1IQWH

Crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCARNRDYSNNWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY M-HFE7A, LIGHT CHAIN
publication title Crystal structure of the antigen-binding fragment of apoptosis-inducing mouse anti-human Fas monoclonal antibody HFE7A.
pubmed rcsb
molecule tags Immune system
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH02
4ELMA 4ERSH 1QO3B 1UM4H 1UXWB 3V4PL 1ES0A 2C3VA 3FHQA 4Z7VF 5T1DL 3ULSB 3FN9A 2UWEF 3PHSA 2R2EA 3K1KC 1R3KB 4JFPA 4PJFA 2FEEI 4N5UA 3RBGA 1FPTH 1ITCA 4FFYL 4PJ9A 1DFBH 1T6VN 2BVOA 5ID0B 1JP5A 5KTEH 3MCKA 3MO1B 2W91A 4OLYL 2A74A 4ZUVB 4GQ9H 3B8SA 3SE3C 2JIXB 5C0RL 5JUEH 3SGKA 1G7QB 1DBJH 1FSKB 2IH1A 1OW0A 5DGRA 3EOAB 5GS1A 2G5BB 4WUUE 3BGMA 5F9OL 2JB5L 3MTRA 5IW1A 1JF1A 1K6QL 3RA7L 4AH2A 4YDKH 1RJYA 4X6DF 1AE6H 4RAVA 4KUZL 4X7EC 4HJJL 3NCJL 4JO4L 2ITDA 3AY4A 3ARYA 4HUKB 4XBPA 4Y4KB 2BY1A 3HRPA 3MNWB 1ZA6A 3MRRA 4RAUB 1MWAL 1FG2B 2OZ4L 3ULUE 3S36X 1KJ3L 2ITCA 4PB9H 3FFCB 1I9JH 3KLDA 4RA3A 1F4WL 3B9AA 1BAFL 2VSDA 1XF2B 5FIEA 3DHMA 2VISB 5J1TC 3L95B 4U6HB 3SCMB 3L5WB 4R0LB 5GRJH 3PWUA 2Q8AL 4DGVH 2DLGA 3JTSA 3QYCA 1QR4A 3VFSA 2XTJB 1LO5A 3NIGF 4F3FA 4FQCH 1UKTA 5BS0A 1URLA 4LCYB 3SBWA 4YXKL 3TNMB 3RWFA 1R3IL 2XN9E 4CVZB 4RSVA 4PR5A 5GSVB 4NQUA 1SQ2N 4MAYA 4G8GA 3K3QA 5I18H 1M7IA 1FL3A 3LKQB 3EJYD 3LKSA 4RGNC 4EXKA 2XNAB 4MMZC 3L5JA 3BKJH 4KQ4H 4TTGA 5DRZA 1IILE 2WIIB 3DO3A 1DZBA 3OSKA 4CJ1A 5MHSD 3T0EE 1H0DA 2VO5A 2IAMB 5FGBA 1OSZA 4K7PX 1N5AA 5I1AA 4ZUTA 1XFPA 3S5LG 4HKXA 2DQTH 2Y9RT 1JTPA 3PF2A 1O0VA 4KJWD 3SDCD 1Q9WA 1CDJA 4YXLH 3EJZC 1T89A 4QRPB 4PJXA 3MRBA 4L8SB 4ELKA 2VTFA 5ADOL 4LLUA 5ALBL 4OB5H 2CGRL 2DD8L 3C2AH 2DLEA 5I8KH 2H9GB 2FIRT 3HI5L 4LKXA 4NPYB 2BVQA 5C08B 3LIZL 5KOVC 5A16A 5GS3A 2A2QT 4JJ5A 3FFDB 5FOBB 4EI5A 5BO1H 3BKMH 2JJWA 2VLRB 4Y2DC 3F6LA 2X1WL 4BQ9A 5H35B 4NUJA 2OTPA 4P4KB 1T1YA 1E4XH 4FQPA 4NDMB 3WIHL 3G5XA 5HYQA 2VAJA 5EO0B 1AIFB 3D25A 3MLUH 3FCTA 3OG6B 2XKUA 5MP6H 1U2CA 4GKZB 1UWGL 5KVFL 2D7NA 1ZVSB 4J8RA 4GRLC 1RUPL 1U8MB 3FO9A 1AGDB 4TVSa 1YEFL 1FORH 2P1YA 1FV1B 2EYSB 3ZKNC 4LDEB 1Q9LB 4Z5RB 3NABH 3KWWB 2ZWLT 3F8UB 4LAQL 2I9LA 4NNPH 4LQFL 3VRIA 2AJUL 4XVTL 5C71A 1NPUA 2D7OA 2DQFB 4HPOH 1WCBA 4JQVA 5L88H 4IS6A 3OJ2C 4OZFG 2HVKA 2XPGA 1OTUC 3CMOH 5BV7B 5DURD 2QSVA 3NAAL 1MI5E 5FUCC 1OTSC 1C16B 1S7SB 2OQJA 4NIKB 3V0VA 2VKXA 1ZT4B 5DDHB 5SV3A 1FCCA 1D5XA 2GT9B 3MV8B 2OM5A 5DI8B 5F97E 1CD1A 1DUYB 1HEZA 1LO0L 4LSVL 1G7MA 5C0CD 5I1KL 4P4RA 1L6XA 3QEGH 4NOFA 4EKXA 1E6OL 3TESA 4DK6A 5HY9B 3QDME 3ECBA 5D7IF 2Z92A 4PTTA 4CADB 4WW1B 5EBWA 1NFDA 2ZUYA 4DKFH 3IDUA 5E94A 2I07B 1D5MA 4NRYB 4X6CF 4MHHI 3O2WL 4LP4A 4D2NA 5TE7L 2E7BA 1X5XA 4IRSB 4GG8B 1X5JA 2HFFB 4LEXH 5DJ2B 2YMXL 3ZMRA 5C0DA 4NO2B 2R15A 1IAKB 1YEDA 5EO9A 1QLEH 4BH7A 1KPRA 5IT2H 1FNHA 2EDHA 5IESH 3WKML 3DJ9A 4UTBH 2ADJA 3ZTJH 3STBA 3U9UA 4WCYH 3MBED 3RWHA 2XZAL 3MRFA 3GMLA 4XPHL 1ZGLA 5I1DA 2GTZA 3TP4A 4K7PY 4ZFFA 2WP3T 5K9OB 4K7FA 4YZFF 3JVGC 2W0FA 4P9MH 5E4IA 4Z95H 2OR9H 3BRFA 4QOKA 1A6AB 4I8DA 5HHOA 2BY3A 1NCCH 2CR3A 3QAZB 4XNZB 3H9HA 4HV8B 4L4VE 5LGJA 4AK1A 4L3CA 4LRIC 1N59A 1T0MA 4JZNB 2A38A 4G5ZH 1KF9B 3RWIB 2XWBA 5GRWA 2XTLA 3ULVL 2VDQL 1JNHA 3G04B 4PBXA 3T4YA 4YHYC 4HIHB 1MPAH 5E6ID 4GRWH 3MACL 4AMKH 3SO3C 5I15H 3PQYA 4CVXB 1A6ZB 3IFOA 1NFKA 5DJDB 1VDGA 1ZLUK 2R2EB 1U6AL 2IANA 1CGXA 2CIKA 2VNCA 2XWJB 4PJFB 1VADA 3K7UA 9CGTA 4JKLA 1TVBB 4PJ9B 4QXUL 4LVHB 4YUEH 3HZKA 1WBZA 4DCQB 3I6LD 3SDDC 3MCKB 1FGVL 1OAXL 3I75A 3KLHC 4MCYB 1WWBX 4FQXB 4YH6A 1I1AA 1BD2A 1ZTXL 4S1DC 3P30H 2HP4A 1BEYL 1KEML 3NGBC 4O2EA 4P2QE 1RZGB 5GS1B 3D18A 2RIKA 5E5MB 3BGMB 4NCC2 5MI0C 2N7BA 1OM3L 3MRHA 1RZKH 3LKPB 4GSDH 3WIFA 1QFOA 4AH2B 2NYYC 3KPSD 4P2YA 1TTUA 3CVHB 3WN5A 1GC1L 1G6RB 4F7EB 3HNTH 3FQWA 4RAVB 3EAKA 4XP5H 5DK2B 4PLJC 2AVGA 1C5BL 3RVUD 3P4LA 5D72L 1J5OH 4P3WA 5DTFA 4UIMA 4XBPB 1X6LA 1ZA6B 2KQMA 3OAYH 3DOSA 3LQMA 1HH6A 4APQC 2ITCB 4IMLA 1DEEA 5DR5H 1U92A 3BZ4B 1WWAX 3T8XB 1F4XL 4CVWA 1S8DB 5KW9L 4KJQC 1CDBA 1WK0A 3PWUB 4I18B 3O45A 3JTSB 4XPTH 4P9HC 4X4XB 1Y6KR 2HJKA 4KROC 3TPUA 5BS0B 3QI9C 4OCRH 3UTSE 1KEGH 3FN3A 1L7TL 3W0WE 4XX1G 1JGUH 1UGNA 1RUMH 4PR5B 4MAYB 4G8GB 2MFNA 3A6OA 4RGOH 3STZA 4ZYKA 4JFHD 4XH2A 4AQOA 1HZHL 1FL3B 3QXWA 5D1ZB 4R7DA 2OP4L 3KPSA 4JG0H 1JCKA 1Z9MA 4P3CH 5EBMA 2EO1A 2ZJSL 2DD8H 4NUGL 3VWJB 4MD0A 4LU5L 2F8VA 3O9WC 5CGTA 1MIEL 2EKJA 2YHGA 3EJJX 3ULUC 3ZE0E 2FBOJ 4RX4D 4MJ5B 1U3JA 1OSZB 3FMGH 1G0DA 1A7PL 3DVGA 4HKXB 3QCVL 3RZWA 3P0YH 1Q9WB 4W68A 2W07A 5I8CA 1OAKL 4ORGB 3V7AE 4JDTH 2ZKHH 3S36L 1A14H 2FX7L 3NPSC 4FS0A 2ADFL 5JZ7D 4FQHB 1LEIB 3MRBB 4ELKB 1U8LA 1G9NH 1F3DH 1CK0H 1EA9C 1EJOH 4LLUB 1NCAH 1TQBB 3RWCA 3H8NA 3NZHL 3UBXA 5ACMA 1MCOH 2DYPB 4HWBL 3GSXA 4LKXB 2BVQB 1RZFH 2VLME 1ZGLM 3QUMA 4JJ5B 4N8VG 3BZEB 4EI5B 1YNLL 3OKMA 4BJLA 5D7JB 1RY7B 4JLRA 2NY4B 3L3DA 4LSSL 1RQ5A 2QSCH 5I1LA 1T1YB 1I3RB 3T0EC 1I4FA 3G5XB 2P5WE 3TYGH 4ETYA 3D25B 3FCTB 4EIZC 1CL7I 3QNZA 1AQDA 1OGAE 5D7LD 5IHZB 1OHQA 4J8RB 4M43H 2B5IC 4K7PL 3FL7A 3NFPA 4OM0H 2R4SH 3GEWB 4WV1C 