5B1JC

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Copper-containing nitrite reductase
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jC00
3OM3B 3AZUA 1KYAA 5I26A 4DP9X 4BWTA 1GSKA 1E65A 2IWKA 1J9TA 4A68A 2QPDB 2J56A 1BYPA 2VMJA 2UX7A 3CZUB 4N8UA 2BHFA 3SBRA 1MZYA 2EINB 3ABMB 3FS9A 5B1JA 1URIA 2CALA 1ILSA 4AKQA 2YARA 3QJUB 3GDCA 3NJLA 2MRYA 1BXVA 3NSFA 1GY2A 1GYCA 1OE3A 1OCOB 2XYBA 2NRDA 3EH5B 3FQ2A 3PAZA 4M4RB 2DYRB 2YXWA 1SFHA 4EF3A 3AY2A 3MX0B 5B7FA 3PAUA 2GC7C 7PAZA 4CSPA 3UAAA 1CYWA 3WNIA 1TEGA 1JERA 1X9UA 4DP4X 1ZPUA 3ASNB 2AZAA 1JZEA 4HCIA 1OE2A 1RZQA 3OQRA 1JZGA 2HX7A 1N68A 3FU7A 5I6PA 2CJ3A 2ZWNA 2PPAA 1A65A 3C75A 2CAKA 3FSVA 3CVCA 4N4YB 3KW7A 2FNWA 3IEAA 3ERXA 1BQ5A 5I28A 4CSZA 3ZIYA 1EHKB 2AFNA 1GS8A 4BWWA 4M3HA 4AZUA 1QLEB 1GS6X 2DYSB 3HEIB 4KNUA 1SDDA 3FPXA 1NDTA 4NERA 1IUZA 2HLEB 3WNJA 4MFHA 1PMYA 3KW8A 2DY2A 2FQGA 2IWFA 1E5ZA 2AZUA 3SQRA 1I53A 2N0MA 1SJMA 2CUAA 1XB8A 3AG1B 1OE1A 1NIFA 4E9XA 2WO3B 2BZ7A 2XX1A 3WKQA 4E9QA 3PAVA 3CG8A 4DP0X 4HHGA 3V9CA 1NZRA 3ABLB 3CVDA 3JT2A 5FC9A 1XB3A 2EIJB 3NSDA 2FQEA 2J57A 4YSDA 4W9ZA 1L9SA 2DWTA 2FT6A 4G7RB 5I6KA 2E86A 4A66A 2HZHA 3NP3A 1AS7A 4HCFA 2PP9A 4E9TA 2VSKB 3NJHA 3IN2A 2QDWA 1BQKA 4WTQA 1V55B 3X1FA 1JZIA 1M57B 1AZCA 3IN0A 3TA4D 1PLBA 2YAEA 3L45A 3FYEB 4P5RA 3S3DB 1PY0A 5B7MA 4UANA 3H4HA 2HX8A 4JHUA 2GHZA 3N55A 3QQXA 2H5UA 6PCYA 2HX9A 1PNDA 3EHBB 3S8FB 3IE9A 1A4AA 3ZBMA 2HRGA 1BEXA 4BK5C 1AG0A 3QPKA 4UAHA 3X2QB 4DPAX 3WG7B 2VM3A 4A2GA 2HRHA 2VW4A 1QHQA 1L9RA 2FT7A 1J9RA 1OCRB 3NSYA 1IKOP 1ID2A 1X9RA 4GY4A 2IH8A 1HFUA 4E9VA 2DV6A 3T6WA 1KDIA 4YSCA 1ASQA 3BQVA 3ZX1A 3PLYA 4YSTA 2LLNA 1NWPA 1ZV2A 5ANHA 1AAJA 2BP8B 1XMEB 3X1BA 5A7EA 1OV8A 2GBAA 2PP8A 2GI0A 1M56B 4Q8BA 1JXGA 2XXGA 2Q5BA 2R7EA 1SFDA 2B08A 5F7BA 1BYOA 4Q89A 4KNTA 1WS8A 3QJRB 4YSOA 3DIVA 2H3XC 3FU7B 2VM4A 2FQFA 2X88A 4DP7X 1NIEA 4G70B 1TEFA 2PCYA 1WA1X 1ZIAA 2RACA 3FQYA 3SBQA 1V54B 3T6XA 9PCYA 1OF0A 1SDDB 2YAHA 1BXUA 3HB3B 1OCZB 4W1TA 4KOBA 1TU2A 2Y1AA 5B1BB 4A2EA 1KCBA 5B1KA 1NIAA 1EZLA 1AOZA 3S3BB 1BQRA 1KV7A 3OMIB 3NT0A 2I7SA 3FT0A 2YQBA 4F2FA 2BWDA 3DKHA 1L9PA 2XLLA 2XWZA 4QKTA 1PZCA 3FU9A 4WKXA 4E9SA 3WIAA 1FFTB 1N70A 1VLXA 2JKWA 4YL4A 2BP0B 4X4KA 2PP7A 1TKWA 4HZ1A 2YAPA 1JZJA 2CCWA 4YVUA 1NICA 2YXVA 1L9OA 1ADWA 4E9RA 4F2EA 3T71A 4YSUA 1B3IA 1PZBA 1DZ0A 3PXLA 1J5DA 2VW7A 2ZOOA 2IDUA 5AZUA 1RZPA 5AKRA 1AR1B 4KO7A 2YAMA 5F7AA 5B3SB 4KO5A 2IDQA 4HALA 3NJNA 4DP8X 4RH4A 5PAZA 4HIPA 2YAFA 5E9NA 3DTUB 1QNIA 3CDZB 4DP5X 1J5CA 1J9QA 2P80A 2PCFA 3CVBA 3T6VA 4AX3A 3TASA 4K9JA 2JFCA 2QPEB 3D12B 1HAWA 3AG4B 1AZUA 5I5MA 1ETJA 1GY1A 4YSSA 1RCYA 1E67A 2UX6A 3AW5A 5D4IA 5PCYA 3U25A 3FSAA 2XXFA 4YSPA 2R7EB 4A2DA 3RYMA 1T5KA 4BDVA 1NIBA 2BO0A 2FT8A 3T6ZA 3NP4A 2EIMB 4YSRA 1GS7A 2FJSA 3TBCA 1SF5A 2W8CA 3GYRA 1WAEA 1BXAA 3FU8A 3OMNB 4TXVB 5TK4A 4QLWA 1GW0A 4P5SA 1W6WA 2GC4C 2UXFA 2BP0A 2WO2B 3NJKA 1IC0A 1MG3C 2PPEA 1PAZA 2HXAA 2PPDA 1V10A 2XUWA 3ABKB 4YSAA 5AFAA 2B3IA 2J55A 1PF3A 1PLAA 1WA2X 2MTAA 4HCGA 3MBWB 8PAZA 2XV3A 1AZRA 1SHWA 1ASOA 1OCCB 4YSEA 4JKNA 3ABGA 2EILB 2VSMB 3OD3A 3NJIA 5I5IA 2UXTA 1MG2C 2QDVA 3H56A 2GSMB 3IBOA 3NJGA 3OMAB 2GB2A 4YSQA 3FPYA 2PPFA 2J5WA 1L9TA 2BWIA 2FQDA 3NJFA 2TSAA 1IBZA 2Y69B 5B7EA 2BZCA 4GP4B 4KO9A 1JXFA 2BW4A 1A8ZA 1DYZA 2PPCA 4UF7C 1ET8A 1IBYA 1XB6A 3NYKA 2XV0A 3NJMA 5EHFA 1ET5A 1A3ZA 4L0PB 1CUOA 4KOCA 5I6NA 1OOWA 1JVLA 2IWEA 3H4FA 2IDSA 4AI7A 3EH3B 1SF3A 1MZZA 1NTDA 1ZDSA 2QT6A 1JZHA 1PLCA 3UGEA 1KGYE 4BDVB 1AQ8A 3UABA 2XV2A 2VN3A 5I6LA 4BXSV 1NIDA 2A3TA 2XU9A 3N2JA 1FA4A 1KBWA 2IDFA 4G7SB 5LDUA 3TBBA 4GP8B 3CDZA 3QJTB 2PLTA 3EF4A 5TK2A 3EH4B 1CURA 2XX0A 3V9EA 1W8EA 3WI9A 3WKPA 1CC3A 1JOIA 4GYBA 4FAAB 1BAWA 2YAOA 2YAQA 2VW6A 2H47C 3PCYA 4GP5B 5I5JA 3AG2B 1JXDA 2ZONA 3FSWA 5B1AB 2WSDA 2X87A 3UACA 4A2FA 3GXUB 1ZIBA 3QJQB 2OCCB 1AACA 4KNSA 3T9WA 4YVNA 1L9QA 1PNCA 4E9YA 3QJSB 2DWSA 4G71B 4AKPA 3NJJA 2W88A 4A67A 1ASPA 2UXVA 2FTAA 5IY5B 1AS6A 4KO6A 3SBPA 3BVDB 1KDJA 4JHVA 3FYIB 1NWOA 4FA7B 3X1GA 1AG6A 2BW5A 1ZDQA 1HAUA 1KBVA 2GIMA 4E9WA 1NPNA 2Q9OA 1NPJA 5I6MA 4DP1X 1FWXA 1JZFA 1AZNA 1AS8A 2EIKB 2I85A 4AKOA 3ZDWA 1R1CA 5B1JC 4ENZA 3FSZA 1PCSA 7PCYA 4DP2X 4NB7A 2OV0A 4DPBX 5D4JA 2I7OA 1F56A 1WS7A 1AANA 1GR7A 1J9SA 1SHXA 2AANA 3QJVB 1JVOA 3UADA 1A4BA 2IDTA 2IAAC 4DPCX 1E30A 4A2HA 2JXMA 3AG3B 4G72B 4DP6X 3JTBA 6PAZA 2BP8A 1ILUA 4GXFA 4BXVA 2XVBA 5D4HA 1NINA 1KCWA 1M9WA 2ZXWB 1AIZA 2IH9A 4ZK8A 1A4CA 1PZAA 3ASOB 3G5WA 4BWUA 5I6OA 3PPSA 1ET7A 1RKRA 4NAJA 1AZBA 2UXGA 2FWLB 1CYXA 2P80D 2TSBA 4F7KA 4PAZA 1E5YA 2CBPA 3S3CB 2OJ1A 3UAEA 1UATA 3FQ1A 4PCYA 4HAKA 4G7QB 3X1EA 3X1NA 3TU6A 3S8GB 1YLBB 1WA0X 3NSCA 1MDAA 1W6LA 2AVFA 1SNRA 4HHWA
chains in the Genus database with same CATH superfamily
