1IQWH

Crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCARNRDYSNNWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY M-HFE7A, LIGHT CHAIN
publication title Crystal structure of the antigen-binding fragment of apoptosis-inducing mouse anti-human Fas monoclonal antibody HFE7A.
pubmed rcsb
molecule tags Immune system
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH02
4N8VG 4EVNB 2YK1H 2GTZB 1PZ5B 2DYPB 3I3BA 1J7VR 4I4WA 4L29A 3BPNB 4A2MA 4OJFL 1DQLL 3C2AH 4OFDA 4TVPL 1JMZA 4UU9A 3TEUA 5E5RB 4XHJD 1MI5A 1OTTC 3EO0A 3C6LA 1H3GA 2J8UA 1R5IA 5F7DB 1HHIB 5IVZB 2X4QB 3TYFA 1JWUA 1I8MA 3MRRB 1D5XB 3PHOB 3ORJA 1R5WB 5TDNB 5H37H 1I1RA 4MJ6A 3SJVA 1JGEB 4FOMA 5K33A 4YEFA 4CRPA 3QWQB 4LHUA 2X1QA 4A6YA 4YQXH 1NMAH 3LEVL 5GZOD 2PYFB 4ZXBD 3BYYA 1C5DA 2YPLE 5E00A 4AZ8A 2PR4L 4NWUL 2QEJA 3OQ3B 5C9JB 4L8SA 5ENWA 1T3FA 4HC1H 2VDRH 5EUKB 4HS6A 2LVCA 3HUJA 1NC2D 4Q9BA 5IT2H 3MREA 4G7VL 5IB5B 2FJFA 4PV8A 3DMMD 1MRDL 2EO9A 1GOGA 2C5DC 1FVEB 4OD2B 2E6JA 1CTOA 3NCJL 3WIHA 1YNLL 5L7XL 1O7VA 2FD6L 2VSCA 2JB5L 1RU9L 1DVFD 2P5EB 3CH1B 4YWGH 5I66B 5JHDA 2CIKA 1J05B 3TVMD 3WXVL 2JCCF 1BAFH 3LRHA 5HDLA 3S96B 1FZMB 1FRGL 4AIZB 3WIIH 1S9VA 3SGJA 4JFFD 5IVXA 4NFBA 4W6WB 3B6SA 3K8KA 3ARFC 1JTTA 1W72L 4QGYA 3S36L 3TO4B 1CD1B 3BP7B 4M7JH 5IB4A 5HYFA 5IEKA 1NGQL 1TITA 2DWEB 4CU8A 3EFFB 3UP1A 4MJIA 4MNQA 4YBQD 2CSPA 4TULL 2BDNL 2VDQH 3I2CL 3RL2B 4DUXA 1GIGH 2VXVH 3LH2L 4FQ1L 3MNWA 1XCQB 4OLWL 4QRTA 2XRAH 5DUPH 4X6BB 4YZFE 5L2KD 3QUXB 1OP3H 4NKIL 2MWCA 2BXZA 3HKFA 4MVBD 5SWSD 2P24B 3EYOA 1S5IH 3OPZH 3S35X 4HK3J 1IKNA 3EYUL 3FQWB 3CMOL 3EYVB 1FV1A 3IAQA 3IF1A 4PRHD 4JDTL 1N64H 3IDXH 3WO3B 2NXZC 1IGIL 5ADPL 2A6JA 5AG8A 5CEZH 1EA9C 2YRPA 2NLJA 4FP8L 2UYLB 3QQ3A 4MAYA 4Y5YB 3S3SA 5HDQH 1IGCL 3CJJA 3F7PC 3C5JA 4M6ML 4ONFH 1G9EA 1KTLB 4I18B 1ITBB 4A6YH 3PJSA 2OR8A 5FB8A 3CFCH 2VXTH 2YWZA 1FQ9C 3MBEA 4JFQB 3X13A 3HE7B 4OSUL 4LCCA 5DD3H 2DQJH 3SKUD 3BH8A 3W39A 2DYPD 4OZIA 2BVOA 4RNRA 2OSLA 2VDLH 3F7VB 5LWYL 3QI9A 1WT5C 3WIHH 4YXKL 2CKNA 3TFKD 5I1AB 4FTVB 5F89B 4OIIL 4UDUA 1F3JB 1PKOA 5CBEB 5F96H 5DMYA 4ODSH 1DLHB 4HX1B 3S3PA 3UTTA 5IFJB 1ACYL 4LP5A 4ZD3H 2ERJB 4GO6B 3V5KA 4I2XA 1KTDA 4K07A 4L9LA 4XVUD 3QDMB 1CFQB 4GUPA 3GMLA 4N5ED 4P49A 1UKTA 2BCKB 2MQ3A 4FQIH 1MH5B 4WI5A 1V3MA 3IDMB 3PV7A 1B88A 2XQYG 2DQTH 4BUHA 1BIIA 3DXAA 1YEDB 4PJ8B 2D3VA 1ED3B 1T2QL 1P6FA 1ZGLA 3ES6A 1G0XA 2OZ4L 1BVZA 3T3PF 3VE0B 2NX5E 3MCKB 4D9RD 3TYGH 3MRJB 3B2UD 1GGUA 3QFDA 4MA1B 4JKLA 5GRYA 2P5ED 4LHQB 1OAUH 3O3AB 5D72L 2H2SD 1MAKA 4P9HH 3C5ZB 1RPQA 3QHTC 4O9HH 1ZLWH 4BSWB 3RVTC 3O4OC 2VLJD 3OKMA 1TENA 5EBLA 2Z4QA 5C0BE 2D7NA 4OM0L 2RCSL 5GGRB 15C8H 4C83A 1Q0XH 1PYWB 3LN5A 4TN9A 5F9OH 5EU5B 4L4VE 3U1SH 5E4IA 1A2YB 5JNYA 4IRJC 1G7HB 1YEGH 1EEYA 3BP6A 4XPBH 3VXSA 1RUPH 4FFWC 4U49A 3KWWA 1HWGB 5EZLA 1IMHC 4LASL 1FO0A 3PQYA 1ZSDA 5D6DC 1ERNA 3FQTB 1IGYB 2WINA 1FLRH 3H7BA 2YSSB 4S1QH 2NY7H 2QADD 1ZA3A 3MJ8A 1A6AB 1MJJA 4QXGL 4EKXA 4RIRB 3NCBB 3CPLB 5T3XH 2VSDA 5TPWL 4Z7WB 1U8OB 2R29H 5IV2A 5ABDE 4H26B 3AGVA 4WO4D 1T83A 4XGZB 2NY0B 1CG9B 1WZ1H 1E0OB 5C07A 4HIIB 2VZ1A 1UM6H 1IGJA 4XP4L 3TIEA 3MRLA 4OBSA 5ALBL 1D5MA 4U1SA 5CZXD 2NY5C 3V0WL 4M62L 3GHEL 4KI5D 4DZ8A 2I24N 4AJ0A 2IALA 4WI3A 1D5IH 4TNVK 1VFBB 3KPOB 3STBA 4NNPL 1G0YR 2BOBB 5HI3C 1T6VN 4OGZA 3BRFA 1E4JA 4NBYB 1M7DA 4KJPD 2X4OB 4F7CB 3V95A 1FBIH 1X5XA 1HXMB 2PETA 4OI7A 2B5IC 3OZ9L 4P4KC 1I9RH 4X7SH 4M8QA 3QDMD 3HMXL 5CUSH 4KROB 4XT1C 1S8DB 2F15A 3RPIB 4JO2H 3FOMB 1TIUA 4D3CH 5I30H 4HXBH 1VKXB 1AQDA 3SDAA 3VWJA 4CU6A 4HK0B 1KF9B 1FO0H 2GI7A 4BUGA 4PJ8D 3G5YA 1CXKA 2GT9A 4PJDB 2WV3A 3SDXF 3GMQA 1PVHA 4WEBH 3TBTB 4GKZA 3PL6C 4S1RH 2B1AH 2DDQL 4FFYL 1LGVA 5KOVC 2DWDB 3H3PL 3CFDB 4J4PD 5KSVB 3C5ZD 2VABB 3NACH 4HEPG 4FQXA 4OD1L 1IC4H 3BIAX 2VAAA 4UILL 1NKRA 1Z9OA 1KJMB 4Q6IA 1FJ1B 4TNWK 4M93C 1CGUA 1TQCC 4N8CL 2FDBP 3OG4B 2IBGA 3T2QA 1NCBL 2BOCB 1EV2E 1GGBL 4EIZC 5HXMA 4CU7A 2PCPA 1ZANL 2QQKL 2Y36L 4MXWL 3FCTB 2ENSA 2VKXA 1OF2A 2DD8H 3DV4B 1YECL 5DMIL 1NGWA 3OR6B 2LVEA 1MCCA 1U8NA 3LV3A 3SE3C 3GGWB 3O6ML 2MTPA 4EBQL 4EUPG 5F44A 4RMWA 3T04D 4K94C 1HINH 4GW4B 3EDDA 3ULSB 2ZUQB 3HC4H 3B2VL 3D25B 4YHLH 1IM9A 4JN2B 2OQJA 2V2TB 3LEYH 4KKBD 1K6QL 4Q9RH 2QHRL 3KGRA 2NY0D 1S7RA 1T1YB 3RIAF 5IB3A 3HZYA 3F5WA 3V6ZB 3BJLA 4UOW0 1CGWA 3ARFB 5HD8C 2AKRB 4JM2C 1QLFB 3BW9B 4NO2B 4N0CD 1EXUA 3PG2A 1QA9A 2G5BB 3OHXB 5FCUH 1QTYT 3OKNA 4OIBA 4H20H 1UZ8A 3L3DB 5E6IC 5FM8A 5GSVB 3GHBH 1RHFA 5FGSA 5TFSH 4EDXA 5L8JB 2E8YA 3T8XB 3ZZ1A 3QFJE 4TUOB 1AD9A 1D7FA 2E7MA 1KJVA 1RD6A 4ZFGL 2BSRB 4O2CA 1IAKB 3BPCA 3GSUA 2VTFA 4BFBD 3SDDA 1MWAH 3U7YL 5CMAB 5FA3A 4ERSL 3KPTA 3TH3T 2NXZB 4IOIA 4KH2A 4KROD 4KMTH 4X99A 3U30C 4KV5E 2OTUA 4XCNA 4ZPTB 3BN3B 1N0LA 4B50A 5CJQH 1AJ7L 1LO3H 3SCMC 4J23A 4E5XB 4ZO9A 1J0KA 5MERA 4P57A 2XFXB 2AAVA 4ONHB 1H8NA 4UIMA 4PRBB 4U0RC 3KDMB 5ISZE 1I85C 1FIEA 5GRZA 5LCVL 4LDOB 3WJJC 1FCGA 4BH7B 1OP5H 4F7TB 5CD5C 1FPTH 3IU3B 4WTXA 4L8DA 1FDLL 3O81A 4YEEA 4KUCD 1CGSL 2IANE 1XGRA 3F12B 2Y4SA 3DX8A 1MUJB 3A6CL 1HHJA 3RNQB 5DJCA 4HHAB 