4D9RD 5IB1A 3KG5A 1CDCA 3O3UN 4KUCF 4D3CH 5JPNA 2I9LB 3VRIB 2WK2A 4NKDA 1H5BB 3TYFA 1WCBB 2HYMA 2DQDL 2H41A 4KK9C 3U7WL 5JA9A 1ODAA 3NIDF 5B22A 4TVPD 3FAWA 5CILL 1TPXB 3CDCA 1VCAA 5GSRA 4HW6A 2NY6B 3QDGE 5F3BB 2OQJB 4KQ3L 3TF7C 4GKOA 3V0VB 2R8SH 4MLSA 5HTSA 1NLBH 5AYQA 1OAZL 3M8OH 4DQOL 1MQKH 5ALCL 1HEZB 3PV6A 3VXOA 2CK0H 4PY8I 4IOFD 3V79C 4U3CA 4WFED 2K3TA 3WYRA 2R1XA 4FQ1L 1DN0A 4OFYD 1P4LB 1P7KA 2RB8A 1V3LA 3ECBB 1DQDH 2P8LA 1BOYA 7CGTA 3T3PF 2Z92B 3ZE2E 2EDXA 4I3RL 5EBWB 1NFDB 2F58L 4F8QA 5TQ0L 1D5MB 2Q7YA 3SGEH 1YY8B 1CD0A 4LLDB 4M6NL 4TPRL 4NKIH 3RTQC 4NKQB 3Q48A 3GBNL 5KG9B 2AJYL 2ORBL 2FB4L 1RK0A 5DD0H 2ADJB 1ORQA 3CU7A 2OS7A 3V4VL 4TUOB 3ZYIA 3U9UB 2VZTA 4XX1E 2XQYK 3GMLB 1VERA 3DXAE 4OLWH 5I1DB 1ZGLB 2C3XA 4DGYL 1NCWH 4ZFFB 2PR4H 5IBTL 4K7FB 3T65A 3CU1A 3P9LA 4HT1L 5CWSA 2W0FB 4FQ2H 3PWPD 2PUQT 3HNSH 4QOKB 2V5MA 5HHOB 4JKWA 4OFYA 1BZ7A 1I7RB 2VXQH 3KYKH 3DLQR 3H9HB 2NY3C 1H3TA 4ZUWA 1YNTA 3P4MB 2C3HA 4O2FB 1T0MB 3RDTA 3EOTL 2F5AH 2R0ZL 3H6JA 4OUUB 4X4MA 2NXZC 1AR1C 2KQNA 1JNHB 1XR8A 1FCGA 1BMGA 2F54D 5KVGH 2DWDB 1RSFA 2DQGL 3PQYB 4Y19E 2BNQE 3D85D 4XNUH 1MEXL 1RULL 4FFWC 4GJTB 3OXSA 1FRGH 2IADB 2E9BA 2Q76A 4A6YA 4EUPA 1GC1H 4ZO9A 2IANB 3EDFA 1I9EA 4P5KB 1VADB 2X42A 4HCRH 4O00A 5ADPH 4RMUA 3DSFL 4WI9A 3HZKB 5FK9A 1WBZB 2CDEA 1KTRL 25C8H 4B5EA 1N2RA 3I75B 4OJFL 3O11A 3JZ7A 1TIUA 3EDEA 2W9EL 5HJ3A 1I1AB 4K3EH 1QSED 3K2MC 3L5HA 2BY0A 2IALA 3LN5B 4BZYA 4O2EB 3LPGA 3JWDC 4JFZL 1IEBA 8CGTA 4RGND 4UIKH 3NFSL 3BKYL 4UAOC 1KUMA 3MRPA 3LS4H 1UWXH 5HYJA 3OJVC 1ZT7A 1MRFL 3MRHB 2Z9TA 3WIFB 3MLRL 5I9QC 4N0UA 2Q20A 3WN5B 3WUWG 3SGJC 4NGHL 1WZ1L 3ZSSA 4QCIA 2XOTA 2YKLL 1DEDA 2VQ1B 1E27A 4NQXB 5HHXL 1MNUL 5DTFB 3FQTB 4GBXC 3EJZD 3D85A 4KH2A 3W5NA 4U7KA 5EIQA 3U46B 4FZ8H 2VQTA 1S9YA 1MFBH 1IAIH 1T22B 1ZGLP 3IDMA 1DEEB 5T5NF 5D96C 1Q0YL 3MJ6A 4FXGA 1DBAH 3D0VA 5T3XL 2ARJQ 1E4XI 1AGBA 2HJKB 5FYKH 1QZ1A 3TPUB 1QSEA 1WITA 4Y2DD 5CINL 2BJMH 4KVCL 3LDBC 5F88A 5FM8A 5GZOC 3GNML 3V6ZB 4ZYKB 4LPTA 2GK2A 1XR9A 3MUGB 4L4TD 3STZB 3QUXC 4XH2B 3GMMA 3P0VH 5T3ZL 2B2XH 2JE8A 2PYEE 3K1DA 5DMKA 5SWSD 4QRUA 2OL3H 5FA4A 3IRZA 4Y7MA 2HWZL 2DBJA 5I6XC 1YDPB 4MD0B 3SEPA 2PO6B 4OZHA 2J1KA 1II4E 4D0DA 2R4RL 4GRLD 3MMEB 1SMAA 1J1XL 3KHQA 3ZKND 4JRYE 3RUGA 1IGCH 3HC3H 3IXAB 5C0AD 5I8CB 4Y4FB 3AXLB 1Z2KA 3PWJB 3KAAA 4PJFF 3M17B 2IGFH 3GSOA 2NTSP 4HZLA 3EDDA 3RVTD 2RQ8A 4CGTA 1U8LB 1KLUA 4O58H 5AZ2H 1ADQH 4MQSB 3MLPA 7FABL 3A6BL 1KNOA 3MV01 4W4OC 5DRWA 4M8QB 1OTUD 1M7DB 3WFCL 4F7MA 2IAMD 3ZE1F 4Y2DA 3QHFL 1MELA 1OTSD 3GSXB 2FX8H 3H9YA 4BYHA 5GGUA 3EIFA 1DE4A 1OPGL 1INEH 3QUMB 4K94C 3HI6H 4XZUB 5SWQA 3OKMB 3MRJA 1TQCC 3G6DH 4KV5F 4JLRB 3WNNA 3KS0H 3U2SB 5DD1L 3EKCA 4W4NA 1JI1A 1YQVL 4M7LT 3RVXC 4ORZC 3B9KA 3C5ZC 4HKBA 4XPFH 5I1LB 2NTFB 5C0IA 1I4FB 4E41D 5GS0C 4EDWH 5F7DB 3QJHA 3PNWB 2Y1VA 4OFIA 3BE1H 4NZRH 2NY5H 5C6TH 1QFWI 2HFGH 3KPLB 1BQSA 4LHQB 1TVDA 2AEQL 1WGOA 3OKKB 3MREA 4OGXH 5F7FA 2VLRD 2XYCA 3DPBA 1J05B 4I13B 5GPRA 1A7QH 3ARDC 5ALCH 2OJEA 3VXMD 3MZGB 5IB1B 5CUSL 3RFZC 3T1FA 1JIBA 3NN8B 3N9GH 5KVEL 4PRPD 5JPNB 1NEZB 4Q0XL 4I48A 4NC1E 3GBML 1A7OL 1FGNL 3MYJA 1S5IH 3J7HA 4LVNC 3OB8A 1Z6JT 4YR6B 1R3JB 1GGCH 1AKJD 4RA0C 5GSRB 1VGEH 2PW2B 2A6JA 4LSRL 2HN7A 5LAXB 5I19L 3VGFA 3AGVA 4YHNA 4PRIE 1UACH 1PLGL 4WI6A 3VDCA 2G60L 5CP3H 3ULVE 1BVZA 4RIRA 2EDNA 5LWYL 1FJ1B 3HG1E 2EH8L 4E41A 5IWLC 3VXOB 1Z5LB 4UV7L 3V5HA 1Z9SA 4ZO7A 1DN0B 1TJHL 1GXEA 4DTGL 3HZYA 3H9SB 2HFEA 1EEYB 1UWEL 3FO2A 3UJIH 1IVLA 2P8LB 1MFDL 3O6FC 4OBSA 1N8ZA 4ZQKB 4WI3A 5DJAA 1JWSA 1J10A 3VI4F 3WDHA 4P3DB 1QA9A 3H7LA 4YHIB 2X89D 3GIZL 4YFEA 3VXMA 4M6MH 2Q7YB 1DL7H 4LLYA 3CSYB 3IJSA 4PRPA 5DO2C 5T1MA 2XV6B 3QNYB 1VENA 4KXZI 4AL8L 2VOTA 2IG2L 5F6HI 1IQDA 4OM1L 5ERWA 1S7VA 2P24A 5CD5C 1NC4B 1RK0B 2P5EE 5MERA 1R5IB 4QXGL 1JPSL 1ORQB 3SDDD 3KLHD 3O3AB 2RAMA 3JVGA 2UVEA 3MOBL 5IP4A 4G3YL 3VXUA 3QEUB 3TNNB 4S1DD 4BFEA 1G7HA 2ZUSA 3PL6C 4HXAL 4PJGB 3V52L 1LD9A 4H25A 2YD2A 3C60B 2AXFB 4LOUC 5D9SA 3T65B 3P9LB 2X4RA 2LTQC 4NZJA 5CWSB 2QQLL 4LRIA 5C0JA 4IIQB 1Z9OA 3FQUB 2NYYD 1BZ7B 3UC0H 2Z0BA 3UAJC 3ZTNL 5HDBF 3DSFH 4JPVH 1IGIL 5DFVC 2IFFH 4HJGA 3RDTB 4PLJD 5FFLA 5I8OL 3VFGL 5B38G 4HIXH 2X89A 1TCRA 1J1PL 3L1OH 1JGDB 3S88L 1XR8B 4X5LA 2FCBA 4BZ2H 3V6OA 2NCMA 1YZZA 1MCSA 2VDRL 4LCIL 4APQD 4XNXH 4UQ3A 1PAMA 5EUOE 1IBGH 3VGAC 1A5FH 3SKNA 3ALPA 2RJMA 5FECA 4TN9A 3BQUA 1MHEA 4UTAH 4ONOA 3OKYA 4KJQD 3CXHK 3OXSB 1Y6NR 4A6YB 1JPTH 4PJIA 5IFJA 3BWAA 3TO4C 4ODXA 3AC0A 2P8MB 3TGXA 2YKLH 4KROD 2XFXA 3GK8L 1NDGB 3QI9D 2RCSL 4MXWH 2VH5H 4MAUL 3JUYA 1N2RB 1CTOA 1JHLH 5HJ3B 4WUUD 3BMWA 4DN4H 2BHZA 4KK6C 1AXTL 4P2OC 3D87B 2HMIC 3WUZA 3BPCA 1SJHA 4PTUA 2R29L 1GPOL 1L9MA 3TBTB 2R1YA 1J0ZA 2H32B 3IFPA 3MRPB 2BDNH 4U1IA 5HYJB 3WSQH 3PDDA 1ZT7B 4OFPA 5SX4I 3TIEB 3PGDA 4N0UB 4JG1L 4V1DE 1NFDF 2YWZA 3HR6A 1NCDH 5J06A 1U8QB 3ULUD 2UUDH 1NC2A 4KVCH 4M9OA 1MCRA 1E27B 1AP2A 1W72A 3BP4B 1F8TL 4M93B 2VWEC 3TO2A 2CLZA 1J1OH 5F96H 2NY1C 3CX5K 3D3VE 3JV5A 3CH8A 2VLKE 1GZPB 1K4CB 4LK4A 4JM2B 2VUOA 3U4BH 1CICC 5JDSA 4LCWA 