5B1JC

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jC00
2MTAA 2PPEA 3OMAB 4HHGA 3S3BB 4F2FA 1L9SA 4UAHA 1NINA 1E65A 5PAZA 2IDFA 3DTUB 2R7EA 4JKNA 4KO6A 1KV7A 3QJVB 4KOBA 3FSWA 3QJSB 1SFHA 2HRGA 2TSAA 3QJUB 2XV2A 5F7BA 3AW5A 1XMEB 1KYAA 1ZPUA 2ZONA 1JERA 3KW8A 5PCYA 2WO2B 3FPXA 1BXUA 2IDTA 1BXAA 1ID2A 3X1BA 1GS7A 2PLTA 4BDVA 5EHFA 3D12B 2QPDB 1X9UA 2CALA 5I6OA 2EIKB 1NWPA 3EH5B 1OOWA 2YQBA 3UGEA 4YSOA 5I28A 1URIA 4HAKA 1NDTA 3T6ZA 1MZYA 5ANHA 3ABLB 4DP2X 3WKQA 3QJRB 4DP7X 2QPEB 3NSCA 4M4RB 1J9RA 1HAWA 2XV3A 2FNWA 4YSAA 5B7EA 3EH3B 3UACA 3SBPA 1J5DA 4AZUA 4DPAX 5F7AA 3NYKA 2NRDA 1JZJA 3T6VA 3NJKA 2IWEA 2X88A 4ZK8A 4CSZA 2RACA 4AKOA 1BQRA 3NSFA 3NSDA 1SHWA 1HAUA 2EIJB 3NT0A 3SQRA 2FQFA 2DWTA 2GC4C 4GYBA 2BHFA 3OMIB 1MZZA 1ASQA 1PZBA 4A2EA 2DV6A 1AS7A 4X4KA 1SF3A 3N2JA 1KBVA 1NTDA 2HX9A 2PPFA 4L0PB 4G72B 2XYBA 1E67A 3AY2A 1ILSA 1OCOB 1PNCA 3HEIB 3TASA 1GY1A 1MDAA 1OCZB 3H4HA 2FQEA 5I6NA 1GS6X 1NIFA 1AR1B 3PAZA 2R7EB 3S3DB 2HZHA 2BP8A 2PCYA 1OE3A 3JTBA 4KO9A 5TK4A 3UAEA 2FT7A 2FTAA 2OCCB 2J5WA 1GY2A 4DPCX 1KCBA 3WNIA 4YSSA 1OCCB 1AZUA 4BDVB 4NAJA 3GYRA 1JXFA 4EF3A 4DP4X 1GYCA 2GIMA 1ET5A 4HZ1A 1BAWA 1ZV2A 3DIVA 2Q9OA 3OM3B 1OE2A 1CYXA 5D4HA 1L9RA 3AG2B 4YL4A 1IBZA 1PCSA 3EF4A 1BQ5A 2ZOOA 2HXAA 3NJLA 2VM4A 1GW0A 4Q89A 3NP4A 2GI0A 3ZBMA 3FYIB 4YSQA 3PXLA 3U25A 3T6XA 1AS8A 2I7SA 5I5IA 1PLCA 2JXMA 5IY5B 2YXVA 4AI7A 4W1TA 1L9OA 4BWUA 1N68A 1X9RA 2AANA 1M57B 4A67A 3GDCA 4KOCA 2EIMB 1JOIA 4E9QA 3CG8A 3PPSA 2AZUA 4DP6X 1J5CA 2VMJA 2HLEB 4HCFA 1PZAA 3AG1B 2N0MA 3WNJA 2YAOA 2XU9A 2WSDA 3G5WA 1RCYA 1JZGA 3FQ2A 6PAZA 4DP5X 5D4JA 2P80D 4KO5A 1ZDSA 2B08A 1XB3A 2Y69B 1KDJA 1M9WA 1PLBA 1ILUA 2YAMA 2BP8B 3OMNB 3S3CB 1F56A 2YARA 2FT6A 1EZLA 3FSAA 1CURA 4GP4B 2E86A 1GSKA 2ZWNA 1JZEA 2JFCA 1FWXA 2ZXWB 5A7EA 1YLBB 3NJMA 4JHUA 2GSMB 1ASPA 2XV0A 1ADWA 2FQDA 2DWSA 1JVLA 4QLWA 1MG3C 4QKTA 2HRHA 6PCYA 4ENZA 1WA0X 1BXVA 1OV8A 1GS8A 1A3ZA 1IUZA 1OF0A 1AOZA 1IBYA 2IWKA 5B1KA 2H3XC 2IWFA 1TKWA 3NJJA 2IDQA 2XXGA 1AZBA 2H47C 3IE9A 2BWIA 2DY2A 2BO0A 2VW6A 3JT2A 2AFNA 2FJSA 3UAAA 1AIZA 1E30A 4KNSA 2UX6A 2YAPA 2PPDA 4TXVB 1A65A 2GHZA 1L9QA 5I26A 5D4IA 2VW4A 1E5YA 1L9PA 5B7FA 2J56A 3CVDA 3AZUA 4CSPA 2XUWA 2BW4A 5B1BB 2HX7A 3WIAA 4N8UA 1NICA 3FT0A 2P80A 4BXVA 5I5JA 1PY0A 1V10A 1WAEA 3FU7A 3L45A 3FYEB 1W8EA 3PAVA 7PCYA 1ASOA 3WKPA 1KGYE 1NPNA 1PLAA 1AACA 2FQGA 7PAZA 4E9YA 4MFHA 3NP3A 8PAZA 1TEFA 5B1JC 2YAFA 3ABMB 3FSZA 4NERA 2PPCA 4YVNA 2CUAA 3ABKB 2VM3A 2MRYA 1V55B 1BQKA 3V9EA 5FC9A 5I6MA 1XB8A 1QNIA 1L9TA 2X87A 4DP8X 1AZRA 3FQYA 1CUOA 2IDSA 4UF7C 1EHKB 4A2DA 4A68A 1JZHA 1AG0A 1NPJA 4KNTA 3ZX1A 2PCFA 2BZ7A 2BP0A 3T71A 3TBBA 2EILB 4HHWA 3X1FA 3NJGA 1I53A 2GBAA 3CVBA 1A4AA 3OQRA 3NJNA 4M3HA 4F2EA 1DYZA 2PP7A 2UXVA 2VSMB 2XX0A 3UADA 1ZDQA 3OD3A 3DKHA 4YSRA 1BEXA 2IH9A 4KO7A 1RZPA 4AX3A 3X1NA 3MBWB 4Q8BA 9PCYA 4E9SA 2GB2A 2A3TA 2QT6A 3ZDWA 3SBRA 4NB7A 2QDVA 3BVDB 1SF5A 1A4CA 3TU6A 1CC3A 1PZCA 2UXGA 4YSEA 2PP8A 2YXWA 4KNUA 4WTQA 4JHVA 4DP1X 4PAZA 2AZAA 1ZIAA 1B3IA 4G7SB 3FU7B 3ABGA 2DYRB 3X1EA 1AZNA 1FFTB 1AQ8A 3RYMA 1JXGA 3EH4B 2OJ1A 3MX0B 2AVFA 2XVBA 4BWWA 2BWDA 2JKWA 1QLEB 3GXUB 1R1CA 3NJIA 1UATA 1TEGA 1T5KA 1AG6A 4A2FA 1ETJA 1GR7A 1WA2X 4DP0X 2W88A 2XLLA 2VW7A 2XX1A 4F7KA 1AZCA 5B7MA 5AFAA 3T6WA 3TA4D 2Q5BA 4UANA 3H56A 3PLYA 1WS8A 3QPKA 1PF3A 2GC7C 1M56B 4P5SA 1SFDA 3CZUB 4N4YB 2H5UA 1QHQA 4WKXA 5B3SB 3QJTB 3EHBB 3ASOB 2YAEA 2QDWA 5I6LA 2YAQA 2BP0B 3CDZA 1NIEA 2W8CA 1SJMA 4DP9X 1IKOP 4AKQA 2IAAC 3FPYA 1BYOA 5E9NA 2CJ3A 5B1AB 1V54B 1NIDA 3BQVA 4YSUA 1SDDA 2IDUA 3FSVA 5AZUA 4G7RB 1SNRA 3S8GB 2CAKA 5B1JA 5I6KA 2XWZA 1PMYA 1JVOA 1J9TA 1KBWA 4FA7B 3FU9A 4G7QB 2WO3B 3V9CA 4YSTA 2FT8A 2BW5A 1AANA 2CBPA 2UXTA 1N70A 2CCWA 3ZIYA 4YSCA 1W6WA 1W6LA 3PAUA 3IBOA 1ET7A 2XXFA 1PNDA 3AG3B 4YSPA 4E9XA 1OCRB 4GY4A 4W9ZA 3WI9A 1ZIBA 5TK2A 4FAAB 3X1GA 3CVCA 4HCIA 4BXSV 1AAJA 4GXFA 2EINB 1AS6A 4YSDA 4DPBX 4YVUA 1KDIA 3TBCA 1ET8A 5I6PA 3T9WA 1A4BA 1VLXA 2PP9A 1NIBA 2I7OA 2IH8A 1J9QA 1NIAA 1J9SA 4E9RA 3X2QB 1NZRA 1PAZA 4K9JA 3S8FB 4A66A 4E9VA 4E9WA 1RZQA 2I85A 3IN2A 3QQXA 5AKRA 1SHXA 1WA1X 1JZIA 2B3IA 4G70B 4PCYA 4GP5B 1IC0A 3UABA 4A2GA 2PPAA 4RH4A 1FA4A 1CYWA 4AKPA 3HB3B 3ASNB 3NJFA 3FQ1A 4P5RA 2FWLB 2TSBA 3CDZB 3N55A 4HCGA 3C75A 3H4FA 3WG7B 4G71B 5I5MA 1A8ZA 2J55A 4BWTA 3QJQB 3NSYA 1OE1A 4BK5C 2VN3A 1SDDB 3AG4B 2J57A 3NJHA 3ERXA 4HALA 2UXFA 2VSKB 1XB6A 1MG2C 4GP8B 1JXDA 3IN0A 2DYSB 4E9TA 3KW7A 2YAHA 2OV0A 3IEAA 1BYPA 1DZ0A 5LDUA 1RKRA 2BZCA 1KCWA 1JZFA 1E5ZA 1NWOA 1HFUA 3PCYA 2LLNA 3SBQA 2UX7A 3FU8A 2HX8A 2Y1AA 1TU2A 4A2HA 1WS7A 3FS9A 4HIPA
chains in the Genus database with same CATH superfamily
