1NCCH

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDTATFFCARGEDNFGSLSDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccH02
5JXEA 3SOBH 3TO4A 1C8PA 5INDA 3L5WA 1BD2A 2VWEE 3HI1A 4G6KL 4N0FA 1CFSA 1ZANL 4PJEF 4YZFE 3QPQD 4YHIB 3T8XA 3LVEA 2B5IC 2VRAA 4KMQA 5IEKB 4P4RA 1ZT7A 1R3LA 4KY1L 4EOWH 4L4JA 2ED8A 1PQZA 2NY2C 3G5XB 4PY7A 3TNNA 1P9MC 2APWA 2J12B 3PHQB 3ZKQD 3QP3A 5FECB 2J3SA 2AJVL 1RV6X 5T1KA 1ZA3A 2QQKH 3QEUB 1IGFH 2ZUSA 1NUDA 3O11A 4KRNA 1NQBA 4AK1A 3WS3B 2Q8AL 2DDQL 1F2QA 2PXYA 4K94H 5FCUH 3D3VD 2FECI 1HE7A 2YKLH 3T1FA 4XX1E 3T2NH 1UGNA 5IHZA 4Q9QH 4S0SD 5CSBA 5EC2B 2OMBA 4F7CA 3MREA 4MGXA 3AUVA 1QFWL 4P4KA 5BVJB 1LVEA 2OL3B 2WBKA 2HFEA 4UOW1 4WO4D 1ZLVK 5CEZL 5SWQB 1KCSH 1T1ZA 1GC1H 4HWEH 3LS5H 4TRPL 4ZPVA 4NWTL 3RAJL 3BP4A 5DQ9B 1NFDE 3FQRA 3VXNA 4U6XA 5F9JA 4YHZL 1J0YA 3BGMA 2G60L 2CUIA 4YR6A 3T09A 2R0LH 3CFEA 1U8IB 5DVNA 2QSCL 4XB7A 3VI4E 3ARQA 4PJGE 1MNUH 3ZYIA 4LSQL 1QRKA 2XN9D 4N0YL 5I1HH 3U1SH 5IT2H 4X6DB 2D7NA 1IGTA 1XZ0B 2HG5B 4HIIA 3TA3D 3LRHA 4NZTH 3W82A 2VLJB 2OR7A 5JOPD 2D7OA 5KVFH 3FO1A 5GRVL 1OSZB 5F7UA 3IVKA 3PXJA 4HJJH 4RMWA 4RISL 5I8KL 1K2DB 1WZKA 1Q0XL 3Q6FA 1F6LL 4LNRA 1F5WA 3L5IA 1E4XI 2NX5A 2H3NA 5C6TL 1E4KA 4AH2A 1HHKA 3FQUA 4JZOB 2OZ4A 4WV1B 3WXVH 2WBJA 4HWUA 4EUPB 2CLZB 1EUUA 1MWAH 5F7EL 3EKCA 1SYVB 5HTSA 3DO7A 5E4IA 3DRQB 5JA9A 4MLIA 3K8KA 3VGAC 4LQFL 4GRLA 4HKZB 3PABA 3RUGA 4J3SA 4M7ZC 3WDJA 5EU5A 3TO4B 5INDB 3L5WB 1BD2B 3K80A 4EBQL 3E2HC 3HI1B 2WAHA 3O2VL 5E2WL 2HTKC 4N0FB 1CFSB 4XVTH 2BVYA 2FX7L 4BK5A 3A6CL 2BHUA 4P4RB 4OZGF 1ZT7B 2YD6A 4X8XA 5HVHB 3B83A 1R3LB 1PQZB 3TNNB 4PY7B 5KVGH 3L9RA 2J8OA 2WP3O 4NKOA 2HMIC 1BJ1J 5T1KB 4WENB 2ZUQC 5J1AA 4UV4H 2QSTA 3KXFA 4Y1AA 4PJ9C 2X6MA 1IFHH 4MQXC 4MX7A 3O11B 1KCVL 1HHJA 1LWRA 3JWOC 4XMLH 4AQOA 3B9KC 5ISZE 3PV7A 2COQA 4DTGH 4KZDL 2PXYB 4K3GA 5ITBL 5CGMA 3VFSA 3QIBA 4J3XA 3T1FB 4MA8H 2VXVH 2ZOLA 3JV6A 5IHZB 1FNEA 4F7CB 2Q86A 3MREB 4JY6A 4R4ND 4P4KB 4BFGA 1DQMH 4PUBL 2HFEB 1T1ZB 3T77A 4NZDA 4JM4H 2F54E 4PJ7F 1WLHA 5TQ0L 4ZPVB 4OUOA 2MQCA 2NNAA 3C60D 1S7RA 4LIQL 3BP4B 4H1LA 3BJLA 5GPRA 2NY6B 3FQRB 3VXNB 2UUDK 4U6XB 5F9JB 1ZS8A 3BGMB 1CLOH 4U1LA 3EDFA 4M5ZH 1IT9L 4YR6B 4PP1C 3V52H 2J8UA 3CFEB 4XC1H 4HWBL 2YD4A 4C54A 5C86A 1DEDA 1G9ML 1CXIA 3D2UA 2DQUH 5GGQL 1U8OA 1IGTB 2X1OA 4LARL 3VD4A 4BUGA 4HIIB 2B4CC 3ROOA 4D3CH 3ULVL 2R4SH 4PRIA 1TJIH 1J1OL 1O0VA 1UJ3A 3EHBD 3FRPG 4ZOBA 1U8NA 1JV5A 3GKWH 3QUYA 3NH7L 1RFDH 3FO1B 4IM8A 3G04A 3O9WD 1E4JA 4G8IA 2PF6A 2AJSL 3IVKB 5D2LA 1RIHL 4PJDF 2F8XC 3X3FL 3SDDC 5IHUL 4F7PA 1GGCL 5FO9A 4N9GA 3Q6FB 2DKSA 4LNRB 4ELMF 1X5YA 5TE7L 2A77H 4ZAKC 4X9FA 3FZUC 3LN5A 2NX5B 2QSVA 2H3NB 5I2IB 2DQGH 4AH2B 1HHKB 1EDQA 3EYFA 3FQUB 35C8H 1B2WH 3MCLH 4OLYL 1OOAA 2RGSA 4QHKI 2WBJB 3HAEH 3JZ7A 1Q9KA 2IPKA 4Y16A 1RUKL 4LHUG 4I2XE 3DO7B 4Z7WA 5KAQG 3SGJA 1JNLH 1G1YA 2V6HA 2X4UA 4HC1L 4XP4H 4KK8D 2E7CA 1UH4A 5EU3A 4KKLD 4F33A 3PABB 1H3UA 1J05A 3RUGB 5EU5B 4YBQC 1SEBA 4IDJH 1IKFL 1MHEA 2QQNH 3IDUA 2EXYC 5DR5L 4KWUA 3BP7A 1IGIL 1GYAA 3IDYB 2W9EL 3VJ6A 1BM3L 1KXVC 3HC3H 5JW4M 1JL8A 1HILA 3L9RB 4JFEE 3SPVA 2NXZC 3ZL4L 4H88H 4NKOB 4QOKE 5GS2H 2W9DH 2HVJA 4HFUL 1QUNA 3KXFB 4Y1AB 1IARB 3OGOE 6CGTA 1DQJB 1V3LA 4MX7B 1HHJB 4RBPH 3CFDA 3MTRA 1EAPA 3VWKC 4HBCL 3S36H 3WN5C 4K8RL 5J12C 2BNQD 1I1RA 3VFSB 3QIBB 1T7VA 4KRPB 2ZOLB 3JV6B 3HPLA 1AGDA 3BKJL 4DCQA 1FNEB 2AK1L 2Q86B 3UBXG 4JY6B 2AP2A 3O6FA 4XVJH 4XHQA 4S1DC 1JNNL 3T77B 4DQOH 2NYYC 1D5ZA 3DUSA 4UNVA 2EEBA 2NNAB 1S7RB 3C2SA 1GGUA 3SKOA 1ZS8B 2XN9A 5MEND 5DQDH 1NUNB 4U1LB 3G5ZA 5FYJL 2J8UB 4KK5D 1IAIM 4FTVD 5DLMH 1BGXL 3TA3A 4C55A 1S9XA 4HQQH 4KJQD 2V7NA 4JHWH 2HJFA 3S5LG 5ADPL 3D2UB 1U8OB 5D9SA 5T5FL 1NGPL 1JZ2A 4PJHF 4O4YH 2I07A 3ROOB 4PRIB 4H26B 1UJ3B 4RWHA 3N06B 1U8NB 3BD3A 3H42L 4HH9A 5L88L 1JV5B 3QUYB 3G04B 3UJJH 1VERA 1VEMA 4G8IB 5D72H 5EUOA 5T1DH 1IC5L 3UO1L 5DRNA 2LV4A 5D2LB 3O3EA 2X2YA 4GSDL 5DRZA 5C0AE 5JXAH 4F7PB 4YXHL 5FO9B 4YFLI 4N9GB 4LASL 4MVBC 2R0ZL 2XZQL 5GRXG 2UY7A 2MHAA 3LN5B 3IFOA 1FVCA 3SE3A 2N7AA 1KG0A 3EYFB 5KW9H 4I3RH 3RVTD 2NY7L 1T5XA 1X5AA 1LEGA 2YEZA 1OPGH 4K2UH 1BAFH 1Q9KB 2IPKB 4Y16B 4HGWA 2VZOA 3D1MC 5BXFA 1ZXQA 4Z7WB 2OYPA 2A1WL 4OZHF 4LDEB 3T2OA 1L4IA 4CMHC 1JZ6A 2UVFA 2X4UB 3ZKMD 5EU3B 2EC9T 4F33B 5JNYA 1J05B 1ZKAA 3MRFA 4MD5A 1V7NL 2NQCA 3C6LD 4PJIF 1NCDL 1XIWC 4R2GC 2J5LB 1SEBB 5I1GH 5J1TC 1ZV5A 1MHEB 4I48A 1EK3A 2GK2A 4FP8L 4UU9A 3BP7B 1RU9H 2AEPL 3K4ZA 4MDJA 4XC3L 3VJ6B 3E3QE 2IEPA 4K7PY 3RX8A 3PE9A 4PYGA 1HILB 1U3HD 1I7ZA 4G6AC 1S3KL 4DZBA 4Q6IC 3SPVB 4CU8A 4LSPH 1BFTA 4QTHA 2Q3AA 3LIZL 2VDPL 2VDMH 2HVJB 2CKNA 4KAQH 5IMLA 3GJFH 4B53A 1AIFA 1QOKA 4FQ2L 4LLVA 1DJSA 5GGVY 2AGJH 3GRWA 5IGXH 2WIMA 3CFDB 1EAPB 3WUWG 3GSOA 2F19H 1AO7E 3L3KA 1B4JL 4LHJB 3MV9E 4LLWA 4L8SC 3HPLB 3BGFB 1AGDB 2BHZA 4GOSA 4DCQB 3QDAA 4I4WA 1H15A 3O6FB 2R29L 5ALBL 1ZOXA 2DI8A 3QH3A 4ZXBC 3VXME 3IDNA 5F3BA 1CL7I 3WIHA 3K4AA 5L2KA 4OGZA 5DHYA 4E41D 1D5ZB 1QRND 1G1CA 3DUSB 1XGTA 1M4KA 3D9AL 4OTXL 2Z92A 1KCKA 4OF5A 3SKOB 2EH8L 