5I73B 4LHQB 1XGTB 5EORH 3OAYH 5HDBF 2CSPA 3JWNE 3QUZB 4AM0A 2XN9A 3V6OC 4H8PA 3AAZA 2CIIA 1DEEA 2B1AL 4YE4L 4OAWB 2VDKL 1CE6B 1E8YA 4HCRH 3U0TB 3B5HA 1QFWM 1W0VA 2Q86B 2DQMA 4XPHH 5IJBC 3LSOB 2A74C 2CCWA 3C8DA 1CI3M 2C3GA 3V8OA 5B38G 3IJ8A 4K94H 3RWHA 2IDUA 4ZMTA 1GAFH 4Z3JA 2YD5A 1I9EA 4XMTA 2IAMD 3BDYL 5IB3B 2ARWA 3ZN6A 1NLBH 1P6AB 2R1WA 4XCNA 3L5XL 3KJ6L 1GYAA 3NOIA 1KTLB 4NI3A 3TA3C 3RJOA 4L4TE 3V6FB 5AYUH 1BZDA 3C08H 3QEGL 4IRZH 1AZZC 1OQOA 3IGUA 5IVNA 3NGBB 4GQPH 2DLFL 1ROWA 2JCCB 2GITB 1H19A 5HI4D 5EZJA 5K5YA 3UL4A 4LFHD 2H2SC 3DROA 4AVJA 3VNZA 3CG8A 3TTYA 2WVTA 2YA0A 5EDSA 4HWBL 2R29A 3IYLW 2ZXQA 3HFML 1H3GA 4KI5E 2NYZA 1E5BA 1BMWA 1IGFL 2O72A 3K4ZA 1CLZH 2CG9X 1P4BH 5GRXG 1B2WL 1N0XL 2MEJB 4KJQC 2QADC 2AITA 5F6HJ 5CFHA 3C2AH 1OY3B 1XL4A 3PWVB 3QP3A 2RFXA 2QQNH 3P0VH 2MPAH 2FX7H 4OGAC 1FDLH 3ELQA 4BZYA 4U49A 3CN3A 3QJFB 5CJQL 2ICWI 5HGDA 1VIWA 2VRAA 3KNBB 2AC0A 5EO1B 4JM2F 4AJ0A 3FQTA 1DVXA 3VDBA 4N26A 4MQ7B 1FDLL 2IV8A 5DFWH 3D25B 5CLTA 3UYPB 1URLA 3MV8A 4BGDA 1NOLA 5GS1A 1HESA 1UD4A 4OLYL 4P2QB 4YIQA 3AQXA 3ETSA 4XAWL 3MA9L 5DSCB 3EBHA 3LPWA 3FRPG 5GRVK 2O26U 5B3NA 3VXUD 5EH1A 3ZGIA 1T1WB 2VSCA 4J3OC 3MV7B 1PLGH 2W5PA 2CUAA 3OXRB 2XIBA 4TULL 1SN2A 3RPKA 3MLYL 1RZJH 3M86A 4WUUB 2YKLH 3DVIA 4O00A 4OB5H 3VXPB 5D7LA 5IWLA 4BFOA 1BM3L 3KPOB 5MEOB 2YQ3A 3O3UN 1L0PA 5J06A 1OAQH 3CVHB 3V4VL 3EF4A 3ZKNC 5HJ3A 3H55A 4XTRC 1TZGL 1G7MB 2OMUB 3CFCL 1JNHA 4DQOH 1DR9A 1UFGA 4ZPTA 3T0XA 1AE6H 1XBRA 5EUKB 5L0QB 2YIHA 2UX7A 1ZVYA 4JE0A 3I6LE 4EN3B 1CS6A 2J8OA 4KZEH 3EDDA 4AYMC 5EF0A 3MRRA 1BWWA 1EJ6A 2IBBA 4AYGA 2YRZA 4YX2H 1LO3L 1FNHA 4PRIB 3FTVA 4FFYH 3KYNA 3HPLA 4Q0XL 3J07A 3OG4B 5E8DH 1AIFB 1QOKA 5GISL 5JR1L 5K9KB 3BGFC 3QA3B 4PJGA 3U2IA 3GMOB 2BSDA 4IBWA 4ABWA 5HYEA 4L4TB 3BT0A 3B5TA 4JO2H 1QRND 2F19H 5E00A 3ZT7A 1TF4A 3GFUA 5HDQL 