3K3QA 1NBVH 1SJEB 3FO9A 4K8RL 1OW0C 3EYSL 3QDGB 4EN3C 1RJLB 5I1EH 5HGHA 1VGKB 1OB1A 1AGCA 3WFCL 5HY9A 2FSEA 4WFHE 1J5OH 4MSWB 5GGVY 5BOPA 3UDWC 1F2XK 3BZEB 1FL6B 1RJYB 3Q5TA 1KYOK 5A40E 3GRWL 3ILQD 5EOCL 2OK0H 3IKCA 4G6KL 2IAMD 3MV9B 2XA8L 3O3EA 1SEBB 1TJGL 2P7TA 4XRCA 1UWXK 2ZWLT 3AREB 3QHZL 3QDAA 3TA3A 4LSVH 4JQIH 2RGSA 4PJ9D 2HJLB 4Y5XC 4PJCE 4DGIH 2HT4D 2O5ZH 5E9DA 3E6FA 3QIUA 4PRIE 1MVFA 1FNSH 1BM3H 1PQZB 2E7LA 4D0DA 1FORL 4NUJB 2EDQA 3WFHA 2NZ9C 4HUXB 4V2BA 2OS7A 5LXGH 4ZODA 5FFLA 1N3NB 2BHYA 2GSIB 3D6GA 3C8KA 4M43L 4Y1AA 4CMMA 1DZBA 3PWJA 3WXWH 5C3TA 1JGLH 1MCPL 2X1OA 4APQD 5IK3A 1I9JH 2EE6A 4JDZB 1Q9WB 3E0GA 3UBXI 1MIML 3BO8B 3ZL4H 4UDTA 2ZCHH 3TF7C 3S37H 3ULUD 1HKLL 3I85A 2CDEA 3L95B 3MV01 4FQQB 1U8LA 4CW1A 4CN1A 4WUUB 1WWWX 3FTGA 1F4XL 1A6TA 3RU8H 1X7QA 2LTQC 5F8RC 4Y19A 3P4MB 1MREL 3LRSB 4RWYL 1E4KC 1G7JB 1IT9L 3GFUA 3B83A 4GS7C 2K7QA 1BX2B 4WU7A 2L0DA 4LRIC 3V0VB 4P0DA 4DKFL 4R7NB 3TV3L 1UM4H 2AK1H 5DJXB 1A7NL 1T0NB 2HKFL 5EZIH 1YN6B 3NCMA 1KGCE 3FQUA 4K94L 1X9QA 2W91A 5DVMA 1NDGB 4RGMB 1KLGB 1T6WA 2AK4E 3TCLA 1WBYB 4PRPB 3NCCB 4WWKA 2OBGA 4KQ3L 5EIIA 4K3EL 5K9JL 2Y07H 4HPYL 4PJEA 5F72S 1WFNA 4D0BB 3REWB 3VD5A 4KHXH 1OVZA 3VDCA 3VFGL 3EHBC 4QNPE 2ENYA 1OSPL 3FKUS 3N85L 5TE7H 4C56E 4ZUTB 1NEZG 1YEIH 3MLSL 3QDGD 4WI6A 5IJKA 2GJ6A 3VA6A 4XP6H 2X4TA 3GKWH 3OJMB 4ZG1A 5T5NF 2FATL 2AJXH 4P4KB 1CDYA 3HN3A 5IVNA 2W60A 3WIFB 1ZHKA 1CLYH 4YHKL 5ANME 4PJFB 1QRKA 2HLAA 4TSBL 5KVEL 4KRLB 3QEQA 4I1NB 5D7IE 4XI5D 5D7JA 5BVPL 5FYJH 5I1IH 3ARED 1U3HB 1KJ2L 3GKZA 3VD4A 2OR9H 4PJBA 4XC3H 2XN9A 1WWBX 3I50H 3CSYA 2BVEA 3PGCA 3VCLB 3RBGA 4OCWH 4C55A 1OAYL 2B4CC 1E4WL 1JMXA 2FR4A 2J5LB 2ICEB 1R3IL 2VZSA 4KAQH 1CVSC 4NZRH 1PAMA 2DI9A 1DQJA 3ARWA 3RJDA 1KCVL 1HSBB 3BMVA 4PJHB 5CZVL 4P23C 1OGAB 5FHAH 1A6WH 1VFMA 1BFVL 1LDPH 5EU6A 4HS8L 1MHEB 4Z5RB 2WIIA 4NQEB 3NCFB 1QD0A 1U3YA 3Q6GH 1HZHL 4CBPA 5IF0A 4XVTH 4AEHL 5A3IC 4RISH 4TSAH 1SVZA 2ORBL 4O58H 5ICXA 5K9OA 1BQLL 4E41B 2E27H 1B4RA 4YDKL 1F4AA 1QSFA 2D9QB 2IPTL 4H1LA 3DNKA 2R23A 1J8HB 2XWTA 5FOBB 5H94B 3WJLA 3SO3B 4ZTPL 3G5VB 1JRHI 3WEXB 3DBXA 1RIVH 1UB6A 4NQDB 5INCA 5DJDB 3PIQB 5F8QC 2ESVD 5CHNB 4CDHA 4AIXA 2AS5M 3RA7L 4PRPD 5DHVA 2EH8L 1YEHL 5CGTA 4TRPL 4U1NB 1YC8A 1GXEA 3MROA 4NT6A 4M3JA 4Y4FB 2G75B 1TCRA 4PJ7F 4RMTA 3HI6H 2BNQB 2A9MH 5ESQA 2NY6B 5I15H 4JM2B 4HLZH 5F1IA 4LP4A 1PKQB 4O4YL 3G6DL 4CVWA 4MZ2A 2BY0A 3MRBB 4R90L 4S1SH 3W2DH 5GS0H 5DVKA 1W0WB 5E8OA 3RWIA 1BQHB 2OI9C 1JWSB 3IETA 5E94B 4EJ1C 5HYJD 3O45B 1Q9OA 4WV1B 5DFVD 3P4OA 4KJQC 2XTJE 2SEBA 1N7ML 5T1LD 3UC0H 5F1NA 5C71A 1JWMA 1CXLA 3OXSB 3IVKB 3GB7A 2KQNA 1RZFH 5C09B 3TNNB 3WO4C 1KPRA 1S7TA 1HQ4A 3MYJA 3MRPA 4JJ5B 3BZ4B 2F54A 4UBDC 4ODVL 1KCUH 5I1DB 2PTTA 2VXQH 3QUML 5MP6L 4EEEA 2J6EA 2DQCH 2A9NH 1U3HD 5DI8A 1KJ2B 3SCMB 3SGKC 4FXLA 2UWEE 4M5ZL 4NQXA 4IDLA 3I02B 2ED9A 1MFDL 3KPSB 1S78C 1A7PH 1JNJA 1UA6L 3IRZA 1UWXH 3VG0H 3X11A 1T04A 4WIQA 4QHKI 3RDTA 5F1OB 1YDPA 2Q8BL 4P5KA 3T0BA 3AMLA 1CE6B 1CFTB 2W9DH 5DHVH 3V5HB 4IRSC 3TFKC 2HH0H 4NQED 1S9XB 4R0LB 2F8XC 2CRZA 1WLHA 3KS0H 5F7YC 4YC2C 3NPSB 4S2SB 3E6HB 1KB5A 2QV2A 5DHYA 1KN2L 1IL1A 1XT5A 1EEUA 1HE7A 2DM4A 5FUCE 3P30L 4XNMB 1J8HD 4F7MA 4A2LA 3BP4A 5DJ6B 3SY0B 2FO4B 2PYEA 1G7QA 3S37X 1DFBL 3EJZD 5D6CA 1U0QA 4JKMA 3ZE2F 2ATKB 4HCRA 2BVUA 4MDJA 4NQDD 4G6MH 2VZOA 4KC3B 1TTFA 4OZGA 3OJDA 4ELKA 3VH8G 4M6OL 3VMNA 3FL7A 1ZS8B 1XIWA 2ICWI 4NWTH 4Y4FD 4J1UB 5HGDA 2LU3A 4G8FA 5EFIB 1V7NL 2BNQD 2H8PB 2J6EH 2NY6D 1QSZA 1ORQB 4OF7A 4PY7B 3L7FB 3GJFH 3DSNA 2DI8A 3TIDB 3HPLA 4BYHA 3MC0A 4PS4L 1IZKA 4OM1H 4M02A 5FYLH 5DEZA 1NFDE 2OP4H 5HHME 4O5LL 9CGTA 4UI2A 1DBKL 3U7WH 4U3XA 1P2CB 1I4FB 5D1XC 5MEQB 4RFOH 4V1DE 5CJXC 5EN2A 4YDIL 3I3DA 5E8PA 4GG6F 2YC1B 2DQFA 5C09D 4UT6L 4M7ZC 3IDNA 1ACZA 3LS4H 2E8ZA 5CP3A 4J7RA 3AROA 5C0ND 3QUZB 1F11B 2EDRA 4MNGA 1Z3GH 1AKJB 4DQOL 2EKJA 2HFEA 4HWBA 3X3GL 3F8UB 4DW2L 2EZ0C 1KB5H 1T20A 2MKLC 4R4FL 5EC2A 5JPMA 1I7TA 5DC4B 2I07B 1KC5L 3ZO0A 2DMKA 4JHBA 2EIBA 4N0UA 5GGTL 5GRUL 3C8HA 1RQ5A 4P46C 1FN4B 3B3IA 1A7RL 3BDYH 3O3BB 2XT1B 3OF6D 3MO1A 4POYA 3QCUH 4M61A 4MLIA 4OF5A 4UT9H 4LLYB 4K9EL 5D2NE 5TF1L 3LDBB 1JRHL 5F88A 1FYTE 4XB7A 4JZJC 5DQDH 1K5NA 3GIVB 3HMWH 3BHBB 3RVVD 4F37K 1MVUB 3MLXL 4I0CC 4X6EB 4ZXBA 5B39G 4ZS6D 1C16A 3WFDH 3VFNA 4ZS7L 4JRWA 1ROWA 2EEDA 1TZHB 4JRXB 1IQDA 3JUYA 4ISVB 4M4PA 4Z7QE 3M8OL 3DROB 3O2DA 1NC2A 3MV8B 1TETL 4Y4KB 2P5WE 3DMMA 4OV5A 3QJHA 5K9QI 1X5GA 5I8KH 3VI3F 1M05B 4IMLB 4J3VA 4ETQA 1OY3B 1DVFA 3VFPB 4BFIB 1IKFH 2R1WA 3TVMA 4GBXB 5JZ7C 1NANH 5DZLA 5IHZB 4ALAL 2ZG1A 4JFFA 4RGNE 4JPKH 5AG9A 4NJ9H 2MPAL 4ZSOE 4DEPB 3SGEH 4FQHB 2HRLA 5E99H 3KPRE 4I3SL 1PG7W 5CSBA 5CP3H 1S7XB 3TT3H 3GSOA 1T1ZA 5EUOA 3PWNB 5I8OL 4HWUA 3TJEL 1J0YA 4XBGA 4HWBH 3B9KC 3DVNB 5L2KA 3ZTJG 5SWSA 3ARGD 1MLCB 3HNTL 2VL5B 4F9PA 3TN0B 1YJDC 1WAAE 3UJIL 2YPKA 5DEFB 4PRHA 1KCKA 3BT2H 3MMEB 1HIMH 1T89A 3LPWA 3IFOA 1GYAA 1MQ8A 4I3GA 4KKAC 3MR9A 3RGVB 5HI5D 2ITDB 3MUGB 3ZE1E 2O93L 4XWOC 5SWQA 5ID0A 3MLPA 4WW2B 4U1HB 1AXTL 1AGFB 2P8PA 1XCTA 5HPOA 2ADIA 