5B1JC

Crystal structure of the electron-transfer complex of copper nitrite reductase with a cupredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Copper Nitrite Reductase
doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Copper-containing nitrite reductase
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1jC00
4YSPA 3QJQB 4A2GA 3ABMB 1B3IA 1ZDSA 1TU2A 3NSCA 3X1EA 1PLAA 1SFHA 2BW5A 2B3IA 2YARA 3WKPA 1GS6X 1SDDA 2HX9A 1F56A 4RH4A 2R7EA 2HLEB 1E5ZA 3AG3B 2FT8A 2CALA 1RZQA 5E9NA 4PCYA 4DPBX 2PPCA 2ZXWB 3HEIB 1YLBB 4YSUA 1T5KA 4M4RB 1PCSA 1VLXA 3NJLA 2XV0A 2QT6A 3NJGA 1AIZA 4CSPA 3MX0B 1CYWA 4AKPA 2GSMB 2OCCB 4AX3A 3TBBA 2YAFA 1ILUA 3UGEA 2XWZA 2J5WA 2BW4A 1M9WA 3ZBMA 3T6ZA 4E9QA 4E9RA 4HCGA 3H4HA 3PAZA 3FSWA 1QHQA 1JZGA 1V54B 3CVCA 2PP7A 4CSZA 2XV2A 1NDTA 2IWKA 3KW8A 1J5CA 3PPSA 3FSZA 4P5SA 1MZZA 1M57B 1PMYA 4DP6X 2VN3A 2MTAA 2YAOA 1L9OA 3OM3B 3FSAA 1UATA 5D4HA 3BQVA 4QLWA 1JVOA 3L45A 3T6WA 1IKOP 4DP0X 3QJTB 3NT0A 1OCZB 3PAUA 2IDTA 3FU9A 3CZUB 1PZAA 2XYBA 2XX0A 4BXVA 2BP8B 3KW7A 4KO6A 3X1GA 4F7KA 4YVNA 2H5UA 3FU7B 2UXTA 2VW6A 3G5WA 3JTBA 1WA1X 3AG1B 4ENZA 2VSKB 1AQ8A 2GIMA 4GYBA 4GP5B 1GY1A 5B1JA 4AKQA 4UANA 2HRGA 3AY2A 3U25A 2I85A 2CJ3A 3UACA 1MDAA 3EF4A 1NPNA 3QJRB 1XB6A 2XUWA 1JXFA 2BP0A 1HAWA 1URIA 3NJJA 3AZUA 3WI9A 3UABA 1FFTB 2BP0B 1L9TA 3SBPA 1ASOA 1AZNA 2AANA 1NWPA 4E9SA 1OCCB 1A65A 4GY4A 2RACA 1JVLA 1GS7A 3TASA 2HX8A 3WIAA 1OCRB 2EIMB 2MRYA 3TA4D 2WSDA 3ZDWA 5PCYA 1TKWA 3EH3B 3IBOA 1BXAA 1XMEB 3QPKA 1CC3A 3V9CA 4G70B 4DPAX 2IH8A 4AI7A 2VMJA 1CUOA 3WNJA 5B7FA 3ZX1A 4G71B 3FS9A 4KNTA 3T6XA 1AZCA 1QLEB 2DY2A 2VW7A 2VW4A 3QJVB 1RKRA 2FJSA 3S3DB 4X4KA 5AFAA 5I5IA 2IDUA 3IE9A 3EH5B 4KNUA 5D4JA 4HALA 1A8ZA 4A2HA 2UX7A 1J9QA 5B3SB 1NIAA 2PCYA 1AANA 4HZ1A 2IWEA 1ET8A 2TSBA 1X9RA 1IBZA 1EHKB 3DIVA 1NINA 4GXFA 3T6VA 2EINB 2BZCA 4NAJA 3ZIYA 3WNIA 3S8GB 2R7EB 4Q8BA 1TEFA 3WG7B 4YSOA 1I53A 4G7QB 4E9XA 2PLTA 3OMAB 2FWLB 3S8FB 3IEAA 5B1KA 1IBYA 1OE3A 2GBAA 3ASNB 2UX6A 3TBCA 3OD3A 1RCYA 1A3ZA 1NIDA 4YSEA 5I6MA 5I6PA 3X1FA 2Y1AA 1OOWA 4N8UA 4DP9X 4YL4A 1JERA 1BXUA 1PF3A 3NJIA 4GP4B 8PAZA 2JXMA 3GYRA 1TEGA 2PP9A 2FNWA 4BK5C 1JZIA 1J5DA 3OMNB 2FQGA 2WO3B 1JZHA 4YSTA 1E30A 4HHGA 1CURA 1OE2A 2ZONA 3NSYA 4N4YB 2BWDA 3H56A 1KBVA 2FTAA 3FSVA 3NSDA 3AG2B 3DTUB 4KO9A 4EF3A 1PNCA 4BDVB 3S3BB 3HB3B 2I7OA 5LDUA 4FAAB 1KYAA 1W8EA 3H4FA 1AG0A 4WKXA 2EIKB 3NYKA 1WA2X 3V9EA 6PAZA 3PLYA 1ID2A 1BAWA 3SQRA 1FWXA 4KO7A 2FQFA 3ABKB 3N2JA 1EZLA 2QDWA 2XV3A 1KDIA 3ASOB 3FYEB 4HCFA 1KDJA 1NPJA 5AZUA 3FQ1A 2J55A 1M56B 3FQ2A 2CBPA 4K9JA 1ZIBA 3CVBA 1SHXA 1WS7A 1JZFA 1JZEA 2WO2B 1SNRA 4YSAA 5EHFA 1SDDB 2E86A 2W88A 4L0PB 1OE1A 2PCFA 3CDZA 3PCYA 1AS7A 4KOBA 1IC0A 1JXDA 1A4AA 4A66A 3WKQA 3X2QB 4DPCX 2BHFA 4A2FA 2TSAA 5PAZA 4UF7C 5I6OA 1ASPA 2JFCA 1E5YA 2BZ7A 2GI0A 1R1CA 3AW5A 3QQXA 1SF3A 4YSRA 3UAAA 1AR1B 2LLNA 5I6LA 1BYPA 1X9UA 3QJSB 5A7EA 1NIEA 2PPDA 2PPAA 5F7BA 2IWFA 2FQDA 2VSMB 3CG8A 4BXSV 5I5MA 1HFUA 2UXVA 5D4IA 1SFDA 2IAAC 2IDSA 4DP5X 1PLCA 4E9WA 3C75A 4A68A 5IY5B 1NIBA 2W8CA 2XU9A 1W6WA 3NP3A 4DP1X 2P80A 2NRDA 2H3XC 2FT7A 4W1TA 4HCIA 2VM4A 2CCWA 1BEXA 1ZIAA 4A2EA 2BWIA 4NERA 2OJ1A 3ABGA 2J56A 5FC9A 3DKHA 2DWTA 4JHVA 4BWWA 1DYZA 1MG2C 1WAEA 1AS6A 3EH4B 4AKOA 1ILSA 1J9SA 1QNIA 2UXGA 2X88A 4GP8B 2UXFA 4P5RA 5I6KA 1KCWA 3PAVA 2QPEB 2A3TA 3NJMA 4TXVB 3FU7A 3GDCA 5B1AB 1A4BA 5I6NA 2GC4C 1OCOB 3CVDA 3SBRA 3N55A 1NICA 2XXFA 1NZRA 1CYXA 1GSKA 3GXUB 5TK2A 4MFHA 1J9RA 2I7SA 2Y69B 3EHBB 2GHZA 1OV8A 1RZPA 4QKTA 3NJKA 7PCYA 4BDVA 2H47C 4F2FA 1ZPUA 2DV6A 3UAEA 2XLLA 1GY2A 4E9VA 4UAHA 1PZCA 2HX7A 4E9YA 4YSCA 1KV7A 1PZBA 3OQRA 2IDQA 2XX1A 2JKWA 1BQRA 3OMIB 4FA7B 1GYCA 1L9SA 2EIJB 2BP8A 4HAKA 4JHUA 4ZK8A 1MG3C 4A2DA 3NJHA 4WTQA 1KGYE 2B08A 2XXGA 3MBWB 4YSQA 1AS8A 5B7MA 3ABLB 3X1NA 2DYRB 1AZRA 4HIPA 4YSDA 1ZDQA 1GS8A 2QDVA 3T9WA 4DP7X 3FU8A 5TK4A 1HAUA 1SHWA 1OF0A 2CUAA 1AZBA 3FPYA 3CDZB 1AOZA 1NIFA 2BO0A 3JT2A 2ZWNA 3NJNA 4YVUA 5B1BB 1GW0A 1BQKA 1BQ5A 1SJMA 1PLBA 2FQEA 2N0MA 2EILB 2AFNA 4M3HA 2OV0A 4G7SB 5F7AA 2XVBA 3AG4B 5B1JC 1AG6A 2ZOOA 2GB2A 1PAZA 3UADA 4E9TA 1JZJA 3PXLA 2IDFA 1E65A 4G7RB 1AACA 3X1BA 4A67A 3D12B 3T71A 2YQBA 2J57A 3BVDB 3FT0A 5AKRA 2YXWA 3QJUB 4G72B 4HHWA 1XB3A 2PP8A 5B7EA 1MZYA 1J9TA 1WS8A 1N68A 4DP4X 3NSFA 2YAMA 1L9PA 6PCYA 4PAZA 1AZUA 2VM3A 1GR7A 1PY0A 4BWUA 2GC7C 1A4CA 1BYOA 4F2EA 3IN0A 3S3CB 1ADWA 1V55B 1JOIA 2Q5BA 3FPXA 3NP4A 1SF5A 2YAPA 2CAKA 4KO5A 1FA4A 4Q89A 1L9QA 4W9ZA 1AAJA 4NB7A 1DZ0A 1XB8A 2HXAA 2AZUA 1W6LA 1KBWA 7PAZA 2HZHA 2Q9OA 2HRHA 5I5JA 2IH9A 1PNDA 3TU6A 4YSSA 2YAEA 4JKNA 1JXGA 3IN2A 3NJFA 3FYIB 2DWSA 3FQYA 2X87A 1ET7A 1L9RA 2YAHA 1ASQA 1N70A 2DYSB 3SBQA 3RYMA 1E67A 4AZUA 1NTDA 4BWTA 4DP2X 1IUZA 1ETJA 2YXVA 2PPFA 2AZAA 1KCBA 1ET5A 1V10A 5I26A 5ANHA 2AVFA 9PCYA 1NWOA 1WA0X 2FT6A 4KNSA 3ERXA 4KOCA 1BXVA 2QPDB 2PPEA 2YAQA 5I28A 4DP8X 1ZV2A 2P80D