1D5MB 3LSOA 1VFUA 2XN9B 5I74C 3MXWH 2RFXA 3TP4A 1KLGA 3G5ZB 5T5NG 3WE6A 4G6FD 1MEXL 4K7PH 4BZ1H 5EBGA 3JV5A 3TA3B 1S9XB 3MBED 4L1HA 2V7NB 2HJFB 5E6YA 3W9EA 2YD7A 4U1HA 1FH5H 5D9SB 1YYLH 3VFRA 3NIDE 2I07B 3VG0L 1J87A 3PP3H 5GGVH 4XNMA 1EGJA 1FNGA 3QUML 5E08H 3ARXA 4CNIA 1QLEH 5E6ID 4TNWF 1OY3B 1NSNH 1SMOA 5EUOB 2MSPA 4NBYB 1VFMA 1WICA 3O3EB 4OLVL 1FPTH 5DRZB 2Z8WC 2NY5L 3ARTA 1RZKL 4EDWH 4GW5A 3I2CH 3SBWA 4OZIF 1D5XA 5I17A 4TSCL 4M43H 4JN1H 5D2NE 2MHAB 4G7VH 1NCCH 3IFOB 2JCCE 5I30H 1FVCB 2Y07L 2IANE 1T7YA 1KG0B 5E4EC 4A2LA 1T5XB 1P4BL 1LEGB 2YEZB 1QFPA 3FB5A 1T66D 1ADQL 5HD8D 4GKNA 4NN7B 1KN2L 1UZ8A 3EYSL 4Y19E 3X3GL 3HI5H 3MOBH 4O5LH 1OSPL 4X80L 5BXFB 5L0QC 1BFOA 3CVIL 2CJUH 3PWJA 4XMPL 4NUGL 4XWOD 2EEDA 3ZSTA 4WWKB 3QHZH 1PZ5A 5JNYB 3WDIA 2ZCKH 3MRFB 1T0PB 4M61A 4MD5B 3VXOB 1PSKH 5TH2A 1MHHA 3AU1A 4P23D 4V1DD 1T03L 4I48B 3SDCC 2GYSA 3ZE1E 4UU9B 4MDJB 3U30C 3QXAA 2J8HA 2CH8A 2WIIA 5C0IA 3RJDA 3QXVA 4KH2A 2EIDA 2X41A 3DI2B 2DICA 1I7ZB 4DZBB 2CKBA 1TCMA 4QTHB 5TE4H 1NCAL 1AHWC 5A2IH 5IMLB 1FORL 3UBXA 1AIFB 1EBPA 3TZVD 4LLVB 4PRPD 5GS3A 4KDTC 1P7KA 3GK8H 3GZKA 1AD9B 2GI7A 2YC1A 1X5LA 3GSOB 3L3KB 1J0JA 3MA9L 3H7BA 4F8QA 4NYLA 4LLWB 1KLUA 1YY9C 3QA3A 4XP6H 1LMKA 1OGAD 5T1MA 4I4WB 1H15B 1CGXA 2WK2A 4RGNE 5JW3L 2OX5A 1DVFD 3IDNB 4Q0XL 1F4XH 5F3BB 5IMMA 3OKLA 5L2KB 5DHYB 1DANU 1BMGA 1XGTB 4FTVA 4EI6A 4KV5E 3BUYA 2Z92B 5EOQL 4AL8H 4DOHB 1JRHI 4OLXL 3MLTA 2WSKA 3GO1L 1XMWA 3LSOB 1BF8A 2VQTA 3P4OA 2DLFL 2RFXB 1KLGB 1JMZA 2ZUUA 3NTCH 3W39A 3WE6B 4OM1H 1E28A 5MEOA 2E7MA 4CRPA 2RCSH 3TBWA 4AG4H 3UDWC 4QNPF 5EZIH 4MB3A 1ZVYA 3W9EB 3STZA 3BSZH 3LHPH 4U1HB 3MJ7A 3A0OA 3VFRB 2UWEF 3QRFM 4JE4B 4TPRH 4XNMB 1FNGB 2ZNWA 4FQLH 5IFHH 3PV6A 25C8L 1I85A 1LO0H 4CNIB 3SDXE 3WLWC 4RMQA 5D96B 1KJ2H 1CXFA 2GY5A 4M6OH 2AI0L 4GW5B 4BH8A 1FDLH 1D5XB 5I17B 1II4E 4P99A 5EORL 4EI5C 3ARGC 2XTJC 3NIGF 1Q1JH 1OW0A 2AVGA 2C1OA 5DD1H 4JPVL 1W0WA 3KJ6H 1FC1A 5DUPH 3MC0A 3PWNA 4LAQH 4A6YH 3FB5B 2EKSA 4GKNB 1NANH 3TBSA 1WC7A 4HF5L 1H8NA 1UZ8B 1CBVH 3MLZL 1AXTL 1GZQA 1NUFA 4Y4KD 2EYSA 1BFOB 4WUUD 4F37F 1F4WH 3PWJB 2JIXD 1BEYL 1MI5A 4IOFD 4F15B 4YNYA 1PZ5B 3TLRA 3TBTA 4M61B 5TH2B 4P49A 1MHHB 3AU1B 5SWZD 4N0CD 5FB8A 1YY8B 2H1PH 5ALCL 5EBLB 5CJQL 3ESVF 4FFYL 1NAKH 4U33A 3RIAF 4LMQE 1CF8L 3QXAB 5KSAD 1F90H 1AC0A 2WIIB 5C0IB 1OARL 5I15H 1GPOL 2HJLA 4XGZA 4OFYD 1XCQB 5I8EA 3RZCD 3WUWA 3EJYD 2CKBB 1TZIA 5AUMB 2VXUL 4NNXA 1IL1A 1QQDA 3UBXB 1HEZA 1I9IH 4D9QE 1P7KB 5J13B 1G0XA 3W2DL 1LILA 2YC1B 4NJ9L 2DTML 4P3CL 5FUOH 1IGCL 4YDIH 3CMOL 3H7BB 4NYLB 4NHCL 3OKEA 4XPTH 1KLUB 3QA3B 2NXYC 2IJ0C 1QFHA 5T1MB 4M6ML 5GRZA 4LP4A 5IMMB 3OKLB 1H8SA 2X44D 4JCLA 5GZND 5CJXC 4FTVB 4S1RH 4EI6B 3IDGA 3BUYB 4IMKC 2OMNA 3VRIA 4X6DE 4G5ZL 2BOBA 4OLWL 2A6IA 1S5HA 1OAZH 3MBEA 4YBLC 5IJVA 5GGSY 1OAYL 1ZHBA 1CE1H 3P4OB 3DROB 5F9WB 5HI4D 2VLJE 3W39B 4DEPC 1E28B 5MEOB 4J12A 1T7XA 3TBWB 3UJTL 3ZO0A 4OGAC 3FFDA 1F45A 3V7MA 4WI6A 1R3KA 3VGDA 3ZKXC 5IVXA 3MJ8A 3S3PA 3STZB 5KJRH 3MJ7B 2PUQT 3UAJD 1V05A 1IAII 1IGMH 4O02H 3C09B 5IM7A 2OCFD 4GMSH 3PV6B 3LB6C 1S78D 1I8KA 1F3RB 5A43C 1TTUA 2Y25A 3VI3E 1ZTXH 4HCRA 5I9QC 4ERSL 5KTEH 3OAZH 2ZUTA 1MJ7H 3C8HA 1DBBL 1BBDL 1FP5A 1ZK9A 4BH8B 4J3OC 2JJWA 5FOJA 2I9LA 4Z7NE 5IJKA 2BCKA 5BMFH 5HYJA 1DQDL 4K3DL 3CSYA 4HBQA 1CU4L 5HGGS 2C1OB 4B0MM 4IIQC 2X4PA 1W0WB 3K8LA 2D7TL 2JB5L 3U9PH 2JJVA 3PWNB 2EKSB 4G6KH 3TBSB 1BD2E 1WC7B 3OGCA 3U4BH 3DVGA 4GS7C 3KS0J 4P23A 1RUPL 3L6FA 1GZQB 2EYSB 4MXQD 3TV3L 4V1DA 4MQSB 2O5ZH 4KY1H 5DUMH 1AR1D 1MI5B 3KLHD 1K8IB 3PGCA 4YNYB 3C5SA 5F70A 3TBTB 1YPZF 3Q3GA 5D7JD 3QSKB 2AJVH 3MRJA 4U1JA 5FB8B 3U0WL 2QADB 12E8L 5A40E 1FAIL 3CLFH 2FLBT 1BOGB 1FCCA 3K0WA 4TYUA 5IQ7H 5IB4A 3R4DA 2H41A 1RHHA 1CXHA 1EEUA 2APBA 3RL2A 2HJLB 4W81A 4TNVF 4XGZB 3TZVA 2HFGL 4X4ZA 5I8EB 3WUWB 1ED3A 1J11A 4PGEA 1TZIB 5JMRA 3D48R 2FHCA 1IL1B 4NNXB 4IJ3C 1QFWH 1D5IH 1QQDB 4P5KA 4ELKB 1T0MA 5CEZH 2C9AA 2J88L 4KJWD 1HEZB 2APVA 5C0JA 2FJFA 3AY4C 3HZMA 2BVEA 1HZHH 2AJYL 3ZKSD 3RAJH 2X7LA 5DHVH 1NL0H 5JW4R 4UI2A 1ZLSL 3S37H 1P6FA 3OKEB 1A21A 4YZFF 2ZP0T 1PW3A 2FWOA 4QCIA 1FFQA 2VLKD 1FV1A 5ACZA 5F6HJ 1PX4A 4HLZH 4W70A 1N64L 4HZLA 5FK9A 5C7XL 4KVCL 3IDGB 3AREC 4P46D 3VRIB 1LDSA 4XMKH 4KHTL 2A6IB 1S5HB 3RVWD 3MBEB 1KTKE 5IJVB 1ZHBB 4NQDD 3VRJA 2VDLH 2M1KA 2PN5A 4KVNL 4POZD 4P9MH 3OPZL 3BEWA 1A6AA 4GG8A 4JN2A 4XBEL 3BRGC 3ULUE 3FFDB 4RISH 4X83A 2E9BA 4QWWD 1R3KB 1BF2A 3P73A 1Q0XH 4MB4A 5IVXB 3MJ8B 2V2TA 1KV3A 3KYAA 5I8OH 1BVLA 4I9WE 2FDBP 1WEJL 4S1QH 5C6TH 3VXUD 5IM7B 2NX5E 4N8VA 3LEYL 4O00A 1I8KB 4QXGH 3OR6A 2YBRA 5J89A 5F7EH 4OIBA 1UCTA 2D03L 1JUFA 3ABZA 5DJXB 3V8OA 5EDXA 1J5OL 3IDIA 4IRJC 4J3UA 2HN7A 2I9LB 2LU4A 2BCKB 5HYJB 4LQFH 3VI4F 1RVFL 3CSYB 4PJGF 1CIDA 1RJYA 2X4PB 1S9YA 4G9FD 1XF5A 3RUGE 2AABL 1C1EL 3LEXA 1JTPA 2JIXA 2MPAL 3O2VH 5L6YL 4JRWA 3OGCB 5HI5D 3DVGB 5LCVL 2IFGA 4P23B 3L6FB 2FX7H 4MA3A 1QVOA 1NEZG 2VXTH 3DSFL 4V1DB 4OD2A 1VSCA 4M8VA 4PRHD 3R8BB 1AE6H 4CU7A 3PGCB 1I8LA 3ARFB 3MUZ1 3C5SB 3Q3GB 4AEFA 5I1DB 5GGRY 