1IQWH

Crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCARNRDYSNNWYFDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY M-HFE7A, LIGHT CHAIN
publication title Crystal structure of the antigen-binding fragment of apoptosis-inducing mouse anti-human Fas monoclonal antibody HFE7A.
pubmed rcsb
total genus 41
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1iqwH02
5DRZB 3TWCL 2NY0C 3BI9X 4G6KH 4H8WL 2XACC 4R4FL 3GSXA 2H2SD 3BE1H 1T7VA 4GLRI 4PJHF 5DZOA 1LE5A 1CLYL 4YHKH 1DN0B 2P42B 2RCSL 4U49A 1OSZB 4WO4B 5M95B 4OCXH 3VRLF 1UJ3C 5ETUB 4JREC 5FKAA 1MAMH 1JWUA 2VKXA 5BVJB 3KPMB 5HDQL 1QO3B 3QG6A 4JO1L 4U1MA 1S7VA 5FDWB 4AM0A 4PRIB 2JELH 4F8TA 4WGWB 1T7YA 3QIBC 4MA3B 3X13A 4D8PA 1EO8L 3GSRA 4ELKB 1CXLA 4OLZH 4Y19E 1QNZH 4OGZA 5BCAA 4KVCL 5KANG 2YPLB 1RUQH 3NIFF 4ZSOA 3ES6B 1T0NB 3UTPD 5FHAH 1HWGB 4I4WA 1AGCB 2HT2D 3WNOA 3FN0H 1F2XK 5ALBH 1QPPA 1OTSC 3FO0H 4KI5F 3HC3L 4NNPH 1IM9D 4PRHB 4XHJD 5HDOA 4KKAC 5JW3H 1QVOB 2I9LB 2I27N 3O3BA 1FLTX 1Z9SA 2EXYD 1YEFL 2BSRA 5IUSA 1RUML 3U4AA 4QXTA 5EFIA 5HVHB 1QSFB 1JBJA 3QIUA 1A0QH 5GXBB 4JFEA 2C4XA 3IDYC 5F7NC 1MCDA 4O4YH 3HUJA 5EBMA 5C0CB 5E2TH 5IFJB 3BDYL 1FYTE 4PG2C 1CG9B 2YRZA 4UILL 5DD5H 4KDVA 3UTZB 2AXFB 3LV3B 3HE7A 1RULL 2ZOLB 1D6EB 1Z9OA 4NNXB 4P2OD 3QUXC 3L7FB 1WWAX 4H25B 4G8GA 4JY4B 1MFCH 4OLUH 2UUDK 1NAKL 1NFDE 4PJAE 2BDNL 3LD8B 3ZTNH 3D39D 2IBZY 1A3LH 5DXWA 4YXKL 1MRDH 4P4KD 5JHDB 2BY1A 4NQDE 2ITDB 2FNBA 3QIUC 3LB6C 1JYXA 3RIFK 3OPZL 4LLWA 5D7JB 5A2LH 4C83B 4DN3L 2PYEE 1JGUL 1N0XH 3P4MA 3ZE1E 2P1YA 5JQHC 2Q3ZA 3DYMA 4MWFA 5I74B 5DRXA 2QADB 3VXSE 4Z7WF 2J8HA 4UOW0 1QP1A 3D69B 4ZUTB 2FEEL 3MTRA 3TBWA 2PUQT 2X4TA 2ORBL 5DMJB 3TZVD 3SDCC 4KUCF 5J4MA 4P49A 4HWUA 5FV2A 3CFJA 5FO7B 4M62H 3QDGA 3S7GA 5B39A 3LIZL 1XF3B 2W07A 1QBLL 3A6BH 4X80L 4X5LA 1B0GB 3T3ME 4MNHB 5ICZB 3WIFA 4ERSL 1BOGA 1RK1A 1CGXA 5L2JA 4MSWA 4CW1A 1HCFX 1QEWA 3WUWB 1HHKA 3MRDA 2R8SH 3NIDE 4L8DA 1FH5L 1MF2H 2DF3A 4HUUB 2MMXA 1YEIL 1QKZL 3QI9D 4YAQA 1W0VA 3RP1A 5ABDE 1S7XB 5F9OL 3DX9B 4NDMA 5HI4D 3OTTA 4GXVH 2F74A 3MLYL 4ZXBD 1ZLUH 3BH8A 5K9KB 5EPMA 3FB8A 3OJMB 4PJEE 4QRPE 3O6LL 4ONFL 2P5WA 3S98A 1WK0A 3QYCA 3KPRB 1HE7A 3HZKB 1G9MH 1OW0C 1F13A 5L8LB 1KJ3H 3V4UH 4ZAKA 3TA3D 2A6JB 2NZ9C 1BPVA 3O4LA 5GS2D 1N3NA 2F54D 2J8UE 1JZ3A 4NYLB 5L88L 5KZCB 1MJUH 1OSPH 5GSVA 1OGAB 1T2QH 2CDEA 3EGSB 3TO4C 1G6RH 2FYYB 2Z31C 1C1EL 5DMGD 3OKKA 1U6AL 5EN2A 1D5IH 1RI8A 3EO1B 3NMEA 3SCMD 2BOBB 2SEBB 5FOBA 3T77A 3CFCL 1KJMB 5ISZB 4A2LA 1X5GA 3SKNB 4ZUSA 4FQHB 3UBXA 1DQDH 5FXCH 4APQB 2FO4B 4L3CB 2H32H 3IXTB 3ROOB 1RFDH 1U8LA 2PW1B 3VWKD 4BZ2L 3MLTA 4U6HB 5HGAA 2J1KA 3TV3L 1A1NB 3VGGA 4OFKA 2ENYA 4UQ3A 2DBLH 4JKKA 4LGSB 2KZ1B 1PFCA 2ICWB 2YUZA 5E6IB 3GJFB 3PXHA 4XVTL 4TSAL 1FIEA 3RDTA 2YPKB 1L9NA 3KJ4B 3SGDH 3W9DA 2L4OA 3VFWB 4UV7L 2YK1H 3F5WA 1MFBL 1S8DB 1ETZB 4Z8FH 3QEQE 3SE8L 5GRUH 4IDLA 5DA0B 5FUCC 4M43H 5GGQL 1DBJH 4HFUL 1TVHB 3RX7A 3T0EA 5E4IA 2G75A 3RTQA 1H3WM 4NPYA 2VDRL 5T1LD 4ISVA 1KIRA 4U3CA 1FZJA 2GCYB 2J88H 3ZTJH 4WW2A 4CVZB 5JIHA 5IB5B 4YR6A 1FVDB 1UH2A 1T5WA 1TZGH 1JJUA 1U8OA 3KPNA 5I76B 5D2LE 1IM3B 3GMPB 1QHPA 1BMGA 3ARGD 3DRQA 4O02L 2AQ2A 3VG0L 3A6CH 4XXDB 4U33A 1NC2A 2DQCH 4PTTA 1N64L 3O41A 2AJXH 3WUZA 3CSYA 1TJIL 4BKLB 4PLNC 5E8NA 3T0EC 5KJRL 4HG4J 4G6JH 4PJGA 3N1GC 4XPFL 1DL7H 1M7XA 2NY0D 2EDLA 3RWHA 2QLVB 4UINH 2YD1A 3BKYL 1OWRM 2YZ1A 2OL3B 1NGXB 4FG6C 4LARL 3PWNB 2FGWH 4P5MA 1QSED 1ZMYA 1A64A 4BQ8A 2DLHA 4YJZL 1JPGB 2FDBP 1IC4H 5TH2A 4HKBB 3PHSA 3SDYL 1FL5B 1FFPB 3WV0A 4G43A 3HC4L 4X6FB 1YEHL 3L95B 1JPTH 4MD4B 3UEZA 1WC7B 1AXIB 3IGAA 25C8L 4UT6L 2J2ZA 2ESVA 5GGVH 3G6JE 5FYKU 3MV01 5D93C 4N8CL 1MCNA 2IAMA 4LOUC 1MCJA 4OT1H 3QIBD 2GTZA 3PGDB 1XGQB 3VDCA 4J8RA 3BGFB 3QNXB 1AD9A 1GOFA 4WCYL 1DQQA 5DLML 4ZFGL 4N0UB 2AV1B 1UWGL 2NY1B 4M48H 1VKXB 4P2QA 1S3KH 1OTSD 4L3EB 1HHIB 2UZYB 4PJDA 1FFNB 3BEWB 3I02A 2BOCA 5IK3A 3L5WB 2Q6WA 4J1UA 4YDKL 3U6RA 5FYKL 4Q9BA 3IFLH 4NKDB 1A5FH 1ITBB 1P9MA 1S7TA 3SE3C 3R0NA 1AGEB 5LJYH 2OX5A 1KB9J 1J10A 3LMJL 4QHNA 3WSQH 3MLSL 1TLKA 2GITA 2ADJB 3VFSB 3KPSA 3DX8A 2VE6B 1FV1B 3FHQA 3PABB 3RZWA 4LSPL 2KUTA 1N8ZB 3L3IB 4RFNC 1UEYA 2D7QA 4NKQB 3QUXD 1VDGA 4LFHD 4BQ9A 1UJTA 1QLFB 4HQQH 4IEFB 4QRQA 4XCCH 4GW1B 2LU4A 5E8EB 3OKEA 4PLKD 5HHOE 1CBVL 1DEEA 4OKVA 4JFFD 4P5TB 4XHQA 2P47B 3SGEH 2ZG1A 1G0XA 4B50A 2R4SH 4U1SA 4DVRL 3DO7A 1FPTL 2P48B 4Y5YB 5HHQA 2CDFB 2RB8A 2ADIB 2R0KH 3VMPA 4R97C 1T3FB 3CDFA 1BBDH 3HI5L 3QIUD 3LB6D 5GPRA 3NAAL 4BM7A 3VGEA 5K9JH 2F8OA 3EOBA 1QYGH 1WBZB 1T6WA 2W0PA 3T4AB 3O2DL 1NAMA 3NACH 3GMLA 3QO1A 5C09A 1G7LB 4R3SA 3SDXA 5LG1A 1R0AL 2NNAA 4N9GA 1I7TB 5I73C 4NN6C 4GS7B 4P4RB 1DE4B 1LO0L 4G8GD 1JFQH 2F19L 2B5IC 3UPAA 2FZ3B 4G6KL 3BE1L 3FT3A 5J6HB 1JMZA 4MA7H 1DDHB 4YHKL 4JHWH 1M4KA 4HXAH 5FYLE 3WN5B 3GRWA 2YD3A 5C0AE 4OCXL 3L3OB 4RMVA 3IAGC 1MAML 1J8HB 4X0KB 2JELL 3X11B 2EKJA 5FYKE 4M7LT 3NCMA 3BJLA 2Z93B 4YDVA 3AS3A 1FN4B 4M7JL 3D2UA 3ZMRA 3MNVA 4POZC 5HGBB 4OLZL 4OD2A 1QNZL 3VWJB 2JCCA 2DQJH 1RUQL 3LDBB 4K7FB 3MYJB 5FHAL 5HPMB 5GJTH 3DHJA 4NO2A 3VI4E 