5B1JC

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase/electron transport
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jC00
2IH9A 1AACA 1J9QA 4F2FA 2UX7A 1W6LA 4E9QA 1BYPA 2N0MA 3D12B 3EH4B 1ET5A 3QJQB 2FQDA 5D4IA 1AZRA 2BP0B 4FA7B 4YSPA 4KNSA 1V55B 1NTDA 5AFAA 3S8GB 4FAAB 1E5YA 1PLBA 3NJMA 5PAZA 4DPBX 1RKRA 5LDUA 4DPCX 1JERA 4CSZA 2EINB 3FSVA 1M9WA 4A2HA 1XB6A 1CUOA 1PLCA 3FSWA 3MX0B 5I6KA 1L9PA 6PAZA 2YAPA 5AZUA 1NDTA 2MRYA 3FPYA 1JXDA 3JTBA 4BDVA 2MTAA 4G7SB 5A7EA 2IDFA 3UACA 4G7RB 1JZHA 2XVBA 4QLWA 2PPAA 4KOBA 1I53A 1L9SA 1M56B 1OE3A 1JZIA 4HALA 2Q9OA 2FNWA 3BQVA 1SJMA 1OCOB 2W8CA 3IN2A 4YVNA 2X87A 3X1GA 3WKPA 4UF7C 2BHFA 1UATA 2IDTA 1JXGA 4G70B 3X1FA 4DP2X 3WI9A 2VSMB 1E5ZA 2VSKB 5I5MA 1AZBA 2DV6A 4P5RA 4BXVA 2VW4A 3ABLB 1AS8A 3FU7A 1AG0A 4GP8B 4A66A 1IKOP 1W8EA 3AZUA 2FQGA 4AKOA 2UXTA 1A3ZA 2CAKA 4AZUA 4E9YA 2PLTA 2EIKB 3IBOA 2PP9A 2UXFA 1NZRA 5PCYA 1ILUA 2FT6A 3DKHA 1GR7A 1KCBA 4GYBA 1OF0A 2WO3B 2TSAA 3GDCA 3AG1B 3FU9A 4BK5C 4BXSV 4A2FA 2XV0A 3WNJA 4UANA 1NPNA 1DZ0A 1NWOA 1WA0X 3N55A 4YSAA 3UAEA 3X2QB 2DYRB 3FU7B 4YSSA 2CCWA 2XV2A 4AKPA 1SF5A 2XX1A 1CYXA 1ET8A 3OMNB 4AKQA 1ET7A 1ID2A 2XXGA 1JVOA 3TA4D 3QPKA 5D4HA 1ASOA 4HCFA 3U25A 1SF3A 3PAVA 4YSOA 2DWTA 3NJIA 1L9TA 3ASOB 1JZFA 3IN0A 3H56A 2OV0A 1DYZA 2HX8A 1V54B 3EF4A 3SQRA 2BW4A 4BWTA 1MZZA 1NIDA 2GC7C 1PAZA 2IH8A 4F7KA 2OCCB 2HRGA 3DIVA 5B1KA 3V9EA 1NICA 3X1EA 5EHFA 3CVBA 6PCYA 4TXVB 5I28A 3JT2A 2Y69B 4GXFA 2XXFA 3FQ1A 2J56A 2HX9A 2YAHA 2YQBA 1AIZA 3NP3A 4DP6X 1AG6A 1GSKA 2FQEA 2VM3A 1KDIA 3OM3B 2XX0A 3C75A 4DP7X 2PP8A 4KNTA 3QJUB 2XYBA 4GP5B 2J5WA 2HZHA 4PAZA 4KOCA 2XUWA 3ZIYA 4YVUA 4CSPA 1FFTB 1BQRA 2IAAC 5I6LA 1ZPUA 2IWKA 2ZOOA 1NWPA 3T71A 2GBAA 3CDZB 4BWUA 3N2JA 1AZNA 2AZUA 1GW0A 1B3IA 2LLNA 2YARA 1T5KA 3HB3B 2BZCA 4YSTA 4A67A 1KCWA 1ZIBA 2XV3A 1SNRA 2FT7A 3PAZA 3DTUB 2WSDA 3NSFA 3ABKB 3T6XA 3S3BB 2XU9A 3WIAA 3NJHA 3NT0A 3NJFA 1AS6A 3IEAA 1NIAA 4UAHA 4YSEA 3NP4A 1TEGA 3QQXA 2AZAA 3EH5B 2YAMA 3V9CA 4ZK8A 1ASPA 3PLYA 2H3XC 3CZUB 4A2GA 5ANHA 3OQRA 3OMIB 4BDVB 1L9RA 1R1CA 4YSUA 1FWXA 1PF3A 2CUAA 3FQYA 1IBZA 1A8ZA 2FTAA 4KO9A 7PCYA 2IDSA 1MG2C 4E9TA 2QDWA 4NERA 4A68A 3PPSA 2X88A 1ETJA 4WKXA 4YSQA 3S3DB 2HLEB 2R7EA 3TASA 1PLAA 5I26A 4JHUA 1QNIA 3MBWB 1QLEB 3GYRA 1SDDA 5B7EA 1AANA 4DP9X 1L9OA 4DP8X 1F56A 4YSRA 3WKQA 2IDQA 2CALA 3CVCA 2PPCA 2BP0A 5F7AA 4Q89A 1OE2A 3FS9A 2IWFA 3CG8A 1J9TA 2H47C 3NYKA 4HAKA 1WS8A 2FWLB 1RZQA 1TKWA 3FSZA 4DP4X 2BWDA 3UAAA 4AI7A 4E9VA 5TK4A 2BP8A 1CC3A 7PAZA 1BEXA 2IDUA 2BP8B 1NPJA 3AG4B 3NJJA 4E9RA 1XMEB 3EH3B 5FC9A 3NSDA 1EZLA 4W9ZA 2Y1AA 1PMYA 1BQKA 4HCIA 4NB7A 1PNDA 3TBBA 2QDVA 4HCGA 2PP7A 4F2EA 1FA4A 1NIEA 5D4JA 1ZDQA 1TEFA 2W88A 1BXUA 4YSDA 3AW5A 3QJTB 2VM4A 1PZCA 2UXGA 4DP5X 2VW7A 3ZDWA 2VMJA 2HRHA 3AG2B 1NINA 4G72B 1MG3C 2UXVA 2PCFA 3EHBB 4W1TA 2DWSA 2OJ1A 1KBWA 2VN3A 4YSCA 4N4YB 3IE9A 1CYWA 4HZ1A 2JKWA 3ZX1A 1A65A 3S3CB 1J9RA 3X1NA 1RCYA 2HX7A 2YAOA 2A3TA 2YAFA 2B08A 1J9SA 1E65A 1HAWA 4AX3A 4G7QB 4ENZA 1KGYE 4EF3A 2QPDB 1WAEA 4M3HA 4E9SA 3HEIB 1AQ8A 1RZPA 4GY4A 1KBVA 3ZBMA 5I5IA 1L9QA 4L0PB 2BO0A 1QHQA 1X9RA 2XLLA 5I6PA 2GHZA 4E9WA 1OCRB 5E9NA 3FQ2A 3UABA 1JZGA 1URIA 1MDAA 3ABMB 3NJLA 4JHVA 1WS7A 1J5CA 3FSAA 3NJGA 3PAUA 4KNUA 3CDZA 2IWEA 2CBPA 1AR1B 1JXFA 2B3IA 4YL4A 4WTQA 2JXMA 1XB8A 4N8UA 2AFNA 2HXAA 2GB2A 2E86A 3SBPA 1ADWA 1GY1A 1XB3A 3OD3A 3T6ZA 1HFUA 1AAJA 3NSYA 2YXVA 1ZDSA 3PCYA 1PNCA 2AVFA 1AZCA 1HAUA 4KO6A 1IBYA 3AY2A 4HIPA 3NJNA 2YAEA 2JFCA 1AS7A 1A4AA 1IUZA 3ERXA 1KDJA 3WG7B 3RYMA 3FU8A 3ABGA 1EHKB 3T9WA 2I85A 3CVDA 3G5WA 4DP1X 1ILSA 2H5UA 3QJRB 5B7MA 5TK2A 2ZWNA 1YLBB 1PZAA 4QKTA 1V10A 1SFHA 3KW7A 8PAZA 4Q8BA 3WNIA 1KV7A 2TSBA 2PPEA 1OCZB 2P80D 1VLXA 2EILB 2EIJB 2J55A 3OMAB 4E9XA 3NJKA 5B1JA 4HHGA 2PPFA 3KW8A 1AZUA 1JOIA 3ASNB 2CJ3A 1OE1A 4G71B 1MZYA 3H4HA 1BAWA 4P5SA 2FJSA 2BZ7A 5B1BB 2P80A 1J5DA 4HHWA 1PCSA 1BXVA 3SBQA 3T6VA 3L45A 2AANA 3AG3B 4KO7A 1N70A 1A4BA 2EIMB 1KYAA 3UGEA 5I6MA 1BQ5A 3H4FA 4PCYA 5I6OA 3TBCA 3SBRA 1OV8A 1JZJA 1NIFA 1GYCA 5F7BA 4X4KA 4KO5A 2UX6A 3GXUB 1A4CA 1BXAA 1SFDA 2ZONA 1W6WA 2FT8A 4DP0X 4NAJA 4M4RB 5AKRA 1E67A 1ZIAA 4JKNA 4RH4A 2I7OA 3X1BA 2YXWA 2BW5A 5B3SB 2NRDA 1AOZA 3PXLA 5B1AB 2GC4C 2QPEB 1SDDB 1OOWA 1ASQA 2DYSB 3QJVB 2WO2B 2BWIA 9PCYA 2R7EB 1SHWA 3FYEB 2GIMA 5I5JA 2J57A 1IC0A 5I6NA 1X9UA 2RACA 3FYIB 3QJSB 2DY2A 3NSCA 2GI0A 1E30A 2Q5BA 1WA2X 1CURA 3FT0A 2PCYA 4GP4B 4BWWA 1OCCB 1GY2A 4DPAX 3TU6A 4A2EA 1N68A 1PY0A 1PZBA 1WA1X 2VW6A 2PPDA 1SHXA 1TU2A 1GS6X 2I7SA 2ZXWB 3BVDB 2YAQA 3T6WA 3UADA 2XWZA 5B1JC 2FQFA 3S8FB 1JVLA 1GS8A 1NIBA 4K9JA 1GS7A 4A2DA 5IY5B 1ZV2A 1BYOA 2GSMB 4MFHA 5B7FA 1M57B 1JZEA 2QT6A 3FPXA
chains in the Genus database with same CATH superfamily