3HRZC 4QR7A 1XX9C 4PGBB 4HEPA 4L29A 4UQ2B 3JTTB 4YNYA 3ISRA 4U1GB 2GK2A 1IIKA 1D7FA 2XIDA 1T4WA 2DLGA 3ATAA 1FVCA 3UTTB 3FSWA 3QJSB 4XVJH 1TQCB 4Z3FA 3CZFB 1G7JB 3KPRB 2WBXA 4UAOC 3FPXA 1RZJC 4RRPG 1JWSB 5JLZA 5DGQA 5HHPA 5DZVA 4WO4C 5EHFA 4BFGA 1V7ML 3THML 3L48A 3HC0A 5F1KC 3LNIA 4X4MA 5I6OA 2UWEA 2H0FA 3ZYIA 2J5LB 3HFML 4BRJA 1ZT1B 1BZ8A 3GSXA 1KCLA 5T1KB 5E4OA 4TVPE 4NKIL 1BA9A 3GKWL 2FWSA 4HWZA 3OQ3B 3RWIA 1KN4H 1QSED 5GJSL 5AAMC 3ARGA 1KB9K 4YSAA 3HHSA 3WUWB 3ULVC 4DEPB 1OM3H 1UZGA 1DCLA 3BPOB 2V8MA 5E00B 1AGDB 2XTJD 4YGAB 3KPQB 3TJHD 2PWHA 4LLMB 4IYKA 1NFDB 2FYYB 3O2VH 4YUEL 3SD5A 2WINB 4NQEE 2VUOA 3ZDZF 1N8ZA 3QNFA 2H1PL 1ZLSL 3D0AA 2WO4A 4S1RH 1NQBA 2QGCA 3MLSL 3REVB 4Z8FH 1PZ5B 5JIQA 3EFFB 3LDBB 4HUUA 3MUUA 5IIEB 1FIGH 2F8IA 3IPEA 1C5CH 4JAMB 3H55A 3IDIA 2V3FA 5F6HJ 1UGNA 1MW3A 3LZLA 3U82B 3B5TA 1BLIA 5EN2B 1E42A 2WAHA 4AQ1B 5DI8A 2VDNH 3RX8A 4DK6A 4EBQL 3NAAL 4JZOB 2AK4A 3JV4B 1OP4A 3CLEL 1XZ0A 4YSSA 1LGVA 4M1GH 4PBVC 4QOKE 4R4NC 4XWGL 4YDKL 5B39B 4XWOD 2G9HB 5C0GB 5F7FA 1JVKA 1ORSA 1V7NL 2NNXA 3QHFH 1U3HA 2MSPA 2BVUA 5EU7C 2CO4A 3UBFA 2R29A 4XOAA 3E38A 2O93L 3NQIA 5E1GA 1YUHA 3RVUD 1FNEB 1QSFB 2O5XH 5DURD 3TO2A 5D4HA 5J56B 1G7LA 4M6OL 1S3KL 1IBZA 4POUB 4DUVA 5B1CA 3O8XC 1QTSA 2DPKA 2OL3A 5D7LA 4NQVB 3LQAH 4UOW1 4WI2A 3QPQC 1BF2A 4G8FB 5I0YA 5DS1A 4YSQA 1EPFA 1WFTA 1AS8A 3MRJB 3EYUL 4J39A 5IMOA 3BLKA 3QAZB 4ISVB 4JFPA 5MP6H 1PD0A 4JR9H 4Z7OE 1UOWA 2QBWA 4E5XA 1M57B 1UXSB 4HPYH 4KTEH 4G9FE 2CO3A 4JDTL 1R3JB 4A6YA 4BYHA 3VWKC 2L8AA 1KEML 4U1HA 3WD5H 5TFSH 5SWQB 4N8VB 4EVNB 1ECYA 1KSRA 3L3DB 3RDJA 3V0EA 4XP9H 4PHXA 3GGWA 1X5XA 1O7SA 4RBPK 1MI5B 3CXDH 2CUHA 3EDFA 1I3UA 4MBRA 4HUXB 4N20A 4Y8DC 4GUPB 5L0QB 3MROA 2RALA 3GPSA 4BFFA 5F7WC 4KNQA 1PLBA 5CLWA 1R3LB 3V6OE 3ZR5A 1I1FB 2Z7UA 1JWMA 5ACMA 4QLRA 1N26A 4X0KA 2JFCA 3BE1L 1YLBB 1L7IL 1JDCA 4MS8D 3Q6GL 4UDUA 1A9EB 1ASPA 2F5AH 4PJFE 2JI2A 4PJCA 4HJ0D 5CS7A 1SEQH 2W65B 3MNWA 2VDKH 3C09B 1P5UA 2VIRB 4NQDE 5IG7A 3U46A 4AVKA 2AXGA 3B83A 1IUZA 2WLIA 2XICA 2AXWA 3QXDA 4W9HC 4ZOBA 5DJZA 1G9HA 1DEEB 2ZOKA 4EOWL 2ZCHH 3RA7L 2OJEB 1G7HB 3VFNA 5DJAB 3CMGA 3V0IA 5ABDE 1E2VA 5A3IC 1FHNA 4IDJH 2CHXA 3UJJL 1G9NL 2VCOA 2O6CA 4CADB 5FOBA 4YDLB 1CF8H 1MVUA 5E2WL 3ROOB 1A65A 2WZ6A 1VEMA 3MKKA 5E5MA 4LFHG 3PHAA 3CVDA 1WC7A 1W91A 2HKFH 1JF1B 2H32A 4U6XB 4O51B 4JGJA 4PGEA 1O9ZA 1UCBL 1DVUA 3KLKA 2XFGB 2Q86B 1RU9L 5JW5A 3QNYA 1MHPH 4LSVH 4KI1A 4OZIB 2XBTA 2YD9A 3I9AA 5CZVH 4KUCF 4JM2B 1QFWM 1VPOL 3FU7A 4MD5B 4MQTB 3UAFA 4AMKH 4J8RB 2IG2H 3KD4A 3QEQB 4NUJA 3HI6H 4PRDA 1CL7H 3DK0A 5F6IC 4F7EB 4JFSA 3V6ZB 2L04A 3HPJB 2DQTL 3LS5L 1EGJA 2Z31C 3C60D 4Z3EA 3D4ZA 5D7KD 5KSAD 5C09B 3HZVA 5C70A 1WD9A 1QD0A 4K07A 3QZBA 1A7OL 2V7HB 4JKMA 2IH3B 4TUOA 1IKNC 3RUGF 1JPST 1MIMH 2Y06H 5EEUA 3L1EA 4K94C 5DT1H 2XNAB 4FDWA 1I8LC 1X7SA 2ATKB 1OEZW 1BQKA 3KBEA 3Q3GB 5DC0A 2WXFA 4AW4A 5KG9A 1RUAL 1AZRA 2VISB 4RWHA 4N2CA 4M1CC 3HNSL 4O00A 1E4WL 1G1OA 3UO8B 3RBSA 1AG0A 3IXTA 3UTPD 1YCSA 4OCSH 5IFJA 1X5HA 4GIPD 4Y5YC 3L3HA 5ALBH 1Z5LB 4WRLA 1YNTA 3QG7H 3ESPA 4WK4B 4PREA 3ZVVA 1JV5A 3GSOA 4ENEC 1ITBB 1JP5A 2ZWKA 3QISA 5E24E 4YC2C 5B4MC 4U1IA 4WFHE 4HZLB 4Z5RB 1MELA 1HHKA 2GB2A 1GPOH 1VA9A 2EYRA 3U9WA 3ZE1F 5EMYA 3GLDA 3B3IA 4XNMA 4M29A 3EYQD 3ULAB 1BAFH 3L6FB 4Z95L 4F8NA 5D2LB 1QKZH 4FHJA 1BVZA 3RX5A 4EI6A 4UINL 3KMDA 3A6OA 4YHZH 1ZSHA 2L3BA 1Q9KA 2RQEA 1CDBA 2W07B 1T66D 3GB7A 4E41B 3X1EA 3CZEA 4F57H 3QCTH 1KG0B 3MRGB 1MAML 3QYCA 2F7IA 1Q1JL 3MNVA 4JFUA 5EZPA 5EOTA 4OIFA 3DTXA 2VL5B 4QRPA 1KPRB 4PH8A 2FIRT 2YGVA 4KTGA 4N3UA 3FQWA 1OZTG 2KLRA 3T08A 3P9MA 1F11B 3MJ6A 4WDIA 4DP0X 1AE6H 1ZJBA 2VLLB 4HC1H 4AEFA 1GHFH 1P5VA 3CVHL 4OZFG 3JUYA 4FFVC 3PLYA 3ZUCA 2J12B 1M56B 2FYVA 3VSTA 4L5FE 3N44B 4DF9A 1BM3H 4POYA 2VOTA 5IEHA 3MJ8B 3SJVD 4Z7VA 1CXIA 3GJEA 4FQXB 4JQIH 5C0JA 2Q8BL 3G6JA 2BP0B 1FGVH 1OT4A 5F7EL 1AR2A 2CO2A 3APFA 2Y36L 4UQBA 4N0RA 4S0HA 5EU5A 4J3VA 1RUPL 1E9OA 2NY2C 4A55A 4AEIH 5AL0A 4PJDE 3FC8A 2CJ3A 4X8CA 1OAZL 4N9OB 2NXZB 2AEPH 2A9AA 5AZUA 4NYLB 5KZCB 4FQJH 3MZGB 4ZO6A 3VW3L 1USZA 3FO9A 3AM8A 3M17B 3ROLB 4PS4L 1N8OE 3QDJD 4LDEB 43CAA 2XWZA 5EZJB 5KJ7E 4W9FC 3BJ91 3CK0H 3KAAA 2EEDA 2VXUL 4RFOH 3HG1E 2BW5A 1CK0H 2VMEA 3F7QA 3NCBB 3QO0A 5I30H 1RJLB 2VH5H 4GKOA 4G9DA 4R7DA 3ZXAC 4KJPD 2NX5D 4GY4A 4F3FA 4ZDHA 4Y19E 1PCXA 4ZTPL 3DWTA 3X1GA 4KRPC 4BXSV 5DFAA 3OB0H 4FZEH 3PHQA 3IDJB 4DPBX 4X2UA 1DO5A 3ARFC 3VU2A 2R4SL 2LTQB 5GGSB 2X4PA 4NO5A 2CPUA 3T9WA 4H20H 3RFZA 2VM9A 1S7TA 5GGRB 2D8KA 1JF5A 4QJ3B 3F58H 4X98A 3TFKC 2I85A 3ARSA 4NGHH 4Y4HC 5E7BA 3ARDD 1OT2A 3EBIA 4FNLH 4YEFA 3OXSA 5MI0B 1XSOA 3OKKA 1I8MB 3WLWC 4FGMA 3B5GA 4AUYA 2R69A 2C3VA 5B3JF 1BM7A 3O0LA 2OSLB 4LEXL 1B0GA 4A04A 4GINA 5TF1H 1SXZA 3FB7A 2ZXGA 3SPVA 3C9NA 3ILQC 4ZO9A 3V4VA 1G5GA 2XKNB 2X2YA 4TNGA 3RWDA 5HBBA 5A6IA 4IRJB 1FO0H 5C0AA 2NNFA 1KOAA 2VR7A 4JPKL 2J55A 2AABL 3MFGB 2CJSA 5ANMA 2DIAA 5AKTA 3MKGA 5E4IA 1RZKC 2CJUL 4IIQA 4BFKA 5I8CA 5LGJB 2WVVA 1XB6A 3AQXA 4G42A 2CKBA 3O6LH 1IAOA 1NAKL 2GAZA 2WKOF 2ZUYA 3II2A 3QUML 3VFGH 1S9KC 3IRZA 5TDOB 5LJYH 3NCXA 3D33A 3MGTB 3QUXD 1JS4A 1FYTE 4FXKB 4ODTL 4DQOL 4RNRA 3LZNA 5A7BA 3TT1H 1MUJA 2WXJA 4ONHA 4AGPA 5DO2C 3GI8L 5C9KA 5DRXA 3DJTA 5JORB 1EA9C 4BZ2H 1ZPLA 1Y1UA 1HQRA 3IF1B 4WKZA 2B1AH 4I8DA 4NDMB 4F2ME 4ALAL 2Y2YA 3HPLB 2FR4A 4O9HL 4PJ7E 4XP1H 1B88A 4HHGA 2BX5A 3R7RA 3QE5A 4JREB 1IO4C 3HUJF 