4JZNA 5DJ8B 3WHE0 3X3FH 2VZTA 1IVLA 4NZJA 2GB2A 1EHLL 1QRNA 5L8KB 3ML9A 1CGSL 1LMKA 1O0VA 3G5ZA 5ACMA 5JYMA 4X6CB 4RFEA 5MP6H 3HJ0A 1E43A 2C3WA 4YHIA 4Y4KD 5E99L 4KNQA 5JIIA 4QJ4B 2DKUA 4Y5YA 4Z78B 1DN0A 2CLRB 3AADB 5TQ0L 4WNQB 2X53A 5D7EA 4ZFQA 4H1LG 1H6FA 3BRDA 2CK0H 3DBXA 4PGEA 2EXTA 1U8IB 1IO4C 4PJ5D 4TQEL 5BPPA 4DP2X 4FOMA 3P3RA 5B1BB 3IDYB 3VM7A 2GEEA 2DMGA 3IRPX 2DQTH 1OPOA 4PRID 4H4NA 4LPCA 2ICEC 3L4UA 1GPOH 3QZMA 1JI1A 4G1EA 5LXGL 3E80A 4J3TA 2VMDA 2ZG3A 1QRNE 2IWGA 5HJDA 1V7MH 4X80H 3EJRA 3BUYA 5G4NA 2DBLH 4NKDA 5D7LD 4FA7B 3GINA 1XH2A 4FCAA 1IRAY 3I50L 2XACC 1KB9J 3ME0B 5DEGB 4XXDB 4HS6A 2PPAA 5EBMA 1NGXA 1JGEA 3SDDB 3O3AA 5C0BE 1ZA6A 3AXIA 3WLWD 2YRBA 4UU9B 2R2CA 4OD3L 1YPZF 4A6YH 2APTA 4X9GA 3PQYB 3ULSB 1NPNA 2HUEA 5C6TL 2O5NA 1IGJA 1IC7H 2QQLL 1EGJH 3VI3A 2HKFL 2HH0L 3PIQB 4R26H 3LPPA 3TM6A 1I7TA 3NYKA 1AD9B 3EOTH 1WD9A 1HWGB 2AV7B 5C0EA 3SZKC 4JFEE 4PJ7F 4YWGL 4NNXA 3OHXA 1R75A 4R4NC 2E8ZA 4J3SA 3B2MA 4H26B 1NM9A 1MAMH 3FB6A 2ZYSA 3UEQA 4E9YA 1E6JH 3T2NL 5JXAL 3EH3B 4GO9A 2B1AH 2EE3A 1RZGA 3K8MA 2NCEA 1ZANL 3RIKA 3FN3A 1ZHLA 3KH4A 5C8JB 5I19H 1A8ZA 1CICA 5I5MA 2W91A 1F41A 3B4NA 1QYGL 4XVJH 1OAJA 3GO1L 4XP6H 3TF4A 5CHNB 2GSIA 3EYOA 5C0BD 3T4AB 1IFGA 5MEPB 4HG4J 3WEXA 3I02A 4FNUA 4OFYD 4X5PA 2YBRA 1MI5E 3QEUA 2IFFL 4FYTA 3QJHA 3GMNB 4UF7C 4UILH 5LGYA 1FCGA 3UBHA 1FNEA 2XA8H 3LH8A 3UAJC 3WNNA 2XWTA 1DP0A 5HVGB 3IWVA 4KRPC 4KRPD 4LBEB 2IGTA 3F5WB 1UB6B 5KBDA 3OJMB 4U7SA 5DS8A 3NSJA 5DMKA 3ARBC 1VGKB 3KNBA 4APQD 1DQJA 1Y07A 3DKHA 1JYVA 2PYEA 2BVYA 5DHVH 5F88A 4XPFH 4JZJB 1NCDL 2P5EE 5C86A 2KZ1B 3CVBA 2Y07H 1XH0A 4N0UA 3K4DA 4FMVA 2VKWA 4CJ1A 2JB5H 2OV0A 2DPKA 1CLYL 3PWNA 5EU5B 5D1QD 4MVBC 3AMKA 2PWGA 2IPKA 4GW5B 2NY3C 3DURB 3HZMA 3T65B 4OV5A 3PWNB 5EU5A 3RA7H 4W9JC 1BGXH 1IC0A 2RB8A 3SBQA 1ZVNA 1KGXA 3NIGB 1FZKB 1UOVA 