2YPLA 1LEKA 4XN5A 1JK8A 3A3YB 1MCOL 1W6LA 1FH2A 2BIIA 5M94B 1A3QA 4TTDD 3LEXB 1SYVA 3GZPA 4N2GA 5ADPL 1DP0A 2X3CA 1LP9A 3D48R 3PWLB 4HJ1A 2F9BT 3FZUC 4B41A 1JXJA 3DHUA 1Z2KA 3TV8A 3V9FA 3TS8A 4XNQA 4DFIA 1LQBC 3DX1A 1CDHA 4ZNCD 4K7PL 1IFHL 3DJTA 4WDIA 2JKTM 2XPZA 4C55A 5KW9H 2H9GB 2MIZA 4YE4H 1GVIA 1TU2B 4D8OA 3W2DH 5G4MA 3L9YA 4HCRA 2ITDB 2H0PA 1RK1A 5IVXF 4S1SL 1IC5L 1SQ2N 4R3SB 3H3PH 5GHWH 4NJAL 5E1AA 4PJEF 4ZFZA 2C1PB 4ZDHA 3IYLW 5E8NB 2BOLA 3REVB 4YDLC 5FUZH 1BBJB 3MLWH 4XI5C 5JQIB 3RFZC 5DD3H 3SYQA 3P9MB 3EFFA 4TQPA 5ERWB 2HT3C 3RFZA 1PTZA 3DMMB 1NDGB 3SKUD 5J6GB 4UOW0 2ZWLT 1BM3H 4G7SB 4TUKL 3VA6A 1QNZH 3UACA 2QPSA 2ZG2A 2XVBA 1RURH 1ORQB 2YGOA 3FB5A 4OGYL 5E9DB 1PJWA 3B2PA 3OPUA 4W9IC 5L0QB 2Q9OA 4Y5VB 3BH4A 5DC4B 3Q6GL 5KG9A 5LBVA 4YS4A 2DZEA 4EZJA 1HILA 1DO5A 1PZ5B 1YYMH 3WI9A 4J28A 4APXB 2OCFD 2ZWZA 2BRRH 2H2SD 3AS0A 4I13B 2X70B 1XGYH 3MV7E 4ZUTA 5T1DH 5BMFL 5GZOD 3KMDA 3P9LA 1RMFH 4YXHL 3NCFB 1FSKC 5C9KA 1AS8A 4GKSB 1WIOA 2JKRM 4FD0A 1HL4A 1CG9B 4P9HC 3S48A 1LL1A 4EE2A 1DVYA 1CE1L 1JZ5A 3VD3A 4F92B 4NKOB 2BNUA 3PGCA 1CI5A 1GKEA 1I3RB 1HKLL 2OJZL 1D5RA 3AJ7A 4LKXB 1QBAA 4YLQT 2DQTH 4JO3L 2D03L 1L9NA 4NO2A 3QIBB 5KSBA 1S2EA 3V5HB 2VDMB 1MLCA 1LWHA 1VZGA 4QRBA 4QRPD 3L16A 3OAYK 3O2DL 4CVXB 4I3SL 3KPNA 3LV3A 2FLRT 4A2FA 4L0ZA 2D7TH 3HAEH 3I74A 4R7LA 2EE0A 4PS4L 5C3IA 3Q2NA 5MERA 1P5VB 3BAEL 4WJG3 1QHPA 4YSAA 4JRXD 2BSTB 5FA4B 3BP7B 4MMXA 4KROC 4TSBH 4YSSA 2HT4C 3FK3A 5FFLA 1C8PA 2Q20A 4Y16B 4B7LA 2WTPA 1XD1A 2X4QA 1JVOA 1Y0LA 5GSRA 4Y2NA 3IWUA 1RHFA 4PI0A 5LAPA 1QTPA 3PAVA 1G1YA 4ZMAT 1LE9B 1X5XA 3BSZH 3DRTA 1WUNT 5IBLD 1S9WA 5I6XB 2VDPL 2Q8BH 4TV3A 4LSSL 4R7NA 1M2VA 3B3IB 3EF4A 3DRTB 2P5EB 4F27A 2ZSVA 2IH8A 3I50L 3C12A 3W0WD 1MCDA 4BK8A 5IMLB 4XMLH 5HGGS 2AXFA 2EDNA 2APSA 1PYWB 3TM6A 5HDBB 1MHPH 3PJSB 4A55A 4LU5L 5I28A 1AIFA 1ZEAH 3TT1H 5KEZA 4RWYL 4CVXA 1Z9OA 4DTGL 1LVEA 4NFCA 1MWAB 1EGJH 2EDQA 1GJWA 3L3JA 5CILL 4XNDA 1UKTA 3WIFB 3QUMH 4MD4B 3HIZA 2DM4A 3SGEH 5I75B 4XBPA 1BD2A 1G9NH 4LSPL 4PVBA 1C1EL 2NMSA 4L8SB 4FFVC 1OO2A 3RIKA 1KLGA 5EULV 5T3XL 3MRLB 2JWYA 3VXRE 2H32H 1S78C 4JO1H 3EH1A 5E4EC 5IB5B 2X4TB 3PGCB 4CU7A 3RY6C 5DDHA 1O6SA 4YHLH 4FMFA 1CYGA 3MTXA 2XQBL 3RZCB 3K1DA 1QLEH 3BUDA 2KHAA 5ISZD 4BFIA 4GPVA 2OP4H 1K8IA 3MLTB 4P2QE 1F1DA 3H9ZA 5FUOH 2DWDA 5I1JL 3ILQC 3S5ZA 1ECYA 1NIAA 2WIMA 2W94A 4KQ4H 2Q8AH 1TEGA 3ARGD 3QHZH 4PJ9A 3TVMD 2Y0SA 3EO1B 4BFBD 2J1XA 4Z76A 4JB9L 4NQCA 4B96A 3F00A 3MRPB 4DF9A 4YMPA 3QQ3B 3GRWL 3VGAC 2YMTA 2CJSA 1DQQB 4E2OA 2ENYA 4IYKA 3ZYOA 1HE8A 3L6FB 2QTEA 4NZTL 3BYTA 1B4RA 2HAZA 1PU0A 4P3WA 1Y07A 2X88A 4AQOA 1I4FA 2GJZA 2EH7L 3EYQD 4Z78A 3HS0A 4Y9FA 5GIRB 3TJEL 3EYFB 1PG7L 1QLEB 4PJ7A 3C6SA 2CKBL 2UWEF 3QFGA 5IHUL 1RZKC 2CUHA 1X5JA 3JTTB 3TEZA 4OLEA 1T0OA 3QCUL 5FWRA 3ZTCC 1RSFA 2H7WA 2PPCA 5F7AA 4ZO9A 3TWYA 5DYOB 2IWFA 2W60B 3R0NA 1QLFB 3QFJD 4JM4H 5LGJA 2FEEL 4HH9A 3IDXL 3TWCH 4DP4X 1U91A 4ZPVB 2WLZA 2IV8A 3FUKA 3T0VA 3LRSB 5DT1H 3IVKB 1JJUA 5DRWB 1IMHC 2ODIA 2IDUA 4Y16A 4OZFG 1CZ8L 1NCHA 3CXDH 5GGUA 2OXGB 3R8BB 4PJEA 4DQOL 2XWDA 3MGTA 2CSPA 1E28A 2LAAA 5FYKU 2OZ4A 1W15A 2DM2A 3NSDA 3MPCA 5EU3B 1J8SA 1MH5B 4HKZB 1E40A 1P6WA 1U8NA 1HOCB 4NYLB 4ELME 5I1CH 4IDLA 4PRIA 3GMPA 3UEZA 2BCKB 1WFIA 1E9OB 4UYQA 1YEIH 4P5KA 1S9WB 3S5YA 1HESA 1JI1A 3N40F 5FOBB 1T5XA 5JPMC 2O61B 1HSBB 4PYGA 1IO4C 4C8XA 5E9AA 1EWHA 3QHZL 2F53A 3EYFA 1Z9SB 3WAKA 4FTVE 1DJYA 5T8IA 2VW7A 5FCSH 4PCSA 1EXUB 3GFUA 3RZCD 1OTSD 1YQ2A 3QJFA 4HD9A 4Q9RL 4PVLA 3PJNA 3D69A 2GJ6E 1DSFL 1N0XL 4N0UA 2CJUH 1KBWA 1LLAA 2IADB 3T3PB 2HG5B 2OA9A 4I8DA 4Z7UF 5E24E 1A65A 1J9RA 4U6YB 3OHXB 4CU8A 2VDRL 4IBUA 3O6LH 4ZO8A 2VR4A 1T7ZA 4I4WA 1IGCL 1BWMA 4NNXB 4LLQB 4GSDL 3ZRCC 4TRPH 5D1XA 2V6HA 4NZJA 1IKFH 5FCUH 1EFXD 4JUTA 2WQ8A 2APXA 2C7FA 3ULVC 1ZANL 3MBXL 2P5PA 3M1BA 1T89C 2VTFA 2OX5B 4MLIA 4AXWA 4MCZA 3C60A 4BFEA 4AEHH 1MRDL 2HMID 2GTWB 1NMBH 4L1LA 3EJZC 3ZMEA 3O6FC 3RGVB 2IWEA 4QRFA 2MCPL 1O9ZA 1RUMH 3E8UH 5D2LB 4Y19B 5ID1A 2YQ2A 3IGLA 3I50H 5H37G 5JMRA 1G7HB 1ACYL 4W6YB 1GY1A 2BS71 1PDKB 2AJVH 1XB3A 4F7CA 5JHLL 3MLZL 3EJPA 1AAJA 1F3JB 3DOSB 5JZ7D 4Y2DC 5JW4Q 3Q0HA 4XOAA 1ZJAA 4ES9A 1X5KA 3WTSA 4WWOA 3GGWB 5E4OA 1YNTA 3WFBH 3SJVE 1A4JA 2VAAA 4KUZL 3BAKA 4EDXA 4OI8A 5J3HD 3CN3A 3MNMA 4PJ7E 4XB7A 2ODHA 1Z3RA 5AVVB 4DP1X 1JN6A 4RIRA 2X2UA 3ELAT 3KHOA 4G59C 5GGVH 3QRLA 4UT6H 4LLWB 3ZE2B 5E08H 4MA7L 4K3JH 4Q8BA 4YHKH 5E5UB 1DEDA 5ESQB 4YZFE 5M7QA 2B7DT 4G5ZH 2B4CL 3FFOA 3KYOB 4X7DC 5AW9B 1AC0A 3VWKD 3WJMB 4E9XA 3HI5L 3VSVA 3BAWA 2FRGP 4H20L 5AW6B 4M8RA 3HUJA 3QIWC 1N0LA 1JGUH 1JOIA 3S35X 5EU6A 1OTUC 3VXMB 4PB9L 1MZYA 1AGFA 4P5SA 4JFPB 1QW9A 2WN2A 4M3KB 4KITB 5K39A 5IJVB 5EO9A 1RUPL 3R1GH 43CAA 4K9EC 1FCCA 4ZI8A 1DJHA 3OXRA 2OL3L 4P5MB 4ZBJA 1NOAA 5EU3A 3UTOA 4LKCB 1FLRH 2AQ1A 4WU5A 1BQ5A 5F1OB 3SE9H 3SPGA 1S3KH 4E36A 3AXLA 1ETA1 4OSUH 4YDZA 1P1ZB 1DTUA 2BMKB 4M03A 2JJTC 3SPVB 4BM7A 3NN8B 3M07A 4FX5A 4NQCE 3VD7A 1OK0A 5D1XD 2DTMH 2L7QA 3CLWA 3WHXB 1M3IA 2AQQA 2FIKA 4RBPH 1VB9A 2I60H 1CGSH 4HJGB 4FMVA 5F7YC 1FIGL 3GMRB 1XT5A 3BKCL 2ARJB 4IRJB 4O02B 4PWGA 3T4YB 5B3SB 1PD0A 1DVUA 2XWEA 3T65B 4N0FB 2X9ZA 3E6FB 3CVIH 1MJ8L 4OGXH 1KF9B 2Z8VC 2GC4C 2FATL 4PJIF 5JDJA 3OC8A 4LFHG 2EVGA 1RMFL 2V17H 4Q6IC 1QBMH 3W0WE 1B0WA 2V3FA 1LO0H 2HH0H 3UTZB 5ECGA 3BUYA 3OZ9H 3V95A 5DD3L 