1WT5C 2WQ8A 5EA0H 5JPMA 2R56L 2Z31C 4FXGB 4JQIH 2X4TA 3CMGA 3D0VB 4GG6B 2YPLB 1PGRB 1ORSA 1U93B 4JCMA 3T0BA 1AGBB 4KKAC 5C0BE 1CF8L 3HMWL 1FE8H 5TPWL 1FZKA 1QBML 3NA4A 1OP5K 1WWCA 1KN4H 4TNVK 5F88B 5DD5H 1IL1A 1U91B 1WAAE 4YEEA 1C5DA 1FYHB 4LLVA 1XR9B 1A7NL 1BM3L 3GMMB 1UH3A 4ZAKB 3O9WA 5M95B 5JHDB 1MJ7H 4QRUB 1XGTA 4RWYH 4MWFA 2XQBH 4EN3A 4EOWL 3TBSA 2YD5A 1EGJH 4CDGC 4D0DB 1KLFA 3MXVH 3S37X 3QIWA 2PYFA 3HFMH 1U8PA 2CD0A 3IDGB 5DD1H 3CVIH 4RDQG 4I0CC 1IAOA 5GJTH 3GSOB 4LLQA 1Y0LA 4XBEH 4OKDA 1MHCB 4BSWA 3VWJD 4KK9D 2XN9A 4TSCL 1B9ZA 4ZFOL 4R4ND 1U8OA 4ZSOE 5DRWB 3LB6C 4OV5B 1ERNA 3O2DL 4OZ4B 3P2TA 4KRLB 1R0AL 4ONHA 5KSVA 1A1OB 1I8KB 5GGUB 1DE4B 1JGVH 5LGHH 1SY6A 5IGXL 4ODTH 5HPOA 5SWQB 3MRJB 4DFIA 2AEPL 2GYSA 1NUGA 1A6WH 3T0EA 4E0RA 1PYWA 3GMNA 3GBMH 4OSUL 4C4KT 3B9KB 5GGQL 4HKBB 3KYAA 5MENB 3ABZA 1S7WB 5C0IB 4OTXH 4XCFL 4JGUA 5ELIA 5I66A 4WI5A 2H8PB 3QJHB 2DYPD 3U6RB 4EBQL 3BPLB 3VW3H 2V17L 5HDQH 3NIFF 3MREB 2A83A 4K71B 3WFHA 4Z7QF 1HHKA 4WV1A 5ILTL 2KKQA 2Q7NA 4MA7L 1T2QH 2IF7A 3ISWA 4MNQE 4XXDB 2IQ9L 4MJIE 5H94A 1NBQA 2FNBA 1Q9KB 4J4PD 1A6UH 2OJEB 4OZGE 3RTQD 2FJFB 3T1FB 2ZPKL 4B50A 2RFXB 5BZDA 4I48B 1J8HE 4DTGH 4HC1L 1MI5D 1UWEH 1F45A 5D93B 4YBLC 2AK4E 1N3NA 3MYJB 3W9DB 1RU9L 4P46C 5I73B 3MXWL 3TA3C 2QHRH 2EE2A 2EXYC 3MA9H 3V0WH 5CEZD 3R1GL 2HN7B 1A22B 1X7QA 4YHNB 1IM3B 3VXSD 4Z77A 4YK4C 4RIRB 1JPGA 1FC2D 5A2IH 3MR9A 4JFDB 3WHE0 2VSCA 1BJ1J 4ALAH 2NY3D 2XICA 2A73A 1RIHL 3V5HB 1HHHA 1KXQE 3HZYB 4KI5D 4L29A 2HFEB 2NXZD 2AJSL 4WDIA 1AR1D 3FO2B 1YYLL 3BW9A 3E8UH 1IZKA 3AS0A 2HRPL 4OFKA 2LE9A 5DJAB 2VXUL 1INDL 4G6FB 5TF1H 3X14A 3DRQA 3NCFB 5EZIL 1CXIA 4JVWA 3REWA 3IJSB 1IJ9A 3B3IB 1MCCA 1F00I 3TBWB 1WQVT 1MI5A 3EYOA 4NJ9L 2ZUTA 1DQJB 1IQDB 4H0IA 3TCLB 5ERWB 1S7VB 2P24B 4X5XA 5CD3A 1BREA 4P2RE 2DM3A 1HI6A 5FYJH 2CKBH 2WUCH 3CSBA 2ARJA 1BF2A 2DB8A 1QSFE 2VDRH 4U6VL 2ZUUA 3ULVC 1UG9A 2DTML 1LE5A 3ARXA 4LASL 3VXUB 1EFQA 4H25B 4D8PA 1YMME 1FNSH 3QDMA 5D9SB 5CGMA 3FJTA 2X4RB 3ARGC 3WHE1 4JRXE 2HKFH 5C0JB 5EG6C 4JJHA 2BXZA 1S3KL 4KTDH 2X6MA 3BD4A 4KMLB 4W6XB 3D9AH 3GSNL 4F58L 5C6WH 1P9MC 1EVUA 3MRNB 4GXVL 5DWUH 5E4EC 3L3OA 4HJGB 1GJIA 1LK3L 4OCXH 1FDLL 1QNZL 1RZJL 1CBVH 4GBXD 5BV7H 3P4NA 3Q5YA 4XHJD 1RZ7H 5D2NC 1MAMH 1MREL 1UM5H 4UQ3B 1MQ8A 5F9AC 1GGBH 5FECB 2XKSA 3BQUB 1MHEB 1G7PA 4Z7UE 5LXGL 3FO0L 4DGIH 4PJIB 2I5YH 1DLHA 4XC1L 4OLVL 2ED7A 4Q6YA 1JZ4A 1KCUL 2XFXB 5JMOC 3TBYB 2ZOKA 1OL0A 2QBWA 1F8TH 4O2CA 3GRWA 4WY7H 4MXVE 3OJDA 4P2QD 3VGDA 1MHHB 1YEKL 4Z7WE 4YBQC 4L4VA 4LLMB 2I27N 5GZOD 4UT9H 4YWGL 3BPCB 2NZIA 1SJHB 4LKCA 1JYWA 1JMXA 3QUXD 3VFOA 3KLAA 4NYLB 4PRDA 5F9WB 4OAWB 1AJ7H 2GI7A 3O41A 2R1YB 5IJVB 3MC0A 2M1KA 3SGJA 4JRWA 1S7RA 4A2LA 3I50L 1YEEH 3PGDB 5JOEA 3T4AA 3HMWH 4Y8DC 1AGCA 5HVHC 1P7QB 5CLWA 3MJ7A 1EEZA 5DMIH 5K9JL 1A0QH 3AAZA 1UB5A 5D5ME 2ADIA 2RBLA 4DVRL 2P8PA 4HH9A 2R0LL 1AP2B 1W72B 1P69B 3TO2B 1IE5A 1P84K 4POUB 5CJQL 5DHVA 3N1MC 2CJUL 5GJSH 2E7MA 2B0SH 1KBGH 1NBVH 5I1GH 1I7TB 5JDSB 5E08L 4LCWB 1CU4L 3L7EA 4EOWH 3LEXA 2X4TB 2D9QB 4JZOA 4O5LH 2KZWA 2AABH 4P2QA 1ORSB 4KY1H 4PJGF 2JCCA 5CZVH 3A67L 1UQSA 3OF6A 4LHJB 1TCMA 5CKAA 5E95B 1MFEL 3H7BA 1CI5A 1S9XB 1HHIA 3RVXD 1UJTA 4LLVB 1JK8A 2EDBA 3C5ZD 4J3UA 3JV4A 1RUAH 3UJTH 3CLFH 4NC0B 1I9IL 5JXEA 2LVEA 5GS0D 4NN5C 2D31A 3TLRA 4Q58C 5GS2H 1NH6A 1UENA 5ICZA 4MYWB 3GI8H 1RFDL 1V3KA 3GUTB 5IB4A 4EN3B 1SJXA 1BF8A 2DM7A 3KJ6H 1F5WA 4XMLH 4U33A 2WSKA 3QFJE 5HDOA 3JV6B 3QIWB 3DYMA 4I77H 5B8CC 5KSBE 1U8PB 5D71L 4HF5H 4OZFA 5FO8A 1H3PL 3ARDD 4M1GL 5EORL 4OSUH 3O3EA 4F7CA 4MQTB 5HHME 4GMTH 1IAOB 2YD7A 1ZKAA 3OXRB 1HIML 3UTSA 1Y0LB 1U3HA 3W0WA 4K23L 2AJZB 4W4OA 4K07A 2XN9B 1K5NB 4O02L 4HKJB 1MCNA 2V17H 1F4YL 5FO9A 2PO6D 1U8OB 5DUBA 3VD9A 2E27L 3CVHH 4Q74A 3PXJA 5GGSA 1CTNA 3VRLE 3CFEB 5E2TH 4O4YL 4W6YB 4U3HA 4ONHB 3I02B 1KCKA 2BVTA 1KCVH 4HLZH 4Y4FD 3IXTA 2YD4A 3TT1L 1LMKA 5E2VH 1RZ8B 2VDLL 4E0RB 1PYWB 3FB6A 3GMNB 3MRKA 1PY4A 1IGFH 1S7UA 3QIBC 1RJZA 5I1HL 4NHUA 4JE4B 1FZOA 1OGAD 2X4PA 5GIRB 3V5KA 1PG7L 1X5KA 2CDFA 3HNVL 3BAEL 1BQHB 1I1YA 5CP7A 4NCC1 1MRDL 5F1NB 3QULB 2EIEA 2A83B 5D6CA 3WFHB 3S37L 4G6JL 4JM2F 5D1XB 5BXFA 5E56A 1F6AA 2PW1A 5DO2D 1R5VB 3AU1A 1U0QA 4LHUB 4Y5VC 3TJHC 4YHPB 1N6VA 3MA7A 3LD8B 1NAKL 3K80A 2XWTA 1KLGB 3HN3A 1RIHH 4GG6F 3P40A 5BZDB 1X44A 4KMTL 5TE6L 2B39A 3O4LE 2Z8SA 2FBJH 4RFNC 2NY0C 3LQZA 1YEGH 1N3NB 3BUYB 3QDGD 1PY9A 3JXAA 4JM4H 1INDH 4MD4A 2ICWJ 4B7IA 1HN1A 3KDMB 1DDHA 2D7QA 5EZIH 3UO1L 4WHDA 3FRPG 4YX2L 5FCUH 2JF1A 2P5WA 5DQ9A 1X7QB 1MH5B 1A47A 4NWTL 4KHTL 5IWLA 3FT4A 1MRCL 1OGAA 3MR9B 1KJMB 1PX3A 4OCYL 3UAJD 3MV7B 3LKNA 1NAMA 5L2JA 3O6FA 2A73B 5DFVD 1HHHB 4LNVA 1A1MA 1JV5B 2ZSVB 3S6CA 3VFPA 2A0LC 4WDIB 5JDJA 2R2BA 4WUKL 5ITFA 3BW9B 1U42A 1VA9A 4NM4L 5I30H 1NANH 4F2MA 3X14B 3DRQB 1D3CA 4Y2OA 3MLWL 3MRDA 3QT2A 4YEFA 4X6EB 1TFHA 4R90L 3IB4A 3QUZC 3REWB 1BBJB 1V3MA 1XIWC 2EZ0C 1KJ2A 2LAGB 4AENB 1MOEA 3EYOB 4HK0A 2XZZA 3T77A 3QDGA 1RIUL 3TO4D 3HE7C 2C7UA 5J6GA 3O2VH 3MLZH 3DXAD 5KS9B 4X99B 5FB8A 1ULVA 3BMVA 4KZDH 2PCPB 3OMZA 4ODVH 3PL6A 1RJLA 