4KTEH 3VXRA 5KOMC 3V5DB 5ALBL 3FO0L 3VXTB 2R2BA 2JK5A 2X40A 3WNKA 3H0TB 1TITA 2VZSA 4NNPL 4XNMA 4Q6IC 2GQHA 2X42A 3O9WB 3MV7B 3TO4D 5JW3L 2Z31D 3BH9B 3I9GH 1A6TA 2Z92A 1XZ0B 3L3JB 1BJMA 1A0QL 2C7UA 3LKRA 4JPIB 4HH9B 4O4YL 5DK2B 1HCVA 5E2TL 5GS3A 4XPGH 1TVDA 5FA4B 3O11B 4GAYB 5DD5L 2UYLB 2VXSH 4MS8C 2MQ3A 4PRDA 5GISH 1YN6A 3U7YH 1CFSA 5A16B 4TRPH 4R6UA 5LCVH 4Y0GA 3PHQB 5I1DA 3O4LD 4I3RH 4K7PH 3OKMB 1MFCL 5CEZD 3P73A 1MSPA 4K3JH 4NWUH 5IVXA 5EZIH 1N6QL 4FQXA 3KPLA 3JV6A 3ZTNL 1A3LL 1YDPA 4YXLH 2CR3A 1R3LA 1B3JA 1MRDL 3WO3B 5EC1A 3RX5A 1N5AB 2HJLB 5KS9A 1U3ZA 3NFPA 5IJKA 3ABZA 5D1XB 1LEGA 1R3JB 4MQTB 5FM5O 4P2RA 1N0XL 5T5FH 4CGTA 2VOTA 4QRUB 2LVEA 1MJJB 9CGTA 4QKXB 4UBDD 2UWEB 1KCSH 3KHOA 2WZPD 2XTJB 3DURA 3BN9C 3GUTB 4LCIH 1GC1C 1BIIB 3F6LA 4LASH 4J3XA 1OCWH 2ZUUA 1F58H 3WKNA 3PHOB 3RDTD 5E8OA 5A2JH 3X12A 4Y4HC 4FQXC 3DVIA 3A6BL 4JY5H 4I0CC 4G8EA 4QRTA 43CAB 2VLJA 3BKMH 3PWUB 4EN3C 4NQCB 4GOSA 1PLGH 3GKWH 5LAXA 3T0ED 3V6FA 5IJKC 5EOTA 2R8SL 2MNUA 5DC0A 5I1EH 5C0BE 4V1DA 4MGXA 1MF2L 5JORB 5F3BA 4S10A 5K9QG 2XN9D 1P7QA 1HXMB 1BZ9A 3BEVB 4FG6D 4KK9C 3WE6A 4GXVL 1ORSB 3IFPB 4BQCA 3RWFB 4R7NB 5INCB 3CVHH 2A2QT 3GI8H 1EGJH 4XNQB 4RCAA 3JBG7 4WV1B 4PJ5E 5C1MB 3S3JA 3QDJB 1G9ML 4MJ6B 1QRNA 2EE2A 1R5IA 2HA1A 1KJ3L 2NY7L 3V4UL 1NC2D 4EQ3A 3GO1H 3WIHA 3UJTH 5BZDA 1UH4A 2IGFH 4F80A 3TCXA 3CDGA 4LOUD 4UT9H 4LMQI 1U91B 4LBEB 1MJUL 1OSPL 1C5BH 4J3SA 5IM7B 1JPFA 2Z8RA 1T2QL 4LAJH 2R1WB 4LVOB 3WEXB 1G6RL 3DVGA 4GAGH 2ARWA 4F37K 2G9HA 1D5IL 3B9KA 1I4FA 5DVNA 4PR5B 1T1YB 1Q9LB 1FL6A 2NXZB 1AO7A 2C4FU 3TVMB 3C5ZB 4FTVB 1DQDL 4K3GA 3TN0A 4ZUWB 2ZPKH 4NO5A 3C60C 1RFDL 1YJDH 2HTLD 4B5EA 5HPOA 3L7EA 5JZ7D 5L8JB 4NC0B 1P7HL 4K71B 2E7LC 3F8UB 1B4RA 4QWWC 4Z7WA 5HYSB 3HZVA 2DBLL 4Z7OF 2IAMD 3O0RH 4NQVA 3ECBA 4LHJB 4Y1AA 2VERN 5HJ3B 5DGQA 3E3QE 3NOIA 3QUMB 2YK1L 4NN7C 4Z8FL 5CCKH 3U9UB 3LKOA 5GRUL 1CU4H 4JQXA 2JJUA 4OQTH 3MRBA 4I0PB 4NN5C 4P2QD 1JZ2A 1FC1A 4PTUA 3S96B 3EFDL 5HD8D 5J12C 2FHCA 3IKCA 1W0WA 3TN0C 3B9AA 3QT2A 2WK2A 4KH2A 5ALCH 3S97C 3CSBA 2J88L 4LHUG 4QRRE 1U3HB 1A7NH 3RPIA 3VA6A 1TTUA 1QFHA 2FR4B 4HC1H 4OTXH 2D7PA 4U1NA 2CMRH 3MLVH 3DBXA 5JW4N 4DEPB 3V6OE 1LO4H 1K8IB 1TZGL 1O5DT 1EERB 4MAYA 5L2KA 1J11A 5HYIA 4OIBA 4N0YH 1CDIA 3REWA 3KPSD 3FN9A 3UTSE 3A6CL 2K3TA 4LEOB 5JQ6H 2VLRA 2DQCL 4YHLH 5DQDH 5E5RB 4O2EA 5BW7A 4YHPB 2CLVB 4G6JL 2YD2A 1FSKB 4RMUA 1KC5L 3JTSA 1YA5A 4UINL 2Z4QA 4WW1B 1A7BA 1TCRB 5DQ9B 3VFUB 4YWGL 3HAEH 2WLYA 3K4ZA 4LPVA 3RWEA 1OGTB 2A6KB 5D1QA 5C0EA 3OMZA 2FGWL 4XRCA 1IC4L 1JF5A 4Q7DA 2L0DA 2Y9RT 2YD7A 1QFUH 1AD0A 5F7FA 4N0RA 8FABA 3IU3B 4YGVA 2LTQC 4W6XB 4KDWA 5C09D 3SJVB 5GGVL 5BW7C 3JTTB 4Q9CA 3W81A 1CLZH 4OT1L 1UVQB 3LVEA 2IALB 3KVQA 2E9JA 4UDTA 2OP4H 1YMME 1JNJA 4POZD 3OKOA 3PL6A 3ZHLA 4EOWH 5DSCA 1ZT4A 4TNWK 5KBNC 3VI3E 1BQUA 1GVIA 2EIBA 3OR7A 3OAYH 4M48L 4U1LA 1S3KL 2YC1A 5T1MB 2XWJB 3X14B 3MGTB 1ZAGA 2N7AA 2DBJA 1BJ8A 4LLDA 4OM1H 1R5WB 1HIMH 4GW5B 1YEKH 2N7BA 1S5IH 3IFLL 1A5FL 1H3XA 5C2UB 1MFDH 3MUGA 3W2DH 3WSQL 3PJSB 4MB5A 5IMOB 3HHRB 3FQRB 3D2UD 1Y6NR 2CUHA 4MS8D 3FB5A 2OYPA 4YO0A 2PTUA 3WDIA 4HQQL 4XCCL 2H3NA 1FJ1B 3TC9A 1RQ5A 5ILTH 5DMKB 1QACA 1CT8A 1JNHA 3WNNA 1AC6A 1VGKA 2R4SL 4EVNB 4QNPF 4HWNA 5D71H 4P59L 3V79C 1RZJH 3ILPB 3TBTB 2DJSA 2R0KL 2HFFA 1S9VB 3MXVH 1BBDL 2D31B 1TQBC 3QXDA 1J05A 32C2A 5K9JL 4G9FE 1MCHA 3S35H 5EU7E 2Q7YA 4JM4H 3I6LE 4F9PA 2X4QA 3NACL 3P4NB 5IB2B 3P2TA 2BVPB 3LQMA 3BN9D 4P57A 1HQRB 3I85A 1J0JA 4UTAH 4RBPK 1NC4D 5BQ7B 3TT1H 3CVHA 1JFQL 1A4JB 2DS4A 2V2WA 3IJHA 3IDIA 4U0RB 4FQXD 4PJAA 3T0XA 1V5JA 4MA7L 1JZ5A 5IB4A 1JYVA 3MJGX 4JHWL 4NQDA 4PJCE 1G7MA 4U7SA 2FO1A 2ZWLT 5FEBA 4PRHE 1J1OH 4FMFA 4P2RD 4F9PC 4U1JB 5IKCA 4UZGA 1K8DA 3UCRA 1Q0XH 1MWAA 3UC0H 4KHXH 1A4KA 4PJFB 1IAIH 1QSFE 4XCYA 4GO6B 5LGKA 2ZOKA 4K94H 5C0CE 2A38A 4S0SD 3D18B 5EO0B 2YR3A 4EDXA 4EZMA 4HBCH 2DQJL 1MJ8H 4YHNA 5GJTL 1UWXH 4GQPH 1MCBA 4X9BA 5E2VH 4KTEL 4PJFF 4F33A 1Q38A 3MRIB 3L5IA 4TQEH 3ULUH 2VLJD 1REIA 3FOMA 4M61B 3PWVA 3EO0A 5GGSY 4H8WC 1MI5B 1U8MB 4XXCC 4P9HH 4NBYB 3I9GL 1NBZA 5ANMB 1UGNA 1D5BB 2R15A 1LDSA 1P7QD 4XAWH 3INUL 4RGMC 3DROA 1WISA 5JDSB 5DHYB 4LDOB 4OQTA 4TNVF 2H26A 1X5LA 4XPGL 5GRVL 3VXUE 1RIVH 3CK0H 2W9LA 4QRPA 4HWEH 2VXSL 5GISL 5DS8A 4YH6A 3U7YL 3PNWB 4TRPL 1F8TH 1QRND 1ZHLA 2C3XA 2KQNA 3LQZA 4JZNA 1ED3B 5LCVL 4QWWD 4PYHA 2EDNA 1Q8MA 4MX7A 4I3RL 4K7PL 1ODAA 3RVUC 4M5YL 5FGBA 4ZFZA 4OZHE 3QUMH 4K3JL 5TFSH 4GAJH 4NWUL 4E41E 3RVTC 4HKZB 5EZIL 1XR8A 2CO7B 2NQCA 3MJ8B 4YXLL 1YY8A 3SE4A 2X4UB 3B9KD 4HPOH 3U30B 1QFWH 1UB6A 4NHUA 3RWJA 4S1RH 2OLDA 2A6IB 1AO7D 3MV9A 2XV6B 3TN0D 3BKCH 3KLHD 1JWMB 3OX8A 3EW3B 4BUGA 5T5FL 2PTTA 4C55A 4L4TA 3RUGB 1MFEH 4O5LH 1KCSL 5EU6B 5I1AB 3UAJD 4OZGB 5DA4A 4LCIL 3HAEA 5IBUB 5IJVA 4FP8H 4LASL 4I5BB 1OCWL 4YBQC 1F58L 4WTWA 4DGVH 5EIIA 4ZPTA 3QPQC 1YMHB 3MRKA 3RUGF 5HYQB 4HAFA 1U2CA 3ET9F 3KPRE 4JY5L 2BVYA 1MAKA 2GEEA 4FQLH 3BKML 1ZT7A 4BH8B 3UP1A 4L9DA 1PLGL 3GKWL 2EO9A 5GS0H 1UCBL 1W72B 3R0MA 4FFWD 3GM0A 1KPRB 5JW5B 1GOGA 3VRIA 3RVVD 1BX2B 4LAQH 5FF6B 2OTWB 