3VFGH 4ZAKB 4M3KB 2EXWC 1F6AB 3QO1B 4POYA 5G4MA 4GXUN 2DMBA 2WZPD 3U2SB 1USZA 2ALWA 3G5VB 3MKKA 5EBWB 3T2NL 4F8NA 2ZSVA 2APVA 2J56A 3IF1B 5EDSA 2NY1B 4UMGA 5ITBH 1D5MB 2VDLH 4KK6D 1JFHA 2BHFA 4YHPB 3CFCH 4DKDC 2ZICA 5HHOE 3ABMB 2Y4SA 2A4EA 3OKOB 4YXHH 1QFWL 4MZ2A 2X4SA 3JWNE 4KX9A 4IIQB 1NAMA 5KWYC 1T2XA 2D7QA 4NM4L 4KXZH 4OZGE 4S1SH 3FOLA 1UEMA 3DIDA 3L1EA 4JPQA 1J88A 1NDGA 4UQ3A 2YXWA 4UTCA 1OF2A 4HKBB 3U6XS 3ULSA 4ZNEE 4NZFA 2ENSA 3PHQA 1LWHA 4JFEE 1AXSA 3KYKL 3MX0A 4V11A 4IRZL 1EGJA 4K5OA 4FS0A 1ZTXL 1FJ1A 3UTTB 2A9DA 1ITCA 4OQ1A 3HMXH 1RZQA 2Y2TA 2NW3B 4MYWB 2O5XL 1A6WL 1HEZB 1N5YL 1BZ9B 2UV3A 1NCWH 1SM3L 5E2TH 3IFOB 3FSVA 2VC2H 1RIVL 1XH1A 4M8QB 3E2HB 4MMZB 1QVOA 5JIKA 1XF4A 3TV3L 3IEAA 5JQHC 1NBZA 2XWBB 3TVMD 2VDOB 1FNSL 4CSZA 5AAWA 3GMPB 2AFNA 3UYPA 2AKRA 2QMKA 3NPSC 2R23B 3SHSA 3GBML 1ZHNB 3TM6A 1P2CA 2X1PA 2YLHA 3F7KA 4L9LA 5HI5D 1IUZA 1EFXA 3RRQA 1F1AA 3FB5B 3T8VA 4ONGH 1OSPH 1BM7A 3L5XL 3DRTB 3QXUA 2XCMC 5JLZB 3FULA 1EEYB 2QV4A 1NIFA 4D0BA 3PUCA 2WLZA 1KJ2L 5IVZB 2ZAHA 3R8QA 1XGRA 4R0LB 2RHEA 3QNXA 1GA2A 3ZL1A 4LRNH 3HBQA 1CI5A 4HIHA 5F7HA 5T3ZH 1Q1JH 2ITDA 3LDBB 1D7CA 2GPZA 2OTPA 4TPRH 4WWNA 5T1DL 1R3KB 3ZTEA 4ZQKA 1D3CA 1UVQB 3ELQA 1BZ7B 5DD5H 3QORD 3SDCA 3ZR6A 3N42F 5T5NG 3LV3B 4HEPG 2DQEH 2BNQA 5C09B 3RZCA 3MROA 1RK0B 2XJLA 4LSPL 1JGDB 3HHMA 3ZQ9A 3S3PA 3DX8A 1S9WB 1U8QA 4HJJL 4AZ8B 4KKQA 1W0WA 2MNWA 2VDNH 3W11D 3S7GA 4RLDA 2G3XA 1A9EB 2FUTA 4I77L 1G7PB 2WB7A 1P7KA 3I50H 3EJYD 4GBXA 3IJYB 3UC0H 1UASA 4M1GL 5FKPA 5LG1A 1X5HA 3RY6A 1CF8L 1K2DB 1OOAA 3ROLA 1WFJA 2WLIB 3RNKB 5H4YA 1IVTA 4FFWD 5LVEA 3BCFA 1CTNA 1J9RA 2AQQA 3G6JE 5L9DH 3U0WH 5I8KH 1F4WL 2FJFA 4NN7C 3MJ6A 4X8CA 5F3FA 4E9VA 2BP5M 5DLLA 4HJEA 3IJ9A 2I9TB 4LLWB 4FQXC 4YSCA 3KXFE 4R90H 1M1SA 2QADD 3CHRA 4R5TA 4QJ4B 1Q72L 2DQCL 3PLYA 5J6HB 5L2KD 4IRSA 1ZV2A 1UM4L 2WINB 4OLZH 4WU5B 3BAXA 4FD0A 4XN8A 4R97B 5D2NE 3GD1C 1G9MH 4PP2B 3KCPB 2X2HA 4KNTA 3TVMB 3WMPA 1T1ZB 3G6AA 3TBSA 1IC4L 5EEUA 4WEBL 1NIEA 4OD3L 1YEFL 3LTVA 4ELDA 2V5TA 1WIOA 2Z92A 4LSDA 5DLMH 4FLRA 5T33L 4TLUA 2ZAGA 5DXWA 4PBXA 1SEBA 3LQAC 4HPHA 5K9QI 3M46A 4JRWA 4NRZB 2YD4A 5DJ0A 5K1VA 2PMZA 4RISL 2IAND 4FMFA 3PXJA 4JFDA 2MOGA 1EFXD 4BH8A 5D6CB 4OLVH 5DI8B 4JY6A 4D0BB 4H5SB 3MCKB 2YPLA 2AK4B 3EYOA 2PUQT 3FU6A 3OMIB 5BVJB 4LL4A 3C2AH 1MWAL 3Q13A 2BWDA 3QAZB 2WBJC 3LNHA 2YBRA 3M45A 1VZGA 2WLNA 4WO0A 5D1ZA 1FFTB 1NFDA 2B3RA 4S0HA 5ETUA 4MSWA 2GCYB 5FAAA 3TPKA 4AMKL 1NUFA 3KWWA 4OD2A 4NJAL 5HYJA 2Z0UA 1ADWA 3HS8A 4J3TA 1YC7A 2E27L 3RVWC 2BVTA 1MI5A 5H4ZA 1E3XA 1RZPA 3BAKA 2Q0ZX 1NCOA 4GNKB 4APXA 4KITB 2E74C 5AVVB 1ZEAH 4PHZA 2ENJA 1RJZB 1U42A 4TNGA 3QSKB 1KGCE 2JTDA 3AABA 4JS7A 2YOCA 1SY6H 5L6YH 2Q6WA 3D8MA 1E9QB 1I8AA 1EGJH 3B8SA 2AK4A 2WYTA 2KI6A 3GNMH 4LEOA 3HNVH 4L8BA 1AI1L 1KTRL 5DVNA 5BOPA 2OMXB 4JL2A 5E2WH 2KERA 4L48A 2V3DA 1OCWH 1OAUH 4AV5A 3F85A 4XR8C 3GSNL 5ISZD 1HAWA 4FFWC 4DWHA 1HYSD 4GINA 1DFBL 5I5MA 2K8MA 5HGBB 4P9MH 1ZGLB 4IKJA 4YHKH 1GMIA 3WEBA 3ZTCC 1GAFH 3MBWA 4XVTH 1KTCA 1A7OH 1DBBL 5LNDA 3GI8H 3L16A 1T5KA 4AYID 2F9BT 2BO0A 3GRBA 3GTNA 2VH5H 4MRCA 3TBCA 1ODAA 4MZIA 5KYUA 5T5NF 2WZ5A 4GXUM 1UB5A 2WXHA 2H32A 1NEPA 2CGYA 1IGJB 3GSOB 3FB8B 3MRIB 1NCAL 3IFNL 5F7WC 1DEEA 4I0PD 4P5TC 3V6BR 3DK0A 1G87A 4Y4HB 4TQPA 4HCGA 1CFBA 5BV7B 5C2BL 1JGVH 4TSBH 3FHAA 4XMXA 5DCCA 3QAQA 4TTDC 5DJ6A 5DO2D 4B60A 3U1QA 3DYMA 2HG5A 3GTVA 3CFBA 5KVGH 2EDLA 3CZFB 3OD3A 1H19A 5K59F 4KDWA 3CSYB 4WFGE 1YNTF 4WI3A 4TQHA 2VLJD 4X7TB 2ILLA 3VI4B 5C0DB 4LSSL 2IOIA 4FNPA 3C60A 1DBBH 3FO9B 2G2PA 5AVZB 4EVNB 4Y8DC 3TJEL 4X4YA 3V10A 2MKLC 2KQMA 4YHKL 5I1DA 2OTWA 3DX2A 1JTTA 5E5LA 1IGTB 2NUTB 5F8QC 4L4VA 4IU2A 1WG3A 2DEWX 5I1AA 4BV1A 3CFDB 5B8CB 2D3JA 1BQHB 3PHAA 3ARGC 3HMXA 5LHDA 4FZ8L 1RK7A 4KVCH 1Q9LB 4NFCA 4Y4HC 35C8L 1KXTB 3FQTB 1XF3B 2FWOA 4PSRA 2HTLD 4AW7A 3QDJA 5DEGA 3VFVA 3F7PC 1XCTA 3U1SL 3TCTA 1IL1B 2X0UA 2VL5B 4FYTA 2V9RA 2JB6A 4JB9L 3V6OA 3A22A 4OLZL 2BPBA 2CLRB 3KM1A 2OL3B 1MLBB 3MYZA 1LM8V 4GUCA 1DCEA 4XCNB 2ZCHL 4G43B 1XHHA 2J1ZA 3RA7L 1QYGL 1AE6H 1CGYA 1SGKA 3KBEA 3TN0D 3N43F 5I1LB 2MHAB 3MJ7B 3OR6B 4NSKB 3QI9B 4NT6B 4LDCA 5GRVL 4FNRA 4BINA 2EZ0D 1EFXB 3S37X 2C1OB 5EUOA 3U0WL 3VWJD 4IMKA 4G5AA 4QF1B 1T7VA 1OD7A 5GZOC 1A14H 1TPXC 2AP2A 4XC1H 4NJ9L 5JMOC 4FFZA 4EN3C 4NBYB 3BKYH 2XBDA 2ZCKL 3VXRE 2P9RA 5KS9E 2J88H 3MOBH 5ICYB 4MJID 4P5KB 4UUJB 2X6CA 1CC3A 3MRBB 3T0EE 5I18L 1CDBA 1NEZA 1MRCH 1GJWA 4JG1L 4GP5B 4PJEE 4CKVX 3DOSA 4V1DD 4X5WA 1AD9A 4AL8C 5F6IC 4XO9A 4C56B 5IMMB 1R3LA 2WO4A 5T5FH 2OCCB 5C0RH 4DGUA 2F08A 2UVFA 1TVHB 2WBJA 2EYRB 4Y9GA 4UAOC 4Y5YC 5FYJE 4P4KA 5IMOA 2VXVH 5AVYB 5A16B 1OSYA 2X9XA 4P2CG 5F7FA 1T0OA 2IH3A 5IMKB 3PRZA 3SBWA 1GGYA 4CVWA 3VNZA 1NWOA 4GRLB 2H9GA 2F8XC 4E5XB 1HAUA 5MEQB 5DJXB 3PNWB 1MW2A 1CR9L 2YGPA 2DLFL 3RPBA 5KYYA 2D2CC 4EN3B 43CAA 5EO0A 3B7YA 1TYEB 3QUMA 3ELAT 3P4OA 1NC4A 4HKZB 3RIKA 3TJPA 3IF1A 4LARH 5IHUL 1AP2B 3DX9A 2D9CA 3AQDA 3ROOB 4GXVL 2I85A 5J8OA 3PP4L 2I26N 4ZFZB 1WFNA 3B3IA 4QXTA 3DA0A 3EO1B 2PO6D 3O3EA 4KGJA 4UT9L 5F96H 4XC3L 1SY6A 4ZAKA 2P43B 2CKBH 3UO1H 4L8DA 5GGRB 4RETB 3K5SA 5EN3A 3P69A 5DJZA 1IO4C 1HILA 3FFCB 2IAAC 3B1TA 3F6LA 4U1HA 2F7OA 3CSYA 4FHKA 5IIEA 4NKMA 3M8OL 1D5ZB 3GGWA 5I15L 2F0CA 4G1MB 1VFMA 4GKSB 5AOLA 1NINA 3TFKD 4L29A 2H6PA 2Z34A 3SE3A 4KV5E 2VTFA 2R29L 