chains in the Genus database with same CATH superfamily
3AU1A 1F4YL 3GIZL 1UJTA 5AYUH 1H3TA 1YMHA 3LEVH 5HHOE 1TTAA 4MCNA 5E9DD 1YEFH 4YBQC 4JFFD 1HHGB 1BM3L 4Q4EA 1OPGH 1AR1C 4XN4A 4RMWA 1CBVH 1NDMA 2JCCA 2R9HC 1U8MB 2R2EA 5HHMD 3SDCC 2LAAA 4PJGE 4LCVA 3UG5A 3RAJH 2XWRA 5DJXB 1B0WA 2X4SA 4PJ6A 3OPUA 5CCKH 2X05A 4KVNL 4P5TA 4YHNB 5CWSA 2JKXA 3RWCA 3TH2T 5DZOA 4UOZA 3V4PL 1CO1A 1OD7A 4L48A 3SE3A 4EZKA 3SE9H 4WUKL 2AV1A 4PLOB 1FG2A 4E9QA 5JHDE 3RBGA 5F7MC 5L2KB 2RBLA 5CZVL 3MV9E 1NKRA 1ZMYA 2TRYA 5F88B 2DQFB 3QVAA 3HZYA 3H54A 3QEQA 1BM7A 2WYIA 2N0KA 1FRGL 1M1XA 2L0DA 4I4WB 1TQBB 4FERA 4AZ8A 5D7IB 1FORL 2CXKA 4IK6A 4Y1AB 4X5LA 1A6TB 4TVPL 3ARGD 4JO2L 2WZAA 1Q72H 4BKLA 5A16B 3I3DA 1QRNE 3CSYA 4JY4A 2UVFA 5DMIH 1IGJA 3DTXA 5C07B 3BP7A 1WGVA 5DO2D 3N1FC 4JFDA 2P8PB 2O5XH 4A7TA 4DK3A 2Z65C 5DRNB 1GZPB 1N8ZA 1KIUA 2ZSVB 4OQ1A 1CXLA 1A1NB 2JKSA 4N2OA 4BXVA 3P3SA 4ZMXA 5KWYC 5IF0B 1RZ7H 4UDTB 5TH2A 4Z7VB 5JDSA 1RK0A 2FWOA 3L5XH 2XVKA 5JPMC 4OFDA 2VSKB 3U1PA 3MREB 2VDQB 3ZTEA 1IIIA 3GXIA 2F19L 5C7XL 1KBGL 3BDYL 1EAQA 1MY5A 3S5ZA 5E03A 3FW6A 1M7DB 1MCWW 4U6YB 5T1DH 4FCHA 4M5YL 3IRZA 4QCIB 2WUCL 2DLHA 2VL4A 1DL7H 3D25A 3NFPA 5ALCH 2ROYA 4LU5H 4PVLA 4DO4A 4F7CB 2WOBA 3F58H 3AITA 2ICES 3RTLA 3D48R 3SGKA 5KZCB 3NPSC 3KJ4C 2R4SH 5DJ6B 2PYFB 4WK2B 4JO1H 3LN4A 4GSRA 1MWOA 1DQIA 3IDGB 4HUCA 3J7HA 2RACA 2LFEA 4GSDH 2YA2A 3BWAA 5HDBB 4KPHH 5KS9E 1OCRB 4HXBL 5C0JB 5AZ2L 1MELA 1XEUA 3WNLA 5AENA 1MCPH 3HCVB 3KPSE 3EH3B 1BZ8A 2BC4A 4E36A 1JWSB 43C9B 1P4BH 3LSOB 3TIEA 4ES9A 5F89B 1MRDH 3QUYB 4RAHA 4FFTA 3ISWA 3TPUA 4D7PA 4KI5C 3I74A 3D69B 2JE8A 1MHEB 1B4JH 1L3WA 3IFOB 4AQ1A 2ATPA 1MCBA 3TA3C 2EKJA 4FFYH 4XNAA 1KBGH 3BDYH 4OJAA 1UD5A 5FFGA 4P2RB 4I2XE 1UKQA 4F7PA 1IGYA 4A1RA 1A7BA 1SRDA 3TIEB 2X0UA 4RZKA 2Y4SA 1E9QA 4HZ1A 5SWSB 3C60D 4IGBC 1ET8A 4OCXH 2XZQH 4XCFL 1IBZA 4EE2A 1EV2E 2EO7A 2QBWA 4LPCA 3VFVA 2X4TA 1F90H 1Z1WA 4F8LA 3F7YB 3FDWA 4L8DB 2YBRA 2Q6WB 3WS3B 1VACA 5JOFB 3QCUH 4U0RC 4Z3FA 3RIKA 4L4TD 1CFQA 3ECWA 4DVRL 2VH5H 1O5PA 1OCWL 1H6EA 2FWLB 1A4KA 2V9TA 4TNEA 3IJ8A 1DVFA 5GGRA 3VFWB 3PREA 4CMHB 4A6YL 2ZKYA 1X3DA 2NMSA 4R83A 1T1ZB 2FX8L 3C6SB 3M17B 3G9VA 3Q2WA 4IHOA 4WWOA 3EDEA 2OMXA 2OMUA 1C5CH 5DFTA 4WV1C 4Z0XB 4PP1D 1BXUA 2WK2A 1TQVA 2JXMA 4JN2A 1YJDH 2VERA 4CNIA 1DQDL 2UY6A 3U7WL 5EIIA 3LRHA 2CUMA 5T8IA 4L4VB 4Y4KA 4E41B 1JZHA 1KGJA 4X6EB 1YDPB 3DHUA 1RK0B 2FWOB 1BVKB 5JHDA 3BWUF 2WCSA 4UT9H 1D7FA 5C97A 5B3NA 3S96A 1NGWA 2YPVA 4NO3A 1EHLH 4KO9A 1J12A 3FQUA 3SPVB 1A1MA 1BQLL 2WGXA 4AJWA 1NFDA 3S3BB 2K70A 2XTJE 1WCQA 5KBKA 4MTMA 2BIQA 3O3AB 4FYTA 4FAAB 1Z5YD 1KYAA 3EFOA 3DHMA 3IJEB 3O9WA 4X5XB 3BVNB 1HH9A 2OMBA 3NTCL 2BMKA 4I85A 3G5YB 5DYOB 3SD5A 5LCVA 1IAMA 1OAYH 4EZLA 3C09B 4LOEA 4GKOA 3WKYA 4Q6IC 3HMXA 1NAMA 3SDAA 3IT8D 4BRJA 1D9KD 3BT2H 2R51A 1MFAL 1GJWA 1F1GA 3Q3GA 5AOJA 3BVXA 5IG7B 3D39D 1WS7A 2MJWA 5IHZA 3LZFL 1AHWC 4GO9A 3QIBC 4FQQA 3A4FA 4ZQTA 1JWMB 2D3LA 2XIDA 3B3IA 1OE1A 4XWGH 1PD1A 1IEAB 4HMDA 1NSNH 3UTZB 3MLTA 3EFFA 4IIQA 3VXQB 3S3PA 3VRIB 1MFBH 4NFCA 3K6FA 1VEMA 5EZIL 2GW5A 1ORQA 2WBJD 2HFEB 2N1KA 1BQHG 4P23D 2X4QA 4L05A 3T3ME 1FGVH 5CWSB 1T2XA 4L3ED 4P5TB 1CG9B 3GXDA 2IPKB 4RAVA 1ASPA 4HD9A 1MAMH 3TNNA 3WSQH 4ANVA 4YDVA 4F37F 3C6LB 1GSMA 4OIIH 3DSFL 1FZJB 3LRSB 4HJTA 2PTTA 2R2BA 3GC3A 1USZA 3AC0A 4KMQA 3VFSB 3EHBC 4U3SA 2VITA 3RJDA 4F58L 5E08L 4PJCA 2E3VA 1FGNL 4JS7A 2C1OB 2D7TL 2AXJA 4N1CA 2X53A 2P24B 5IQ9A 1RPQA 5IIEB 4K0OA 2KL6A 3GD1C 3H2WA 4F1ZA 4AEEA 3FB5B 1JI2A 1K4CA 3WFDL 4XVOA 2HJLA 4W70A 4ABUA 5C8JB 4WUUB 3MO1A 3UJTH 1TO4A 4MDRA 3V4PA 4U6XB 1CFVH 3WENA 3DKHA 4FMVA 3LH8A 1FSKB 3BZFB 1JPGB 4UIMB 1G7MA 1DYZA 5CGBA 3UYRL 3WE6A 1AS6A 3GSOB 4ZNCD 4J4PD 2CHXA 1WBYB 3MA7A 4GP8B 2HWZH 3C2SA 5C6TH 4L3CA 1KCWA 2KZKA 4YDZA 3N0AA 2R39A 1E6OH 4X8XA 3V4VB 3K0WA 1S7SB 4FKHA 2XA8L 2V3DA 4PG9A 3EJCA 4NKDA 4Y9CA 1REIA 3H6AA 4Z7IA 3V5KB 3W1ZA 1XT5A 2AJVH 3Q8FA 5CZVH 4RESB 4TQPA 3HR6A 5C0EA 3B9AA 3TT3L 5BJTA 3D07A 3DBXA 2E59A 1UWEL 1CWVA 3SPHA 2GY7B 3AT8A 2VLME 3WN6A 1UZ8B 4GLRH 4PS4L 5GXBB 1J1XL 3EYSH 1CD8A 3A21A 4PJ9D 5SWZA 3ZL1A 3NJKA 1C12A 1E4JA 4NPYA 4W68A 5H37A 5C0CD 4EUPB 1I3RB 1BGXL 4HIXL 1F18A 4YE4H 3VI4E 1A7RL 2FR4B 2R0WH 3MMEA 1KPRA 4WUUE 1T2JA 4P5MB 1PEWA 4AEHH 3K71A 1PZCA 2GYSA 4PJBB 4AENA 4LLVB 2JMRA 3FULA 2QVMA 4CRPA 2VO5A 4RA3A 4MMZA 1U8PB 3ULUC 4FA7B 1GYCA 3D4ZA 1MFMA 5I1DB 1DBJL 3BIKA 3S36L 4ZK8A 2EE0A 1KYOK 1U3YA 4M00A 3SOBH 3MBWB 2V17L 1G0DA 5FYJL 1SY6L 5B7MA 4X4ME 3WO4C 1DVZA 1LGVA 1FYTD 2HT2D 4MMYB 3BCDA 5C70A 1RUKH 1SJHB 5DMKA 4Q2ZA 1LYQA 4C55A 1A9EB 5FOJA 5GQBA 4RMUA 4QTHA 5IK3A 5EBGA 3WUWB 1LMKA 3O81A 1CICC 2KS0A 1H8SA 1OT4A 3T3PF 3GMLA 1MJJB 5B1BB 4AT6B 1A9BB 1Q0XL 5J5EA 4RCAA 4PJGA 4DO5A 4IEFB 3CFQA 3QUXD 4ZOEA 2Z9TA 2WXNA 2OMZB 2Q86A 4LF3B 5EOQH 5J13B 1T3FA 3O2VL 4F9LA 4G1EA 3LNDA 3Q8BA 3WELA 3W81A 1HWWA 5ALBL 1SXBA 1WBXA 4HPYH 1DQQA 1M3JA 4QY8A 2FJFB 4G7RB 4A67A 3BWUC 3ZT5A 