4U1JB 3MRJB 4OFYA 2ZUVA 3CH1B 2GCYA 1X4ZA 1ZEAL 3KXFE 4Y1AE 1JWMA 2KQMA 5IB4B 1F3DJ 1N7MH 3VH8A 1CLYL 4Y2OA 1RHHB 4KZDH 3ARBC 3RL2B 5FA4A 1U8KA 5ITBH 1FE8L 2YRPA 3TZVB 1FFRA 3QWQB 2LTQB 3TO2A 4ZO6A 1ED3B 3HG1D 3GMMA 4PGEB 2VLRD 2DMBA 4P5KB 4BSVA 3RU8L 4WEMB 2EDOA 2I27N 1T0MB 1TDQA 4JO2L 4PUBH 4P2OD 4HAFA 5C0JB 2FJFB 3HZMB 4NFDA 3GIVA 4KDVA 3OXSA 2X7LB 3G5YA 3QFJA 1D6VL 5FYKL 3WJLA 3BFOA 1IT9H 2D0HA 4EEEA 3KAAA 3SKNA 3Q5OA 2FWOB 1JP5A 4R4BA 4QCIB 1UEMA 2J8UE 4HWBH 1MELA 1FV1B 5ACZB 2YK1L 3LZFH 1O7VA 4GBXD 4R6UA 2HA1A 3OB0K 3RVUC 3HR6A 4HZLB 5FK9B 4Y2DC 5EU6A 4ZFOA 2WWMC 2CXKA 3WFEL 3BMWA 3OXRB 1KCUL 3ILQD 5T33L 1J1OH 3VRJB 4NZRL 1GGTA 4QT5A 2DQHH 3I3EA 4PRIE 1L7IH 5CUSL 3BEWB 1A6AB 4GG8B 1I8IA 2IAMD 2AJSH 4JN2B 1U8MA 3BKYH 4Z7QE 1NC4D 3QXTA 1RIHH 3X3FH 5IHUH 5D2LE 5A1AA 2D0FA 3P73B 5GS1C 4JDTL 3LQAC 4ZNEA 2V2TB 5ENWA 3DETD 2ZPKL 4LGSB 4ZD3L 3KPSD 5TE7H 4BQCA 2W0KA 1BVLB 5DXWA 3SE8L 3KPRB 1MF2L 4N8VB 3MRCB 5K93A 1MQKL 3V8CA 4UINL 3OR6B 2YBRB 3ISWA 4I0KA 4PLKC 3KR3L 4J4PA 1JUFB 4MXWL 1RUKH 1AC6A 1Q94A 5DJCA 2IQ9L 5HI3C 1OP3H 3U46A 2ZOKA 2HN7B 4Z7WE 4HC1H 2MOVA 1MFNA 3T0XA 2E8ZA 2NY2D 1RJYB 3MACL 1S9YB 1UH3A 1XF5B 4LLAA 3C08H 4L8CA 3LEXB 2F15A 2JIXB 4NKDA 5GHWL 4DZ8A 2B8OT 1G7IA 5EU4A 5D7JA 1FCGA 1WAAE 5DK0A 3S96A 3P4LA 3QUXC 4P57A 4MA3B 1HYSD 1QVOB 2PKDA 1BM3H 5MI0B 4N8CL 3KNBA 1Z6JT 4OD2B 2AXGA 4JM2C 4GRMA 1IM9D 3MBXL 1TTFA 5TF0A 1B0GA 3ZL4H 3P4NA 1QR1A 5FAAA 1CDJA 2DLTA 2D0GA 5E5MA 3ZKNC 5HHVL 3L5XH 4HFUH 3SGKA 5DQJA 1JPTH 5DFVD 2GCYB 3SQOL 5D6DA 5D5MA 1JWMB 5IV2A 1E27A 3VH8B 3ZTJH 4HBCH 4OV6F 1J7VR 2HT3C 2W91A 2XIDA 1V3JA 5FA4B 1U8KB 2UYLA 3FHQA 1MCBA 1QLFA 4K8RH 3B2VL 4PY8I 3RTQC 4L3AA 3TO2B 4RGMB 4XCNA 5GSRA 3GMMB 4GKSA 1QHPA 4UBDC 1QZ1A 4BSVB 3S4SG 5EO1A 1T3FA 2BVQA 5L8LB 3IU4L 3MV7D 1JNNH 1EIBA 1Y0LA 2G2RA 2OZ4L 2D4FA 4U1SA 2P24A 2OTPA 3ALXA 1UM4L 3OXSB 2WWKO 4N5EC 3G5YB 1KIUA 5DJ6A 2XY2A 5DURD 2JJSC 1CE6A 5M7QA 2YUZA 3QFJB 4NN6C 4M4PA 4ZUWA 5IIEA 3IFNL 2XN9E 4OCLC 4P46A 2MCPH 2R1WA 4KKAC 1J1PL 3SKNB 3T2QA 4R4BB 1BGXH 3LAFA 4YXKH 2H32A 4RRPA 1F00I 3OAYH 1Z0NA 5DMGC 5ADPH 3GMQA 4KUZL 4PB9L 3OAUL 5EU6B 5T5FH 4ZFOB 1NGPH 4OM0L 1GCFA 4Z95H 1IRAY 3EJJX 1DDHA 1JHLL 4Z77A 1H3PH 4Q6YA 1RUQL 3MODL 3H42H 4QT5B 4MB5A 4Y5XA 2X4SA 1RJLA 1I8IB 4AQ1B 1U8MB 4FXKA 2MQ3A 3FB8A 3VXUA 5EUOE 4GSDH 2PYED 5LKNA 2H26A 4KKBC 3D0LA 2IBBA 5ENWB 3HNSL 2XZQH 1XR9A 5FHAL 5I16A 4Y4HA 2NY7H 2BDNL 1MIEL 3UTSD 2Y5TA 4RGOL 3QAZB 3L5JA 4A2MA 3STLA 4U6HA 4ODUB 4K9EC 2HTKD 4G9FA 1Q94B 2WANA 5DJCB 2LVCA 1V5JA 1Y6MR 4YHLL 3GI9L 3U46B 3RVXC 4E0RA 2ZOKB 3U79A 2DI9A 3MFGB 1LO3L 4F8TA 5J1SC 4HPYL 1IKNC 1R6VA 1V7NH 4U3HA 1NCDH 2XWJA 5DHXB 1G9MC 4L8CB 4NKDB 1AGEA 2H9GA 2YD9A 4DZ8B 1CD9B 4FP8H 3DV6A 1G7IB 3BE1L 4FNLL 5EU4B 5D7JB 5DK0B 1NGQL 3S96B 4WW1A 3N50A 3O2DH 4P57B 1DBJL 3HI6L 3A6BH 3O6ML 3ULVC 2HKHL 3B9KD 3KNBB 3WO4C 2AXGB 4XVSL 1DLFH 2DKMA 3V7AE 4GRMB 4CVZA 4F7EA 5EIIA 2O5XL 1QFUH 4WFGE 1B0GB 5DMKA 3GFUA 3P4NB 1QR1B 3LIZH 2CIIA 5E5MB 1KJ3L 2A38A 1FZMA 5KG9A 3BRDA 1RZIA 4OZIA 4FQ2H 3HG1A 5DQJB 4Z7VA 3TPKA 2ICES 5D5MB 3X14A 2YUXA 1UWXH 1FNAA 3HE6A 5IV2B 1BLNA 3SDAC 5BW7C 1PG7L 1K5NA 1X3DA 1CZ8L 3L3JA 2UYLB 1QLFB 3WFZA 3LS4L 4DKEL 4XCNB 5I1EL 5GSRB 4YEFA 1JI1A 1MFBL 4GKSB 3HHRB 3IB4A 4PG2C 3RY6C 5CGTA 1T3FB 2BVQB 5ALBH 5IESL 4L29A 4M03A 5T3ZD 1Y0LB 2G2RB 2AV1A 4U1SB 1VEOA 2AJ3A 2P24B 2YS4A 3IKCA 3ZDXE 3D9AH 4L9LC 4BZ2L 5L2KE 4JRYD 4PS4L 1M6OA 1X5KA 1N0LA 5DJ6B 2EH8H 1A7OL 3MMEA 4DOHE 1CE6B 3P4MA 2GJ6E 4ZUWB 3QJHB 2QR0A 5IIEB 2AW2A 2R1WB 1MEXH 3DMMC 1X7QB 2R8SL 3TNMA 4HEPG 5IOPA 1MCCA 4JGUA 4N0RA 2H32B 2YD2A 4WFEE 2YHGA 4N90E 2EICA 3GMQB 5CZVH 5IROC 1A6PA 4GFTB 4U6VL 1NC4A 3VG0H 5JW5A 4ZAKD 1DDHB 3CDCA 4Z77B 3RHWF 1MCWM 5IB1A 4ZNCD 2B2XL 3KPSA 4Y5XB 4YIQA 3WUZA 1JI2A 1VGEH 2DJSA 2X4SB 1Y18A 1RJLB 1RUAL 2Y36L 5IF0A 4LEXL 4DKFH 3PG2A 4FXKB 3VXUB 3FB8B 4OLVH 4C59B 1RZKH 2H26B 4K8RC 3D0LB 5JTWA 1WZLA 5ID1A 3TH3T 1XR9B 4U1KA 5I16B 4DN4L 1JGEA 1ZHLA 4FHBD 1E4WH 4Y4HB 1MCOL 1TZGH 2Y5TB 4M93B 1FVEA 3BX7C 2A9NL 1RPQA 3STLB 2VQUA 4U6HB 1EXUA 1KIPA 3ARDC 1KN2H 1P9MA 1T1XA 3EYSH 5M94B 1VKXA 3SJVA 4G9FB 1U2HA 1OSPH 2VXQL 4L5FL 1KEGL 1A6UL 4ACPA 1OAXL 4E0RB 4BFBD 4XMPH 3LY6A 3TN0D 1K8DA 3OV6A 4NPYA 5CKAA 5F8RC 2EE2A 3VW3H 2NXZD 3F6IA 2XWJB 4M5YL 4N1EA 3FONA 4XI5C 1PEWA 1RIUH 1AGEB 2H9GB 4R96A 1IM9A 2VITA 3NIDF 3ZT7A 3PWPD 3DV6B 5EUKA 1QG3A 1NAMH 2A2QT 3GBNL 4WW1B 2UWEA 4GKOA 5B8CC 2D9QB 4I77L 5F44A 4FOMA 2CDEA 5CKGA 4AT6A 1ODAA 4CVZB 4F7EB 1HINL 1D9KC 5EIIB 5F72S 2Y06L 1U92A 2CIIB 5KS9E 4UOW0 1FZMB 2EDJA 5KG9B 1RZIB 1U91A 4OZIB 2BZDA 4M9PA 5LGJA 3T0BA 3HG1B 4Z7VB 4S1DD 3NA4A 5DJZA 2NYYD 3GNML 3X14B 5GRWA 5DC0A 3HE6B 5GRUH 1BLNB 1JE6A 3MV7A 4HULB 3L3JB 3MA9H 3WHE1 2DQDL 3G6DL 4Z0XA 5TF1L 1P4IL 3ARSA 3FB6A 2E8YA 5C0RL 2DQTH 5JW3H 3GB7A 4JLRA 1JK8A 5E1HB 4ETQA 4HJ0D 2AV1B 2AJ3B 4JZJC 4LVEA 3IKCB 4DK6A 5EOQH 1M6OB 1D5BA 2XRAL 4R97B 4OLXH 4FTVE 3KJ4C 1I9RL 2W9LA 3MMEB 5DEFA 3UTZA 3P4MB 1B88A 3ZE1F 5I19L 4YDVA 2QR0B 5DUBA 5BZDA 1H9VA 