1RZFH 5L2KD 3CVHL 1BVLA 4PJ8A 2EH8H 3GI8L 3D0LB 1EGJL 3BP4B 4BELD 4BK4A 3MROA 4XBPA 2HN7B 5D2LA 2WAHA 4Q0XH 4AY0A 5TGBA 2PCPA 1XIWA 3JV4A 1G84A 1P7KB 2EDXA 3BZ4B 4ZG1A 2VLRD 5TJWK 3BGAA 3GO1L 3MXWH 5DD1H 3UJTL 2IGFL 4JDVA 5DURB 2PETA 4UT9L 1BWWA 4OJFH 2FJFA 3BIKA 3GDBA 1MH5A 2VC2H 4GAGL 1U93A 4ZMAT 1NPUA 2DWDB 3H3BC 1RU9H 1SYSA 3EIFA 1PY4A 4PGBA 2VNCA 2FSEA 4GRMA 3TO2A 4HZLB 1ORQA 3MRMA 1U92B 2B4CC 2ZPKL 1QG3A 4PJ8C 5C3TA 2I07A 1I8KA 5HHPA 3WNLA 3NZ8A 1YJDL 1UXSA 4BSWB 2YWZA 4XCEB 3MR9A 2WUCH 4D2NA 3OB0K 3UO1H 4TYUA 4WU5B 3QUZA 4EDWL 1KB5H 1WZ1H 3NPZB 1QBAA 1CDYA 4MDIB 3O0RL 4G8FB 3VXNB 4ZO9A 2R2EB 3BP6B 4JPVH 3BZFA 1X4XA 1INQB 5DRWB 1YN7B 1KACB 1RHFA 1FC2D 1CU4L 1AGBB 5CIPA 4AIZA 1ADQH 3PGCA 2DDQH 4JM2B 3VE0A 5DZLA 1RY7B 3NCEB 3BQUA 3NFNA 4OCRH 5B38G 3LQAH 3QZWG 5ALCL 3KJ6H 1MY5A 1WGOA 4JFPA 2FEEI 3BT2H 4FXGB 4QGYA 2XA8H 4HC1L 4JO3H 4OTXL 2CMRL 2CRMA 1WBXB 1PKQB 4MQXC 1LO4L 5E24E 1BQHG 3IF1B 4N0YL 1ITCA 3SDAA 5DEFA 5E9DE 3HPJB 4QO1A 2R9HC 1LO5B 3K2MC 4ZDHB 3SGJA 3PWLA 3VRJB 4PJBE 5JQ6L 3QIWB 5DQDL 4YHLL 4Y19D 4TUJB 5I16B 3CXDH 1FGVH 1EFXA 1XH3B 1CFNA 1G0DA 1MREH 5CWSA 3U7WH 3BQUC 3QR2A 1D9KC 3L3KA 1NEZA 4ZFOA 4Y4FA 3GBNH 3U0WH 3DMMC 3PP3K 4L1DA 2BJMH 5ACMA 1MCRA 5D7IB 4UQ2B 1S7UB 4L3EE 4YK4C 1G9EA 1H8SA 1JI1A 2DTMH 1QFUL 1GGYA 2ZG2A 4ZNEA 4CNIA 4ONHB 3QUYB 1JPSH 2Y06H 4HS8H 1IEHA 2QQQA 4P3DB 1FYTD 2W92A 1SYVB 1N4XH 2P7TA 1U8PB 4KK8D 5IVZB 3FT2A 3MV8E 3H9SB 2RFXA 1CLZL 3QH3A 4GW4A 4R2GC 2BNUA 2UY7A 2OP4L 5F89A 4PP1C 3LRSB 2HAZA 4OLVL 1VB9A 1UACH 2HH0H 3C6LA 3S36X 2Z35B 4UIMA 4N0FB 1JGVH 1A7RH 4S1SH 4JVPA 1RAMA 1NFIA 3RJDA 4NQDD 4OM1L 3EOTH 1LE9B 2EYRA 5KSAC 3ARSA 4KKBD 2XICA 3FQNA 1CICA 1YEKL 3C8KA 3CU7A 1S5IL 5JW4R 1KF9B 2DQDH 4NZDA 4TSBH 1HWHB 1WAAE 2NX5E 5MEOB 3VW3H 3F12B 1W8OA 2PYED 2VDKH 4X4ME 2P46B 1DZBA 1D5XB 1MFDL 4NOFA 3JV5A 1KV3A 3W2DL 5J13C 3TNMA 3VXSD 2OTUA 1UB5A 3EBAA 3FHAA 5CGYC 3VXME 4LSDA 5AD0A 3KPOB 2XKSA 3FQXA 4MCYA 4BZYA 2XFXB 4QRSA 2BHYA 1JK8B 3OXRA 1HDMB 3ARXA 3VFNA 3D6GA 5D2NB 4X5WA 2XZZA 4LLYB 1HINH 5ILTL 1HNFA 1T1WB 3MRGA 1EAJA 5IV2B 3DSFH 2OSLB 3GJEB 3RVTD 4EQ2A 5E7FA 4FN0A 1LD9B 2DMKA 1CICC 2YN5A 1EFQA 3DARA 1MVUB 5D71L 4G3YH 1CDJA 1RZJL 4HWBA 1JV5A 2IPTH 4NO0A 3MXVL 2FCBA 4O2CB 3CGTA 4L4VB 5GGTH 1J1XH 2FB4H 3C6SA 2AJYH 1F6FB 3S35L 4JM4L 3TJEH 4M7ZC 2C3GA 3N9GH 4ORZC 4QRPD 4C56B 3T2NH 4ZFFA 2QQNL 3V7AG 1S78C 3QQ9C 1PY9A 3MCKA 1ACZA 5IHBA 3MA7A 1MHCA 4UTAL 4HBQA 4KWUA 3W0WA 3TT1L 3THMH 3HNVH 3QPQD 1GHFH 1EUUA 1N2RA 1EMTH 4H5SA 5BO1H 3QRFM 2HT3C 4E5XA 5IMKB 3NPSB 5C9JB 1RV6X 3WFHA 1TJGH 1WCBA 3G04B 1MRFH 1W72H 1GOHA 3KYMB 3FQWA 2E8YA 5J1SC 4XMKH 4Y8AA 5DJCA 2NW3A 1WFOA 3UTQB 4M1CC 3ULVH 1GIGH 1J1OL 4LPCA 5I6XB 3MV7E 4EIZC 3WLBA 5LQBL 1U8IA 3D1MC 1M7IB 1Q0XL 3UC0L 4KHXL 3NCJH 3NBNA 4NO3B 1IAIL 3G5YA 2D9QB 3IDNA 1IGIH 2BMKB 5TDNB 3GIVA 1C08A 4K94L 1XCQA 5CJ5A 4HBCL 3ZKQD 5ESAB 3WS6A 2D03H 3VH8B 4WUUB 5KG9A 1MJ8L 5CBAB 2FIKA 5E2VL 4WWKB 2XQBH 4IRSC 2GKIA 4TQEL 3ULUL 4JAMA 3BKJH 5I8KH 3P4OA 4EUPB 5BVPH 1KB5A 1MCEA 3QPXH 2P24A 5IB1B 2YA1A 4P9HL 5DHVB 2EIEA 4ZS7H 5C0FA 3CNKA 5C0BA 5I30H 3O6FB 1K5NB 3MRLB 2XWBB 4HLZG 5F1OB 3SGKC 3C5SB 1WZMA 1N6UA 6FABH 3OHXA 3MRFB 4ZOCA 5SWZA 3STZA 5GS1A 3HE6A 4PJ8D 3VGHA 3MBEA 3PIQA 3IFOA 1RIVL 1RZKC 3CK0L 4HWEL 1U3YA 1WWBX 5F7WC 3RI5K 1CCZA 3WS6C 2HLAA 2Z9TA 4M6MH 1UZ8A 4PJ5A 5GHWH 2CRZA 1TPXC 4PJBF 1F8TL 2GFBB 2Z91B 3BD4A 2V6HA 2UWEE 3QEUA 1DANT 5A3IC 1G9NH 4TPRH 2XZCH 3QUML 5TFSL 4M9PA 3QXVA 4GAJL 3TBVA 5IEKA 2VJXA 3PWPB 1MHHB 5GGUA 2F53B 3GIZH 4JZOA 1JYWA 1RJLB 1WBYA 5I1JH 4HPOL 1QFWL 4G80B 1JWSA 3ARDC 4S1RL 4Q58C 5EU4B 2X2YA 4BK5A 1A7OH 5A1AA 3IXAB 3MOAH 3N1QC 4M1GH 4XC1H 3T4YA 3AB0B 4NQCE 3CFKB 1CE1H 1IBGH 4JRXB 3MBEC 4X7CC 5EBWB 2IANB 2VABB 3DGGB 2HJFA 2Q76B 1MFEL 4O5LL 2QTEA 3RL1A 1JZ7A 4G6MH 1BZ7A 3QUZD 4FP8L 5D9SB 5EORH 4ODUB 4OLYH 2OTPA 3TPKA 5A2FA 2IH1A 4DGVL 4LKXB 4Z7NE 4CU8A 2R9HD 3MO1A 2AJVH 3GSVA 4OAWB 4GKSA 5A2IH 4RAUA 2AW2A 4FQLL 4LFHG 2QHLA 1R5VB 4ZPVB 4N0CC 1S9XB 4YFLI 5GS0L 4NQEB 4YIQB 5DFVD 1ZK9A 2P8LB 3BVNB 3BQUD 3T04D 3FRUB 5JNYB 3MOQA 3ULUE 1ZOXA 1MCIA 2X70A 3AXLB 2YSSB 4QRRA 5HY9B 2NY3B 3BW9A 4CN4A 4LAQL 1RJZB 4HIEA 1FZMA 4N8VB 2NLJA 1RZFL 3WFEL 3V6OA 3C9NA 1MIMH 2EH8L 4HX1B 4OCYH 8CGTA 2P8MB 4FTVE 4KQ3H 3ROLB 1I1AC 4KRNA 4Q0XL 4JJHA 2XNAB 3MNWB 5DQJA 2FL5A 4JKWA 4YDIH 3E3QC 2ZUQC 3MXWL 5DD1L 1R6VA 4AT6A 3SY0A 4KROD 4OJFL 5K59E 4NRYA 2XKNB 4PREA 2VC2L 1Z0NA 4PP1D 2BVQA 1RU9L 1CIDA 3QNZA 5HHOD 4GKNA 5DVOA 4S0TD 4FNLH 5HGDA 1S5HB 4FQ1H 5D6CB 3BPCB 5I1GH 1G7JB 1NFKA 4DGYH 3QXAA 4LCCA 4YNYB 1K4DB 1PKOA 1UG9A 4QHUB 4DZBB 5KSAD 1HYSD 3TEUA 2O5ZH 3VXQA 2O61A 3BIBX 2VMFA 5H94A 2WUCL 1SY6A 5HVFB 3UO1L 4UU9B 4Z78B 3QDMA 1G6VK 1S9WA 4NP4H 1TZIB 4X99A 5I15H 1ZV5A 4N90E 2KZWA 3V6BR 3DETC 3KWWA 1CGSH 3HFMH 4JPVL 1CXFA 1FO0H 2WBJB 5CGYD 5C08E 5GSRA 2VSCA 5FIEA 4Y5XB 5TE7H 5IFAH 1KG0A 3BWAA 3HKFA 3KAAA 3C6LD 1FZOA 2EYSB 1ADQL 1MLCB 3PE9A 2DDQL 2YHGA 4PV8B 2VDPH 3QULB 4OCRL 3LQAL 5AUMA 4Q74A 5FYLD 3KJ6L 1V3LA 3BT2L 4WIQA 1CICD 4PGJA 4JO3L 4GKOA 4Q9RH 