1UZ6F 4G6MH 3STZA 2WV3A 4J3OH 1MCPL 2DYPD 2X12A 3ZPDA 4M6MH 4AZ8A 4MS8C 3ABKB 4BSVB 1TJHH 1UXMA 35C8H 3UTTB 1YY8B 1FFNA 3QWOB 1M7IA 4JN1H 1RIUH 3DYOA 4NOFA 1TITA 2AK4A 3OSVA 3NJMA 3RHWF 2HTKD 5IEHB 2F2HA 4JN1L 4P23C 1GKEA 1WZKA 5IMOB 3W9EA 1QFUL 4PJBF 4V1DB 2QVTA 3BI9X 4P3DB 3QEQB 1MFDH 1T22A 4X4ME 1KBPA 1QZ1A 4DGIH 2GSMB 2JNZA 2AABH 2YFOA 5FCSH 3L5WA 2JXMA 3SCMB 4AZUA 3CUPB 4HOWA 2MCPH 4NO0A 2BOBA 1KGCE 1W8OA 1SUJA 1TETL 2GJZB 3FTSA 2VISB 4Y1TA 2XXGA 5C09D 4JM2C 1AY1H 4MNHA 1R5IA 4Q2ZB 3QFDB 4UT9A 5EIIG 3TVMA 3G5ZB 3NZ8A 1QPPA 5GRJL 5JHLL 1O75A 1RHFA 4OIIL 4UV4L 4XPGL 3VWKB 1PZDA 1BJ1H 1I4FB 3GXIA 3V6OE 2B9AA 4JZJA 4HEPA 4AYID 2E7LC 1SFDA 1AR1C 4G7RB 4XX1E 1HYSC 4HIJB 2FLRT 4OZHE 4QLWA 3WFCH 5DC9B 4HMDA 4LHUG 3AUWB 2MCMA 5GXBB 1FC1A 6PAZA 2B1OA 2CD0A 4G6FB 5FR3A 1IT9L 3EADA 1DQLH 3OKLB 4XH2A 4JCLA 4YDVB 5J1SC 1GW6A 4U1IA 4PJ5E 3BWUC 3QI9C 2A83B 1HEZB 2WO2B 4OSUL 1JZ6A 1QNZL 3MRBA 1G5GA 4AGNA 2XV6B 1I1FA 2NZ9D 2L7UA 3BUYB 5DZ9A 2HT3D 3QIUC 3FT4B 1WC7A 5HHOA 2AAAA 4ZOAA 5F6IB 3INOA 1UT2A 4M00A 4NS0A 2JJWA 3HUJB 4QAWA 1D5RA 3H9ZA 2HG5A 4L0PB 3FYEB 3DRTB 4A2GA 3C6LC 4NUJB 2OJ1A 1WF5A 3DVNA 1BFVH 2A1WL 2EDBA 4FFZL 1TDQA 1JE6A 4CU8A 1MY5A 5SV3A 1QHPA 2HT2D 4N9OB 1JERA 4DZ8B 1N18A 5IM7B 3MLWH 3SBWA 4C56D 4YK4C 4RAHA 2UWEF 1R24A 1G1KA 1N5YL 5E99H 1A7RH 3D4GA 3TS8A 4PJCF 2OTWA 2WXKA 1A14H 3JQOB 4X6DB 5C09E 5L4JA 3Q1SH 3WKPA 3U79A 3PLYA 1PZ5B 3TBWA 3K72B 5FIEA 2BIHA 3ISRA 3MRQA 1II4E 1KY7A 4G80A 4JRYB 5KYNA 1YA5A 3SDAC 2YHGA 3N5AA 4Z95L 5B1AB 4HUVB 3RX8A 4AVIA 5KG9A 2E75C 2A6DB 1U8QB 2NYYD 3OBAA 3RIAF 1S7RA 5ETUB 3ZK0A 2QKIB 5KJ7E 2AERT 2R2EB 4X8XA 3BE1H 4XO3A 5JLZB 3EXLA 3WUZA 3QCUH 4MDIA 4KO5A 5CBAA 5DMJB 3V0HA 4NQEB 3ZKMD 3ZKMC 1JPST 3EFOA 3TFKD 1LO0H 1AZRA 4X7DC 2AJSL 4KNUA 3A4FA 4MBOA 3A67H 3WL9A 4K5NA 5B8CB 5AYQA 3U9PH 3QYMA 2OP4H 