4P2RD 3O3UN 3MYJA 3TNMB 2V9QA 2IPUG 4K3JL 2YPVL 1NKOA 5IOPB 3MUJA 3PQYD 3EOAA 1CI5A 1DE4A 1NGXA 3REWA 2HYMA 4B50A 3BIKA 5JW5B 5I1AA 3DI3B 2PYEA 3PWLA 4QHMA 25C8H 1XF3B 3BAEL 4JB9L 5CJ8A 3WYRA 5IB1B 1U6AL 3KPSB 4YIQB 2EIEA 2OTUA 2X89D 1Y18B 5IF0B 5D1QC 1JPSL 5LQBL 1QBBA 1R0AL 2E6PA 1SJVA 1IBGL 2YR3A 1YQVH 3GSWB 1INDH 3OZ9L 2X40A 5E7BA 2XZCL 4U0RC 1TPXC 5ID1B 2XTLA 1RAMA 5F7FA 3TJHC 4UOJA 4U1KB 4F7MA 1JGEB 1ZHLB 4XP9H 3CIQA 1YMHA 1YN6A 5F1NA 4JPVH 1MFCL 3MYZA 1FVEB 2B5IB 4X7FC 1TXKA 4KV5F 3ES6A 2X10A 1U8JA 1EXUB 1KIPB 2NY2B 2ZUWA 1KPVA 4HF5H 4MWFA 1T1XB 5CEXA 1VKXB 3MLZH 3SJVB 1AXTH 3K2UL 3JVGC 1PFCA 3HTLX 5C0NC 1HOCA 1ACYL 3WIHL 1BEYH 4ONGL 4BYHA 1K8DB 2DIBA 4NPYB 5DMYA 2ZSVB 1FFOA 4PJAA 1MI5E 4OCRH 4G6AD 5F96L 3B9KA 3JTTB 2VIRA 3FONB 3UC0L 4KQ4L 4XH2A 5ALCH 5CJQH 4PLJC 1IM9B 2VITB 4R96B 3WKML 4AIZA 1URLA 5EUKB 2BJML 4FG6C 1CF8H 3CLEL 2UWEB 5TE6L 3WCYA 1HIML 4O58L 4Z76A 1T5WB 3HC0A 2CDEB 1GPOH 1IEHA 1TITA 3SDXF 2GSIA 4AT6B 2RAMA 3UX9B 1FNSH 3JWNC 1G7LA 2VXUH 4WW2C 3EYVA 1NH6A 1EGJL 2NY5C 1RZKC 1U91B 1P69B 2F54D 3HAEG 5LGJB 1L0QA 4ZXBD 4NZUL 5DJZB 5DSCA 4PJXA 3W2DH 2F8OA 4ZUTA 1GIGL 3MV7B 2DTMH 1IAKA 3BOVA 1WT5C 3CMOH 4JG1L 4PRBB 4NHCH 4Z0XB 2B20A 1DP0A 3UEZA 4JRYA 3ZDZE 1RZGA 2AQ3A 3FB6B 1DBMH 5A16A 4LSUL 4PBVC 5CILL 4JFPB 5DURB 3G9VA 4M6MH 3GB7B 4JLRB 1JK8B 1ERNA 4ETQB 3B9EA 1OTSC 3PP4L 3S6CA 1IEAA 1FL6A 4G5ZH 4OLWH 1D5BB 2KPNA 2QEJA 4U1NA 5DEFB 3UTZB 4BQBA 1A3QA 4YDVB 3ECBA 1VACA 1A7RL 5DUBB 5D70L 5BZDB 4Y5VC 3MYJB 4MZ2A 4KTEL 1RZJL 4YDKL 4ZAKA 3UJTH 1PZUB 1NBZA 1WV7T 3EOAB 3EAKA 1K3ZA 1DE4B 2JELL 5ILTH 5FO8A 1NGXB 4ESKA 5IVXE 3REWB 4GAGL 3BIKB 5I1AB 4U05A 5FYLL 3RPIA 4CVXA 2PYEB 1KEML 4GXUN 3PWLB 4QHMB 3VFGH 4NSKA 2OTUB 3MLVL 2FNBA 4ERSH 4U1MB 2NCMA 4BSJA 2CKBL 3OB8A 1DBBH 4TVPL 3VGAB 5DMJB 1BBDH 2A74A 3P30L 3HMXA 4M7ZB 4NQCD 1SMAA 4EN3D 2XZZA 3EZJB 4WJ5A 1C5DA 1DQDH 1ZE3C 3E2HB 1CU4H 3C5JA 4F7MB 4LSRH 5HYJE 1FYHB 1YN6B 5F1NB 2D7TH 3I6LD 4BQ9A 3BI9X 4AENA 2VDRH 4MLSA 5F7YC 3OHXA 4N1HB 4X6DF 4UIMA 3ES6B 1U8JB 4G8GA 5CEXB 1KPVB 4MWFB 2ADGA 2R15A 3VXPA 4FMKA 3ZMRA 3AGVA 1RUPH 3CX2A 4NM8H 3GSNA 3JXAA 3JWDL 3TV3H 1HOCB 2QQKL 3MJ9A 1WISA 2ZUQB 3PWPA 3WFDH 4UZGA 4JFED 4V1DE 4PJ9B 1FFOB 4PJAB 4UQ2A 5HHXH 1OTUC 3B9KB 3BWUC 4R4FH 4K94L 2VIRB 2J4WL 5FCUL 3VWKA 3EW3B 4ONOA 4XH2B 4EIZC 3WN5A 12E8H 1F2XK 4AIZB 1FAIH 2BMKA 3T2NL 3PL6C 1CT8A 1CQYA 4BELD 4Z76B 1YZZA 3HC0B 4HIXL 4RBPK 5M95B 4QHKJ 1TZHA 2FLRT 2HFGH 2H6PA 4XAKE 2GSIB 3U6RB 1G7LB 1W72A 3EYVB 4Z7NF 4JVPA 3VDBA 3GIZL 1A9BA 2C3WA 5B21A 3L1OH 5DSCB 2Z91A 4PJXB 2OJZL 1OL0A 1HQ4A 1TNNA 4ZUTB 4QGTA 1GH7A 3RIFF 4NC2B 1IAKB 1ZLSH 1MNUL 3FMGL 1L0XA 3S35X 5D8JH 4JRYB 5E2JA 1RZGB 3X11A 5A16B 1WBXA 4QRPD 4NZTL 4LGRB 1U9KA 1MFDL 4LPWA 1CWVA 5KVFL 4P2RA 1IEAB 1FL6B 4KHTH 4MD0A 4KK6C 4M7JH 2DQEL 3PQYA 4HJJL 5FEBA 5GIRA 4U1NB 1WFOA 1FIEA 1M1SA 3MRBA 4KVNH 3SDDB 4OQTA 3ECBB 4LNVA 1VACB 3O41A 2O5YH 4EXPX 4ZAKB 1OLZA 3L3GA 5C0AD 1NBZB 3B3IA 3WLWD 1X5JA 1G6RA 1EJ6A 3OX8A 3CSGA 3WXVL 3NMEA 5FO8B 1KB9J 2APFA 2ARJA 5ERWA 3RKDC 4ISVA 1RIVH 1A7QH 4BM7A 1WEJH 4M6AA 2C4XA 2QL1A 3RPIB 4OF7A 4CVXB 3RGVD 4JQVA 1MJ8L 3BIAX 3KPRE 3LEYH 4NSKB 1PD6A 3O8XC 4FFZL 2ID5A 2D03H 4HV8A 1FQ9C 1BX2A 3B43A 3QZWA 3SGDI 1J5OH 4OCXH 1XIWA 4U6TA 1JVKA 4J3VA 4WJ5B 1C5DB 1J1XH 2Z31C 3C5JB 1JNHA 1JN6A 3ARZA 2AABH 4AENB 1C1EH 5DJ2A 5L2JA 3OHXB 3QI9C 4QGYA 1HH9A 4ODTH 1J10A 4G8GB 5KVGL 3TCXA 4KUCF 2ADGB 2DWEA 3VXPB 4Q6IA 4RA0C 2NXZB 1BIHA 5HDBF 3GSNB 3IS0X 1MCIA 4N68A 2IC2A 4UV4L 3PWPB 3VWJC 4HG4J 1IEBA 2R23A 4NO3A 3ULUF 2AK4A 1PY4A 4UQ2B 4XMLL 5A2JH 3RI5F 3CFKA 3D85D 3NVQA 3VWKB 1UKTA 2ITCA 4QEGA 3WN5B 5B4MC 5J12B 4MA8L 2BMKB 2VXVL 3GJFK 1MRCL 3BN3B 3K8MA 4L8SA 5B38A 1AO7D 1CT8B 5A3IC 2V17H 1SBSH 1FE8H 3MV9D 5T1LD 1TZHB 3MR9A 3TBYA 2H6PB 4JM4L 1JF5A 4ZXBA 4Y88A 4GRWB 2VLMD 1OM3H 3IAGC 2NXYD 3RU8H 1W72B 1LO2L 4HW6A 4MAUH 4JO2H 2RR3A 5ICZA 1CLOL 4EJ1C 3V95A 5IG7A 1A9BB 3MNZA 4M5ZL 3QEHA 2Z91B 3V52L 4EUPH 5E8OA 1HQ4B 1KACB 3RUGF 5I73C 3J8F7 1EHNA 5LXGH 4WGVB 2XQYG 5BZWA 1D6VH 2FH8A 4NUJA 4HLJA 4XP5H 5FYKH 3VGGA 5HYQA 4MNQE 2BSRA 3QFJE 2DQUL 3QQ4A 1JCKA 1WBXB 4LSSH 2NZIA 4NQVA 2XQBL 4OD3H 1F02I 4P2QD 2YK1H 3CU7A 2R4SL 3MUY1 2L7UA 4OGAD 4MAYC 3GKWL 1CS6A 1RFDL 4P2RB 3CVHL 1A2YA 1KXTB 2IPTL 1FLTX 3R1GH 3WFEH 4MD0B 3BIBX 2ICEA 3PQYB 5EU6E 1OF2A 5GIRB 4GQ9H 3MRBB 3BDYL 1EFXD 1A8JH 1ZWIB 3O41B 3LB6D 4JKKA 5CUSH 1S9VA 3L3GB 4LDOB 4M48L 5IP4A 2DQGL 3B3IB 2Z8VC 5E2UH 1G6RB 7FABH 1KIRA 3OX8B 35C8L 4XB8A 2YOCA 3MCLL 1SVZA 5ERWB 2ARJB 4ISVB 5ELIA 3SE8H 4ZNEE 2AS5M 1U8LA 2IAND 3L3IA 1MF2H 1KLFA 1FO0L 3C5ZC 4NQCA 1UM6L 2DQCH 1KFAH 3OQ3B 4UV7H 4XP4L 4Z5RB 4CMHB 1Q72H 2DD8L 4Y19D 3BISA 5MERA 3KR3H 4HV8B 1BX2B 1PAMA 3I6KA 4MXWH 3QZWB 2IQ9H 4O9HL 2I24N 1HWHB 5AZEH 4R2GB 1XIWB 1TFHA 2QQNL 1ZHNA 4IRSC 2XWTA 1YDPA 2J8UF 5KOVC 1JNHB 4H5SA 1JN6B 1X5GA 3MACH 1JJUA 1ZMYA 2EIBA 3U7WL 3CPLA 4IEFB 1H3WM 3HC3L 3P0VL 3WIFA 5DJ2B 4WTXA 4PJFA 5L2JB 1W8NA 3PDGA 5GHWH 1HH9B 1QR4A 3DGCR 3WSQH 4RDQF 2DWEB 2VSDA 3H6JA 