1SMAA 4MNQE 3KPPA 4BK5A 2AEPL 3RDTD 3UPRA 4L05A 3CZJA 4WHDA 4Z3TA 2UUDH 3B6SA 1IEBB 4GBXA 3TU6A 1LO2H 1PY0A 4NPYA 2WZ0A 1OAYL 2DLEA 2ZXWB 2YAQA 5C0AB 3ZL4L 3NEOA 3SZKC 3N0AA 4PJ9B 3DGGB 5C07A 4NRZA 2Q2LA 3KG5A 3D52A 1IFHH 2EUWA 4OKVA 3OXSB 3NABL 1UM6H 5FYJE 3WFHA 3WMQA 2QVMA 1D7DA 1S5IH 4UYPA 3OKNB 3A6CH 3P4LA 4MAYD 4CJ1A 4N2IA 5IF0A 2J1WA 1AACA 2PYEA 3N06B 5CS7A 3Q2WA 4MD0B 2XWJB 2AP2A 2OL3H 2Z31C 4URTB 2A99A 5JIPA 1LDSA 5E1AB 2R1WB 1RIUH 4ZFZB 1AFVL 1DLFH 3KL5A 3FONA 3W11C 1CK0L 2Y06L 4M1CD 1WPCA 1HVXA 1MCLA 3L3KA 4G8EB 1DQDH 4S2SB 5IR1A 4G6KH 3F84A 2ZCKL 5KAQF 1EXHA 1ZV9A 4NQEA 2JSFA 3QR0A 2R23A 3ARFA 3GSRB 3I84A 4XE5B 5DUJA 4AQAB 3DOHA 1INQA 1MRCH 5BRZB 1J1PH 3PU7A 4DN3L 3WELA 1ORSB 3L3DA 4HGWB 1E3FA 5E1IA 3RY5A 2FBJL 4H26B 2CK0H 4X99A 3QIBC 5E6SB 4XC1L 4I18B 3HLAB 4OGAD 3EHBD 3MRCA 4OIBA 4B3VA 2IGTA 3FF7A 4HHAA 3WUWG 4QRTB 3KPSD 4ZS6C 1OAJA 2DD8H 3EZJB 2L4OA 5A6IA 4OJFL 2UZPA 4RNRB 3ZRFC 2UYLB 1RERA 1JZIA 4XXWA 3WNNA 3AXHA 1T03H 5ICYB 3RWHB 4A1RA 2PCXA 4XP4H 5KW9L 5MHSE 1JK9B 3MACH 3BE1L 3QUMA 4N87A 4U1GC 1TFPA 3LHPL 1JXGA 3FCTB 4JGJA 3GSNA 1IM3B 3DJSA 1TVHB 4NUGL 2G5BB 4PTTA 1DQJA 4ZXBD 3KBHE 2VQ1A 1FCGA 1KPVB 2DQCL 2VO5A 3HLKA 1AZBA 4Q0XL 3MRKB 2F54E 4IGBD 4C56D 4JFDD 4M93B 1B3JA 2MWCA 3K6NA 1J0ZA 5KYWA 3BVVA 2NY5C 3VD4A 3MBXH 4LSTH 5JIQA 4NC2B 3HZKB 1UVQB 1W0WA 4ZUUA 3UCQA 2C3VA 1ILUA 1KELH 2IXQA 2VB5A 4EDWH 4FA8A 3L1EA 3NVQA 3LPFA 1Y18B 2GT9B 4D94A 3MRGA 5BXFA 1WO2A 4KJPC 3W9DA 3ALWA 4MWFA 3V0IA 3LN5A 1BQLL 3T04D 4AH2A 4BXSV 3ABZA 3HE7C 2CLVA 3TX4A 4B7IA 1Q1JH 5I1KL 4PBXA 4X83A 4R9HA 4QHPA 3FU3A 3V6FB 3PNRB 5IJDC 1WA0X 3DARA 5G5DA 1VPOH 4AE0A 2FX9H 4G8AC 3WS6A 3ZKMD 4JRXB 2CCWA 3NCJH 3KCPB 4J3OD 5LAXA 1QASA 4X6DB 3RGBA 4X7SL 2RAMA 1RPQA 1U8OA 4UNIA 3SOTA 4MZIA 5D4HA 4F7TA 2P5WD 4ODSH 4OQ1A 1YJDL 3PWJA 4QLRA 3KXFD 4CILA 3VI3B 3DVIA 1OSYA 1NSNH 3OKLB 4TNWK 2DBLH 1KB5H 3G6DL 3HE6A 4RFOL 5F89B 2AJ3A 4KK8C 3MOBL 1KT2A 3P4NB 5C0FA 5EIIA 4A7GF 1PAZA 1R3LA 2EUXA 2QGDA 5KVFL 5FUOL 4URKA 5DTFB 3GLAA 2XQYK 4RVBA 1ZRUA 1FFPB 2WJ5A 4FLOA 4PH8A 3ZSSA 1SOQA 5EH1A 2BJMH 2R83A 3L17A 5CP7B 1L6ZA 3HNTH 1FNLA 3ZW3A 2HJLB 4GEIA 4OT1H 1PW3A 3HN8A 4JFED 5BOPA 1CTNA 5AYUH 4LHUB 2VM3A 3HFML 4ZW6A 4JFVA 4YDNA 1MQKL 2IH3A 5CEYB 1EANA 1RVFH 2PP8A 5CKAA 4KZEL 3U4AA 3NCXA 1E5CA 3O41B 4UM9B 1X9QA 4Y5XC 2HZHA 4OZHE 1JIBA 1FNEB 3WHE1 1FVEA 3KR3L 1JPGB 3ZK0A 1BIIA 1NWPA 2DMHA 1UJTA 5JNYA 1UUSA 2O93L 5E56A 3HZYB 1N59B 1TEYA 4DO4A 3K6SB 1WFOA 2E7LA 3HB3B 2DQ6A 1OXYA 2VLKB 2XWJA 3S97C 4PRAA 1XZWA 3Q5YA 5CWSA 1UM6L 5KVGE 2P5EA 3ABKB 3HNSH 3SYAA 1S7QB 4I2XB 1Z9LA 2X4RA 43C9B 3TEWA 1CU4L 4MJIA 3RL2B 3VXUE 1YZZA 5AALA 3VQ2C 2CGZA 3BUIA 1IZJA 3FHQA 1DVXA 5EUKB 3JWNH 1R24B 3MU3A 1J05A 3F7VB 4PWHA 3ZHFA 4EIGB 1XAKA 3VQ1C 4KQ0A 3MBEC 1KIPB 3GI8L 4K3JL 4IU2A 3AXIA 5GGQL 1KTBA 4OVVA 1KWGA 3RU8H 1NGWA 2AK4A 4R5VA 2IDSA 4XO3A 1D3CA 4IIQC 2QDWA 3WFEL 1HEZB 4WKXA 5EU6D 4YSQA 3BRDA 2H1XA 2J6EL 3DGDA 3D6GA 1IRAY 2GK0B 3MYJB 2DYPD 1II4E 2GG1A 3D51A 4ATWA 3ZTDC 1A9BB 4IOIB 3ULSB 1ITCA 4R7DA 4AEIL 1RQ5A 2ADGB 3WD5L 2I60L 4LGSB 1L9OA 1TQBC 1U33A 2CHXA 2X2IA 4YSRA 4YAQA 3WYRA 5JHMA 3DUSB 5FIEA 3SDXA 3W56A 1ZVHA 2B15A 3ULUL 3CZEA 4YAQB 5HYQB 1QUNB 4D7PA 2QHRH 3MBEB 1CVRA 3SJVD 2OSWA 1EGJL 1X6LA 2P47B 1CBJA 1P4IL 4FLQA 2VNCA 1YN7A 2IMNA 3ZDXB 4AEIH 3DECA 4GAJL 4N3UA 1E7UA 4IBVA 4L29A 4I89A 1FO0L 4LKCA 1N6UA 2ZUWA 2V3DA 3EFDL 3K8MA 3J7HA 3S5LA 5DGRA 3IMBA 1NL0L 4M29A 2HUHA 1ZLUH 3IU3A 1IKFL 3ML8A 5C0JA 3GPSA 2F58H 2QDVA 3QZBA 3EJTA 4P2QD 5E2UH 5C08B 3TBBA 3HPJA 1NIEA 3O2DA 3WS3B 4XBMA 3UYRH 3TF7C 1I1FA 2GITB 3P4OB 4CN4A 3MDJA 4J4PD 1PG7W 2XCMC 3PP3H 2CLZB 1JFHA 1GYWA 4NQVA 1Y6NR 3FTUA 4NNPH 1HZKA 3ETTA 2ZOWA 2BXZA 2ZUVA 3O45B 2HRHA 3FQUA 4OM0L 4YPGA 3TBSA 1NINA 4UINH 4G9FB 1J5OL 4NWTH 1HXYB 3VO0A 4OZFB 1R3IH 5HI3D 1RUKL 3FTZA 1DSFH 1P5UC 1TETL 3V5KB 1E27A 2ZWSA 3BGAA 3OKEA 3IGUA 4GUPB 3EAKA 3LS5H 1JGLH 3APDA 1G7IB 3MO1A 4UT7H 1G43A 2UY7B 4X8CA 3IXTB 2VERN 5L8JB 3ORJA 4AM0B 1A6VH 4PLOB 4ENZA 2D7OA 1KXVC 3H0TA 4YO0A 2GABA 3WN5B 4D8PA 3PV6A 3ILEA 4NO5A 2BHUA 1T22B 1KTDA 2VQTA 4XHJC 4JZJC 3K4ZA 1A7NH 1MY5A 4PJBA 1BQHB 3RFRA 3ARPA 2AI0L 3CJJA 3MV11 2FVNA 5FXCH 2DF3A 4TLTA 3FN0L 3ABMB 2WAQA 3ZN6A 4Z8FL 1NMBL 4RAHA 5DZOA 1BF2A 3B34A 3NRPA 4JFDB 5HDRA 1YY9D 4G6AC 2BVOA 3RWCA 4F80A 1L5GA 4PJDE 4I1PA 3S34L 2N7AA 5FYLE 3KYKH 4C4KO 2O6DA 1LO5A 3QQ9C 5C0CE 1FNFA 2NR6A 2ICWB 3MBEA 2H6PA 5TF1L 1ADWA 4GNKB 2RQ8A 4HSQA 1IGCH 3N1QC 3DK2A 4ANXA 3ESVF 5AYUL 5C0DA 2CDGB 1NGZA 4JPKL 1KELL 2VDRH 3PGDB 3ZYIA 2WBJA 4RGNC 5SWSB 4JM2A 3IS0X 3OZKA 2YR3A 4QAMB 5IQ9A 2JJTA 5INCB 2Y36H 1AO7B 2P5WA 4Z18A 2F5AL 1OGPA 3PWPE 5EUOE 3S9DB 3PDOB 1KV3A 3Q6FA 4G7YH 5FKAB 2Z93A 2GAZA 2DN7A 3QFJA 3Q8FA 3V6OA 3TV3H 2AEIT 2WBKA 2Y5QA 2FX8H 5CD5D 4JNXA 25C8L 2K6YA 3QQDB 1G7MA 3MRNA 1OCZB 1TZIB 2P80D 3GLDA 2P8PA 3VFNB 4CJ0A 3L3OB 4NQUA 3BGFC 3CN4A 4LHUG 2PCPA 1OSZA 3LKPA 4KJWD 2LHAA 1MHCB 4PI2A 1I8AA 3QDMB 3ROOA 5CN2A 4ONGL 2AJYH 2W0KA 4JPWL 5BVPL 3VXUB 1AQDA 3TNNB 2NY5L 3Q5TA 3E6HB 