5EU6E 4CW1A 3BT2H 4FQQA 2CIIA 2DLTA 1LE5B 2HMID 5SWZB 4PJHE 3E2HC 1P2CA 2YS4A 5HI5C 5LBSH 4I4WB 3QDMB 4Y4HC 5JOPD 3VRJB 5GGVY 4G8EA 1NC4D 3UP1A 2VDNH 4U7SA 3NTCH 4KKLC 2PKDA 3U36B 4F80A 3DV4B 3E3QE 1M05A 2HLFC 5C9JB 2ZCKL 4UDTA 3MRLA 2YD1A 3HPJA 5IMMA 1ZVYA 2NY1D 5DMGC 4R97C 4L9LA 3DX8B 5BMFH 1CICD 5D8JL 4YHOH 5DS8A 3TO4A 5KJRL 3DXAA 3SQBA 3RY5A 2B8OT 2Z31D 3BH8A 1WC7A 2XG4A 4UV4L 5AYUH 1JMZA 1DLHB 2B4CH 3BGFC 4PYHA 3OAYK 4KKAD 2O5XH 1GGIH 2ZOKB 1MLCB 4O2CB 4ODHL 4P2OA 4YHKH 2W65A 2J8UE 1MWAA 4C55A 1H8OA 2Y06H 2OZ4A 4WEUD 2VLJD 1D7FA 1Z0MA 4FFVC 4X6FB 4L4VB 1XF5A 1ZK9A 2VUYA 1JRHL 4LKCB 5FKPB 5GRYA 4CL7A 4M7LH 3SE9H 4AT6B 5TFSL 1YY9C 4QYOA 4PJCE 1CU4H 2V5SA 3SKJH 3DYPA 3O41B 1BIHA 3S5LB 4TNWF 2HKHL 1HH9B 3IS0X 5IF0B 4X7FC 4NRXA 1TZGL 4ZUUA 1JZ7A 4Y19A 2HRLA 3T4AB 4D9QE 2MCPL 2BNQA 1AGCB 2FIKB 2NR6C 3MJ7B 4S1RH 1EVTC 3AAZB 1UB5B 4MNGB 1OWWA 3QJFA 2ADIB 1ZANL 5JW4Q 1WBXA 3U0TA 1QOKA 2QR0A 5IIEB 1OAUL 5DHVB 4N8CL 3HZVA 4KAQH 2WINA 4U7MA 5IFHH 2Z31A 2EDFA 4OGYH 4N8VA 2KUTA 5CJ5A 3RPIA 3L7EB 3BDBA 3LB6D 4M7ZB 1CFSA 5DJ0A 4JZOB 5E8PA 3ZYOA 4WTZA 3MCLH 1G9MH 3PIQA 3PJSA 4F9LA 4O51A 2MQCA 3LKRB 2JCCB 3RQ3A 2GCYA 5D71H 1RHHB 3VFUA 4TVPL 1UQSB 4WHTB 4YHZH 1ZEAL 3CLEH 4UI2A 2AV7A 3RX5A 3RL2A 1NGXA 3QCUH 4LCCC 4UOJA 5J11B 3H7BB 4DKEH 5HI4C 1BFOA 3TZVC 1JF5A 1JK8B 3D2UB 4OLUH 1HXMB 5DYOA 3JV4B 4ZXBC 1ZAGA 2D3VA 5JR1L 2E27H 2D31B 5GZNC 4Q2ZA 4ODSH 4YXHH 1J0YA 5ICZB 5F7EH 3IFLH 3HHRB 4JY4A 2BSSB 1UM6L 4JHAL 4OUOA 2ED9A 1F58L 1CXKA 4PGCA 1X4XA 2ILLA 5H37G 3N50A 1ZHNA 4BSVA 4Y5XA 4RAHA 3FOMB 4Z0BL 4S1QH 5D2LE 3BIKB 4Q9CA 1U8JA 4PJIF 5DUML 3AREC 1WTLA 3HRZA 3UTSB 2OSLA 4ZAKD 1U3HB 3W0WB 2XG5A 5AZEH 3QQ3A 1EERB 4GS7B 4P46D 3B43A 3VFWB 1FP5A 4Y1AD 3S35H 3TA3D 1MVFA 5DUBB 2F19H 4YDJA 3IDJA 3VXNA 5GGSB 1C12A 4CUCA 2PYEA 2AJXL 3RGVC 3RI5K 1OAQL 1TZIB 1EIBA 1TZHA 5L0QC 1N64L 1MIMH 4QHMA 4X83A 4I0PC 1BGXH 5F7WC 2B1HL 5CZKA 3GMRA 2NY2C 4X5WA 1QKZL 3BPOC 3RU8H 3FB6B 3VXRB 4OF7A 4KJYA 3IFNH 1S7UB 6FABH 5E8OA 4PUBL 4RMWA 4JRYA 1LDPH 3V5KB 3AS2A 1E4WL 4ZOBA 4PJAE 5EOQL 2H26B 2HJLA 3MJ9L 3D39D 4HGWA 3QB7C 4LPCA 5CBEA 5I1CH 2YN3A 4FABL 2PW1B 4OF8A 3AU1B 3QZWG 4G8FB 3EDJA 5E03A 1UCBH 3MA7B 4QRRA 2XWTB 5FEBA 5IEKA 4XCCL 5EPMA 2CDGB 3O0RL 2CRYA 5GGVL 4P46A 1EJ6A 1XT5A 2ZCHH 1LQSR 1BX2A 3TA3A 4N1CA 1J0HA 3MBXL 4HDIA 4X7TA 3VXPA 4L3EB 1VSCA 1HOCA 3LAFA 3H9ZA 3LQZB 5JTWA 5I71C 1IC5H 1D6EB 5CIPA 4MD4B 5IQ9A 3OPZL 3RX7A 4HHAA 1DDHB 2OTUB 1FZMB 1RUQH 5DA0B 4Q6IB 2P5WB 1AI1L 4NQDB 5I17B 1NGPH 2FX9L 3AB0C 2QLVB 2GJ6E 1UYWL 5MHSE 3QPXH 5IVZA 3IVKB 1IGTA 4LIQH 4NNYA 4U4BA 4MA3B 1NAMB 4QY8B 4N0FA 3K4DA 5GRVL 3O3BA 1Q38A 4Q9RL 2X9YA 3QWOB 3VFPB 2EICA 2R2BB 2XACC 4M62H 3K2UL 3C6LC 5HI3C 5E8NB 4LBEA 1IGYB 3B2VL 1UKSA 3IDIA 4GAFB 1AC6A 3VCLB 4XP6H 4U1JA 4Z0XA 5AEAA 4G7VL 3GMPB 3QUMH 4HBCH 4LCUA 2RGSA 1QTYT 4JFDD 2P5ED 2FHCA 1BP3B 4G80A 2F53B 3PP4H 2ZUQC 4I9WD 3T77B 3I85A 1E28B 2BCKA 3Q1SH 1EEQA 3MRCA 4GAJL 5J6GB 4C83B 1C7TA 1TJGL 4PLNC 4PRBB 4PRIA 2ZG3A 3WXVH 4H0HB 3ME0A 4BQ8A 3KYMB 2ZCKH 5F6IC 4PJ8A 3ZHLA 2CMRH 1J8KA 2BHUA 3HG1A 5FKAB 4CW1B 3CFBA 4FQQB 2CIIB 3HE6B 1UZ8A 3JWOH 4IHOB 4WO4C 1JNLL 2Y25A 3U79A 3GB7B 5L6YL 3ARGA 3NZ8A 2VIRB 4G42B 1P2CB 3MLVH 1OP3H 4FXKA 4UINH 5MEPA 2Y7QA 1SHMA 1VPOH 5E70A 1A6TA 1M7XA 3I2CH 3DURA 3BD5A 3ZKXC 4PREB 1PD6A 5C0FB 3CCHA 1EMTL 5GGRB 1ZLSH 1JGLL 2LFGA 5K9KB 4MQ7B 3MRLB 1UWXK 3D0LA 5HGHB 2P5EA 2O5YL 1S7XB 4L9LB 5I76A 2DQEL 1F2XK 1ED3A 1RJCA 5DS8B 1HKLL 3VJ6A 4QTIL 4JFFE 4NNXA 3N85H 4PJBA 2Y07L 1S78C 1ZHKA 4HJ0C 3BP6A 5CHNA 4FFZH 1BVLA 3WJLC 1UH4A 3TFKC 1GZQA 3ARBA 5IOPB 5JLZA 3FB7A 4WW2C 3TH2T 1MWAB 3DYOA 3UPCA 1N0XH 5C0CE 4Z7VE 1OT1A 3LQAH 1QBLH 2UWEE 1XF5B 2R39A 2Z91A 5EZOL 4HWZA 3M1BA 4R4BA 3HS0A 1AGEA 2ICEA 4K9EH 4QYOB 4H88H 2C1PA 4LEOA 4XCNA 1WEJL 1N5YL 2J4WH 3E3QC 3Q6GH 2X4UA 4NRXB 4ZUUB 1A02N 1JGEB 5EUOA 1GGYA 4WWKC 4GOSA 1CQKA 3QUKA 2IBZX 3N1FC 1CCZA 3KNBA 4YDLC 5FYLD 2AXGA 3D3VD 4YE4H 3EYSH 3LEYL 3TJEL 2B1AL 2GTWA 4U1GC 1MCHA 3UJJL 3QJFB 4XWGH 1QP1A 3U0TB 1FC1A 3HC4H 3QO1B 4HWUA 4POZC 3VXTA 4D94A 4DVBA 3BDYL 4Y5YA 1CGWA 4U1HA 3VFNA 1MY7A 1MLBA 3HZVB 4ZD3L 3BIAX 2WINB 1O7SA 1FFOB 4Z6AT 5KS9F 4F15B 2YPKB 4X6DE 2DQUH 2FD6H 2LU3A 1MF2L 4JFOB 4XP1L 4JO2H 3AVEA 3HR5B 1PZ5A 4PRHB 4XB8A 3RPIB 4U49A 1XZ0A 3DIFA 4HS8L 2A1WH 5FCSH 2H1PH 1QQDA 2XA8L 3PIQB 4O51B 3RHWK 1D5BB 3K8KA 3VFUB 1E6JH 3NPZB 1EBPA 2AV7B 5D1QB 2H6PA 4V1DA 4OD3H 3RL2B 1NGXB 1HSBB 4JPKL 2X4OA 2C1OB 2L7UA 2BNRD 1BFOB 3QIBD 5DYOB 4OLZH 3U1SH 3UZEA 4NKOB 3WS3A 3NIGE 4MJ2A 1MCWM 4Y8AA 4A6YH 3QUYA 2JJUA 2GKIA 4Q2ZB 4AIZA 1FIGH 3D3VA 1QRNB 4HWBA 2VLKA 1CS6A 2APBA 4L5FH 3WJJC 3L6FA 5BQ7A 1N64H 4JY4B 3QIUA 2JB6A 3F7VA 4PGCB 3W39A 1FZJA 4JFYA 4BQBA 5FYKE 1ZHNB 4Y5XB 5EUKB 3TJHD 4JDZB 1I3GL 1U8JB 1EHLL 5C0BA 4PBWD 3HRZB 3I6LE 2IPUG 5F7LB 3RWGA 3MLXL 2RR3A 4ENEC 1CR9L 4CVUA 2H32H 1RZKC 5D7SL 5EB9A 3QQ3B 3MROA 3P9MB 2YUWA 2FJGB 2QKIA 4YDJB 3IDJB 5I75B 1YEHH 1C12B 5DA4A 3IDNA 1MHPH 2A77L 4DN3H 1XGUA 3LMJH 2VE6B 4QHMB 1HCFX 3V2AR 5EOCJ 4J1UB 1KIQA 3QIBA 4BZ1L 5CMAB 3IJHB 