4H88L 4Q6IB 2LAAA 2OI9C 1ULVA 2W9DL 4I0PC 1AHWA 5HDQH 1IEBB 3G6JA 2R23B 4NO3B 4Z7QF 4KDTA 2AK4B 3MBXH 5IVZA 4M1DL 3CFKB 5D2LF 3IETA 3MRMA 3S36L 2ITCB 3WNOA 3HNTL 4NO2A 4RIRA 2E6QA 2V9RA 1PJ9A 4L8SB 1UACH 4AY0A 2B39A 5B38B 4XVJL 5D5ME 3U36A 5GJSL 4LOUD 3TBYB 3MR9B 3BMVA 3B2VH 2W92A 3AS3A 4ZXBB 1DN0A 5L7XL 3UZEA 1DANT 5IMOA 3WMSA 3LOWA 2NY0D 4X5WA 2M8XA 3IU4H 4Z7WF 5ICZB 5HYSA 1A6WL 2GT9A 2OZ4H 5I74B 4XT1C 5IG7B 3MNZB 3QEHB 4NHUA 2P49B 4QRPA 5E8OB 4CAGA 4YC2C 5F3HA 3F7YA 2VDOL 1IZKA 1WSST 5BZWB 3UDWA 4NUJB 1WAAF 3IFNH 4WDIA 5HYQB 2BSRB 1I1CA 3IJHA 3QQ4B 4YUEL 1HQRA 4O4YL 4NQVB 3DURA 4S1SH 2R0WL 3WV0A 4XCFL 1NLDL 2IBZY 3QDHA 1PKOA 4KUZH 1UWEL 4PB9H 1A2YB 3OAUH 3UJJL 4OM0H 5T1DL 1YECH 4J7RA 2ICEB 1OF2B 1JHLH 5K33A 4YHML 3UYRH 1RUQH 2CO7B 5CD5D 3MODH 1WFUA 1I1YA 2H2PD 4XRCA 4HS3A 5C3LD 1S9VB 4PRAA 4EI5A 3NCBB 3ARGA 1T7ZA 3D0VA 4I3RL 3VXUE 5E4EB 1KIRB 1W8OA 1QACA 2EYTA 3CDYA 3HNSH 2KZ1B 4IRJD 4K2UL 1U8LB 3L3IB 5FHAH 2O93L 3CZJA 4NQCB 2BDNH 1MIEH 5B39G 5L0QB 3EZ8A 4Z9KB 1JWUA 5H94A 4QHNA 3QDGD 3IKKA 5MERB 5A2KH 3I6KB 5TDPA 4YHLH 1DFBL 1IGYA 1U8HA 3K74B 1MCPL 4G9FE 3GI9H 5AEAA 5HGBA 1ZHNB 5AD0A 4JDZA 3H3KA 2XWTB 4HPYH 5IBTH 3QG7L 1YDPB 4H5SB 1A14L 5D4QA 2BXZA 1CIUA 4Y4FC 2DQJH 4H1LH 1SBBA 3CPLB 2NY4C 3Q48A 3WIFB 4KJPD 4PJFB 1Z9LA 4DKAA 1YN7A 4M00A 2GY7B 3BE1H 4FNLH 1MCDA 2VERN 1I1AC 3O6MH 2VDML 2HKHH 5AYUH 1AHWB 4KAQL 4R90H 5IWLC 1WZ1L 4XVSH 3QWRD 2AGJL 5CFHA 2AEQL 1F42A 2O5XH 3G6JB 5EUOF 5IGXL 1KBGL 5IVZB 4K07A 1K4CA 3IETB 3MRMB 4ONHA 3VXSA 3MV9A 1KJ3H 2Y6SC 4NO2B 4RIRB 4D9QD 3DUUA 2EDFA 4OZIE 4P5MA 3EDJA 1QEWA 3HG1E 4Z7VE 1AGCA 1PG7H 1OD9A 3U36B 1R3IL 1ZLVH 1CZ8H 2W60A 2F5BL 2AJXH 3MLUL 4FZ8L 4DKEH 1DN0B 1WF5A 2X42A 1TNMA 3KPNA 1A0QH 5IMOB 2XXMB 5CJXA 4X5WB 4IMKA 1WZMA 2DF3A 1BQHA 3NA9L 1PEZA 5IESH 4L3CA 4PGCA 5HYSB 2GT9B 4I18C 4FQCH 1TQCC 1S9WA 3U83A 2PTUA 4BZ2H 4NHUB 4QRPB 2YA2A 3RVUD 4BZ1L 4PS4H 4FFWC 4P2QA 4Y2DD 5F3HB 3F7YB 4XTRD 2VLJD 4WDIB 3MNVA 3F62A 3IJHB 4ODBD 1A9EA 1CD1A 1HQRB 5DFWH 4JFHD 3PJSB 5CSZA 5F7KC 4JQIL 2XXCB 5E08L 2ZG2A 3NZHL 1P5UA 4PJ8C 1X9QA 1OAKL 1NSNL 4WVRA 4U6VH 3GBLA 1UJTA 2W0PA 2DIAA 1ITBB 1S7WA 5CZXC 4HUXA 4ALAH 1X4YA 4EDWL 3I2CL 2Q20A 3HCVB 1I1YB 1IAOA 3OBAA 1KTDA 1OHQA 4PIRF 3LDBC 4HS3B 4XRCB 4M43L 2Y36H 4JN1L 1RUAH 3V6FA 4PRAB 4EI5B 3KPSE 4ZS6C 4V2BA 5FGRA 1NCCL 3SO3C 4HK3N 3ARGB 2XTJB 3D0VB 3OAZK 1KXQE 4PLKD 5KANG 4M7LH 5BOZG 5J3HC 2EYTB 2P5EE 3E1F1 1CLZL 1PKQA 4MMZC 4JG0H 4DN4H 3ZSSA 3HI5L 1OT1A 3MOBL 4O5LL 2EE9A 1FL5B 4C4KT 2C4FU 3T3ME 5C07D 3DWTA 1T22B 4HK0B 5JXED 3TO4D 2A9NH 3R0MA 4DN3H 1JWUB 3TM6A 1BD2D 4HKBA 5H94B 1XF1A 4QHNB 1EEQA 3FCTA 1KIQA 2CK0L 3QHZL 2ZCKL 1PSKL 1CCZA 2VXQH 4HLZG 4L5FH 2DQFA 5TDPB 1KEGH 1IGYB 1U8HB 3SJVE 3QUXD 2VDQL 1OAXH 4WTWA 5HGBB 5AD0B 4JDZB 1LGVA 2OR9L 4ENEC 4JM2D 4GRLC 3G08A 3V6ZB 3MPCA 4P9HH 5BV7L 1A64A 4BUHA 4M5YH 5GGTA 1OCWH 5CAYB 5T1KD 1YN7B 3EGSA 4P5TC 3MGOA 1P4LA 3AC0A 5GXBB 4P3DA 4WI8A 1QFWM 1ZSDA 5TE4L 4L4VD 4I77H 4MA7L 4Q9RL 1MAJA 2UWEE 2HT3D 4K23L 3QPXH 1UADC 4FN0A 1HINH 3GK8L 2VL5A 3SKJL 3FRUA 3EUUA 2PTTA 3RTQD 5F9DC 3JTSA 3UROR 3VE0A 4X6FB 3VXSB 3MV9B 3RIAK 4YHOH 3CD4A 2QSQA 3MRQA 4HMCA 2R2HA 3M8OH 3KPMA 3D69A 3DUUB 2D4DA 4P5MB 4LL9A 1QSEA 5F7DA 2NXYB 3S3SA 2OTWA 1AGCB 2NY1C 3CU1A 3BRFA 2W60B 3NIGE 3F58L 3SE9H 1F4XL 3MV7E 2UZYB 2VZVA 4PTTA 3G6DH 5I71C 3HA0A 1P4IH 3KPNB 4KDWA 3L95A 3AREA 5C0RH 1Y6NR 4AL8L 1BQHB 4XPAH 4L3CB 4ETYA 4PGCB 4GXUM 4YBLB 2A6KB 1S9WB 3MFFA 2X4QA 3GSXA 4OM1L 1F3JA 2DLHA 5DMGD 4DEPB 5DK2A 2GTZA 4OF3A 2J6EA 2XRAH 2WLZA 4P2QB 4AG4L 2K1MA 3BDBA 5CJBA 1RUML 1S8DA 4LCUA 2FIKA 5IBUG 3O2WH 3ZKXB 3MNVB 1HDMA 4JPKL 2XI9A 1KELL 1A9EB 3OKOA 4U49A 1CD1B 3N1MC 3ULUD 1F6AA 3O45A 5CSZB 5GRVK 2DOCA 2DM3A 1TMCB 1LO0L 4I9WD 3F5WA 3VFNA 3TT1L 3JSSA 2CK2A 5KS9F 5I9QB 1FRGL 2OP4H 4RFNB 4HKJA 2J1KA 1F97A 4JGJA 3WL9A 1RULL 4APQC 1S7WB 4HUXB 4YX2H 4S2SA 1FDLL 4JB9H 5CINL 4C56A 3LRGA 1U6AH 1IAOB 4CUCA 1KTDB 4IRJA 4OFDA 1M7DA 4TULL 3NABL 5LQBH 1JPSH 1R5WA 3V6FB 1R0AH 5JR1L 3GSQA 1RMFH 5DD1L 5FKPA 4IIQB 3KJ6L 3Q0HA 2EZ0D 1Z5LA 4LAQL 2VXSL 4A6YL 3HB3C 3QDGA 2PW1A 2CQVA 2M2DA 1PKQB 1KJVA 2FEDC 1CG9A 4YHNA 4LPUA 3NFNA 5K9OA 4GS7B 4G6ML 1MFCH 3VCLB 4D0BA 3RX7A 1F4WL 1DBAH 5DJ0A 3UTTA 3VFPA 3FCTB 1P2CA 1KIQB 3PHQA 3SCMC 1WJ3A 3AM8C 4HPOH 1O7SA 4ZFFA 2DQFB 3ZLQC 2DS4A 5GZOD 2XY1A 2MTPA 3ULVD 1S7TA 3WIHH 2ADFL 5F7NC 3VFMA 4ONGH 1NCBH 4BFIA 1NAKL 3H7LA 4KQ3H 5DEGA 3G08B 1AJ7L 3O81A 5F96H 1MH5A 3GJEA 4PJAE 2CRZA 3ARBA 1PGRB 3UC0H 2DBJA 4KQ4H 5I15L 3QWRA 5DGQA 4ZSOA 4F7TA 5DD0L 5EIVA 3EGSB 3WKMH 3MGOB 1P4LB 5DZNA 2BJMH 5TE6H 3BP5A 1HIMH 1YC7A 2ZSWA 4O58H 4IJ3B 2Z4QA 1OVZA 2NPLX 3RL1A 4FQJH 2VL5B 3T1WA 3FRUB 3QIBD 4KRPD 2PTTB 1IM3A 4EVNA 3JTSB 3VE0B 3T4AA 5HJ3A 4XX1G 1EHXA 1EGJH 5C0BA 3MSPA 5FUOL 3MRQB 4NRZA 5H37H 1A5FH 3KPMB 3D69B 1L9NA 1B6DA 4NZUH 3QO1B 1QSEB 5F7DB 1QBLL 4NBZB 2OTWB 3D6GA 5F1KC 1GJIA 1GIGH 3PDDA 4PJXE 4WO4C 1AP2A 4PTTB 2DI7A 4WIQA 4S1RL 3L95B 4ODVH 4Y2DA 4POYA 3AREB 4LSUH 4LCYA 3DMMD 1OAZL 1LEIA 3L7EA 