4PG2A 1EBAA 3OKDA 1YNKH 3IT8D 2YD2A 2X9YA 1ZT7B 3QUZD 2NW3A 3STLB 3DHMA 3RIFF 1AKJD 2H6PB 4EVNA 3QXUA 2L4OA 1PZ5A 2DYPA 2P44B 4K3DL 2PF6A 1NSNH 3GK8H 1JHLL 1G9NL 3TCXA 2HT3D 4ELME 3OKEB 3RWJB 1DBML 2YD6A 4OFYD 2BX5A 5F7DA 1BJ1J 1BZQK 1HHIA 5IVZA 4S11A 2X4QA 4L4VB 4P9MH 2E7CA 3MRRA 4GAGL 1D5XA 3PHOA 5FKAB 1U8MA 1OLZA 4N0CC 1R5WA 5TDNA 3GNMH 2AI0L 1JGEA 2X89D 4W4OC 4HG4K 1N8ZB 1BGXL 1Q0YL 4O2FB 5LKNA 4O51A 1MJ8L 5FGBC 5HVHC 3FFDB 2Q6WB 1CDGA 2V5TA 4QRPB 4F3FB 2I9LB 4MS8D 5E8DH 4ZMAT 5C9JA 1AXIB 6FABH 4JHWH 4NGHL 1ZTXH 3BGFB 4JRXD 5EUKA 3G04B 3QNZB 4LU5L 4XP5H 3MV8D 2CLRB 4Y4KD 4RMVA 1M7IB 2DBLL 2FEDC 1QFUL 2ARJB 1JHKL 1MQKL 2VQUA 3WYRA 3D1MC 5DO2D 1DL7H 4IIQC 2P5EA 2V17H 4DGVH 3S96A 1Q72L 1FZMA 4B5EA 4GBXD 3W82A 4PJ5E 2HT2C 3QULB 3CDCA 2VLJA 1SM3H 3HNSH 4X5LA 1CD1A 3BP7A 3V0AC 3QXAB 1JZ8A 3R4DA 1QLRB 5L6YL 5BZWB 3EFFA 4RWHA 3MNVB 3TWCH 4AM0B 3DARA 4RGOH 3PGFL 2F19L 4C4KO 4KMLB 3RL2A 5ETUB 1XCQA 4KPHH 5KJRL 2AEPH 4WJ5B 2FB4H 3U0TB 5TQ2L 2EICA 2P24A 3GSRA 2IFFL 3TN0D 3BRDA 3FQWA 5BVJB 1G0DA 1IAIL 1RI8A 5ACZB 1U36A 4MXVF 3VXME 1ZEAH 1YEFL 3RGVD 2HTKD 3ROOA 2UYLA 4Y5YA 4Y2OA 2UZXB 2H32A 2NZIA 3EOBB 3L7EB 3TBSB 5JIPA 1KTLA 4I18A 1QBML 3C60C 4BKLB 5CJ5A 5C6TH 2EC9T 3A6OA 3D85B 4WO4A 1V3KA 3VI4E 1PY9A 4XWGL 5I1HH 2D9CA 4H88H 4WU5B 3D3VB 2QSVA 4JFQA 1EO8H 2J8UF 1S9YB 3U0WH 4JQXA 1AQKL 4AEEA 4UQ2B 4CADA 1H3TA 1UQSB 1UJ3C 1RJZA 4XPTH 2XACC 3WLWC 2VMFA 2WWMC 4DAGL 5TE6H 3F7VA 5ID1B 3NFSH 1E6OL 5I1AA 1RIUL 5T5FL 1NGXB 4JN1L 5F89A 3P9MB 1F3JA 1DLHA 3T0EE 1CCZA 1GOHA 5IFJA 1FE8L 3SQOH 3VD3A 2Z35B 4N68A 1NC4B 4YHZL 1YJDL 5I1KL 5HGBA 3KLDA 3QDMA 1EGJA 1CFQA 3NVQA 4I77L 4QRPD 5E4EC 2BCKA 2FEEL 4K71B 3U4BH 3IDMA 5D1XB 5I17B 5EU7E 4P59L 5C0RL 4GKSB 4OD3H 1NMCB 4LVHC 5DGQA 1YEDA 4PJ8A 3FQRB 1ED3A 1WTLA 1L7TL 4UT7L 3IJSA 3VE0A 3MCKA 4IOSD 2F58H 5EWIL 3EDEA 2QQQA 2ZZUT 3OKOB 4KTEH 4NNXA 3O3AA 1E6JH 3T2OA 2KL6A 4J4PA 1MHCB 2F9BT 3C5ZA 2YRZA 3CC5B 3O4LD 4BSWA 3STZA 1IGTB 2I26N 2X44D 4QRRE 3G5ZB 4GXVL 4QCIB 1DQTA 1RFDH 1NCCH 1PYWA 1T5XB 4RMSA 3GMRB 6CGTA 4WDIB 5EU5A 4HQQL 3EYQD 4KXZI 3TNMB 1A2YA 2X4UB 4M6AA 1G7HA 2F8OA 1D9KC 3QIWC 1U8QA 1ZMYA 3FQTA 1DQLH 4OJFH 1IGYA 4TVPH 2VDKH 2PNDA 4Q6YA 2H26B 1Q9LB 4HIXL 1A6AA 1FGVL 2FZ3B 4WI8A 3BD4A 4RIRA 4GLRH 4F80A 2ZNWA 3CPLA 1AR1C 2EXYC 3HRZB 4Z7WA 1NJ9B 3K8LA 1U8OA 4YHIB 1H8OA 4HMDA 3QRGL 4QHKJ 3HB3D 5I8EB 4MLSA 3D85D 1W0VB 3LEVH 4XGZA 2AEIT 1CG9A 3V52L 3D3VD 4HIIA 4WFGD 1KEML 5TF0A 5IIEB 3UPAA 2IANB 4G7VH 3JVGA 1QSEE 2ZG3A 1ZLSL 1VFBA 3KPOA 5F70A 5I16B 2R9HD 1YNLH 5L7XH 3R06B 2FD6H 2C1PB 2JB5H 1IILE 1RU9H 5J6HA 3CMGA 3WXVH 3P77B 1FRGH 4JFPB 2X4OA 3SKNB 4F7CA 3QDJE 4Y8AA 4OF0A 4QTHB 2VZUA 1R3KB 4NFCA 4YPJA 3T2NH 1CLOL 1KELL 1ZHNA 2VZTA 2WMPA 1NC4D 3S36H 1ZT1B 5H35A 1NGQH 12E8L 1S7UB 3EDKA 2OL3A 4JVPA 2A0LC 2YD8A 4TULH 5B8CB 1S8DA 3I2CH 3TT1L 5E2TL 3FOMA 1JGUH 3LH2H 1VKXA 4OLWH 3WBDA 1CS6A 4JB9L 4HK0A 5A2FA 1HYSC 4PRIB 3S3JA 1V05A 4YHNA 4NKIH 1NQBA 4HUUA 4EI6B 3BSZL 2IPUG 2X4NB 1OCWL 2FECL 3N1FC 4KQ4L 3TBTA 1CVRA 3CMOH 4NQSB 3NGBC 4JDTH 4XNUL 2DWDA 4ENEC 1T2XA 2FLRT 5ADPH 1JZ2A 3QWRD 3CFDA 5HHQB 5KSVA 2VABA 4FP8H 4UIKL 5FO9A 2K9UA 4M6MH 3CX5K 3QUKB 1KJMA 3ULVF 1FJ1A 2EEAA 3MODH 1HDMB 3V6BR 4HIJA 2ADFL 2BJMH 1SYVA 4H5SB 2GK0B 4DOHB 1DSFL 4GG8A 3FCTA 5HVHB 1BVKB 1S9WB 3DV4A 3TLRA 5LWYH 4HAGA 2IAMA 1U2CA 1XZ0B 4YXKH 2KKQA 5HI4D 4X4ME 3GGWA 5GJSL 1CDJA 1S5HB 2VLKE 1GGYA 4WI9A 4OIIH 4PJ9A 4ZUSB 4E0RB 2BRRH 4GW4A 2AJZB 1Z9LA 3ULSA 1ACYH 1P69B 3QB7C 4ZUWB 3D25A 2Y6SD 1TQBB 4JN2A 1WZKA 2FHCA 1K8IA 2V2TA 5IEHB 2GW5A 1DP0A 3VXUE 1T1YA 1T22B 2XZCH 3V6ZA 4QHNB 1JK8B 4APQA 1T2JA 2AKRA 5KANI 1J1OH 1QLFA 3BW9A 3LS5H 3P9LB 4NO2A 5D2NC 1JE6A 5D1QC 2VERN 2NY3C 3LIZL 4KVNL 3UO1L 1T2QH 4N8PA 5GSVA 2OZ4H 4C56B 2F8VA 3T8XA 4XNZB 2NY2C 5FECB 4TUOA 3K1KC 2BNRD 4HV8B 4OFPA 4Z7UF 3G6AB 4G8IB 5D72H 2E9JA 4AQOA 2BSRA 5C6WH 2R2CA 3SDCD 1IAKA 4XPFL 2JJSA 3CNKA 2YKLH 5F6HJ 4PP2B 2VQTA 4OM0H 4HXAL 3QIBD 1U42A 5HJ3B 2RCSH 1MCFA 3HMXA 3MNZB 5IWLA 1G7PB 4CGTA 3NFNB 1NUDA 4ZPTA 5CCKL 1PX4A 1YPZF 2ZUSA 5CLTA 5C0CE 4MA7L 1ETZB 4LASH 4E5XA 1KENH 3MUY1 4ZPVB 2J88L 4ONHA 2VLME 4HKBB 4PRBA 4ODWB 3KDMA 4QXTB 3SDYL 3HS0B 4FZ8L 1QO3B 4QXGH 4JZNB 4BH7A 1LVEA 4F7TA 1BBJB 3IU3A 4KJYB 5TPWH 1KCSL 4M1DH 3L5JA 2F5AL 3I9GH 4IEFB 1R3JB 2Q1EA 2ZKHL 1MUJA 3RNQA 2VXSH 5BMFL 4HHAA 1I8KA 5HDBE 1SJEA 3QDGA 3HA0A 3HI1B 3GUTB 4AEIH 3BQUC 4XP4H 3HPJB 5ALBH 1OQXA 1MY7A 4MSWA 2NR6D 4NM8L 4M62H 1PW3A 3GHEH 3BZEA 1RJYA 5IW1B 2Z91B 1SEBA 3CVIL 4NNPH 5JIIA 3AREA 3KHOA 4LVHB 3W5MA 3JV4B 4M00A 3LHPL 3KJ4C 4K7FB 5E2UH 3OTTA 5DK3A 2WW8A 3G6JE 1LP9B 1OHQA 4NKQB 1PQZA 2XKSA 3OZ9H 5HTSA 3U4AA 1HI6A 4U2YA 4NUJA 1CFVL 4HUXA 4JRYE 1PBYA 3I6GB 2JTDA 4Q7DA 1N3NA 3HMXH 1VENA 4K7PL 3KPNB 3MRIB 4OZHA 4PD4K 2VB5A 4NPYB 4JDZA 3BO8A 4LSRL 1MCKA 2EDFA 3T77B 5BQ7A 3IFLL 4G8EB 3L95A 2D0FA 4C56D 4QWWC 2DDQH 4LRNL 4BK5A 1NCDL 3P4MA 3LRSA 1G7JA 3QIWB 4H8WC 1BVLA 2XTJB 3KJ6L 1KPUB 4L3EB 5C0IB 4G8GB 4OD1H 3V0VA 4R7NA 5L88H 5DT1L 4UILH 1C08B 5ELIA 5DJXA 4DVRL 1T0NA 3G08B 3EZ8A 2YA1A 2FJHB 