5L7XL 2HFFA 4CA4A 4DCQB 2DQGH 4LKXA 4N85A 4M7JL 3PWVA 4TNEA 4NKDB 1A4KB 1IC1A 2PNDA 3AW5A 2O72A 1JFHA 2F7RA 2BSBA 4MAUH 1D6EB 1ZPUA 3B9VA 3NACL 4AQAB 5LGHL 2DI8A 1QYGH 4PGCB 4RA3A 2VDPB 4KVPA 4BDVA 1N64L 5EPMB 2QV4A 5ESQB 3PAYA 4N2FA 2P24B 3Q6FB 4XPHL 3NSXA 3MXWL 4MD4A 1QR1A 1GVIA 3V10A 3M7OA 2COVD 2BVQA 1ED3A 2MH4A 1AI1L 2WLYA 3BH8A 3QORD 3U0TA 2E7LA 1UZ8A 3BCFA 4QHUB 4NHUA 2EDDA 4W9IC 2C9UA 5EU3B 1A1MA 3F12B 5EEXA 1HAWA 1IM3D 2BC4B 4YK4C 5HI3D 2Y5QA 4OM1H 1NKOA 2W0PA 2FNWA 5DJ8A 4HKXA 4JG0H 3G5YA 3EYOA 4WK2B 2PTUA 4JK0D 3K4AA 4N5EC 3MCG1 4KZCA 5E99L 4B5ZA 2EVGA 3H9ZA 4U3SB 4HV8B 4ZK8A 3LRHA 1Y6KR 2EIJB 3NSDA 2OFQA 4EIUA 4LPCA 4GYBA 3Q0HA 1LK2A 4XH2A 4MSWB 4TQ8A 2MNJB 3W0WD 1AS7A 4UT7H 1FV1A 4PVMA 1YEDB 3VGDA 1S78D 3CHPA 3P0YH 4ZXBC 2CDGA 2IPTL 2CJTA 3EOTH 4JFQA 4UAOB 2ENYA 2OMVB 1OCOB 1PNCA 3GBDA 4NQCA 5G4MA 5I8EA 5LO7A 1SM3L 5T33L 4WO4B 1IKFL 3WKYA 2YKKA 4XNQA 3D0VB 5AVQB 4ETQA 1C08B 4FNPA 3QDME 2NYZA 3L5HA 2BP8A 4GQZA 3QR2A 4PW9A 1MLCA 4JPSA 3MUHL 4GAJH 3JTBA 4GB9A 4MDJB 3S7GA 3P30L 1TZOA 2K45A 4H1LH 4IMLA 2CO7A 4KZEL 1ZLDA 4OLXL 3MRDB 2MNUA 3ZYZA 1TT6A 4X83A 4BEIA 4CVWA 3ARPA 3HBPA 4ZAKB 1FFQA 5C0BD 2B8OT 5DVLA 1FNHA 2P42B 1GZPA 2JKJA 4MX7A 4DP4X 3VWJA 2AVGA 3BWZA 1UENA 1A7QL 5DQJA 3QZWB 4JFDE 3DMMA 1INEL 4G6AC 4LRIC 4JUSA 3ZTNH 3ESUF 4K7PX 1HIMH 4PLJD 1TQBC 1EXGA 5CINL 1YMME 1YEKH 4BH7A 2P8MA 1AGBA 3LZRA 4GSXA 3ARED 4L5FH 1RZ7H 3CHQA 2FSEB 4QF1A 3CQPA 3NP4A 1V27A 3ZBMA 4YN3A 4ZMZA 1KIPB 2Z35B 3OKEA 3HB3D 4WZ9A 3UO1L 1JE6A 1X5IA 4UIKH 3IS1X 2YFNA 1MFVA 3S35X 2BVEA 5AVSB 3SYOA 2HAZA 3ECWA 4AJVA 3WN6A 3MRCA 4OGXH 3RVXC 5F3HB 5DUPH 4UBDC 5HY9B 3AACA 1S46A 4PV1C 5HXMA 1VESA 1VGKA 3QQNA 5C0RH 3KPOA 4JO2L 2CLRA 4TTDC 4BFOA 1KXQA 4NWTH 5KS9F 4N2LA 4G2AA 2YGNA 3FO0L 3TIEB 2V7NB 4AM0B 5EEVA 6PAZA 1M05B 4TUUA 2P80D 1RK1B 4PBXA 1H8SA 1OD9A 2EXYD 3T0ED 4HA1A 4D8PB 3K6DA 1G7QB 3FKUS 3APDA 5FA4B 3WGUB 5JNYA 3DV6B 4O58L 1WDAA 2NCMA 2YAMA 4XNUL 2DQUL 4HMEA 2ICEA 3LPFA 1PTZA 2PWGA 4MCNA 4WFFE 5AOKA 4CN4A 4Z7WB 4PJIA 4MXQC 3Q06A 2OMYB 3NIDE 1PZ2A 4WI3A 4AXWA 3E9UA 4MJJA 3O8XB 4HDIA 3ET9F 1OV8A 3NCJH 4FRWA 4CRPA 4FQLH 2AV7B 5HGBA 5ISZB 4FFWD 1LE9A 3HN5A 5D1QB 4Q74A 1V3MA 1T1WB 4LQFL 3L1OL 5E8NB 1PW3A 4AGNA 4K8RH 4FMVA 1G7PA 3FO1B 4PW4A 4R8WH 4XVTL 3DO3A 5FIEA 3JV0A 5IOPA 3VXQB 3FNKA 3RUGB 1MCSA 3AUWB 3GBML 1SMDA 4G7YL 2QTVA 5E56A 3DRTA 2XKSA 3UYPB 3STLA 4MMXC 4WV1A 1N3NB 3U36B 1D7CA 5CN2A 2ICES 4L4VE 5IMMB 2EDWA 2PCXA 3K4ZA 1JHTB 2D3JA 5AW9B 3DXAB 5EBWA 4I3RH 3MA7B 1KPUA 2BK8A 4YX2H 1GH7A 2N7SA 1S9WA 1EEUA 3LHPH 1BDYA 1FZOA 3KPMB 3QUGA 2MCAA 4G6KL 4ANUA 3HCVB 4LPVA 4G6JL 4X7SL 1HH6A 1CLCA 3SQBB 1NPNA 2WC7A 5G55A 4M00A 3QIWD 4XODA 5GJTH 3ZT6A 4AJWA 4FFYL 1GAFH 4P4KB 1KFGA 2L4OA 3SDDC 4XZ4A 4CKVX 1PEZA 2PYFB 2OMNA 4PB0H 3WS6A 3UDWA 2PPCA 1NANI 2WXLA 1MJJB 3DV4B 2CUAA 3ABKB 1BFSA 3KYMB 3KGRA 3QJFA 2V2XA 3RVWD 4R4BA 1EK3A 1C7SA 1T0NB 1U8IA 5SX4I 1U92A 4ZMQA 5KBDA 2NZ1A 1T5WB 2NR6D 3K5SA 5JXED 4J8QA 2PW2A 2Y7QA 3OLIA 4I0CC 4A68A 2YWZA 3MLVL 1BWWA 1JPFA 3QUYD 1E9QA 5TF0A 4I9WE 4ODWA 5CSZB 3WJLC 3C6LC 5CCGE 3ARBD 5INCB 2B7DT 5JUEH 3ULUC 2UXVA 32C2B 3QJXA 1T22B 2QGBA 4TSAL 1QFPA 4H8WL 5DRZB 1RZPA 3MRLA 1IC4L 1RURL 4NQSB 4AX3A 1WBZB 4E9SA 2VDQB 3I2CH 5GS0H 4WY7L 2VLRD 3CSYA 4Z76B 5F6IB 5E6ZA 4P48A 3TC9A 2FIKB 2H4EA 2QDVA 2J88L 2Z31B 4YDZA 4IS6A 3ZDXF 2CH8A 3DHPA 5CGBA 2P5ED 4WWID 3UP1A 5DCCA 1QEWB 1KTCA 2ERJC 1VGEL 3FUHA 4WTQA 3MLZL 3RURA 1GTFA 4X9IA 2EAEA 5EG6C 1X6LA 3NFSH 4X99B 1LEKB 4WEBH 1X4XA 1OP9A 2XA8H 1TZHB 3SGJC 3STBA 1TIUA 5DMIL 4XZUB 5DS8B 5GRUL 2H45A 1J8RA 2LT9A 3SGKA 3MODL 1M7IB 5GGTH 4DN4H 4MHHG 1NCJA 1F1DA 3TO4A 5BZWB 4JDEA 2N1TE 3EH4B 3UG5A 1T0PB 3ECBB 4AV4A 2VKWA 1EAPB 2JKWA 1XCQA 2Y0SA 1PX3A 3OR6A 1YUKB 3DX9B 3K80A 3FQRA 3BIKA 4QRRE 4UU9B 1YEIH 3C8HA 3IGLA 3P4NA 3JWNG 5CMAA 3UTSD 2O5ZL 3D25B 4Y5YB 2OXHB 4IGBA 2P5PA 3LRGA 2VW7A 3QHZL 4Q9QL 1P1ZA 4KZDL 1J11A 1XH1A 5B7MA 1UXWB 2OXGA 4MXVF 5EEWA 4QJ4B 2Q5BA 5LKNA 1KBGL 2JJTA 5FA3A 1K4CB 3VRLE 1XGTA 3HNVH 2MOGA 4YC2B 3VXME 1CN4A 2H5UA 2Y7SA 4XXCA 2K3TA 1JK8B 1M2OA 4OJYA 3BXNA 1L5GB 5ACZB 1QBLL 2J43A 1YAIA 4WJ5A 3BH9B 2VRAA 4XX1G 4Z7QE 3QXAB 4XNBA 3VMNA 5LAXA 3GS7A 1UTDA 4F33A 2LGNA 3CDGA 2PXYA 2BMKA 3A67L 4AZ8B 4Y0GA 3V4PB 2ETWA 3LZFL 2P5WB 2HRLA 2VSDA 3Q44A 4LAQH 3ESMA 1XH0A 3W1ZA 1SNRA 3PJSA 5EZIL 5I66B 2CK0L 3KLAB 4JFXB 4JFOA 3RAJL 3SHSA 1NEZA 4FCAA 1ZHLA 4TVPD 5I1AA 5D2NB 3S3PA 3V5HA 2QQLL 2FJFA 1F18A 3QRLA 3V9CA 3QIUD 3KS0J 4N2NA 1E28A 5I23A 1WAAE 3MUJA 1XEUA 2XN9E 2X4OA 3QWRA 3BP6A 4PRPE 1W6WA 4XXDA 2Z7WA 2Z8SA 3PAUA 1BHGA 2XG5B 3S37X 5D8JH 1WIUA 2YD7A 4W9ZA 2CKNA 5IMLB 2VDPL 3FU0A 3L4YA 4LSSL 5BRZE 3WFHA 4XVSH 5I9QB 1BV8A 1U0QA 1UOVA 1Z3GH 3BPLC 1DJIA 2DOCA 3NVQA 4NQED 4XI5D 1JD7A 1ET8A 5C92A 3ZTJH 4KC3B 1BZ9B 4BFBD 1PY9A 5DURB 4H0IA 5DUBA 4LLVB 1R3HB 1ZHKA 3T1FB 1F2XK 3KL0A 4LDCA 1WBXA 2BS8A 4E9WA 1X3DA 4UT6A 4HMDA 2NY2B 1A7BA 1R5WB 2MWCA 1PIGA 3O4LE 3Q01A 1R3KA 4LBAA 4PY7A 5JA9A 5LQBH 1MQ8A 1UZ6E 4J28A 3MV9A 5I2IA 3F5WB 