3R8QA 1WICA 5EB9A 2DQHH 1BVKA 3HN3A 3S4SG 3DPBA 4OKDA 5SWSB 1RZ8B 2AV7A 5F7LB 1E0OB 1PEWA 5H37H 2X1XR 3G5ZB 2X4OA 4HK0A 4IIQA 2QQLH 4GMSH 4Y4KA 3AAZA 1YY9C 4UUJB 1S78D 3QQ9D 4G8IA 2DIJA 3SJVE 3CXDL 4I48A 3E0GA 1N0LA 1FGVL 1MREL 3U7WL 5IR1A 3M17A 3GBNL 2Z8VC 3U0WL 1Q9WA 3GSOB 4K2UH 2EDTA 3BP7A 2BJML 2HT3D 2IC2A 1LGVA 5I1IL 4F3FA 2GTWB 3RL2B 3VMNA 2VLKB 3IDXH 4NO0D 4Z9KB 3CXHJ 4KMTH 3RY6A 3C87A 3LHPH 3LKSB 4PBVC 3IS0X 2DTML 5EUOB 3MGOB 5I17B 1O7SA 3AC0A 4G9FA 4LVNB 4Z0XA 1JPSL 2Y06L 4HS8L 4G9DB 3BZEB 4MNGE 1N4XL 5IW6B 3I6GB 4B53A 5AZEH 5GQBA 5IOPB 4NJAH 4KJWC 3BYYA 1OPGH 4N5UA 5T3ZH 1I8IA 5C8JA 1UACL 3D3VE 2HH0L 4Q2ZB 3VD9A 4EUPH 3TYGL 4QF1A 1JGVL 4HCRH 1A7RL 3GMNB 4S1SL 1NGWA 4HKJB 1RK0A 2X4PB 5J8OA 5DHVH 3E6FB 3EOTL 4PJCA 1HSBB 2CUMA 4MVBC 2GIYA 3RVWC 3VFTB 2DQDL 1KN4H 4TSBL 3VW3L 4WO4C 5EU7C 5IMMB 2VDKL 1AC0A 2BERA 1YEJH 1I9IH 4CRPA 3SGDI 2LAGB 3KG5A 4ESKA 4MDJB 4PRAA 2CGRH 4QYOB 3ESUF 2ADGA 4NRZA 5T1KA 1EO7A 4NKIH 4LQFH 3S3SA 4DCQB 4CADB 3TGXA 4CMMB 1PJ9A 2CLZA 2ICWJ 2D0GA 3CPLA 2EEDA 1HINL 5E08H 3DSFL 1P84J 5HHNA 1J7VR 1RZIB 4H25A 4JY4A 4ELMB 1WUNT 3WS3B 3B3IB 4PV9B 5C0BD 2K7QA 4G3YL 2BNQA 1TVBA 3TBYB 2IPTL 5BS0A 1U8NB 1E4XH 3D0VB 5GGTL 4KRPD 3UPRB 1J1XL 5HYJB 3P77A 4WHDA 4WTZG 2FB4L 2CLRB 2AJYL 1UM6H 5FK9A 4JANA 3HE6D 4I2XA 4OBRA 2CDGB 3ZE2E 5HVHC 5EOCH 4H1LB 1CI5A 3MBED 2G5BA 3TJEL 3N9GL 4MXWL 1FE8H 2D9CA 3T2NL 3VXUA 4PB9H 5D7JA 1CLOH 4C83A 1T22B 4PJ5D 4Y89A 4M6OH 1WT5C 3WL9A 1P69B 2PKDA 3MFFB 2W9DL 3ALXA 5KTEH 3M1BB 3THML 4RSVA 4IS6A 1GHFL 4M8QA 4OZHA 1EHLH 1K2DA 2ZSWB 5HXMA 1EMTL 3S36H 5BO1L 4E41A 1T1XB 2CIIB 5I66B 4DJMA 4QTHA 1TJGL 5E2WH 4X6DF 4N0CD 4L29B 1MRFL 1W72L 5DEGB 5KAQG 4MNHA 2EDJA 4ZODA 4MZ2A 4XMKL 1A47A 4IHOA 2RGSA 3KPQB 4X4ZA 3ULVL 1GIGL 5DVKA 5HYFA 5CHNA 3I3EA 5D7JC 1X5JA 5EC2A 3MRNB 2IMNA 3NCJL 2V5YA 2YUXA 1U8KA 3M07A 1P4LA 2DWEA 4Y2DA 4HEME 4KUZH 1IGIL 1H5BA 5I74C 4DK6A 2QADC 1MCKA 3V4PH 5C86A 3VFPA 3TYFB 3TCLB 4NC1C 2VR9A 2D03L 2CRIA 1Q9OB 4LKCB 5MEPB 4XP1H 5IW3A 4F7TA 1IQDB 2XQBL 3JWDC 1KENH 3B2UC 3BKJL 5I8KL 3GMQA 4PGZA 4GG6F 1B9ZA 5BVPL 4ONGL 2NPLX 2XZAH 4KJYA 4WFGE 5DVLA 3QEHB 3QPXL 4PRPE 4LRIC 5FA3B 3V7AE 2D4FA 1TTFA 2VR5A 1ZWIA 4ZS7L 4QHMA 5I30L 1FO0A 4WI7A 1GH7A 4QRRD 4CVUA 1PZUB 5CJOH 3V5KB 5CEYA 4D9RE 6FABL 5DFTA 1TCMA 3ZZ1A 1KUMA 1FNGB 4JEGB 4RDQG 2E6JA 3NGBC 1FRGH 1YEEH 5CINH 5GHWL 1AIFA 3U0PA 5FO8A 4GRWE 2VL5B 4YDJB 3PDOB 1LMKA 1T89A 1G9NL 3MREA 4NZJA 4OZGE 1H0DA 4HUKB 5IP4A 2XZCL 3QG7H 5DDHB 2WWKT 1A9BB 4N8PA 5J6GA 2EH7H 3GIZL 4UOW1 4XCNB 1I7RA 1AGFB 1V3KA 5I1JL 2QSCH 3KXFA 5DJZB 2DJUA 2V2XB 1IM9B 4WFHE 3MOAL 3O2VH 4M1GL 4XC1L 2PYFB 2BNRE 4LLMB 1CE1L 3SQOH 1IBGL 3BXNA 4MQ7A 5FO9A 4AL8H 4KK5C 4FFZH 4HKXB 4APQC 3FQTA 3H9ZA 3UJIH 3IDMB 4PJIE 2X1OA 1BQHB 1NGYB 1FFRA 4G6ML 3QDMD 5EORL 4OLYL 1T89C 4FFVC 2BRQA 1FVDA 2M1KA 2Y6SC 3WHE0 3MRCA 5IEHA 1BECA 4TUOB 5DI8B 1CDBA 2AJVL 3QCVH 4ZUUA 2AK1H 3HC0B 5E6IC 4UNVA 2DQIH 1YY9D 1H3PH 5DYOB 3KJ4C 4EEEA 3CLEH 2ZSVA 4JFHE 5I8OH 3K8LA 2HVJB 4MXVF 1KIPA 1Y18B 1MIEH 2GJZA 3T8XB 3PF2A 4BKLA 1UM4H 1DUYB 3DGCR 2I25N 3FOLB 4RNRB 5BXFB 4LP4A 2PW2B 3QWOB 1CL7H 5IW1A 3I6KB 4MD0A 3LN4A 2ITCA 3MUHL 3RGVA 4WVRA 1YEGH 5IB3B 2HFGH 4R7DB 1MIML 2CIKB 3AREA 4HCRA 4OCYL 4XGZB 2OL3A 4KQ3L 1MCWM 3FT4A 1C16B 1FNFA 3JXAA 5F9WB 3UROR 5E9DA 1CFVH 2OXGA 2IQ9H 4WHYG 1KULA 2KH2B 3OR6A 4NQXA 4YDIL 2I26N 1IGTA 3CSGA 4PJBA 1Z9LA 4EXPX 2WSKA 2YXMA 4X6FA 3GSUB 4ORGB 3TZVB 3K4AA 4WHCA 1EXUB 2AAVA 4HV8B 1AGDB 1QBBA 3IDGA 3LN9A 1JUFB 1QZ1A 5CJXC 1D5MB 2JIXA 5CD5C 4WHTB 3KNBA 3T2OA 1KTKE 1HNGA 3VD5A 3O6MH 4D3CH 4FNLL 4FQ1L 3RJQB 5I1GL 3RGVC 1XF5B 4XVUC 5EBLB 4DGYL 5AAWA 2AV1A 1OLZA 1QSZA 1NMCB 2R0ZH 4TVPL 2ICWI 3QI9B 4MVBD 2WQ8A 3RVWD 2O5ZL 3T2QA 4G9FD 5C2BH 2HKFH 1OHQA 1KJ2B 3I6LD 3VFMB 4UDUB 5F6IB 3PUCA 4XBGA 1I1RA 4GRLB 1A1MB 3GSNA 3DUUB 1PKQE 3MV8A 5I15L 4MXQC 3O3UN 2FX9H 3H7BB 1F11B 4LHUA 3HFML 1FO0L 4O2FA 2I9TA 3ARRA 3FO2B 5FYJH 5TE7L 2D3VA 4Y16A 4X8JA 3V8CA 5E0QA 3BGFC 2DKSA 1HSAB 4QOKB 3T0BA 2Y07H 2VDPL 3RWGB 2NY1C 3PQYB 3SCMB 3MFGB 3ULSA 1MLBA 4GW1A 1QFWM 2GJ6A 3HZYA 2X6MA 4Q9RL 5C0DA 1WAAA 1OTUC 2NX5A 3CXHK 4Z7VF 5IHUH 1A1OB 2DQHL 3SPVA 5C0JB 4H1LH 4DAGH 2X4SB 4MJ5B 3V6ZA 5D7IE 5TE4H 1IGMH 1ZSDB 1S9KC 1QSFD 1DQJA 5T1KD 3VFVB 2VLLB 4IRZH 4Z5RB 3VXMA 2QKIA 2QQLL 3RIFF 2BSTA 4GMSL 4YHYB 3STBA 5C0CD 4GT7A 2XKUA 4PJ9A 1LDPH 1HEZA 4OFPA 2HG5B 4EJ1C 1N5YH 1I3RB 4I77H 3BDXA 3V5HB 1TFHA 1AXSB 5EA0H 5EU5A 2XPGB 2QEJA 4LLVA 4JQVC 3BO8B 3OJDA 2YMXH 2CPCA 4QXWA 2JJSC 3OXSB 4K2UL 5DJ2A 4XZUA 4NSKA 4LF3B 3U79A 1K6QH 2Q3AA 5T1LB 1M6OA 4MB4A 2E9IA 3IDXL 4P5TC 2V9RA 3MRJA 4FXKA 2H9GB 4KMTL 3B5TA 4RFEB 5J6HA 3IJSB 5MERA 4Y5YC 1DDHA 1NEUA 3P30H 4QEGA 3RU8H 4X6CB 2DQFA 3OJVC 2A1WH 3VXPA 1M7DB 1GZPB 4HS6B 3VXUD 2APVA 5D7JD 2FX7H 4RAVA 4TVPE 4Y5VB 4PJ9C 4MB3A 5AZEL 3FO9B 4RQQB 2I60H 1BBJA 5GRVK 2AS5M 2EDBA 4IMLB 3X11A 3DO3A 1OPGL 4NKOA 4TN9A 3I84A 1X5YA 2OJEB 4GS7C 5T3ZL 5HVGB 1K3IA 4E41D 5C0RH 4X98B 4E0RB 3GJFK 3O45A 4UIKH 1IGJB 3B2UD 5MEQB 5I8EA 4RA3A 5JO5B 5T33H 2XXMB 2ED9A 5HPMA 