3PXJA 1UVQA 2J57A 1HHJA 3G6JB 4WI8A 1FFQA 2PP8A 3L1EA 4KUZH 3FH7A 3BUTA 2WTPA 2Y1ZA 3RWDB 3IKCB 1WS8A 3CZGA 4NXKA 4PG9B 5CM1A 5DS1A 2ZWKA 1Z5LB 4HISA 1QUPA 2D4DA 2GTZA 4RGOH 4YR6B 3BGFC 5TDNB 5EN3A 2JH2A 4CDHA 1EJ6A 3IN0A 1CVRA 3I6LE 1KFAH 3RDTB 5KW9H 1IT9L 1IGCH 1V55B 4Z7WE 2IMNA 2F7IA 2OTUB 4JRXB 4LOFA 4ZMNA 2C9PA 2AF2A 1IQWH 3WEMA 2AGJH 2XZQL 3NRPA 4XCFH 4AITA 3RJQB 2NTSP 4NQDD 1MI5E 1NEZB 4KJYA 4NGHH 1FNFA 2YK1L 7PAZA 1CDCA 2FX7H 4AGMA 1A1MB 4RETB 3N0PB 4J3XA 3EFDL 1YEKH 4FQPA 3QE5A 3RPIB 1TITA 1H15B 1KJ2B 3D3VD 1L0YA 1YY8A 2Z4QA 1IGTA 3POHA 5ICYA 4JFFE 1KPRB 3KPQB 1Z3GL 3TTYA 4OUOA 3A6CH 5ALCL 2Z4QB 4DP2X 1OM3L 2K8QA 5FCUL 3ARBB 2RD0A 3VFUB 4TOYH 3HPJA 3PWPD 2PR9A 2UYLA 4WTWA 4LPVA 5AYQA 2W1NA 1EJOL 4U1MA 1T21A 5SV3A 2VDPH 1KGIA 1BMZA 4OQTL 3UX9B 4P5KB 2QGEA 1A7QL 1KXHA 3P4MA 4AXWA 2NSXA 4EI5C 2DBLH 3OJVC 2RR3A 4ADIA 1NCGA 5F7HA 5KS9F 2EVGA 1S9WB 3OAZH 2V5TA 4B9IA 5IV2A 2BVQA 1TQUA 3MV01 2YUXA 4JHWL 3FT1A 4PRPE 1P9MA 4RH4A 1F56A 4M48L 1I9IL 4M93C 5D9SB 1BWWA 2E9JA 1RZQA 2Q3ZA 1HWGB 4MB3A 3QIBB 5ICXB 3OKYA 1MCQA 5FYJE 2QHRL 3FO1A 1WHOA 5D1QE 1T89A 5FGBA 3RUGA 2DWXA 1DUZB 5L4FA 3MGTB 3QZBA 3HG2A 2NW3B 4P9MH 3VFPB 2JB5H 4OCYH 2CUIA 3D8MA 4FJ6A 4ZPTA 3ZUCA 4CSPA 5B8CB 4M6NL 3HG3A 3AM8C 5DT1H 1OSPL 1HL8A 4CUCA 2J8UA 3DV6A 1L7TH 3CFCH 1FNAA 1ZS8B 3E80A 4DQAA 1KN2L 1JF1A 4GBXD 4O2EA 4E9RA 4RBPH 4MA8H 3V4VH 1KLGA 3MLRL 4HUUB 1SXAA 2ALWA 4OM1H 1U95A 4TMPA 2DBLL 4PJ7F 2LU7A 5KSBF 3QIWC 4Z7OB 3MBEA 2JQZA 3P54A 4M1DH 4B9FA 3E8UL 3PRZA 1E4WH 2XYCA 3LXBA 5ETUA 4MJ6B 5LBVA 5KUKA 3RFZA 1LWRA 4OCRL 4K2UH 3KS0H 4N2KA 1KUMA 3FB7A 4KROC 1DN2A 5D4HA 4QLWA 2F54D 4DP0X 1FF5A 4R0LB 4G8GE 4ODSH 3R7RA 3BCFA 4PS7A 4YX2L 3SKNA 3V0VA 5E08H 3OPZH 5CJBA 4MNHB 2G5BA 1HN1A 3BAEH 5IB3B 1TQCB 3I9IA 1VFUA 2P5WB 1MW1A 2J4WH 4IBUA 4HH8A 4OU3A 1WYJA 4JO5A 1XSKA 1D9KB 3U0PB 4OZHF 1ZJAA 2NY5H 4NWUH 4LP4A 3CLFL 3MV8B 4OUUB 3GTNA 5EOTA 2E8YA 3DMMB 4UQIM 5E8PA 1ZD6A 2E7DA 2EXWC 5BVJB 4UT6L 3KHQA 5GSRB 3QI9C 3NCEB 4X8CA 1AD0A 4XB7A 1F1AA 3DDGA 3GMRB 2A9NL 4PJDA 2IANE 3POCA 4RDQG 1R4XA 1FVCA 3TBWB 4LO9A 2NTFA 4N2FA 1INDL 5D6DA 3X3GH 3UABA 3GFUA 4Y5YC 5HYJD 5L2JA 3IGAB 4RGMC 2XIBA 4TVPH 4N2IA 5SWSD 1MPAH 2APFA 1BVKA 2E47A 5JHDB 4E42B 1L5GA 4RAUA 3HBPA 4MQXD 4NUJB 3DBSA 2A73A 4EO5A 4OT1L 3ZDWA 1YN7A 2F1BA 3A6BH 4WDIB 4NKOA 5HI3D 4GW1B 3T0DA 5DVLA 4UTBH 5HDRA 2PXYD 1XBRA 4I18A 5FFOA 4YE4L 4MJJA 4MDIB 3REWA 2R83A 3T6XA 5AOMA 5IMLA 2B1HL 5C0FB 1B2YA 1VCAA 3ZT6A 2P48B 4N8VG 4ZNEA 5GRXG 5DF0A 2ETWA 1CFNB 4U1HA 3C5JB 2N7AA 1ID5I 1A6PA 1NMAH 1T5WA 2FYYB 2AJYL 3D51A 3P0YH 4M7JL 3ZL2A 4UTAH 2QMJA 1UXSA 4MDJA 4P07A 2EECA 3RX8A 5KTEL 3U4KA 1X9QA 1E9QB 1IU1A 4WI0B 4FQIL 2F1AA 1SJXA 3KPSD 5IMOB 2PYEE 1XF2B 1D5MA 1P7QD 4PBVC 4N2GA 4HBCL 5TFSL 2EUZA 2GI7A 4WI7A 3W9DA 1W16A 1D5ZB 1QRND 1NMBL 5E94A 1Q4NX 4QGYA 2P5WA 4BFNA 5JQ6H 4OFYD 3LH9A 4TLTA 3WXVH 4V2BA 1U8JB 5I6PA 1UASA 2W65B 1M2OA 1CLZH 4DVBA 1QFWH 3GM0A 3KYMB 3VX1A 3PWPA 3T0AA 2VNCA 1HIML 4JY4B 3NH7L 1IBFA 4HG4K 2RA1A 1J5DA 2YWZA 3PL6D 1KYUA 4N3UA 4GKLA 3UTSA 4Z5RB 4W81A 3BJ91 1IQDB 4PG2C 5F0MB 3PP3H 1I3GL 3TV3H 2JIXD 4WLCA 4ZOAA 5D7IA 4XBMA 4Y8DC 3L6FA 1USQA 4RGNB 3QQNA 4ZUVB 5TDPB 4BQ9A 5KVGH 1IQDA 4GUPA 1B2WH 3QG7L 1A7NH 4N4YB 5EU4A 1NMAL 3KBEA 1VHPA 1TMQA 4ODVH 1YJDL 3BLBA 2CIIA 2DL2A 1T6BX 5IZ7A 1TETH 4NS0A 1YAIA 2EYRA 3GMQA 2ZG3A 3VXUE 1NBCA 2VXVL 1NM9A 3D52A 4ZUUB 4HP5A 1BIHA 1WA2X 3HS0B 5BO1L 2YQ2A 3BUIA 3D6GA 4TVSa 3RY4A 4NN6C 3STBA 4MD4A 3GRWL 1FWXA 2HP4A 2IH3A 3RUGB 3GO1H 5J6HB 2GJ6D 2Y36L 3DSNA 3N2JA 4LCYB 1DUZA 4YDNA 1P4IL 2XV3A 3MUGA 2YMXH 2EZ0D 3RWIA 4O02L 1KCUH 5FYLH 1CL7H 3ORJA 3NIDE 2FX9L 4QHNB 2L7UA 1OB0A 2PO6B 3QW9A 3EZJB 5AYTA 2VXVH 5C6PB 1SNRA 3VWJD 2OS7A 5EHFA 1PSKL 4GUCA 3GBNL 5TF0A 5IFHH 3WNNA 1YJDC 4HKZB 1OQXA 3MNZB 1PLGH 1DSFL 4ZPVA 1I8MA 1FDLH 1RIHL 4TQIA 3WEOA 4GQRA 4JG0H 4HC1L 2ZJSL 2CBTA 1P4BL 2VDRH 1UCTA 3D87B 1M71B 4BCYA 1VGEH 1FNGA 2WCPA 5JIIA 2WD0A 4FZEL 4XC3H 3O2DH 3AW5A 4IIQC 4KTEL 3HZYB 3ISYA 3HN5A 3NABH 2OKMA 2M83A 1NCBH 1XFPA 3O6MH 4U1JA 4YJZL 3UO1L 2UWEA 3P0GB 4Z7QE 1GGBL 2WJ5A 2H3NA 2QGCA 2X1QA 4Y89A 3PPEA 3DGDA 5LXGL 1W8OA 3V0EA 3BH8B 1IM9B 1VFAB 2VDOL 4L4TE 4WJ5A 4B9YA 4XAWH 4PJ5A 2CHWA 4IKKA 3WFCH 1V05A 1N9PA 3LIZL 1KTDB 1KULA 4YHNA 2P80A 2D7PA 1HH6B 3OL2A 3QZNA 3QA3A 1RPKA 3IJSA 3BAXA 5SV4A 5HJ3A 5LWYH 5JXEA 1IFRA 2QQLL 2WLMA 3FRPB 4R90H 2ZKHH 5E99H 4JFXA 2WLKA 1TJHH 3ABGA 2J56A 4Y4HB 1JZ4A 4JFTA 2FECI 4A6YH 1JNJA 1QTSA 4ONHA 1MIEH 3ZVVA 5BV7C 1AQDA 2DN7A 3S34L 3LIZH 3FUMA 3L5JA 3UYOD 2XN2A 1UM6L 5IB3A 3VGGA 1K85A 3AGWA 3B5GA 3ZE1E 3QDGE 4N8VB 4M61A 2LTQC 5SWZD 4HHAA 3B56A 2VDNH 4UIKH 3WL9B 3ZMNA 3KWVA 3CX2A 4J23A 1OO2A 3EFDH 1UVQB 5J1AB 1L6ZA 5I66A 4ZRGA 1PG7L 2NLJA 3GLAA 1N18A 2B4CL 3RDTC 4AIEA 1U3ZA 4UOJA 1NDGA 2PWFA 1GKOA 3QO1A 5EBLA 3SYCA 2DD8H 5F6IB 4UWQB 4ZG1A 3RFZB 3DGGB 3ARDA 5EU6D 3VYNA 2H47C 4FG0A 4PJ9B 5BW7A 