3LQZA 1DJIA 3LKRA 5GS0H 3DETC 4I9WD 3W37A 2VM9A 2DTMH 3SJVB 4PJ7A 5I6XB 2GABA 1QWNA 3GSOA 2G5BB 7FABH 1BJMA 2E4TA 5E2UH 5F6HJ 1TZHB 4Z7IA 4FFZH 3NAAL 1MCSA 4JFED 4HAKA 4KI1A 1S2EA 4NO3A 5G5DA 2Y5TB 1XZ0B 4Q0XH 4TQ8A 4JCLA 3OV6A 5ALCL 4ZPVB 4C4UA 4XP9H 3DJZA 1GJIA 4H40A 3W38A 3WV0A 3K72B 4E42A 3G9AB 5D7IA 5FGBC 1UCTA 4QRBA 2H0PA 3A0OA 3O2WH 5EIQA 3RWEA 5EA0L 2QQNH 1KJ2H 4GUPA 4FA6A 4GJTB 5DHDA 1E8ZA 2RMNA 3LD8C 2GAZB 2UZXA 5CAYB 1S9KC 1K8DA 3HRZC 1XV8A 2G9HB 1P0SE 3GSUA 5KAQF 3DX0A 1T21B 3UPRA 2NRDA 3BESR 3OKLA 2IGTA 1VZIA 4M02A 2BSRA 1EUTA 3AJ7A 3BWUC 1T7ZA 1GGCH 4CSPA 5FB8B 2P5EA 4DW2H 4X4XA 3ET9F 1FFNA 2X4OB 4FNSA 4P23C 2R0WH 1N7MH 3LVEA 3KWXA 4NZRL 5C97A 4HCIA 1DEDA 1INQA 1I8IA 1HKLH 1J8RA 3P4NA 1U93A 5IV2A 3DMMD 1DVFB 3I85A 4NCC2 4H8HA 4ZFGL 3QXDA 4IDLA 4OGZA 5CZVL 3EYSL 2B0SL 2HKFL 3CVCA 5JQIB 1B0WA 5L88H 4CVZA 2FNWA 2IFFL 4ZFGH 4EI6B 2IPUK 4JRYA 1NUNB 1GZHA 4HAFA 1EHKB 2G0KA 1F3JB 3BAEH 3GLAA 3ISRA 3N85H 4P49A 5FYJD 5ID1A 4JLRB 4WLCA 3C6EA 2NZIA 2FAUA 4WW2A 4WUUB 5I1EH 4I2XE 5EU5B 3WEAA 3UDWC 3NK4A 5LB1A 2JLPA 2P24A 1OTSD 1MFBH 3KW8A 3KLHD 3T77A 1JVKA 1SN2A 1AJ7H 1E5ZA 4U1MA 1D6VL 4PJFB 4FQHA 3IMVA 3C5ZC 4PEEA 3CFCL 3T4YB 3V4VA 1RIUH 2CUAA 3NMEA 5ALBH 5EBLB 3L1GA 4E9XA 1PEZA 1KB9K 3IXAB 1JMZA 4JGUA 4XBPA 3QCTH 5DT1L 1OM3L 2CUMA 2DS4A 2VDNB 2EADA 4B9ZA 1MFBL 4OUUB 5DS8B 2VZSA 2DPKA 4XZ4A 2NY4C 4YDZA 3V9CA 5F9DC 2EIJB 4P07A 4YBQC 3NCJL 4NQTA 2VDML 4GS7C 4PRPD 5MENA 2VYRE 3JWNC 4FJZA 4NQCB 5GGVL 2FJHB 5IM7B 5IVNA 4LCCC 3CMOL 5CZXD 1RUML 2E9GA 2QVTA 1S7QB 1NOLA 3X1FA 1Z7JA 2Z6FA 5FKAB 3LD8B 7FABL 4ZO7A 2EDDA 5IFAH 4P5RA 3LN5B 4AM0Q 1K5WA 2FB4L 3D18A 4ISVA 3S88H 3QQXA 3ZVVA 1AKJA 1PKQB 1J11A 4EI0A 5EBMA 3VFUA 2RIKA 3AACA 2F58H 2O1AA 4A7TA 1NMBH 4FRWA 3L5IA 5I76A 2WHVA 3BFOA 3K74B 1TQUA 2GQHA 1T5XA 4ZQTA 2FO4A 2P44B 3MRJA 2FT7A 2WXRA 3P0VL 3TBTB 2ZAIA 3PNRB 4FFYH 5CJQL 4HOXA 2UWEE 1LDPL 2MPVA 3RDTB 5CSGA 3QCTL 4QKXB 4PLJC 3D3VE 3BAIA 1I8LA 3SY6A 3L2LA 5ALBL 1EMTH 1ASQA 3AB0C 3NTCL 3T4AC 1Y6MR 1ZK5A 3SE6A 1LILA 4U6VH 3DVNB 4ONOA 2E7CA 1T3FB 3GSWB 4Q6KA 1A7RH 4XI5D 3V0HA 5SWSA 1H6EA 1SN0A 2OJZL 5JUEL 1I3UA 3F05A 5C0FA 3UZQB 2AERT 2QR0A 1OO2A 3SDCB 2EDRA 4C55A 3P9MA 4QHNB 5EU3A 4Y4KD 2YRZA 3P2DA 4DJMA 5I1HH 1TEFA 4ZMTA 3EYSH 1ZIAA 4K5PA 3P3UA 1HWGB 3SBQA 4K71B 4R4FL 3C2SA 5DEGB 3Q9PA 4JGJA 3VFVB 5IQ7H 1OF0A 1SDDB 4RFOL 4ZSOE 2W07A 1A6PA 1MRFH 2VUKA 1HHHB 5I30L 3JYCA 3OJDB 1G5AA 4LHJB 3SDDB 3LS4H 1ZTMA 5C1MB 3ZKQD 4KZDL 1KYOK 3QDJE 3VDCA 4M5ZL 1KGCD 4G42B 1FP5A 1REIA 2O5ZL 4JDVA 1OP3K 2P8PA 2E8YA 3DPBA 4G5ZL 4NIKB 1H8NA 2OMUB 2I60H 3VM5A 3WFEL 1SLUA 5DSCA 4LHQB 5LQBL 4GPVA 3NRPA 1MIEH 1MRCL 5D71H 1A6AA 3A23A 2PP7A 1HN1A 2BJML 4HZAA 4HZ1A 2FO1A 4RRPG 4AH2A 3GT6A 1XF4B 2KDYA 2X1OA 5L2JA 1U92B 4QGYA 3VD0A 4Z78B 1UGKA 3OSVA 1FV1A 4FI8A 4MDIB 4X8JA 1DZ0A 3SZ6A 4H7VA 2X6UA 4MX7A 3HE6C 4N6QA 1EEUA 1SYVA 3BE1L 2GJ6A 2B1HL 4LLAA 4ANUA 4NNYB 3TTYA 1YEHL 1FYHB 5F3BA 3FBKA 5LBSH 4UM8B 4PTTB 5B3SB 1AE6L 5HY9A 2OSXA 1Q90A 4DP8X 3MRGB 4OR1A 2DIJA 4S1DD 3W0WA 2YAFA 1M42A 1SOKA 5AB2A 1ORQA 1ERNA 1UB5B 4LFHG 1T83C 3W3BA 5JOEA 1I1RA 3ZL4L 2VE6A 3GRWH 1S7VA 4G82A 4ODHH 2NXYD 5BZDB 4OD1H 1BG9A 1BLNB 1X44A 4B0MB 2CG9X 4Z7WB 4OZIE 3S5YA 4FQXA 5ICXB 4MAYB 1GL4B 1T0NA 1WCBB 2I24N 2VXQL 2EKJA 3IETA 4W4OA 5HYEA 4Z7WA 3T0VA 3U25A 2YS4A 3PUUA 3CZLA 1JFQL 1OSEA 3BZDA 5DZAA 3MJ9H 2B5IC 3T6ZA 4NO5B 4M9OA 2EIMB 2VE6B 4J3OF 2DQUH 1C12B 3A5VA 2OJEB 3P1VA 4QLWA 3BYTA 2IALA 2NT0A 3VXSB 4L8BB 5D55A 2GC4C 1RL1A 3NIDF 1IFHH 2WO2B 4J8RA 2FX8L 3VH8B 3QORA 3D07A 2CE6A 2XUWA 2BIQA 5E8EB 3L1OH 1W72B 4LARL 2BHUA 2J55A 4N90E 2YRLA 2B2XH 4X6DA 4TOYL 4H2AA 2WWKO 3GHBL 4TLTA 1CR9H 4NRXB 3H42L 1KT2A 3QEQD 2NY1C 4A6YL 2P48B 4D9RD 2RTTA 1JMXA 3ULUF 2R69A 2LU7A 4KKNA 2WKOA 5J6GB 2BVOA 2GK0A 5C09D 3HOGA 1J5OH 4W93A 4Q2ZA 3H56A 3F2LA 5E00A 3EYFA 3WIIH 3ULVE 1U8CB 2EVJA 3ZDXB 2HH0L 3LN9A 5IG7B 3K46A 4BZYA 4YSQA 5BVJA 1DE4B 3UEQA 5D2LF 1BREA 3DV6B 2ICES 3D9AH 2C3HA 4HJGA 5ANMB 1YNTB 5C6TH 4L3EE 4UBDD 5KS9B 1HHHA 2LVEA 2CBTA 1U21A 4ZZKA 4JFYB 1JZ7A 5K9OA 4XB3A 5BS0E 4DKTA 1FDLH 2XI9A 3VXRD 3ZRCC 1CUOA 4OJFL 1AO7B 1U3HA 3PWJA 2ZP9A 3IU3A 3EJYC 4ZMQA 2BNUB 3Q7JA 3D09A 1OOWA 3W9EA 3D39D 4BKLA 5L4FA 3UFIA 2RQEA 1TEYA 5LCVL 1PSKH 1KB5L 2HFEB 1TXKA 2IFGA 5T3ZE 1NCHA 2ATKB 4MXQD 4Z95H 4K8RL 5KN5B 5CEZL 4P57A 3CDGB 4ODXB 1X5LA 3L4WA 3C6SB 2JELH 3S96B 3IFNH 3RWJA 3V2AR 2BFVL 2E9WA 3GM8A 2NXYB 1N0LA 1UXSB 5GIRB 4Z7NE 5A2KH 5LDUA 2R29A 3ZXAC 3ULVL 4GOSA 2DQHH 2LAAA 3T3MF 4JM4L 2NY7H 2ZXAA 4RGMC 1LO5B 4JJOA 3LEVH 2H26B 1FVDA 3C9NB 1NUGA 1CURA 4GT7A 3WI9A 1CFTB 3WSQH 1LP9A 3O11B 3QH3B 3VXTB 3QNYB 4FAAB 4YDLC 2E7DA 4AT6B 2ROXA 4P9ML 4WO4A 5K39A 3RNKA 5CCKH 4URKA 4LASH 3ARFA 5HYSA 3T65A 4KHXH 1JXDA 1A2YA 4Z0XA 2LV4A 4N85A 2BHZA 3GSNH 4XOBA 1WEJH 4OF5A 4RESB 2JSFA 1EJ8A 2CWRA 4JFXA 3GXUB 3QJQB 2X4TB 3KGRA 3IU4H 4HJ0D 1XH3B 4GSUA 4WWKC 5DK0B 2UWEF 4BA8A 1B0RA 1TQWA 3CN4A 2Z7YA 2D8KA 1JGEA 1NEZG 4N9GB 2VAAA 4OCNC 2ZX8A 1GPOL 4WJKB 4EN3D 4H88H 2Q3AA 5G55A 2WIIB 1R5VB 