5DJXA 4N86A 3KWWA 1N2RB 4BINA 3B9KA 4YXKH 4H0HB 3VFSB 3RVWC 3FH5A 1PAMA 4IHOB 2E46A 4KV5F 4M7KL 1RY7B 2VLKA 3NZSA 5T3ZD 3A4AA 1N70A 5BJTA 1AZVA 3ARDA 5CHNA 2F68X 5D5MA 1DFXA 1UM5L 1YQVL 3OHMB 4HUXA 4JKLA 4PRNB 5GGRB 4F2ME 1MREH 2YK1L 4R26L 3C5JA 3WDJA 4KQ4L 2Q8AL 1HHIA 2XPGB 1W6WA 2WCSA 5KN5A 2J1KA 2NZ9D 5EN2A 2PWHA 2AJUL 1UC6A 2ID5A 4NAJA 4H40A 1M4KA 5AUMB 3I02B 3EDFA 3VXNA 1BZ7B 1D7BA 4ODUA 3CDCA 2UVFA 3QHFL 5GJSH 2I7OA 3LHPH 3L5WA 1G9NL 4LSPH 3VWKC 3WUWA 4HW6A 3BMVA 1B90A 2DMCA 1FHGA 2APBA 2ZX6A 2PWDA 3DHJA 3QFDB 3LYRA 2CJTA 4QMEA 4CN1A 3O8XC 2JK5A 2PR4H 4PVMA 1ADQH 1ZE3H 2AMGA 2F53E 2UUDK 5BRZE 4I0KA 2GIMA 2VLKD 3OKEB 1A7RL 4FEMA 1A4JB 2VAAB 4M6MH 5D1ZA 1ADQA 3QXWA 4AGNA 1OPGH 2HLFD 2V4LA 2K4AA 4X99B 1JHKH 1KJ2B 3A6CL 4OZHA 4BSWB 1T1XB 4PQXA 2Z35A 1KPRB 5GGTA 3FT0A 1IAIL 2IG2H 4HPYL 3CVHA 5E8OB 3MCYA 3ECQA 4D0DA 1D9KC 1QFPA 1A3LH 3UADA 1H3PH 1UASA 2R1XA 4TLSA 3WMSA 1XZ0B 3F85A 5DZ9A 1GCYA 4PBDA 2XPGA 1ZTXE 5DEZA 5IB1A 4MDRA 3WFDH 3QW9A 3U7YH 2FGZA 2Z0BA 3O0RH 5KSAD 2JI1A 2IAMA 2QQKH 3BDXA 4UQ9A 3X13A 4N90D 3OPZL 4G8GA 5FGCB 3ARWA 4BFIB 4G1MB 1N12A 1E6OL 2DQGL 4GKLA 5BS0B 5GS0H 3GJFH 3UC2A 3LKRB 4BGDA 5E8EA 4DUWA 1XF3A 4JM2D 1D5IH 3IDYB 4B9KC 4WLCA 3ROOB 1CF1A 1MN4A 4TVSa 3AAZA 4DW2L 4HOZA 5D9SA 3FB6B 2VC2B 4ECNA 4XMUA 3E1ZA 3NZHL 1TYJA 3SGEI 4DPBX 2C3VB 5CAYB 1IM9A 1QSEE 3MGAA 3QUXB 5F9OL 1KTKE 2XZQH 2HRLA 3V0WH 4FA6A 5EZLB 2KERA 4PGJA 3MLPA 5E23A 1PLCA 4LB8A 2QMJA 5FB8A 3L81A 1TYEB 3OC5A 4J3UA 1CTMA 1NCNA 1PJ9A 4OM1H 3V6FA 1KJ2L 4GIAA 4IU2B 2PYFB 1BECA 4ZOCA 2F74B 1F90H 2K6WA 1G6RA 3KPSB 1T20A 2OJZH 4H25A 4XNYL 3OJ2C 4J3XA 1DBJL 3P3SA 2YGPA 5BOZG 3QJZA 1OE3A 2LU7A 3APCA 4I9XA 4GQPH 4UQ2A 4KZEH 4AY0A 4ZFOL 2OMXB 1JCVA 4EI5C 3W38A 5EF0A 4GG6F 1M3JA 2CCVA 1OM3L 4H88H 2F8XC 4N2EA 5J13B 4BQ8A 4P5TC 1B2WH 1QQDA 1WISA 4YHPA 3SB3A 2A9NL 4ZPTA 2FGWL 2XKNA 5DJDA 5GRJH 1N59A 3ZKXB 4WFEE 2OXHB 1ND0A 2JCCE 1AGCB 1KXQE 4GFXA 1AG0A 2NNFA 2EVFA 3QYMA 4MMYB 1P84J 4WWPA 5AENA 5GJTH 1A3ZA 1OHQA 5IHHA 2B1OA 3UMTA 1I1YB 2R23B 5E6IB 3VFGL 2XETA 4YHYB 3MNZB 3QWOA 3WSQH 4TUKH 1M7XA 4AYSA 3C5ZB 1J8RA 4NRXA 4NRYB 4L9LC 2EXTA 3LAFA 3STLA 1OF0A 2V8LA 3RB7A 1PL3A 3AS1A 3MRQA 1H3VA 4Y5XB 1RIHL 2VABB 5FUZL 4HHAB 3BZ4A 4LASL 1WGOA 3US1A 3H3PL 3DTDA 5GHWL 3U7AA 1A7RH 2DB8A 3ZSTA 3BPNB 5C6PB 3HNVL 3SCMB 4IRSC 3E2HB 3F2LA 2Z4QA 4ETQB 5HSFA 4ANVA 2XBDA 4XAKD 3NCEB 1XSIA 4U6TA 1G7JB 2XG5A 1G9MC 1ET7A 2KT6A 1XQ4A 1PY4A 2G3XA 5ALBL 2XXGA 3T3PF 1JSYA 3VMPA 5BS0E 3KH3A 3MFFB 4GW5A 2WQRA 4L9LB 1ZLSL 4N90E 2Y9RT 1U8MA 3AU1A 2VL5B 1GAFL 2QSCL 4XWGL 3RL1A 5CEZL 2OV0A 1NEZB 2QPFA 3ME0B 4W9EC 1JPTL 5E9DA 2VDOH 1P2CB 4HJ0D 5T3ZH 4Y1TA 1LE5B 2NW2A 1VACB 3RIFK 3ULVL 3KPPB 2OCCB 1I8UA 4FJYA 4XNUL 1NCAL 3DIVA 4WHYG 3KS0H 3VX0A 4RMWA 1S7VA 2EXSA 4IIQB 4EI6B 4FQ2H 2VXSL 3HAEB 5JXAH 3CVHH 4TXVB 5KTEL 4MXWH 4TOYH 5A40E 1A64A 1HNFA 1N9PA 1A1OA 3ARFC 2MOVA 2YQBA 4IKLA 1U3YA 1BVLB 1A4KB 2IQAA 1V5JA 3A6BL 3QRBA 4B9IA 2Z9TA 2QQLL 5JOFA 2DEXX 2DKSA 1GGCH 2G3NA 5DJYB 5IFHL 1KJVA 2W0FA 3EXLA 4HLEA 2C3GA 1GMIA 4AH2B 3AS2A 5INDB 3LQAH 4AK2A 2Z8SA 1P7BA 2XQYA 4GRLB 4Z7AA 5FO7A 5D70H 3U1PA 2H9GA 2JJWA 3LRGA 4X9IA 4J39A 2X1PA 3FUNA 4RETB 1I9IH 3GSXA 2GY5A 1BGXH 2GBAA 3LHAA 3T71A 1NBZA 3VGEA 1T4KB 2VDOB 1AZNA 4NUJB 4NN6C 3EDJA 1ZIBA 4PLNC 5CJ5A 1U2YA 1JNLL 3WMPA 1HZLA 1UXLA 1CGYA 2VJ0A 3T8MA 2JKIS 2BERA 4FULA 2XBTA 4NP9A 4X5QA 3CPLA 2E47A 1QI4A 4JBSA 1FNHA 2FL5A 4NZDA 3ZDZB 3NP4A 2F1AA 4BRJA 4F1SA 3GSUB 3SO3C 2C5DC 3U46B 4KKCC 3QUMB 1U8JA 4P57A 5A2JH 1AQMA 2OTUB 1OZUA 1Z1WA 1H5BB 3OMIB 1UM5H 2F6AA 4XP1L 3KYKL 3H9HB 1XO8A 4HS3A 4L3EE 2UZYB 5IB3A 4FXKA 3J2PA 5F1IB 5I1EL 4XHQA 5L8LB 3PPSA 4I18C 4PJEB 5L4JA 2NUTB 1GGIH 5ICZB 3WIHH 4C4UA 4L3CB 1AY1L 4XN4A 3B2UC 3CCHB 1ZLWH 3ZDYE 3ATDA 2B2XH 3GHBH 1IGTB 4LQFL 1KIQA 4Y7OC 4PP1C 4WI5A 3ZGHA 1DVTA 4FL4B 3U0TB 1SDDA 3QI9B 2ZAIA 4UOQA 2ETWA 4G6MH 2C34A 2DDQH 4GJTB 5A3ID 1K8DA 3BYYA 1FL3A 35C8L 4X0NA 3S37X 5A2FA 3CVCA 3HE6C 4LAJH 3BP6B 4MASA 2BP0A 1FZOA 1OE2A 4F9LC 4ODBD 3FS9A 5DMKB 4LRNL 3VRLF 3LKOB 5EU5A 4HAKA 2Z34A 2WINA 3V4PH 1MIMH 4RRPG 2VT0A 3G04B 3FSZA 5FKPB 4U2ZA 3A4FA 2XICA 3N50A 4P9MH 4K8RC 1O7VA 2G2RA 4JHAH 3FTXA 3NZUA 3OJDA 5JW3H 2KC0A 4Z3HA 3FQXA 3TBWA 1YEFH 1G94A 1O5DT 3MROA 1TTAA 4G1MA 5BS0A 4TPRL 5BRPA 3PP3K 2YKLH 1TJIL 1UZ6E 1PMYA 1INDL 2APTA 2Y1AA 3T1FA 1SVZA 3ET9F 3SODB 2ZYIA 1HHJB 3VWKB 3ARQA 4N9OB 1CQKA 4YBQC 3A67H 5D71H 4GRWF 2Y7SA 1HWWA 2W07B 3K7UA 2O5XH 4F37K 3AW5A 3EYVB 3ISWA 5E8OA 1CFSB 4U6VH 5T1KA 1HCZA 2DQJL 5TDPA 4Q9QH 3JWNE 3V4PB 2DJUA 5CGMA 2OJ1A 1S8DA 2ZOUA 2NTFB 5T3XE 4V2BA 1BX2A 3D69B 1CYWA 1QUNA 3VX1A 5ISZB 4X6DE 3ZX1A 1FGNL 4Z77B 2P26A 1S9VB 3M86A 1RCYA 5F9OH 3Q2LA 1U58B 2IAMD 1CF8H 4PJCA 5D1XE 5I0DA 3BLPX 2ERJC 1UFGA 2BC4A 4WO0A 3C5ZA 3TBVA 2Y7MA 4GUCA 4WW1B 3T8XA 1DBAH 5CZRA 2OZ4H 1L7TH 2CA4A 1UYWH 2D0GA 4R90H 2Q76A 5FFGA 4X5WB 2P9RA 5DHYA 2NX5E 4PRIB 2EDTA 5IMKA 3G3LA 4AIEA 4FQXC 3UABA 1MDAA 4TVPD 1NBVL 5K33A 5ACZB 3NJLA 3QUML 3N43B 4WEEA 4FXLA 1ES0A 3PAUA 4GMTH 1OAZH 