1XEDA 1EJOH 1MFCL 3BD5A 4X98B 4YSCA 4QO1B 4S1SH 3B6SA 4ODTL 1MJJA 4JKPH 1F6AA 4F7MA 3E3QE 3BFOA 5EDXA 2EIJB 2KLTA 3AT0A 3HFMH 2AJYH 4POUB 3GBLA 1FAKT 1R24A 1JD7A 4OLZL 1R6VA 1E4HA 3CIAA 4AEHL 3O2WH 4AM0Q 2V5RA 5I1JL 1E40A 3T9WA 5JIDA 1WZ1L 4Y0GA 1UH3A 1MW3A 2DS4A 1DQMH 4AQEA 2V2XB 1TF4A 4WJKB 3MRQA 3JV0A 3DX7B 3VRIA 5HYIA 5E2UL 1KJVB 3BIKB 5CMAA 4PS3A 4WWPA 4J1UA 1G0XA 1NIFA 3JVFC 1IE4A 3HMWL 2R0LH 1Y6KR 1BQKA 5DUPL 4XXCC 2E9GA 3EOTH 4DUWA 1EVUA 3U46B 3X3GL 4L3EA 1LEIB 1LO2H 5CD3B 1DQLH 5F7AA 4P23A 1C5BL 1FUNA 1LO0L 4PRHE 2WXMA 1I3GH 3TV3L 3HI5H 3V4UH 4BUGA 1EGJA 1BZDA 2AEWA 2ZUUA 2HTKC 4NFDA 2AV7B 3W11D 3LPPA 4KH9A 4OM1L 2XZAL 3QA3B 3DTDA 1F5WA 3AJ7A 1HH6A 2F74B 3NFNB 5F9WC 5JW3L 5KYXB 3FT0A 1J8HE 2ZYRA 5DHYA 5IBTL 1HTYA 4HLZH 3RIFF 1U21A 4JDTH 1MZYA 1JRHL 1F3JA 4N0FB 3O4LA 1R5VB 3QORD 3PG2A 4P23B 1XIWD 2YAMA 1GYWA 3BKYL 3GJEA 4I5BA 4KNQA 5D7LB 1BJ1J 4CKVX 4YXKH 3TFBA 4JDVA 2BSTB 1GYAA 2N1TE 4FXLA 1EMTH 1IC7L 2VDQL 4JL1A 1A4CA 3CPLA 3J07A 1XCQA 5HI5D 5CP7A 4PJIF 4IW4C 1QSFB 1X5JA 3O9WD 4LASL 1SF5A 5LNGA 1H5BA 2AKRB 4UMGA 3VD5A 2NW2A 3CLEH 1XDTT 4DEPC 3QUMA 2IO5A 2FE0A 4YGVA 5ANMB 4KZDH 5DMYA 4IHOB 1Q1JL 3EAKA 1MN4A 3KJ6L 4FQHB 2GPZA 5A6MA 2DI7A 4UV4L 5AOLA 2BSTA 4OZHE 2Y3NA 3NJFA 4K9EH 5KVDE 3S4SB 1Z5LA 1M1SA 1ND0B 1FFOA 2EDRA 1UHVA 1ZK9A 1GOGA 1EAJA 3OKLB 3KEHA 3VFGL 4BWTA 3SDDA 1ETJA 3NCCB 5EIVA 5DQJB 1M6OA 5KEZA 1J1XH 3EYSL 2AZAA 4QRQB 4F7MB 4HSAC 1LWJA 4KY1H 4FZEH 1S9KC 4JDTL 3R1GL 2HPOA 3MJ9L 2APWA 1R34A 1AKJA 4GH7B 1JPFB 4R96B 5CEYB 3NN8A 2VDPB 2EXWD 3HBQA 3BSZA 1BAFH 2OXHB 4XHJD 3DO7B 3NN8B 3K4ZA 4QOKD 4OTXH 2MPVA 5DTFB 4WI3A 2VRAA 4ECNA 5EO0B 3MJ9H 3OKOA 3QUYA 2GK0B 1L4IA 3HS9A 4NC1C 4Z7NF 2M26A 1UWGL 4Z7UE 2E6PA 1Q94B 4OJFH 1HHIB 4YO0B 3RILA 3P77A 1VLXA 7FABH 5DXWA 4WW1A 3S34H 3AAZB 3DX2A 4XVSH 1FG9C 2YKKA 3X14B 4Q0XH 1S7TA 2A9DA 4PJFF 3MX0B 4CJ0A 4LARH 5GZNC 1LE9A 2DEYX 1RFDL 5LGKA 2HFFA 4QYOA 4N3TA 1CS6A 1QSED 5D2NA 2BW4A 1OARL 2HA1A 2ZP8A 4P4KC 4WEBH 4A2LA 3KGSA 2IPTH 4ELKA 3ALWA 1V54B 2BVOB 1FDLL 1QMUA 3KM2A 2HJFB 4ILDA 3ZN6A 1BVNT 2PP7A 4U1KB 1PKOA 2HJKB 1WH0A 1QSZA 2JELL 3JV6B 3NA4A 1OAQL 3FSZA 4JM2C 2VJ0A 5DHVB 3VI4B 3T8MA 5EZOL 4ZX3A 3GRWA 4PYHA 1E7VA 5IESH 4U1JB 2W95A 1OP4A 2DM3A 2YS4A 1FSKC 3PWUB 4M8UA 4URTB 3KYOB 2UY6B 3DHPA 1UATA 2IQ9H 4JRXA 3V4VL 2ZSVA 1Z66A 5GGSY 4U1NA 4X7SL 2E5EA 3QJTB 1MOEA 2JK5A 2NNAB 3FU9A 3TT1H 4H8UA 3P73A 1T1XA 4GNKB 3DJSA 4L3CB 2O4EA 2XFXB 4XHJC 5EU6B 2Z4TA 3W38A 3OKEB 5FO8A 3U6XS 1PFCA 4OCYL 4F9PC 3V0WL 1HX0A 3DROA 1AQ8A 3QO0B 5E9AA 3R06B 3U4BL 5EOCH 3LB6C 4UAOB 3HW7A 2W60B 4K5PA 2ZKHL 3NDYE 4JHAH 2V7NB 2C9VA 4MLSA 4OBSA 4ZX5A 4J12A 5LVEA 4H7VA 3EF4A 3VVVA 3ULVH 2E75C 2VDNB 3FCUB 3TZVA 3CIQA 1S7UB 4OJEH 1UM6H 1E50A 4M4PA 3NIDF 5EBMA 1S7WB 5KBLA 1E2WA 1SDAB 4Z7NB 2CM6A 1BFVL 1YPZF 4NOBA 1IL1A 3PIQB 4JE0A 4HS6A 4ZMQA 4ZJ9A 3WEAA 2R1YA 2MRYA 1PYWA 1SMAA 5KN5B 3DX4A 4TSBL 3MCLL 3UC2A 5BS0A 2VLRD 3GMPB 3WUWA 2UZIL 2OMYB 3LKQB 4C56D 1JFHA 1H3PL 2X4QB 2ZX8A 2DD8L 3HRPA 1HHGA 4UINH 3RGVB 3TVMC 5L4IA 5HYFA 3TO2B 1L0PA 1OPGL 2E0PA 4HV8B 4BFRA 2VMEA 2CNZA 3GXTA 3V0WH 4ZFGL 5IW6B 3M1OA 4W4OA 3FUEA 1JNHB 2CBMA 4KI5F 1KY7A 3CH8A 4KRNA 3ESNA 2OK0H 4LVNB 1B0RB 1R5IA 4ONFL 4XP9L 5CBAA 4EVNB 4AQOA 3MJ7B 5ACLA 3ME0B 5D4JA 1IRAY 3TIDB 1R3HA 4PGEB 1NFIA 2PCYA 3UJIL 5KSAA 2VR4A 5I73B 3MRJB 5DI8B 3WY4A 2VN6A 2TSBA 2VB5A 5FV2A 4Y19D 5AEAA 4HT1H 5EBWA 5C09D 5DSCB 3HHSB 3SDAC 4MNGA 3WNIA 2COQA 3VFNA 4PTUB 5LDSA 3T2NH 3WG7B 2WIMA 3EJZD 4R7NA 4U1SA 1HYSC 3UTSE 4JN1L 1ZGLA 1A6ZB 2ZUSA 5DD5H 1HQ4B 1BVLA 3P11L 1IBYA 5MEPA 1P5UA 4JANA 3DLQR 2NCMA 3MNDA 4HIJA 2H1XA 4OFKA 4M7KL 5T3ZH 5I6MA 2B9BA 2R15A 2W5PA 3A47A 3EFOB 4WV1B 5GISH 1OOWA 2HAZA 4G83A 4XE5B 1F2XK 1G7IB 8PAZA 3HFFA 4NYLA 2VDKL 4LDEB 4PWHA 3BP7B 4JKMA 4KDTA 2SEBA 2OJEB 1UJ3A 3G6DH 1QEWA 3QUGA 5TE4L 3DX0A 4JFYB 1FPTL 1O7VA 2GUOB 2JJSA 4JRYD 4YSTA 5D1ZD 3R0NA 1YEDA 4PJ8C 3O8XC 5EC1A 1K8DB 3CXFA 3B4NA 4OD2A 4GUQA 1HSAB 3RWHB 2XXMB 1CLZL 4NQQA 2QADB 2FSEB 3EO1A 4WFEE 4QRPE 3LD8B 5CLZA 1I7UA 3HPLB 4G1MB 2Q3AA 1TZAA 3T0EE 3SKUD 3I50L 4FA8A 1W8EA 3L2MA 4TQHA 5ICZB 1Q1PA 4ZNEE 5IVOA 3FKUS 3FB6A 4TNGA 1H6FA 2OR8A 3GT6A 4P2QE 5DZLA 3IGUA 2QVKA 1V3JA 5H4ZA 4MHHI 4KQ4L 1MF2L 1KEMH 2X4SB 3GMRA 1AFVH 3LKQA 3ABKB 2V17H 2PO6D 2PTUA 5CEXB 4KJWD 4I77H 1TTCA 2R1YB 5EOTB 4RISL 3SE8L 5KYUB 4X0NA 3MUGB 4MA1B 3RWIB 1JZEA 4CSTA 5AB2A 5I0YA 2NY3D 5SWSA 1G1YA 1OM9A 3HG0A 1WWCA 4HIQA 4TVPD 4XZUA 4P2RE 1AS7A 4MDIA 1A4AA 1RZGB 1OIOA 5E2VH 1HI6A 4WSKA 1JNNH 1QD0A 1OGAA 4HUKB 3DO4A 4X5PA 3K4AA 2GTQA 4AL8H 1KIPA 2WTRB 3AB0B 2VIRB 2XXCB 4W9KC 5JORB 4XN7A 1R0AH 3B2DC 3K6SB 3IDGA 4J3UA 1JYNA 2GBTA 3GSWB 3R0MA 1CDUA 2VSMB 3P4OB 4YFLI 5D1ZC 1AC6A 1S7VA 2V9UA 3P73B 3QJHB 4PTTA 1UENA 4A68A 2C5DC 5FUOL 2Y3AA 4YMPA 1UM4L 4DP1X 5D8JL 1JFQL 5MEPB 3QDJD 5DK3A 1ANUA 4Y9EA 4N20A 1N2RA 5DUBA 3FQUB 1ZIAA 4R2GC 2VCOA 3LV3B 1G7JA 3BQUD 