5JHDE 1QSFB 4TKWA 3GZPA 4E0RA 1TJXA 5G4OA 3UO8B 4AQ1B 3KPOA 1F6FB 1FH5H 3BGFC 3CFIC 1ZSDA 5FUZL 3MRMA 2BSDA 2JCCF 3GMNB 1JZFA 2WWMC 1ZLEA 1XCQA 2G9KA 2UZIL 3EGXB 2EIKB 4GAFB 4JZNB 4OI8A 1WFIA 3SYAA 2DQHL 4HIHB 1IE5A 2GBVA 4I0CC 3ABZA 4KDTC 3T4YA 5JYLA 2APXA 1WS7A 5IROA 3DXAA 2XV6B 3ARGA 5DZNA 1GZPA 3TYFB 4H20H 1DSYA 3IGAB 1H6TA 2QVIA 1S9VA 4FQCH 4K8RD 2HTLC 2A7BA 2JXMA 5JPNA 3UYRL 1IZJA 4JLRA 2CBQA 4XNMA 5GJSL 4ZT1A 3JTBA 4XVTL 2JKTM 5LWYL 5AW2B 1QTYT 5CILL 1U0QA 2PWDA 5EPMA 3MRQB 4HKJB 4OU3A 4G80A 1HOEA 1MVUA 2J2ZB 1N6QL 3MRNA 2F5AL 3LOWA 4IHBA 2BSRB 3HC3L 4APQD 4J6IA 2V2WA 3IFOA 5EC1A 2IBBA 4AGQA 4YHIA 2G2NA 2BXYA 1JWSA 4UAOB 4Y5YB 2BCMA 3TWYA 4GW1B 1RU9L 3BKCL 1ITBB 4ZNEA 1ZVYA 4PCYA 2XACC 4UYQA 5HVWA 1SY6L 1OP5H 1MDAA 1MHPL 3ZL4H 4P5TA 3HE6D 5BS0D 5F7EL 1UZ6E 2WXKA 4GUPB 3RFRA 5I24A 3PREA 5D5MB 2V4LA 1RULL 3WL9B 3E8UH 3ULSB 5BVPH 5AB1A 4TYUA 4RWYL 5C0AE 2Y25A 3B7UX 5FM5O 3LYRA 4CDGC 4AK1A 5E0FA 4PIRF 3CE1A 4Y19E 5DVPA 2BSBA 1DJWA 5KZCB 1JZ2A 3MLZH 3E0GA 2UZYA 4HMCA 5C7XH 3HC4L 5AKTA 3VE0A 5EC1B 2PW1B 4U3SA 1GY2A 3EH5B 1A21A 1P4IH 2LLGA 4J3VA 3NIFE 5LXGH 4OW6A 2QPSA 4ZTOL 1FZOB 3PAUA 3ZTNL 4OZIA 4KX7A 5GZNA 4J27A 1JERA 2Y9RT 5E24E 2BC4A 2XVKA 4OKVA 4XWGH 4Q52A 4MKTA 3NABH 1QZNA 2ZUVA 1VERA 2QMJA 1CI3M 1YQVH 1Q0XL 4H2CA 1JNHB 4DKEL 5AZ2H 1B9ZA 1RZIB 3RWFA 5SWZE 4JFQA 2WLMA 2DQEL 1MCNA 2AV1A 4JJ5B 2ZP0T 4Q6IC 1JYVA 5J1SC 1KXHA 3VXUD 3QXVA 2VITA 1PU0A 4R4FH 3U46B 4JR9H 1BXXA 2F5BL 3ATBA 4ODHL 3QDMA 1OAZL 1UQSB 4PJDF 4LBAA 4YDMA 4AZUA 4A1RA 3ROOA 2PYFA 2OP4H 1CT8A 3WNJA 3TF7C 2VJXA 2YLKA 5F1NA 4OBSA 1MF2H 3ASWA 2ADFH 3HZKB 2MCMA 2X05A 5CZXC 4ZUWA 3QCVH 2DZEA 2X2IA 4LRIA 4EQ3A 1I53A 3RVWD 3SQBB 1THCA 3ULVC 1KTDB 1UH4A 2AQTA 3MRCB 3C5JB 3J2PA 1K85A 1DUYB 3BP5A 2OYKA 1KC5L 4DP0X 1Z3GL 3IMRA 3P0YL 1ZJBA 4HHGA 1TVDA 2B1OA 2QTEA 4U4BA 3WN5C 2XQBH 5L9DL 2CRYA 1MWOA 3OWRA 3QYCA 4KRPB 3VFPA 3JT2A 5AD0B 3FRUA 2AJVH 1NQBA 1Y07A 5D1ZC 5DJ8A 2WBJD 4P5TB 4CDHA 4DN3L 3HRPA 3QUXC 1YN6B 3WYRA 2YD7A 1PD1A 3E38A 3IFLH 1I7ZA 4V1DA 2WNKA 1AS7A 1BCIA 4XWOC 5A2BA 1P4BH 3PWPE 5C08D 2IH3B 1XTLA 3VXME 1HINL 2DKUA 5MEOA 1AZCA 4LRIC 2LAGB 3EJZC 1DVTA 2XTJE 1J0JA 4WFED 3Q06A 4Z7VE 1MVUB 4KK8C 1QFUH 1IQWH 2VKWA 3QWRA 2IAMD 4NAQA 1JNNH 2DIAA 1A1NA 2FBRA 2J1WA 3E3QE 4O02A 4BFIB 3FUDA 1BEXA 3FO2B 4NM4H 4NO0D 2C1PA 1Z5YD 3CC1A 1YA5A 5A3IC 3EJSA 4WRLA 3QQ9C 4TRPH 1RURH 3WG7B 4F7CA 1QFWH 5A6LA 3MO1B 1ZVNA 1S78C 1CE1H 1DBAH 1WBXB 2H1PH 1KJ3H 2BDNL 5FFLA 4NYLA 5G2NA 3ARBA 2X42A 3C6LA 5IT2H 3T6WA 1ES0B 2Q7NA 3NCJH 1VFOA 5CGTA 4BFFA 3R18A 5F89A 5HDRA 3B7RL 3MBEB 4PCKA 3VG9C 5DQJA 4O58H 4QHPA 5DHVH 3NIDB 3JVGC 4NHUB 1R3HA 3QG6B 3JWNH 1GHFH 4KH2A 1XMEB 3RWHB 2WLLB 4CC4C 3B7TA 2CGRH 2GBAA 2GI0A 4Q8BA 4O51A 3IMSA 3VJ6A 3IDIB 3JZYA 1BYOA 1GC1L 2ZG3A 4TTGA 1BQHA 4DZBA 3WFHB 3BP5B 4O9HL 4OIAA 3DJ9A 1JGEB 1ROWA 1VDGA 4P2OA 1ONQB 1KCUH 1W16A 1XF3A 2VC2L 3A47A 3BWAA 4E41D 1XGYH 4OZGF 5CO1A 2WXJA 4KXAA 5DUPL 4D7BA 1BXUA 5HVFB 3SGKA 3KVQA 1CT8B 1FL5B 4KOBA 1E5BA 3QUZA 4F7PB 4F24A 2B0SH 2HKFH 4C56D 4ZMXA 3RU8H 5E1QA 1AOZA 2NSXA 2ZJSL 4EUPA 3S3JA 3LS5H 3TC9A 1WFUA 4M6NH 2NYZA 4ZYKA 5EZLA 4LBEB 3HG0A 5DRWB 4QOKA 2QSVA 4YFLI 3N41B 1S7XA 4C4KO 3HLKA 5C3LD 1L9PA 1GGCL 3H53A 5HVHB 2G75B 5I1IH 1TTFA 2DQIL 2XPGA 5GGRY 5BQ7A 4NQDB 1IGJA 1KGUA 5D1XD 1CFNB 2Z31C 1JZJA 3TH3T 2UY7A 5T1LB 2COQA 1N0LB 1UXSA 5GIRA 4CBPA 3U9UB 3HHSA 1IC5L 1BF5A 2GT9A 3EBIA 4RGOH 2EEAA 4O58L 2EJ1A 4P2AA 1J1PL 1X3DA 4XRCB 3ULUL 2BP3A 4YH6A 3LHPL 4TUOB 3O6FA 4B9YA 2YAMA 5FECA 2X3AA 5TJWK 4HUUB 2OKMA 4B27A 4TVUA 2ZKHH 1XGTA 4YO0A 3ETTA 4FL4B 4PB0L 1YSOA 3MR9A 3EO0A 3KPLB 5FHAL 2WSKA 3APNA 3CBJB 3DBXA 3DDGA 5ALCH 2CDGB 5CMAB 3EBGA 3CU7A 4FFZL 2ICEC 5FFGA 5FWQA 4K9JA 4QRSB 1BZEA 5E9DA 1WSST 2DDQH 5C08E 2VO8A 1VACA 4NKOA 2R59A 4HXBL 2KS0A 5E6ID 2VC2B 3FOMB 4W6YB 4AQAA 1UA6H 5D7KD 4D9RE 2YPVH 1A3QA 2E75C 1RJZA 2XIBA 4LCCB 4MX7B 1EZVY 1UURA 1ZWIB 3LEYH 5MP6H 2HT4D 1I9IH 5I9QC 4Z9KB 3ECBB 3OMNB 4LEOB 5HYQA 5D2LE 2VXSH 3GJFH 4HLZH 4NI6A 3TBWB 1E3ZA 3OZ9H 4L3EB 4PY8J 4QRQB 4Y4FD 4I3RL 4PJ9D 4HD5A 4MSWB 3QT2A 3PDGA 1TOXA 1DLFH 4LVOB 5CFAA 1V3LA 4X6DB 2R2HA 3BDYL 4N2KA 4YFDB 4HK0A 2ICEA 5ADOH 3ATEA 4DNLA 2IC2A 4GW4B 8PAZA 2WWKT 4ZMPA 1H6FA 3BEWA 2EXWD 2IMNA 4OF8A 2GCYA 3AU1A 1UD3A 4LNVA 3ZO0A 1T1WB 1ASOA 2AQ1A 3NACH 4QOKE 4S1DC 2QZQA 3K2KA 2F8OA 4K3EH 4R3SA 3BGMB 3AQXA 3MMEB 4JUTA 3F5WA 3ILPB 1XCQB 4ZD3H 3PABB 5ECJE 3IGKA 1WGOA 1UZ8A 5HHMD 2WLYA 4ICXA 5FOBA 6FABL 5D6CA 3NJFA 5MHSD 4AQ1A 4PRHA 4QRSA 4NEHB 1RAMA 2EDFA 2Y69B 3S5LG 5IR1B 4OZ4A 2IXQA 1A8JH 3FO0L 5AW3B 4WJ5A 2BW4A 2R27A 3ZKNC 2B1AL 1FAIH 2ZKYA 2LFGA 1F0LA 3DBXB 3NN8B 4X6DE 5CP3H 2WANA 1JF1A 3RPKA 2GG1A 4JPIA 3RE0A 2VZ1A 3BO8A 1ADQH 1YG9A 1SXSA 1CIDA 4FTVA 4LPYA 5E23A 2OMWA 5I6NA 1D9KC 3HNTH 4TUOA 4PWJA 2IDSA 2IV9A 2HVJB 5DRZB 2H3NB 2A9NH 1Z5HA 2CRMA 1UD4A 3IFLL 3L08A 3P4MA 4W9LC 3WXVH 1G9NH 3IJ8A 1LXMA 1WISA 3BVTA 1U30A 1VEOA 4R7NB 3VTTA 1NJ9A 1CDJA 1S7SB 3NFNB 4ODWA 1CYGA 4NX0A 4PJFF 2B5IB 5F7NC 3ZDYE 2XFGB 3DK2A 5D1XE 4G7SB 