2IQ9H 3CUPB 2X9XA 2XTSA 4QJ3B 1A21A 1KY6A 4WRLA 1GCFA 3QCVH 4O51B 4Z23A 3FO1B 4PJEE 3H6AA 3TIDB 3LZRA 3TEUA 2E86A 3QXUA 2K3TA 3TYFA 3O2DH 4HWZB 3JWDC 2GFBA 2K8QA 4BQ9A 1DUZA 3HMXL 4DEUA 3C5ZD 4Z7QB 3VE0B 2P7TA 2AVFA 5F6IC 2DI9A 4HWZA 4KO6A 1S78D 5HGHB 2XNAB 4OLYL 3VG9B 1GPOH 3AY2A 1XF4A 4PLKD 1AS7A 1SHSA 1S3KL 5GS2H 1QSEA 5CSZB 5KSVA 1TZIA 2X53A 2Y1YA 1UZ6F 1CFNA 2FLMA 1P6FA 4QXTB 1C8QA 2VDLH 4XN7A 1I8KA 4WI8A 4OKDA 5EEUA 3RHWK 5AAPA 3FU8A 1YNTB 5MP6H 4C4BA 5HPOA 4QKXB 4NBZB 2IIJA 4UM9A 2BDNL 4HH9B 2D0FA 2J25A 1EZSA 3DDGA 4LCWA 5B21A 4ZUSA 1SFHA 1HQ4B 4QXGL 4PJAE 3EDEA 1VLXA 5HYIA 1E8XA 1XWVA 4O2FA 4WW2C 2A6DB 1KC5L 4YGVA 2AMUA 4HHGA 1UHVA 3M7OA 1KXTA 1T7VA 5JDSA 3TO4B 2BY2A 2Z7ZA 2JLPA 5DZVA 1CGTA 5L2JB 3DC0A 4GXUM 1VFUA 3F12B 4XVSL 4J23A 3A47A 5EWIL 4HEPA 1R6VA 2EH8L 1YNKL 3NH7L 3RNKA 5JW3L 3QQ4A 1F58H 4KO7A 1NBVH 4MYWB 4ZYKB 2ROYA 2BHYA 4Z7OE 3F12A 3BN9D 1RZ7H 5DFTA 1E4JA 5BO1H 1PIFA 3NCCB 4RISL 5E6IC 4NQDE 1DVFC 2NZIA 2G4EA 3IB4A 4TMPA 3CFKA 5I1HH 2XJLA 5EFIA 5BV7C 4EOWH 4XAWH 1IAMA 1KNOA 3A4EA 4UOZA 3G5VA 3PL6B 5I82A 5CF3A 1QTYT 3MUHL 3X1BA 4TYUA 2BRQA 5IQLA 1OKEA 3LQZB 4ABUA 4JRXE 3HHRB 4RAUB 4TUJB 2QVKA 2WVTA 2C26A 3W37A 4RQQA 1NCOA 2EC8A 4FFWD 4DEPB 5GGTH 1JVKA 3I9GL 4TUOA 4IGBB 3VTTA 1T83C 1TZ8A 5TDOA 3QJVB 4I48A 3BDYH 3H85A 3FFCD 3OL2A 2B4CC 1T0NB 1F4YH 1SHWA 3JTSB 4NCC1 1E6JH 5I6NA 1E27B 4G8GD 1E4XI 2UWEA 3OR7B 4YHOL 3DPDA 3G08B 4AIZA 1NLDL 4HQQH 4PG9B 4QT5A 3WY2A 1NCIA 3KGUA 4I1NB 2WAHA 4Z0XB 1WBXB 1XSJA 1H5BA 5MI0C 1OGAD 2YZ8A 1OQOA 4O2CA 1MXDA 2H2PD 2ADIB 1E2VA 3GZKA 4OW6A 4MHHI 1YMME 2XWZA 3D9AL 3EJCA 4PJHF 5B1JC 4RRPM 5HP5A 4LBAA 1T0MB 1O0VA 4A2DA 4G6ML 1D5ZB 4PJHA 2GJ6D 5C3LD 1M7DB 2WLLA 2XTJD 3NSJA 4H1LG 2ZCHL 1OP3K 2QQLH 3BWAA 4W6XB 1XGZA 3S5LB 4R2GC 4DKEH 4FXKB 2F5BH 1BFVH 1NCWH 2PR9A 2QLYA 3OB0K 5IM7B 5IMOB 4N9GA 4AYFA 2OXHA 4IDJH 1NBZB 3GBNL 4P23A 5D4IA 5H35A 1U3HA 1AGFB 1DUZB 1QVOA 4XR8C 4CUCA 4ONHA 4F20A 1P7QB 1YNLL 1NTDA 3QZWG 1FQ9C 3TBVB 3INUH 5SX5K 3TONA 1PLBA 4OD3H 3EGXA 1IQWL 3LB6C 5HHXL 3EJYC 1FN4A 4PCTA 4F15C 3CBKB 4OLXL 4NXKA 1UKSA 5DZLA 4BKSC 4LLWA 1SOKA 4PJFE 5C0AE 3SYOA 4DGYH 3KLHC 4OV5B 2I5YL 4KY1L 3C6SB 1P4LA 4BZ2H 5AZUA 2MRYA 4EN3D 5MERB 4NUJA 3BKMH 2GK0A 2C3HA 4BDVA 1YMMA 1PS3A 4QGTA 2WWKT 1A14L 1IM9B 2X28A 2X1OA 4LRIC 2IDFA 3VXOB 3MRPA 1RZFL 4WJ5A 3NBNA 4AC2A 2FLBT 2WBJB 4NKIH 1Q9WA 4MXQC 5CEZH 3UGXA 3BQVA 5INDA 2X3BA 4FYQA 1NGXB 5I74B 2ZCKH 4PJIB 5J1TC 4UQEA 1QWUA 3GXPA 5D1XC 5I8CA 4WCYH 4AJYV 3AS3A 4DN4H 5LQBH 3CU1A 1LO5B 5DK2A 2B0SL 3O81A 2ICWJ 4NQXA 3BPLB 3RA7H 4AG4H 2YA2A 5DWPA 5C8JA 5DDHB 4DEWA 4OJFH 3CX2A 1R75A 1OEZW 4P2OD 2E0PA 4BXVA 3FOLB 4U1IB 1BF5A 2BK8A 3E3QE 4NQXB 1AYOA 2ATAA 2ICES 4X6CE 5F7MC 1FO0A 3HZYA 3ULUH 4GQZA 1OWWA 3DA0A 1UJ3A 2Q3ZA 4PV9A 5DMJB 1F4WH 4B9FA 1D9KA 3D85B 1CT8A 3CFNA 1J8HB 2FHFA 2YMXL 3QNXB 5AYQA 5TE6L 3VFGH 5B8CB 3SQBB 4UT9A 4WDIB 1DANT 4QXUL 1N4XH 2X89D 3O6FA 2A9AA 3GDCA 3MQIA 4GO9A 4TSAL 5CD3A 2PETA 3CX5J 2A2QT 2VXTL 3EW3B 1OT4A 4KUCD 1W0VA 3LVEA 3PHAA 4Q6YA 1RK0B 3EDKA 1HXYA 4Y16D 1EO5A 2AV1B 3SDAC 1S7TB 3RAJL 3S5LG 2G75B 3LN4A 4AMKL 4JFFB 4NDMB 4QHNB 5AOKA 3L5WB 4R90L 1A9VA 2OMYB 1J12A 4Y4KB 1QQDB 3VFRA 1SF3A 2F53B 4K3HA 3DUUA 2ZNWA 1E50A 1SVBA 3QFDA 4YSOA 2DWTA 3ZGIA 3B9EA 3VWJC 4XMKH 3ATFA 2P8MB 4ZX5A 4IMKA 5I15H 5CILH 1O5PA 1WK0A 3S6CA 5I0VA 2VXUH 5B3JE 3QORC 1DUYB 2RMNA 4JFEA 2HRGA 4NUMA 1WBZA 1JNNH 3A22A 3V9EA 1RUQL 3MJ9L 3A21A 3R4RA 4YL9A 2XV6B 4MCNA 3CVBA 3QG6B 5D6DC 2P3YA 1D5XB 3ALXA 2XKNB 3RDTC 3H9YA 5SX4H 1YEHL 2XXFA 2NQCA 2VMFA 1G5AA 2HX9A 1CGUA 3HUJB 3V4VH 3IFPB 5IESL 4WUKL 1LDPL 1H6TA 4N2BA 3RWEB 1AE6H 3UTTB 5AVRB 2CKBB 3OM3B 3S4SA 3UPAA 3ARGA 3HS9A 3GO1H 3DETD 1N7ML 3JTTA 2ENJA 4KTEH 3FQ4A 4ZX3A 4HS8L 2CUIA 1X7TA 2Z3FA 2LLLA 3EUUA 4PIBA 1H0DB 1ZXKA 2ZOOA 4UTAH 3PDOA 4E5XG 2HH0L 3HBZA 5KBNC 2J21A 3CDYA 1T2JA 2GIYA 4GOSA 3IS1X 3MUY1 4NCDA 4YSTA 2WTOA 2NTFA 2XACC 5JOPE 4NNYA 4R8WL 4JKPH 4APXA 1AHKA 2VQ4A 2DKUA 1JD7A 1P2CA 2QFPA 4X7TA 5LWYH 1L6XA 4WO4D 4OZIA 2E3VA 5FDYA 1IEAA 2Y7LA 4UIMA 1B4JH 4JJHA 5DD0L 3SYPA 5DGQA 1RL1A 1EHLH 4F8TA 2AJXH 1KNOB 1U8CA 2R69L 4L9LA 1VFMA 1NAMA 2R15A 5E2TH 5GJSL 1ZLWK 2WTRB 4Y5VA 4HF5H 5DHVH 4ELMA 3VGDA 4MGXA 1F02I 1VJSA 1G9ML 3JV4B 3OAZK 3HZMA 2CHWA 4A68A 1U4FA 3N41B 5LXGH 1JDDA 1SN2A 4WI7A 2GBVA 3M17A 4DZ8A 3BZEA 4GH7B 2ZQKA 5JUEL 3UFIA 2EAEA 5E2WL 5HYSA 1WHOA 1MWOA 3VVVA 2ZE0A 1G9EA 4PJ9C 3GYRA 3P3TA 1DDHA 3F58L 4I5BA 4KDTA 3N1PC 1XZ0A 4J3SA 3RBGA 3REVA 4ABWA 5BV7L 3KGTA 2P5WE 5L88H 4L8BB 2KZKA 1AQKL 4JQVC 4JZOB 1XF1A 1FPTH 4Q89A 5JXEC 3WKNA 3T3PE 4ALAH 5DK0A 4BE5A 4EUPA 2B9BA 4DVBB 2CRZA 2V5RA 1J18A 1YNLH 1ZVSB 1YQVH 2BWDA 4TN9A 1SZNA 2F54D 3VD1A 3VFMB 3LKNB 3E38A 1Z9PA 7PAZA 1UM4L 3H3BC 1BCIA 3FZUD 1UA6H 1SJHA 3FB8A 4DPRA 1FZMB 5JHDA 4IHBA 4OLUL 1ML0A 4RAVB 2B20A 2K70A 4NRXB 4PJGE 1T6WA 3P4NA 4RX4D 5EIIB 1EDYA 2BZDA 4AG4L 5C0FB 1G7LA 4NB7A 1Q72H 3IRPX 4XP4L 3UJIH 4P3DB 4OZHF 1XVSA 3SBWC 2XN0A 4PRPE 1O9WA 4A38A 1L9MA 3QIWA 3DURA 1EGJA 5GGVY 1R46A 2BSSB 3CC1A 