5D2NE 3V5DA 3WXVL 2F8XC 3IS1X 1FVCB 3CH1A 4N5ED 3GNMH 3WN5C 4Z7UE 1E4KA 1M05B 1OAUH 1LK2B 3SOBL 1YEJL 1I9IL 4K23H 1ZLSH 1A6WH 2W65A 2Q86B 2CGRL 4IRJA 2BVEA 4L4VE 5BJTA 3G6AA 4H26B 4NKIL 1VADB 5I8CB 4LQFL 5ADOH 1HI6B 2HFEB 5DO2D 2PXYB 1JCKA 1U41A 3T0AA 43C9A 3VWJC 3KPRD 3LDBC 4LIQH 4HIIA 5E08L 4PP2A 2EIZA 5D4QA 3GSXB 2DQGH 4HXBH 4IOIA 5KZCD 4P9MH 1QTYT 1LE5B 3O9WC 2PO6A 4FRWA 4ZUVA 1E4XL 1R24A 5D96B 1NQBA 1T66C 2C3WA 3O3DA 5EOCL 5CS7A 4U3XA 5FKAB 3HG1E 1JWUB 1HZHH 4J4PA 1FE8L 4DZ8A 3QG6B 4U1MB 1S7VB 4KK5D 4PB9L 1X5KA 4AM0B 1CLOL 2NTSP 2P5EA 1J5OH 3RPKA 2BC4A 4M6OL 2GK2A 3X13B 4D8PB 4ETYA 4K8RL 1MHEA 3GSRB 5KTEL 1KCKA 4MD5A 1JHKL 4ZSOB 2DYPB 4F58H 1EHLL 3FB6A 5I9QB 4I4WB 4XAKE 4MZ3A 3S36L 2HRLA 2XI9A 1K3ZA 3Q5TA 5DJ8A 5IFHH 5E2WL 3WJJC 3EDKA 3DYPA 3DTXA 3TM6A 3PV6A 2WW8A 3EAKA 2OZ4H 2BSSA 5D6DA 5TF0A 1F3JA 3U46B 5E5MB 3O3BB 2FH6A 2BSRB 4EBQH 1DLFH 2HMIC 2OCFD 1AP2A 4QXTB 5EFIB 1CQYA 3QIUB 4FQCH 3EHBC 1I85A 4JFEB 5D1XC 1FDLH 1QPXA 4YLQT 1HQ4A 4QLRA 5GGRY 3HUJB 5EBMB 5J3HC 1XEDA 2R29L 4KUZL 1A14H 4HUWA 1JZ6A 1EJ6A 3V4PL 5F72S 4MMXC 3C8DA 3HE7B 4DN4H 4M9OA 4EI5A 4BFIA 2QSTA 3HUJF 1KENL 4G8GB 1R3KA 4ODWA 3SEPA 4NUJA 2XT1B 1AI1H 2XZAL 4KAQH 3W11D 2G60H 1CD9B 3L9RA 4JFXB 4XI5C 4OD3H 5CD5D 3T65B 3PWPE 3KR3H 2VRAA 4HUVA 5CJOL 5D1ZA 1F5WA 3RGVD 4XVUD 4LLWB 4DFHA 3FJTA 1Q9LA 3CFBA 1JP5A 2NYYD 3ARED 3P4MB 5C0GA 3TVMA 4MWFB 4F7MA 1L4IA 3O81A 1KJ2H 3UDWC 2IPKA 5DRXB 2EC8A 3HRPA 4JRXE 5E9DD 1FRGL 1HHJA 1ACYH 1CFBA 1YEEL 4XB7A 5CINL 4G6AD 3T09A 3TBWB 4EI5C 4NFCA 2X4TB 1Q9KA 5J89A 2MSPA 5IMLA 2P4AB 4MXQD 2EDEA 3OKLB 3QG7L 3CFJB 3QDGB 5GS2H 5B39B 4HIJA 2EH7L 1AHWA 4XP4L 2IJ0C 4C57C 2UUDH 3WIFB 1BOGB 1Q0YH 1RK1B 3ULUC 1A9EA 5L2JB 4KZDH 3BRFA 4MSWB 4CW1B 3FB7A 2VL4A 1QEWB 2Y7QA 4X6DA 5D1ZC 3O2VL 1HHKB 3MRDB 1NMBH 1GGBH 4EXKA 4L8DB 3FL7A 3P9MA 2FJGA 3SQOL 2NY1D 2NXZC 4NQEE 3NA4A 3TVMC 4L3ED 4YAQB 1W0VB 4AL8L 4FFZL 4NDMB 2R23A 1P1ZB 3UJIL 3RNQA 1UA6H 2F74B 4LVHC 1OTUD 3BH8B 4MNQA 5EPMB 3FZUC 3FB8B 5D7LA 3BZDA 3LKPA 2IBZX 2P5WB 3MV8D 4K71C 1OAQL 4Z7QE 7FABH 2W0LA 4LHUD 4N1CA 4LNRA 5ACLA 5B3NA 4JG0H 4ODHH 5INDA 1U0QA 1YNTA 2MKLC 3QCVL 4ZAKB 5C08A 4E42A 3OSKA 2AK1L 3O4LB 4HIHA 4HFWA 4OV6F 1N3NB 4Y16D 2GSGA 3V8OA 1Q1JH 3CLEL 1MRCH 1INDH 5GSVB 5I8OL 4GG6A 4XPAH 3WD5H 1MCPH 2CDEB 5HGHA 4MJ2A 4ETQA 4HUXA 1MIEL 3BP5A 4LVEA 3OKKB 4I0PC 5EN2B 1A7QH 1IAII 3K80A 2EZ0C 4HJGA 3T77B 5FOBB 1CL7L 1XAUA 4A2MA 4DUVA 4Z7UF 2W0FA 4AMKH 5HI5C 1YEGL 3UBXB 5B3JF 1E28A 4P5TD 2JJWA 1U3HC 2NX5D 1KEMH 2HFGL 2XTLA 5DQ9A 2A6KA 1U8LB 4DEPC 3EO9H 3MLTB 5LXGL 1CFVL 2IQ9L 5HGAB 1ES0A 3VXMD 4F9LA 4UQ3B 3OKNA 3DNKA 1T04A 2B8OT 5J0BA 4PJ9D 4M4RA 5ACZA 2OR9H 4M1DH 3H9HA 3RDTB 2NY5H 4GSDH 3W9DB 4XPTH 3OKDA 3G6DH 5CP3A 3F5WB 1ONQA 1UVQA 4ZTPH 1JZ4A 1F02I 3FFCA 2M2DA 3O6ML 1A3QA 4PJXB 1FSKC 3GMOA 2VYRE 4B0MM 2G75B 2VXTH 5HDBF 3RTQB 4NPYB 2A9NH 1KIRB 4ISVB 3N06B 2F58H 5FB8A 3RZCA 1FZJB 4JVUA 5DD6A 3K8MA 2R0ZL 2BVOA 5T1MA 2XWJA 4JFOA 1YZZA 4NOBA 4XPBH 4WW2B 3X14A 1SEBB 3BGMA 4OCNC 7CGTA 2DN7A 5C2BL 2HKFL 4YR6B 3QXTA 1T5WB 2BRRH 1U8OB 3SE9H 3KPNB 1T7WA 2B2XH 4MNGA 2QSQA 5CJ8A 4ENEC 1CZ8H 5B38A 3QQNA 2UY6A 3CFEA 3QZWA 3VMOA 2FX9L 1N59A 5B8CA 1QFWI 4PY7A 4NCDA 3PJSA 4OB5H 4XNXH 5FYJL 5D7KE 1NC2B 4QCIA 1G1YA 3BIAX 2EC9T 4XVSL 4OZIF 4L8CA 4FA8A 5E8DL 3O41B 4OF8A 4PJ7E 5F7DA 4LMQE 3N0PB 3D3VA 5E8NB 3EYFA 4PJGB 4QHKJ 2Y07L 4ZO8A 1T03H 1EHXA 5C07B 4R96A 2RAMA 1FLRH 3RWHB 2C1OA 4P2OA 3WDJA 1SVZA 3SKUD 2VZTA 5F7KC 3RWDA 2X4NA 1CFQA 2UZXB 4QY8A 4P5MB 3O9WD 5IHUL 5HTSA 3O3EB 5TH2B 1ZHNA 4JZJA 4HJJH 3DVFA 1LVEA 4DAGL 1LP9B 3U0TA 1VSCA 4G43B 3AROA 4JN1H 1IGML 1T6VN 5H2BA 5TE4L 2C1PA 2OZ4A 4IRZL 3IGAB 5F7EH 5EUOE 3O3AA 1T5XA 3GMRA 2ESVB 3R4DA 4X4YA 1LDPL 2IAMB 1FFOA 3EYUL 5L6YH 1SMOA 1N5YL 1TJHH 2GTZB 4I77L 3PWJA 1BQSA 4J8RB 4H0HB 5E8PA 4NJ9H 1QUNA 3JSSA 5EA0L 1AD9B 2BVPA 1DQQB 1HQRA 1WF5A 4P2QB 1HILA 3F7YB 1K6QL 2XQYK 4PJDB 1TMCB 3LQAC 3I02B 2BOCB 5IK3B 2Q6WB 3BAEH 4J1UB 3U6RB 4XH2A 5ELIA 1JHLH 3P30L 3MJ6A 3RU8L 1S7TB 4BFEA 2CKBA 3OGOE 1WLHA 2A1WL 4J4PD 2AXGA 1AR2A 4QHNB 4RGNE 2P5ED 2FX7L 2VLME 5LGJA 3Q3GA 2GITB 3KPSB 3DX8B 4LPXA 2I60L 5J3HD 4JFDB 2VZ3A 4L9LA 5FM8A 3U2SA 2HLFC 1FCGA 1XGTA 3F65A 3NCYP 5I73B 4OUOA 4X7FC 2VAAA 5GGRA 4QRQB 3NVQA 4UIKL 3QHFH 2HKHH 3DIFA 2EXWC 4KJQD 4U0RC 4AQ1B 1KSRA 1T80A 3WHXA 3OKEB 1WZLA 1DEEB 4OKVB 4D94A 5CILH 5CGTA 4U1SB 3TA3A 1XF2B 4NQCD 3DO7B 1UM5H 3GNML 5HHQB 1OAUL 2F54A 2MHAA 4RGOH 3IAPA 3HLAA 4ELME 4K23L 1I1YA 1ZLSL 4F37F 4Z7VA 1KCUL 1CDCA 4TVSa 1A6WL 3EOBB 4IJ3B 5EOQH 5ID1A 2YPVH 4L9LC 3G5VA 4P3CH 4JY6A 1RVFH 5HYJE 2VQTA 1NAMB 3GMLB 3QO1B 5DRNA 3WFZA 5ADOL 4R3SB 3SDXB 2NNAB 4N9GB 1IZJA 1I1CA 1WITA 4IBLT 3MLRH 3GSWB 4EI5D 1MQ8A 3ZKMC 3VCLB 1F00I 4MCZA 2R39A 4LEXH 1MQKH 5CFHA 4RDQF 4UMGA 1YPZE 3VWKA 1ED3A 3AM8C 1BFTA 3ZO0A 1LEIA 2GAZA 4B7LA 2DQGL 2BVTA 4HXBL 4PRPA 3FT3B 2X41A 4P9ML 1MUJA 4NZRL 4HT1H 2Q8AH 1IL1A 3CZFA 1T21A 2DJ4A 3VFRA 5D1ZD 4NWTH 3Q6GH 4LSVH 2W38A 1MPAH 4IOSD 3MJ7A 5DJ6A 2DQUH 2HJKA 3ETBF 3TVMD 1HZHL 1DBMH 5DJYB 1J5OL 3IYLW 5ITFA 5B21A 