1Y18B 4EZJA 5GRUH 1P4LB 2OAAA 3UAFA 4NKDA 3RAJH 1G0XA 1D2PA 1Y18A 5IB5B 3SO3C 1GKOA 2AXJA 4MLSA 3SDCD 3D39A 2Q87A 3MCLH 1NGWB 3V0DA 3WY4A 1NGXB 5GQBA 1HSBB 4XAKD 5EC2B 1BP3B 5F6HI 5D1QC 3BFWA 1IGMH 3NZ8A 2Q8AH 3TLRA 1UJ3B 2O61A 1D2OA 2WYIA 1K2DA 1MOEA 3CZSA 3ARFD 3HB3D 4DK3A 2AGJH 3CDGA 3AG2B 4QHKI 4WEUD 2OBGA 1IKFH 2VXTH 2C3VA 1YYCA 1BMZA 4XP1H 4YAQA 2G5UA 1IM9A 4D8OA 3FO1A 5CGYD 4I1NB 4FZ8H 1J10A 1R19A 3SPVB 3T2OA 3UAJD 3ZN6A 1KLGB 3F7VA 3QORC 3G08A 5ANME 5E6IA 4N0CD 1HH9A 3JTSB 3HUJF 1G7MA 1W72L 2FK9A 4NQDD 4AEIH 2XDHA 3E9UA 4XBPB 3D85B 3QIBC 3QNXB 5TE6H 1RFDL 3VGHA 1A02N 2WLLA 4CAGA 4Z7VA 2FBJL 3UBHA 3TEWA 4DGVL 3DRQB 1O5DT 2AI0L 1OLZA 1UD5A 5EEVA 2J6EL 1NC2B 1YY9D 1GGIL 1VZHA 3HS0C 3QNFA 5C0EA 1O6TA 1IGIH 5INCA 1C7SA 3QARA 4DP1X 3BLBA 4ZNCD 2Y06H 2PCPA 2PO6C 5IBLD 3HN8A 25C8L 1VFAA 1U4EA 4N22A 5E4OA 1IM9D 1WBXA 2YMXL 1GGUA 3NH7L 5GRXG 5HYFA 12E8H 3CFJA 3LRMA 4FLOA 4QWWD 4YPGA 4RWYH 2WVUA 3K4DA 3OB0H 3VU2A 4OQTL 4BFIA 4P0DA 4N2OA 3K8KA 5EBMB 2OXGA 5DMKA 3L13A 1X5FA 4TS6A 3IKKA 2B14A 2CU9A 1VA9A 2XVBA 3MDJA 4GKOA 1NBZB 1M9WA 3UTTA 5SWZA 5HP5A 1FLRH 1I1AC 4MJIB 4MMZA 1H8LA 3ECBA 5EOCJ 1DJSA 4XPAH 4YXLL 1RKRA 1MFDH 5A40E 2A1WL 3TT1H 4BFJA 4YQXL 1CYXA 1LNUA 2P80D 2TSBA 1FRGL 2A74C 4PBVC 2J4WL 3T6QC 2W59A 4H1LB 3D2UB 4HD9A 4Y5XB 3LKPA 4D9LH 2C9AA 3D05A 1HZHL 3S8GB 5A6IA 1F4YL 4Y1AB 1OAJA 1ZSHA 1QBML 3PJNA 4G1EB 3AMKA 4HHWA 4RNRA 3KJ4C 2Y6SC 2Z7ZA 5KAQG 1KV3A 2J71A 2ZSVB 1GJUA 1U6AH 2WMPB 4UT6H 2E4FA 3SQOL 1MLCA 3HA0A 4OUUA 4ZBJA 1RPQA 3SQBA 3DMMC 3AXLB 4BEIA 1AGCB 4IIZA 5IQLA 2FSDA 3MLUL 2YK1H 3BSZH 4OQTH 3HI6L 3KPTA 4GRMB 3UG3A 4LDLB 5DA0B 1BAFH 4AG4H 4XVUC 4N2BA 3CSTA 2AJUL 1RD6A 2HUEA 2XFXB 1MFCL 3QZWB 4PJ7B 3IGLA 3BVNB 1F58H 2E76C 1ZLSL 4DGWC 2AK4D 3H9HA 1B4RA 1SJHA 1M71B 5DC9B 4JRXD 4AQ1C 1QRND 4IGBA 5DHVA 5DRXA 2VQUA 1JXJA 3QUXB 5EZJB 3V6FB 5IEKB 1INDL 1BAFL 1IQDA 1JHTB 4X8JB 1PFOA 3SJVE 4AG4L 1DN2A 5HI4D 2B15A 2YD0A 1QSVA 3MXWL 3FCGA 5E5MA 2GJ6E 1YEWA 4PVBA 3HKFA 1SXBA 5TE7H 2IJ0C 1CCZA 1FDLL 1VGKB 3WO4B 1KTBA 2MJWA 2X44D 3HFML 4YE0A 3TH2T 5GSVA 2HFFA 2E56A 2ZWNA 4RDBA 1GIGL 5HGGS 5EOCL 1KFAL 3AROA 5FYJH 4G8GD 5GGRA 2WXLA 4LLQB 4EZKA 3OC8A 5INDA 3EXLA 3A6CH 5JW3H 4PJHF 5AWNL 2A6IA 3UEZA 1GZQB 2HUHA 5JHLA 5FB8A 4Z7QF 2X2UA 2IWGA 3BDBA 5T33H 3GLZA 1PS3A 1ZLWK 4XP4L 2PW1A 2A99A 1QLEB 1U58B 4KNUA 3F7YB 1B90A 4P2QE 2UZYB 1G94A 1V7NH 4HV8B 4M62H 2QADC 2Z91B 1OP9A 4OZFB 4ATTA 4C54A 2A0LD 5BV7C 3N40P 1ZCRA 4JHAH 1QNZL 2B77A 1T04A 1AR1C 4E9QA 3BGAA 3VSTA 3CG8A 1BJ1J 1D5IL 5C0FB 3EFOB 3PJLA 4K5MA 2OK0H 1WYJA 4R90L 2CRZA 1XB3A 2XXMB 1G7IB 4BQBA 3NIGB 5D4QA 2OULB 4YX2H 2FQEA 4ZPVA 3MR9B 2C9XA 1KZQA 1R3LB 4TVPH 5DK2A 2V0AA 1IM3A 2FSEA 3KVPA 4ODTL 1KWKA 1KIRB 1DQJB 2OA9A 3X17A 3ARBB 1CXEA 2G5BA 5TDNB 4F15C 2V2WB 2VSKB 3KHQA 4PGZA 3S5LB 2GTWB 4ZUSA 3QE5A 2F7IA 4WTQA 15C8L 2XBTA 3HTLX 3PFUA 4X0KA 4M1GH 2Z4QA 5FS5A 3DX6B 5DU7A 2R4RH 5FA3B 1PY0A 4EAEA 5E7BA 4GKZB 2J8UE 1DSFL 4HU2A 1JK8B 3IJHB 2YQ3A 1QABA 4JO8A 2JJUA 4OD1L 4N8VA 3OLEA 2G75A 2VN4A 3WOVA 1FORL 3P3SA 4DN4L 1NCCL 1A9BA 3ARRA 2W0FB 3FO0H 1S46A 2X4NA 3FT2A 2E7BA 3JV4B 3SDYH 1QAWA 3GHEL 4YGAB 2WTRA 1HL4A 5GRZA 2VRAA 3LPGA 3QFJD 2VLRB 5KTEH 4QR7A 3O6ML 4NOBA 4IOFC 2K9UA 2YR3A 3GZKA 3L9YA 2HWZL 4RMWA 2EICA 3ME0B 5MI0C 1NWPA 1UM5H 2Y7OA 1CFVH 3BP6B 1E28A 1ETZA 3EJUA 3VXQA 3WTUA 3X14B 1M56B 3CLEL 1JXGA 2ZG2A 1QRNA 1OLLA 3ES6B 3FUEA 3MOAL 1WS8A 1QHPA 5TDOB 2NY6B 1E28B 2FQFA 4JFHE 3X12A 2BRQA 1VESA 3EW3B 3H55A 2KDGA 1NCBH 4WWPA 3MLTA 4JRXE 1BVKB 4N26A 1CTMA 3H3PH 3JV4A 4HWEH 2JIXA 1PJWA 1TTUA 2CK0H 3AY4A 3N0PB 4PHXA 4JG0L 1HZKA 2E5EA 2K70A 3TWCH 4P4KC 4A2EA 2VITB 5J57B 4Y5VB 3I50L 2HLFC 1QI5A 1JD7A 2NY0C 4BQ6A 1ZHLA 3CFKB 2E6QA 4OF0A 5LUMA 5FA3A 4JE4B 2Z4QB 2VLKA 3VFNA 1RZJL 2B1AH 1T22B 2A6JB 3S5LA 1NCIA 4R9HA 1U3ZA 4ZTPL 5J89A 2VLJB 1WZAA 2EYSB 3O4LB 1UOVA 4WI6A 4FCHA 3B2DC 5IQNA 3DX6A 3BJLA 3P73B 4FTDA 3SDAD 1AXTH 5CCJA 4NT6A 4WWKD 2G3ZA 3LSOB 4LP8A 1OEZW 4P2QA 1B3IA 4XXDA 3FN3A 4GW5B 5FLUA 4A2LA 1KB5A 4Z1PA 4ZO9A 4LRNL 1IGFH 2VR9A 1P84K 3L4VA 1WFTA 1KCKA 4PJEA 2ZWZA 3UP1A 1FIEA 3G5YB 5DUML 2CIKA 3JWNG 3QDJB 1QNIA 4HH8A 4JJHA 3CDZB 4JG5A 4JFYA 1U8HB 2C7UB 3GKWH 3TCXA 4LVHB 3AS3A 3P30L 4XZUA 4CGUB 3FH7A 1HJBC 1AZUA 3DHUA 1ZHBB 4UNUA 3AW5A 5HDLA 5SX4I 4UQ9A 4WSKA 3GSRB 1T4KA 1CXLA 2YN5A 3RYMA 1MRDH 4LCWE 5D96B 1UXLA 3VWJB 5J6GA 1IAKA 4BGLA 3IDGB 3PWUB 3QHZL 2OMZB 1IVLA 4YE4H 2JJTC 3ZYIA 1LEKB 2AMGA 5JR1H 4EE2A 1BXAA 3KDPB 3BOVA 2IAMA 4UWQB 2R0ZH 2AXHA 1KXVA 1GW0A 5TK4A 3OXRB 3CFBB 2ZSWB 4WI2A 1EBAA 4GKNA 3UG4A 4AL8H 3BH4A 3OVUB 4OY9A 4F33B 3ARSA 1JHTA 3MA9H 3SGEH 2HXAA 3HZ3A 4PRIB 1OY3B 2FDBP 3H9ZA 5AFAA 3OPZH 4FYQA 4UBDC 2CO6A 3UTSB 4M1CC 3N1QC 3OKNB 4J8RB 1NCNA 1YECH 2CA3A 2MWCA 5BW7A 1P1VA 2NXZD 3GF8A 2XWEA 5DJ0B 1E0OB 2DLTA 2DL9A 3ABGA 3I6GB 1DVYA 3WFBL 5ELIA 3DX1A 3ILDA 2ZCLL 1MG2C 3QZPA 1Z5LA 2VDKB 4AQOA 2AAVA 3DX9B 4GAGH 3HAEH 4U1GB 5I1EL 4NP4H 1F13A 3I6KA 5D7LB 3UGXA 2J5WA 2MNUA 5TFSL 3KLLA 4ZMLA 1NFIB 2WLJA 3TO4B 2JK5A 1Z0NA 2AEIT 5B7EA 