3W9EB 3R1GL 1K5NA 2YPVL 4WHYG 1X7QA 4MS8D 2NY7H 3VQLA 2BSSA 2J21A 3DPDA 1ZVSA 4PHXA 4JQVC 1UWXH 5H8DA 3TEYA 4FJ6A 4FE9A 3QEGH 3FT0A 3QG6A 4HKBA 3FCTA 4HIIB 1JWMA 1NCHA 3E3QC 3MTRA 4UOQA 1MRFH 2EXWC 4EKJA 4OLEA 2ZD0A 4YO0B 5I6NA 2LU3A 3CSPA 4XNQA 4YQXH 2H8PA 2P5WA 3ASNB 4Z7NB 1CO1A 2E7CA 1I9RH 4XVUC 2OMWB 1MUJB 4FABL 2GPZA 2H45A 1JZGA 1T03H 1FE8L 1CMOA 2BP5M 4HHWA 4K7PX 1OAXH 3B1TA 4Z76A 1LEIB 3HN3A 4A6YB 3LNGA 2WXIA 2UVEA 4YHOH 4KKQA 3KJ4B 2IWEA 2J3SA 2JF1A 4BH7A 3A6CL 4L8SC 5FM5O 4PWJA 5ITFB 3WTSA 1RUPL 4JO4L 2EIZB 4JK0D 3RDTB 4F8OA 3AQDA 2FEEI 3B6SB 1ZLWK 4P5TC 2NCMA 3RWJB 5GS1C 3MLWL 2BSTB 2R69A 5J12C 5T3XL 4JQIL 2P5WD 4LLUA 5GSRB 3U9PL 3N91A 2QHLA 4YUEL 4GRWE 1IEBB 1KTKE 2FX8H 1E2ZA 4YOKA 3UTZA 3RVXC 1K72A 4U7KA 2P49B 2A5UA 1BBDL 1CDBA 2NW2B 4DZBB 3VU2A 3EO0B 1V55B 2X1OA 2Y6SD 4ZMNA 3PV6B 2B2XH 2ZSVA 4JRYE 1HL9A 1F4WL 1G7PA 4FYSA 2CLZB 4CSZA 2P52A 4RESB 4MQ7A 4BFFA 2ZCHH 3I6GA 1IFHH 3P1VA 3GRBA 1TJMA 1FL5A 5K59F 5I8OH 4F8PA 2JKLA 5CWSB 2R83A 4IYKA 2B39A 2QQNL 3FUMA 2EEFA 1F0LA 1GH7A 4NNPH 4UOJA 2BNQD 2R0WH 3SYOA 1SEBB 3QNXB 4M8QB 5F7DA 4B7IA 5IZ7A 3K81A 4R3SB 3K2MC 4XMPH 3V5HA 4W9DC 1MFCL 3HZKA 3O6FA 2NQ3A 4PJCE 3RVVC 4TQPA 4HKZB 4NM8L 1HINL 1OAUH 3NJKA 2H1PH 5DJ0B 4PRIE 1C5DB 2NXYC 4UT9H 3IFOA 2VLME 2PTUA 2AXGA 4QRPE 4RGOH 5E00B 3ZY7A 3BN9C 4S0HA 3TJHC 4QXGL 1WZ1H 2Y2YA 1MAJA 1FBIL 2WZAA 4UUJB 5B7EA 3T3MB 3V4PL 1MFNA 3U2SB 1WWBX 3SDDD 1NANH 4PJEB 3IF1B 1CGTA 3O9WA 3VH8G 3LHPL 1O7SA 2GK2A 3ARFC 2J8UB 5EBWA 4WHCA 3FO2A 4FADA 5I75B 1AO7A 4S1QH 2F08A 3KDMB 4JRFA 1XR9B 4YHKH 3H9SB 3MNDA 4ZT1A 2BFGA 1HZLA 1OGTB 3QORA 5CEZE 2V9QA 5C0IB 1K6QL 5CINH 4EI5C 1BXUA 3ZKND 1OTTC 2I27N 4QOKD 2JKSA 3KR3H 3OZ9H 3PXJA 4L1SA 2NTFA 3LCYA 1L9RA 4QF1A 5F3BA 1AGCB 5FLUA 5F97E 1X5FA 3S6CA 3MRGA 4UINL 1JG9A 2A4ZA 3HUJA 4P3WA 3M1BB 2XX1A 1ZWIB 2HPOA 3WY3A 