2BY0A 4YDVB 4P3WA 3D2UB 3FZUD 1KYOJ 3MNVB 5FFLA 1CXEA 2OI9B 4OD2B 2H32B 2JCCB 3ALPA 5EO1B 4PUBH 4M6AA 2O26U 4F58L 5GRJH 5CEZH 4NO2B 4S1DC 3VXRB 1EJOH 1J0YA 2R2BB 2JK5B 5IFHL 3FFDA 2MOVA 5HYQA 2JJTA 5F8RC 2AJUH 4XNMB 2D7OA 3ARGA 2H2PC 3AMLA 3MRRA 5EG6C 2FLBT 3U30C 2BNRA 1EEYA 5MI0C 5ICYA 3LEXA 1KCVH 1A6TB 3KHQA 4EBQL 1DLFL 2Z92B 3ARFA 2EZ0D 4XP5H 2FHFA 4G6FD 4HMEA 2C7UB 1FDLL 3LKRB 2RBLA 2G5RA 4NCC2 1X5XA 3V0WL 4PJIA 1U3HD 2ICES 4MNQD 4YQXH 1A14L 3CLFH 4X7TA 2F5AH 3G9VA 4PRDB 1YN6B 1CFSB 4N90D 4J3UA 5C08D 1EVTC 3P9LA 5ESVA 2H41A 4K3HA 4Z76A 1P7KA 5J1TC 3P73B 4PD4J 3DXAE 1UJ3A 1AI1L 4KAQL 5C7XH 3FRPG 5IVXB 3KPLB 3JV6B 4OD3L 4JDZA 1YDPB 3RX8A 1R3LB 5TF1H 1PDKA 1DLHA 4PJHB 3ARFC 3Q1SH 3KR3L 5EC1B 3Q2CA 5KS9B 1JHTA 3VGAB 3NFPB 4OUUA 4DGIH 1FVEA 3AFLA 4YHIB 2CD0A 4TNWF 1LEGB 4I18B 3MX0A 4P2RB 3ULVC 2ED7A 2VO5A 1KJ2L 4QHKI 4ZYKA 1ACYL 5JR1H 3DURB 4DK3A 5KS9F 3ILQD 4OZFG 1IAOA 2DIAA 1VFBB 4XCEA 3C2SA 4NT6A 3UZEA 5E8OB 3SJVD 3X12B 1JF6A 5KSUA 4QRTB 4G8EB 3VA2C 3ZL4L 2EEAA 2KQMA 1Q0YL 2YRLA 1UH3A 4KZDL 3FFCD 2Q1EA 1KLGA 3LS5H 5LAXB 3V6FB 3QA3A 5EOTB 4PG2A 1NMBL 1GGBL 1FHGA 1Z9MA 3O6KH 2YEZA 4V1DB 1AGBA 3RZCD 1AE6H 5F3BB 1V3JA 3QUXA 3B4NA 2QHRH 1BZ9B 3OAZK 1UA6L 3WE6B 2DLIA 3CDCA 4OV5A 1UZ6F 4FXGA 5D7SL 4JFFA 4YZFF 2EICA 3EZ8A 7FABL 4NQUA 1VGEL 1DSFL 1QRNB 2F5BH 4MJIB 1R5IB 3E6HB 4JG0L 4ODHL 1W8NA 5CSBA 5BZDB 1GAFH 3CDGB 1XGPA 1Q1JL 3BWUC 1MRCL 1INDL 3D3VD 1JPFB 4XPAL 3WD5L 1MCPL 1YC7A 1FNAA 2YUWA 3JZ7A 4HK3N 4RMRA 2FLRT 4F15B 2G9HB 5K33A 4V2BA 3B9KB 1I4FB 1A7QL 4JM2C 1E4WH 2G2RB 2IF7A 1FL6B 3F7PC 2ATPA 1FL3A 2V7HA 1AO7B 2W91A 5SX5K 4AMKL 4KV5F 3LKNA 3HZMA 3TN0B 5GIRA 1D5ZA 3FCTA 3SDCA 1KEML 4NO5B 3ELAT 2WWMC 1Y6KR 3EO9L 3L7EB 5L9DH 3HMWH 2ZUXA 1I75A 2X89A 2V9QA 3DSNA 4Z7WB 2F9BT 2WBWB 3HZVB 2Y5TA 4ONHA 4LL9A 3HPLA 5EZJA 2OR9L 4F2MA 3ECBB 4Y1AB 2PN5A 4M1DL 2NY5L 4GSDL 1RIUH 4XPTL 1YPZF 5H8DA 3G6DL 4ZTPL 3EOAA 3LKOB 3ZE0E 3S5LG 3DV4A 3I2CH 3MRBB 4BH7A 1NUDA 2CUIA 2VDMH 2VN7A 2VXTL 2Y5EA 4KY1H 4PTUB 5E03A 4LCUA 1EHAA 5F96H 5CP7B 3IKCB 1W0WB 2EXWD 3IDJA 5F1NA 2A9NL 2F58L 4AENA 4PGEA 4QOKE 1QLEH 3RPIB 1OW0A 4XPBL 1RJYA 3TFKC 3PQYE 4OI7A 3BISA 4U1NB 4JN2A 2ZUSA 4K9EL 3DBXB 2BRRL 5L2KB 1AQDA 4MAYB 3SE9L 1C8PA 3QUYC 1CZ8L 1U42A 3TO4A 1NAMH 2Z31A 3REWB 3F12A 2NY2D 3CMGA 15C8H 3DUSB 4OB5L 3MSPA 4XNXL 3NFSH 3SKMA 2VLRB 3L3HA 4F8QA 2IEPA 4O2EB 1OD7A 1EAPA 3VFOB 2A74A 3J8F7 5E2UH 3S4SA 1IGYA 1T03L 2C9AA 3VFGH 1FLRL 3JTSB 4XPHH 2Z4QB 1K4CA 2H6PA 4KU1A 4DTGH 3GRWH 3RWEB 5D1QB 5C0EB 3FQUA 4N9OB 5GZOC 3AU1A 2VZUA 4Z7UA 4XRCB 4HJJL 3DLQR 4WEUD 3O8XB 3BUYA 2AXJA 4LP5A 4X6BA 1MVUA 2IPUG 1AD0B 1RIHH 3MNZA 8FABB 4JN1L 1H15A 4AEHH 5EOCJ 1CD1A 3UXFA 3VD4A 4YGVB 5F7EL 3QQ4A 3BD5A 4X6CE 1MELA 1GGIH 4K3DH 2P8PA 5L6YL 1TJHL 1X6LA 4KGLA 3V4VH 4NJ9L 4UDTB 5TQ2H 3MRPA 1LHZA 2QV2A 5IT2H 1JGDA 3OKOB 3PL6B 5D5ME 2VQ1A 5DSCB 1ZT4B 2NY4D 3J7HA 5ITBH 5D2NC 3OR7B 1KNOA 4U1LB 4A6YA 1OAYH 4PRPD 2YC1B 2A77H 1RUKH 3OZ9L 4POUB 4RMWA 4FZ8H 3MC0A 2NW2A 4ZOEA 4LLDB 3V9FA 2GY5A 2H2PD 4U6XA 5DK0A 3BAEL 3ZYJA 4D9RD 2VR4A 1J9CT 2ARJA 2A9MH 2EKSA 1CDGA 3DVNA 3QO0A 4LCYB 3HG1A 3MUGB 1RSFA 1ULVA 3B5HA 4D0BA 5IG7A 2OR8A 3UMTA 1VCAA 4JLRA 3IETA 2XN9A 5KSVB 3K1KC 3FB5B 5AYQA 4OZIA 5TDNA 4YO0B 5HHVH 3S6CA 2VISA 3DI2B 5MP6H 1ZS8A 4IDJH 3QHFL 2H3NB 2HKHL 4R4BA 2F15A 4KZEH 1T7ZA 1F6AA 5A40E 1CT8B 1JNHB 4KVNH 3RKPA 1RZ7H 3NPSC 4WFHD 4NHCH 2DLFH 1U8JA 2BNRD 4X4XA 1FORH 5CILL 5HI3C 1UM5L 4RGOL 3ARFD 1ZGLA 5FKPA 2HFFB 4GQ9H 3QXDB 1V3MA 1J05B 2DMBA 2ZCKH 32C2B 5I6XC 4BQBA 1OM3H 5EOQL 2YPVL 4KMQA 1KOAA 5TDPA 4TULL 3ZTJG 1NANH 2Q7YB 1KT2A 4P3CL 1RVFL 3HMXA 2X4QB 3RAJH 5CKGA 3QWQB 5AZ2H 5JDJA 2FX8H 4J3VA 1EEZA 2R0WH 3A67H 5I75B 2V5MA 3MRHA 3MLRL 4YFDB 5E6YA 1JRHH 2VDOH 3ZKSD 1JPST 5DUBA 1KYOK 4J6RL 4WTZA 5L7XH 1GZQA 2PF6A 4LEXL 1MQKL 3N1MC 3CVHB 3DECA 2VIRA 5DJXA 3S35X 2V2WB 3IJHB 3IDIB 4WY7H 4JFHD 3SE3A 3VU2A 2AJSH 4PJAB 2VWEE 1P53A 4NZUH 2ID5A 1CDHA 2APBA 4ZSOE 1NLDL 3DWTA 4HT1L 2Q8AL 4NQDB 5DD3H 4NWTL 1G7MB 2X4RA 3IRPX 3Q6GL 3R06A 4LSVL 3BPNB 1RJLA 1MPAL 5IQ7L 3O6FC 4LLQA 1HH9A 3CDYA 1NFDF 4PJAF 2DQUL 3VJ6A 3IXAA 2NTFA 3NIGE 5IKCB 1K8DB 1DBML 4BZ1H 1MWAB 2J8OA 1UWEH 5JW4M 1A4KB 1NJ9A 3EYQC 3IFNH 4XCYB 4JFEE 1ZLVK 2AJZA 2DMCA 3DGGA 2ZOKB 2Q76A 4KKAD 2FWOA 1NUGA 4EDXB 1SBBA 1CTNA 1X7QA 4RFOH 3WIHH 4D0DA 4PUBL 3ZE1F 3NCYS 1CGTA 2LFGA 2B1HH 5GRJL 4YHNB 5CEZL 5MHSE 4F33B 1EJOL 3FKUS 2VXVL 2GK0A 3FOMB 2AJUL 3PWVB 4P0DA 1VFOA 3EO0B 5E00A 3S9DB 3U4BL 4X5XA 5LVEA 2R56H 1C7SA 1YC8A 1KCVL 1NBZB 1G7HA 4JM2D 4XP5L 3T3MF 2IQAA 4R9HA 1YUHA 3U9PH 5CSZA 3DROB 2H26B 2GSIA 3L5JA 5E1AA 4YQXL 2ED8A 3WNPA 3NIDF 3CLFL 2JB6A 4QRPB 1IKNC 2F5AL 5DS8B 5AEAA 3ALWA 5JIPA 2B0SH 4JZNB 1ZHLB 3LQZB 2P8MA 3GHEH 4JFYA 4MX7B 3SBWC 1M1SA 4K8RC 4ZFZB 4PJEF 1RZGA 5C7XL 5J11B 2DM4A 1XR8B 4WJ5A 1IKFH 5CLWA 1YY8B 3QDGE 5TF1L 3TIEA 3Q1SL 1UB6B 3Q5YA 4NHUB 3RWJB 5CJQH 3ZSTA 4PRNA 2J8UF 3MV9B 4DGIL 4F7PA 1WZKA 1HH6A 3SDCD 3OX8B 3MQIA 1CD8A 2NY3C 3WCYA 1J0HA 1YYMH 3DX6A 2PTTB 3TPUA 4CJ1A 4L4TB 1OWWA 1VERA 5CBEA 4YNYA 3TFKD 