4DUVA 2H9GB 4FXGC 2D7TL 1T66C 4ZFFB 1RSYA 4IMKC 2MPAL 1Y0LB 2DJ4A 3T2QA 3V5KB 2WK2A 2EUXA 2A6KA 2V7HA 4FGMA 3CLFL 4NQCE 1CS6A 4HC1L 3E6FA 2MEJB 4Y89A 1QACA 2OX5B 2Q2EB 5I1KL 5JPNC 1A3ZA 3FT3B 4HH9A 1ZVHA 1DUZB 3REVA 1KY6A 1Y1DA 2D7TH 4LSQH 2AQSA 5HYSB 4HKXA 2ZOKB 4GW1A 2W81C 3DOSB 4QXGL 2VR3A 2EYTB 3APMA 1BHGA 1MAML 5E94A 1P4BL 1II4E 3KGSA 2NY3D 3CD4A 4UU9A 2EO1A 4AH2B 3N04A 5IW3A 1ZA6A 4OD2B 4G80B 4L3CB 1IB5A 4LSRL 4DETA 3M17A 4PWGA 2UWEA 3TBBA 3V52H 4FXGA 3RY4A 3VXMB 2F54D 1AQDA 4JPKH 1CDCA 1N19A 3NZHL 4KXBA 1YDPA 3NDYE 2VDPB 5EUOB 3HUJA 4PS4L 4Y2NA 1OPGL 4W4OC 4WTZA 4PJBA 3K7UA 4OIIH 1TTCA 4YOKA 5KN5A 3D3VA 5DI8A 2ZNXA 4ZTPH 3FAWA 1CK0L 2FCBA 3NOIA 4QJ5B 1HXYB 5BRZB 4GRWE 3FSWA 3OQ3B 4P5MA 1ZTXE 5B1AB 3OF6D 4A2FA 3EJCA 1CD0A 1FZKA 4N86A 4HX1B 1N10A 1WZMA 2NY2D 4UQ2A 1CBJA 3HBZA 3BWSA 4FHBD 4J3OC 5BRZA 4XP6H 5DF0A 1T5WB 2ZUTA 3TBVA 2WB1A 2NZ9D 1XR8B 2WC7A 1N7ML 2WIIA 4HJGB 2IV8A 5D1XA 3ZL2A 3EOTH 4N9GA 1RLWA 4N2EA 2R0KH 4ODSL 4Q9BA 3U7WH 4M7JL 3T0ED 3SE3C 1T0MB 1V7ML 1WGVA 2VLKE 3QAZC 4BGDA 3RGVB 3BISA 1E4XI 1IM9B 2R23A 5KSVA 1SRDA 2FYYB 4NN5C 2R2BA 5AALA 4ZS7L 5F96L 1C5CH 3B9VA 3GMPA 1FO0H 1U8IA 2OLDA 2YUWA 3LJ3A 3PY9A 4L3CA 1N8OE 2IQAB 4M61B 4WI7A 4WUKH 3PP4H 3N06B 3EZ8A 3W2DH 4E2OA 5FO2A 5GGVY 1KN4L 4TVPD 2KBGA 3T3PE 4AC4A 2EDBA 3ZDXF 4P4RB 3OAZH 5E94B 4OFPA 4MASA 5C7XL 3D39B 4U1NA 3MLZL 4F7EA 5L8JB 3C9NA 3P0YH 1FIGH 3ESNA 4MJ4A 5E8EA 2CHDA 5H35B 4RGNC 3AG3B 1AC6A 1SBBA 5I71C 4M56A 1N26A 5FGCB 4LSTH 2XIIA 1YEDA 4WHYH 5SV3A 2O5YH 3OAWA 4RBPK 2FHCA 2FEEL 4GFXA 4XCCL 1C16B 4XI5C 1AIZA 4JN1H 1W0WB 4ZK8A 4FABL 3GSQA 5I6OA 1J0YA 5DHMC 4BZ2L 1E4KA 3C6SA 1M7DB 5AVTB 4K2UL 3RDTC 5IZ7A 4Q9RH 2HVJA 3T2PA 4HEME 4HUKB 2QVMA 1BX2B 1MEXL 2NY5C 3BD5A 3ZE2E 3UBFA 4P2YA 1FI8C 2DM7A 3FFDB 1W8OA 4LOFA 4KWUA 4YHPA 4JEGB 2AK1H 4N20A 5E9AA 4DEWA 4YHZH 4Z18A 4QXVA 3TU6A 4FTVB 1WA0X 2ZOUA 4B53A 2D31B 4RQQA 3IU3B 3F65A 2GJ6D 3LKNB 1NDMB 1J8HD 4JG0H 5DS8A 2D0FA 3U2SA 4AIOA 1QQDA 2DEYX 5GHWL 5IB1B 2BXZA 4NJ9H 1HEHC 4KMLB 2LGNA 4MZ3A 4OKDA 3HZVA 4BE6A 2W95A 1BYPA 1FYTD 2Y1ZA 3LIZH 3PU7A 4ZMAT 3D3VB 3E7JA 5CD5C 3IS0X 5I16A 5C0AA 2DWDA 3NCFB 4LHUA 4PJBB 1JPSL 2P24B 4CVXB 1EAQA 1U33A 3NFSH 3QRBA 4WW2B 1BXVA 4FG2A 3NSFA 2DL2A 4HWBA 1EAJA 4GKNB 5HXMA 5JIQA 4GG6E 5FYJU 5ICZB 2G3MA 4I7ZC 2YRBA 4JRYB 4Z7NF 2HWZH 2BK8A 4JO1H 1R3JA 2F18A 4LCWB 1J86A 2ADIA 3BUBA 3T3ME 3WNIA 3LKSA 2ED9A 3NCXA 1TEGA 4NQVB 5KW9L 3QXAB 3WNNA 1W0YT 3I02A 1HESA 2JVUA 1U93B 35C8H 3FN0L 4Q9CA 3TEYA 3GIVB 4X7SH 3REWA 2WUBH 3EUUA 2ORBH 5FF6A 1HEZA 5AENA 3WKYA 1AH1A 4QRPE 1QBAA 4UB0L 2YXMA 1JGLL 3KLQA 3ARPA 5DZVA 4OT1L 3QW9A 5C0AB 2R2CA 5DVMA 3WXWH 5EORL 5JW3L 5IFJA 1BPVA 3OKLB 3OPUA 1GS8A 2YD3A 3FQ4A 3RL1A 3KPPB 1OTUC 5DO8A 3UIZA 4BWWA 1A64A 3MJGX 1H9VA 1SDDA 2R4RL 3WTYA 4CC1A 3BAJA 3DUHA 3CN3A 4WFFE 1PMYA 2J88L 1UOWA 2VUYA 3DGCR 5LGJB 5AOMA 1WFOA 5AVRB 2DTSA 4ADIA 4H25B 3RWIA 4LP4A 4H13C 3AG1B 3D69B 1EXGA 4RFEB 5KVEL 1IBHA 3IPBA 1D5MA 2C9VA 5D7LA 2AJSL 3IMTA 1BX2A 4HF5L 1KN2L 2VZUA 1I31A 1IC1A 3DX7B 1WUZA 1LE9A 1U9KA 4YX2L 1EHLL 1UM6H 4OB5L 1BBDL 2Y5TA 3MRPB 4Q56A 2OK0L 4PWKA 3I3DA 5FDWA 2EYSA 3V4VL 2EC9T 1GVIA 2OMTB 1C16A 4Z3HA 1TNNA 3P40A 3EO9L 2E86A 5E9DE 2Q7YB 2VSCA 2PCXA 1FVCA 4UOZA 4FQXD 3QFJE 5CJ8A 3IDXH 2AJZA 1N67A 2J25A 2JELL 4M00A 5H35A 1BQKA 4LSUH 2HVKB 3HRZB 5HDQH 5CEZH 4KKAD 4J3SA 1J5HA 5CHNB 4LBEA 1KLUB 2EVGA 4L29B 1CDUA 3IGFA 2AQ3A 2TRHA 2F7PA 1C1EH 1TITA 3VTAA 1TTRA 2IMMA 1CD8A 3MBEC 2QFRA 3MRFB 2VDKH 5FYKL 4HCRH 4DQOL 1OAUL 4XMLL 1PNDA 1FG9C 3PL6C 4PJ5E 3LN5A 4JKWA 2W65A 1OTTD 1C5BL 4JFSA 3O81A 4BCYA 4UQDA 3GBNL 1J0ZA 1C7TA 1DTUA 1QHQA 4HC1A 3DO7A 2NOYA 1KG0A 2ZOLB 3D9AL 5GZND 5DZJA 4P3WA 1ID2A 4GY4A 5EUOE 1UENA 1HFUA 2W1NA 3ZE1F 2N1KA 4FJ6A 5K69A 2V7NB 1JNLL 1WBYA 3I75A 1ETZB 4V33A 1G7QB 3A67H 3QFDB 3CHQA 5IOPA 4L1HA 5GISH 5H8DA 4K7FB 4NC1E 3OJMB 4OF3A 3VXRA 3AFLA 5EZOL 4NGHH 3QXWA 3G5YA 1BM3H 4XX1E 5DVOA 1FL3A 3BC9A 4GRLA 2HJFB 3MBEA 4PMFA 2GVYA 1M1XA 3BQUB 1TO4A 1BWWA 4M7ZC 3MODH 3ZKMD 4HXAH 2ZKXA 4RSVA 3LKOA 3F12B 4DP7X 1T2QH 5HI3D 1NBCA 5KYWB 5KBLA 5A2CA 4YZFF 1WA1X 2RACA 4J8QA 1F02I 1DVZA 5HDBF 2WNXA 1MKFA 3V4PA 2XG5B 2XA3A 3UOAB 3EGSA 1DJXA 2V37A 3WN5B 3CX2A 1G6RB 3SCMC 5DTFB 4Y9FA 5C0CD 1NAML 4ELKB 2BMKB 1T22A 1VPOL 3RVUD 1KCRH 4DUXA 3S3BB 3WEXB 2R56L 2EE3A 1BQRA 3AAZA 3QIWB 1I1FA 3JTTA 1G6RA 1HDMB 1OAXL 1T80A 2I7SA 5I74B 1I8IB 1INQB 4K3JL 3RX8A 5I76B 4ICWA 1F4HA 4XPAL 4YXLH 3WJMB 2EYTA 3N3EA 1KPUB 4Y16D 4AQ8A 4ZXBD 1B0IA 2BP0B 2YXFA 4UCFA 2N7BA 2VQ4A 2HAZA 1Q9WA 1ZLUK 3S34L 3BD4A 2AABL 2BERA 1P7BA 3V5DA 1FNGA 1MUJB 4PJ8D 4CILA 4YSUA 1PZBA 3P9WB 3QDME 3T0DA 4BFRA 4U7KA 1H5BA 1FL3B 2Z64C 5I71B 2VDQB 1XF2A 3BYYA 1RIHH 5HVHC 3VQLA 2E46A 4RH4A 3VXRB 2JKIS 3WTXA 4U2YA 1JRHH 3O9WC 4S1QH 3EHBD 3Q5YA 3TO4D 3X3GH 3DXAD 1BFSA 5CLYA 1FUNA 1BFVL 1JZDC 5CIPH 4XVSH 4BZ1H 1PDKA 5CEYB 2EEDA 3FTZA 4L4VD 1N6UA 1AGEA 1FO0L 3VWJC 4ERSH 3T8XA 43C9A 3DO7B 5AVQB 3RJOA 3BVUA 1ETJA 3ZTJH 4WTZG 3M1CA 4RISH 4IQHA 3QULB 5C0DA 4JM2B 5EOTB 3FSAA 