2PCFA 4FQ1L 2J5WA 3KBFA 4WWKD 4X4MA 4Y89A 5DHYA 5DZVA 5I82A 1AXIB 4IS6B 3VFNA 1VADA 3O6LL 5D70L 3ZRFC 4NRXA 5JIKA 3RBGA 1BYOA 4JJ5B 1CG9B 1GZPA 3VFMA 1MCHA 1QPXA 4JG9A 3FT2B 4IKNA 4Y2LA 4XO5A 2J6EA 3D87B 3LS5H 4LPVA 3RX5A 5FF6B 1Z3RA 1OCWH 1FZOB 3ELAT 4G7VL 3MMEB 1TJXA 1WIOA 4PJBB 3LVEA 1EO8H 1BD2E 4ERSH 3STLA 5I5JA 4I2XA 1AVAA 4WK2B 1ACYH 2NY4D 1GCFA 3BP5A 2QMKA 5LGHL 2OMVA 3U7WH 3HNVH 5DQDL 4PR5B 3F58L 3OKDB 1P1ZA 4Y0GA 2VL5A 4HD9A 1F86A 4WLCA 4JUTA 4JFEB 3NVQA 3PGCA 4JDZA 4YHKL 3MUJA 4GG8B 2QPEB 4HFWB 3SDAA 3ARDA 1LNUA 3BIBX 3QSKB 2HKFH 3LRHA 4RLDA 3ARFB 1JF1B 3NK4A 4ODSL 3QUMB 2W80C 4PSPA 1OGSA 1KCSH 1U92A 5BVJA 1IGYA 4I89A 4Z7QE 5FGCE 5J8OA 2VJXA 2QLYA 3IFNL 2HX8A 3M17B 5GZOD 4R7DA 3P4NB 5FB8A 5K9QI 4ALAL 5ADOH 3ISWA 1O6TA 4MXVF 4QO1A 3BWAB 4X5WA 1XMWA 2AEIT 3D85A 2K9UA 5DVLA 1MCLA 3F00A 5HI5C 3BMVA 4M61A 4ZO7A 2EABA 4JPIB 4ENED 5I1JH 4XCEA 1EUUA 4MCYA 2P8MB 3D06A 4XR8C 3ARBA 1T83C 2F74B 1MCSA 2C9QA 3L5IA 2XTSA 2EUZA 1J5CA 1TJIL 4JL1A 4KDTC 2OA9A 1OAZH 5E24E 2UZYA 5D5MF 5HGDB 4YDKH 1Z32X 4FDWA 2QPUA 1YO4A 4F9LC 5IROA 3AS1A 3D85B 2WK2A 3DOHA 4P2RA 1E9PA 2X6CA 3U7WL 5ANHA 2H47C 3F58H 1DFBL 2J25A 1D5IH 2W07A 2XG4A 3IN2A 1ZS2A 4Y5XC 3SQBB 1OGAD 4N2BA 4X2UA 4DKFL 1RJCA 5F70A 3A6BH 5CN3A 4URTB 4LCVA 2BRQA 4G9FB 4MMXB 5KUKA 1CLYH 1TCRA 3HZVA 4C58B 4JMXA 5T33H 3TYFB 3Q48A 5IFJB 3ARGB 4G3YH 2FSDA 1CE1L 2WIIB 2PYEB 1YPZA 1HI6B 3RGBA 3IMUA 4MAUH 1BAGA 1Z9SA 1NINA 3WD5L 2C7UB 2Q5BA 3IT8D 4DETA 1X7TA 3THML 4WU5A 1BZ7A 4R6UA 5GISH 5HDLA 2GBTA 1JZHA 4JNXA 3FYIB 2WQVA 1GL4B 3BUBA 3QUXB 1JXFA 3TBVB 3SY6A 1CD1A 1GS8A 1UXSB 3SBPA 3BZEB 4XPBH 3Q5OA 1DBAH 2E4TA 5LG1A 3IJEB 5D1ZA 5E8EA 1BLNB 4NYLB 3QO0A 2WBJC 4JO3L 1A6VH 4PRPD 1ZHLB 5IBLD 3ALPA 2X1QA 4Y1AA 3O45B 4WI9A 3CXHJ 4Z3HA 5JIPA 2ZOTA 1BZ7B 4MMYB 2R69L 4N2EA 4UAOB 1JXGA 1U93B 5EU3A 3MLVL 