1HQRB 4ZS6C 3ZHLA 4JREC 4N8CH 2Y25A 4PBWD 1YMME 2Y9RT 2BRQA 4Z7VE 3WSQH 4H0HB 1TVHA 1NCBH 1GGBH 3U9UB 2ESVA 1KLGA 3ARBB 5KS9B 1ZANH 2QQKH 4RFNB 4MXWH 4YFEA 4PRPA 5F93C 3VRLF 5K9KA 1NAKL 3MLTB 1YECH 2GCYA 5DMIH 2D7OA 2EDLA 4HWEL 4YK4B 5AUMB 1YYML 3IKKA 3OAYK 4P2QE 4EBQH 2XICA 4JO1L 4NN6C 1BJ8A 3REWA 4K2UL 4HJ0D 4F7EB 4XCCL 1JCKA 4P4RA 1BWWA 5C3LD 3MXVH 3QUYD 3B2VH 4GRWB 5DJ0B 1NKOA 4EXKA 2IFGA 3WS6A 3T0WA 3OR7B 1K6QH 3CLEL 3EGSB 2HLFD 2QHRH 4ZUTA 5HYJA 3FMGL 2XWJA 4X6DE 4BZ1L 1A6UL 5JPNB 5T1LA 4OGXL 1KJ3L 5J4MA 3WIFA 4DN4L 5ITFA 4PJ7E 3OAUL 3O8XC 4PJFA 1X5IA 4TYUA 1IEBA 3DI2B 4GAJL 1LE5B 4MJ4A 3WFBH 4YO0B 1U3HA 1LE9B 5IR1B 3MUHL 2DB8A 5DHXB 1W2KT 5C08D 3VCLA 4PRNB 5BCAA 3U7YH 2VZVA 1LNUB 2VUYA 4TNWF 3VJ6A 1WBXB 4J3OC 4OF3A 2Q86A 5LJYH 2FH8A 3P73B 4GQ9L 1MY5A 5B4MD 5KW9H 1IVLA 4IMKC 5ICYB 3AY4C 3CDYA 5DYOB 1HSBA 3T0EC 3H9HB 4PJHA 1RUKL 3QXDB 5JOPD 3PNWA 3PGDA 2HFGH 1HXYA 1L9NA 1OARL 2BY2A 1MHEA 2BNUA 3NFPB 4RDQG 4NQEA 3K4ZA 1HHGB 5LCVH 1NFDB 5HHMB 4PLNC 5ITBL 4YBLC 2EIDA 2WK2A 1RURL 1X5ZA 4OTXL 1VB9A 4L3ED 2R56H 1CGSH 4V1DB 4C57C 1SJXA 4G8GD 1OGTB 1Z9MA 3A6CH 5L9DH 1J8HA 5FOBA 4K8RH 5H94A 5T3ZE 3EYSH 3G5VA 3MLYL 5F3BB 3WEXA 3NAAL 3WFCH 4H1LG 4LSDA 5INDB 4NQDA 4OQTL 3PIQA 4DGYH 5CHNA 3ARBD 4M6NL 1L4IA 4M03A 2PXYB 4PJIE 1K3ZA 1P6AB 5J13C 5EOCH 1BBDL 2V2WB 4U1NA 4N0FB 5J7CC 1MHPL 4PRAB 4G6KH 2XA8H 1TJGH 4Y4FA 1QFWI 5I73B 1MJ7H 2BNQA 1BEYH 1RMFH 4UAOB 1FYTB 1GZPB 1PKQA 3L6FB 5D1QB 3QQ9D 2ED8A 2BFVL 2ZOKB 2GYSA 3MRBA 5DD6B 3ZDXF 1FORH 5I1CL 1BQHA 1JWSA 1FIGH 5E94A 4X80H 5CGYD 4PB9L 3O45A 4WV1A 4M43H 1KSRA 1MSPA 1MAJA 3AM8A 3RZWA 1MCPH 1OAQL 3N9GL 4RAVA 5H2BB 3SGDI 4UQ3B 5DMGD 4JM2F 4NN5B 4PJBF 1WC7B 3OXSA 3UZVB 3IVKA 5C09A 3TNNA 4LVNB 1HKLH 2FHFA 4CNIB 2V5YA 4JJ5A 4L4TD 3BZ4A 4GW5B 3BUTA 5I1DA 3CVHB 1KIQB 3TZVD 4RWYH 1MREH 5EO1B 1IT9H 4RGNB 1KJ2A 4JAMA 4L9DA 2FL5B 1IC1A 2R0LH 2RR3A 5IMOB 4G9DA 2IC2A 3TV3H 2OXGA 1A7NH 3KPRB 3I02A 4YE4L 5B38G 2HKFH 3OF6A 4Q9CA 1NCNA 1KFAL 4K94H 5HYQB 1S7QA 3VGAC 4CVXB 4G6JL 3MOBH 4EI5B 1CE6A 1CFTA 4QTIL 3V5HA 2JCCB 3QHFL 5IW3A 5DA4A 4KQ3H 3TH2T 4KKLC 2C1OA 1S9XA 4R0LA 4K3EH 1RULL 5K9JH 5GGSB 3QPQD 3CDGA 4LLVA 3OXRB 3DIFB 2V9TA 4HPYH 4X9HA 2F5BL 4LCIH 4S2SA 1NGYB 4LPXA 2R0ZL 4Z95L 4MD5B 2HKHL 3VFGH 4D9QE 4QGTA 1OSPH 2CJUL 1M71A 5IP4A 3N85H 3OAZK 4CKVX 3BOVA 3PWPE 3MLSH 5DJ6A 3SY0A 2FO4A 1X5FA 3LMJL 4QXUH 2FATH 2DQDL 2HTLD 3OKYA 1ADQL 2PXYD 1PEZA 3RVXC 1ZGLM 3BKJL 5KVEH 1ZS8A 4JG1L 4J1UA 2E9BA 5BVPH 5EFIA 5E0QA 4Z7OF 3AAZA 1MFBL 4ZFOL 3BWUC 1ORQA 1WFTA 1KJ2H 3LKQB 5C8JB 4PY7A 3L7FA 1FYTD 3E8UL 3ARGA 3TIDA 1DCLA 1SJHB 2QR0B 5ACMA 2CPCA 3S5LB 3RI5F 3FFCB 2FWOB 4PJXE 5AAWA 4OIAA 5CSZB 1OAYH 1E27B 1INDL 1E4WH 4NJAH 1GC1L 2Q7YB 4D2NA 1R3IH 2UZYB 4Y2DD 4L8CB 1UWGH 4ODUB 1P2CA 1YEEL 1I4FA 2VDML 5IM7A 4NQVB 3QT2A 1JPST 1BFVH 4JKPL 3WE6B 5FKPB 2YC1A 5JOFB 1JF1B 1ZLVK 5ECJE 5D9SB 4MD0A 4RA3A 1HZHH 3KYAA 5DJ8A 1MCWM 3QUZA 5D5ME 2ORBH 1F11A 1QRNE 1AKJA 3VRIB 1EHNA 3DLQR 3WD5H 3VGEA 3VRJB 1CFNB 5E7FA 4JGJA 3VGDA 4DTGL 4M7LH 5KVFL 2IPTH 1W8NA 2I07A 1YEKH 4OFYA 4YUEL 5L0QB 4JPVH 2Z31B 3O3BA 3RKDD 2Z9TA 4ZTPH 1HOCB 5HHOD 4NN6B 1WJ3A 4PP1C 4FQJL 1S7VA 4LLYA 4Z7NF 5FK9B 3ZLQC 1R6VA 2J4WL 4YDJB 4U6HB 1ZE3C 2OJEB 4Z6AT 3GIVA 2X89A 3BHBA 3W9EB 3N50A 1EFXB 5HHPB 3RA7H 4EI5D 1MVUA 4DKDC 3S97C 1MPAL 4X6EA 2XIDA 2EH8H 1YEHH 4TRPH 1A5FL 1AFVL 7FABL 1ULVA 4NYLB 1Y6NR 2DQHL 4KK8D 3JZ7A 2EDXA 1U9KA 1TZHA 1IC5L 4JRXA 2QQLL 4ISVA 5BS0B 4O4YH 3G6DH 3HE6B 3MSPA 1T66D 4U1GB 3ARSA 3MV8A 3RVUC 2ZSVA 1KV3A 3IGAA 4L1HA 4Y4KA 1QR4A 4JZOB 1UWEL 4ZTOL 2YD9A 4FFVC 5J89A 3UTOA 4XP9L 1M05A 4XCEA 3VGBA 1P7KB 4OZGF 4YZFF 5SWZB 3SKMB 4HGKC 2QJDA 2QLVB 4BFIA 1JNHB 4FXGB 4JE4B 4GBXA 5IHZA 3CXHK 4YHML 1I7ZA 2IPKB 1EUTA 3BKCL 1N7MH 3VU2A 5IQ7L 3NCEB 2H3NB 4FQHA 1MCQA 2ZJSL 1P9MA 4KDTA 2H1PH 1S7XA 4G6AD 4ODVH 1UCBL 3PWNA 3UYOD 1V8HA 3DV6B 4OAWB 2VQ1A 4AT6B 5MP6H 3CFEA 4ZFOB 3DVNA 3ZHDA 5CJOL 1BJMA 3NMEA 1MLCA 2EC9U 4M5ZH 4Z18A 1TNNA 5HGGS 1GRWA 2VL5A 3FFCD 1BJ1H 3TN0A 3TGXA 1MFDH 4BQBA 2GKIA 3MMEA 4YBLB 4LSUL 1I1AC 2A6DA 4X8XA 1QVOB 1RZKC 1C1EL 3Q1SH 3RGVA 1NAML 3CFJB 5AZ2H 4K3JL 3MUGA 5I74C 2Q8BH 1Q9KB 1F90L 3IFPA 4WW2A 2I60H 3H9SE 4PJAE 3FRUB 1WIPA 1K4CB 1AGFA 3FB5B 5I19L 1P5UA 2CUMA 3WL9B 4J3UA 5C0AB 3QQNA 4EIGB 1VFUA 1ZT7A 3STLA 4MCZA 2AVGA 4OB5L 2H6PA 1DJSA 3T65B 1EEZB 1CFBA 4JO4L 2Y72A 1X4ZA 3LVEA 4JKWA 1KN2H 3FO0H 4RA0C 3OKEA 3RWJA 4QRRB 1CICB 3P30H 3RAJL 1EK3A 2Z31D 3EO1A 5KN5A 3EFDL 3BEWA 2Q76B 3X3FL 2W9EL 1WK0A 1DN0B 1DFBH 3IDYC 3KPMB 4FS0A 3SDXB 4S1DC 5GGRY 4JR9L 3RZCB 3VW3L 1GAFL 1D3CA 1EFXD 1N8ZA 4UTAL 3OB0K 5EBMB 4O2FA 1MI5E 1Y18B 3ARZA 3UTPD 1J0JA 2J8UE 4NO0B 3WKML 2V9QA 4BJLA 1FVCB 3FFDA 4M6OH 2Q6WA 5F7MC 4QRPA 1UYWL 4F3FA 2I9LA 1VPOL 4LLDA 5A1AA 4MWFB 4XX1E 4IOFD 4Y4HC 1G6VK 4KMQA 1V7NH 5CEZE 3RWEB 1OTUC 3G04A 3QNZA 1ZV5A 3SJVE 5BS0D 3WFZA 3CUPB 3HE6D 2CLRA 1RZJH 3L9RB 4PS4H 1M7IA 2B2XL 2ARJA 1MOEA 3QIBC 1P84J 3LRGA 5SWZD 1MLBB 4C54A 4X6CF 4UZGA 4OCMC 3S98A 1EHXA 2XOTA 1DBKH 3HUJE 2XXCB 2R4RH 1A14H 3O4LA 3DTXB 3NABL 3VG9B 