3VI4A 1HSAB 1UOKA 1OAYL 4L4TB 3UL4A 4A2DA 3P0GB 3MFFA 2WD0A 1HQ4A 3PE9A 3BGFB 2XRAL 4UOW0 1P5UC 4N8VB 3W0WE 3GYRA 1WAEA 1NBYB 4CW1B 5JQ6L 1KIUA 4JANB 3WTWA 3ESPA 1MEXH 4X0NA 4PJAA 4U3XA 1CXHA 2PPEA 2VERA 3ARED 4BFOA 3GEFA 1NLDL 4HVBA 2CUIA 3MRIA 3SGEI 2A2QT 3VWJA 1PLAA 1X5IA 2NXZB 2ZYHA 2PWFA 3I2CL 6TAAA 4TNVK 1A22B 2DEXX 3VFRA 4QYOA 2CIIA 5JXED 4HDIA 1ZHBA 1T1YB 1PG7X 4HETA 4X9BA 2ARJA 4ZOBA 3SGKC 2XKSA 5GGUB 3ZOAA 4DFHA 3O6LL 3SDXB 2LQRA 1F90H 1GGBH 2UXTA 3QZBA 2AEOA 2WQSA 4OFDA 5CZKA 1SLVA 3P4OB 2NZ1A 1E5UI 4GEIA 3MREA 5ENWA 5DMYA 3LQAH 5CXPA 3L3IB 1PD6A 2KT6A 4TN9A 4TM9A 1FHNA 3Q0HA 2KQNA 5JHMA 2RFXB 3C5XA 1S3KL 4Y4FA 4TSCH 4ZUUB 3VGAB 1R46A 1KCLA 3L3IA 3MJ8B 4MA8L 5HVGB 5TE4L 1JWSB 4Y5YA 2I60L 1Y6KR 4OJAA 3HNSH 3QIUB 3N9GH 5D7IB 3LEXA 4AENB 4ES9A 4P4KB 4GSQA 2DIEA 5FYLH 4MJIA 1P1ZB 2ICWA 4J3OG 3SDXA 1UACH 4PJIA 4X98A 1RH8A 2GBTA 5C0CE 3TURA 4F15B 2HLAA 4UT9A 1EAOA 3RVXD 5FF6B 5SWSE 4TVSa 3EH3B 3LZNA 2GJZA 3QWRD 1OT2A 3VSQA 3NA4A 3TN0B 5JPNB 5EUOF 3VI3A 2EC8A 4KRPC 3UROR 3QS2A 5BJTA 4UUJA 2K78A 3WEXA 3PQYA 3ARGB 3B2VH 3EAKA 1QI4A 3IXTB 4CKQA 2X41A 3IAPA 4MGXA 1I7RA 3D7PA 1I4FA 4ECNA 1HYSC 4KPHL 4DSYA 1KIQA 3FTXA 5LBVA 4UNTA 3NESA 5LGHH 5LJYH 2VLRD 5J1AB 4PS8A 4YDKL 3QIWD 5IIEB 4D8PB 3OR6A 5GS1C 2QGEA 2Y7QB 1KYFA 1R3IL 4F7MA 1OP4A 3RWGB 1JOIA 4M5SA 5KOMC 4OI7A 4LCYB 1BECA 2R9HD 4JPKL 4F9LC 3JWOL 1MHCB 4G59C 4MS6A 4X4ME 4FFYL 4LKXB 1USQA 2XZCH 1BVNT 2VXSL 2DWYA 1PIGA 5KYXA 3K81A 4G1EA 1P53A 2YKKA 3WHE1 3ULUC 5CEZE 2WXPA 1R5VA 2FTAA 4JO3L 1AS6A 3SBPA 4NPYA 3H9SE 3D2UA 3K1DA 4XBGA 4L9DA 1ZT7B 4XNXH 5K9JL 4IU2B 1YMMD 5K9JH 1H15A 4I2XB 5F9JA 3TNMB 4X4YB 1ZLVH 3I9GL 5BNXD 1NPNA 5ESQB 5JDSB 1H3UA 4LEXL 5JXEA 2WQ8A 2DMHA 4NZRH 1KCUL 1NH6A 3PYCA 3O41A 1FWXA 2XPYA 4LVNC 5KVFH 3MV9D 4LIQE 5FHAH 5IJCC 3ZYOA 1T7YA 4OLXL 1A2YB 1HHIA 3N5AA 1HQRB 4PB0H 3TOPA 5I66B 4JRYD 3NFNA 2I7OA 4N28A 5E0QA 3RUGB 5E8DH 1YNKL 4KKLD 3ARDA 4KXDA 3T2NH 3W39A 5HPMB 1SHXA 4CN4A 2IQAA 2ZCLH 2W91A 1N6VA 5BZWB 2FNBA 2IDTA 3V5HB 5CM1A 1TJHL 1SQ2N 1E30A 4BZ2A 1IC5H 3SPHA 3V55A 1VGEH 4D0CB 4LLYA 1YPZB 5KSVB 3KEDA 1MCPL 3Q6FB 1LK2B 3SDDD 3RTLA 2OMWB 4KVPA 3S37H 5JO5A 5IMLB 3LZPA 3P9LB 3CHPA 4AZ8A 4QRPA 5E70A 3T0EC 2B16A 3MLSH 3FH8A 2HKHL 4MJ2A 1LP9E 1KJ2B 3QDGB 1AXTL 1ET7A 1G0YR 1KBGL 3PV6A 4GMSH 5HGDB 32C2A 2X4RA 3LKOB 4OZ4B 1D7DA 1DANU 2JKXA 4EQ2A 5HHQA 2HFEA 5ADPH 1RK1A 4HJUA 3OKDB 2NY2C 1IBDA 2IFFH 4OLEA 1BEYL 3ARYA 3H3KA 2FBOJ 1DQML 2CR3A 3ARDC 3GEWB 2LFEA 3QHFL 3HG1A 3APFA 4ZW5A 1E5AA 5LXVA 2OMVB 5KS9A 5IQMA 5BOJA 1KYAA 3C08L 3HR5A 3VYPA 1F45A 2YWYA 4G6KL 3SDDC 2XT1B 2CCLA 1GGTA 3QCUH 3EIFA 3LQAL 5INDB 4EVNA 4XO4A 1XEDA 2EDTA 2EDHA 3PIQB 4CNIA 1T03L 1FZMB 1SMOA 1XWVA 3IE4A 2OSYA 1Z66A 3HC0B 4P04A 1Z3GH 3QXAA 3RNQA 4L3EA 5HYJB 2QJDA 4D9QE 2WVVB 3VH8A 5DR5L 4UU9B 5AOZA 3Q2WA 4ZJ9A 5EIIG 2KYIA 3L7EA 1MELA 4TNWK 3U4EA 4R4NC 2ADGB 1DQIA 4Y5XC 1KPRA 2DLFH 1AGDA 5EZJA 3V6FA 5IEKA 3OLDA 4AJ0A 2CD0A 4CVXA 1N68A 3FU7A 1VKXA 2OYMA 1TJMA 1UD8A 2AQNA 4UINH 5C0AD 1A65A 4HHAB 4P9HH 5DRZA 1EJ6A 3IRPX 4ELMA 4H5SA 1JBJA 2XFXA 4N4YB 3ZDXE 3M1BB 1BOGB 5I28A 3ZIYA 1C8PA 5TQ2H 4M3HA 1B0GB 2QLYA 1NAMB 1SEBB 4G9DA 3SGDH 3FKUS 3KBPA 1S7WA 2XXCB 2IWFA 4R2GB 3RVXC 3S36H 2W80C 3LRLA 5HJDA 3BUYB 1M7DA 4A55A 1ULVA 3WKQA 4XOEA 5IBLC 1C08A 1P4IL 4Z7QE 5JIDA 2GJPA 4OV5A 1FYTA 1RJLB 1YMHB 4LE8A 4ZOEA 1BOGA 5FC9A 4APQB 1UB6B 4Z78A 4NLAA 4XO8A 4PJAE 1HNGA 4CMMB 4LLWA 3VXUE 4HHAA 4MQTB 5DGRA 5DJCA 2CO6B 3UTSA 2R15A 5C2UB 5JHLH 2BNQD 4E9TA 1MJUL 2JKJA 3SOBL 4LLVB 1TQBC 1CLYH 4WI8A 3U30C 1YEJH 1P7QB 1U3HD 3QIUC 1BVOA 1KEGL 4NUJB 3SPGA 1YYML 4GI9A 1CTOA 1QG3A 3KWWB 5KJ7E 4NZUL 1OXYA 2GHZA 3HC0A 3IDGA 3PWUA 3VGDA 4KKZA 2Q7AA 3HB3C 5EO1A 2AF2A 4DK6A 4TNEA 4PCTA 4WK2B 2B7DT 2W07B 4JPVL 2D0HA 4HS8L 1MREH 4YHML 5I1GL 1BD2E 4R7VA 1WTLA 3D51A 4MCNA 1ZJAA 3IT8D 1GYVA 4POUB 2VN7A 1CO1A 1X4XA 2EDJA 3IDIA 5CILH 4BH8B 4L37A 1FF5A 2NNAB 3LV3A 2QR0B 2PTTB 2OMVA 3E2HC 1UT1A 4NC2B 1E4WH 1EVTC 3B2MA 3FJTA 4NDMA 3QDGD 1K5NB 1ZD6A 1G7MB 1M7IB 4L05A 3RTQD 3GSXA 5LXGL 4YJZL 4PJEB 3INUH 2D31A 1BVLB 4WY7H 3WEMA 4K73A 3SPVA 5EWIH 5T1MA 1LO4L 2PP8A 3TT3H 1HXMB 2EECA 4F8OA 5IWLC 5EF0A 3PV6B 1IBGH 4GW5A 2D7MA 3GSWA 3RHWF 3GLDA 5HDOA 4NGHL 2Z31A 4I8DA 3MV7A 4H1LH 5FUZH 4OFKA 2P26A 1HHKA 3NRQA 3F6JA 1MNUL 2UY7B 5BUGA 1ACZA 1CB4A 3SE4A 2YK1L 4YBLB 4H88L 3GJFA 2PR4L 1G5GA 1QBLH 4JFDE 3SQOH 1AY1H 5KANG 4AQZA 1UKQA 4KY1L 5DJDB 1SUJA 4QXUL 5DMJB 4JO4L 3ZZLA 2GITB 3EYVB 1E9PA 2GY5A 3MTRA 3JWDH 1HJCA 2YA0A 4EUPH 2O30A 1IE4A 3CDYA 1B9KA 2RJMA 1NMCB 4HKXB 1MCBA 2DQMA 3DTXA 1ECYA 5AG9A 1WEJL 4IJ3B 4WKXA 4GUOA 3MNVA 3L17A 2NTFB 4ZI8A 1TKWA 1UA7A 4FNTA 4GBXB 3O3AA 1AQKH 4N3UA 3RFZC 4HH9B 4DERA 4K23H 1ND0B 4URTB 3UPAA 3UYOD 3W57A 2BSCA 3MLTB 2YKLH 2CCWA 3KYOA 4ZOCA 3NIGF 1TIUA 3T04D 4ZMVA 4MB3A 1H15B 2ZOOA 4I2XA 3EZJB 4WKZB 3QB7C 2NSQA 2GK2A 1DVFC 3WMSA 1DQDL 1KTKE 5IM7A 2CJSA 1O0VA 4N0YL 3UTOA 4KO7A 5F7AA 2VXQA 1KNOB 4F5CA 4F9PC 3AT8A 1UUSA 2RCSH 4FJYA 5E9NA 5D96C 5IF0A 2JKSA 4UQ2B 4OGYH 4XCEB 3PABA 