3MUZ1 5JR1L 3WO4B 3UZVB 3RHWK 1AFVH 2X89D 4JO4H 1J0IA 3HAEB 5IJVB 4Q6IA 3KLDA 1TETH 3QUYD 1FZKB 1NL0H 3UTTA 2W1NA 5EIIB 4ZPTB 3QJFA 5FCUH 1ZVHA 3MRKB 2P5WE 4QTIH 2J7LA 1WVZA 2HT4C 1TZIA 1E4XI 3ARWA 3CVIH 2Y25A 1ZT7B 2ICEA 1I9RH 1TQCB 4DW2H 3O4LE 3LS5L 1Q94B 4AEEA 3DV6A 1MAJA 5CEZE 5KVDH 3O6KL 3RBGA 3AGVA 1AE6L 4CAGA 2DM2A 3WUWG 1JYNA 3VRIB 1W2KT 3FN0L 4O51A 2NZ9D 2QHRL 5I1LA 5GZOD 4NNYB 5IVNA 4OIAA 3LKQA 5IIEA 2WLZA 3MROB 3OG6B 4TVPD 4XBPB 5D2LB 2PCPB 1XIWB 3JV4B 5CMAA 5T3XH 1UC6A 2YUVA 3STLA 1I7UA 4JDVB 2WBJC 3ARBA 4PJ7A 4Y5XC 5D2LF 3S8WA 3BSZH 2FJFB 3BIKB 3ZYZA 1MH5B 1DCLA 1U93B 4GG8A 3FONA 3CX2A 4PGCA 1SYSB 4PGBB 3U4EA 1E4WL 3OL2A 4NC2B 1OP3K 2FSEB 5I0DA 3S88H 2X1QA 1WEJH 1ORQB 1NC4A 1A6ZA 4OLUL 1DUZA 4PJXE 4W4NA 2I07B 1I8KB 2VZVA 1BQLH 4Y4HA 3NZ8B 1X4YA 1UXSB 3D87B 5L9DL 1QD0A 2X9YA 3HMWL 2APFA 3MR9B 2VDLH 4L4JA 6CGTA 2IBGA 4EN3A 1BD2E 4G7YH 3QUZB 2E7CA 3HA0A 2DQTH 4UT7H 2GW5A 3ARBC 1B6UA 1KXQE 3HNSH 2FATH 3IAQA 1RIUL 5MENE 3BZFB 1S9YA 5K9OA 2MCPH 1IAKA 2DICA 1UCTA 1G0YR 4P2YA 5KN5A 3I2CL 4FQ2H 5CIPB 4AIZB 3G6JF 2VDML 1U2HA 3VE0B 4KY1L 2D2OA 5F96L 4TTGA 3BQUB 3NFNB 4OCWH 3VDBA 3T3PE 1IC5H 2DM3A 4M62L 4JFPB 4PJGE 5E56A 1QLEL 2O5YH 3DRTA 3MCLH 1AR1C 5C07E 3RY5A 5H35A 5HI3D 4ZQKA 3U1SH 5C71A 1L0XA 5FV1L 2CKNA 1KLFA 2ILLA 3HG1D 3ZDXE 4LVNC 1DQTA 2WWKO 3MCG1 3QNYA 3SDAB 5DEFB 1NAML 4F7EA 4P46B 5SWQA 3WBDA 4LPYA 15C8L 3FMGH 1LP9E 3PWLB 3NFSL 3SO3B 3QEGH 4JRYE 3MLXH 1CK0H 4PYGA 3EYVB 4PRBA 4ODVH 5E2UL 2ESVE 4XAKD 3C60A 4H0IA 4KROB 1EFXB 5CWSB 3N1FC 3RI5F 3L3KB 3VFGL 1NEZB 4ZFOB 1NCWH 4Y4FB 5I2IA 4XPHL 2AEWA 4CN1A 2IBBA 2E7LA 1DP0A 4LCWE 4DTGL 3GRWL 3FTGA 5EWIH 4AEIH 4YX2H 5J06A 1XGUA 5HHMD 4RGNC 1VEPA 2GT9A 3I75B 3O6FD 1PG7H 4CNIB 1MWAH 3FO1A 2RCSH 1U8NA 4AEHL 3UPRA 2A83A 3IB4A 5HYJA 2P7TB 1Y0LA 3FT2B 1GGIL 4K3DL 5F21B 2C3HA 3BDBA 3HCVA 3Q6FA 2RFXB 1A8JH 4C54A 3QH3B 2Y36H 2FHBA 4GW4B 2BNUB 1S7SA 1QR1A 4NZTH 5F89B 1CL7I 4C4KO 3KPSE 1II4E 5CUSH 4JFDE 4U3HA 5IT2L 3BUTA 4TTDC 3RVXC 1YPZA 5ITBL 1QLRA 4RX4D 2V5RA 3C6LB 2J5LB 1KN2H 2A77L 1RUKL 4J3TA 1E27A 1NFIB 3PWPD 3VDAA 2EYRB 4FOMA 3FQNB 5ESQA 1CICB 3C8KB 1BHGA 3T1FB 1A3RH 2P43B 2A9ML 4M43L 1DBJL 2E3VA 4LLUA 3TIDA 4HG4K 1PZ5A 5JXEC 4JRXD 1KIQA 5ICXA 3TNMB 2OTUB 1NBYA 1UB5B 2EDQA 2UV3A 4P23B 3X3FH 2GUOA 4NFDA 5AD0B 1OL0A 3FQXB 4MCYB 3NZHH 5I71B 4P5KA 4QRSB 3MACH 3OXRB 5HHVL 4HPYH 3VFNB 1F6LL 5MP6L 4I1NB 3LN5A 4IDJL 4K8RD 4X5WB 1T0MA 3L5XH 3MRGB 4KVNL 1RZ7L 2QSVA 2DLFL 5BRZE 1FORL 2AJXL 4NQED 1JV5B 2IFGA 4NO0B 3VI4F 4GQ9L 5BOPA 1JN6A 2AEIT 4X9GA 1VESA 2ZCKL 2DQEH 3ARPA 3C6SB 1OM3L 1HHGA 12E8H 1DL7L 2NY3D 4PGDA 1TDQA 3RAJL 1O7VA 3RRQA 3LSOA 5AZ2L 4ZFFB 2FX8L 2R0WL 2ATKA 3A67L 3KLAA 4RIRA 1JRHL 3MCKB 2VDOL 1MHCB 5KSBE 5L7XL 3W0WB 3E1F1 3DXAA 1JPTL 4H0GA 4WY7L 1PQZA 2ORBH 1KB9K 1N2RB 2AJSL 4H5SB 3L3GB 2HT4D 4E5XB 4NZUL 2JCCE 3LPFA 3WFHB 1LEKA 1WCBB 1X3DA 4JCMA 1R3HA 3VXRE 2H2SC 5DD3L 1H8NA 3FQWB 3MA9H 5DJCB 4ERSH 3WFDH 1U95A 3WLBB 1U8IB 3TH4T 2B4CH 4BZ1L 4X6EA 1NDMA 4NM8H 3G5YB 3IFNL 2OJZH 1YEIH 3IDNB 3W9EA 4HKXA 5EUKA 2AJ3A 1C08B 2WINA 2NR6C 3BPOB 3UTTD 3MJ9A 4NM4H 5C0IA 3WIHL 5FGCE 4M4PA 1TPXB 1VFMA 1VFUA 2B1HL 2FIKB 1EPFA 3DX7A 5ENWA 4JAMB 1KCRH 5JTWA 4BYHA 2WBJD 3P4OB 4YFLF 1KB5B 3WYRA 1FBIH 3F58H 4JJ5A 2DL2A 1TNNA 2P24B 1QQDA 4BQ6A 4Y19A 3EYSH 4XHJC 5C0FB 5C0BB 4RZCA 2VTFA 4CN6A 3QBTB 3CFIC 3U9PL 3T8XA 4KK6C 1XF1A 2EXYC 4KRPB 4PJHE 3OHXB 3STZB 5DUPH 5SWZB 5GS1B 1NCBH 5J9PA 3HE6B 1X5FA 2R1YA 3I3DA 3MBEB 3PIQB 3IFOB 5EIVA 5JHLH 2UVEA 3VRLE 4Y88A 4P2RE 1AXTH 2F8VA 2WP3O 1UZ8B 4NRXA 2B0SL 4PJ5B 2CIKA 3GHEL 4OF5A 5BZWA 5D7KD 3QEUB 4QXGH 3ARBD 1WIUA 1QYGL 1IVLA 5IQ9A 4XB8A 2AEPH 3TBVB 5IEKB 3K81A 4Y8DC 4OF7A 1FYTA 2NY6B 3P0VH 3QUKA 5CIPH 4JZOB 1FNEA 3PGFH 4P2CG 4WEMB 1WBYB 2WNGA 3NIFE 5CJQL 4W4OC 4PRIE 3DUHA 1M71A 1CE6A 3T4YB 5JA8B 3MMEA 4KI5E 4HFUH 1EZVY 4Y4HD 1NFDA 1AR1D 1ND0A 4V1DE 2HJFB 2YPLE 4CDGC 2EDOA 3RL1B 1AFVL 4JO4L 5DJ0A 4EN3D 3MODH 2VZ1A 1BZ7B 4HXAL 1IMHC 5F9WC 1TETL 1XF4A 1UEMA 1WFUA 1NL0L 1AKJA 1Z5LA 2AKRA 3NABH 4XXCA 5FCUL 3KS0J 4QTIL 3MO1B 3D48R 3GSVB 2PYEA 5ERWB 4GKSB 3TZVC 3CVIL 4RAUB 1QRNE 4GH7B 4MJIE 4KK9D 3VXSA 1VA9A 1I9RL 1C12A 3WHE1 1NUFA 4CU7A 1WFTA 5FOJA 1HKFA 5KVDL 4I13B 3KPPA 1SJEA 1MNUH 5ID0A 2X70B 4TSCH 4QRRB 4QOKA 5EDXA 3BW9B 3EYOA 4G7VH 1C5DB 4HIEB 1FZMB 1NMCC 2NLJB 3C9NB 2H8PA 1KTLA 4RGND 2R4RH 2VLMD 3MZTA 2V2TA 3D9AH 5DQJB 1SEQH 3AS2A 5F6IC 2FL5B 4CKVX 2CO6B 5T3XL 4GRLC 4W6WB 3SDYH 1ZT1A 5JHDE 5DMYA 4AT6B 1CR9H 4Z7WE 3WDHA 4KI1A 3SY0B 2X9WA 2DLEA 3C60D 2E7MA 1S7QA 3BSZL 4NRYB 4PJEA 2BHZA 4PREB 4Y1AE 2HG5A 3EDEA 4TTDD 3RVXD 2BVQB 5EU3A 1RPQA 3QNZB 4GKNB 5HGDB 1HK6A 2XQYG 4BA8A 3S88L 1A6AA 4WCYH 5DMGC 1UYWH 5FYLH 5DLMH 1WEJL 3QXAB 3SCMC 4LCCB 4NC1E 2J8UA 1ZA6A 3HI6H 1ZE3C 3E2HB 2GI7A 1BQLL 4L3AA 5TDOA 3IJYA 3VXQB 2O61B 2H9GA 3TH3T 3HS0A 1FP5A 2VDLL 4G7YL 5HYJD 3QDMB 1S9WB 4D9LH 2DQTL 5JXED 4UT7L 4X99B 4TUKH 5F1IA 2AGJH 4HWZA 5KSBF 3HNSL 3KWWB 4WI9A 5HYSG 2FBJH 5GSRB 2MCPL 1WSST 1I7ZA 1KG0B 4RQQA 1IRAY 5D5MA 4XNZB 2IADA 1CD0A 1WJ3A 4FQ2L 1FZOB 