2Y1YA 3VB9A 1G84A 3MV9D 3HAEH 4RA0C 2JCCE 5K59E 2A6JB 1KCBA 4HH8A 5FYJH 1LE5A 1JSYA 4HMCA 1LQSR 2MOQA 2Y23A 4HALA 1QR4A 3IMRA 1ZHNA 4TNEA 5C0IA 4M62H 1L6XA 3EFDH 3V6BR 2JKIS 5KSAC 5KSBF 3N50A 1YN7B 4XWOC 5C0GA 4ZDHB 4YXHH 1NCBH 4HGWA 3SDCD 4OT1H 5EIIA 3GHEH 4DP4X 4HKXA 3RWCB 4J3XA 3GDCA 2EIJB 2XKUA 1EJFA 2L7EA 2EECA 2F18A 1KIRB 1UADC 4OCWH 1U33A 1BAWA 1KN4L 5DWPA 4PJ5B 3LX9A 4KK8C 3Q6GL 5EOQL 4AMWA 3QRFM 3VD3A 4KRPB 1MWOA 4JFSA 4QTIL 2AJSH 5JYLA 3FTGA 2VLKE 5E4OA 5C7XH 4BKLB 4OGAD 1FL6B 2WNKA 3MX0B 3OWRA 3NCJL 1TETH 3BKMH 2VOTA 1XSOA 4IGBC 1D5ZB 3PFUA 4HXAH 4EE2A 1JV2B 4H8WC 4YR6A 3T0AA 1DBBH 1FGNL 2CWRA 3PUUA 4WO4C 4ZS6D 2FAUA 4L3FA 1FSKB 1XGRA 4N2KA 3S37H 2YPKB 3IFLL 5EBLB 3UGEA 2GBVA 3RWDA 5BUGA 5CZRA 2VMCA 3GMLA 1CTOA 2PCFB 3GKWH 4K3EL 3NJHA 5DQJB 1NEUA 1EFXA 4YHIB 1T89A 3OLDA 1CF8H 3FQYA 1PKQB 2FSEA 4P2RD 1A7OL 4FG2A 4BV1A 4J3OD 3WENA 2IPUG 3MLPA 2YEVB 3J7HA 2J73A 3FQ2A 1GZQB 3NSFA 5HHXL 2E9JA 4WUKL 3B56A 5FECB 3QBTB 5DMYA 1JK8A 1L6PA 1QA9A 3MBWB 1OAXL 4ZK8A 4IBQA 5KSBB 2OMBA 3X13B 4JFXA 3S97C 2OJEB 5CCKL 3LN5B 4JM2A 5DUBA 2D0FA 3O81A 5D2NB 4I18C 4JHWL 4JO3H 5K1JA 3VGFA 2NZ1A 5CSZA 5DUBB 4FL4C 2K6ZA 2YWYA 5L6YH 1PAZA 4XVSH 4J1UB 4ZMQA 5BZWB 1DO6A 5TH2B 1TTAA 3Q05A 1JGUH 4Q89A 4LLQA 2AZAA 5JQIB 2A1WH 4LCWB 2N7AA 3KPQA 5FYJL 1U95A 3I6SA 3PWUA 4KDWA 3BSZH 1BEXA 3BPOB 3RUGE 4PJFA 3TPKA 4NNYA 4GT0A 2TAAA 4WUUA 2CDGA 1F1GA 4BQCA 5T1DL 2W07B 2XG4B 3CHRA 5IR1B 2IANE 1AHMA 3SCMA 5B4MC 2GJ6A 5EOCH 2G60L 1TYRA 2G5RA 1U91A 2YMOA 4YSPA 4CVXA 4QGTA 4YO0A 5T33L 3NIDE 2X10A 4R5TA 5IHLB 3JV6A 3S5LG 4DPAX 3FO9B 3LMJL 2ZQKA 4C4KO 4F33A 1EAPB 5DLMH 2OLDA 2F8XC 5I1HL 5GSVA 1I1AB 3HE6C 3UC0L 3LZFH 3T1WA 4UQIM 2HFFA 4WEEA 1R6VA 5H2BB 1AGDA 2Y3NA 3QJQB 2EH7L 4XN5A 1IZKA 3IDGB 3RZCC 3HA0A 5HYIA 3RY5A 4NKOB 1KENL 1S5IL 3TA3D 4JCMA 3CNKA 5F1SA 2VERA 