1NDMA 1CE1L 3MRRA 3VFTA 5IHBA 1J9CT 3BPNC 15C8L 1KOAA 5EBWA 3MFFB 3DX7A 3GSXB 1F3JB 3D2UD 4OZFH 5DK2B 2GTZB 2VC2L 2ORBL 1U58A 3FO0L 4UNUA 4PRID 1VESA 1S8DB 4LCUB 2FIKB 4X0KA 5GS1A 1HDMB 5D70H 3OKOB 1RZ8A 1RZJH 1F6AB 1EVTC 3O45B 1IGML 4O02L 3WBDA 2WUCL 3AAZA 1DR9A 2JELH 4PJ5D 3LN9A 3F5WB 3VFNB 5KTEL 3ZTJG 4PPTA 1MJ7L 2XYCA 3OKKA 4JJHA 4HKJB 3WL9B 4POUB 1KEMH 1MFEL 3F7PC 5K59E 5E56A 4S2SB 4C56B 3MLVH 4IRJB 1M7DB 1UZ6E 5BMFL 2HWZH 1BFSA 4W6WB 1R5WB 5C2UB 4WTZG 1ES0A 2CKBH 5JW4Q 3GSQB 1YNLL 5C07A 5FKPB 2K7QA 3P30H 1WITA 1GGBL 2QV2A 1Z5LB 3ZDZF 3U9PL 5DDHA 3QDGB 2PW1B 1OP3K 5I75C 1KJVB 3U4BL 3ELAT 1CG9B 4YHNB 2FH6A 3NFNB 1U2CA 4U1GC 5K9OB 4OLEA 3QUXA 4UT6L 2JJTC 1J12A 4D0BB 3E6FB 5EA0H 2O5ZL 5DUML 3NCFB 5DJ0B 3BO8A 3UTTB 3VFPB 2KL6A 4XI5D 4JM2A 1NANI 1OWRM 1P2CB 3AMLA 2QJDA 1ZAGA 2YMXH 1XT5A 3PWUA 4G8GE 4ZFFB 4TUJA 3JWDH 2VISA 1S7TB 3VFMB 3QDMA 5EOCJ 4BFIB 3W0WD 3CLFL 1XCTA 5DEGB 3PWPE 5IQ7L 1D9KD 4L4VA 1U41A 1HHGA 2KKQA 1MH5B 3GJEB 4G6JL 1R5IA 3ARBB 2J4WH 5FDWA 1UM5L 4ZSOB 2YPLA 4F7TB 5IVXF 1MCRA 5E8NA 3RTQA 2EDHA 5FOBA 1GXEA 3LKSA 3VMOA 3S9DB 3BP5B 2VSCA 4LRIA 1D5IL 1KF9B 2ZSWB 4HIXH 1DL7L 2Z4QB 3RKPA 5JA8B 5CJ5A 3RWDA 3RL1B 2WV3A 2D3VA 3IDXL 3EDEA 2YD8A 1IM3B 1KCRL 2YWYA 1HZHL 4XXCC 4EVNB 3IDJA 4GRWE 3T4AB 5HJ3B 1NL0L 5C0BB 1YEIL 3O6FD 3FL7A 3S37L 4NRZB 3L3OA 4YHKL 3GIZH 2JJSA 1T0NA 3RX5A 4ZOCA 2OJZH 3GHEL 1DQQA 2F58L 3G5VA 2WP3T 3FMGH 1AP2B 2W38A 5DO2C 3OKDA 3KLDA 4FMFA 1XFPA 3C60C 4Y2DB 5HSFA 4XMKL 4LCYB 4CN4A 1LEIB 3L7EB 1NDMB 2VDLL 3MRRB 4FZEH 3VFTB 1MFDH 4P9ML 4X4MA 5EBWB 3DX7B 4URTB 3OAYK 4C58B 4MCZA 4P2RE 4LCCC 2O26U 2DQEH 4R26H 5DVLA 1Q8MA 3P9MA 1U58B 3F8UB 3PQYE 1E6OH 4QF1A 2ZJSL 4X0KB 2Y7QA 4YFDB 5GS1B 5F21B 1RZ8B 5I8OL 5JIIA 3ULSA 4S1QL 5I2IA 5K9JL 5FM5M 4PY8J 5D1ZC 3EHBC 3AAZB 1XGRA 4N0UA 3EO9H 1A3RH 1KB5A 3BHBA 4QXGL 3LEVL 2PR4L 3O9WC 2I60L 1AQKH 3OKKB 1MJ8H 4HFWA 4RFOH 1A6VH 2EXWC 2VZSA 2NW3A 3Q5TA 1ES0B 4FFZH 1IKNA 3QUZC 2FX9L 5IUSA 5C07B 3SKMA 1LQSR 3DLQR 5DDHB 5EH1A 4KI5C 4LCIH 2Z35B 3V0AC 4WWKD 3OSKA 3QUXB 5T3ZL 2VXTL 5HVGB 2BHYA 1AE6L 3BO8B 4KK8C 2VDNH 4JM2B 5CBEA 1LDPL 5GRYA 2VH5L 3PWUB 4TUJB 2HAZA 2VISB 2B4CL 1NGYA 5DZOA 1RZ7H 2DM2A 3PHSA 3MQIA 4TSBH 3QDMB 4WFGD 1ZLUH 1Q9WA 3CX5J 1DQJA 1XCTB 5GS0H 2HH0L 1YNTA 4L4VB 1N7ML 1HHGB 5BW7A 2AK4E 2DL2A 5E5UB 3SDAA 5IW1A 1R5IB 5FDWB 4YH6A 1INEH 4WHTB 2YPLB 1WWAX 5INCA 3QXUA 5SX5H 2E9IA 5E8NB 1JYVA 3RTQB 3E8UH 1MRCH 3V5HA 5FOBB 2HT4D 3LKSB 3IXTA 4HUKB 4EDXA 2HT2D 2LVEA 4PG2A 1UWXK 3IS1X 2JB6A 1NCWH 1A7NH 2ENSA 4X7EC 3RWDB 1MY5A 3UTQA 2F8VA 4XPBH 2ZKHL 3UCRA 4HC1A 2HRLA 3IDJB 4L9LA 4JHBA 1QFWI 1JFQH 4PR5A 4XNQA 1LO2H 3MNWA 4OBSA 2R0KL 5ID0A 5JQHC 4XPHH 5F6IC 3L3OB 1SHMA 5KANI 1EH9A 1T0NB 5L2KD 4NN6B 5CP3H 1L0YA 5ESAA 3MCKA 1CR9H 4F9LC 1DQQB 3DMMA 3PDOA 1UVQA 4HAGA 4OFIA 4ORGA 1CFTA 2UY6A 5CIPA 5FUZL 3G5VB 3LZFL 2GJ6D 4JO4L 4LVOC 3CFJA 2P8PA 3OKDB 4MYWB 4OBRA 5ICYA 4HJGA 4K3EL 2XQBH 3MRNA 4WFED 2WUBL 2EDKA 3JWDC 4H26A 4HMEA 4N90D 4EQ2A 2DQHL 5IBLC 3ZE2E 2FYYA 3CVHH 1L7IL 4KK5C 2Q8BL 2EDQA 2IPTH 4MCZB 2EKJA 2AJUL 3HE7C 3BKYL 3P9MB 3K46A 1A1OA 2BY2A 5DA4A 4K94C 2EO1A 4GO6B 4QF1B 3SKUD 3BDYH 5H35A 4PJ5A 2Y7QB 4LFHG 3WXWH 3V6OC 2VZUA 5FO7A 3ULSB 4DKDC 1BBJA 5FV2A 5IFAH 5E9DA 2AAVA 4M48H 1EJOH 1XGRB 3MUGA 4N0UB 2FGZA 1KB5B 3BHBB 1GC1C 4WHYH 4LHUD 1IE5A 4QYOA 3ARDA 1JZ4A 2ZCHL 3B8YA 1I3VA 1FO0H 4BJLA 4HFWB 1BZ7A 1RY7B 1UM6H 2Y9RT 5E8DL 3GSRA 3S36X 4NQCE 5JO5A 1V3KA 3N1PC 4XNYL 3VXQA 2NW3B 2DD8H 4XPGH 5IHLB 4UILH 3RVTC 4O9HH 3HUJF 5E8PA 3C08L 3D87B 3BWAA 1KENH 3I6LE 3SKMB 2IMNA 3NGBC 3R06A 1WAAA 1VCAA 4OIIL 3FQWA 1A22B 4Y89A 2H2SC 1Z9SA 1JZ5A 4NO0D 1T80A 3IAPA 3U7WH 5B8CA 3P0VH 1S7SA 3WO4B 1PYWB 3NCJH 3W0WA 1CYGA 1U8QA 4PJFE 5CBEB 1D9KA 3C6LC 3HN3A 4KU1A 3IFPA 4JVUA 3L5XL 1NGYB 4X4XA 5CBAA 3ZYZA 1JPTL 1Q9WB 1OP5H 3MRPA 1YNTB 4M1DH 4WFFE 3G6JE 3SDAB 5IW1B 3HNTH 5INCB 1U3HC 3MZTA 3B2UD 1CXLA 5DEZA 2GUOA 3V5HB 3IXTB 2BRRL 4EDXB 3SY0A 1UXWA 3FT3A 1OAUH 3LKPA 2GSGA 5GJSH 5IW6A 3WHE0 2JK5A 2JB6B 5JDSA 3I75A 3UTQB 4JZJA 5L7XH 2WNGA 4PBXA 4MJIA 4LSVH 1UA6H 4L9LB 4XNQB 2Y1VA 4PR5B 1YEJH 1FGNL 3MNWB 1D5MA 4M6NH 5ID0B 1A6WH 1F4YL 2EE6A 4RZCA 5KVMC 3ILPA 4OD1H 1C7TA 3DECA 3M07A 2GAZA 2MCPL 2X4NB 5ESAB 3MCKB 3DMMB 3RGHA 3PDOB 1UVQB 4ORGB 4QRPE 1CFTB 5CIPB 4YXKL 2VDOH 3CFJB 2P8PB 1K6QH 5ICYB 4HJGB 1YNKL 4YUEH 1YA5A 3GM0A 1SYSA 5DRWA 4Q9CA 5JPMA 3ORJA 3MLYL 4Z95L 3MRNB 1H3PL 2R0WH 4XCFH 1L9MA 1NLDH 4H8WH 2PETA 5DS8A 1VDGA 2C7UB 2FYYB 1UWEH 3RJQB 1BJ1H 5AWNH 5L8KB 3B4NA 5D1QA 1UC6A 1YC8A 1EV2E 1A1OB 4YHMH 4JAMA 3IJYA 5H35B 4PJ5B 3TWCL 3QFDA 5D5MF 5FO7B 1BBJB 4XPFH 5E9DB 1IJ9A 3GKZA 2LFGA 5ESVA 3O8XD 4HGKC 3BZFA 1QSFA 1YMMD 3MUGB 2XTJE 5JHLH 5E6IC 4RNRA 5C0CD 3VGBA 3H0TA 1FG9C 4X6BA 5EIQA 3A67H 3T2PA 3S34H 4HUNB 1U3YA 4QYOB 3QEGL 3ZZ1A 3ARDB 2Z31D 1BZ7B 4R0LA 4M8QA 3JVGA 1MCSA 2WZPD 1HKLL 3GSRB 5JO5B 2EDXA 3VXQB 5DZLA 2AQ2A 5IVNA 1S7QA 3DBXA 4WWKA 4NO5A 4GT7A 3QCUH 3VXOA 2P5WA 4QLRA 2KZWA 5JOFA 5E8PB 1DFBH 1MCPH 3BWAB 1EERB 1IILE 5HY9A 