1E4HA 3F01A 2V2TA 3KCPA 1VEOA 5DRWA 1QFUH 4L8DB 2XN9A 2GI7A 3PWVA 4H8WL 2NXZB 3MODH 1QI3A 2DWSA 3BPNC 4H13C 4HKXB 1NEUA 1Q4NX 5AW4B 2JKXA 3WEAA 2B14A 1NFIB 3BCDA 1AR2A 1IM9D 4HZ1A 1PKQE 2NYYD 5E1QA 3KPNB 2J5LB 2FHCA 4LLDA 1U8QA 5C86A 3AU0A 2VKWA 2NXYC 1PQZA 2CHNA 3P4MB 3QIUD 5C0DB 1A7NL 3VW3L 3GMRA 4IRJA 1L9QA 4O02A 2XHNA 2BO0A 2W92A 4K2UH 3CH1B 2X2HA 5I6PA 4D9LL 5ENWA 5IEHA 3L4UA 1XR9B 3CZNA 3MR9A 3TGXA 5F93C 1HC1A 4IDJL 3N6YA 3UYOD 1SLUA 3MUJA 4ZUWA 4WTXA 5CLTA 1JV2A 3WEXB 1Z66A 4OLXH 1JXFA 5B4MC 2NXYB 3CXDL 1CR9L 3X14A 5I76A 2LFGA 2NT0A 3F62A 3O9WA 3WJLC 4FG4A 2WKLA 3L3GB 3QXAB 4NWTL 1MNNA 5JIIA 1G5GA 3E2HC 5CR1A 3VFWB 4ZUVA 2X4RB 3VWJA 3QEHA 2Z6FA 3VWKA 4XNXL 4HLJA 1AGDA 4FI8A 2MHAA 4X6CF 1JZ3A 5DLMH 4UV7L 2E74C 1BFVL 1NCWL 3ARTA 3BW9A 3UZQA 2Y6SC 4F7EB 2DQDL 3P2DA 5F3HA 5C71A 1DQLH 4GI9A 3QUYD 3LKSB 1Z0MA 4HUNB 2SODB 4GG8B 1NMCB 1FL6B 2FCBA 3FO0H 3OB8A 3U83A 1XF2B 5MEOA 1TZHA 3MODL 3G04A 2GYSA 3TT3H 3DHMA 1J8HE 4GG8A 3PWPB 5CJ8A 5EUOA 3IKKA 3LNEA 3WNIA 3QG7L 5CLXA 1BZ7A 1MCQA 2BIHA 3FO9B 2DJ4A 2UZIH 2Q86B 2BIQA 1NGQL 1QACA 3EG9A 5GXBB 2NY3B 1YECL 4ODXA 3HOGA 2RH0A 1NL0H 2FZ3A 4JCWA 3H4HA 4PV9B 4I0PC 5TDNA 1T5WA 3SOBH 4L3CA 4DZ8B 2BOBA 1PDKA 1JHTB 1F4HA 4N68A 3TO4D 1PCSA 5KJRH 4Z95L 3O3EA 2J1ZA 4AGQA 4Z8FH 1QFWM 4MZRA 4XCCL 3FOLA 4U1IA 5CLYA 1F58L 2IWGA 1DR9A 1AJ7L 3ILPB 1TVBA 4N2DA 4HC1L 4U49A 2CLZA 2UX6A 3LNGA 1NC2A 4Z9KB 1KFAH 1SXCA 2WNWA 1SFDA 3N85H 1DANU 2EC9T 2YEQA 3GZOA 4ILDA 2JQMA 5KN5B 2VZUA 4EOWL 5KYYB 2NY6C 2EKJA 4PJIA 5T1MB 4X6FA 2IJ0C 5EOCH 1MOEA 1JZ7A 3GD1C 4FQJL 4XTRC 1VEMA 3K0WA 2F58L 3LSOA 5FAAA 3FT1A 5IOPB 3O9WB 1WP6A 2A77L 4HLZG 2QEJA 2WO2B 3RVWD 1G7PA 2IVFC 4YHML 4M93C 4N2KA 1MEXH 3P77A 3Q48A 3VFPB 2VDKL 2VISB 1TZAA 3HG3A 3HE7A 5D2NA 1MPAL 1WA2X 4DGIH 2XFGB 3IGAA 5E6ID 2BX5A 1DL7H 1MFVA 4MS8C 3F04A 1DE4A 4AVKA 2X05A 3IJ8A 2CMRL 4JZJA 5JHLH 4J4PC 3BVDB 2WB7A 2FR4A 2A6KB 1M1XA 5HYJD 1KWKA 2UZIL 1YEEH 1G0DA 1I8LC 3VGBA 1OAUL 1ZV2A 1KYUA 2BMKA 4K94H 4LNRB 4A2MA 2WN3A 1N3NB 2Y23A 2BCKA 3GQFA 2QT6A 3R8QA 5JPNB 1UOWA 2VITA 4NEHB 5J3HC 1SBBA 2YEZB 2FWUA 2CM5A 2XG4B 1BYPA 1K4DA 4ZO6A 4YHNA 5IREA 1DBMH 1DJZA 2D3LA 1KIPA 1URLA 3CWGA 2XN9D 3HN3A 1UQSA 5I30H 3FRUB 5IVXE 4U6XB 3FQTB 3U79A 3WNLA 1PLGL 4G8IA 3NJMA 5PAZA 2Z65C 2GIXA 3QIWD 3VA2C 2XY2A 1RURL 3D3VD 2NX5B 3C2SA 2EINB 3ILPA 1M9WA 1FAIL 4FNLH 1CE6A 1CUOA 2HT2D 2I9LB 5KSAC 4ZAKB 4IBLT 2JKNA 4KKLD 2Q6WB 4NHCH 2C1PA 4ZDHB 1KULA 3CFIC 1JUFA 1R34A 4LL1A 3JTBA 2WWMC 4KK5C 5KYUB 4CDGC 3UBHA 5L8KB 5CJBA 1FBIH 2WYHA 3L13A 3P4OA 4RSYA 4DNLA 4E41B 3Q8AA 3SDDC 4Y7MA 3V7MA 2AXWA 5EEXA 4DESA 4N1EA 1PY9A 1CU4H 3L5JA 3QXDA 1WD9A 1ETZB 4KY2A 5C0GB 1NLBL 4F8LA 1S9XB 1OW0A 3GSQA 1CDJA 4Y0GA 1Q94B 2VZ1A 1U8CB 2IDTA 4NUQA 3X1FA 4K3DH 4JG9A 1AY1H 3FRUA 4G6JL 3ZUCA 3EJUA 4OR1A 4FXGA 1JV5B 2ZIDA 5IHZB 5I5MA 4O58L 3GZQA 3KDPB 4P46D 1KJMA 4YUEH 5D5ME 3GKWL 2XTJE 1ZCRA 2VLKE 1UOKA 3PYCA 1KTJA 4KX8A 1I1FB 2GITA 3IDXH 4LEOB 4P5TA 3ZDZE 1QZNA 1JZ8A 3G5ZA 4X4YA 1MAML 5BUPA 5FR3A 4XNMA 3CH1A 4PUBH 1PBYA 1MIML 3TO4A 4F91B 2WLJA 4LNRA 4FKKA 3CSBA 4ODVL 3KHQA 2K7PA 4HX1B 4OGYH 1QPKA 5D7IE 4J8QA 3WTUA 1A66A 3TT3L 3QWNA 5FW7A 4MA3A 1TLKA 2QGCA 4B9ZA 1XH2A 2K7QA 3ARGB 2YBRA 3BPLC 1ZA3A 3AG1B 3IDMB 1YJDH 1ZK9A 4BK5C 1J0YA 2W59A 2FEEI 3WO4C 2EIZB 3ZE1E 3KPMB 3D06A 1HXMA 5T3ZE 3WE6B 5DEFB 5J9PB 5KBDA 2HN7B 4L4VE 5I17A 2YRLA 3ZDYB 5C0EB 2HVJA 3I75A 4MVBC 5JQHC 4C56A 4LSQL 3FU7B 1I1AD 2DD8L 1HXMB 1VHPA 2HFFB 2WXNA 4AKQA 4FL4C 4BQ6A 3QUXA 4HZLA 2YSTA 5T1MA 3BLKA 1ASOA 5IVNA 4JN1L 4Y2DD 4WTZG 4JFHE 2XA8L 5DHXB 3UCRA 2H26A 1K4CB 2E59A 4PJHE 2NW3B 4AZ8B 3H56A 1O6VA 4XWGH 2IFGA 4FGMA 2BSRB 1WEJH 2WGXA 3D39B 3BCFA 5AVSB 1ERNA 4FNUA 4JZNA 2NZ1A 3ZZSA 5JXAL 1MCOH 3QEQE 3RIAF 1W8NA 1JNLH 5H94A 4JPIA 3RZWA 4AW4A 4NOFA 2XOTA 5KANG 5KBKA 4Z7NB 4JFUA 2H0FA 2CIKA 2MKLC 2YAHA 4NIKB 5F9WB 4Z5RA 1AIZA 2YC1A 4ODXB 2YN3A 2XVLA 4A6YL 3AUVA 5DRXB 1ZSHA 1OHZA 1QOKA 5D70L 3TJPA 1TJGL 1M6OA 5GS1C 2VZOA 1CXKA 3QDAA 1NJ9B 3T77A 2BIMA 1EDQA 3KD4A 1J8KA 1R3HB 4YDVA 2J5WA 1ZTXH 3WNPA 4Y4KA 3MUUA 3OLIA 4ZTOH 3A23A 4LARH 1OPOA 4GRLC 1F8TL 3EUDA 4A67A 1WAPA 2Q3AA 3BUTA 3MV9E 3VFMA 3AQDA 4TL4A 3K4DA 1SMOA 4G3YH 1SVCP 1WWBX 1M53A 1W0VB 2Y4SA 3DTXA 3NSFA 2WANA 2NNAB 4C54A 5GRJL 2MCAA 3WFHB 3IFOB 4OD1H 1Q72L 4Y2DA 4XGZA 1Z5LA 5F7EH 1FL5B 5AKSA 4HLZH 5TE7H 4PJ5A 1QPXA 4LPXA 4OIIH 2KKQA 5D1ZI 5C70A 3BXNB 3KEHA 3CZUB 3RDTA 3U9PL 5KG9B 5GGRA 1MFCH 2ATPA 3KLHD 4JDEA 2PW1A 1PF3A 4OLVL 3O8XD 4HZAA 3FQYA 1IBZA 2OR9L 2Z8RA 2CBMA 3PWNB 4LDOB 4LVOC 3UAJD 4TUUA 4PJDF 3FUEA 5DUBB 3QDGD 4FI7A 3U2IA 4PLJC 2CM6A 5JHDD 5AOJA 2NW3A 5E6UB 3US9A 5L88L 1HXKA 3FO2B 2EACA 4XP6H 3TZVA 4HBCH 4PJFA 1RUPH 3VVWA 1U8QB 3MNWA 2XZQL 5I71B 5LJYH 3IKCB 1I7ZA 1HHHA 6TAAA 1PD1A 5ILTL 1RZGB 2H47C 1YEHH 2WM0A 3C5XA 3VQLA 1ZHBB 4GSUA 4H4NA 5C0EA 3LTVA 3AWFA 1BVNP 1E0OB 4E9VA 1N5AA 1NOFA 3KNBA 3ZQ9A 4B6ZA 2BP8A 1CC3A 4U1NB 5IOKA 4P23B 1XGTA 5AL8A 4OLZH 3LJ3A 2GPZA 3T2NH 1DQML 1AP2B 3GPEA 4FQLH 4KPHH 4LLMA 5FLUA 5IOPA 4HK0B 3ZTEA 4B0MB 