3LEVH 1DVFC 1PKQA 4KJYB 3VU2A 1NJ9B 5JHLL 2J5LC 1PQZA 3HAEG 5E8OB 3F58L 4Y0GA 3RKDC 5IVNA 3OPZH 2A0LD 1LEKA 2QTEA 1SVCP 4M3JA 1SM3H 2YEZA 5HHNA 1N7MH 2FX9H 1BBDH 1NGQL 4PGZA 2QQNH 3QUZD 4LSPL 4ZSOA 1VFMA 4ONGL 1XIWD 2EZ0D 4EUPG 2AK4D 5JXAL 4QRRB 4XVUC 5IEKB 5EPMB 2IMMA 3HE7D 3CFDA 3S35X 4P5MA 3N1PC 4Y16A 1TITA 2JCCF 1BX2B 5HXMA 3UPRA 3VXPB 3DVNA 1HOCB 4XMPL 1LHZA 2AK1H 1I8LC 4P9HL 2R23B 4JFHE 1TETH 1DBMH 1NCBH 5CIPB 5IQ9B 1B2WL 2YSSA 2Q6WA 4I1NB 5D1XD 1FHGA 4ISVB 4LHUD 5B38A 2A9NH 4YGVA 3TN0A 3WD5L 1CFQA 1O7VA 3OAUL 3BRDA 4Y4HD 3QDJE 1S7QA 1DQML 5GISL 4GAJH 4PGDA 5L2KA 1G9NC 5E1HB 3NACH 5TDNA 3THMH 4G43B 3UTPD 4MNQA 4CMHB 5ANME 4MJIA 4KKLD 4QLRA 2DBLL 3C09C 1NQBA 4OZGA 2OCFD 4HIIA 2HLFD 1JNLH 2FATL 4ZPTA 5E8DH 3ROOA 3IDYB 5EO1A 1J8HA 3OGCB 3ULUL 5DMGD 4LBEB 4KC3B 2AK4A 4U1JB 5IR1A 1P5VA 2FL5A 4Z0XB 3CDYA 4PY7A 5JQ6H 5ETUA 5T1KA 5D70L 3WFZA 3HE7A 1WISA 1UADC 3QEQB 4G80B 5A1AA 3MV7D 3OKNB 4E42A 4RMSA 3HC0A 1KPVB 1EMTH 1ZHLA 3CH1B 2BCKB 4PB0H 3CAFA 1QACA 3QXUA 4XVJH 4PRIB 4OI9A 2BRQA 1G6RL 1FFPA 1FYTE 4PJ8B 1FBIL 3SOBH 3HG1B 2D0GA 2O5YH 4JRXD 3WUWB 4UT7H 1T1WA 3ARGB 4Y4HA 3NZ8B 3ZE0F 1T2XA 3Q2CA 1YY9D 4J6RH 2HJFB 2ZG2A 2MQ0A 4DZBA 3Q5TA 5MEPB 2Y7QB 3HLAB 3BP5A 1G7IA 2PF6A 1CGSH 1ZT1A 3T3MF 3SDCC 3KPRE 1A6TB 1T7YA 4N5EC 2VXVH 1NKRA 5T1LA 1IZJA 5D7LE 2AXJA 3VDAA 4K3JL 1V5JA 5BOPA 2HG5A 2NR6D 4P23A 4LARH 3CCHB 2AQ3A 3EO9L 3HMXL 4QRQB 4D9RE 4HAFA 1XGYH 3O4OC 1BFVL 5KSAA 4YZFE 3S3JA 1KN2H 1IM9D 3O8XC 5EZOH 1KYOK 4NQCB 3VI3F 4FP8H 3D0LB 2A9ML 4P2RA 3IRPX 4KJPC 4UB0L 4F9PA 1KELL 2YK1H 4N68A 3OKOA 1WEJH 5EU3A 3VWKC 1MFCH 5I76B 2Y36L 4JREB 3EBAA 3TWCL 1F3JA 1QSFA 1Z3GH 2XXCB 4NM8L 1ED3B 2E8ZA 1AFVL 3VJ6B 3CK0L 2UUDK 4PJBB 4R26H 1P6AB 1ZHKB 4FTVD 3TT3L 1YMMA 1BVLB 3LEYH 4L1DA 3UJJH 1D5ZA 3ARBB 4XMKH 4QHKI 5JLZB 3FB7B 2C5DC 1M71A 4JRXA 2DQHL 5ESVB 1B90A 1W8NA 2X1PA 3V6BR 5ISZD 2MPAH 5T33H 4YNYA 1IC7H 4WFEE 4ZD3H 2BVYA 4OCSL 2AV1A 4E5XB 5HI4D 3TZVD 3M1BB 4R4BB 3EO0B 3HS0B 4KRPB 5ICXB 1AGEB 4ZXBD 1IQWL 4LPYA 1AY1L 2C1PB 2ZOLA 1D9KA 4LEOB 4R96B 5HVHB 5GZND 2G2RA 2WBKA 2XA8H 2X4UB 4RBPH 4RGMC 2K7QA 1IKFH 3QUKB 2AXGB 5J12C 4Z7UA 4AG4L 2O61A 1UJ3C 4GFTB 4JPKH 3FB5A 2HVJA 3G5YA 1FO0A 3H0TA 5CEXA 3V4UH 4R4FL 4XXCC 3BSZL 3KYOA 4Y5YB 1HNGA 1UEYA 2JTDA 3ARED 4U1HB 5A3IC 1AGFB 4MZ2A 1X3DA 1CD8A 1AHWB 4U1LB 5MEOA 3ZKSD 3MGTB 5FUOH 5I1JL 3GO1H 4Z7WA 4KPHH 1PZ5B 4OD2A 1U3ZA 3KXFE 2NXYC 3DUUA 1F11B 1B6UA 4HIEA 4ZDHA 4FOMA 1QQDB 1LILA 2R0KH 4S1SH 3BKCH 3PWPE 3RGVD 1XGPA 4LCCA 4I0PD 3LPFA 2KZ1B 1RMFL 3QCTL 2H6PB 4V1DB 2GY7B 2NY2D 4JPWL 4X6BA 5CBAA 5CEZL 2PN5A 1OWRM 1FAIL 1K8DB 1OD7A 1SYSA 3K81A 4HEME 4OD1H 1GGTA 3MLXH 4M48H 5D5MA 1CE1L 1XCQB 2Y6SC 3GGWA 5F7MC 5ESAB 2K1MA 3E6HB 1CLYL 4HQQL 3QFJD 2F54E 1T66C 2WUBH 3QUYB 4LP5A 5E2UL 4LSQH 3Q3GA 4NO5A 1PJ9A 2VLKB 2GFBB 4JFEE 3GM8A 2DM2A 3EFFB 3QIUB 4I3SH 2R0WH 1ZWIA 4QHLA 4LSUL 4EEEA 1QSZA 2WWMD 2JB6B 3F7VB 1H3VA 1QRKA 2C3WA 3AREA 2APFA 3OJMB 4P5TC 3W39B 4BZ1H 4MA8H 4C59B 5JW4M 4MDIA 3D2UD 4JZJC 4HFWA 4LLWA 4YHLH 1J86A 1MJUH 2GY5A 1ONQB 2VXTL 3A6CH 4QHUB 4G9DA 4ZFGH 4C56D 3WFDH 4M7KL 5EIVA 1X5IA 2Q87A 4IJ3B 2J8OA 4LSTL 4CMMA 1OCWL 1QLFB 1FVCA 5CJBA 3MJ8A 4RFEA 4FQJH 4I0PA 2JJSC 4F7PB 3IDNB 4RMRA 3D1MC 1FFRA 4JN1H 3KJ4C 3QRFM 1T7ZA 1CT8B 1W72H 1FVEB 3ROLA 3RKPA 4G7YL 1KIQB 3UBXI 1HINL 3QA3A 2ZSWA 1KTLA 3JWDL 1I1RA 3WFEH 1PKQB 4XPAL 5IQ7L 3RIAF 1N4XH 1YEJH 4TRPL 3FQNA 5KSBA 3CD4A 1PQZB 2X2YA 3SGDI 5I1IL 2GSGA 1DP0A 1T04A 1I75A 4LNRB 3JSSA 2F5BL 3IKCA 4IRZL 2WBJA 3LHPL 1DBKL 3QXAA 3C6LD 1KIPA 2VZOA 3TVMC 4JKPH 4HUWB 5IHLB 3WD5H 4GMSL 3U7YH 5ITBL 1JHKH 3S8WA 1OT2A 3O4LD 2I60H 3WLBA 1UH2A 4HWEL 1NL0H 3FT2A 1LP9B 2VABA 2ZCLH 3CFDB 4Y16B 4WGVB 1KTKE 5KSUA 3Q5OA 4CNIB 3FFCE 4HX1A 2X4NB 3IDXL 1BQUA 4WI4A 4PGBA 3C5SA 4L4TE 2OK0H 2DQJL 1U2HA 3GJFK 4GKSA 3BP7A 4WO4D 1B0WA 2YSSB 1WZMA 2Q8BH 5CSGA 3ARFA 5KANG 2OLDA 2E6PA 5ACZA 4Z76B 1SJEB 4R6UA 5DHXB 3DETC 3G08A 5B38B 4NQSA 4YGVB 4YIQB 3TN0B 1K4DA 1CFQB 3SDAC 2FZ3A 1JRHI 5HGBA 3NIDE 3FN0L 4JO3L 2YA2A 4FG6C 4PGDB 1Q0XH 5L2KB 1XF1A 2UZIL 1JWMA 3HUJE 4MNQB 4MJIB 1OSPH 4NZTH 5C0AE 4OZGB 3FRUA 1MJ8L 3AS3A 1JVKA 4R2GC 4IOSD 1JI2A 4ZPTB 2WANA 3ROOB 3L5XL 1I1FA 1J8HB 3GMOA 1CE6A 3VFTB 2Y5TB 4H26A 3O4LA 4PS4H 1HSAA 4IRJB 3WLWD 2N1KA 4NQEB 2OMNA 4XP9H 1SY6H 1BJ1H 1DQLL 2VLLB 5T1KB 1FIEA 3MV9D 3U4EB 4L8CA 3X12A 1S78D 3OX8B 4HJ0D 2IPTH 5DD6A 4GAGL 1UB6A 2QADC 3HZMA 1BFVH 2BVEA 4QRPE 3ZSTA 3VG0H 1BZQK 1JFQL 1RURL 3W2DH 1FFPB 2NY5C 2YD3A 3DMMC 1FFQA 2A9MH 1EAPB 3MLYH 3LZFH 1UCTA 2DF3A 4CU8A 3JWNC 3CFJA 3WHXB 5ESQB 1WBYA 2OI9B 1T1WB 5DRNB 4FN0A 1DLFL 3GKWL 5FGSA 5AWNH 2V7HA 5DFWH 4MJ4A 5C08E 1G7LA 3SHSA 1YNKH 1NMBH 2EYTA 3TT3H 5L9DH 1QFUL 5T1LB 3FQRA 1VFBB 3VFVB 4FA8A 4J12A 1NUDA 2VLRE 2JJTC 3W9EA 1R3HA 3OB0H 4WWKD 4OQTL 2HG5B 3PHQA 5C0NC 1X5YA 4P23B 5GS0L 1C08B 2Z93A 1ND0A 4MA1C 3HE6D 5KSAB 4Q9QL 1CVRA 3NFNB 4POZD 5FYJE 4EVNB 2VDPH 2NX5D 5J57B 2LABA 4NFBA 3RI5F 4P2RB 3H3PL 1AY1H 5LCVL 4TYUA 3OKOB 4HUXB 1YMHA 5E99L 5EU3B 1WFUA 3RAJH 5EU6A 1F3JB 1QSFB 4XAWL 3WJLA 4DAGL 