4YZFE 1U8HA 1DBBL 1FVDB 5J57B 5JHLL 3HUJB 3D39A 1Q9OA 3EH2A 2XQYA 3FN0L 1BD2A 1WQVT 2MMXA 3KHQA 3KS0H 4G8EA 3EFOB 1HCYA 2CPCA 4DTGL 3C6SA 2FX8L 5TE4H 3IMUA 4XMKL 2GJRA 2BCMA 4HU8A 3BUIA 2NY3D 4QOKD 1BZDA 3NJHA 3MRBA 2QLVB 1RK0B 4H7VA 1ZK5A 5I74C 3VSVA 3CPLB 2A6JB 4UQIM 4HIHA 1RZJL 4JVUA 2AJSH 3EG9A 3IEAA 2B59B 5CEXB 2CZNA 3JWNC 3O41B 4K9EL 2VB5A 5GS1C 4HLEA 1WO2A 5CLXA 4HS8L 3VD5A 3HNTH 1CD8A 4UV4L 4E0RA 3CGTA 2ZOTA 3CNKA 3TJPA 4LXFA 1HE7A 2R0KH 4NHCH 2DQFB 1UURA 3BAWA 4KY1H 3NFPB 2X9XA 3OMAB 4MCZB 5EIQA 3GXPA 3S3BB 4Y4HB 4WNQB 4X80H 3GIZL 4I89A 3DTUB 3EBGA 4Y2DC 1KV7A 3GSVB 4K23H 4JKWA 1CXEA 5HDQL 3ULVL 1WZMA 4ZFGH 2BFVL 2BNQE 1XH3B 5D1XA 4G9FD 3BDXA 3MJ7A 5MEQB 3GMLB 3WL9B 3L1FA 4LE8A 3MLYL 4RZCB 4WJG3 3FZUD 5JZ7C 4X7EC 5H35A 5IQ7H 1NC4D 3HN3A 2VZTA 4DW2H 1P2CA 4I7ZC 2NUTA 4OJEH 1BQUA 1M2VA 2CRYA 4R6UA 2C7UA 1FNGA 5JW3H 1IGFL 3SDYL 3VA2C 3VXNA 1CJYA 3IFPA 1NDTA 4GSDH 4NFDA 5CLZA 5F7NC 4FTVA 2UZIH 5SWSA 3WEXA 3IMVA 2QPEB 1DUYB 3V7AG 5CWSB 1MF2H 3FFCE 1MCDA 4MRBA 1MXDA 1TZIB 3CH1A 3EH3B 4CVZA 4OLZH 4OZGA 2C3HA 3SBPA 3I9GH 4FYTA 2X2IA 1UJ3C 4JE0A 2GQHA 4X6CA 4ZNEE 1CFMA 1IAMA 4NQDD 2R1XB 4OZFB 4CSZA 3D30A 3J7HA 5KSAB 3NSFA 4AT6B 4N8CL 3B3BA 4TM9A 5MEOA 4KROD 1I3GH 5TH2A 3SYAA 2NTFA 3MTXA 4A2EA 4CBPA 4N2EA 3R06B 5GRVK 5KYUB 1IEBA 1M1XA 3ZR6A 4M62L 4MAYC 3INUL 3LH8A 4BZ1L 1I9RL 1HWWA 5FK9A 3LQMA 3NPSB 1IAKB 4KK5C 2VLKE 3G6DL 2Y5EA 1LDSA 4C83A 4F8LA 4YLCA 5DGRA 2FQEA 1AQDA 2DL9A 2RCSL 2RHEA 4EZJA 1YC7A 3S3DB 3PU7A 3ARUA 4NQXA 4KXZH 1CU4L 1GZHC 2YBRB 4NP4H 1N4XH 3FONA 4JO5A 3FF7A 2WUCH 4PCSA 3NK3A 2H7WA 2ODHA 3P0VH 5CIPB 2C9VA 4WWOA 4IRSD 1Z9OA 5ALCL 5FV2A 1M7DA 1OPGL 4YK4B 3O3AB 4DZ8B 2SEBB 3VXSE 3MBED 4R2GC 5KSUB 1QSEA 25C8L 1GZQA 1UA3A 4LOUD 3W81A 4XO3A 2J8HA 1XDTT 2A73A 3V0DA 4ZD3H 2CIIA 1KZQA 2EKSA 2I07B 3V0VA 4P57A 2VC2L 4RVBA 4M93C 3ZL4H 5F9JB 2AGJH 5GZOC 1NBZB 4BSVB 2ICWI 1LP9F 1RIVL 1CFQA 1KCSH 1QRNA 1KCRL 1WZKA 1CFTB 3HW7A 1C12B 4DIXA 4LPUA 2LFGA 3BDYL 3NJLA 4Y5VC 4OUUB 4ZPVB 1PZDA 5KVFL 5JTWA 2YRZA 3MLWH 5FO8B 1UWGL 3CN3A 4Y4KD 1HQ4B 4D9LH 5IY5B 2WZ0A 3LNDA 4JGMA 4XCEA 5E1AA 4DZBB 3VDBA 1T0OA 4HT1H 3T77A 1ACXA 4U49A 2GHWB 4PJHF 1OAQH 3CIAA 2D3LA 3D18B 1DBMH 4GW4B 3WCYA 4BFIB 3OKYA 3PPSA 4F37K 3X13A 1TJMA 4HJIA 3V5KA 3G04A 3UJIH 4OCYH 1GGTA 5F2FA 4WFHD 5CBAA 4ZQKA 3FT2A 5FEBA 4P2AA 2OYMA 4DP5X 1TJGL 3N41B 3FQTB 5TE7L 3MCLL 5IQ9B 1GGIL 2NW2B 3BSZA 3RY4A 4DETA 3SJVB 3MOAL 2BIIA 4PTTA 4GUQA 1XF2B 1NOFA 1ZJAA 4GAFB 3UC0H 4XPGL 1BXXA 1MHEB 5FR3A 5HYSG 1VENA 2C3WA 3ENEA 5CCHE 2PW1B 3C08H 4JY5H 2WOYA 2DQCL 2FQDA 4YBQD 1JVLA 4AUJA 4NI6A 2VABB 1PKQB 1A7PH 3MFFB 2I9TB 1HSAB 2HLAB 1VADB 3BKCH 2R2EA 2XSKA 5D70H 4APQA 1IGIH 5D72L 4RMRA 2H3XC 3S8WA 3HE7C 4WSKA 1JHLH 5LGKA 4W68A 1MCKA 3DIDA 4ZFOB 2HT3D 3JT2A 3KL5A 4K2UH 3P2TA 4UT9L 2ARJB 4MNQA 4GAYA 3HMWL 1U8LB 2VR9A 2QSCL 4OZHF 4XXWC 1LJMA 1CLZL 5IQNA 2EDLA 3VA6A 5F44A 3VWKD 2J8UE 1PDKA 5HGGS 3VH8A 3R1GL 5DZ9A 2OMWB 5EO9B 5E6UB 4KFZC 3MLUL 3T65A 3FCUB 4FLSA 4J2QA 1BVKA 2Z65C 2BY1A 1UC6A 4HP5A 5F3FA 3HI1B 4NO0D 5FKPB 1AO7E 4BV1A 1AHWC 2ZKWA 3DNKA 4S2SB 5HI5C 3DVGA 3WKPA 3ARDB 4HIQA 1JPEA 1U3ZA 1S9XA 3NG5A 4NXKA 4HG4J 4MFHA 5D7HA 3ML8A 5DHVA 3LAFA 5DEGA 2B5IB 5JXAL 3F00A 3TT3H 3PL6D 4Q6YA 3BKML 1F00I 3ZE0E 3U0WL 1XGUB 2OX5B 3HG1D 3WNKA 1HE8A 1TQWA 1LYQA 3DX3A 3FTGB 3ZKMC 2DB8A 3H9SE 2YC1A 4JJ5A 4OLYH 4EZMA 4DN3H 4JO8A 4Y19D 3IJSA 1OB1B 3BH4A 2NPLX 4KNTA 3V4PL 2YXMA 4FA8A 1B2YA 3QZNA 2BINA 1DQIA 4PV9A 5LVEA 3DHUA 1ZEAH 2AXJA 2BSSB 2PCPB 3TF4A 1EANA 3JYCA 2GFBB 5JPNC 4HMCA 4WENB 2VSMB 3KLHD 2R0ZL 2YWYA 4K8RD 1PKOA 3QARA 5IHZA 3OR7B 3X11B 3HR5A 4H1LG 4Q97A 3TP4A 2YEZA 3BUTA 1UA7A 1M53A 2D9QB 4WFEE 2CRIA 4G8GE 2F54E 4L05A 3ZE2E 3T2NL 15C8H 2R0WH 4JN1L 4DQAA 2CCVA 3BVDB 5J12C 3SO3C 3J2PA 3C60A 3I50H 1INDH 2Y6TE 1NAMB 4PRHE 1ZVSB 4JHVA 4ZMAT 5GIRA 1SJHA 3SDDB 2XOTA 1BP3B 2IBZX 2YZ8A 3PUCA 3NCEB 1E8YA 1MCCA 1ND0B 2CXKA 4G7SB 5EZLA 3QA3B 4FFZL 4I87A 4OV6F 4HJGA 1E5UI 5GZNA 3EH1A 1NFIB 3FH7A 1NM4A 2EZ0C 2ZP0T 4Y16A 3MQIA 3FRUB 4YOKA 4ONGH 3VFSB 4FI8A 3PHSA 4ZSOA 1VZIA 3MX0B 4ZX5A 3WNNA 4BWWA 4XB7A 3K0WA 3SE9L 2FNBA 4J23A 4H5SB 4XHQA 5T1JA 4OU3A 3ATBA 4ODXB 5E9DE 4LHQB 3QORB 5EO1A 1WZ1L 2K78A 4W9DC 1DE4B 3DOIA 3RWCA 5L8KB 1ZE3H 2P52A 1IM3B 1CB4A 5J06A 1JDAA 3LRSB 1EFXD 2XJKA 4EZLA 3QZLA 4PYGA 4NN5B 4JO3H 1PF3A 3B7UX 1B0RB 1SFDA 4GO6B 4PB9L 1PD1A 1AR1C 1NBYB 5ITFB 3M46A 5KS9A 2AS5M 2PCFB 4BQ9A 3NCYP 2UZXB 5DC4B 3ZZSA 4Z7OF 5K5YA 2VLJA 1BBDH 1T7XA 5IFHL 4IJTA 3MRFB 5J3HD 4XNZC 5IW6A 4PJ5E 2AQNA 1O6VA 2C3XA 3FPYA 2CHZA 1FP5A 2ERJB 3GK8L 3TN0D 2J6EL 4RGOL 5KVGE 2YPVA 1IQWH 5KSBA 3R19A 4JM4H 3SKJL 3BZDA 3QQ3A 1MLBA 3VVWA 1DN0A 2AI0L 6TAAA 3WIFB 1BVLA 1FJ1A 5T1MB 1PQZA 2OP4L 5I75B 5I1KH 2BP5M 4AH2A 4NOBA 5GS0D 5HHXL 3MBXH 5CHNA 4WUKL 1XGRA 3L3JB 5CN1A 4G6MH 5D5MA 4MD0A 3LS4H 1IEAB 4JFEA 2F74A 3A24A 4PJFF 4D7PA 2FJGB 2M2DA 1ZIBA 1IIIA 4NRYB 4ZYKB 3S98A 4RDBA 2J71A 4GG6E 1EHNA 3O9WC 3AQYA 1A1OA 2QADD 2VQ1A 3CPUA 5E8OB 4Q6IC 1I1YA 4D0DB 1J9QA 1E50A 1J9SA 