3REWA 4HCRA 5DJZA 4H25B 4PRBB 1FFOA 4Q6YA 1NH6A 4WI3A 4XMXA 2HLFD 2AAVA 1WWCA 4U1SB 4U2YA 3TJEH 2BJMH 5L7XL 1H9VA 1EHKB 2XJKA 1J9QA 5EO9B 4ATTA 3VSVA 2YGOA 3VX1A 3MKKA 4ECNA 3ULVF 4Y5XA 4B96A 1XWVA 1R46A 3TPUB 4PRPA 1NGYA 1BVZA 2YAEA 4OR1A 3CFIC 5FKAA 4LSRH 4MJHA 1A6WL 1TQVA 3VX0A 1FGVH 2F54D 2VDNL 3O4LD 1E5UI 4JKPL 4E2OA 3AGVA 1NCCH 3JSSA 4PJIE 3WLWC 3CZKA 2Z7WA 2ID5A 3T0EC 5GS2D 2A6IA 3C60C 1EO7A 4HZAA 1JHTB 4JFTA 3FH7A 3MA7B 4PGZA 3IVKA 2OMVB 4ZFFA 2Q7AA 2LR4A 1Q9LB 3OKNB 1MJ7L 4MJJA 5J6GB 1ANUA 4LBEA 2RAMA 4F3FA 4TPRL 3FUEA 2XZQL 2LHAA 2VJ8A 4UM9B 5GGQL 4Z7AA 2DQHH 2DQJH 4ZW6A 1A6TA 4ZFFB 5J6GA 2OMXB 4M7KL 1F6AA 1GVIA 3BZ5A 3QCTH 2E8YA 4HJIA 1EV2E 1Q1JH 1QLEL 3U7AA 2OMZB 4AYSA 2Z7UA 3C5SB 5CFAA 2P8PB 4A2FA 4HZLB 4QRFA 4P48A 3UG3A 5TE4H 3CSBA 5EOTB 3TU6A 7TAAA 4BQ6A 4UDUA 5EWIH 5SWZB 3LS5L 2QJDA 3GPSA 4XGZA 3HG3A 4M3JA 1EX0A 3WIHH 4JFFA 2XV2A 3CFMA 2BVQA 5AVRB 3FQXA 5AALA 2NY6C 5FOBA 5AZUA 1R3KB 1PSKH 3QUZA 2MPVA 2IH1A 2H1XA 4Q58C 4LF3B 3VFGL 3W5NA 3VWJB 2V17H 5HYQA 1GYVA 2N59A 5JW3H 1MN4A 2VDPB 1I75A 3RIFK 4C55A 5T1LB 1A25A 5C0CB 1NCGA 4QRSA 1MCDA 2DQHL 2DQJL 3ABZA 5TDOB 5JW3L 3TBCA 3G6DL 2WAQA 2WUBL 5DLLA 4NPKA 5IR1A 3GMQA 1MHCA 4WWPA 3ATEA 3U4BH 4A7GF 5KSAB 5EEYA 2WMPB 2AK1H 1PY4A 2DEXX 5AOJA 1FVCA 1GHFH 3L3GA 1NAMB 4R3SA 3K6OA 3K5SA 2VITA 3BFWA 4XN4A 4BXSV 4L8SB 2X87A 4O2FB 3KCPB 1RZPA 3BO8A 3CH1A 4RMSA 5IV2B 4LVOC 4Y1AE 3ZE2F 2ZXEB 2H4EA 2XVBA 2W88A 1ZSDA 4K5OA 2VMJA 5DR5L 4GRMB 1KGJA 1I3RB 2J1YA 5CGYC 4N2OA 4HIXL 5H37A 4RDQG 2X4SB 3K6SA 2X4TB 2E7DA 2R23A 4O02H 1SOXA 3B9AA 1FNLA 4FX5A 1FG2A 3MCLH 4MA7H 2ZUTA 7PAZA 3BDBA 2XQBL 1USQA 2QHRH 3ETBF 3IKCB 3MGOB 3VXSA 3LS4H 1OPGL 4KJPD 4NQED 2AQ1A 4JDZB 1QA9B 3TONA 1NUDA 3RTQA 3LZQA 2ESVA 3QAZB 1F6FB 1H3XA 2IDSA 1AQDB 1UM5L 1AJ7H 5BV7L 1N4XH 4GSQA 4N9GA 4OLVH 4GUPA 4ZTEA 1Q94A 