1CZ8L 3OZ9L 5FHAL 4PJHA 3LSOB 3K8MA 1YN7B 5I8EA 2YUVA 4X98A 1YMMB 4Z8FL 3WMSA 3NCBB 1D5ZB 3WL9A 4NN7C 3VXQA 1M71B 2D9CA 4U6TA 2QJDA 1F13A 1S9VA 4XPBL 1R5WA 2EYRB 2XY1A 1T1ZB 4YNYB 3U30B 2D7TH 4BA8A 2AV1B 1NCNA 3KPMB 4YC2B 2B20A 2Z4QA 1DBBH 3QRGL 3OR7A 3CUPA 2ZOLB 1D9KB 1Q9OA 4H5SA 5F89A 2KDGA 4N8PA 4YFDB 4JR9L 4NO0B 4X4ZA 2FWOB 1NLDH 3MV8E 4X4YA 1YN6B 4PRNA 4MD5A 4R8WL 4BKLB 3NVQA 5DK3A 3P11L 1NBYB 2WNGA 3QCTH 4JY5L 5FM5M 1HQ4B 4WVRA 3BN9C 2Y5EA 3FB5B 2HVJB 2VITB 3G5YB 2CRIA 3G5ZA 4K8RC 1YECL 1MFNA 1BLNA 4HQQH 5F1IA 4YQXL 2J8UA 4ENED 5MEOB 1KT2B 4JB9L 4CU6A 5JW3L 3ULVF 3GI9L 3ORJA 4NWUL 4Z7WB 4X80H 5GGTL 4YAQA 4YO0A 4HIEB 2BHYA 3STLA 4PJCA 1SBSH 2NNAB 3I3DA 3VFMA 1RZIB 3SE4C 1NBZA 1RIVH 4HH8A 2DS4A 3WEXA 2E7HA 1T21B 1SYSB 3GHBL 3PE9A 1DVFD 4KZEL 4PRHD 4ZFOA 5E8EA 3RKDD 3WJJA 4GRMA 3O2DA 4AM0A 4YFLI 4H20L 4NO5B 3BGAA 1VHPA 5DJ6A 5LQBH 4QHLB 1ZWIB 3GRWH 2ATPA 2AI0L 4R9HA 1RK1A 1GHFH 1UT9A 4LRNH 4UBDC 3ESUF 4MDIB 1LNUA 3PGFL 4P99A 4PJBF 4XVUD 5L7XH 2H2SD 4HFWB 5GRUL 5C2BL 1NUNB 4WJ5A 3WS6C 3FRPA 4PJEE 4G9DB 43C9B 5C86A 5EU7E 1P6FA 4WFFD 1QRND 2ZNXA 1LK2B 4J7RA 2XRAL 2Z35A 3BISA 4XP4H 3TPKA 1FVCB 3SDYL 3MJ8B 3LKOA 3RZCC 3FTGA 3QDHA 4NT6A 4FNLL 5ICYA 1MY5A 5C07D 4PJFE 4X8JB 1EO8L 1PKOA 5JOFA 1Q72L 2GJZB 3ROLB 4HWEH 2VZ1A 3SE8L 3RL1B 1L7IH 5DHVH 3KPPA 2ZSWB 4JEGB 4HC1A 3OQ3B 3GSVA 3WFBH 1YPZB 3IDXH 4D0CA 4G6ML 5C2UB 3FQNB 1MFAH 3ZE1E 3BWUC 2PXYC 1C1EH 5D2LA 1P1ZA 1KULA 3PWVA 5DQDH 3KPNB 5HHMB 1IGJB 4ZTPH 5J0BA 4ZMAT 4PD4J 2WBJB 3DX6A 3T2QA 1KIPB 5IROC 1R3LA 4K3DH 2EEAA 3VD4A 5DVKA 4ZS7H 3BN3B 5CEYB 1ZVHA 2VDOL 3KPTA 2FGWH 1NMCB 3S3SA 3WLBB 1I7UB 4G6KL 1EAJA 3V5DB 1IAMA 3FT2B 3BVNA 4TQEL 1NFIB 4U1NA 4CDHA 2DQCH 5HGDA 3E6FA 1QLRA 2J6EL 2W9DH 5KSUB 1CXEA 4HX1B 4OF6A 1XGRB 3B9DA 4OQ1A 1P53A 3C5SB 1OTTC 5BRZD 1V7ML 5KVDL 2BVPA 1B0RA 2GJ6D 5CCKL 3BP7B 3BYTA 4IEFB 3ARFB 2YZ8A 4GW1A 2XT1B 1KG0A 3EZ8A 2YXFA 2EH7H 2GHWB 5ACZB 4XVSH 1B88A 1XH3B 5K93A 4PJAA 4OZFH 4DUVA 1K4DB 4L3AA 2FZ3B 5IG7A 4N5ED 1FSKC 3LY6A 3DO7A 4N0YH 4M6OL 5FV2A 3ZDZF 3ILQC 1JWMB 3OR6A 2XKNA 3FRUB 4R7NA 1XCTA 3O8XD 3O6KH 1N6QH 4RISL 5C0GB 3RHWF 1I1FB 3GMOB 4K94H 4KJPD 4FXLA 3PHOB 4KDWA 3V8OA 4JVUA 4Y4KC 5I16A 1HSAB 3DGGA 3VWKD 2DDQH 3QH3A 4AZ8A 4M7JL 4HUVA 3BPNB 4MCZA 5DUPL 3D6GA 4XNYH 3GJFB 3F7RA 4U31A 3ALXA 1IFHL 3C5JA 4QRSA 4L8CB 3X12B 3GSNA 5HHPB 5BVPH 3JV0A 1TLKA 2V5YA 4K55A 3SCMC 3TH3T 3HZMB 4R0LC 4WI8A 2GJ6A 2D2OA 2CKBB 2J12B 4TULH 1F90L 1I1CA 4CKVX 2XTJC 2DJSA 1X4YA 3U48A 2BOBA 3H3PH 2P49B 1NSNL 3CFJB 1WBYB 4NKMA 4NZUH 3SDCA 1A21A 2QV2A 4XTRC 2V7HB 4XPGL 1G7LB 3CFCL 3S34H 2QQKL 4H0GA 4Z8FH 5J1SC 1R3HB 4I3GA 1T1XA 5DF0A 1CFBA 3PHQB 3CSPA 3RVTC 2Z93B 4IDJH 4NQVB 1L0QA 1OARL 1QYGH 5IBUG 1T6WA 5HVGB 1CG9A 3GJEA 2AQ1A 3BZFB 2WM0A 2IAMC 4M5ZH 4JFFD 3WO4B 4E9LA 1MCFA 1LP9F 5A3ID 3F5WB 4MS8C 3BEVA 4RMVA 1YC7A 1YMHB 4YGAB 3CDGB 5HDBE 3OTTA 2MCG1 4RMQA 1B4JL 2CKNA 1YYMH 2V2TA 5HHVH 5CEZE 3T1WA 2NXYD 1NMAL 1U8HB 4L8SC 4PJHB 1QVOA 4H8WC 4R8WH 4C4KO 4QRTA 5DSCA 1NAMH 3VE0A 3VXSE 3C08H 3WL9B 4DW2H 3VXQB 4ODUB 1NGZB 3RJQB 4NQCD 4EI6A 1CIDA 5ACLA 4WTXA 4G9FB 5CAYB 5GXBB 3OHXB 3A0OA 2Y6SD 4KI5E 1FQ9C 2J3SA 3GI9H 35C8L 2ADGB 3MRIA 3LN4A 4GAYB 2Y23A 5F89B 1Q9OB 4OZGF 1K9TA 2W92A 1KJ2H 4OCWL 1T66D 1OB1A 4P4KC 3V7AG 4YDLB 5KANI 3SDXE 5DJYA 3NH7L 1UJ3A 3TV3L 1QFWH 3WXWH 3UYRH 4PRNB 4MD5B 4PJ7E 2B7DT 4XXCA 4JFFA 4P5TD 1UVQB 2DAVA 2J88L 2HLAB 2XZQL 3T04D 2V9RA 4QEGA 2UYLA 1FN4A 5I74B 3V4PH 3F6IA 1Q94B 3EOYG 1NFDE 1BLNB 5T1DH 5F1IB 2I9TA 2W0KA 2J8UB 1UA6L 2CUIA 3L3HB 4JY6B 5C0CA 1L6ZA 4Z7VA 4JQXC 4WEBL 2UWEA 4HS3A 4FFYH 1A3LL 1AO7B 4J3WA 4YAQB 4YO0B 3ETBF 2AJVL 4XNQA 5J13B 3STLB 4M3KB 4PJCB 4XI5C 3OKLA 4OLYH 4OLEA 2M2DA 5BV7C 1SEQL 3PGFH 2NW2B 5C0RH 2HTLC 1NBZB 2LU4A 5DVLA 4CBPA 1E0OB 2BFVL 1RV6X 3V9FA 4ELMB 2EDYA 2W60A 5C09D 5D6DC 3PV7A 5F9OH 2JB5H 4U1SA 4ZFOB 1X9QA 1ES0B 5E8EB 2C3VB 2YPVL 1K6QH 1NDMA 4TOYL 4IOIA 3RA7H 2O5ZL 4PGEA 3QZWA 4GRMB 1CGUA 4JFPB 4AM0B 5FYKD 3S97C 4KUZH 1FVDA 4HJJH 4P5TA 3NCJH 3MBEA 2DTSA 3TVMD 4JO4H 4X7SL 4NHCL 4X6DA 1Q72H 1U58A 5CJOL 1QG3A 5DJ6B 2BVOB 5E9DD 2ATPB 1A6VL 1MWAH 1RK1B 2BP3A 3ZO0A 4C58B 2WWKT 2YD8A 2A74B 2OZ4H 1H3GA 1TNMA 1KJ3H 1LNUB 4KXZH 1PDKA 1B6DA 2C4FU 1YEIL 1F4WH 1BAFH 1KXVC 2I24N 2V2WA 4IRSC 4WJ5B 5HPMA 3QXVA 3QPQC 2FO1A 4JDVA 4PP2A 2CLVA 2FO4A 2IH1B 2QL1A 2MNUA 2R69L 1C8PA 2Q8AH 1Z9LA 2EDOA 3PQYE 1A6PA 1VACA 2JJSA 1JWUA 2BVUA 5IW1B 4UILL 1JF1B 3SJVD 2Z35B 3QWQB 1JPST 1HKFA 1EFXD 3LKOB 3DNKA 1RJYB 3LPWA 2Q86A 4NT6B 5ICYB 2IANE 4YXKH 1TVHA 2VDOH 4OGAC 1R3IH 4UQ2A 4AEIL 5E6IA 3DETD 4AYFA 1ZE3C 2ITDB 1FH5L 3SDAD 3BEWA 3MRRB 2PETA 4FG6D 2VDML 1U8KA 3GSVB 1K8IA 1KCSL 4AEEA 2JELL 4D0CB 4Z7UF 1VFUA 2GQHA 3H2WA 3OKDA 3QAZC 4R2GD 4XNZC 5D2LB 3DBXA 3PWVB 1GAFL 1JBJA 3V8CA 3DX6B 3VFSB 2KPNA 3M07A 4QHKJ 1LO5B 4F3FB 1R3LB 1XGQA 2SEBA 2AS5M 3L7FA 4X9FA 3RWFB 2UY6A 4Z7WF 5IVXE 5EU7C 1C5CL 3MOAL 4M6OH 1P4IL 1T3FA 5E0QA 1CWVA 3BVNB 1FNFA 1M7IB 4U1NB 5HGDB 2QADD 5ADOH 3NIFE 5ALBH 2X7LA 3LKSB 1QLRB 2CGRH 2BX5A 4X0KA 3DMMD 3P73A 4H1LG 2LAAA 3HI5H 