5C07D 4RZKA 1RZKL 3GEFA 3GSUA 4EN2A 5FAAA 2V37A 3HS0B 1MJUL 3Q8FA 2O1AA 4X4ME 1K5NA 2KL6A 5F72S 5HTSA 1EAJA 2BXZA 3H3PL 3WJJA 4PCYA 1R17A 3UABA 3PS6A 4KV5E 2PPAA 5E5LA 2X10A 1XF3A 1AFVL 3I3EA 3VDAA 3HB3B 2HJLA 1HSBA 3QDMD 4ZUUA 4NM8H 3ZL1A 4ZFFA 4MMZC 4GJTB 4XP5H 5DD5L 2NNRA 5TGBA 2V2TA 1F1AA 3QDJA 3SDAA 1FBIH 1WPCA 2O5NA 3CFQA 1DL7L 1A02N 3WNLA 1TTGA 4NUGL 2XFXA 2YPLB 1H15B 4Q9RH 4P5KA 1DBKH 5D4QA 3DO7B 1YNKH 3DX1A 5CD3B 4ONFL 3CFDA 2VNCA 5EF0A 4IBZA 1RULH 3DUUB 2Z34A 3NFNA 5I19L 1Q90A 3MLXL 3POHA 1ONQB 2X6VA 4PLKC 1CT8B 1U6AH 1SOXA 2NX5A 4JFDD 2V9RA 3L3GA 4JRWA 5HD8D 5F1IB 1QX1A 3TS8A 3A21A 1H0DA 1X5GA 1JGEB 3P4MB 4P05A 3OMZA 4FG4A 4MDIA 4UTBH 4KKAD 1YMMD 2JJWA 5GS3A 3ZQ9A 1KEGL 1WS7A 4U1JA 5LHDA 5BVJA 3T8XB 2ADIA 2VDNB 2UVEA 3PGCA 4N2GA 1HZKA 4DERA 4B53A 2Y23A 4OLEA 2ED9A 4G1EA 1E6JL 2X3CA 3O2DH 3QWOB 1A1NA 4JHAL 4BGLA 5F9OH 2GSIA 3JZ7A 4NPKA 3MU3A 4P2OC 4HUVB 2AJYL 2X4TB 3OHXC 4DUWA 2B14A 1BXUA 2IDTA 3ATFA 4LZKA 2ZOLA 4RISH 3QNZA 3GSRA 3D69A 4DGVH 2Y72A 1J8HE 1LO2L 4NM4H 1JRHL 3WFEH 2ZG1A 1VERA 3IGAA 1ICTA 1CLOH 2JB5L 4QXGL 5EN3A 1XCTB 3T6ZA 3K81A 2IAMD 1JGDB 2E9IA 3JTSA 1A3LL 1AKJA 1ECZA 1VFUA 4I0PC 2HJKB 5B8CB 4WFFD 4PJEA 2OULB 3BWUC 3UZQB 4HWBH 3O6FC 2EXWC 4I3SH 4QTHB 3QUXA 3HKFA 5H2BB 1OGPA 1WLHA 3RZWA 2X88A 1XF5A 2DDQH 3CC5A 4FTDA 1F5WA 1QLRA 3WO4C 1BQRA 2E76C 2ZKHH 4JHWL 3QIWB 1FL6A 4X9YA 1UHVA 1RL1A 4LLQA 3J8F7 3RWJA 3VFPB 3GHPA 4Z7AA 4MA1C 2WQSA 4Y2DB 2V0AA 1ACZA 2Q6WB 3OC5A 2G5UA 1LP9B 4RFEB 5GRJH 1IBBA 4RFNC 5BCAA 2FLBT 1CDHA 1MH5B 1SJXA 3IMTA 4ODHH 4RA0C 5J11B 5IK3B 5TQ2H 4MKMA 1HEHC 3IFOB 4ES8A 5EZOL 5F9WB 2W5PA 3OB0K 1DDHB 1EJOL 4L4VD 1D5IH 5DK0B 3PAZA 2OJZH 3KZ8A 1E6OH 4FJ6A 3RTLA 1YZZA 1LO0L 3DETD 3BYTA 4GT0A 5E7FA 2VDKB 5TK4A 3R0MA 2A83B 4PJHB 2JH2A 3FOMA 4PJDF 5E2TL 2ZPKH 2QVKA 4JRXB 4J6RH 4LESA 1NCWH 4WI8A 1V3KA 3S4SA 2DD8L 4E36A 2F7QA 4F1ZA 4KH9A 4TN9A 1QPPA 4XO5A 2QQKL 3B8YA 3GXFA 1FSKB 4X6EB 4F7MB 1IC5L 1DFBH 3AS3A 2ATAA 1J5OH 3AT0A 1E5AA 1L7TL 4EI0A 2WBJD 3DYMA 2HYMA 3IWUA 1SY6H 5L6YL 3L3OC 3WKML 1BFVH 5C0CA 3L4UA 2GITA 4N5ED 2P5EB 4YLBA 2NZ9D 4KI5E 2Q8AH 1AKPA 2YK1L 3ZTJG 2ZOOA 5GRYA 4N0YL 1PX8A 1DJYA 4LSPL 4OF3A 3LPWA 4JKKA 3U7YH 3W0WA 3WFDH 5LXGL 3QH3B 2YMOA 2NW3A 5KYYA 4HKBA 5JW4N 5EU6E 4GQ9H 3MUGB 4CW1B 2J7LA 1PLCA 2AQ1A 5JQ6H 3FB8A 1OARL 4JANB 1GCFA 2PMZA 1TVHB 5EWIH 2ZCLL 3QQDB 4RDQG 4K3GA 4Q4EA 4W9KC 4FXGB 3WE6B 4I9WD 2QHLA 3RILA 3FTUA 1P0SE 4MLSA 2XRAH 2F5BL 3EGXA 3CFIC 1E4XI 5L2KB 5E6RB 2ADFL 2JCCB 1CFSB 3IJYB 3QUMA 4XGZB 1JZ5A 1U8NA 2OMTB 3ZKSD 3N9GL 1RMFH 3F7YB 2XWXA 3SDXA 4GKSB 3N50A 4JHZA 2E7DA 1HZHH 1J1PL 2FBRA 2A2QT 1ZDSA 4KK8C 1XB3A 1M9WA 3BUYA 3GRWL 5C0BA 3D7PA 5FUZH 3OMNB 2EIDA 1UWYA 2FD6L 3BVTA 4DKEH 2RTTA 4FLHA 3ZSTA 1F2QA 3UYRL 2Z8RA 3QHTC 4A1RA 5KBKA 1BEYL 2H8PB 2BRRH 3VGGA 5AW2B 1I1AD 5LCVL 1EEYB 1IX2A 3AREA 3FQNA 4Q9BA 3BW9B 2YJLA 5LNDA 3O0RL 4L8DB 4QRRD 1ZSDA 4FQPA 4I77L 1G9MH 5A2FA 1TVBA 4P46C 5CJOL 1IGYA 3QIUB 4L9LB 1T7VA 1NAML 2FJSA 3GSWB 4EUPA 4F7CB 4EE2A 3DX7A 3MBWA 1EEZB 2NY6D 2R9HD 3LTVA 2D0HA 2F18A 3EDEA 1KT2A 2PYEA 4PJ7F 4R26H 5I26A 3VXMD 3FHQA 1AXSA 5F0MB 1NCIA 5AWNH 5IOKA 5AAWA 5DUMH 4BKSC 2ZYIA 3K8LA 2K1MA 1CGWA 1L6XA 1OY3B 3QQ9C 4WI5A 4CSSA 4NQEB 1DN2A 1VF5C 2P80A 3IU4H 3QG6B 3T0EA 4LSRH 3TA3D 3RVVD 5BZZA 3IGUA 1RUQL 4P4RA 4YH6A 3SQOH 4FXTA 4OGAC 1H8OA 2H6UA 1SQMA 2ARWA 3AWFA 2X4SB 4AEHH 5MERA 4QRPE 1UXMA 1ZS8B 3SY0B 3WLBA 3ULUL 1TEFA 2D7QA 4WI9A 4YXKL 3VGAB 5CCKH 3MOQA 4XN7A 1I3RB 5AZ2H 3TIDB 5F88B 4HHAB 3BQUC 4KPHL 4U2ZA 3II3A 4N24A 4QHNA 1CGSL 2AKRA 4XN9A 4MJ6A 4PRPD 2XN9D 3DGGA 2B2XH 4B7IA 2HFGH 3HIZA 2XHNA 3MMEA 1XHHA 4IRZA 1EHKB 3A6BH 3QRGL 1K4DA 3I6GA 1T21B 5DVOA 5BRZD 2NY3B 4QOKB 3VFMB 1CE6B 3O3UN 3TNNB 3FT1A 4DVBA 4ZUSA 3AFLA 1EHAA 2YQ2A 3F7KA 5IB4A 4HHWA 1RV6X 4Y4FD 3M8OL 1HWGB 2QL1A 3ISYA 5ICYB 4GSQA 1E3ZA 2FLMA 4MWFB 1G5AA 1OCWL 4TNVK 4H88H 1ZDQA 2Y1YA 3WIIH 2ZX9A 3P9WB 3PNWA 2R29H 4GO9A 3ZPDA 3QEHA 1MCFA 3O4LD 4ZTEA 3ZTEA 2OQJA 2VZ1A 1AHWB 2BIOA 4YO0A 5AD0A 4TVSa 1XR9B 1VACB 1IC7H 4N2HA 5ECGA 2OL3H 3TPKA 4BE6A 4EI5C 1A9BB 1JUFB 2VR3A 3L5WB 3BZFA 4JG1H 2DWDA 1CF1A 4HJUA 1DJSA 4O2EA 1A6UH 4MJ2A 2BZDA 1I7ZB 2VLME 4MJIE 4Z78A 3U9UA 1JWUA 3QXUA 1BQLH 2P28B 3UYOD 4C4KT 4DKFH 4A6YH 3WNOA 5JYLA 1D5BB 2BDNH 2XVBA 3EJZC 3RDTA 2F19L 1I4FB 2NR6A 1KJVB 4JM0A 5JXEA 1BZ7A 1KN4L 2J1YA 1AG6A 2IV8A 4NX0A 1ETJA 4PJ9C 1GR7A 2I60H 4GBXD 5I1DA 4M3JA 1TMQA 1OM3L 2V4LA 4JFFA 3QUYA 1PFCA 3EUDA 1QLFA 4JY4B 5E6SB 2WXRA 3MV11 3OKNB 1TEYA 3TA4D 2Y25A 2EIZA 1M9SA 2AXFB 3AXHA 3ARBA 2DLFH 3O2VL 1QBAA 2DZEA 4PJFB 4XCNA 3TX4A 1FO0B 3LNGA 4O02A 1C16B 4YEEA 4JW3A 1HINH 3D85D 3TZVD 1U93A 1YEFH 2VLRA 1ZKAA 2GI7A 1EFQA 2BNQD 2OLDA 4S1RL 2JMRA 5E1IA 5AVVB 5J12B 1JPSH 5ANME 3Q2VA 1UB5A 4YHPA 1A6VH 1IBFA 4QXTB 1V54B 4K3DH 1FIGL 1T20B 3Q2WA 1C5CL 4KDVA 4N0UE 2HFEB 2F2HA 4XCCL 5AVXB 2NXYD 1B9KA 5FGRA 5HYSB 1JI1A 1AYOA 4DOHE 3B1UA 2BP3A 5F93C 1J8KA 3TM6A 1AZVA 1KELL 2BLFA 3ESNA 2VDNL 5F89A 5FB8B 1JVOA 3GRGA 1KBWA 1D5XA 2E3VA 1WUZA 4N1EA 3NABL 