2QLVB 5IQ7H 4XNMB 1PDKB 5DWUH 3P4NB 2P26A 3EOAA 1RIHH 4JG1H 3RP1A 3SKOA 3MGAA 4AKOA 4HIIA 5DQDL 1J9SA 5HHMB 2UXGA 3QS3A 4HXAH 5FECA 4GBXA 1RUKL 1WFOA 5A2IH 5I6KA 5DD1L 1KJ2H 3PAVA 5GRUL 1U8HB 3HNVL 4P49A 3W39B 2RFXB 4L3AA 1HHKA 4KZDL 3FU7A 3CC5B 3KLAB 1RFDH 3GSRB 4R90L 3RWEA 3W0WB 3EH1A 4XMPH 3SBRA 1HINL 4PP1C 1JV2B 2DQEH 1A6AB 1G7QB 5C7ZA 1HXMA 3IWUA 2Z8RA 4GRWF 3MCG1 4LCUB 4I3GA 5AVXB 3EHBB 4R26L 3P4MB 1IBGL 5BRZB 4XB8A 4RFNC 4G2AA 4NSKA 3JUZA 4U3HA 5DGRA 1PYWB 3ARZA 5K9JL 4E9VA 5EEZA 1LLAA 3KBPA 1URZA 1U8PA 3FCSB 2IDQA 5MP6H 2F5BL 2XX1A 3TM6A 2WTOA 4GRLB 1EFXD 2O5XL 2X0WA 1S7WA 3GTTA 3QIWB 4JQIA 5B1CA 5J12C 3LHPL 4HS6B 1YG9A 2A99A 2Z8WC 3HJ0A 1IL1B 3BP4A 3PIQA 5EO9A 3WXWL 2WPGA 5IMKA 3FRUB 3BZDA 4XPTH 3X1NA 2A77L 2X4NB 3BT2L 1IBDA 4C47A 2GAZB 2W92A 5DD3L 1FV1B 3ZHDA 4PJAA 4ODBD 4P5TC 3TGXA 1KGCD 2A5UA 5BQ7A 5FDWA 3AACA 1VZIA 1ZA6B 4X4YB 5E9DE 3K6IA 2M1KA 1E4XH 3PJLA 5MHSE 3CHPA 1NDMB 2CA3A 2JCCB 2NXZC 2WW8A 4Z7UF 3UTTD 5E2JA 3T3MF 2A7BA 5JTWA 3QHZL 4JGJA 4Y5YA 4Q6IA 2CLRA 3WE1A 2H2SC 1G4RA 1ZEAL 1LK2B 1UA6H 2NY4D 5E2WL 1A3RL 4FZ8H 5HHPA 3TN0D 4WO4B 4M6NH 5DT1L 2OZ4A 4H2CA 5F1KC 2OV0A 3EO0B 5FV1L 4NQDA 3AG4B 3PHOB 1KC5L 4PMFA 2BSED 5A3IC 2BHUA 2IAMB 4DW2H 1V7NL 2FWUA 4QMEA 4Y2OA 5F1IB 4CC0A 3AS1A 3ULVF 3PF2A 3OR6B 5MERA 4TOYL 2YD0A 2RCSL 1VEOA 4CW1B 4G72B 3QFJD 2Z6FA 3EOBB 4P2YA 1DLHA 3TBTB 3ZQ9A 1HZLA 5DGQA 2DJMA 1EANA 4LESA 4FI6A 3IETB 5T3XH 4GO8A 5C0DA 3A67L 1TZHB 3OWRA 5K69A 1MCRA 1XF4B 2VM3A 3N1MC 4FQXB 1PY0A 5EEYA 4BWUA 3RPIA 4JL2A 1CFVL 5FWQA 1E4XL 3HN8A 1JHKH 5E6IC 1DN0A 4XXWC 5JW4M 3IGLA 1UH4A 2FLBT 1P5VB 1S78C 3KXFD 1U3HC 4G8EB 4IMKC 2A6JB 5LAPA 2G4GA 2FJGB 2HVBA 3RTQA 3A67H 1WPCA 3K6DA 4OFQA 3MJWA 4MXWL 1HKFA 1XVSA 3GMOA 3UIZA 4FX5A 4CC4C 1TYEB 4ZZFA 4N5UA 2F9BT 3G08A 2XN9E 3LKRA 4IRZA 5IHUL 4DGIL 3B3IB 4C4KO 2XZCL 2ATKB 1KBKA 3HG4A 5KG9B 4LASH 1LEGB 2GK0A 4N0CD 4AZUA 4CC1A 4X9GA 4M7KH 1QOKA 1W91A 4W6YB 4WO4C 2H0FA 1ZV9A 5LNEA 3C60B 2HVKA 1OTUD 2EUXA 1B0GB 4MNQA 5ANHA 3MACL 1JHTA 2VO8A 3QEHA 4NRZB 2EDXA 2VZSA 2LGNA 2CRIA 2BXYA 2D3VA 3UC0H 4ZW3A 3ZZ1A 5GGSA 3PY9A 4LRNL 4QOKA 5E00A 5TE4H 2W9DL 5IMMB 5FS5A 3EOYG 4QXWA 2OXHA 3ROLA 3LN5B 4AC2A 1QTYT 1U30A 4PJFB 5C92A 2ZT9C 2QQKL 3OLDA 4H5SA 4HEPA 1IGMH 4LT7A 4OGZA 4E0RB 2BS71 1FBIH 2CSPA 5KN5A 1CQKA 2VQUA 3LKNB 4K2UL 2OZNA 1C8QA 1F6AB 4MHHG 1W0WA 1JZDC 2RIKA 2FT8A 3L9RB 4OSUL 5I2IB 1BECA 4JQVA 1M6OB 4DPBX 2DJ4A 4JDEA 5CJQL 2NY2D 4OCNC 1KCKA 5F1OB 5F8RC 1NCAH 1PCXA 4Y4FD 5DWUL 4N90E 2J44A 3MV7E 1HOCB 4Y1AD 1ZTXE 3KPRE 1NGXA 1PCSA 2Y7QA 1IKNC 1A02N 1D5BA 2Y7LA 1MW2A 1IFGA 3QUZC 2GK2A 4FLSA 2J8UF 1CICB 3WHE1 3ZYZA 3UTPD 3B43A 3GSQB 3L13A 4G80B 4OV5A 1OP3K 2NY5L 1WC7A 1RL1A 4TUJA 3MRNB 4GQ9H 3N44F 3DX6A 5E6SB 4RGNE 5JIQA 5KVFL 4RX4D 1MFBL 3WUZA 5CLTA 3CVCA 3PGFL 4JY5H 1DQKA 4N9OB 2VITB 2OMTB 1VENA 4HIXH 3ZRSA 3O4LB 1PMYA 1KTLB 4N0FA 1OARH 4WEBL 2AK4D 1N26A 1I1AC 1OTUC 3MSPA 5TE7L 1HYSD 1R0AL 4OIIL 5HVFB 4JBSA 1JVOA 4G5ZL 1G43A 4AUUA 1DDHB 3NT0A 3PWUA 1KTDA 3P3RA 4XNDA 1UD6A 4D3CH 3O3UN 4N5ED 1WFMA 2XX0A 3PL6B 2LLLA 4XMLL 3IMUA 2C7UB 3SO3B 7FABL 2JSFA 3BH4A 3KPLA 3LYRA 4ZMAT 3FRUA 5TTRA 3VNZA 1UD2A 1UT9A 4XO8A 4PBWD 2K4AA 1WCBA 2CDEB 3MV9A 3AWGA 3F7PC 5DHXB 4FNPA 2WQRA 2VLRE 2GABA 2EZ0C 3LKPB 5JXEC 4XN1A 2ENQA 5IK3B 5T1MA 4I3SL 3NEXA 3M6DA 4WU5A 3OX8A 4HKJA 1S7RA 4M1GH 3VWJC 1MHCA 4IBTA 5I8KL 3PE9A 1K6QH 4JKKA 5FKAB 5CD5C 4G6KL 4P4KA 2NXYC 3GJFK 1S46A 1PSKH 5JXAL 4NP9A 3O3AA 1BQHA 3BZ4A 2VN4A 3Q1SH 4RBPK 4F9LC 2MQGA 2ZUQB 1YEWA 1CGXA 4H5SB 4AOFA 1G9NL 5CR8A 3ZDYE 4RZCA 4Y19B 4PJBA 3SZKC 5IHLB 5FHBL 3FZUC 3BT0A 3MXWH 1ES0B 4KXZH 4JO1L 4KRPD 2CJUH 1ZVHA 3KGRA 2O93L 1CE1H 1DLHB 3TBTA 1BGXH 1V27A 4XNXL 4F15C 5I6XB 3RZCD 1HJCA 4P46A 3NGBC 1QQDA 3THMH 3VWKB 2PW1A 4ZMTA 4KVPA 4I87A 5CFHA 3CVIL 3IE9A 5L8JB 4ZUWB 4Z3IA 1IAII 1JWMA 4PWJA 4F5CA 5HP5A 4JM0A 3WN5C 4XO9A 5CEZD 5FDYA 4A2HA 2X3CA 3APNA 3LX9A 3DXAD 4KWUA 4V1DD 5JHDD 2I07B 3O11B 4EI5D 3RDJA 1INEL 1OHQA 5I9QB 2VLJA 3HRZA 3QI9B 1YYML 4HJJL 2Y7MA 3QIUD 4AIZB 5I0XA 4ONHB 4Y4KD 1SPDA 3C09C 4N2HA 4TNWF 3OC5A 3WOVA 5TE6H 2JQMA 4I4WA 4OLVH 5FM5O 4Z7OF 3NTCH 3GB7A 3MC0A 2B15A 4G7QB 4XZ4A 1OTSD 2H32H 1AQKH 3Q5YA 1FYHB 1AYOA 2GY5A 4A7QA 1OGSA 3MLRH 3ASNB 4XNQB 4C57C 2WGNB 3MOBH 4XC1H 5E24E 2D3NA 1AIFB 4I9XA 3ZKNC 1EHAA 4JFFB 2G2PA 4YLCA 3I02B 3HNVH 3CN2A 4XO5A 5C0RH 4UB0L 2FNWA 2B5IB 2YUVA 4JQIH 3WLBB 4J8QA 4WJ5B 1BOYA 4K5NA 2ZQKA 3D39B 5T1KB 3TWYA 1IZJA 3QIWA 4G3YL 2NSQA 3CVIH 2P9RA 3LAFA 4MAUH 3PXHA 3G5ZA 1BG1A 4JPIA 1WICA 1BP3B 3TOPA 3FBQA 2A0LD 3IFPB 1C9SA 3NSYA 1PEZA 2ZNWA 3WHXB 1IV8A 3CBJB 1MCHA 1I7TB 2IGTA 4PIRF 4OZIB 4BDVB 1CGVA 4J3OC 1BLNB 4LXFA 3MLUL 4YHKL 1CXEA 4NC0B 3M1BB 3ZPDA 1T7XA 4JFSA 5IT2H 1B9KA 5F1NB 3RZCC 3QRFM 2QSCL 2CO7B 1QAWA 4LOVA 3TV8A 1GAFL 4KMTL 4OF7A 5B38A 4ZPVB 4Q6IB 1JPEA 3GMMB 3TA3A 5AOZA 1F00I 2WM0A 1FP5A 4LPUA 4NZRL 5FKPB 2EKSB 3VVWA 3SO5A 3ARPA 