1LO4L 3S96A 5DRZB 1GH7A 2BVPB 1B0RB 4PJ9C 3LIZH 3QDJD 4LVHC 4GW1B 1H0DB 2VKWA 1KG0B 4FQLL 1TJIL 5I0DA 5EOCL 4FQXC 1N5AB 5I1AB 5JIIA 4KVNL 4ZUTB 4PJAB 1VFAA 3B6SA 3TIDA 5M94B 1OW0C 5GS1C 1I9RL 1ACYL 2DLFL 5SX4H 3WIHH 4QWWC 4PJXB 2N4IA 4CN1A 5C0ND 5CZXD 4ZOCA 2DKUA 1T7VA 3ZDXF 3OR6B 2XKNB 4OI7A 2APXA 1UWGH 5KVFH 4R7NB 1OP3K 4P59L 2VR5A 2P4AB 4TUKL 1RUPH 5FYLL 1LO3L 1YEFH 3AY4C 4HXBL 5A16B 4BFBD 4JO1L 3DGGB 3CFCH 4M1DL 4HUVB 5K9QG 4OIBA 4LAQH 2DWEA 4LQFH 2RHEA 2AJUH 4XVTH 1FYTD 3C5JB 4QRSB 1B0GA 2KH2B 3GSNB 3UTTD 5A43C 4WTZG 4NUJB 5E7BA 4PJ5D 3DMMA 1F3RB 1FNLA 5HYQB 4UMGA 4I18C 1XF3A 1VGKA 1JYNA 4GXUM 3B5HA 3RWDA 3MODL 2XQYG 4HPYL 3VG9B 3NAAH 3LRGA 1GOFA 4RX4A 2BOBB 1KACB 3KPRD 1CDHA 1EHXA 4IRJD 5GHWL 4NQED 3SBWC 4NKMB 4XB7A 2CPCA 1ZXQA 1YPZF 1KB5L 5F1SA 3FO9B 2NY7L 1QSVA 4MAYC 2XY2A 2P43B 4AEFA 4NP4L 1LO0H 4U6XA 2BXYA 2XIDA 4LSVH 3Q6FA 2NW3A 4G8IA 1Y18A 5I1KH 4ODWA 4OLXL 5D1ZC 2XZCL 3UMTA 5BJTA 2V6HA 3MV11 1E6OH 12E8L 3FO1A 1VFOA 4D9LL 5TQ2L 4IS6B 3VWJC 4HIJA 5EWIL 5H8DA 3BN9D 4R4NC 2HVKB 2XPGB 5EBLA 5CIPH 1CG9B 5CP3A 2W0PA 3VRLF 4K8RD 2MMXA 3O2WH 5FGBC 3F65A 5TE7H 4KDVA 2VL5A 1FYTA 3G6JA 4FZEL 2YMXH 5F8RC 2IPUK 3KS0J 1T89C 4PV8A 1D5XB 2V2TB 4Z18A 5IJKA 3L3KA 3U0WL 1V7NL 1CD1B 2HAZA 4U1MA 3WKMH 4QHNA 5IFAL 4QRTB 5J8OA 1G7MB 5DSCB 1EXUA 2GJJA 2BOCA 1TQBC 4P4RB 1NGWA 2XZAH 3KPRA 1T03L 1BQLL 5EZLA 5I1EL 1ETZA 2XZQH 4EI6B 4XPHH 5D7LA 3UDWA 3RX8A 4PTTB 1IAIM 2GAZA 5T5FL 5E94B 4EI5C 5DLML 5D7JC 3INUL 4F33A 3S4SA 1EUTA 3MRIB 3FKUS 2NY4C 3LN4B 4J4PC 3VGGA 3DUHA 1EO7A 5C0DB 1YEDB 5EO9B 4BH7B 1KPRB 2G5RA 4U6YA 5IKCA 2K7PA 5CS7A 2DMBA 1WLHA 3ULVH 2VDQH 3AM8A 2BRRL 5DURB 3MGOA 4UBDD 3RWHB 2EIZA 4UOW0 3MACH 3MRFB 3FT3A 5F70A 3H9SE 2V5RA 1FL5A 2GTZB 2UYLB 3KXFD 2Z8RA 1FN4B 3FONA 1GRWA 3C6SA 3EYUL 4KKBC 2I9TB 3EFDL 4LSDA 4NN6B 1U6AH 5C0CB 5AG8A 3PWNA 4WHCA 1A7BA 1H5BC 3T2NL 3QHZL 2YBRA 4JQVC 4NHCH 4XNQB 3RZCD 4QXUH 5LGJB 4L3CB 1N59B 3OKLB 1FGVH 1OAXH 1A6VH 3HAEA 5JOPE 1KFAL 5KBNC 5CLTA 1RUKL 1TPXC 4KI5C 2XWBB 1XF4A 4M1CC 5TGBA 5KVMC 2VDKL 1J87A 1MJJA 5IB3A 1ZTXH 4HMDA 2NY6C 3T4YB 5F8QC 1BEYH 1KEMH 2ESVD 4HZAA 3L3JA 3BXNA 2W60B 4HKZA 4R3SA 3VH8G 4JFED 1SVZA 4KHXL 4U1SB 1OM3H 2VWEE 3IFOB 4PJGE 4U3XA 1NDMB 2PXYD 1A9BA 4IOIB 4DKAA 4PGEB 3I6KA 3X3FL 2CIKB 3FQXA 2A6DA 4ESKA 3H42L 1C5BH 3MBEB 1INQA 5D72H 3SE3A 4UOW1 4ZTOL 2DIAA 1EZVX 3I9GL 3WS6A 5IMOA 3IAPA 1IARB 1S9WA 1IEAA 5DMJB 3U9PL 1N6UA 4PJHF 1BD2B 3PWPA 4X9BA 2V2WB 1JHTA 4JDVB 1F4XH 2CLVB 2FO4B 4GLRI 5KW9H 3D18B 5DEFA 2HT3C 1KCRL 1DR9A 2VLJE 3RZCA 1VACB 3JTTA 4JHZA 3MJ9A 3DX7A 4TSBL 2DMKA 1OTTD 1W0VA 1QBBA 3PWLA 2ICWI 1L7TH 5ECJE 2Q86B 5A2FA 3FQWB 2EO9A 4UQ2B 2VZUA 5E6IB 1D5IL 2JIXD 2F54A 4QNPF 4AIXA 4WEMB 4QTHA 1VEMA 3BEWB 4RFOL 4UIMB 1U95A 3MLSL 4XHJC 3ES6A 3C8HA 4JFEA 1HH6B 1HZHH 4JPIA 2PXYA 5B21A 2OP4H 5TE4L 4IMLB 3JUZA 2ZJSH 3ILQD 4NUGH 5BW7C 1FLTX 1U92B 3OKDB 3GHEL 5IROA 1H3UA 4LU5H 1PX4A 5IHUL 3DRTA 1G9MC 3O45B 2G9HA 3EYVA 1MIEH 5FA3A 5C7XL 1WCQA 1RVFL 3MNVA 1Q1JL 3GIVA 5EU4A 1A7PH 2PNDA 4Y4KD 3QCVH 3B5GA 2J8UF 2SEBB 1P4BL 1OAKH 3FFCD 3S36H 1PEWA 2FX7H 1FO0L 2ADFH 1T3FB 1FLRL 3UCRA 1CLZL 1MCLA 4PGJA 4Z78A 2E7CA 3HPLA 4PJCF 1KYOJ 4KTEL 3SCMD 4GKNA 1RHFA 4R7DB 3KPSB 4OT1L 5EBMB 4KUCD 4NBZB 4X0KB 5INDA 3NZHH 3MO1A 2XTJD 3O3DA 1N0LA 5EN2A 4HWBH 4ZUVA 3S96B 1AQKL 4GW5A 2DQIL 4ELMF 4J3TA 3RY6C 1QPPA 2WW8A 4AJ0A 2N56A 3GDBA 1J0KA 1YNLH 4GG6E 2YPLE 1I1AC 3EOAA 4XTRD 4ERSL 2G5BA 3DVGB 4HGMA 1UM4L 1VFAB 4LSSH 3X13A 1SYVA 5MEQA 3WE6A 1CFVL 3CPLA 5LVEA 1FPTL 3WN5C 1DFBL 4Y4KA 1NKOA 5KTEL 3RWCB 4RAUA 1CXFA 3UBXB 5JHDE 4B41A 1FG2A 4K7PH 4GQ9L 2EC9U 2D4DA 4MS8D 3VDBA 4Y1AE 1DBJL 1XF2A 5K59F 4L4TA 5E1AA 2VISA 4QRPD 1BIIA 1MCPL 1OQXA 4LF3A 1T7XA 2DWEB 2XZCH 3L5WA 4R0LA 5DD3L 3L3DB 5SWSA 1EX0A 3QXDA 1FNAA 2DQDH 4TTDC 3U7WH 5EWIH 4YDKL 1XF3B 4LCYA 5CILH 1ZLWH 1AE6L 3TNMA 4GRLA 5BVJA 5J9PA 5C08D 4CVZA 3QNZB 5GSVA 4KQ3H 1AQDB 3HUJA 2ERJB 2NMSA 3CZJA 5C0AA 4JANA 3NFPB 4PB9L 1OAZH 4DQOH 1T2JA 5D2LF 3D39E 4TNWK 3G9VA 4P4KD 2NW3B 3Q6FB 5DZOA 1Y18B 4K3HA 4FQ1H 2WIIA 1UZ6F 5FYJD 4NKDB 5GRJL 32C2A 4DGVL 3FO1B 3TYFB 3LOWA 1H8NA 3N0PB 2IAMA 4HIJB 4I3RH 4FQCL 5MENE 2F58H 2PO6C 5TQ0H 1Q8MA 5DLMH 2C3GA 4QRPA 4RBPK 4M6NH 2VL5B 4TPRH 3G6JB 4L8SA 5I18L 4Y4FC 1XEDA 3CXDL 3GBNH 4U0RB 2AJYH 5A2LH 1M1SA 2R2CA 2ORBH 3L3KB 2FB4H 3SO5A 2W59A 4HS6A 3PV6B 4U1MB 4S0TD 1MUJA 1A3RL 3BKJL 2BOCB 4XI5D 4KQ4L 3V4VH 2R1XB 5C08A 2IBBA 1NGWB 3ZDYE 2F15A 4PJAF 5EZLB 1ETZB 5FOBA 1P7KB 5D7LB 2HTLD 3BD3A 4ZOAA 4DGYH 4M4RA 2VLRA 2AKRA 2UVFA 2VAAA 3BJ91 1ZOXA 5IBTH 2DQTL 4WFGD 4HT1H 4PJXF 4DZ8A 4YXLL 4P4KA 2EDEA 3MV8D 3R0MA 4F33B 1G0YR 4NDMA 5D2NE 4NJAL 1RI8A 3RY4A 1KOAA 4U6YB 4GKZA 3EOTH 4OB5L 1ZVSA 1KGCE 2R0ZH 3C2AL 4JFDE 4G9FD 1AKJA 2X4QA 3OKEA 5I8KL 4I9WE 3JWOC 1FV1A 2EIZB 2EYSA 1Q9LA 3FT3B 2OXGA 3VD7A 1MCKA 3ARWA 4Z5RA 2DQGH 3NMEA 3K4AA 5BO1L 4B53A 4QGYA 4IRSD 3I3BA 4HFUL 3QPQD 4JQXA 1MEXH 1RULH 3C6SB 4HG4K 2EEBA 1JPFA 3VMPA 1OAYL 3PWNB 1E4XL 2R2HA 4L9DA 2YBRB 3MLUL 4F37K 1A2YA 1QUNA 1KC5L 4ZUWB 5MP6L 1YNTB 4OGAD 5IBLC 3HAEB 