1YJDC 1DR9A 2FT8A 2J72A 3OPZL 4GLRI 3C5SB 3EYVA 2UXTA 2FVNA 1OGAE 2R2BA 4P9ML 2J1WA 5IVXB 5FFLA 1IL1B 1IT9L 1ET7A 2H32H 3QWQB 3UTSA 5JPMB 3QIBB 1QWUA 3NIDF 1E90A 3W56A 5TK2A 4FAAB 4CVUA 4YAQA 1MEXL 3N1QC 4G8IB 5FO2A 1DQLL 3MBEB 3CHSA 3HZYB 1B2WH 5G4NA 2N4IA 5J8OA 2H26B 4OZHA 5HGHA 1J18A 3TBCA 4HQQH 3LZPA 4HIXH 4FFYA 5IW1A 1NIBA 3NBNA 2I7OA 1EGJH 3G6AB 4PCKA 5IJBC 1W16A 3QPXH 5DFTA 4WWKD 1FH2A 2BVOA 2IH1B 4M8VA 4LDOB 5GXBB 3CMOH 4XNZB 4GT7A 3RB7A 2GJ6D 3GXDA 1KPVA 1HOCA 4D9RE 1CICC 4KJQC 1SHXA 3CFUA 2YA0A 4ELKA 2VLKD 3BZEB 3K71B 4UOZA 4J1UA 3LH2L 4S11A 4PJBA 5MP6L 2COQA 4KJWD 1NSNL 4MCMA 5HDBE 1VCBC 1DUZA 2H3NA 4HPYL 4LCVA 4AKPA 3ALPA 1WBYA 5CLYA 2EP6A 4RQQB 3T0VA 3AGVA 2K7QA 1KIQA 3KBFA 3VD0A 1A7NL 3IPBA 1RIUH 3H54A 3K6FA 3CXDL 4AIZA 2J2ZB 4CU7A 4GKNB 4ELMB 2HVJA 5E23A 1GSMA 1U42A 1F6AB 1VFBB 1D3CA 3VXSD 1I8KA 1Z9LA 3A47A 3L4ZA 5ILTH 3A22A 3TF7C 1OK8A 3IAPA 5IB5A 1K72A 4JLRA 2DYSB 1OW0C 3HLAA 3R4DA 4OGZA 5J9PB 3FQUB 4NQQA 1B90A 5KJ4A 4K7PL 3F8UB 3Q8CA 3JT0A 5DJYA 1P1VA 2F5AL 5I1EL 4MAZA 2UX7A 3ECVA 1SEQL 2R1WA 2Y1AA 4Q6IB 4A2HA 5I73C 2VDKL 2VXTH 1CVSC 1RZIA 7FABH 5GPRA 1K3IA 4LCWB 3KLSA 4F2FA 4BCZA 3AQDA 1HEZB 1U2YA 1UGKA 4H1LB 2LU7A 4KO6A 4NQTA 1BREA 1J9CT 3BFQG 3P4LA 2UZYB 1DLFH 1F0LA 4IDJL 1NCCH 2PKDA 4TPRL 5DRNA 5BQ7B 2IGFH 3TCXA 1NCNA 3FQXB 4K5PA 2FJHB 2WKLA 2Y6SD 3FMGH 1CF8L 1MVFA 3CCHB 4ABUA 1N9PA 5D9SA 1S7SB 3GDBA 1G7IA 5E0QA 1UB6A 1UVQB 3HN8A 1G4MA 3UGEA 1MREH 3VQ1C 1NGXB 2J6WA 5T3ZE 1H19A 2VXVH 2HUHA 1FNSH 5LBSL 3W5MA 1UCTA 1QI4A 4LSVL 3TURA 1A6ZB 3UBXG 4HUNB 4M4RB 5CZVL 3GF8A 3G5ZB 4AMKL 3BUQA 1J05A 3DX8A 3HI6L 4YR6A 1CL7L 5B7EA 3IM1A 1W8OA 2EUVA 1I8UA 4NO0B 2UY6A 2O30A 3O6KH 4X6FA 2HN7B 1NBVL 1OKEA 1SVZA 2W9LA 2Z0UA 4IW4C 1IARB 1RFDL 3OX8B 2X2JA 4P06A 1JL8A 4PRAB 2E59A 4HUWB 5DMGC 1MIML 1OO2A 2Y06L 1Q94A 2RA1A 4QYOB 5DT1L 4AJYV 1L9MA 3QI9D 3KR3L 4S1SH 3PWNA 3QUZC 5HYIA 3X12B 3C5ZC 4GI6A 1KXQE 5ESVA 4ZG1A 1AD9A 2PTVA 3EZJB 1OANA 3K72A 4G9FA 1S7QA 4FERA 1VJSA 3AABA 3VRLF 4JO4L 4OCSL 2B39A 5C0ND 1QFWH 1SGKA 2DH3A 1FN4B 3QDAA 5ALBL 1D6EA 2G5BB 4MNHB 4Y19B 2R2CA 3WHXA 4Y9GA 4E68A 3QG7L 5CU5A 1NC4A 3P3YA 5IR1A 4AIOA 3I3DA 3EYSL 3BZ4B 4NC2B 4UI2A 5DJ2A 4PUBH 4ZMPA 1CTMA 4Z7QF 3PHOA 4PJIE 5GSRB 2X4RB 2QEJA 4CKQA 1AO7D 2XZQH 5DRWA 1GPOL 2ZZUT 2RAMA 4IEFA 5F9DC 4ZZKA 2Y7LA 3GYRA 4C47A 5JDSB 1TQUA 3KVQA 3L9BA 4PN6A 3CTTA 3VX1A 2VE6A 4J3TA 1ZV2A 4K3HA 2EUWA 4LSUL 4CGTA 3DIVA 4P23C 1FC1A 3WELA 2WLLA 2E6JA 1FORH 4J4PD 1G0YR 1TZ8A 4TL5A 4YHZL 1FYHB 5F7KC 1K9TA 1DJHA 2OMXB 3U1SH 2ROXA 4HD9A 4NQDA 3TCLA 2NYYC 4WSJA 1UT1A 4I9XA 3DVFA 2VL4A 1WAAF 2R69H 4B3VA 3P54A 4Q9CA 4ODVH 3WMQA 1H5BC 3Q8EA 3HRZA 4J5VA 2R27A 1GW0A 4IK6A 4XB3A 5F9AC 3H9SD 4IOSD 3V4VH 1T04A 5JIHA 1G84A 4KVCH 3X3GH 2CO6A 1VEOA 4ZJ9A 5I5IA 3IAQA 1IV8A 2K6WA 5AEAA 1KNOB 5EIVA 2H0EA 1N68A 1A6PA 4MCYA 4ZTOH 1IBDA 3KPPA 5C0DA 2VQUA 1AE6L 2BSED 1CWVA 4ORZC 1M6OB 2MQGA 3JVGA 5I15H 3VXPA 1JZ3A 4DP6X 3VXTB 2K70A 2CKBH 1R5IB 4GAAA 1FYTB 4QT5A 4PJAE 5ACLA 1IFHH 3BC9A 1FE8H 5E8PB 1MCNA 2VDOH 3A3YB 1WWWX 1A5FH 3F3HA 3FCSB 2Y7NA 3F64A 4YDVA 3HAEA 3CBJB 4GXVH 2AV1A 3L4CA 1UZ6F 2FGZA 3IKCB 4IRSA 4WFED 4KO5A 5E6YA 4G8GD 5BUGA 2ICWB 4TRPH 4YZFF 1UM6L 2B08A 2F54D 4RIRB 5I17B 5I1CH 5CBEB 2Q7AA 3D9AH 3K6NA 4BBWA 1LE5A 3FB6B 1HKFA 2VXQL 3UTZA 2LU4A 1MFNA 4AEIL 2ODIA 3S3CB 4KKBC 5CXPA 4LRNH 4R2GD 5DJDA 4ZUTA 4PRHD 2FT6A 4YDJB 5AAMA 1M3IA 2FO4B 3QK0A 1E27A 1LO5A 3AU1B 2GK0B 3FUIA 4FQJL 1H6FA 2DAVA 2CBQA 1OVZA 3HZKB 3U9PL 1L9NA 4HX1A 1T4KA 2FATH 2ZUSA 4J7RA 2GVYA 1BPVA 1INQA 4KKLC 2OCFD 1BXVA 4X5RA 2DN7A 2Q7YA 3PGDB 4JMXA 5I0XA 1KTLB 2G75B 4BQCA 4Y2OA 12E8L 4FQ1H 3T4YA 4L8BB 2GSGB 3K6SB 1RJYA 3L08A 4RFOL 5FYKE 1CK0L 1W0YT 1J88A 1AQKH 1CG9B 5A2JH 1Q72L 5E9DD 1NKRA 1TKWA 4OF7A 2XN1A 4Y4KA 2BNRB 1TJIH 3IE9A 2FK9A 3EOBB 4GW5B 3VI4A 2DY2A 3ZKNC 3ZK0A 2AFNA 2DQHL 3VMPA 5E6ID 4FZEL 3TBWB 2GHZA 3HG5A 3C12A 2IMMA 4CMMB 4H8QA 4H20L 2C4FT 4KKZA 1UKSA 3WS3B 3O4OB 4JRYA 4FQHB 3WIAA 1KFAH 3F58L 2FUTA 2CRZA 2QADB 2VQ4A 3LXCA 3W39A 1ZLWH 4NGHL 2GBTA 1XGPA 2APWA 4P04A 3SKOA 2Z4QA 3NZ8A 4FNLL 4YFLI 1W8EA 5T3XD 4Z77B 1SDYA 2HVKA 3DHJA 4ZMXA 1ASOA 1OK0A 4TULH 3LHAA 3OJMB 2WTRA 4IBWA 5KVDE 1D5ZB 2FQGA 4HS6A 3DPBB 1LD9A 2PO6C 4BZ1A 7PAZA 1X5JA 5KYXA 2QVMA 3T4AB 3TV3H 1KB3A 1B0WA 2E56A 4G5ZL 4DAGH 2OMUA 5I16B 4FZ8H 1MCPL 1A2YB 1FO0L 1R5VB 3P77B 4WW2F 4XP4H 3C2SA 1I1CA 3SPGA 2VM3A 2CGYA 3AC0A 2FX7L 3KJ6L 2CHNA 2V5TA 3W11C 3L9RA 5EU4A 1YN7B 1LQBC 3D4CA 3LKOB 4Q14A 3VTTA 3GLAA 4GRMA 1HESA 5JHDA 2FAUA 3O11B 1CUOA 4A63A 1JZ8A 1IVTA 4ZS6D 3S37L 4JPWL 4KZ0A 3O6LL 4YHLH 5CEZE 3QC5X 5F1NB 2BRQA 4GRLC 5DHEA 3VFGL 5I0WA 4U1KB 3ZX1A 3B56A 1A6TA 4NNPL 1G6RL 5FDWB 4LLAA 1E43A 1CE1H 3PWJB 1QWHA 1DQJB 4I2XA 4BM7A 1FRGH 3DVNB 4JFDB 4PRID 3VWKA 4M3HA 4RRPA 5LN4A 2HFTA 2B1AL 4OW6A 2QKIC 4ZFZB 1QHPA 2CNZA 1UQSB 3BJLA 3B9KB 5FYLE 3L3KB 3L95A 5T3ZH 2EEAA 1E40A 3E3QE 3T3PE 2DQGL 4PJDA 1EMTH 4Z18A 4U0RC 1PZ3A 2FRGP 3S34L 3LKQB 3WDJA 4Y5XC 4MAUL 2MCMA 1E7UA 3LOWA 4QRQA 2HVBA 3LD8B 2NY0D 