5JQ6L 1QSEB 4YDIH 3QXAA 3NH7L 5BZWA 1MWAB 3CSPA 4P3DB 1G1YA 1YZZA 5CJ8A 5JHDE 3MNVA 4AM0A 3MGAA 4FZEL 3RTQC 3VGAB 4IJ3C 5DVOA 5E2WH 5ETUA 2MJWA 5IVXE 1OP9A 3IDJB 4DQOH 2NXYC 4K23L 3Q6FB 3X3GH 3UPRB 4DW2H 2CDGB 4WJ5A 2A2QT 8CGTA 4R4FH 4X4XB 2CXKA 5I9QC 1UFUA 1KC5H 4MJIE 4MNQE 5GGTH 5K93A 5GRUH 2Q7NA 5BVJA 1A7RH 1EHLL 5J3HD 5ACZA 4PUBH 3VXTB 4K9EH 1JPFB 2X40A 1FP5A 4YX2L 1JL8A 3O11B 3OGCB 1AGDB 3EOBA 3TBSA 5TE4L 3MLXH 4JVWA 4BKLA 1ZLUK 5I1LB 3D85A 4QHLB 3N1MC 1NBZB 4MXQD 3O6FC 3D3VA 4X4ZA 3AXLB 4ZS7H 3H0TB 5C0AD 4X4YB 3E2HB 1ES0B 4UQ2A 2FBJH 1BFOB 3B9VA 3M8OH 1UQSA 1TETH 1T1XB 3WMSA 5DJAB 1M4KA 4JY4B 5ID1A 1ZLVH 5CILL 1CICD 1EZVY 3FB6A 1NGXA 4P5TB 3V7AE 2E7BA 3P9MA 2UV3A 2VR4A 3RX5A 1CIUA 4ALAH 4OZIE 1YA5A 2MPAH 1XGYL 1NC4A 3LEXB 3RZCD 1UVQB 2B8OT 4MB3A 4NO0D 1RZKL 4I3SH 2W0FB 1CFSB 1M7XA 2APXA 3L1OL 1T21B 3V4UH 4XAKD 1FSKC 4QYOB 3WHE0 5I8OH 3GMPB 4D0CB 3UTTE 5T3XE 5KSAC 4GKSA 1JGVH 4EUPB 4OFIA 3U4EB 1DUZA 4I2XE 3RHWK 3HNTH 5F7FA 3EO9H 2QQNL 4X7TA 2BY1A 1XF2A 3UJIH 1R24B 5CP7B 3OKKB 5E56A 5HBBA 4KI1A 3OKOA 3QWRA 1MHCA 3DXAE 5JLZB 4KGLA 3MGTB 3PWUB 1N4XL 2QTEA 1IGTA 1QSED 1AXTH 3ILPB 5K9QG 3KAAA 5GISH 1IGML 4QCIA 2X4RB 5E6ZA 1T5XA 3GMRA 1FGNL 3TNMA 2X4UA 4HUVA 4NQCB 1AHWB 4JFDD 4K3DH 4KTYA 1F2QA 4ODTL 5IW6A 1G9NH 1U8JA 1XGQB 2AV7B 2H26A 5JW4Q 1Q9LA 2Q87A 3RVWC 3RPKA 4F33B 4PV9A 3H42L 4W70A 1J1XH 4LNRB 3VXSE 2V5SA 1NUGA 3HRZA 4GAGH 2G9HB 5GRXG 3PQYE 1XF3B 4YHIA 1OPGL 4UTBL 3O9WD 1XF4B 1XGUB 1Q0YH 3INUL 1MJ8H 1D5ZA 1R3LA 5I8EA 1FCCA 3DX7B 1W0VA 3FN0L 4JY5H 4KK6D 4LPCA 2JJUA 4I9WD 5JUEH 3EYFA 2R2BB 4JJHA 3W5NA 4I0KA 4Z8FL 4NGHH 1QSVA 3RWCB 4XP1H 1OAKL 4JVUA 4KV5F 3RQ3A 1QP1A 5JQHC 2DBLH 1QFUH 2EKSB 3QA3B 1JTOA 5I16A 3R06A 5C07E 2NYYD 1UCTA 1N6VA 2C1PA 2BNRA 4JO3L 4P5TD 1WIUA 1B2WL 1MFCH 3P77A 4KK9D 4JFPA 3SDCA 2BHZA 2PO6C 2YBRB 5HSFA 1UG9A 1R3KA 3P40A 3EAKA 4WUKL 4FRWA 1ZT1A 3FOLB 4RQQB 4LFHD 5L6YH 3QIBA 1S7UA 1PG7X 1MEXL 4DFIA 2MCG1 4YLQT 2MHAB 3PGFH 5B8CA 1CE1L 4M48L 4H0GA 3WN5A 3ZDZE 1J0IA 2EDBA 4HJGB 4LCUA 2ZPKL 4J8RB 5KJRH 2WAHA 5GGUB 1JVKA 3VXNB 3OB0H 4EI6A 5TQ2H 4JRYB 5B3NA 3DETD 2X4NA 4AMKH 2IMMA 3CD4A 4NQSA 1GGTA 1IAIH 1IGFL 3RUGF 3TPUB 4KY1H 4NIKB 4GW1B 1YEFH 5HHQA 1A64A 4XBPB 2ZUWA 4ZUVB 5EU3B 3D0VB 2D03L 4XBEL 3I6LE 1PY4A 3RY6C 3QUKA 1QBMH 4PJCF 4ZOCA 5IGXL 25C8L 4MQ7B 4H25B 3C09C 1HDMA 4HH8A 4JFEB 3IDGB 4LARL 2WBJC 4H5SA 5KBNC 4MQTB 2GK0A 3JV6A 4U33A 2NY4C 1CL7L 1B0GB 3PHSA 5EPMB 2YUWA 1FC2D 5J57B 4WGVB 4NQCD 4LSQL 3FRPA 4DAGH 1BVKA 5GGVL 1S9WA 2JJTC 4JFHE 3VFOB 2KPNA 5T3ZL 5K59E 5J56B 2R8SL 1E6OH 1RIUH 3KYOB 5T5FH 2CDFB 4JN1H 5BXFB 1RIHL 2QHLA 5IMLB 3KXFD 3ZHKA 1C7SA 4Y5VC 5DJZB 1VESA 2AJZA 4R97C 4KRPB 1FE8H 5D70L 5E1HB 1U92A 4YHZH 4F15C 1P4LB 4ZUWA 4URTB 5I1KH 4TPRL 1CQYA 2YD3A 4I0PC 5IEHA 3FB7B 4R2GB 4I77H 3T08A 4LCYB 3TZVC 4Q2ZB 1T22A 1LK3L 1DE4B 4QHNA 1NCTA 1JK8A 3P2TA 4P59H 5C0RH 3JUZA 4UOW1 3P9LA 4WFEE 5E7BA 1IFHH 2KQMA 5HPMB 4JCLA 3NIGF 3W9DA 3S6CA 1CI5A 1B0RB 4UT7H 4C56A 2P43B 3LN4B 4IJ3B 4DJMA 3KLHD 1EFQA 5FECA 4HV8A 2NXYB 3G6AA 4LLMB 4BA8A 2GAZB 4J6RH 5D7KE 5FV1L 1AO7B 3AFLA 4LQFL 3CCHB 1P4BL 3BAEL 2HWZL 2YA0A 4KTDH 4PJ7B 3SEPA 2NW2B 4GXVH 5HJ3A 4QNPF 4Z0XB 3MNZA 4GAYB 1G7PA 3S35L 2DKSA 3NFNA 4HQQH 5AYQA 2F53E 3NZ8B 2APVA 1MHHA 3RWHB 4FXKB 2DM3A 3OGOE 1Y6KR 1ETZA 1GSMA 3V2AR 4ZPVA 5MEPB 5M7QA 4U0QB 2A74B 4HKBA 4ODWA 2VL4A 3HS0A 4HIXH 4OUUA 1FGVH 4GRLB 4JZNA 4KJYA 2WLZA 5D7IF 1CZ8L 3BKYL 1Q94B 5D1ZB 3WCYA 4I48B 3L3HA 3QUYA 2L7UA 4XNYL 2DF3A 3D39D 3QRGH 5AWNL 2BK8A 1WWCA 1DTUA 5F7NC 4JFED 2X42A 3V52H 1CGYA 5AYUH 1LDSA 3HPJA 3F58L 4WY7L 3K7UA 3WHXA 1VA9A 4RFEA 1PZUB 4HZLA 5IW1A 1CDHA 2F74B 1GZQB 2Z8WC 2Z91A 4N0YL 4C58B 5C0FA 2XNAB 3MRQB 5CWSA 1FSKB 1GHFL 2D7MA 5H8DA 4CMHC 1HCFX 3DURA 3JV4A 1JN6A 4G3YL 4HKJB 1OT1A 3IU4H 4KRPD 1LP9A 2WANA 5C08A 4PJIB 1CLOH 1KELH 1S7WB 4OGYL 4U4BA 3DGGB 1ONQB 4WHCA 3DRTB 12E8H 4I8DA 4X6FB 4R2GD 5ALCH 2WUCL 4NBZB 1UH2A 4LKXB 1SBSH 3KPNA 3MRIA 5E2TH 5E9DE 1LO5B 2XG5A 1MIEH 1NCWH 4Z76B 2OJZL 3G9VA 2FJGA 3LD8B 3T77A 1HCVA 3BSZH 4G8EA 2OYPA 4W6XB 3RKDC 1OCWH 3C6LC 1S3KL 5FOJA 4LMQE 4XNUH 4S0SD 4CL7A 3MRGB 5E5MB 2BERA 2BC4A 4L3EA 4UIKH 5D7SL 1AO7D 5C0IA 4G8GA 5J11C 4XTRC 1LO4L 3AUVA 1C08A 4UUJB 4WHYH 3G08A 1NLBH 2AEWA 5GRJL 5J9PB 4FQLH 3GIZL 5DF0A 1JNLH 1OWRM 2C7UA 4Y19E 5FYJE 1J88A 3PHQB 3BJ91 2A73A 1QBBA 1QEWA 4L8SC 5GIRB 3U9UA 3MOAL 4ODBD 3ARBA 5FYKE 5KS9A 3W0WB 1DSFH 1J18A 2P48B 2IMNA 2QSCH 5LVEA 3BE1L 2W0LA 4JEGB 3J8F7 3EKCA 2FX9L 4PTTB 5AUMA 5E08H 4RSVA 4OLUH 5GJSH 1JV5B 4GRLD 4POZC 5JW3L 1A4KB 3SGJC 2VKWA 4GG6B 4MQXC 4M1GL 4F7EA 2CLVB 1U8PA 4G5ZL 3WV0A 5DJ0A 3UAJD 1BLNB 2UWEF 1MF2L 3OR7A 1BD2B 1U8IA 2YZ8A 3EGSA 4HZAA 1JPTL 2AJ3B 2A6IA 3LQAH 4PJEE 1A0QL 5JPNA 3D69A 4FG6D 4WFFE 4U1LA 3T0DA 1INEL 5FHBL 4KVNH 3JTTB 1Z0NA 4FABH 1KNOB 2ZUVA 3VGGA 4L4TA 1LE5A 1CD9B 1IKNC 2GJ6E 1F3RB 1QYGH 3O0RL 3OJ2C 5MHSD 2EYTB 4ZFFA 4P2OB 3RL1A 2VH5H 1AD0A 5JORB 4Y7MA 3DSFL 1YY9D 3PDDA 2HRPL 1LE9A 2ZCKL 4MAYC 5IR1A 3C2AL 5HYSG 4XPFH 3F65A 4PRNA 1I1FB 3L5HA 4EOWL 4HXAH 1TPXB 5GRVK 