2J55A 1O9WA 1TPXB 4GKSB 1XF3A 1BOGA 2WO2B 2C3GA 1A3LH 4KI5D 4X7EC 4YLBA 2HTKD 5ERWA 1LDSA 4OJYA 1K8IA 5K39B 2YGNA 2HMID 5MEQB 1KEML 1YEKL 1Z3RA 3RHWK 4ENEC 1CTNA 3WMSA 3I6KB 4WEMB 4KKQA 1FO0B 4FQCL 4F58H 3VXSD 1RZIA 3SJVE 4JVUA 2Z8VC 2QPSA 1XGUA 3QFJB 3KMDA 1RUAL 2A74B 4KFZC 1SF3A 4H0LC 4DCQA 3G7TA 3TJEL 1C5BH 3JTTA 4N26A 4M6OL 4JKWA 3UPAA 5MEQA 1E3ZA 1JWUB 4IK7A 4FLQA 1DCLA 3P3YA 5AUMA 4DSYA 4BIKA 4OR1A 1I1YB 1TJGL 3ZXAC 4LQ1A 2WKOA 2FBJL 4PLNC 5I5MA 2BIMA 3CSTA 3RY6A 2R1WB 4MB1A 1IC1A 4NC1E 5F88A 2B2XH 4CGUB 5E2TH 4DO6A 5F7FA 5IY5B 1NIBA 2W8CA 3E1ZA 4M7ZB 4FXGC 3NP3A 3FF7A 5DU7A 4PQXA 2H3XC 5GS1A 3M17A 2FK9A 4JO8A 3ME0A 4I0CC 1E6OL 4WNJA 4Z8FL 3FAXA 2YGOA 4QGTA 4JFPA 3BVUA 4ZUTB 1RIVH 1TQWA 2O30A 3W9DB 4UQBA 5I30L 1MUJB 1XD0A 3MCKB 4HUXA 2Y1YA 1DEDA 1WSST 1I1YA 1U2HA 2EDYA 1QRNA 4YDIH 1WQVT 1N8OE 5HI4C 5ILTL 3OJDB 3EH4B 1CDGA 2IF7A 2V7HA 2VSDA 3EYUL 5GRYA 2X10A 3RWFB 5FHAL 1P7QA 1CD1B 2OZ4H 4P2OA 1UXSB 4MDJB 5DC9B 4RFOL 1QFWL 2R4SL 2GBUA 4U49A 5FO9A 2GQHA 3DPBA 4HDIA 1ZHKB 4YBLB 3VACA 3WFDH 4ODWB 4YNYB 1OAZL 3G5ZB 1HIMH 5DUBB 5JPMB 5G4NA 4NHCL 4NQSA 4X4XA 2IAMC 1RMFL 4UILL 1GCFA 5IHUH 5AB1A 3N55A 4P9HL 3UROR 4O2CB 2D9QB 4PRIB 3BUYA 1S8DA 1ZLWK 2YPVL 1O75A 3PL6C 5E6YA 3IXTA 1TJGH 1I8LA 5C0BD 1A5FH 4HAGA 2FEEL 1D7DA 3MRPA 4WU5B 1OAZH 5DJDB 3OZKA 4KUCF 4O51A 1MHPL 1K4DA 1RJZB 5D72H 2YQ3A 1GY2A 3HCVA 4O51B 3I2CL 1HSAA 3EZ8A 3UP6A 2PCPA 5GS2H 5BO0D 3SHSA 4G6ML 2V4LA 1PZ5B 4H8PA 4HGWA 2I9LA 4IM8A 4PJHE 2BP8A 4N0CC 3V52L 3FO2A 3QO0A 4BJLA 5FLVA 2VXQA 3VG9B 1J8HA 4IKIA 4BK4A 1UZGA 2CHNA 3HC4H 1OP5H 3MRPB 5IVXF 5GHWL 2O61A 3H42L 2WLYA 3CGTA 2JLPA 2W0FB 1AZRA 5INDA 2BOBB 3NZHL 4MJ4A 5K9QG 4M5ZL 1GS8A 5JQHC 1CFBA 1CF8L 1DQJA 3TBWA 2VXTH 2G75A 1YMME 3OF6D 1QR1A 4NO0A 1SLXA 3PFUA 5HGGS 4ALAL 5A43C 1T89C 1KEGL 3QFJE 4EIUA 1TMCB 4A6YB 2F5AH 4JM2D 5EUOE 4Z7UB 3OXSA 3B5HA 3H42H 4O5LL 4PTUA 4K07A 4LCYA 3NZHH 3WIIH 2AFNA 2F1EA 1YO4A 3DVGA 3GSXA 4U1KA 5DI8A 2FX7L 1OF2B 3MCKA 1NCBL 3O6ML 4KKBD 1EJFA 2VR8A 3MRMB 2GB2A 2ICWI 3T8VA 2V6HA 2JV6A 3MR9A 4OV5B 2NQCA 1T1YA 1THCA 1P4LB 2B0SL 3VB9A 3S37L 2JB6A 3TCXA 2F54A 4ZFFA 4L8CA 5CJ8A 2JELH 4GEJA 2YXWA 1TVBB 3VJ6B 1VB9A 1UQSA 1QZNA 3BYYA 1QEWB 2DICA 1HHIA 1WUZA 4YR6A 4OQTH 4AZ8B 3LCYA 3QRGL 3V5DA 4JRWA 1JTPA 2CR6A 1GR7A 3TH3T 4I48A 4JVPA 1SYVA 2CHZA 2NUPA 2CDFB 3I75B 5FYKE 5L2KA 1BX2A 2YD8A 1KEGH 5C0ND 1BYOA 1LEKB 5EZPA 3QYNA 3FQWB 3FFDA 1XO8A 3S97C 1QFOA 3AUWB 4HXAL 4B9KC 5BV7L 2HTLD 5A6LA 1AD9A 3DX9B 5I1GH 2P49B 4BELD 2D31A 3SO3C 2HZHA 4D0CA 1XF3B 3IRPX 1QSFE 2JKJA 2LU4A 2YPLA 1RHHB 3M45A 5HSFA 3BHBA 2WUCH 4WFGD 3VYPA 4GKSA 2K0RA 1KCRL 3GK8L 3UYPB 3C8KB 3EGXB 1E67A 2X2YA 3TEYA 4OGAD 2LLGA 3F7KA 3TXAA 1KCBA 3NCXA 3QBTB 5F9AC 4PW3A 5DEGA 5ITFA 3GMMA 2BSDA 2GJZB 1T0OA 2EE2A 3H3KA 5D1QC 4FXTA 4FFWC 4M6OH 3T3MB 3B9DA 3NUKA 2XDHA 4OD1L 2RQ8A 3B2XA 1UH2A 4N86A 1BXVA 3A3YB 1QWHA 2MIZA 3PQYA 5DEJA 1CICD 3F83A 5DJ8B 1KLUB 4BFBD 4EN3D 3LHPH 5BMFH 3GSQA 5BS0B 3ABMB 2PF6A 2DI8A 1ZDSA 2ZXGA 4GW1A 3VH8B 4BE6A 4NKQB 4XCEB 5M7QA 2UZYA 3QDHA 2NXYD 1M53A 3EJZC 5HDBF 3FBKA 4QNPF 2R7EA 1PZ3A 3LRMA 2DWEA 5I1GL 1NBZB 2HJFA 3K71B 1ZT1B 4GG8B 2PW2A 3EJJX 4H13C 3IM1A 1JPTH 1UCBL 4JDEB 3OHXA 2PWHA 3TZVB 4AIOA 1GMEA 4DK6A 4K71B 1UOVA 5JPNC 4I8DA 4G7VH 4KJQC 5E6UB 5D1XB 4MCZA 3LZOA 1CL7I 3NJGA 5CGYD 1F6FB 3OLEA 1BXXA 2IOOA 4EI6A 4ONOA 3AGVA 1GYUA 1UACH 2MTPA 2P52A 4NO5B 3UGEA 1DVXA 1R75A 2WXIA 1HS6A 5DRZA 3OZLA 3EYVB 2CRYA 4ELMA 5D1ZI 1S3KL 5D2LE 3RVXD 1IGIL 2DJUA 4G7VL 2R1XB 3FSWA 4XHQA 1F11B 1CLVA 4U2YA 2AI0H 4PI0A 1SEBB 1CDBA 4NQEE 4N90D 3O41A 3X12A 1IC5L 3V6BR 2ZCKH 4OZFG 1WC7B 5D72L 3L4WA 3TH4T 3V9FA 4H8HA 2G5RA 4KROB 4OKVA 4ABWA 4R0LA 1KZYA 3D0LA 3NABL 4JB9H 3BQVA 1E5BA 4URKA 3L45A 1ZOXA 2WMPA 4G1EB 4G8AC 4G9FA 4I3RH 5IBUB 3OKNB 1OCZB 3LKOA 4AE0A 3V0HA 3GMOB 4NT6B 1SUHA 1UT2A 1A2YB 4JKLA 3RI5K 3UPRB 3EJTA 4R5XA 5FK9B 4UMSA 1Q8MA 2ZCKL 4UV7H 2X4UA 5BUGA 3AUVA 3VFMA 4LSPH 1HXKA 3IWVA 4EDWH 3JWOL 3Q6GL 3VXRD 4Q56A 5IT2L 5IVZA 4JPKH 5HGAA 2IC2A 7CGTA 2JJTC 4W9LC 3BLPX 3SDCD 1MCOL 1OGTB 3Q01A 1WP6A 4FXKC 2HRGA 3AY2A 3D9AH 3ULSA 5DMKB 5FK9A 2I85A 2DKMA 5JOPD 4DFIA 1BD2B 4ACPA 3IU3A 1XB6A 2NY3C 3WTYA 3FSOA 4NUMA 2FH8A 3JQOB 4QHLA 1RJLB 1WEJH 2XBZA 3VXSB 4DGVL 1V5JA 1KXTA 1N3NA 4HKJB 3KLSA 4XP5L 5GRWA 3ROOB 1JHTB 3JWOH 3Q6GH 3BFQG 5AB9A 3MV9B 1E5CA 2I26N 3AWEA 3MRKB 4HG4J 2R23B 3HAEH 1OF2A 1KJ3L 4DZBA 4HWZB 1LD9A 5KBPA 3KPSB 4LSQH 2CA4A 2CDEA 3FFCB 3WIFA 2NY4B 4WHYG 2YPVH 5I8KH 3CFEB 4DGVH 2D03H 1C12B 2F15A 1NPUA 2H6UA 3KLLA 3LNEA 4XCNA 2L8AA 2EXYD 4NKIH 4DPAX 2FEDD 2G30A 4TF4A 3EYVA 1DJYA 3V10A 4MRCA 5C0CA 3FHEA 3OGOE 4NBZB 3NDZE 4HXBH 4DKAA 5AZEH 1D7CA 4PHXA 4ZYKB 5J3HD 1MKFA 1IGCL 2D7TH 1NIAA 1S7VB 4LLUB 2IWEA 4M1GL 5BV7H 1TQSA 2EDEA 3DX6B 4MKTA 1EHXA 1N59A 2C3WA 5F6HJ 3CCHB 3BH8A 3NIDB 4S1QL 1U8NA 3QIUB 5IM7A 5D7IF 3PNRB 5ANMA 5I30H 2FBOJ 3NESA 2QPUA 1I53A 1NFAA 