3B3IB 1OD9A 3KL5A 4G9FD 3HPLB 3SKNB 1WWAX 3KYKH 4Z7OE 4UILL 2OTWB 3IJHA 3D3VA 3HS0C 3VXNB 1DQQB 3E0GA 2AGJL 3X12B 1AIZA 1J86A 5CMAA 2G2NA 3T2PA 4N0FA 1PLBA 2OR9H 5EZLA 3GT6A 1HKLH 1P53A 1KYOK 1I7ZB 1I9RL 4BUQA 1RZFH 4LSVL 4ABVA 2OTUA 1AO7D 5CJXC 3QIWD 3NSYA 2HX7A 2B4CH 1AR1D 3GHBH 2J6WA 1UFUA 4BKLA 5JUEH 3ZDZE 2QTVA 3CXFA 1KT2B 5EC2A 2VWEE 3P77B 1CFQB 1A6PA 1CDIA 1Y6MR 3ASOB 3RILA 2YQGA 3V0AC 5L2KB 4IOIB 5FKPB 3MRMB 3DMMC 4DEPC 4WEUD 4U6HB 5JUEL 3QZWG 1LEGB 5KVGE 4DGYL 1EGJL 4NQVB 4DHLA 1LTXA 3FSAA 2CDFA 3WNOA 4Z6AT 2WQUA 3DTDA 3ZYZA 3FUFA 1WBZA 5I75C 4GH7B 1HHJA 4YUEH 3CQFA 3L6FB 4ZBJA 5CR1A 3FB5B 3G5VA 1VCAA 2VDML 3FQ4A 1YPZE 4PJGE 4LP5A 3LKSA 3O4OC 3INUL 3UTTA 1SDDB 4MB4A 3KPSA 4DO4A 4ELME 5IQMA 4ZAKD 4P4KB 5M95B 4QHNA 4D9RD 2UZIH 2PO6A 1F58L 3L3OC 1AOZA 4XPAL 2QV2A 3P2DA 5AW6B 4ZXBB 2QFPA 1UCBH 4JO1H 3C5ZD 3TIDB 1XR8B 1CFVL 1DBJH 3EOBA 4ZOCA 1WCBA 3AG1B 5F72S 4YHMH 5KBMA 2BP8A 4Q4EA 3OKMB 3G04A 3HS0B 4PB0L 3TZVA 2NQCA 4AQ1B 3SOTA 3LQZA 2MQ3A 4EOWH 2R8SL 1T0NB 3O3DB 4GMSH 3CBRA 3ARPA 1OB0A 3W0WA 4HJ1A 3D2UA 5D1ZB 1HOEA 3ULUF 2VLMD 5I8KL 5IHUH 1U2YA 4L1LA 1KJVA 2V8LA 1BMZA 1NMAL 1ZT4A 4IIQA 3BKML 5B39G 4MD0B 1RHHB 3PU7A 3NFNB 4ZUTB 4Y8AA 5C0FB 1DFXA 1NAMH 3S88L 4PREA 3ABMB 5EOCL 1Z5LA 1HX0A 3B8SA 4Q52A 3US9A 4L2YA 5GRVL 1LL1A 1VLXA 2EEBA 4LLVA 4EXKA 4JM4L 2PUQT 1KEGL 1YCSA 2DAVA 2ZG2A 4IBLT 1BF5A 4M61B 2F19L 2LQRA 3NABH 4KOBA 5A2CA 4LP4A 2X3AA 4XMWA 3REVB 3TVMD 5I15L 3L5HA 4RGNB 3DV4A 2V3DA 4P46B 4X8GA 2AQTA 4XCNB 2EVJA 3VFWB 1ADQL 1TOXA 4MQXD 5DI8B 5K33A 5E5UB 2EYSA 3ECBB 4AEHH 1CICD 3T65A 1KBBA 5A6MA 5D4IA 3N42F 2HLAB 2CRYA 3KEHA 4RAVA 4WENB 4X6FA 1QLRA 4XTRD 3TT3H 3GGWA 5FYKD 5C9JA 3UPCA 4HWNA 3TCXA 2BRRL 3VTAA 2CMRL 4JHWH 3QJUB 3QNFA 5E4EB 2HJLA 2UXTA 1TUPA 5CZXD 4BH7B 1CURA 4Z8FH 4KMLB 4NC2B 3NJIA 1DSWA 1WGVA 4KGJA 4PUBH </