3GSNB 4XPHL 3FCTA 1Q9LB 3REWA 3OSKA 2AKRB 3K2KA 1ZVYA 4NM8L 1XMWA 5F44A 2XZAH 4HCGA 3K72A 3QCTH 1EVTC 1DQKA 3Q8BA 4A6YA 2VSDA 3DV6B 2XSKA 2X4UA 4FYSA 2NY4C 1DSWA 1LE9A 4KRNA 4OF6A 1HU8A 1ROWA 4A6YB 2Y3AA 5KWYC 1UURA 4JQIL 2H1PH 5E4IA 1BSIA 5FHBH 3QWRD 5F2FA 1UTDA 2AJZB 3LRSA 3KPLA 4WWKC 4OLVH 1BEYH 3LY6A 5B38B 2BSTA 3BVXA 4S1QL 4U3SA 3P0VL 3DVGB 2E7HA 4JFFE 3OX8B 4NQED 4OLWH 2WK2A 3VRIB 3JWNG 3S3CB 3KNBB 4AEHL 2B08A 4N2FA 1J9SA 1E65A 2GJ6A 4HOXA 4FADA 1RZJC 3SQBA 4NO3A 4JDTH 3ILQD 1WAEA 4DVBA 3C5SB 2OMWB 1JGUL 5EOCJ 2NY2C 5F7UA 4LRIA 4HBCL 4YXLL 2AGJH 3Q43A 4NQTA 4O2CB 4EZKA 3O8XB 5E8PA 2CCLA 4NENA 3EBGA 2BPBA 2DIJA 4L8BA 2VDLB 2G75A 3FU0A 3LN4B 4OUOA 5DI8B 5E4EB 3M8OL 4AENB 4N0CD 3MCLL 3BVUA 1MPAH 3P11H 4ZMYA 1JNHA 1A1OB 3I2CL 4NZRH 5F88B 3ZE0E 2DWEA 5CZVL 3RA7L 4I87A 4WU7A 1WBYB 5I2IA 4TQHA 1UEYA 4KXZI 1DQQA 1S9YB 2YMOA 1Y1DA 4YGAB 4Q6IA 3B3BA 1KT2B 3SBPA 3B5TA 4OZGA 1SEBA 3TA3B 1KYDA 2VLRD 1TQCB 2EXYC 3G6JF 4M5YL 3PCYA 3HE7D 3IU3B 4D9RE 5IFJA 4LVHC 1BQSA 3QK0A 2EDXA 3MGOB 4Z76B 4DK6A 1Z7JA 3MRRB 4NNYB 2XTJB 4H1LB 1IUZA 4M7JH 4B9CA 3EGSA 3WFCL 2ILLA 4HC1H 1PX3A 3X11A 3UOAB 4XB3A 4NS0A 2YQGA 3MRJB 1Q9KA 5C09D 2BNRE 4JFYB 4R4BA 2CD0A 1WEJL 4LARL 5JA9A 3G5WA 2NY5H 2ZUTA 3IDJB 3JV6A 2WQUA 4P9HL 2WINB 1C5DA 4B50A 2OMUB 2XZCL 3OZLA 1XIWC 3MACL 1MVFA 5ENWB 1JRHI 3FUFA 5HHXH 2X9WA 1A47A 1M1SA 2ITDA 4BFFA 4F33A 5BZDA 1OARH 4KK6C 3V4UH 2P44B 2VLJB 4FLRA 2AABL 4O02H 4ZMWA 3KM2A 2OYMA 4OF7A 1R3HA 3GSNL 2HTLD 5FO9A 1HYSD 5D71L 4O2FB 2LTQB 1GYAA 3VD5A 1QVOB 1OE1A 2FDBP 2AJUH 4PP2B 5DUPH 2UWEE 3VB9A 3OX8A 1XGUA 4IRZA 4R0LC 1OP4A 5F7KC 2VN7A 3ARBB 4DQOH 5KUKA 5CINL 2IGFH 4J7RA 1KGJA 1U2HA 1HOEA 3HKFA 4EN3A 4PSRA 3RPKA 2E9WA 3LD8B 4LE8A 1GRWA 4P2AA 4QR7A 5H94B 1DQLL 4Q6KA 1GYVA 1VKXB 5A3IC 3RTLA 4PRHA 2FWOB 3HZ3A 1TVHA 3QZPA 3B1TA 2D31A 4TVUA 5IMLA 2IFFH 4FZEH 5DUPL 4N28A 3SPVA 3KYOA 1ZIAA 2ADIA 2FWOA 3DX9B 3OKYA 4QHKI 1EFXB 4RH4A 5EBMA 1SHMA 4J1UA 2LGNA 3BHBA 4R4NC 3K6DA 3H2PA 4DOHE 2CUMA 1A6UL 5TQ0L 1GGBL 2XWXA 4XAKE 1AP2A 5HJ3A 4POYA 1FFRA 1RK7A 4JFDE 1IFRA 2XFXB 5TGBB 1CVSC 1KZYA 1ZY9A 4C56B 3JWNC 4YX2H 1K9TA 5AL0A 4WY7L 1SJXA 2GI0A 4EUPG 1TKWB 2EH8H 1G4MA 2Q86A 1BJ1H 3CH8A 4ODHH 2BVEA 4KI5D 2FJUB 2CDFA 2VERA 4PU2A 1HH6B 3D9AH 3VMOA 2D9QB 25C8H 1LJMA 3EYVA 1JZDC 3TVMA 5BVJB 1BD2E 4LVNC 1JG9A 1MLCB 1OSPL 4QOKA 2VLLB 5CIPA 1NMAL 1O6TA 1YPZB 4MFHA 2DWDB 5F71A 3OKDB 2WXJA 4JX0A 4L4VD 3SDCB 3ZOAA 2X5PA 4LBEB 3E7JA 4CGTA 4OH2A 5A2KH 4OV6F 1RJLA 2BY1A 3OMZA 4O58H 4XNZB 3M1BB 2BNQD 3GXMA 3VI3F 4POZC 4FNPA 3VXTA 5E94B 5CUSL 1RPKA 3CN0A 5E7FA 5EOQH 3L6FA 5CD5C 3TIEB 4OZ4B 4P2YA 3TN0C 2VL5A 5DJ6A 3S35L 3VXQA 4HQQL 1BLNA 2DM7A 4UILH 4CADB 4DWHA 2KDGA 4KJWC 2HVKA 1RKRA 3UTPE 2AVGA 4OSUL 4O9HL 1A7OL 2ALAA 3RTQC 4HGMA 4WU7B 4U1HA 5D7IA 3VD9A 3BDYL 4F3FA 2J2ZA 5IKCA 4LAQL 2RA1A 4Q52A 4L4TE 5AOZA 5IQMA 2QADC 4JS7A 3U4EA 1UA3A 4K94L 3UAJA 5I2IB 4QXTA 1LEGA 4PTUA 3THMH 5MI0B 4W4NA 4K71B 4Z7IA 5A7EA 3MCG1 5CCHE 5CCJA 3OGOE 4YDKL 3P4MA 2BY0A 1QR4A 3V8CA 5HGHA 2JJUA 2NY2B 5GGQH 5ISZE 2IXQB 1SEQH 3D05A 3MXVL 2D7TL 2QFRA 3LQMA 4R7NB 1SJMA 2FO8A 1NCTA 3WKPA 4UF7C 3FTGB 1XCTB 2CE6A 3DO7A 1CN4A 2JIXD 3NA9H 2JELL 1UQSB 1P5UB 4ZOAA 2AV7B 1EFQA 1ZK5A 3U0PA 2FB4L 3CCHA 3RLSA 1SOSA 4UUJB 3UZEC 3ZKQD 3WTTA 3NZ8B 4PJHB 1P5UA 5SX4I 1L7IH 3ECUA 3CBJB 4P46B 4A66A 1T1WA 4HWEH 4ZMNA 4P5MA 4PS3A 1KXHA 3NK4A 4L3AA 4HPHA 5DSCB 5JO5A 3UYRL 4EO5A 4E9YA 4L8CA 1Z9NA 2PLTA 2WWMD 2X89A 1OAUH 1XSKA 3IBOA 3WLBA 4P3DA 2PW2B 4PRDB 5AW3B 2XN9E 5AB2A 2GSIB 4LPTA 1HKLH 1BYNA 3DKHA 3GS0A 4L4VB 3SDCD 3NAAH 4FQIH 4U05A 4DKTA 2WPGA 5GGUB 3TT1L 3MFGB 1EEYB 5E2VH 1DZ0A 3TO4C 1H3WM 4TNEA 5KSUB 4FQ1L 3EADA 3BP5A 4FXKC 1KGWA 2XT1B 5FUCC 2WUCL 5HDWA 4FP8H 4HUUB 3I9AA 4X5WA 5DHYB 1F97A 3VTMA 5J5EA 2E75C 3EYUH 2YBRB 4CU6A 1P0SE 1H9DA 4TM9A 1VZHA 3MRRA 3LSOB 5DK3A 1UA7A 1KOAA 2EIEA 2WKOF 4GQ9L 1RJZA 4JKMA 4JRFA 1HNGA 2QGBA 2Y2TA 4XO9A 3RX7A 1V54B 2XJKA 3FBKA 4BFRA 3WEBA 3FONB 2VRQA 2NY0B 3UIZA 4OCRH 3L54A 4AYBA 4WWNA 1MHEA 1TZGH 1OANA 2ZD0A 3GSWA 4GRMB 5CGBA 3RU8L 5F1NA 1O6SB 2EE6A 2ATPB 2YPLE 4FTVD 1QO3A 1WZKA 2YWYA 4FFYH 1JV5A 1IC5H 3V4LA 4MVBD 1MW1A 5DS2A 5T1KD 1JNHB 2VKXA 2HVBA 3B4NA 1FNSL 1GSKA 5ADOL 1AXSA 2B1HL 3B6SB 2XX0A 1SGKA 4DP7X 5KUMA 4ODWB 2FO4A 1G0YR 1KCRL 4BHUA 4ZXBB 4UQ3B 4OZHB 1K2DA 5ABAA 2XUWA 3MNZA 3QWOB 1QSFA 2LV4A 3MJ9A 4XC3H 4K5MA 3GJEA 5ICXB 4PJ8C 5J11B 1EBPA 3C09B 2RIKA 4TQEL 1KCWA 1TZHB 4LP4A 2HTKC 2MNUA 3I85A 3AABA 1JRHL 5F6HI 5E8NA 3QO1A 3BEWA 4HS3B 5DRNA 4ZNEE 2J5LC 5KVFH 4LO9A 1IILE 3EJJX 3F5WA 1X4ZA 4NO0D 3T6XA 2ADFH 4UV7H 3F83A 4ZMPA 2BVTA 4UDTA 3PQYD 2ZXEB 3QCUH 4H8HA 5EIIG 5EN3A 1E8ZA 2YJQA 3VGAB 4BFKA 1XF4B 3B7YA 4OT1L 5LUMA 3LPOA 4XPAH 4M4RA 4UDUB 1OAQH 4O5LH 3BE1H 3HNTL 2IPUK 5MEQA 4M43L 3KZ8A 5E5MB 4X6DF 4ZUVB 1P1ZA 3GXFA 4C47A 4U3HA 2E7MA 4JPIB 3PY9A 1CR9H 4JFXB 4NYLA 4YX2L 1XR8B 3NFPA 1T80A 1MY7A 3OR6A 4MA8L 3C6EA 1X6NA 3BESR 2CQVA 4NERA 2CO3A 4S0SD 3V4PL 1XR8A 2AJZA 3NFPB 1LMIA 5BS0D 4P0DA 4FQ2L 2HT3D 5J0BA 5DJDB 4YR6B 