1C16A 5K9QI 4OJFH 1S7SA 4LGRB 2W9EH 1XF4B 5TGBB 1ZT4A 5D6DA 5DDHA 1MJJB 5IB3B 3AFLA 2GT9A 1FORL 43CAA 1OQOA 4QKXB 2P46B 5DI8A 4JFZH 1DUYA 3BXNB 4HKZB 3NABL 3BKYH 3NFSH 4NNPL 1MRFH 1EK3A 1K3IA 3MLRH 1A9BB 2Q76B 4EUPB 5L88L 4MNHA 3ILPA 4NGHH 3FQXB 1EH9A 4Z9KB 1WZ1H 2A6DB 4NCDA 3SDDA 1G9EA 3CMOL 2I07A 5HHXH 1MNUH 5FK9B 1HILA 2CDEB 5FDWA 4IRSA 5IMOB 3O11B 3WNOA 2HFFA 1S9WB 1IEAB 1M6OA 1IAKA 4KRMB 4WIQA 3S9DB 1QHOA 1H3WM 2IALB 2HA1A 1IEBB 1Q0YH 5GS2D 5DEFB 3P77A 3IT8D 4UU9A 5T3XH 3DX7B 4LHUG 3QEGL 1IEHA 4PJ9D 3MUY1 1ACZA 1J7VR 3AMLA 4FQXD 4QCIB 3DTXA 4M5YL 5CINH 4DKFL 5CGYC 1WSST 4APQA 4QTHB 1FO0H 3GNMH 5IB5A 3C60C 3D85B 4U0QB 5FYLE 5T3ZH 4LEXL 1S9YB 1WFOA 4QWWD 1SBBA 1QLEL 3IDMB 4IIQC 4JZNA 4UNVA 5IT2L 2HWZH 2QQQA 3VD5A 4LDOB 1AQKH 3DRTB 3QI9A 3G04A 2G9HB 2X5PA 5DJ8A 5FA3B 1T0NA 2R4RH 4HIHA 3RDTC 4WCYL 5CJXC 5J89A 2D7MA 4PJEA 1X5HA 2YUXA 3MNVB 1J1XH 4WUUA 4PG2C 3GIVB 5EU4B 1AC0A 2YOCA 1QSEB 4CVXA 1A6ZA 4HSQA 1WF5A 3K8LA 5DJDA 3HA0A 5EOTA 1KXTB 1CFVH 4RGNB 5C1MB 4P9ML 4Z95L 2OR9L 2ZUWA 2XWJA 3X3GL 4Z78B 3BOVA 3HPLB 1NCCL 4GKNB 1TVBA 1AXSA 1HDMA 7FABH 3A6BH 5HYIA 5DMKB 4DCQA 3WFCH 5INDB 5FA4B 2BNRE 3O3DB 4MCYA 4G5ZL 1A7RL 4FQXA 3QHFH 5EN2B 5BS0D 4LCWE 4GW5B 4OZHB 2Z8VC 2IC2A 1OPGH 1MPAL 1MCPH 1RZGA 4AMKL 4MAYD 2EC8A 5E5MA 5I15L 4G8GD 5DD3H 3RUGB 1YQVH 1KCLA 2WLYA 1LE9A 3X13B 1SYVB 3LKPA 2ID5A 5D1ZD 3ZKMC 5MEQB 3WE6B 1V3JA 3CVHA 3CPLB 1G6RA 2IH3A 4HZLB 4F7EA 1IT9L 1KLUB 5DK2A 3K46A 2AEQH 1KNOB 5IM7A 1WV7T 4YUEL 1FNGA 4F7MB 1TNNA 4WRLA 1J88A 4Y2DB 4M93C 4DUWA 3N1QC 3EHBC 5JW4N 3OB0K 4Z7OE 3P30L 5CUSH 3BZ4A 4L4TB 5E1AB 3T8XA 5KVEH 1BIIB 4LF3B 1S8DA 4Q0XH 4HUUA 3IAGC 4I18A 4HEPG 4JM2C 4LPUA 3HMXA 5SWSB 2JK5A 3QXDB 4Y89A 1A7OH 1RZKL 1FGNH 2OBGA 3DX9A 4GSDL 4X4XA 4OZIE 2VR9A 2AP2A 4XT1C 3T0XA 3RWEA 4DK3A 3HNTL 4X7DC 4XP5L 2EDJA 4GRLB 5BVJB 5J9PB 2EDRA 4LSRH 1EUUA 1LGVA 2ZNWA 1J5OL 5I19H 1I7ZA 3HUJB 3NOIA 4EI5D 5KZCB 1UXSA 1PLGH 2G60H 5D7JD 5C0AB 3CXDH 4KU1A 1F42A 2VYRE 5D1ZA 4JANB 2NY4D 5LWYH 2EH8H 5DR5L 1A3RH 5TJWK 3VWJA 4UV7H 2V5TA 1TJHH 4ZAKC 32C2B 1WFTA 1T5WA 3B9VA 4XPTL 1B3JA 1MFDH 4MJ5A 2J7LA 4QXWA 5LKNA 4OCRL 5DC4B 1V05A 4CRPA 1KEGL 4TUJA 2YA1A 3AMKA 3GIZH 1G6VK 5DMYA 2ATKA 1JGUL 4ORGA 1RUML 2A6JB 3RRQA 3VGBA 4KKBD 2WBWB 4FQHA 1LEIA 4NJAH 15C8L 4RGOL 1DANU 4AL8H 5HYSG 2IG2H 3W82A 4RZCA 4OM1H 4JG0L 4P3CL 4E41B 4HS6B 1CFNA 4LFHD 3MUJA 1MUJB 4QXGH 1A4KA 1JPSH 3KPQA 2E7LC 2DYPA 4IDLA 2IBGA 5IHBA 2H45A 5C6PB 2DJUA 2YD9A 1ZS8A 4M1CD 3MOBH 3BZEA 4G3YH 2HFTA 1W0WA 1N8ZB 2NY6D 2AKRB 3FMGL 5D7JA 4HXAH 3V52H 1JWSB 2VAAB 4HFUH 3UTPE 1QPXA 4C57C 1QA9B 2EDLA 3P0YL 4J4PA 3VXMB 3RTQA 4DZ8B 1EEUA 4LLYB 1OAYH 2QQLH 4JDTL 1NUFA 2ZKHL 3MRQA 1I3RA 4PRPB 5T1MB 1CIUA 3GJFH 1A14L 1T7WA 1G9NL 3B9KC 4DOHB 3ZTNH 4ZS6D 1CK0L 1NCTA 1KC5H 1IGIH 1EJOL 1NCAL 5I8OH 1EHNA 3VFGH 4ZO6A 4DWHA 5IHZA 5F9JA 5MERB 1J1PH 1AKJB 2X4QB 3MV7E 1W0YT 2EDQA 1MCOL 3BPLC 3OKEB 4AEHL 3S88H 3DROA 1KB9K 1RZFL 4LCIH 4K71C 3KGRA 5B4MC 3VXSA 1G7HB 1T80A 1LD9B 2BK8A 1H5BA 2I25N 2HT3D 5ABDE 1JPFB 3HKFA 2QSCL 2R2HB 2OX5A 3GK8H 3TYGL 2VZVA 5D93C 2RCSH 1A2YB 3EUUA 5I73C 4MAUH 5FGCE 4YHYB 5F3BA 1K3ZA 1JJUA 3IF1A 3SO3B 1HQRA 3OGOE 4M43L 1AXTH 1TCRB 2AXHA 3SDXA 5KS9E 4OCMC 3G5VA 5I0ZA 2R29H 2A6KA 1GPOH 4OM0L 43CAB 5BZWA 3TEUA 1GOGA 2R4SL 4PJ7A 2ZUVA 4QOKD 1I3UA 2EDTA 2P44B 4RWHA 5SWZE 4D3CL 3LRSA 3SKNB 5HHOD 4ZPVA 3NCCB 4DUXA 4JG1H 3GSQA 1P4LA 4MNHB 3ILPB 5IFJB 3C9NA 1JE6A 3BWAB 2R1WA 4ODXB 3SDDB 4M5YH 2IJ0C 4HD9A 3G6JF 1YY8A 4G6AC 1HILB 5FDWB 4LLDA 4FTVE 4KDTC 3QISA 2OJZL 4LLAA 3NGBB 2R8SL 3PQYD 1M6OB 5MI0B 4BSJA 4PTUB 5KG9A 1NLBL 3LVEA 3M8OL 1MQKL 1VEOA 5ISZE 2R56H 2IAND 2CK0L 3IFPB 4OFVA 3P77B 4U1IB 4TUOA 4UU9B 3ZKQD 1KTDA 1CF8H 4OCLC 3R8QA 1DQDL 4GBXA 5TPWH 1QBMH 2L7JA 3DTXB 1I1AD 4KKNA 1NC2B 5IMLA 4APQB 1BD2D 2XI9A 4AIOA 5IB5B 2CLZB 3X3GH 5BW7A 1A7NH 1BM3H 4NKIL 1I7RA 2R9HD 3RNKA 5B3JF 3P4MA 2GSIA 4O2FA 1A7RH 5JPMB 1W8OA 4KROB 4OUUA 4J3VA 3QI9B 5DD0L 5DJ8B 3ZT7A 1T0NB 1HNFA 1X4ZA 4PJEB 4S11A 4WUUB 2DWDA 4OLWL 1NCWL 2CXKA 1FZKB 3V6OC 2PR4L 3QUXA 4MNGE 2DIBA 4XRCA 1L9NA 5EOTB 4YHML 2IADA 1IL1B 4BQCA 2MSPA 4FQ2L 1C5DB 1IT9H 3HNSL 3T0DA 3BQUC 1GIGL 4TTDD 4P5KA 4TSCH 2PTTA 2AGJL 3KYKL 1AXSB 1HDMB 2VXQL 3O9WB 3RY6A 3O2DH 1EO5A 1XGTB 4GT7A 1R0AH 1J18A 4U1KA 3B2UC 2IWGA 4MWFB 5EBGA 2F5AL 4PYGA 5GRZA 3TBSB 2WMPA 1M4KA 2FLBT 3MFFA 5IGXH 3LN5A 2PYFB 5C3TA 5E24E 2AEPH 5KVGL 2JCCE 3ZTJG 4BH8A 5DJXA 3NPSB 3SKMA 1LE9B 4XNUL 5GGQH 5F9WC 3DVFA 1FRGL 3T2PA 4LLQB 3BIBX 4XCFH 1B4RA 2P47B 2IH3B 2ICWA 4NZDA 5JW4R 1JZ5A 3WNKA 4BSWB 1F6FB 5B3NA 1F97A 5IVXA 4EBQH 2VQ1A 4HCRL 4NQXA 1AR2A 5ADPL 5IM7B 3FQTA 4NQTA 1Z0NA 2F8OA 5F1OB 1FNGB 4C56E 5ILTH 25C8L 4MA7H 5KAQG 3U46A 3T09A 2IQ9H 4K3EL 5JW5A 5KSVB 1T22A 1H15A 2X44D 4P49A 3QBTB 2ZPKH 3C5ZA 5EIIA 1G7JA 4UIKL 4HUUB 2QSTA 4OQTA 4HC1H 3T0EB 3LS4L 1BJ8A 1WVZA 4YBHA 2JK5B 3DX9B 2IQAA 1RU9H 3MXWH 3RWEB 5I66B 3ALWA 2B5IB 4PBVC 3R1GH 3RBSA 1I7ZB 2M26A 3ARDA 5F71A 3LCYA 3V6ZA 15C8H 1HHKB 1UXSB 3MUGA 4WV1B 5INCA 4FZ8L 2CSPA 1MFBL 5H94B 1IAIL 3VFRA 3L9RA 1YD