3VFWB 4NM4L 2ATPB 1WBXA 1U93B 2NY1D 3MBEC 3P11H 4MZ3A 1I1YB 1T4KB 5J12B 4PJBE 4LCCC 5ICYA 5CCKH 2XN9E 3EJYC 4KXZH 1J0ZA 3H9HA 1JPGA 3QXDA 1OAXL 4HKXB 3KPQB 1KIPB 2FNBA 2J88H 3QI9C 1DDHA 3SDYH 1HHGA 2R1XA 1NFDA 3GMMB 2VDRL 3LKRB 1LO0L 4FQCL 1K85A 5DURD 4NCDA 3Q5OA 4X9GA 4CJ1A 1IJ9A 2E6PA 5KANG 2F5AH 5EU6E 4GRWH 1OGTA 1ZT4B 2ZKHH 2KZWA 3S88L 4L9LC 5BMFH 4DN3L 3LKSA 5KVDH 2VDOL 1BAFL 2LQRA 5F3BA 5LGJA 1QRNB 2ZUYA 3QQ4A 1NMBL 3AVEA 3FT4B 4R97B 5INDA 4Z0BL 4F15B 3BN9D 1QSFE 1MCBA 4M7JL 4PR5B 4NM8H 2PXYA 3W0WD 2MQ0A 2V2WA 4D9LL 1IM3B 4N0FA 4PRAA 1KTRL 3QEHA 4LLQA 3ZKNC 1CDIA 4XPGH 3VFTB 3CVIH 3MRCB 2IH1B 3L5XL 3MJ7A 4QRSB 5DUPL 1FZKA 2ID5A 1FYTA 3KG5A 1GZPA 3L6FA 3T4YB 3LHPH 4HC1A 2ZOKA 1SHMA 3MRNB 4ORGB 5DD6A 1CFVH 3IDXL 3P0YL 3QH3A 1BD2D 5B39B 1VGEL 3GM8A 4ORZC 1U3JA 4Y2DA 4LBEB 4MAUL 3CU1A 3I75B 2EDJA 3QP3A 3Q5YA 5TDPB 3FAWA 5H2BA 4GMSL 4UQ3A 4U7MA 5DK0B 1WC7A 2DM7A 1F97A 2VXTL 4CNIA 2H9GB 2VZ3A 1SY6A 3JWOC 3CDFA 2NPLX 1EUUA 1B0WA 1KPVB 3ZTNL 5E8NB 4D8PB 4GW5A 5IMMB 3UZQA 3W11C 5I1JL 3CVHA 1KIQA 5DD3L 1JF6A 2B0SH 2C3GA 2DQJL 4JG0H 4P2OD 2CRYA 3ARRA 2DIAA 5CKGA 1LEIB 3KJ6H 1WGOA 4TVSa 5IMOA 4UOJA 2UY7A 4Z7QF 4DVRH 1J10A 3QZWG 3DGCR 2F54E 3O2WL 4HIEB 1RUML 4BSVB 4F8TA 1T83C 5HHOA 3VWKB 4R6UA 3KNBB 4CVXA 1CLCA 2ZUUA 4ZD3L 4HKZB 4EI5A 5MENE 4NKDB 1NAKH 3O3DB 2JELL 5EU4A 2JCCA 1U91B 4BQ9A 5FYLE 1EO7A 3M07A 4HWEH 4FQIL 5SX5H 1IAOB 5JW4M 4NZDA 1YYMH 2H2PD 1CU4L 1UXWB 5GGSA 1CK0H 5CD3B 5GS1B 3OXRA 3DIFA 4JO1H 2HAZA 1RK0B 1F3DH 2Q8AL 1NGYA 1BZ7B 1UB5B 2IADA 2MSPA 5CEXB 2P42B 4MD5A 4XCCH 3L3OB 4PJAB 4HGWB 4BM7A 5C0JB 2LV4A 3IS1X 3BEVB 1AP2B 3TYGL 3ROLB 4G43B 4JY6B 4Z7NE 1GL4B 3CLEH 2YN5A 2N7BA 4O9HL 1WAAF 3BISA 4BZ1H 3SDAC 1LD9B 4PGEB 3VWJC 4OGXH 3C8DA 4NOFA 4DN4H 2CK0H 4OFKA 4OV6F 1Z5LA 3ZE1F 3OAUH 3PDOB 5HGAB 1SY6H 15C8L 4GAJH 2OXHA 1WBZB 3MV7D 4XAWL 5F9OL 4M3KB 2PYEE 3CVHH 4B7LA 4MMXC 1X5AA 2WP3T 1A6VL 1WIOA 4PJGF 1YEGL 4XPBL 4B41A 4MB4A 2K1MA 5C8JA 3LKQA 4HWZB 2DBJA 1AGBB 4MJ2A 1JBJA 2CGRL 4FQXC 1DEEB 1SJHA 2QR0A 4OZGE 3S5LA 3FFCA 2FWOA 4Q6IC 2J8UB 1VEPA 4P48A 5CSZA 1E27A 3U9PL 2CKBL 2Q7YA 4Q0XL 2D7TH 1JWUB 1I8MB 1H5BB 5T3XL 5F9WB 4IRZL 4ELMF 4L8CA 1RK1B 2X1XR 4ODUA 1QPPA 3TJHC 3SJVB 1XFPA 5DMKB 1A7BA 2R29L 2VLRD 4NQVA 3WE6A 3GJEB 3IXAB 1EO5A 1HEZB 1OARH 1C5DB 5JOFA 5D9SA 1A9BB 1L6XA 4CJ0A 3NPZB 5ENWB 1W0YT 1TFHA 3HUJB 3VRIA 4HFUL 3MREB 3VRJA 1UKQA 3TBYB 4OTXH 2FJFB 1CFNA 1D5IL 3P0GB 2EYSB 1QUNA 4NFDA 4HBCL 4OFVA 2Z31A 1UJTA 4WGWB 4P5MB 1HOCA 4MNGE 5FDWB 3MLYH 1FBIL 2C3WA 3VWKD 2AXFB 5FK9A 4HGMA 4PREB 2OJEA 4E9LA 4M6NH 1EFXA 5HHPA 3K80A 4N0UE 1I3UA 4X7SL 3RIAK 4M8VA 4MNQB 5CUSL 5E6YA 1FZOB 4NYLA 1F6LL 5D2LA 3I84A 4HXBL 1QG3A 4QRTB 3V8OA 4KK9C 1WV7T 1I3VA 1OP5K 1JP5A 1KXVC 3ULVL 1T7YA 5BS0A 1FO0L 5GS3A 3HE6A 2X6MA 2BFVH 1N2RB 4JZOA 3EYOB 3JWOL 3U6RB 4F9LA 5GHWH 1H3UA 3SDDC 1DUYB 1P7KA 5SWZA 1J11A 2VDPL 3SKMA 1HK6A 2R15A 1JNHA 1A1MA 2A6JB 4FXGA 3LB6D 4ACPA 1FNFA 5IFAL 3GBML 3QQ3B 2Z8RA 5ESVB 4N1CA 1OAQH 2IPKA 3N9GH 4MNHB 2H3NA 2BZDA 4YHOL 3TO4D 1W72B 5GPRA 4G80B 3X13B 3AB0B 2L7JA 4LCCB 4OAWA 3EBAA 5DJYB 4AT6A 3VI4F 4JFFE 4OZIB 2AP2A 1MFEL 5IHUH 2A1WL 2BVOB 2OSLB 4KK5C 2DD8L 2APTA 4U6YB 5TH2B 3A67L 2GIYA 3JXAA 2D31A 2JLLA 3QUXD 3U36B 1A3LH 4KVCH 2A77H 4X6CE 1KEGH 3MCG1 1N5AB 4YE4H 5EUOE 3S9DB 1CXIA 1TZGL 1KFAH 2CKBB 1QVOA 1OTSC 1Y6MR 1HINL 5JOEA 4JFZH 1T03L 1XR8B 3CFJA 4PGBB 5L2KE 3Q3GB 1Q9KA 4G6JH 4U7KA 5SWSE 3QXWA 2C4XA 4QTIH 4L9LB 3LEYL 3FRUA 4WRLA 1K4CA 5ADOL 4PRHE 3SPVB 2I27N 4LMQI 3FB5A 3QHFH 5I75B 5D93B 3GI9L 3WL9A 1PFCA 5C0AA 1MCIA 3S4SA 2VISB 1RULH 3QNYB 3TA3C 4R8WL 1RVFL 3DXAB 3HE7D 2F5BH 3E1F1 4PTUA 4MYWB 3T65A 1EEZA 2R0ZH 3CH8A 4OZFG 4Z95H 3QIUC 2P1YA 4R4NC 2HKHH 3VDBA 3BPLB 2E7LC 3GHBL 1KXQE 1FFNB 1F4WH 2DI7A 1CICA 3O6LH 4TVPD 4MCYB 5DXWA 4ZAKB 4FTVD 4G6FB 2Q76A 4YNYB 4NRXA 1DN0A 4ONGL 4CDGC 2VOTA 5A2JH 2DQDH 4ZDHA 3SDXA 3RZCA 1ADQH 4YHYB 3IAPA 4YDLC 3ZMRA 5DC9B 3UTQB 4HSQA 1Y18A 4NO0A 3SE8L 1FVCA 4G9FB 1XF1A 3FQNA 4C83B 3BKJH 3JTSB 2RFXB 2E6QA 3MLUL 4XXDA 1L0YA 3ARDB 3C9NB 4MWFA 5JNYB 3C5SA 3RWEA 4BQCA 1MFBH 3KWWB 2KBGA 4L3CB 3CUPA 2R2EB 1KBGL 2AABL 3E8UH 1W8OA 2WINB 3RBSA 3L9RA 1II4E 4Y16B 4X9BA 4PYHA 5ERWB 3MJ8B 1MJJB 1MLBA 1INDH 1GC1H 5I6XC 2GITB 1CDUA 2C26A 3QPXL 4NO3A 1YEEH 1CF8L 1K9TA 1N59B 2YRLA 3DTXA 1TTUA 5FDYA 1QSEA 4KUZL 4D9RE 4JKPH 1DQQB 4GRMA 4WCYL 2HMID 1MWAA 4WWKC 4P3DA 3H9YA 2P5EE 5DUML 4GMTL 1IGJB 5IBLC 4LL9A 2AEQL 2X4SB 1D5MB 2V7HB 3IDJA 3Q6FA 4JFDA 4WI7A 2CDGA 2VLJE 2EXWC 2HVKA 4S0TD 3SN6N 3ZKXC 4DTGH 3OX8B 5KVFH 4X4XA 4XB8A 4NHCL 5DK2B 4YUEH 5IB1B 3MFFA 4LSVL 4MHHG 5ESAA 5IJKC 4DGIL 1EMTH 3VXTA 3KVQA 2O5ZL 1FNSL 1H15B 1BM3L 2J4WH 4M1CD 3O11A 1TVBA 3O9WA 3SOBH 5DRZB 1N5YL 1MPAH 5IOPB 3BRGC 4KJWC 5I1LA 3DUHA 4QHLA 2MQCA 4Z7UB 1A5FH 3C87A 7FABH 2IH3A 1JYNA 2DQHH 5D7JC 1JFQL 4X4YA 4CVZB 5KSBF 1ES0A 1KB9K 4QF1B 4U1MB 5GZNC 1MFNA 1R0AH 4KZEL 1T1XA 1QKZL 5I71C 4ZTOH 5DJAA 5GS0C 4JY4A 2C3HA 3QWOB 4XP9H 3BUYB 3P4LA 2Y23A 1YPZB 4P5TA 4P2RB 4ZAKD 3H3BC 5DQJB 1CGTA 4G6FD 3HC3L 1ITCA 1X3DA 4NCC1 4PLJD 