2R0LL 4DP5X 1JRHI 4OGYL 1L0QA 2BH0A 4PRPE 4R2GD 5F9WC 3Q2CA 1ACXA 3HE7C 3QFJA 1CLOL 3P2TA 5ID1B 4QHLB 2Y1YA 2QPEB 3OX8A 1NMAL 4YC2C 4AGPA 5KVEH 2Y06L 5B4MD 5IJDC 3QQ3A 5B38A 4NFDA 3CSBA 3WJJA 1GY1A 3BEWB 3H3BC 4UZUA 1E67A 1SYSA 3ZHFA 3WE6A 2R7EB 3QNZA 4FA8A 2ICEB 2FT8A 3QJHA 5JDJA 3GBNH 1DVFD 4OLYL 4KFMA 4GG6F 2D03H 1OB1B 3JV5A 3US1A 2E7MA 1AQKL 2X6VA 2VDPL 3FZUD 4N2AA 2XZQL 3M17B 2FD6H 3JT0A 1F6LL 4KRPD 3FFCE 4KHXL 2BOCA 4BQ9A 1F1DA 5CINL 4FDWA 1RXLA 1TTBA 4GG6B 1Q94A 3QG7L 1PZ3A 4R96A 3GMMA 3RZCD 4FQ2H 1YJDH 2DYPB 1KXQA 3WN6A 3HNVL 4HOZA 1MW0A 3RZWA 1TVBB 5KW9H 4FMVA 4F8QA 4QT5A 1CWVA 2NNXA 3HG5A 2Z31D 1VACB 5I8EB 3REVB 3WNPA 3B1UA 3FT3A 4XO3A 1VADA 4X9GA 5E99L 4S1RL 1UJ3C 4YSEA 3ULVH 3KPRA 2Y7LA 1AR1D 4G8GA 3WS3B 2VNCA 4UT7H 1NSNL 1QUNB 2GSMB 3GK8H 1XBRA 2CZNA 12E8L 4AM0B 1T2JA 1MHHB 3ZY7A 1IBFA 1JPGA 1L9TA 5DYOB 3WNKA 2CIIB 2VIRA 4HP5A 1TZ8A 3GMMB 2YKLL 5AYQA 4NHCL 1Z0MA 4KO9A 4L5FL 2X38A 4GG6A 2EE9A 2J12B 3CHXA 1JPTL 2KHAA 4R7XA 3T08A 1MWAH 1V8HA 3INUL 5DMIH 3G5VA 1MJ7L 4GQZA 5DGQA 4JRXA 3BSGA 3WXVL 1IGCL 2ARJB 4HKJA 1WV7T 1BV8A 5L2KA 5EN2B 3NVQA 2QEJA 3QDJD 1RPUA 3U0PA 3MBED 1XMWA 1LL1A 1QO3B 3D06A 4Z7QB 3R06A 5MI0B 1KTLA 3SKJH 4XPTH 3FONA 4HPOL 4MMXA 5DS1A 2VN3A 4OZGA 1CU4L 1PX3A 3AUVA 4H8WH 3EYQD 2JE8A 3K6DA 4ZMOA 2F19H 5B38B 4FABH 1NIDA 2A3TA 4N2NA 5DJZB 3D6GA 4LLDA 4X9FA 4N0FA 2EXYC 1FNHA 2IBGA 3VA6A 4OZHE 4ZZFA 3V4PH 2IDFA 4AE1A 3WKNA 3FRPB 3TV8A 2PTUA 3BIBX 4NKMB 4L23A 4RA0C 3CC5B 5LBSL 4GP8B 4B9IA 1WC7B 2R1YB 3CH8A 2PLTA 4HUWB 4PJ7E 5CEYA 1RZ8B 1KEGH 3W5MA 3L7FB 3N6YA 2WYZA 3TZVB 1IX2A 3PWNB 4GYBA 4OFYD 2JB5H 1JV2A 1AGCA 2W5PA 5SWQA 4O2CB 3LRGA 2YAOA 3O3EB 4IEFB 2YAQA 3ARUA 3A4EA 3LKQA 4DHLA 1TPXB 2A9ML 1MIEL 5AZEL 1V27A 5D8JH 1GZHC 1PQZB 4Y1AA 3K2IA 2J8HA 1MIMH 2DWSA 1TKWB 4JW3A 4JO2H 2OR8A 5F7LB 5DQJB 4KK9D 2CO7A 3MXVH 3ARTA 3SPIA 4MD5A 5DC4B 4WO4B 2QKIB 2HN7A 5E2TL 3AS0A 3AT9A 2C9QA 2VDNL 1AG6A 1L0XA 1LP9B 2BW5A 5A16A 1Q1PA 5I9QB 3GBDA 2EE0A 3UTZB 2GIMA 3PDDA 4TQIA 5C6WH 4Q9RL 1A7QH 4LGRB 3VW3H 1LO5A 5I1HL 3HAEA 2NUPA 4M3JA 4OFYA 4UQIM 2DJSA 3HPLA 4AKOA 4JHBA 4MHHG 1RZKL 1X7SA 3ULUE 1LE5B 2ISDA 2KKQA 5FDYA 4CGTA 1CVRA 2E3VA 4OCRL 5ECGA 4L3FA 3VFNB 2CBMA 3TYFA 2CDFA 1KJVB 2GTZA 1A6UH 4L8SA 1JNJA 3HE7A 1FIGL 4ELKA 2MCPH 2EVHA 3DXAB 3PWPD 4K3EL 3TIEB 5F3HA 4LOUD 5KUKA 5TDNA 3RJDA 2YUXA 1MFAH 3AY4C 1KN4H 1QSZA 1GYWA 2ZPKL 1BVLA 1NANH 2YWZA 2NXZC 2CO3A 1IL1A 2AXWA 3GMNA 2ZXWB 2AEQL 1FFPB 3WO4C 4X6EA 1A4CA 4YHLH 2FWOB 4AVKA 2CO2A 5JW4M 5LQBH 1MJJA 5HGAB 1BYNA 1DVUA 2Q1EA 4NAJA 3BD3A 4NLHA 3WAKA 1RUPH 3UBXI 1O7VA 4UV4H 4I3RH 1FNSH 3GJEB 3IRZA 4KJWD 1AMXA 4JFEA 3G6DH 1E42A 4D9QD 1G1CA 3GDBA 3LAFA 4OZFA 2FYVA 1JV2B 2OTWB 1KXTA 3FQTA 3MV11 3NSCA 3WUWA 3VFMB 1SM3H 1KENL 1L3WA 4JM2C 4QHKJ 2YGOA 1ZA3A 1I8LC 4MJ6B 1RZ8A 1WAAE 3F7LA 4YAQB 1PLGL 1AZZC 2QSQA 5JPMC 3CUPB 3D39E 2WTOA 3WD5L 2APFA 4PRBB 3VFTB 2VMJA 3ZIMA 4JY4B 5KSUB 3QQNA 3MACH 3C60D 4AT6A 3SBRA 1NGXA 3NIDE 4XMUA 5LG6A 3ZKSD 1UWXK 1CFTA 5JORA 4NP4L 4J3OD 1ILSA 4EZLA 1A7RL 1JNHA 2GUOA 4CRPA 1GYCA 3K6FA 4MDJA 1F2XK 5E5MB 3FQ2A 3ILEA 3PAZA 4MRBA 5IB2B 2QV2A 4CMMA 1SFHA 4HS3B 1UXMA 4E41E 1WJ3A 5L8LB 1F00I 4HA1A 2CGZA 1JIBA 1KLUA 2Y3NA 4MAZA 4NZTH 3O8XA 4N2GA 3CZEA 1OKEA 1NAKH 4FI6A 5EZIL 4QTHB 3BUPA 3SIKA 1ZPUA 1JCKA 5F7MC 1J1PH 3RUGF 4X0KB 5CS7A 5I6PA 5HHNA 3RILA 1BFOB 1IAII 3LQMA 3OAYH 1MAMH 1OZUA 3E6HB 3EOBA 1ANUA 4P2OD 3E3QC 1FO0A 4YK4B 3MFGB 1BQ5A 4HCRA 4W9KC 5C71A 4OLXH 2AXFB 3NPZB 4Y4KB 5F1IB 3H9YA 3OKEA 4L4TD 4RX4A 2FB4H 4U31A 4HOMA 3S88L 1ID5I 1HEJC 2NY3C 2DYSB 2H4EA 1ESOA 4N9OB 1KENH 3RTQC 2Q8BL 4PRHB 5EF3A 3VU1A 2DD8L 1JNNL 3IJEA 4M6AA 5FO9A 2ITCA 2N0MA 3ML8A 2GEQA 1VKXB 3MLSL 4HW6A 3MLVL 3OKYA 2YD5A 5IW6B 1SYVB 2CDEA 4LCUA 3T3MB 3KPPA 4XXCC 2ZT9C 1E2VA 5CU9A 3K71B 1U58A 5FW7A 2V9QA 2XWJA 4CC4A 3UC2A 2BVPA 2DLGA 1NCGA 2BOCB 3SB3A 4B7IA 2H41A 4FX5A 5E8PB 3ULUD 3WNLA 1NBVH 1JTPA 4W9ZA 4BUQA 1NAKL 2EIEA 5ICZA 4LLQA 5D7SL 2OMUA 4LL1A 2O4EA 4H44C 1IGFL 2YBRB 1MI5B 2QDWA 3IN2A 4UTAH 4MA3A 2VDMB 1W8NA 1R33A 4GQ9H 3VXSE 1VGKA 3HG1E 4QRUA 3CIQA 4R97C 2ZF8A 4LCWA 4G42A 1RHHA 1U91B 3U36B 4M43L 4Y7OC 3DSFH 3P77A 4BIKA 3LRSB 3HS0A 4MJ5B 4X6DF 2YPLD 1JWUA 3Q1SH 1BBJA 1G7HA 1BAGA 1B6UA 3CPUA 2WXQA 4IGBB 4LO9A 5DRXB 1LO3L 3MV8A 2A6DB 3L3GA 2KL6A 3ZKMC 2DWDB 1O9ZA 3D0VB 2QPUA 4JR9L 3QPKA 2ERJC 4JFPB 4XODA 2OZ4L 3K1KC 2Z92B 5C86A 2VM3A 4RFNC 4OM0L 3EYUL 1L9RA 1T66D 2C4XA 4LU5L 1H3PL 4JFDB 4AITA 1E8WA 2XWRA 4G6ML 3LB6D 3IDYC 3CQPA 4NRZA 1QQDB 2CDGA 4WDIA 4L8SC 2IVFC 3JTSA 1F4AA 4FADA 1MIML 4Z7UF 5FYLL 1FO0B 3SYOA 4I3SH 2EDOA 1RUPL 1JV5A 1ORQB 4LXFA 4ALAL 5KS9F 1E4JA 3T0AA 4QOKD 3FTYA 2XTJB 5AG8A 2OQJB 5BRPA 5EUKA 3KBHE 4EKJA 3ZJAA 1SFDA 3FC8A 1AIFB 4N24A 5EU4A 4AQEA 3WGVB 3VQ1C 3SY0A 4HG4J 1JI2A 2VM4A 3MRJB 2IGFL 1XZWA 1BFVH 2X88A 4PY7B 3SKNA 1J18A 1FG2A 1F42A 3VWKC 5H94B 1TJIH 1DBMH 4NQDA 3QEUB 4AEFA 2DOCA 1CLVA 3W9DA 3LZOA 4JVPA 4B9JA 5B1BB 3D85D 5F0PB 5J11B 2CO4A 2V9UA 3F6IA 4PV9B 3QUYD 5H94A 1S5HB 4J4PD 5DSCB 1G6VK 4NRYB 3QZWG 4X7DC