3CFDB 4EN3A 1UG9A 5JA9A 1M2VB 5AVYB 5DQ9B 2PWEA 3OR6A 2Y2WA 4HX1A 1N6UA 4QAMB 2WNWA 2DLTA 3JWDH 4N0YH 2WWNA 4LP8A 1E3FA 3OD3A 4YSEA 4JY5L 2MNUA 3VU2A 1O6TA 1J18A 4FE9A 1T1ZA 4P3CL 2IMMA 2EDBA 5ECGA 3WFBH 3GLDA 1V3LA 2ZNXA 4BZYA 4GP4B 4MJID 4PI2A 4O00A 1TTUA 4R8WL 1OSEA 3GKWL 4BZ1H 1YC8A 1GGIL 1X6NA 2IXQB 1JZIA 3C5ZA 5EOQL 4B41A 3ULVE 4PJ8A 3N85H 1TTGA 3SPGA 4L3FA 1KPUA 1SLUA 1W0YT 4N2MA 2JQAA 3C87A 2K6ZA 3ARED 3V6OE 4M29A 1J0ZA 1RHHA 3HIZA 4KDTC 3ZQXA 4CGTA 4X6DB 2NY0D 4CVZA 5DR5H 1A5FL 4PRDA 5I5RA 3NSDA 4L4TB 5HVHC 1QBLH 1T4KA 4FG6C 5INCB 3L9EA 2WBJB 1PDKA 3FB6B 4JFEB 3QO1B 4MD4B 4MNQB 1L9MA 1RIUL 4GRWH 1ORQB 2HFEA 5H4YA 1TFHA 5L88H 4NRXB 2RB8A 1LEKA 5JYMA 1ONQA 3PUUA 4FXGA 4KO7A 4KMLB 4Y2LA 3KLHC 4WIQA 3C5XA 2GEEA 3K74B 4N8CL 1WAAE 1WV7T 1IT9H 1HL4A 2IFGA 4HCFA 4D8PA 3BFWA 2BSSB 1K8DA 1FFOB 2A1WL 4E41D 3LS5L 4A39A 25C8L 3Q3GB 3GSWA 4XNBA 2AHIA 2J8UE 3ZRCC 3V0JA 4ANKA 1DQDH 2D7MA 1LO3L 5ENWA 3U7WH 2VMDA 4PUBH 4L0PB 4UV4H 5AOIA 3CDZA 2XPGA 3PNWA 1TU2B 3QGVA 3SYAA 3WO4B 3BESR 3LB6D 4XP1L 2F54B 1HHHA 4ZFFB 4ONGH 2V8LA 1KSRA 2KYIA 4B9ZA 1FO0A 3AB0C 5E0FA 4HIEA 1J11A 3BPLB 3RUGE 3UZEA 3IDIB 5D6DC 1E5YA 3N40P 1CE1L 3PDDA 4N68A 5D1QA 5E9DB 5FF6A 3KWWB 3OAUL 3GHEL 4YHPA 2X4PB 3SPIA 3O2VH 4UUJB 1YN6A 4NQXA 3OC8A 3S7GA 5F6IC 3UBXG 2F8XC 4OM0H 3GZKA 4L1LA 3N9GH 2PPAA 2IWFA 4A7GA 2B0SH 2NDFA 4DIXA 3TS8A 4PJEE 1H0DB 1IEBB 3PHQB 4D9RE 5BMFL 5JW4N 3CZNA 3AREC 3FT9A 3QG6B 4MXVF 5F44A 4L0ZA 1FZMA 4DP5X 3KVPA 4XMWA 3IBEA 4LSPL 4ZXBB 2AV7A 5MI0B 3FB8A 5DRNA 1TQTA 1PW3A 5TE6L 3VXSE 1EZVX 4Z3JA 4ZMVA 4H26B 1OXYA 3CLFH 4HCIA 3BUQA 3REWB 1K3ZA 1HU8A 5EMYA 2CKBB 3QJZA 3CSYB 2F6AA 3BYTA 3M8OH 2OW6A 3GS4A 1DVFD 5F7LB 2XWBB 3NFSH 1SBSL 4YBHA 3T09A 2G60L 3KDMB 1CTMA 5T3ZL 2DWDA 3DUSA 2XWJA 3LXUX 4IRJD 3OKMB 4KK5C 3WFEL 2MWCA 1G7MB 3F65A 4X6DF 1G87A 3ECVA 4HGMA 2CDGA 3DXAB 1DFBH 2EIZA 4OY9A 4XCYA 2P8MB 1A4BA 4XO3A 5C3IA 5JHAA 3GRBA 3HZMB 3G6AB 1SQMA 4NI6A 1JK9B 3ZO9A 1U8QA 1L5GB 1U8LA 3K72B 1NICA 4OM0L 2VDMB 2NUTA 5ITBH 5LN8A 2ZE0A 2WIIA 4G8GB 1ZEAH 1OAKL 3HFML 3AWFA 3FHAA 4R5VA 4Y5XC 4FGMA 5T5FH 1NBYA 3ZTNL 1DFBL 4LCCC 5TQ0H 2E27L 4QHUA 4YH6A 3O8XD 3KAAA 5J56B 4NNXA 1KOAA 1MLBA 2ENJA 5EZLA 5JZ7C 1P7QB 2F58L 3MFGB 4GRLA 1JGEB 3DPBB 4HDIB 1N10A 4IBZA 1ZVSB 3QXTA 4NJ9L 4Y2NA 3KPTA 3A22A 5IHWA 1L9SA 3A5VA 4KHTL 3U1QA 1HSBB 1SMDA 2OSWA 3WTWA 1DANT 3ARGB 3ET9F 1YMHB 1MEXL 4GRMA 1J10A 5KTEH 2JJWA 2O1AA 5AW7B 5D96C 4F8NA 5ES4B 4HH9B 2Q2LA 2IAND 5IGXL 1CXKA 2WXHA 4K3HA 1EGJL 1XH2A 2WB1A 2PO6C 1C1EH 4Z3TA 1W72B 5EF3A 3HE6B 5TF1L 2WAHA 1U8OA 4NHCH 1AO7D 1DBJH 2CUAA 1DJGA 3S36H 1NFKA 2C34A 1J9CT 3LPWA 5AVTB 4PVBA 4B53A 3VRLE 5ITBL 4BH8B 2QKSA 5GRZA 4KQ0A 2GSIA 5DURD 1SJMA 4WNSA 1AH1A 4NZFA 2K45A 4JZNA 2BNRD 5KJ4A 2H0PA 1CDYA 3EOAB 3OKKB 2B3RA 1Q1JH 2WQSA 4M6ML 5CU5A 4XPFL 5DJYA 3VMOA 3GZQA 4JEGB 2IADB 4DCQB 2AJ3A 4NO0B 3MV8E 2R69H 5B1JC 3PJNA 4YWGL 4Y2DC 1AO7A 2AJ3B 1JZJA 3MA9L 4Y8AA 2MOQA 4Y5XB 2IANA 1U58A 5DWPA 2VDLB 1YZZA 4GW5B 3QJHA 2AW2A 1JGIA 2YXMA 4DOHB 3ES6B 1LL1A 3R19A 4GRLC 4AW4A 3TBSA 3VFNB 3MNWA 5A16A 3N5AA 4BFGA 4AVJA 1PKQB 2DM7A 4OF0A 3UC0L 5CJ5A 3REVA 2DLFL 3MRJA 1RIVL 3D09A 3RB5A 2EIDA 4PJIA 3W9EA 1ZTXL 1E5UI 5JW3H 1FC1A 4XMZA 4L9DA 3LEVL 3Q9QA 2OMUB 2OMXB 4FF9A 2C7UA 4Z7VF 3IFLH 4JZJA 4PB0H 3VD9A 4BHUI 1Z0NA 3QS2A 3QXAB 1MI5B 2ZKWA 2ESVB 3IGAA 1SN2A 1KXQE 3UO8B 2N3JA 1H5BC 4KXCA 1ADQH 5CINH 2NNAA 3GBNH 1TZGH 5INCA 2XN1A 4NQSB 2BVPA 1BLNA 5A7BA 1RMFH 2YFOA 4CMMB 4QF1B 4XPBH 4N1HB 4UT6H 3QIWD 4LKXB 3D2UD 2X9YA 4HPYL 1QBML 2QGDA 4UDUA 3ILEA 4K7FB 1I3UA 4OCMC 4J5VA 1X5GA 3IE4A 2OI9C 5FYKD 2IH3B 3MLYL 4XP5H 5JNYA 1EEQA 1PJWA 5CKGA 3VMNA 1W15A 1KTBA 5D1QB 5E9DA 1VEPA 1KJ2A 3AS0A 4Z3GA 1KYOJ 4KOCA 5IROC 3D69A 1ESOA 3K6NA 2IFFL 2YAQA 4JUSA 3UTTB 2CO1A 2X2IA 2YHGA 1G1CA 1YMMD 4PJEA 4ZTOH 1D5BB 5SX4I 1EH9A 1S6NA 1TU2A 4MQTB 4PBXA 4XTRC 2B3IA 5BS0E 5J6GA 3QCVH 1MJUH 2HX9A 4OZFB 4Z78B 1U8NB 3QIUA 5IM7B 5I75C 4ATWA 1XCXA 2X38A 1OTSC 4QRTA 4EI5A 4HSQA 5IKCA 1CXHA 1U95B 1AYRA 4L4VD 4OZ4B 2B14A 3B9KA 2CKBL 4YUEL 5EUOB 3UAJA 4IIZA 4LCWB 4NQED 4ZFOL 5L6YH 3ESMA 2VAAB 4M4RB 1J48A 4WSGA 3N3EA 4AGPA 1NC4A 4LHQB 4NI3A 3RZCA 4G42B 1UEMA 3O3BB 2KHAA 1CK0L 3H6JA 2ESVD 4JRFA 4WW2B 1H0DA 1IEBA 1CIDA 3CH1A 3HG1D 3PHQA 4JO3L 4UIKL 2VLKD 3VFPA 4GQQA 1A4JA 1G7LB 1UFUA 2CKBH 1T3FB 4LSUH 2YZ8A 5A2CA 1T7YA 4WJG3 4X2UA 4Z77A 4M8VA 4FFZH 3T4YB 1YCSA 3HHSA 4V33A 1AZZC 2CH8A 3HC0B 5HYSA 1NJ9A 1NDTA 5DJ0B 5KSAB 2D7NA 4JHWH 1LDPL 1ZHBA 4WENB 1TZOA 3DUUA 3RHWF 5G5DB 3GRGA 4GAJH 2CIKB 2ITCA 1QWUA 4OVVA 3GUTA 1OT2A 1I1AB 3AXLA 5DMGC 2IGFL 2AEQL 5G2NA 1HOEA 3JZYA 4MB4A 4R7DA 5JIKA 1ODUA 1JPTL 3FJTA 5E8NB 5E4IA 3LKPA 4YGVB 3FU6A 3CZUB 3GLZA 1PZAA 4ORGB 4KO6A 5HHQA 2FO4B 1LDPH 4PRPD 3S3JA 2BY1A 2EIBA 4B9PA 1JUFA 1Z0MA 5BCAA 3RZWA 3V6FA 3G5WA 2RGSA 3UJJL 5AD0B 3IDYB 1U3HD 2OK0L 4ODSL 2GIMA 4GYBA 3PFQA 4YPJA 5F7WC 2L04A 2FR4A 4QRUB 