1JGLL 2FD6H 3R06B 1T66C 3EOYG 2HFTA 5HD8C 3QG7H 3VD9A 3ZYJA 3H9SD 1MI5D 1A14H 3FQWB 3O2DL 3A6BL 5B8CB 3DXAD 3MJGX 4YGAB 3VGEA 3QHFL 3QUMA 2R1YA 1S7SB 1MRDL 3MOQA 1DLFL 1TENA 5HGDA 3W0WB 2QADD 2EECA 1U8QB 1QFUL 4ZO9A 1D9KB 5B4MD 5T3XD 3HZKB 3QIUC 4K7PX 4P23C 1EHLL 1I4FA 2OBGA 3IFPB 2Y23A 4WW2A 4RWYH 4X4XB 3CC5A 5MP6H 5CBAB 1WZ1H 4FFVC 4U7MA 2AEQH 2XKSA 3D39A 3MRPB 3WD5L 1KBGH 1AD9A 1IZJA 1ZLWK 3UPCA 1GZPA 4J23A 2YD1A 1FZKA 3VXSE 1WT5A 3EYUL 2GK0A 3I3BA 2GUOB 3EBAA 1ADQA 3SY0B 1XH3A 2VLME 1UXWB 3FT3B 1R3IH 3LKPB 2GSGB 5IW6B 2F5BH 3H9ZA 5JQ6L 1NBVH 3MLUH 2OM5A 2JK5B 4FZ8H 5JDSB 4JO3L 3I75B 3NN8A 4NQXA 4JZJB 2W07A 1Z9OA 4MJIB 4TQEH 1FZOA 4YEEA 3NA9H 3SE4C 2GJ6A 2IWGA 4LLQA 3CXHK 3KJ4B 1CFBA 2EC8A 5D71H 4RZCB 5HYIA 3ILPB 2GAZB 3ZTNL 1IQDA 3FRPA 3EYQD 1W0YT 4Y5VA 5GS0D 3WDHA 5DD3H 2L4OA 5HBBA 5FUCC 1DVFC 4P2QE 2YSSA 5JIKA 1XGYL 5CZVL 4D0CA 5DRWB 1BREA 1SYSB 5JPMB 5E7FA 4JQIH 1IMHC 3B5GA 3NZHH 5J7CC 1J88A 4XAWL 5DS8B 1OAKH 1VGEL 3SQBA 4NGHL 4DKFL 4WI7A 5D1QB 5BJTA 3FOLA 3GI8H 4GXVL 4JAMB 3IJYB 1W0VA 3C5ZD 5HGAA 4Y7MA 4DGIH 4Z7VF 5HGHB 3T0WA 3QFDB 4M7LT 4LHUA 3B8SA 4U0RB 1TPXB 7CGTA 4Z7UA 5ESVB 1E4WL 2EH7L 3BZFB 3DV4B 1QSFB 2E9WA 1Q0YL 2DBLL 2CXGA 1TZGL 2XG5A 1HXMA 4KTYA 3FFCA 2PYFA 4RNRB 3H0TB 3B9AA 4X6BB 1CLZH 5HYJD 4JJ5A 3BP6A 4IRSD 3P0YL 1PKQE 4HT1H 4R0LB 2CLVA 4M8QB 1CQKA 1F58H 5MHSD 2NLJA 4N1CA 2ICWI 1OTTD 4U1IA 3TC9A 4X7SH 4LDLB 1S7QB 3DBXB 1U3ZA 2CK0H 2QTEA 5A2LH 4NO5B 3LH2L 4NO0A 2P5WB 5JOFB 4GUPA 3VW3L 1A02N 2HTLC 2VDQH 1YJDH 5HY9B 1YY8A 5EBLA 1RIUL 5F9AC 4AMKL 4I0PD 4JO1H 2OR9H 3FKUS 1AQDA 1IGJA 4OT1L 1BZ9A 1NAML 4NC1C 1J0KA 3ARFD 3PL6A 1FYTA 4Y4KC 5BV7H 4GKZA 1B4RA 5E1AA 1DQTA 1LK3L 3N0PB 4HH8A 3QUMB 2R1YB 1XCQA 1C12A 5HGDB 4IOFC 1J8HA 1ND0A 1U36A 1EZVY 3U0PA 5KS9A 3GM8A 2VAJA 4YXLL 5AUMA 4MQ7A 4M7KL 1I4FB 4JY4A 4N0CC 4MA7H 4Q9RH 2E7HA 2H32H 4WW2B 3CC5B 1EMTL 4XAKD 2XNAA 1QKZL 4K23H 1EZVX 1NC2B 3FO9A 3WJJC 3D39B 3SKJH 3KVQA 5GRUL 3UTOA 3VU2A 2LABA 1QPPA 5KSAC 1QFOA 2MKWA 1GZPB 3M17A 4G8FB 4Y8AA 1FZKB 3RZCC 2F74A 5KVEL 2GK0B 3W11C 5EZOL 3T3MF 1HSAB 1XH3B 4F58L 4KMTH 1M05A 4DUWA 1IC7H 2DQTL 1QSEE 3LKOA 1NMCC 3F58H 4KRMB 1BWMA 2HLAA 3NN8B 2KUTA 4NQXB 4WCYL 2F9BT 5I1CH 4R7NA 2YZ8A 4WFHD 1FZOB 1P53A 2CUHA 3S5LA 5AZ2H 4TTDD 2GJ6B 4AJ0A 1CK0H 4LLQB 5CS7A 1CDBA 3DROA 5TFSH 4HXAL 1FGVH 1IQDB 5IKCB 4Y5VB 3DPBA 2NY3C 4JY5L 2YSSB 3MV11 2OQJA 3ARUA 1RUMH 2FCBA 4U6YA 1BZQK 4JPKH 1KELH 1SQ2N 4D0CB 5HPOA 3H9YA 1Q38A 3QDJD 4OF0A 1CGSH 4DJMA 5HI4C 4XCEA 2E7LA 1NPUA 3TT1H 4YPJA 1F11B 1FRGH 5BJTB 1JPST 3O8XA 3VDAA 3FOLB 3KPRD 3CFCH 1RULH 4JKLA 5HVWA 1YMMA 4F57H 1YQVL 1INDL 4M02A 1W0VB 4ODHL 5CINH 5C0CA 5HGAB 4JDVA 4LHUB 4TULH 1T89C 3NABH 4C56E 3W81A 5JR1H 4Z7UB 5TPWH 2Z31A 1DTUA 4XP9L 1QYGH 4R7DA 3QISA 1S78C 4LK4A 3UZQA 1HXMB 3DJ9A 2PYFB 3FFCB 4IRZL 5EWIH 4EUPG 5C92A 4NJAL 2VXSH 4XNZC 3QI9A 2AERT 5FKAB 4JJ5B 3BP6B 4B7LA 4MHHG 4JGMA 3QDGE 2AV7A 2VYRE 1M7XA 1MREL 2CLVB 4G6MH 2GHWB 2NLJB 1MVUA 3H9SA 2E9JA 3I9GL 4U1IB 5E2VH 1K8IA 5FGBC 1T2QH 3VWJA 1AR2A 3UTTE 4NO0B 4OCRL 3HC4L 3DXAA 4GUPB 4LCWA 2ADFH 4MA1C 1AQDB 2EDNA 1BOGA 3ZHDA 1IGJB 1BZ9B 1AJ7H 3QNXB 2X1PA 5H8DA 3PL6B 3RNKA 1FYTB 4GKZB 5E1AB 1T83C 4MXQC 2X4TA 1TETL 4ZTPL 1AR1C 5DD0H 1C12B 4HGMA 1J8HB 1ND0B 2HFFA 5DI8A 4ZSOE 3U0PB 1FNSL 3DO3A 3RVVD 5KS9B 5D7SL 1LE5A 4MQ7B 4ELKA 4JFZH 4JY4B 4X99A 1CDHA 2XNAB 1VB9A 3FO9B 5F7MC 4JHAH 1B0WA 3MGTA 3S8WA 3M17B 4UAOC 4MNGB 2HLFC 5C0BE 2F74B 3T4YA 5F1SA 1TQBC 1QBLH 1DBML 3P11L 4YBHA 1M05B 3LKOB 4Q2ZA 3ARWA 4Z0BL 4GAJL 4FFWD 4JQXC 3VA6A 4LSDA 2HLAB 4MNQD 5L9DH 3QFJD 3Q6GH 4MAYA 4R7NB 1JIBA 4P2YA 1FN4A 3S5LB 3QCTL 4X8JA 4WU7A 2V5TA 4XNXL 2DYPA 15C8H 3PXHA 4PJ8D 3F7QA 5EU6D 4PJAF 2B1AH 2VC2H 4JFHE 5BV7C 2ORBH 1BOYA 3FO0H 2PW2A 2A6DA 1S5IH 2OQJB 3CX5K 2ADIA 2GIYA 2FZ3A 4U6YB 5ILTL 4U2YA 1GGYA 4P46C 5I1KL 2CRMA 4YWGH 5TDOA 4P59L 3TIEA 4B7IA 2CUMA 2WUCH 5E0QA 3VFGL 3C5ZA 4HIHA 2PO6C 4XCEB 2EYRA 3BPLC 5DT1L 5J3HD 2HJKA 3O8XB 4JRXD 2RQ8A 5DJXA 2XV6B 1MFEH 1YMMB 4FQPA 4YHYC 2X9WA 4YE4H 5C0CB 4JDVB 1QLRA 2SEBA 4IRSA 4PJXF 4MJ5A 3SDYH 2Z31B 4LSRL 1YNLH 3T65A 3QXWA 4J4PD 4R7DB 5CLTA 1WCBA 3ARYA 1GGBH 2EDLA 3GMRA 5C07E 2VDRL 3QI9B 2IG2L 3QQ9C 2AV7B 3LD8C 3MROA 4NM8L 1BQUA 1LO5A 3TF7C 4UT6H 1VPOH 2C3XA 1MVUB 4I0PA 4WGWB 3C2AH 3S37X 3WFDL 3H9SB 4MJ6A 3VWJB 3AFLA 1A3LH 4FA8A 3ARFA 5HHXL 3P9WB 5I1DA 5TGBA 4W4OC 4LCWB 3DXAB 4FQ1H 3MLSH 4R4FL 3EDDA 3CH1A 2BY3A 2FECL 2P48B 4NP4H 4FQQA 4OF6A 5HI5C 4Y8DC 3QDME 2LU3A 4R8WH 1OP9A 2J6EL 3RNKB 2QKIA 4G6JH 4L4VE 1UM5H 2X4TB 3WIIH 4OB5H 5FHBH 5DI8B 2HFFB 2YPLE 2ED7A 4NZJA 2JLLA 1LE5B 3H8NA 3RP1A 5K59F 1XGQA 1G9NL 4OCYL 1DL7H 1JGVH 2ERJC 4X99B 1UZ6F 1T1YA 5D7KD 5KOMC 4OLZH 3IDXH 1A7PL 3L1OL 2DM4A 1KCRH 2DLGA 3V2AR 4YGVA 3NFSH 3AB0C 3MGTB 1YEIH 4CW1A 3OG4B 5I73B 1CN4A 3OJDA 4YHKH 3OG6B 1GL4B 5D8JL 2R69H 3T4YB 2ED9A 2G5BA 3GHEH 5A2FA 2F58H 5KSBA 4Q2ZB 2R2CA 4P2OC 1X44A 4U7KA 1C16A 4MAYB 4PJBA 2Q6WA 4H1LG 1FN4B 1XGUA 1F8TL 5C6WH 2MMXA 4M7JL 4OI7A 4OSUH 3OXRA 4X8JB 4WU7B 1VA9A 1NMBH 