1ZHLB 4YHMH 4KI5E 3BKCH 3U2SA 2CMRL 4JFOB 3LEXA 1AI1L 3GBNL 5KVMC 4DVBA 2DLTA 5IQ7H 1MCHA 1UVQA 2EH7L 1TDQA 3UTSB 4KKCD 1PDKA 2W0FA 4G9FD 1QBAA 1T21A 1UCBH 3ARDD 1A02N 5JXED 2P8LB 4EUPA 3ULVD 3MLWH 3U4EA 1OF2B 5CJOH 3GSXA 3MLVH 5DD1L 2AW2A 3QDME 3O2VH 4Y16D 1U8NB 1CLZL 1R24A 5CP7A 1CGVA 3WJLC 4LSUH 3OKKA 1SBBA 3RRQA 2N1KA 3DO3A 2NY5L 1UEYA 4K3JH 3UYPA 3EZJB 5F7WC 4WTWA 3D18B 1F90H 3MGTA 5HYEA 2AV1A 2JK5B 3PWUA 1YMHA 3ILPA 1OTTD 2X4RA 1TJIH 3MFGB 4XP6L 2XYCA 3X12B 3VFVA 3HG1B 4OB5H 4NQCA 1EXUB 1AHWA 1R5VB 1T5WB 1NPUA 3ABZA 3FZUD 3TBWB 1CLYL 4JO4H 3B9AA 4ODHL 1UZ8B 1X5JA 1T7ZA 1XGQA 4JQVA 2AV7A 4PIRF 3RUGE 5BOZG 3RAJH 4R26L 5I1IL 3WNMA 1AD9B 3EFDH 3QEGL 3KXFA 4TTDC 3X3FH 4LNRA 3BD3A 2W9EH 2F53B 5FYKL 4O2CB 5DVLA 3GSUB 2G9HA 5FGCB 3I50L 4P3WA 4R96B 1XF3A 4JR9H 1JUFB 1TJHL 1XF4A 4OCWL 1GAFH 1XGUA 3WKMH 3PP4L 2R0WL 3DX7A 4NZRL 1UYWH 4YGVA 1DEDA 1VPOH 2HN7B 3T3MF 2OTUB 2VITB 2R2BA 3VFRB 2LE9A 4Z7WE 4EUPH 3FJTA 3ARFD 5SX4H 3O4OB 2QBWA 3RWCA 2Y06L 4PB0L 5DDHB 5MERB 4X9FA 4LOUC 2EKSA 2B2XH 3QA3A 4JANA 4O58L 2E27L 5DLML 4P2RD 4Q9QL 3M17B 4IRJB 2WBWB 3G5XB 5EORH 2HG5B 2YA2A 4N90D 3RDTC 1I8LA 2YBRA 4ODXB 3DX8B 3NABH 5JA8B 3FOLA 1KCRL 4RQQA 1FFRA 3UTSD 5F3HB 1AGCB 3IDUA 4O02L 2MHAA 2NXZD 1CBVL 3EJJX 4FZEH 5HDBF 4P99A 3QJFB 3ME0A 3NIGE 3SE4A 4HJGA 4PGDB 2VR5A 2EDEA 2YN3A 3GJFK 3VXNA 1F5WA 3F7YB 1ZA6A 1FFOA 5AZEL 1INQA 3QEUB 1EHLH 2C3VB 3AS3A 5I15L 5F9JB 1N6QL 4WNQA 1H3WM 3TPUA 4ZQKB 1CWVA 4GW1A 4S1SL 3QIUB 4XBPA 5I1GL 4YX2H 5EU3A 1TTGA 4D0DB 4L5FL 4XMKH 3D39A 4KU1A 3CX2A 4MQ7A 4H25A 1NANI 1Q8MA 3G6JF 1MCNA 4JFEA 1XIWC 3IDGA 1SYSB 5BRZE 5DR5H 2O5XL 3UC0L 1B0GA 5EPMA 4UV4L 2B5IB 3HG1D 1MCRA 5KVGL 4LGPB 4ZYKB 1EAJA 3GSVB 4AY0A 3VFOA 3FTGB 3MXWH 5CILH 3MV9D 3CSBA 2CDFA 5BXFA 5IMLA 3T1WA 3FRPG 2UUDK 1Q38A 4E42B 3KYKL 5BW7A 5FUOL 2F53D 5DJZA 1BQUA 4X5WB 2YD1A 1XGYH 5EO9B 4RZCB 4NC0B 4LEOB 5I6XB 1RZKH 3FB7A 3PL6B 5IBTH 1G6RL 5EC1A 3L1OH 4LCYA 5FM4A 2FX8L 1B4JL 5DTFB 3BZFB 1NBYB 1DBJL 1QBLL 2W9DL 2YEZB 3R0NA 1VADB 2FRGP 4LAJH 4Z7VF 3K2UL 3RVTD 1T0PB 2Z92B 4YH6A 4M93B 4YXLL 1TQCB 4PYGA 5T1KB 5B22A 1B0RA 2QQNH 2M2DA 3BPOC 4XHJC 5EIIB 4TOYL 3UTZB 4WUUD 2XKNB 3ZYOA 1A21A 4LLMA 5BV7C 2G60L 4IRJD 2XZAL 2GAZA 4FFWD 3IXTB 4GAFB 3LKOB 1AO7A 2XG4A 3ULUE 1JZ4A 2FX7L 3HC0B 4XVJH 4PJ7A 5EULV 5M95B 2N7AA 1N4XH 1YUHB 2RJMA 5B21A 3WDJA 2AJVH 5GZOC 3P0VL 4ZXBC 1IGMH 2NW2A 1EHAA 4ZUUB 4Z0XA 4ZO8A 3DVGB 5JR1H 5EOTA 1JI2A 1FGNH 3EOYG 3RWHA 2DIJA 1C8PA 2EIEA 4X6DF 3NBNA 3DMMC 4ODTH 4OCSL 2HLAB 2WM0A 2NTSP 5F7LB 4WVRA 2VXUH 4PLKD 1I7UB 5JIHA 1DVFC 4LDLB 4KRNA 3TVMC 4GRLA 3PV6B 2ED7A 4PJBB 2XN9B 2ZUTA 4F57L 1Q94A 3PGCB 4HPOH 4I48A 4FFZL 3NIFE 5D1ZA 1OPGH 4UTBH 1WITA 5E6IB 3KYNB 5FYLL 1ODAA 3INUH 3FB8B 3NIDE 3F6LA 5IESL 1QFPA 4YBQC 1DLFL 5HI3D 2BMKB 3U7WL 3TC9A 1BPVA 2EE9A 4K8RD 1NEUA 4Z8FH 3IFNL 4RFOL 3MBXL 4P4KD 3U83A 1BOGA 3RX8A 3OMZA 1F42A 1OAKH 4MVBC 1Z2KA 4LIQE 2F74A 4F9PC 2DLEA 3MRQA 3QDGE 4JHAH 2B1HL 4WTZA 1T89C 3U30B 4JO3H 1YN7B 5T1MA 1QQDB 4LVOC 3QAZC 1RHHB 3BVNB 4POUB 3ZDYE 1QSFB 4H1LB 2R23B 3GJFA 4DK6A 4WUKH 4NNYA 3HZMB 4U0RB 5IG7B 3RP1A 3DRTA 3PL6D 1MEXH 4PG2C 4DK3A 1U6AL 2Z93B 1G6RB 4DWHA 1CE1H 4M48H 1CR9H 4HCRL 2W07A 4HAFA 5INCB 5IBUG 3HMWL 1LO5A 2C4FT 3MGOB 2ZPKH 1F6AB 4OT1L 2WNGA 1F4YH 4GSDL 3BPNC 3QG6A 1H3VA 1OGAD 3FQXA 3WFDL 5T1KD 4R3SB 1TCRB 4EN3B 4HT1H 5D7LB 4PJIF 5ESQB 5EG6C 2AXGB 1IGFH 4OZHE 1A6PA 4E41D 3DUUA 2X1WL 5E5MA 3L3JB 1EJOL 2BXYA 2XQBL 5J06A 2D03H 4XBEH 2P46B 5E8OB 5I8KL 5LQBH 5I18L 3IETB 4UUJA 4XVUC 5IGXH 25C8H 5J9PA 4N5EC 3WUWB 1Q9OB 4LARH 3PHQA 5CKAA 2FBOJ 3P4OB 4Y5XB 1PGRB 3LQMA 1C12A 1EIBA 1HN1A 5F1NB 1CL7H 3B8SA 5GIRA 1JF5A 3MA7B 1GGCL 3W0WA 3VFSA 4GKNA 4LNVA 3OWEA 4ZNEA 2V5MA 5AAMA 2B4CL 1H3PH 5C70A 1S7TB 3MRPB 3ZT5A 2YXMA 2R8SH 3B2UC 2PTTB 4PTTA 1K2DB 1EERB 2P8MB 5B38B 1JV5A 1RIHH 5DI8B 5HD8D 2H2SC 2ESVE 3K74B 4JM2D 5HHVL 1A4KA 4GG6A 4PRPE 1C5BL 2CLVA 5MENB 3WS3B 1QZ1A 5LAXB 5E6ID 2GTWB 1PLGL 3HNVL 4U6VH 3LCYA 5F1SA 1BD2A 1VACB 5BV7L 2YPLB 2LTQB 1JZ3A 3X11B 1T04B 2AJ3A 2EDDA 3GSQA 1LK3H 4GS7B 4Q74A 1NCAL 3ET9F 4WEUD 1JIBA 1YQ2A 5JW4N 2KH2B 3JTTA 5E1AA 1QFWM 1KNOA 5GGSY 1OM3H 2FGZA 3UBXB 2QADC 5HYJE 4OLZL 1BF2A 2HFTA 3TESA 3O2DL 2EYTA 4P2OA 1NH6A 5JORA 1HWHB 3JSSA 3QUMB 4HIHB 43CAB 4Y5YC 3SCMD 3HAEG 4Z77B 1P4BH 5LBSL 5GJTL 4OLVH 1MJUH 4I18C 4GXUM 4W68A 1KYOJ 4G7YL 4GLRI 4ZO7A 5E8EB 4WO4C 3ZSTA 3VFWA 1NGZB 3KPSD 1DN2A 2ATPA 1N0XL 4XC1L 3HRPA 1U93A 5CD5D 2UUDH 3S35H 1I1YA 2PTVA 4JQXC 1T4KA 3SKOB 3UJTL 3GNML 4QRUB 1YQVL 5CZXC 3VFMB 4EQ3A 1ZHBB 4OZGB 4KI5C 4HKXA 1KIPA 3KPQA 2YOCA 3FHQA 2V2XA 1AE6L 1GH7A 4EN3D 3PP3H 1I9IL 4G8FB 1B90A 5D7LD 3GMMA 3LKRA 4KRMB 4QXWA 4KJPC 3LKNB 3KS0J 1CZ8H 4PJHE 1CXEA 2XXMB 5F97E 1IC7L 4LEXL 4XNYH 1WFUA 1ZT4A 2VLLA 1FNLA 4NQEE 2R69L 3QNXB 5IKCB 1MCEA 1WQVT 2V17L 3L3KB 4PJXF 3GO1L 3GSNL 1QRNA 1HH6A 3FT4A 4JGUA 4WY7H 4QHMB 4PR5A 4PJ8C 1KXTB 4QRQB 1J8HE 1M1SA 2NZ9D 1KOAA 3IDNB 3TWCL 1IM3A 3MV7A 4HMCA 5AD0B 3VFTA 1GHFH 5FEBA 4MNGB 4MA1C 4QRSA 4KPHL 5H37G 4LK4A 4J4PC 4G3YH 3T4YA 3C5ZC 4P23B 3NTCH 