4PLOB 1P7KA 3ARGD 3BVXA 2E0PA 1SDAB 1OSZA 1XTMA 1KENH 4OT1H 3PL6A 1FZKA 4YHML 3FSOA 4X4YB 1MRDL 1FFTB 3QQ4B 3HG1A 3SOBL 3HFFA 5EB9A 1V3JA 3RZCC 4BUHA 3NJIA 4OM1L 5ESAB 1T5KA 2E6PA 2N1KA 5TDPA 2VZOA 2C1OB 2IAMB 2L7QA 3E1ZA 4D0BA 1RI8A 3NZSA 1SMOA 2WQ8A 4JG0L 4TYUA 5AW4B 4NWUH 4YLQT 4N6RA 4R5VA 4LLDA 5HJ3A 2DM2A 1E8XA 1WEJH 4HZAA 4L8CA 4XCYB 4QO1B 3MV9E 3ISWA 5HYJE 4AYSA 4N4YB 2WQAA 1BFOB 3ASOB 5ICXA 3D39E 4UIMB 4UT7L 1PJWA 1X7QB 1KACB 2B9AA 4M6NL 2ZXCA 3BMWA 1H6UA 5FM4A 5E0FA 4DP9X 1Z9SA 2WUBL 3WTUA 4ZPTA 1D7BA 1BYOA 2EO7A 1S8DB 1WGVA 5F7UA 2DQIL 3AS2A 4RMUA 2BY0A 3SDCD 1AD0A 1L3WA 5I76A 1F1GA 1N12A 1BLNB 1I7UB 1QSZA 1RLWA 1J8HD 1X6NA 2DEWX 1KY6A 2Z1PA 3A0OA 1Q0EA 3KPNA 4GAJL 2K6YA 2HRPL 1IKNA 2C34A 3KJ4C 4TQIA 2FE0A 3FU9A 5AYUH 1DQML 1LK3H 5AUMB 1L0QA 1I8LA 3K2KA 2JELH 4YHNA 3BKJL 5DF0A 1KTDB 3F7PC 4IDLA 1EAPA 4PJ9B 43C9A 1BOGA 2D3VA 4IOFC 4UUJB 2UY7B 2CBTA 5H94A 4ZW5A 1U8OB 4IMKC 4AQOA 5AW6B 3ZTNL 1EFXA 4X8JA 4NO2A 2XZCH 1KTKE 1HIML 1RJZA 1S5IL 5MENA 4K55A 5D1XE 4F2MA 2HTLC 1VSCA 1A4BA 4NS0A 4PJ7A 4TQEH 1YEKL 2EDOA 5D93B 3PV6B 4E9RA 4AYFA 4L5FL 1PAZA 1RZ7L 2O6EA 5KTEH 3DRQA 5DJ0A 3D0LA 5AKRA 3KWWB 3ARQA 2RD0A 2R0LH 3UAJC 4UIKL 3VRIA 2X41A 1CTOA 4R9HA 2J8UF 1YY8A 4M7KH 4RH4A 4ZS7H 3TN0A 1FA4A 2X4NA 3CE1A 2EYSB 3ASNB 5SWSE 3N04A 4UB0H 1Q4NX 1Z6JT 3GM0A 4JHBA 3LSOA 3VQLA 5D7JD 2H0PA 1IB5A 3RPBA 2R56L 4OZGE 4GG8A 1U33A 3REWB 4WLCA 4PJGB 5DZNA 4MJHA 4X6CE 5FYKH 1THCA 3QRFM 1ZLEA 2YBGA 3BLBA 5EO0A 4HPHA 1RD6A 5FKAA 4HG4K 1YA5A 4JB9H 4HULB 2YA2A 3H42H 2EE6A 5DEFA 2OV0A 3GSQB 2WWMD 3V0WH 3H3KA 2EVHA 3WN5C 4ZI8A 1O6TA 2VXSL 4KI5D 3W9EA 4RX4A 3GS4A 1E4JA 1TFPA 3MV7B 3GZPA 3S5LA 2CDEA 4MXWL 4MS6A 5AYQA 5C07A 3TWCH 1KLUB 5EU6D 1E65A 2EQDA 2I9LB 1I1AB 1CXLA 4EN3C 3BMVA 2KC0A 1OL0A 4AGMA 3NJVA 1UEYA 5EFIA 1Z5HA 1ZA6B 4JFVA 2UYLB 2WMPA 4YE0A 4GKZB 5F7BA 3QEUA 3BPNB 4QRTB 1KIRB 1TF4A 2A6IB 2XY2A 3BP7A 5KVDH 1WV7T 1BMGA 3B7SA 3L3IB 4QHLB 3QDMA 3LY6A 4O4YL 4O5LL 3U6RB 2ZJSH 1TFHA 4GI8A 2EIKB 1Z0MA 1ZT4B 1AJ7H 2NY6B 4O2FB 3O3DB 4NOFA 4E5XG 2XTJE 4I3RL 4K5OA 3ZE2F 1O9VA 3RU8H 2RFXB 3SEPA 3VXMB 4R90L 2WOBA 1S7RB 5ANHA 4LVHC 4E42A 1QRNE 2R4RL 3SCMC 1CDIA 1NGZA 4M48H 4LP8A 3U7WH 3FXIC 3ZIMA 1N5AB 3VACA 2JK5A 1RK0A 4AK1A 2NLJA 5FO7A 5EUOE 1ZVHA 5CEZH 3OWRA 4Z7QB 2OTUA 1RPUA 2N7AA 5GJTL 3I9PA 1R33A 2X0UA 4MJ5A 1BVNP 4TSBL 1A3QA 3VYPA 1YMMA 1XIWC 1EO8H 1WH0A 4XTRD 3BISA 3SKMB 3VFWB 4PB0L 2PTTA 2VAAB 3ARFA 4QHPA 5J6HA 5BS0A 4EDWL 1RUMH 1UWEH 5CJQH 2KZKA 2BHFA 5ENWB 3TEUA 5DFWH 2AJZA 1ZTXL 2OI9C 5FYLH 5HHNA 3RI5K 2YXFA 3US9A 5M95B 3T0BA 3F65A 3E2HC 5JIIA 2C9AA 5KYWA 2XYBA 3V9FA 4XT1C 3QJHB 2FZ3B 4PRPB 5IM7B 4LCCA 4M5YH 3RKDC 5GSVB 4WTWA 2CMRH 5F0PB 3H4HA 3ZKXC 1I8IB 5IUSA 5I6NA 2FEDD 4Z9KB 3JWDH 3LCYA 5HHME 2VO8A 5CKGA 4IJ3C 5IT2H 4B9ZA 2X6UA 5JUEL 5E8EB 1RUKH 4NO3A 1OE3A 1NEUA 1A7RH 2J1ZA 5IB1A 4YE4H 4Y4FB 2OCCB 4X5WB 2D9CA 1K8DA 2FH6A 2JTYA 3OKMB 1N59A 3OSVA 2GY5A 4HKZB 4AV5A 3I2CL 3HJ0A 5AG9A 4RMTA 1DSFL 1HNYA 4YIQB 1Y6NR 4MB4A 3H9HB 1TTFA 3QCVH 1SYSA 5AYTA 5DUJA 5SWZE 3O4LB 1SLUA 5CWSA 4I0PD 4LCYB 3S36X 4QRPD 4AQEB 4TKWA 4NRXA 2ZT9C 1RIHH 2XPYA 4OIBA 4ZQTA 5J4MA 4UT6H 4KK6C 1IBGH 1U8JB 3CXFA 3P9LB 1HXYB 1NM9A 2A1WH 4H0LC 4XMLL 4MA3B 1YHPA 3TH3T 5F7DB 4LIQL 5AALA 2ITCA 4OFYA 1U58B 1DBAH 2HXAA 1RP9A 1FG2B 4MNQE 4DN4L 5IFAH 3ARXA 1YEEH 3GRBA 3QUZB 1PEWA 1TENA 3T2QA 4GIAA 1KJ2L 3H85A 1JGUL 2NDFA 3GTNA 4PG9B 3Q5OA 1CFBA 4GG6F 4W1TA 3EHBC 4XPBL 1IE5A 5T1DH 2OCJA 4JEGB 4YDNA 2QR0A 4WUUD 4YHYB 2KKQA 2EIMB 2VYRE 3BIAX 1G87A 4L4VA 3RX7A 2Y7MA 4GBXB 1NCAH 1WCBA 1S5HA 3D2TA 5HVWA 3CFEA 1AGCB 2MKWA 3LN4B 2YAOA 4QY8B 5F3BA 1LNUB 2B4CH 2WSDA 4N2BA 4P3CH 2WIIA 5CFHA 2YBRA 3X17A 5I1HH 4FULA 4WU7A 1FLRH 1DVFC 4KV5F 5A2LH 4LCIL 5C2BL 5KAQG 1SYVA 3B6SB 2NMSA 3ME0A 1NDMB 4PP2A 5IEKA 4MMYB 4PBWD 4XRCA 2YARA 3D85B 3TZVB 4GP4B 2P4AB 4KUZH 1HN1A 2BNQB 2OS7A 3GBEA 1WIOA 1O6SB 2J8OA 3WUWG 3MRNA 3H7BA 3HG0A 4N2OA 4BSWA 3TEXA 2E7MA 1YYMH 2QGEA 3K91A 4YGVB 4MJID 4ENZA 1WA0X 2ZUVA 4RAVA 3C8DA 4XVUC 4L8SA 1VDGA 4JPIA 1K5WA 3PWLB 3MRPB 2DQJL 3MXVH 2KYIA 4A2MA 1LEGB 4BKLA 2C3GA 5B1KA 5HYFA 1C1EH 4G1MA 4M43L 2H6PB 4CVXB 1HHGA 4ZXBA 5IUCA 2W60A 1JPGB 2BWIA 2DIBA 5CD5C 1FL3B 3FFCB 5D8JL 4URKA 1P5UC 5I71B 2YAPA 5K9QI 1JV2B 3QDGB 1D5MA 1CFNB 3CUPB 2N7BA 3P2DA 2WLNA 3VD4A 1E5YA 4Y9CA 3RNQA 1U95B 3STZB 4LASH 2EYTA 1HXKA 4P9HH 3IE4A 4JN2A 2FL5A 1JMZA 3IDGA 3WY2A 3ELAT 1I1RA 4BXVA 3GHBL 4BA0A 2QFPA 5LLIC 1FL5A 2APVA 3OXRA 3UBXB 4WWKB 3I75B 5D7IA 3NA9H 5B39G 1R3IH 2NQ3A 4CNIB 1ES0A 3GMRB 4OCRH 4PY8J 2VLKB 4PFEA 2ZWLT 1NOLA 5D55A 1W0WA 1NUGA 4LRIA 3RTQD 5TQ0H 1PG7X 4NERA 4PRBB 4W93A 2C9QA 4YVNA 4FI6A 1CO1A 3RX9A 3N42B 4HOWA 5EIIA 3VI3B 1PKQA 1WTGT 2DQEL 2AJVL 3D50A 1OGAD 3EDDA 1HHJB 5FC9A 4QRRA 5IVZB 4NPYB 5D1ZI 4AE0A 2EIEA 3P3UA 1L9TA 4MNGA 5GRZA 2JLPA 4TQHA 5T1LA 4DP8X 5JHAA 2FX9H 1XZWA 3QULA 1ZRUA 1T1YA 4A2DA 3IDNB 1QQDB 2X70B 4M5ZL 2QQQA 1OAYH 2ZSVA 3VXSB 4HS3B 4G82A 5GISL 4P5TD 4U1GC 3OSKA 2VLJE 3OZ9H 3DROB 3PIQA 2CLVA 1N6QH 5IBLC 3IDUA 