5ECJE 5A2KH 4NFBA 1I8MA 3CFDB 4ZO6A 1ZHBA 5EO9B 4OCWL 4WU7A 5AUMB 4X98A 4E0RA 5FGSA 2YXFA 1IGJA 1NGZA 4HWBH 1ZKAA 2EC9U 2O5YL 2NXYC 3MCLL 5JO5A 1KLUA 3VI3F 4X8XA 3U1SL 1CBVH 3QEQA 1UQSA 1BVKB 1JTOA 5E94A 2OK0H 1DEDA 2A73B 3QRGH 2E27H 2P45B 4MA1B 2AV7B 1OGAE 5I1EL 3ZDZE 4Y5VC 1LWRA 2X4OB 4HK0B 4IIQB 5IF0A 3QEGL 4R0LB 1TNMA 2Q86A 3MLXL 4Y4KB 1CK0L 3AAZB 3MYZA 4H26A 4ODVL 5ISZE 2AK4B 4I48B 3TNNA 4OFVA 5T3XE 2PXYA 5IR1B 4MQSB 5DWUH 1NCWL 3M17B 5FGRA 3TP4A 1ZGLM 3RWIA 2D7MA 3ZT7A 1Q9WB 2NMSA 3T2PA 2KL6A 1IEAA 4KHTH 4ZTOH 4F3FB 2CK0H 5EWIL 4AEIL 5E7BA 4YX2L 4U2ZA 4GUPA 3S37X 1WQVT 5JIKA 1C5BL 5F7HA 5D70H 4R8WH 4HDIA 2M8XA 4HHAA 1PG7L 1EDQA 4G9FB 2GHWB 1MWAL 4Z0XB 4WGVB 4K9EC 3ISWA 3IT8D 4AQOA 3TBSA 4YEFA 3H9YA 1RZKH 2Y36L 2Z8SA 3RBSA 1LO2H 3GMMB 3KGRA 4NZTL 3H42H 4XC3H 2PXYC 4AH2A 2NR6D 5CUSL 4D0CA 1XCTA 3DXAD 1I8IB 4OCLC 4M7JH 4F7CB 1CQKA 5C8JB 1J1PH 1KN2L 4QF1B 3IDUA 5F70A 5T1DH 3G6JA 3OWEA 2DYPA 1NGWB 1RK0B 1H3UA 1UFUA 4AYFA 4PJCB 1PAMA 1A3RL 5CCKL 3R1GH 5D96C 4OQTL 3GSQA 4MMZC 3U46A 4KK6D 5E5MA 1NLBH 4OZ4B 4PRAB 4PJCF 1D9KA 4U05A 4ALAH 1BF8A 2V9TA 3X3FL 2ADGB 4NRZB 5T1KB 1K9TA 3DMMA 4OFYD 5J1AB 1A7NL 5FECA 4KFZC 3NZHL 3MLVL 2UZIH 4XX1G 3MACL 4HPYL 3HRZA 2CLZB 3OGCA 2VWEC 5BOZG 3CPLB 3RWCA 3S34H 4MA8H 3L5XL 5IROA 5I9QC 1T4KA 5HHNB 2ZUTA 3TT3H 4PLKC 2BNQB 1TVBB 1N6QH 5BS0B 4JFXA 1B90A 3G08A 3T65A 2V7NA 1PX3A 2DQEL 3P77B 5FK9B 4JANB 12E8L 4I2XB 2FGZA 1FG2A 3GFUA 3V0VA 2G5BB 5HHOA 3VXUB 5JOFA 1MCLA 3QFJB 5F1KC 4X7EC 3P0YH 4N0UE 3MLZH 3WL9B 1MCSA 2D0FA 5C6PB 3LOWA 1WIOA 3BHBA 5KSAA 3HE7C 3REVA 4PBWD 2AQ1A 5IROC 4IS6B 4OZHB 4M8QB 1K2DB 1IFHH 4E41B 3HR5A 1T1ZA 1BLNA 3Q5OA 4QTHB 3WJLA 3OKLA 1GXEA 1RD6A 1VFAA 1ZVSA 3L3DB 4LLAA 5LBSH 1BREA 5CEXA 3MA9L 4IHOB 5CD3A 2BCKA 3QISA 3WFDL 4OZHF 4XTRC 4PLJC 4EOWL 1EV2E 3OAUH 1PYWA 1T7XA 2OQJA 1CGYA 5CHNB 2B4CL 4IOFC 5EC2B 1U8KB 2VN4A 2YBRA 4NM8L 2OJZL 1P4LB 2DWEB 4Q97A 2HVKA 3OF6A 4Y2DB 1H5BB 4U1KA 4UNTA 3GBLA 1HIML 1P1ZA 1I9EA 5C0AA 4YHMH 1XFPA 1AKJD 2LABA 3NGBB 5E99H 3VFPB 1OT1A 2BY2A 4NM4L 4HMDA 3F7VA 5C92A 1KTDA 4GRLD 1ZLWK 2FH8A 4QT5A 2VKWA 4F7TB 3WJLC 3HTLX 3UZQA 1KCRL 3K74B 3GMQB 1NCNA 5GGSA 2NY7H 4KJYB 1FBIL 3F58L 3LZFH 2DB8A 1ZWIB 1ZA3A 1EVUA 3EYSL 3WFBH 4QHMB 1FO0B 2DTSA 2XWTA 4QOKD 1ZHKA 1JF1A 2APWA 5CEYB 3PQYD 1KJVA 1U8HA 3RVUD 5DUPL 3T0WA 1NCBL 1F42A 1B88A 3FRPA 3EJJX 5LKNA 3GB7A 3MV9E 2R0LH 1SY6H 5JHLL 1V05A 4PS4H 3ZDZF 1ZEAH 1AXTL 1JI2A 5LGHH 3U0PB 1AIFB 4WI8A 5FO8B 4L4TE 5F7MC 4WWID 3MREB 1CDUA 4QXGL 1H0DB 4ZAKC 1T0PB 2AEPL 5J6GB 1I7RB 3P0VL 3PGFL 1OAZH 2FRGP 1TZHA 3KXFB 3EFFB 4OZFA 3H3PH 1FGNH 1J8HE 1DQLH 1A2YA 1ERNA 4JB9H 3RFZC 3O2DA 4YBQD 5JXAH 4PJXA 3BXNB 4MQ7B 3EFDH 5FO9B 4AG4H 5JPNA 4U31A 2NXYD 4IRSA 3FQTB 4N68A 3RNKA 4DUWA 3MODL 1MCFA 1SEBA 1BD2A 5DTFA 4UBDC 1CVSC 2X44D 3NABL 3MRCB 5IEHB 1PGRB 5IBTH 4ZD3H 5IBUG 4D9QE 3SHSA 1HXYA 5MENA 3L6FA 4KMLB 4U1IA 5GGVY 3SGKA 4KTYA 4ZUUB 5ADPH 1KGCE 3RDTC 2EE6A 1OB1A 4Y2OA 1OF2A 4PFEA 3D85A 4S11A 2ZSVB 4ZFOL 2C3VA 1KIPB 2GJZB 1MNUL 5DJAA 5JOEA 2RHEA 1Q72H 3RTQC 2Q8BH 4TSCL 3WKMH 5IW1B 4MD0B 4X83A 3LN4B 2ITCB 4G7VL 4HGKC 4JPWH 5CZKA 5C07A 3RGVB 2VITA 1KC5H 4YDLB 3QEQD 4WW2C 4RAHA 4YWGH 3AREB 4XCFH 1KELH 3QDHA 2R4RL 3FT4B 1F3RB 1RURH 4Z0BH 3D9AL 5E9DB 1DBBH 1SEQL 3O3EA 1BM3H 2IH3A 3OR6B 4NQXB 1LP9A 1IGTB 3ARDA 4XAWL 1E6JH 4PJBB 4JRYA 5HGGS 1CR9L 4BFBD 1RJCA 3KDMA 5GRYA 3IDGB 3UBXI 2PXYD 2JIXB 4L8BA 3MRQA 1RHHA 3KNBB 4FS0A 3G5XA 5GZNC 3WXWH 2V5TA 1IC7H 2X09A 4GBXB 2FBOJ 2R1XB 1UYWL 1H3TA 4LCWA 1VPOH 2XTJE 5FYLL 1HHHA 3EKCA 1S7WA 3Q48A 3HI6L 5IHLB 3F7YA 2FD6H 2DKMA 4ODXA 4G42B 1G7PA 3S5LA 1CFTA 3GGWA 2ZKHH 3MLWH 1U8QA 2EYTA 4WENB 4U6YA 1UKTA 2HTLC 4D9LL 4XBGB 2KDGA 3GSNB 5JZ7C 5JLZA 3MV8B 1T20A 4TUKL 4QHLA 3U36A 1HOCA 2AGJL 1P5VA 3BKCL 4OF3A 4YBLB 1G7IA 4LHUB 4DVBA 3AVEA 4O2FB 2I9TB 4WNQA 5F88A 2FBJL 4WI5A 2IAMC 2M26A 3C5JA 3IVKA 4JFDA 4Y16B 3ZKNC 4Z77B 4X8JB 4MQXD 3S3PA 4PY8J 3SDDA 4NBZB 1OAKH 2DYPD 2QR0A 1I1AA 3W39A 4M03A 3QFDA 3ULSB 4W6YB 1MLBB 2R2HA 2ZZUT 5HD8C 1BJ1H 4HWBL 1G1CA 2GJ6B 3HZYB 3QDJE 4NKMA 5C0DB 2NX5B 3SPVB 1XF2A 2OK0L 4U0QB 4LSSH 1P9MC 3QRGL 2E27L 4P59H 4UAOC 1LNUA 3V6ZB 2QJDA 1D9KD 1MHPH 1DQJB 4JFED 1U58A 3DMMD 2YD5A 4AZ8A 3VXMB 2QKIB 4ZNEE 3ME0A 2BSTB 2XA3A 3E8UH 1WAAF 1X5HA 2WUBH 4PJ9B 2MFNA 4WFEE 1HEZB 5C6TH 3SDDC 3JUZA 4MLSA 4FQQB 4LSTH 1OQOA 5MHSD 5EU5B 3HE7D 4LRNH 5F9JA 4Z7OE 4NQSB 3GSWA 5DWUL 4F57H 3HI1A 4LLVB 3JWDH 5SX4H 3OJDB 4M93B 3VCLA 3D25A 5DJ2B 3UTSA 4XZUB 4NSKB 5BRZA 4KHTL 4ZTOL 4R4NC 3G9AB 2CK0L 4PBXA 2YD4A 1Z0MA 1M6OB 1S7RA 4HK3J 3MRJB 4CMHB 2X05A 4FXKB 5D8JH 5FDYA 4R2GD 5JPMA 3F7RA 3CCHA 3VXOA 4U1HA 1KPVA 5D70L 2W60A 5MERB 4CVXA 4EI6A 4WFFE 3IU4H 4R8WL 1BGXH 4KKCC 4HW6A 4XTRD 4PLJD 4GKZA 1NBQA 5K93A 2DQFB 3QJHB 4WDIA 5BMFH 1QRKA 2AEQH 3VXPB 4IJ3C 4IOFD 4RAVB 1JNNH 4PG9A 1P2CA 1JL8A 1DR9A 1RZKL 1G6RA 2WIIB 1DVFA 5E4EB 1BBJB 1LO2L 1YEDA 5KSBA 5DJYA 2OXHA 3H42L 4XC3L 3OG4B 4NKOB 1IEBA 4HGWA 1OP5K 1WTLA 3NN8A 1J1PL 4K7PY 3O45B 5TE6H 1KB5L 3LPGA 1WZ1L 2H32A 5JOPE 4MHHI 5EBGA 5EO1A 5T1DL </