3BT0A 1QNIA 2FH6A 5DFVD 1FE8L 3MKGA 5LQBL 2HYMA 3TESA 4LOEA 1V3LA 1MHHA 1W91A 3MOAL 5T5FH 3T3ME 1TDQA 1WYJA 3GLEA 4WW1A 3T8XB 3LX9A 3OAUH 2PXYA 5CLZA 4RIRB 1T20B 3UX9B 1PX4A 5KZCB 2VUYA 2YOAA 2VE6B 3QORD 4Y8DC 5GZOA 4QYAA 4DGVL 1XSOA 7TAAA 3MRJA 4J3WA 5ES4B 5J4MA 4DOHB 5KYXA 1T6BX 4ZMLA 2M26A 3UAJC 2DQHH 2YN5A 1HL8A 2APFA 2CBQA 4GW4B 1FPTL 4W9ZA 3ARRA 3QNXA 1RZGA 4AJ0A 2PW1B 2D8KA 3L2NA 4AJWA 6CGTA 2X6VA 4IBQA 1FUNA 3BXNA 5BV7H 1BZ8A 3L4VA 1B9ZA 1SYSB 1HI6A 3P30H 1TENA 3TA3A 3UTQA 5GS1A 1QG3A 3BZ5A 4S1DC 3PNWB 5GRWA 4QRAA 2XC8A 1BXUA 1W2KT 3V52L 1Z5LB 4MS6A 1FRGL 5F0JB 3PGFL 2ZZUT 1KJMB 2JCCA 3MXWL 3T5WA 3RWDA 5AB9A 3VYPA 4CKQA 3P0YH 5EC2B 1K6QH 3C60B 5IEHB 3TV3L 4LASH 4N0YH 1D6EA 2YGNA 2NW2B 2OJEA 3UJJL 4NHCL 2BOBB 1X7SA 3D4ZA 3DX8B 1FI8C 2FHBA 2J20A 4UTAL 4YC2B 5C0GA 4JO2L 1OCWH 1SJEA 2A3TA 4MMZC 1T7XA 1JFQL 1ZHLA 3QEGL 5GS2D 1S7SB 3S37H 4WO4C 1ORQA 4M3HA 3EYOB 4GKNA 4Z7VE 3O3AA 3OGCB 1A1MB 5EC1A 4MNQB 3GBDA 4WHYH 1HIMH 1MKFA 2XG5B 1Z0NA 3EF7A 3K2MC 3DVGA 4XO8A 2O1AA 3FKUS 1Y6KR 4M5ZL 5ACMA 1CICA 2Z35B 3ZKND 4NT6B 1DEEA 3H54A 4L3EB 3LEXA 3RVUD 3LIUA 2V5SA 3HG0A 3C5JB 1NBYB 4NZUL 4YHZH 3LXCA 2GY7B 3MVSA 1UB5B 1HCVA 1AR1B 2NY7L 1QR1A 1MFEL 3CVIL 3OSVA 2R29L 2X40A 5JHDE 5FUCE 5IB3B 4X80L 2ZF8A 1UCBL 3L1GA 4G2AA 2X4UB 4F5CE 4ZW8A 4PV8B 5HHNB 2FH8A 4KROB 4OCMC 1U3ZA 3K6FA 4LEEA 3DXAA 1CXHA 5DJAA 5ETUB 3NSYA 4OCXL 4PWFA 4S11A 1W72H 4Y19E 4TLUA 4LESA 4DKFL 4HULB 1AZCA 4Y4HC 3L4YA 3PWLA 4XMPL 3T2NL 2H0EA 4KHXL 4PMFA 2W65B 3L9RA 4UQCA 3VXSD 2AQ2A 5C0RH 5DQ9B 5I1DB 4R96B 1MFEH 1KDJA 1V27A 3MN8A 3BWAB 4IRSD 2ZWKA 1ND0B 1YYLL 2PYFA 1EDHA 4HWEL 2A38A 1QA9B 1X5YA 5ANME 2NSMA 2HWZL 3UO1L 5ABDE 1UH3A 3N9GL 3QDHA 4O00A 1KENL 1ZHBA 1FZJA 4LCUA 1ESOA 4NM4H 5ANMA 1MFNA 4Y4KC 5FKAA 5IMKB 2JELH 1N6VA 5TH2A 2BSBA 2OMXA 4MSWA 3B9KD 5T1JA 1N7MH 1XTMA 5F96L 3JUZA 1NM9A 2JB5L 4JRYE 1FIGH 1ZT4A 1JWUB 3C2AH 5KSBE 3BH8B 2HRPH 2PPFA 1K3ZA 2CDGA 4LXFA 1BAGA 4ONFL 3BZDA 4ZMQA 1IARB 1CXLA 1I1CA 3OZ9L 2V7NA 1JPEA 1F3RB 4PVNA 2EDEA 4OF5A 2P80A 1E8WA 3TLRA 1QBML 5TDOB 3SGDI 1CG9A 5D72L 1KJ2H 4Y9CA 3GSOB 3BJLA 3RG1C 2PKDA 5GZOC 4G80A 3Q6FB 3VFPA 4DAGH 4HUVA 4Z7WF 3SBRA 2LQRA 1JZJA 1CFSA 4HEME 1BAFL 2LLGA 4QPEA 3H42H 4P48A 5IW1A 5IV2B 3SE4A 4PJ5B 4OI7A 1FG9C 3CQQA 4KJYA 4P49A 2AJVL 5A2IH 1J0IA 5H4ZA 1Q0EA 4V1DD 4DHLA 4KRLB 1TTRA 1Z3GH 1MFAH 2AJSH 3CK0L 1RJYA 3UBXG 2P42B 1KLUB 2HFEB 4JG0H 4MDJA 2I26N 2PF6A 2DYSB 5CUSH 3CV5A 1THCA 2ORBH 4G8GB 1VSCA 5HPMA 2Z31A 3MJ8A 4HC1A 4JR9H 1AOHA 4FS0A 2RACA 4HWBA 4HV8B 4NQQA 3KJ6L 3STLB 1FNEA 5FKPA 3L3IB 2VC2H 2I27N 5IEKA 3RGHA 1BZDA 2A6IA 2VABA 2NY3C 2W0PA 4TNGA 1IEHA 1OCCB 3Q2CA 1KBBA 1NUNB 3E3QC 5FYLH 3VXRB 3BAIA 3MXVH 4G8IB 1LXMA 4CL7A 3BAJA 5I8KH 3KBEA 3I3EA 3RB5A 3RWFB 2EE9A 2BS9A 3DIDA 3WS3A 5IQ7L 4KJQC 5E00A 5EG6C 1XF2A 4KTDH 4XXCC 1BQHG 4ZMXA 1CJYA 1M57B 3THML 4GQRA 1DVFB 1AIFB 4PW3A 3VRIA 1XHHA 1FAKT 3IU4L 2WBWB 4XMXA 3SY6A 3U7YL 5FHAL 1LP9B 4TTDC 4Y1SA 2FYYB 4YBLB 2DQFA 2H45A 3B9KB 1M2VB 1RLWA 1T2XA 1LILA 5HBBA 3V6ZA 4DGWC 3DXAE 2FUTA 3CLFH 4QYOB 4MTMA 3I6LD 5EBWA 3ULVF 5AFAA 3ATBA 3L3GA 4LLVA 4JPKH 3BQUA 5K5YA 2D31B 5C0CA 4YDMA 3DX0A 1ZKAA 3ZUNC 1TSRA 1GYUA 1RUML 3DO4A 3E8UL 1JERA 3L3HB 4DPCX 2JJSC 3FQRA 5A2LH 4R26H 3VFTB 3UERA 5EEWA 1PG7H 2EVIA 3K1KC 3ARDD 5FEBA 5HVHB 3HRPA 1GZQB 1HINH 1FVCB 2VZVA 3HZVB 4UZUA 5J6SA 4LVOB 4R83A 1JXDA 3AREA 4LP5A 1KEML 2DQDH 4FFZH 3LN5B 3FTVA 1GOFA 1UGNA 2BVQA 3RVVC 2CO7A 4Y4FA 5MEND 3POHA 1QLRA 2PPAA 1ACCA 2OCJA 1L9SA 3N1GC 5IZ7A 1DVQA 1TSHA 2FNWA 1GJIA 1HHHB 4LSRL 5F8QC 4B27A 3IKCA 5LGHH 3LRMA 5IT2H 5KBPA 2R27A 3WHXA 4XPGH 2YPVL 3UTSD 4MJ6B 3VYOA 4BCZA 3LS4L 3WIIH 2BLFA 4UQDA 5K9QG 2VRKA 4AM0Q 4XMTA 4G83A 4GKSA 4OF3A 3AC0A 1JNJA 3ATEA 3W39A 2A9BA 3ARSA 4OZIE 4I2XA 3BGMA 4G6JH 5HVWA 2P5EE 5IUCA 4ZZFA 4FXGB 2CPUA 2ZF9A 1WZ1L 4PD4J 4DH2A 2E4FA 3O3EB 3UH8A 2NYYC 2LFEA 3MGOA 1OZTG 2K4WA 4M1GL 3TBTA 4NQSA 5D6CA 1X5GA 4KKAD 5LLIC 2HLAA 4JANA 5L2KE 1A8JH 4Z7WA 1PLGH 3AT8A 4NQDD 4F2MA 4YQXH 5IUSA 2YJLA 4MAUH 2N1KA 5GRVL 4F58L 4H44C 3LXBA 2X4OA 3SKOA 3QDME 4IRZL 2WO3B 2P46B 3IXAA 3QZWB 1G7IA 4MNGA 4MA1C 5L4FA 5T5NG 5ESQA 3CVHB 2GCYB 3HG1A 3N55A 1KMGA 2Z4QB 4ICWA 5CWSB 5D1ZC 3QDGB 4JR9L 3R18A 3IDNA 5F3BA 1OGTB 1VFBB 3P69A 3QFJE 5C9JB 2Y07H 4NC1C 2DYRB 3HG1B 1MNUL 1I1RA 3WO4B 2AQTA 3OMNB 3PP4H 3RPIB 3H1ZA 1KCRH 5I19H 3CFJB 3QPKA 3TO2B 3GMQA 1JF5A 1AO7E 3C5SA 5CP3H 4HUWB 3KPOB 4NO3B 4IBYA 1RJYB 1J8HA 4XODA 3HC3H 1KYFA 3IN0A 3G7TA 2DM3A 5CEYA 3RY4A 2H32B 1SJVA 3DOSA 4DJMA 1DYZA 1ULVA 3IETB 1G1KA 4GEJA 3VXSB 3MMEA 3CHRA 4QD2E 4QRRD 3F7RA 2QSTA 3ZZQA 1CDYA 1FO0B 3EBAA 2RTTA 3ZL2A 2NX5D 3VG9C 1FH5H 1MRFL 3GIVA 3BZFB 2QVIA 1EERB 3FW6A 4Y4FC 1EHXA 3RQ3A 3RWDB 1V7NL 4HIEA 1CXIA 1GZPB 1MCKA 4GXFA 3D3VE 3IXAB 4RCAA 4YHPB 1UT2A 3HHSA 3SKJH 3FQ1A 4MCZB 4GMSL 4KKBC 4PYHA 1I3GH 3EXJA 3BAXA 3GI8H 5FGSA 3WKML 1MCIA 3FT4B 4BRVA 3EOAA 3ILDA 4KRPD 4LHUD 2QSCH 5F96H 1Q9LA 3REWB 2Y7QB 2D03H 1JWUA 4WJ5B 3ZIYA 5JIHA 4YE0A 2WCPA 1F45A 2IAAC 1ZPUA 2BDNH 2IWKA 1G7MB 3OHXA 3MRIA