5HDBE 4R3SA 2DYPB 4BQ8A 4D2NA 1RK1A 4FQXD 2O5YL 4WHCA 5DVOA 4X4ME 4NWUH 5FGSA 1E4XL 3QDJA 3KYMA 4L8BA 2PW2B 2A6DB 4GBXC 4X7DC 4G7YH 2ZJSH 4APQD 2ADIB 4RDQG 1FSKC 4O2FA 2FZ3B 2DWDB 2ZUYA 1RIVL 5BQ7A 1A7QL 3KPRA 4QXTA 5TDOB 5JHDA 3TIEB 2B1HL 5K9JH 3ILQC 3JWOH 3MRCA 5EULV 3C5ZB 4HIHB 2N7BA 4KROC 3LEVH 2EYRB 2PR4H 2XA8L 4GRWF 4DGVL 4N0UE 1X5ZA 4E9LA 2IAMC 2I60H 1I8MA 2HJKB 3HB3D 1RHFA 3P3YA 4Y4HD 2OL3L 4HWNA 4OCXL 4LIQE 1QLRB 2E7BA 1J1XL 3V4PH 2SEBB 4IRSB 3CUPA 4CADA 1GAFH 4MJ5B 3T65B 2FX9H 5EU7C 2Q87A 5F97E 4OUUA 4Y4FA 3VFUB 1WCBB 1SJHA 5I76A 3GMRB 1I7RA 2BVPA 4ODTL 5J6HA 4FQIL 4UQ3A 3RFZC 3PWVA 3MROB 3INUH 4AM0B 4J6RL 1I1AA 1LO5B 2OI9B 5T3ZH 4Q7DA 3I84A 4JFXA 4I0PB 4JFFA 4P48A 2IQAA 1YEFL 4ZUUA 1HHIA 3ULVE 5IWLA 4MJ6B 1A4JA 4NOFA 4AEHH 4PTUA 1LDPH 1GVIA 3K2MC 2FEEL 2VH5H 5TGBB 4LRNH 3BD4A 2B4CH 1CGWA 2R56H 2IMMA 3JBG7 3P0GB 4FQQB 4G3YH 2HH0H 1JZ7A 1HYSC 2QKIB 3KWWA 2V17L 1CDCA 2P45B 1SBSL 2XFXA 5HHNA 1MHPL 1C08A 3LQAL 5ICXA 3L7FA 4LPCA 1P84K 3CJJA 1OM3L 1JTOA 1VEPA 3HE6D 1XGQB 4MAUL 1MAMH 5F71A 2BSSA 1T1YB 2ESVD 5DFVC 4X6CA 4I18A 4ODSL 2ZKHH 2VAAA 4YGVB 1FFPB 2GW5A 4QTIH 4YO0A 4YQXH 3DYOA 3WNMA 5DTFA 4CW1B 4YC2B 3HUJA 2R0KH 5J9PA 5LXGL 4MJ2A 3BVNA 1N4XH 5IVOA 4MNQA 3OJDB 5CEYA 2DQIH 4XP5L 5JZ7C 2VL4A 2G5BB 3PUCA 3HFMH 1XAUA 5DYOA 4LSSL 4OD3L 5KSBB 2NZ9D 4FABH 5FUZH 3HMXH 1A4KA 4JO4H 3HNVH 3LPFA 2DKUA 3KS0H 4PJ8A 3CXDH 3T0EC 1C16B 4PJBB 1AI1L 2VR9A 2Q6WB 2AEWA 1CDGA 1XGUB 1MCEA 4Q58C 3R1GL 4K3EH 4KXZH 4YK4C 3MZGB 2WUBH 4M1GL 2QHRL 1F13A 2RIKA 3NIFF 4GQ9L 1MIML 4R3SB 3RWGA 1RK1B 4XVUD 4TUKH 3U7YH 2Q8BH 2IH3A 1AXSA 2AJUH 2ZZUT 2VZ1A 3QDJB 3KYMB 3GSNH 3I85A 4L8BB 3B5HA 5E2UL 7FABL 2EDBA 3MJ9H 4O2FB 3TVMC 4IHOA 4PJ5E 5BQ7B 4JRXA 4QXTB 2WBWB 5JHDB 4QRRD 1U42A 5E9DE 3RA7H 2C3VA 4JVWA 2WWKT 2DQCL 1LD9B 2P5ED 3I50L 2C4FT 1KFAL 2BFVL 3PGFH 4LMQI 1MPAL 4UV7L 9CGTA 1T21A 2OS7A 2D2OA 1Q72L 4HMDA 4JKMA 1I8MB 1JPFA 4ODUA 4LPTA 2ZCHH 1BVKA 5E8DH 5AZEL 3SGEI 2CPCA 2P7TA 1PLGH 3DNKA 5E6ZA 1CGVA 4XNYH 5D7IA 4GRWH 3GEWB 3U0TB 3CUPB 3DVFA 4CADB 5F93C 4DAGH 1C5CL 2VN7A 1W72H 4DFHA 4OUUB 3SJVD 4Y4FB 5FYJE 1B9ZA 1SJHB 5I76B 2NY4B 3WFCL 1GHFL 1I7RB 4LVNC 5EG6C 5ABDE 2BVPB 2ZG1A 3WSQL 4PYHA 4OIIH 3F7RA 4NCDA 3MJ6A 5J6HB 4P5TA 4UQ3B 1WFNA 3PWVB 2DLIA 5I8CA 3FAXA 5BO1L 1I1AB 2W0FA 5C08A 3T8XB 3ZE2F 1LK2A 4JFXB 2Q76A 4JFFB 2IQAB 4NKMA 4ZUUB 1HHIB 5HDQL 1A4JB 1BQLL 3VD7A 5E00A 4KPHL 4PTUB 3KYKH 3W0WE 4GLRH 5E24E 5C71A 2WQ8A 4CN6A 5BRZD 3EO1A 4ONFL 3HZYA 1E6JL 1KUMA 3QIWC 1ZA3B 3NACH 1EAJA 4L8DA 4EQ3A 3ULUL 1UACL 2FEEI 2APTA 1UFUA 3V7AG 2PCPA 3BN9C 3KWWB 2A0LC 2JF1A 1Y6KR 2XFXB 5HHNB 5F7HA 4OQTH 1C08B 5ICXB 4X5LA 1TVBA 3L7FB 2BRRH 1CGYA 2ATPA 1KJMA 3QCVL 3DTXA 4OKVA 5E94A 2BSSB 1G6RH 2VUOA 4HD9A 1HK6A 4XWGL 4D9RD 4X6CB 4I18B 1KB5L 2VUYA 4LVHC 1TQCB 5CD3A 2VAAB 5DO2D 4YO0B 4MJIE 1FGNH 5DTFB 3HUJB 5J9PB 2DLEA 4I3SH 4K9EL 2YXMA 3BVNB 1F4YH 4MNQB 5CEYB 1RJZA 4F3FA 4YFEA 3QJHA 2HP4A 1CFNA 1X7QA 5DYOB 2YRLA 4HSQA 1TVHA 4S1SL 4MHHI 3AS1A 1A4KB 1LEKA 4PJFF 4PJ8B 3IDMA 4HS8L 1H3TA 1NMAL 4FQXA 1YNKH 2A9MH 1YECL 3MLYH 3UYRL 4APQA 3IJSA 3RWGB 5D1ZD 1AD0A 2DTSA 4XHJC 1YEDA 4OFVA 4OGXL 3G6JF 3LDBB 4OCWH 2IH3B 1AXSB 3SO3B 3WFBH 3MUHL 2DMCA 5FIEA 4CVUA 1HCFX 1F3DH 2FGWL 3TWCH 4IHOB 2QHLA 2EXWD 5SX4H 4JRXB 1TJGL 2EDRA 5H37G 2C3VB 5GISL 5HVFB 3QUZD 3WO3B 2L7JA 5IQ9A 5J06A 1QSFE 5IB3A 5C6PB 1LO4H 2X9XA 1T21B 2A83A 1JPFB 3F12A 1MUJA 3QEGH 4W4NA 4KI5D 4PP2A 1AH1A 3SCMA 5GJTL 2NMSA 4P3WA 5SWSD 1BVKB 3AM8A 2P7TB 1HKLH 1DQLH 1WTLA 2L0DA 1HWGB 5GRJL 3TYGH 4KFZC 5D7IB 1NEZA 4JFYA 5IBTL 1KCLA 1EA9C 3DSNA 2ARJQ 3QJFA 2DQJL 2LE9A 4GRLB 4LLDA 5I0DA 2FJGA 4MS8C 2VWEC 3X17A 2P5WE 2VZTA 1G7HA 2HMID 5LBSL 4YDLC 1JGLH 1CICC 4OZFG 2FBOJ 5TDNA 1J8KA 4P5TB 4PJ9D 2YRZA 5IMKA 5I8CB 4MQXD 1MSPA 2W0FB 5C08B 3THML 5H2BA 5AYUL 4R90L 3QHFH 1LK2B 2Q76B 3VFOA 5CLWA 1MRDH 4NKMB 3TN0C 4LLUA 1IAMA 5E00B 4WNQA 1EHLH 3N85H 3TFKC 3EO1B 5FYLD 1SY6A 2EE3A 3D3VA 1HHHA 3HZYB 4JKPL 1KN4L 4P2CG 4L8DB 5J1AB 3WD5H 1Z3GL 3D39E 2X4RA 2PCPB 2NY1B 4TVPD 5JLZA 1CDYA 2AJXL 2ESVA 3MRHA 4WO4A 4MZ3A 4PV8A 3EYUH 2VR4A 1CL7L 1TVBB 5I71B 1BJMA 1A0QL 2ATPB 5I6XC 1ACZA 1KJMB 1X6LA 3S88L 4PP1D 3ESUF 3DTXB 4PREA 2E6JA 2IFFL 5JQ6H 1OWWA 4OKVB 5E94B 2V2WA 4JO3H 4FQCL 4HDIA 1QSVA 5DGRA 5CD3B 3VGFA 4LPXA 5KSVA 3HRZA 4HXBH 3FJTA 4XCYA 4JR9L 4H1LB 1H5BC 2OXGA 1HNGA 1RJZB 4WHDA 4F3FB 3O6LL 2YA0A 4UTAH 4OAWA 1CFNB 3NCYS 3ZTNH 5FF6A 5IBLD 1TVHB 1E0OB 4ZFGH 1LEKB 3HE7D 4M62H 4DW2L 3AVEA 4HJ0C 4NQSA 4TOYH 1XGYH 3IDMB 3SDDD 4KTDL 4NOBA 4FQXB 5E95B 1KULA 1CD8A 5C2BL 5HHQA 5IFJA 3FZUD 2B0SH 1ORSA 4Y5YC 4ALAL 4APQB 3IJSB 1XF3A 3ZE0E 1AD0B 4XAWH 1YEDB 4RMRA 1YEGL 4NGHH 4QRRA 4JEGB 5B3NA 3BD5A 4GXVH 4JPWH 5LWYL 2P5EA 3REVA 1ORQA 3GSWA 2R39A 4M7LL 4HZAA 2AXJA 3E6HA 5DVMA 3O4OC 4JG0L 5F7WC 3QR2A 4NFCA 2EH7H 1Q0YH 2DBLH 3BYYA 4Z7UE 5IQ9B 4GW4A 2JJTA 5IB3B 4DN3L 4YBQD 3FFCE 2A83B 3F12B 1MUJB 1KYOK 1T20A 2EXYD 4XBPA 3P0YH 3T3PF 3VXTA 4PP2B 3L3DA 3SCMB 5J11C 1SEQL 4JQVC 4GG6A 1EEZA 2H2SD 2VB5A 3BH8A 3VFVA