4LHJB 5JPMB 5D5MF 3MRNA 3BPOB 4OGYH 2DL2A 2RIKA 4XCFH 5JDJA 1T7VA 3MO1B 2HJKB 5C2BL 2BNQE 2AGJL 5B39A 2YPLD 5BV7B 4U05A 1PKQE 1K5NB 5TDPA 2VLRA 2LAGB 5GS2D 4MDIB 3CXDH 2OJZH 5DK0A 2FYYB 1P7HL 4H88L 4PJGE 1LK2A 4PBVC 2NX5B 5TQ0L 3ZYZA 1KPVA 1S3KH 5E8NA 4D8PA 3ALXA 5IMMA 1IQDB 3QDHA 4PBXA 1RZIB 3RKPA 4PRDB 3DMMB 2GTZA 2IQ9L 1H0DB 4N9GB 5C09E 3MJ6A 1LO4H 4ETQB 4ZNCD 5C0BB 3HI5L 5GRJH 4KKBC 3R8BB 2R1WB 4HIEA 3GIZH 2OMBA 3L3IB 4BSVA 2NY0C 4Y0GA 3VWKA 3KNBA 1MAML 3ARXA 4HKZA 2BVPB 4YFDB 1P53A 3HZKB 3EHBD 3JVGC 2OI9B 2YMXL 1T7WA 4BFGA 4L3AA 3DYPA 3O3DA 4X6CB 2X09A 1FFQA 3GSOB 4JFXB 3BE1H 2PYFA 4XX1G 3U4BL 1IAOA 3ZE0E 2FX9H 4TUKL 3MJ9L 1UXWA 5CD3A 5GGQL 5JW3H 2E9WA 1RK0A 3VXPB 1EJ6A 4XVSL 1BZ7A 1I1CA 4LHUG 4MJ5B 1UB5A 1BECA 5CEXA 3BIKB 2HA1A 3L3OA 4HGWA 5C0JA 5IB5A 3WO4B 4AL8H 3BEVA 1AP2A 5A2KH 3ROLA 1G84A 4G43A 1FVEA 1MF2H 4JY6A 4OD2A 4YXHL 1F58L 3CH1A 4KROC 5JXEC 5I66A 1LEGB 1J05A 4OCLC 3GSNB 1HNGA 4AIZA 5SWQB 4NC1C 1A0QH 4PGEA 4XXCA 2CR6A 1INEH 3D9AL 3TO4A 5JA9A 5FHBH 5M94B 3PDOA 5HGAA 2DWEA 2CD0A 1RFDL 3EDJA 4UV7H 4PJAF 4LSPL 3O0RH 1MCOL 1LWRA 3L3GB 4HUNB 4PGCB 4ZOEA 2PN5A 5B3JF 3DSFH 4HWZA 4GQPH 1IRAY 2Y7QB 1AGBA 2HRPH 1CN4A 1HKFA 2ZCKH 4IRSB 4P23D 4X6BA 2VDKL 1DEEA 3QUXA 4DKAA 3DOSA 2O5YL 4EOWH 1KG0B 2IBZX 1C7TA 4NM4H 4U31A 5A3ID 3EYVA 1H5BA 4YC2B 3VFUB 5IVOA 1RK1A 3SE9L 3S5LG 1U8MB 3WNKA 1MRFL 2K3TA 3FZUC 5DMKA 3RNKB 4UNVA 4O51B 3MACL 1OAXH 3VXQB 1EGJL 3ILQC 3PDGA 3ZTJH 3GJEA 3IXAA 1HEZA 4XNQB 3V6OA 2IAMC 4ZOBA 5E2VH 7CGTA 2NX5D 1A9BA 2H41A 3M1BB 1P5VA 1I3GL 4UNUA 1TCMA 3TBVB 1LO0H 4XHQA 3HE7A 4FQCH 4PJ9C 1IAIM 3O6KL 2HT4C 5HHXL 3S34H 3TBYA 2QSQA 2ZUQC 3ELAT 2EYSA 3S88H 3V7AG 5C0BD 4DN3H 1UH3A 3VD7A 2VDOH 4FTVA 4P5MA 3H2WA 5FDWA 3DYOA 4KZDH 2MCPL 4FMFA 1NMBH 5CBEA 2AXFA 4L4VD 1MCSA 4APQC 3T2NL 1FFPB 4PREA 4HX1A 2VLJB 4Z0BH 5GSRB 5F1KC 3HUJF 3ULUC 4D9LH 1VCAA 1FZOA 4OLYH 3ARVA 1JGUL 2AJYH 1MH5A 3L5XH 2UZIL 5C7XL 4KJQD 2ICWB 3BX7C 3NCYS 1N2RA 3MRKB 1LO2L 2JJSC 3U6RA 3GSRB 5IVXF 4M7ZB 2QADB 1IEAB 1DUYA 1F13A 1WWAX 2R4SL 3WNLA 2IPUK 4UBDD 3P0YH 3MRJA 1GVIA 1VGEH 1YYLL 4JRXE 5IWLC 4L4JA 4MAUH 3ROOB 5ESVA 3MV8E 2H32B 1NFKA 2M8XA 4GMSH 4TSCH 4MNHA 3MODL 4WO4B 3ZT7A 1W72A 4P46B 5EO0B 1IQWH 3ZKQD 4Z78B 1S78D 2DQUH 2BJML 5D8JL 4YAQB 5GGRA 4G80A 3ZTNH 1L6ZA 3QFJB 1D6VL 4NC2B 4CADB 5I1JH 3PABB 5DJYA 3E3QE 4JZJB 1RJZB 4H0IA 4U6YA 4IRSD 5TH2A 3T0XA 2Z0BA 3AS2A 3TP4A 3U36A 5I76B 2EDYA 1N5AA 1UGNA 2G2RB 2YSSA 2ZOLB 3CU7A 5IFHL 2PW2B 2CRIA 3O2WH 3UEZA 1RUMH 2AJUL 2CKBA 1CGXA 3OJVC 1T7XA 2BRRL 1XR8A 4PGBA 2ZUXA 3V6FB 1H8SA 4HMEA 3Q3GA 1XF5B 4Q58C 2OL3L 5HGBB 1SJVA 4OZIF 2JELH 1GOFA 1QACA 2HVJB 3SPVA 4H26A 2I9TB 5ISZB 2XZCL 4XI5C 1WCBB 2PR4H 4NWUH 4JPIB 2VISA 2AJSL 1CU4H 3AREC 3QNYA 5DJ2B 1J1OL 3BGMB 3LS5L 1HHHB 2YZ1A 4U6XB 4BQ8A 3PWVB 5J8OA 2Q8AH 1KIUA 3IJSB 2VRAA 3S4SG 1MRDH 3KYMB 1FFNA 5DC0A 4ZO6A 2ITCB 4MCYA 3NCJH 4ZAKA 4XNXL 4NNXB 2BOBA 1QR1B 1I3RB 4X7DC 5D2LF 1ZAGA 4YNYA 3B9KB 2VYRE 4WHDA 2X4PB 1J8KA 2YKLL 1HXMA 4GFTB 3STZB 1E4XI 1W72H 3SBWA 3UTQA 4KDWA 3RUGB 4G9FA 5KSBE 3JTSA 4XAWH 2RFXA 4HJJL 3ARDA 3C9NA 1UM5L 5JXEA 2BDNH 1A6VH 2PW1B 3RPIA 4FQ1H 4L3CA 4PJCB 5D1XD 5FYJU 1KENL 1U8QB 2R2EA 2CGRH 2ICWJ 5IROA 1A3RL 5DSCB 4Y16A 4PJDA 2VC2L 2GFBB 4QRPE 5FYKU 5ERWA 4X98B 2OZ4A 3U9PH 2CKBH 4Q0XH 3EYUH 1G7IB 2GITA 2CK2A 1HSAB 4IRZH 1IGIH 2VIRB 4M1DL 3I9GL 3VXOB 2EZ0D 4U1JB 4RGMC 5IMKB 1N59A 3FN9A 1IGCH 2VXSL 2LU4A 1DQQA 4PLKC 4P46D 3RWGB 4AEIL 2X4SA 3QFJD 2V7HA 5EZOL 4OSUH 2BOCA 3O4LE 3ULUL 3QCVL 4HFUH 5I2IB 1A9EB 2DQGL 3OX8A 2M26A 1Q1JL 2YPVL 3V79C 4HBCH 3WS6C 5DK2A 5J6HB 3OR6A 1HH9B 5IB1A 4K8RC 1MRCL 1UZ6F 1FL3B 1EEQA 5E2UL 4G42B 5DFVC 1H15A 3FONB 1ZHNB 2AK4B 1PX3A 5T1DL 5H35B 5DRZA 2RHEA 5IOPA 2OL3B 4MA8L 4IIQB 4Z7UA 5DD0L 5ISZD 1QHPA 1U8HB 3JBG7 1VHPA 1WUNT 4CVZA 5JZ7D 1U3HC 3ULVH 3ARFA 4QF1A 4YHNB 3BESR 4U1MA 4HUUB 2JIXB 2G5BA 3OHXA 3ZDZF 2IAND 3JWOH 4X7FC 3L3DA 3QWOA 3BUYA 3EUUA 2VDPH 3D3VE 3LPFA 4WHTB 2J5LC 1YPZA 4P2RA 4WFGE 5DQJA 5BRZB 5JXAL 5CEYB 5IFAH 3GBMH 3ALWA 3B9KD 5FO9B 2JKXA 1ZHLA 3KPLB 5L88L 4QY8B 3DRQB 4WFHD 1TMCB 4JFOA 4LIQL 2W38A 2X5PA 4YHOH 1B6UA 5ANMB 3T3ME 3UTSA 5CMAA 4HIJB 5TDOB 5MI0C 3EOTL 1I8IB 5CIPB 1SYVB 3WSQL 5D7IB 4LF3B 4KKAD 4AEFA 3WHE1 2P8LA 4W81A 5HHNB 4GG8B 4LFHG 4XWOD 1MFEH 2A1WH 1OLLA 3BXNB 3MRMB 3C60B 4C59B 5A43C 3HFML 4PRID 3A67H 2IAMB 4HG4J 2XFXA 3SO3C 1TZGH 4PJ9B 4TQEL 1TNMA 5K59F 3EJZC 1UJ3B 1T03H 2BSTB 4R4BB 3MXVL 3D18A 4X7CC 4J3XA 2JK5A 1WT5A 3O41B 1K8IB 3F12A 3MPCA 3ZKSD 4WW1B 5ADOH 1K4DB 5DD5L 2W0KA 4Y4FC 3GI9H 1BHGA 1RJLA 4DCQB 3ESUF 4APQB 1VGKA 2NY6C 3X12A 4R8WH 2NCMA 1RVFH 3HG1A 4U1IB 1BWMA 1R5VA 1T5WA 3WUZA 4OCYL 3TBWA 3V0WH 3AS0A 3M45A 1FL6A 4CAGA 5BJTB 2R1YB 3WFBL 1V3JA 3MV9A 5E4EB 1CQKA 1KGCD 2Y1VA 1PJ9A 4KGJA 4WV1C 3D0LB 3Q48A 2F53A 4DUVA 2M1KA 2HJLA 3AM8C 4ONGH 3BI9X 5BZDB 4R96A 2AK4D 2LFGA 1JUFA 5L2JB 2FEDD 3N06B 3T4AB 4YR6B 5CGMA 1E4XL 3SE8H 3GI8L 3NA4A 2Z8SA 2DJ4A 5JO5B 2CUHA 3MLUH 5C0NC 2GSIA 5HVFB 5KW9L 2HN7A 2VITA 2DRUA 3VFRA 4LVEA 1MNUL 1A1NB 1NDMB 2HT2D 3OKLB 4AH2B 5DD