1TQCC 1J86A 2ARJA 2EIBA 3ZO0A 2QSVA 2GBAA 3NJGA 4DHLA 5L88L 1MFEH 4F92B 1S9YA 2VDLH 1DYZA 2G60L 3IETB 5FW8A 5IB2B 2JNZA 5KSBE 3BAYA 2IH9A 4KY1L 4PVBA 2ADJA 4D9RD 2QJDA 3X1NA 4Q8BA 1YMHB 3BDBA 2J5LC 3HZ3A 4RWYH 2V9UA 4LBEB 5FM8A 3TA3A 2GTWB 4K23L 3V6FB 5ICZA 5GS2D 2PO6B 3PXJA 3NIGE 3MLPA 2EH7H 5D5ME 2X42A 4JFEE 4PWIA 2V5SA 4KRLB 3PDOB 5HJDA 1PS3A 5I0VA 1VHPA 4IOIA 2XKUA 2F53A 4DEPC 1DJWA 1B3IA 4HH9A 4DW2L 4NZJA 1TZGL 1FHGA 2CDFB 2WQWA 4X7CC 3BQUD 2IQAA 5CGYD 2YMTA 2XN9A 4PVNA 2UZIL 2R2HB 4OD2A 4YFLF 3CZJA 4GRLB 3HA0A 1DQVA 1N0LB 2TAAA 5BRZA 2MQCA 4DGWC 5B38A 2OMZA 5FO9B 3LMJH 5EC1B 1ESOA 3IU3B 4KI5F 4ESKA 2YD0A 2YSTA 4F7KA 3I9GL 1HHHB 3BSZH 4L1TA 4JPVL 3GMMA 4UTAH 1GYVA 3LDBC 4MMXA 1JZDC 4Z7NE 2VJXA 3UGUA 4QCIA 3IJHB 1YJDL 3AXLB 2BOBA 4PTUA 2LHAA 5F97E 3SGDH 1I3GL 3TYGL 4N25A 2G2RA 4JJHA 2H9GA 2WLKA 2X4UA 5LCVA 3CDZA 5AL8A 1LMKA 3P0GB 1WFNA 4Y5XB 5CEYA 3UC2A 5DVMA 1V7MH 2ZIDA 3THMH 3ZKQD 4H8HA 3UPCA 2Y2TA 1TCRB 4NSKA 4QRUA 3H8NA 4KRMB 3HFMH 1N2RB 3KXFD 4QXUL 2HT2D 3VWJD 3SBWA 2QV2A 2EADA 2I26N 4WVRA 3KPSE 3MHZA 2NX5E 3DMMD 4OV5A 4HEMA 3D87B 3GKWH 4S0SD 3QS2A 5T3ZD 2J8UB 1ANUA 1N4XL 4FJZA 2UVFA 2WUCL 4FA7B 3QA3A 5FHAL 2DICA 3DJSA 2WGXA 5GJSH 3LKPB 4QWWC 4NNXA 3IDMB 1FCCA 2PN5A 2P47B 1Q9LB 2BSTB 1DQQB 3TBVA 4KMLB 2AP2A 3AM8C 4GMSH 4IKNA 4YSPA 5IQOA 1SEBB 1AO7B 4JL2A 4ZD3L 1A66A 3ZL4L 4KTDL 4PJXB 5C08E 1OTSD 2AGJL 2FWOB 4GUOA 1YNTF 3N06B 4LEOA 1KDIA 3DBXB 1KCSL 4P5MA 4PV8B 3WJLA 2I69A 3C6LA 4WHTB 1ZLSH 3KNBB 1NMCB 1U8CB 3COOA 3I02A 3T3ME 3ZDXE 3ZSSA 2ZSWB 1OB0A 2HH0H 3ZE0B 3DSNB 3MLSH 4R97B 3AADB 4QUOA 1U3YA 4F27A 2E5EA 1Z9MA 3F7VB 2IADA 4AENB 2DMHA 3MRMB 2QMJA 3H0TB 4O2CB 3BEWB 1BQSA 4D9LL 5C0EB 2HMID 3HE6D 3H9SB 4LHUD 2CUIA 3MRFA 3O45A 2VZSA 4OF5A 3QRBA 4HT1L 2XA3A 5INDA 4A2GA 2Z93B 3RNKA 1W0VA 4AGLA 2RH0A 4NNYA 1DLHB 2CXGA 1ORQA 4EBQH 3F05A 3NAAH 4P5RA 3UL4A 4IHOB 4BA8A 1JNLH 1U8MA 2XPZA 4PJEE 3UJIL 3QWNA 5CZXC 4OCYL 3GFUA 3RL1A 4LNRB 2Y1VA 4PR5A 1MHHB 2YD8A 3M1BA 4ETYA 3HZMA 4XWGH 1EV2E 4L3CB 3NSYA 5K39A 4WW2A 4N86A 4XPFL 5F71A 4NENB 4JY6B 4AYGA 1WRFA 3FT4A 4B9JA 1R47A 3C09C 2HUEA 1TUPA 2JJVA 1DJXA 4KDWA 3UGXA 1IE4A 3UZVA 3IN0A 1F58L 3E6HB 4G8GB 1ZA3B 1CXFA 2F54B 3U30B 3UC0L 3ZE2B 2DKSA 2ZUUA 4HF5L 4M6OH 4PWFA 4RGNE 1PLGH 4PRHB 3LEYL 1EXUB 2HX8A 2X7LB 1A7PL 4IIQC 1G1YA 4N8PA 4YDLC 8FABB 1RZ8A 4D3CL 3BKCL 3DIFB 3KPRE 3OV6A 4FQIL 4HWUA 5D70L 4Y1TA 1IGIL 5PAZA 2OR8A 4UM8B 4D0CB 5FUCC 4P8QA 2GJ6A 4HSAC 1R0AH 2X0VA 1JHLL 5D1ZD 1HILB 1KEMH 2K9FB 1MCWM 5DR5H 2WZPD 4B41A 3HRPA 4Z0BH 3FT3A 2YQGA 1FNFA 4I4WA 5DTFB 5E9DB 2WO2B 2DKMA 4WTXA 5DHDA 4R0LB 2WTOA 5PCYA 2P46B 4JM2C 4H26A 3RWEA 1KXTA 1T2QH 3BHBA 3UMTA 3EO9H 2ID5A 5FYJD 4A7GA 5E6IB 4BCYA 3CLFH 3I6LE 4F7PA 2BH0A 4J27A 2WXQA 3SY6A 4EIGB 4J6IA 1XR8A 4JQVA 5AZEL 4ODUB 1Q1PA 5C0CE 2ZYHA 4OTXH 3ZRSA 3DURB 4DP2X 1CDCA 4ZO8A 4G7VH 3L2NA 1GC1C 1IGJA 1J9RA 5F7LB 1BZOA 3NQKA 3WY1A 1XGQA 4KHTH 5IMKA 3M1OA 4PJ5B 2Y5TA 5BOPA 1AP2A 1WK0A 4ZRGA 3W0WE 2P8PA 4AZUA 3B1TA 3EOAB 5F7AA 5IJVB 4WI0A 1UT2A 5KN5B 1JZJA 5DEZA 5J7CC 3G5VA 3IFLL 4MQXC 3NN8A 3VGEA 4XP6H 4EOWH 5LXVA 1JK9A 1IJ9A 4KITB 2KBGA 5FYKD 5A16B 1E5CA 1QMUA 2YPVH 4EN3B 1MY7A 3VRJA 1G9NH 4CDGC 1A47A 4ICXA 4S1QL 3N2JA 3WEMA 2WXMA 5E94B 3SDXE 4M61B 1OAJA 1OAXL 4HFUH 5E2WH 1K8IB 1TU2B 4TLKA 4V2BA 1OCZB 1S9VA 2DMKA 1JI2A 5DO8A 4YXHL 4L29B 1T1XA 4YNYB 5C0BE 1UCBH 5K9KA 2H2PC 2C9PA 3CSPA 1FVCB 3RWFA 4AYMC 1HDMA 4QGTA 2FT7A 5DD1L 3OKDA 4FL4B 4NT6A 1UYWH 1KCBA 5JLZB 3C8KA 5HHPB 1VFAA 5FF6A 3LS5H 2DQTH 1TYEB 5E5UB 4DWHA 3TO4D 3HC0B 1P7QB 2Z3FA 4Q2ZA 1WUNT 4CJ0A 4QRSA 2UWEB 3T0DA 4OGYL 1T3FA 1HU8A 4WEUD 4JDVA 3EGDA 4LOVA 5I8OH 3I50L 3GSXB 4M4PA 5IV2A 1T83C 3SE3C 2GEEA 5GS1A 5I0ZA 4HWZB 2EDFA 3RWIB 4J2XA 4EDXA 3SZKC 2NY0B 2DMBA 3ARGB 2Q1EA 3HHSB 4H2AA 1RUAH 5L2JA 3QI9A 3NH7H 4KK9C 4CBZA 1E4WH 2PYEE 1MRFL 4XAWL 3FYIB 3FFOA 4LKCA 1ZV9A 2NNAA 4ICWA 5DVKA 3OB8A 3VJ6A 5CEZD 3C5ZD 1XF4A 2KHAA 4ZMNA 4FQXC 4WHDA 1MI5E 5EUKA 3ZKXB 1N8ZB 3BN9C 3FCTA 1MRCH 1EDHA 4XMTA 1XT5A 4JL1A 5L8LB 2XTSA 3CFMA 3MCKA 2JB6A 2LOEA 2PXYD 2VMJA 1ZHBA 5CILH 4HCFA 4JO3L 3LB6D 2F8VA 3I6KA 4F9PC 2NXZC 4XE0A 2VWEE 3Q43A 4XNXH 5FM5O 5FYLD 3NEXA 4HUUB 4Y1AA 1NMAL 5D4JA 5GHWH 3APMA 3IDIB 5HDBF 1BBDL 1KDJA 2BERA 7CGTA 5DI8B 1P4IH 5DFVD 4I85A 3CFJA 1CURA 2AK4B 3BT2L 2ZWNA 2XXCB 2BNUA 4B0MM 4UOW0 3CFCH 3CWGA 1F42A 1XZ0B 2HG5A 1UJ3A 1MAMH 4LMQI 3UOAB 2XWBA 2CRMA 2QPSA 1SUHA 1IM9D 1EBPA 5I1KL 1JNNL 2A99A 4EAEA 1GS8A 2CR3A 1ORSB 3B2UC 5K9OA 3L4XA 1U3HB 4U7MA 4Z7UA 2ICEC 4IOSA 2LTQC 1T0MA 1YUHB 2IWFA 5JOFA 1MPAL 1J1XL 3KGSA 3TO2B 4MAYA 4RSYA 5E2VL 2EEFA 2XXGA 5LBSA 1O7VA 3DOSA 2FEEL 2OL3B 1KY7A 3BO8A 5D7LB 1QBBA 2PPDA 4PWEA 3X3FH 4KGJA 2QVFB 4XE5B 5MI0C 3HG4A 3MV9D 1L9QA 5ID1A 4N6QA 5HYJD 2IXQA 4ATTA 5IMOB 2Y36H 3D39D 4JFPB 4W9LC 1GZHA 4MDRA 4E5XB 4M7ZC 3N40P 4IRJC 5JMOC 3Q9PA 4A6YB 1CZ8L 1BQHA 1GGBH 4U1HB 4N0FA 4APXA 1HCFX 3MOBL 4UDTA 3GGWB 5HJBA 1I85A 1FI8C 2J3SA 4X5XA 3NP3A 4Z7IA 1YC8A 3FUEA 4XP5L 2IQ9L 3BLPX 3MROB 4HUKB 5IHUH 1PL3A 4JFFE