1ZGLP 4YQXL 2J8OA 3JV4A 3EXJA 3QYCA 3DA0A 2WMPB 1UA6L 5E2WH 5AVRB 1JXFA 3QXWA 4JCLA 3VI3F 2A1WH 4I1RA 2LV4A 2X6AA 1E8ZA 1AZNA 3GGWB 3NSJA 3IGKA 3MV8A 3MRBB 4OUUA 4IGBA 4ZFQA 1AQKL 1DE4A 4PY8I 4XOEA 3UCRA 3BZ5A 3LEXA 1DVTA 1WDAA 3IJHA 4D7BA 4Y7MA 4JG0L 1HL9A 3LEXB 4IRZH 1HYRC 4FKKA 3FFCA 3OMZA 1OPOA 4HU2A 4R26H 4IBLT 3TCLB 3DMMD 2VRQA 3DC0A 2MOGA 4PLJD 3WNJA 4X4YA 3ZX1A 3RVWC 1KJ3H 1WISA 3UJJH 4IGBB 3ARVA 1XCTA 2P8LA 4GW4B 3PWLA 1Q90A 2NNFA 3GXFA 1ZT4B 1CYGA 1IAKB 2IDUA 4HEPG 5IIEA 1BMWA 1IC7H 3FL7A 1HOCA 4JJHA 2ZKMX 3H9HB 1QSVA 3S88H 2FBJH 4LSSL 1R3IL 1VZHA 1X7QB 2C1OA 1DJSA 1I8KB 5E5MA 4OFVA 4WY7H 4OLZH 3VA2C 3T65A 2E4TA 4IRJB 4GS7C 4S10A 4JRYB 1TEFA 2Y22A 4IS6B 4Q9QH 2EH8H 4E9XA 2H3KA 2WLHA 5EN2B 3S5LB 4DGIH 2AC0A 3OMAB 1R47A 3UZVB 1D6VH 4DKEL 4KZ0A 5JUEH 3D18A 3FOMA 4DTGH 1AQHA 2J20A 2DQDL 4GFXA 4QXTB 3P77B 1AY1L 2Y1VA 3GNMH 1TZ8A 1X4YA 3AXLB 4XWOD 2ADGA 3X1FA 4BUHA 2YBGA 1R3JA 4YL4A 5T1MB 5T1LD 1KBPA 4JX0A 1AR2A 1Z9SA 4OKVB 5JR1H 5CUSL 4EIZC 2A74C 4R4NC 4EUPG 3ARFC 4JQXA 5F70A 3MBEC 3S0PA 1X5ZA 2BLFA 3K2UL 4YXLH 3RU8L 3ARFA 5AZEL 4MNGE 1L6XA 4ZAKA 4E41E 2HUEA 5I76B 2V5SA 3DYPA 4IKNA 4LSSH 3HI6H 5I1HH 2A2QT 1KBVA 5LBGA 1ZLVH 3DTUB 3L3IA 4YHZH 5DTFA 4R8WH 4A37A 4N2DA 3EIFA 1A7RH 1NEUA 3LKRB 3ULSB 3NIFF 1A6UH 3G6DL 1ZAGA 3ULAB 2EIKB 3CNKA 2YD7A 1FN4B 2ZSWA 2EYRB 3GMQB 4FLOA 3R4RA 4MAYC 1WHPA 5JO5B 1HZKA 1EMTL 4CBPA 4IRSA 3P2TA 1FIGL 1EDQA 3CFKA 3MRIB 3JZ7A 1DL7L 4HOWA 4Q9CA 3OLGA 4DKTA 5CAYB 1PJ9A 2CBPA 4PYGA 4PGJA 4GAGH 1ZIBA 4KUCD 5E56A 4YSAA 3DGGA 4MXWH 1WZ1H 1T2QL 2PMZA 4JFOB 3CZSA 2YO3A 3G5VB 5ADOH 1G9ML 2WSKA 5I6XC 2EUWA 1TLMA 1SJEB 2ZG1A 4HZLB 5DK2B 3U0WL 4PREB 3LDBC 1OGAB 1AGEB 1JXDA 3B7TA 5ABDE 5D2LF 4APXA 3X2QB 3UG3A 4B6ZA 1XCTB 5ABZA 5EUOF 5C08B 1DZBA 5PAZA 4D0DB 4HWNA 1YECH 3GBMH 2NY1C 5EZOH 1X5YA 1PZUB 4OKDA 1MSPA 2WQAA 5EULV 3WEXA 2FD6L 2CLRB 1Q9OA 2V3EA 3EUUA 3INOA 4Y19E 1AQDB 3MODH 4WO4A 4XOCA 2B4CC 1VERA 4RFNB 4X4ZA 5DRZB 5F7BA 3U4AA 1UWEH 5KS9B 2DZEA 4DQOL 3QQDB 3L3HA 2XA3A 2IDSA 3HVDA 1P6WA 4N6RB 5LGHH 4NIYE 1KCUL 3O6FB 2BK8A 4OZGE 3MRFB 4L1DA 2Q20A 2IV8A 1MXGA 4Y2DD 1S7SA 2VM4A 2DLGA 3QUKA 1KB9J 1EXUA 1UWGH 2ID5A 2VLMD 3C6EA 2CK2A 2OJ1A 43CAB 3QDGA 1I31A 5I76A 4Y5VB 1EFXA 4L8SB 2DKSA 2JI1A 5D7JA 1MRFH 2WC7A 4P2OC 4QPEA 4W9IC 3RNKA 3U46A 4AYEC 3EO1B 2VLRB 2G2RA 4KKNA 1VJSA 5IFJB 2EYSA 2QVIA 4OZIF 4PGDA 5FUOH 5KJRL 1NCJA 4NUGL 2QADC 4OD3L 3SDYL 1N19A 2X88A 3VXPB 1NOFA 4DN3L 2V9QA 3BDXA 3PJSB 1CQYA 2YRLA 2A3TA 3DUSB 5B39B 3E9UA 4D9RD 5D7KD 3KH3A 3QJFB 4JQIL 5D70L 3CVDA 3CSFA 4Z5RA 2NOYA 2CJTA 1SBSH 2C3HA 4JG1L 5FO2A 4HWBH 2DMKA 3G04B 2Y69B 1JV2A 2WYZA 5H37H 1ICTA 3SDYH 2BCKB 4ODXB 1WO2A 3QWOB 2LOEA 4WW2C 3B1UA 4XVUD 1DN0B 4U31A 1XL6A 5GGVY 3ZR6A 1K2DB 4XMVA 1AO7E 4XP4L 3ZZLA 3ZL4H 5E8EA 3RNQB 5E8PB 4ZX4A 3MNVA 4NZTL 1NCIA 3ARDB 3CDFA 4NIKB 3T2LA 3FFCD 3VFMB 1E9PB 3G6JF 4H8VA 1O7SA 3OMIB 3BVVA 3OG4B 4BKSC 1F1DA 3V0DA 3P1VA 1TOXA 5EBLB 3HLAB 3NAAH 1R3IH 2NT1A 4ZBJA 3JT0A 4DJMA 2J88H 2Z1PA 4KUZL 1IEHA 3MV8D 3WBDA 4CSSA 4L9LB 4JHZA 5I8EA 3EDFA 2F58H 2GJJA 3DDFA 1AHWB 4DN3H 4P99A 1TZIA 1NLBH 4DGWC 2NR6A 4YDMA 1CFNA 5HXMA 3D30A 5GSVB 2AJXL 2HFTA 3BO8A 1MCNA 4PUBL 4JJ5A 4LAJH 1IM3D 3NAAL 4UT6A 5IMLB 3CDZB 3PNWB 5JQIB 2EP6A 1ED3A 5I23A 5CJXA 4JDZB 4YFDB 4CN4A 3ZK0A 3N44B 4DH2A 2H1PL 2NNRA 5F72S 4L0YA 1QWNA 1PZ5A 2VQ1B 3MRRA 4H25A 3ZDXF 5T1JA 4D2NA 2EILB 3HE6C 1CF1A 1QEXA 4GI6A 2YK1H 5I15L 3KPRD 2XVBA 4PRNA 2VC2B 4R4BA 3DV6B 5BVPH 4M7LL 2FDBP 3DK0A 2W0PA 2ZOOA 4G3YH 4QT5A 2ZPKL 3FN9A 1I85C 2QKIB 3I6KA 1BLIA 1WFIA 4IMLA 4DETA 5FAAA 2Z31B 4PJ5B 4G6JH 4WHTB 3KYAA 3PDOA 1KIRA 2LABA 1XB3A 4GG8A 2AMGA 3ZE1B 3UBXB 2R69L 2NY3B 2D0HA 1HDMB 1U2CA 5C0AA 4PAZA 3KPOA 4JCWA 2G3ZA 3THML 1I8LC 3JV5A 2WKLA 5I74B 3H1ZA 3TO4C 1GAFH 4KMTH 5E8DL 4TV3A 3PWPE 3O4LE 3OJDA 4PJ8B 5ACZB 3L3JA 3TBYA 1UZ6F 1RQ5A 3HAEB 1VRSA 1RAMA 3N1QC 4Q89A 1QFHA 4JZJB 4U7MA 3VFWA 2N7SA 3BAJA 4KH2A 2CKBA 2ESVA 4HLEA 5C07D 2HRHA 2ROXA 3FUHA 4L37B 3NJXA 3RAJL 5CXPA 3QHFH 1JXGA 4UQ3B 2PYEA 1PKQA 2C4FT 2VL5A 4JHAL 1WIPA 2CO6B 2EE9A 3OV6A 4NQEA 1CFSB 2W9EH 2L4OA 4RAUB 3T77A 2J21A 1AY1H 1F4XL 3JVGC 2AXFB 3WAJA 4JHBA 3FT3A 2WVVA 3QEQE 1J1PH 1ET5A 1E9PA 5FW8A 2ZP9A 1GHFH 4X80L 1GGYA 4MA3A 4MGXA 3IDJA 3D4GA 1O7DE 1VESA 2AVFA 5DYOA 5EDSA 2R56L 1D6EB 5L2JB 4ELME 1U93A 3ATBA 1EA9C 1KLFA 1JHLH 6FABL 2DQJH 1MHHA 4FQLH 1D5XB 1RXLA 2AI0L 1KNOB 1C08A 2BP3A 2NY5C 2VDRB 2X2HA 3D3VB 3GF8A 5HHOB 3D3VE 1TSRA 1IX2A 5K39A 5ERWB 2ZWYA 4DERA 2YN3A 1YUKB 2J1ZA 3JXAA 4JM4L 5I1KL 3OHXC 4P46C 1BAFL 3VXMA 1ECZA 5J3HC 3Q0HA 1L3NA 3WDHA 3VXRE 1XH1A 3QORC 5DRXB 1JTOA 2WZ0A 3CU1A 3MROB 4JFPB 4UZSA 2AK4B 4CU7A 5A2LH 4ZTOL 5H35B 1X9LA 3P0YL 5E6IB 3WS6C 3RNKB 3RRQA 1FBIL 4QJ5B 1D5ZA 2LTQB 4AG4H 2A6IA 4BQBA 3KGTA 3L3DB 3MLYH 4KKLD 2AEPL 4H1LG 4MJ6A 1QKZL 3N04A 5B22A 2W0KA 3GWJA 3NCJL 5BS0D 3O6FA 1JNLL 4PWEA 4ODUA 1JF5A 3D9AL 4CADB 3MOAH 1G7PB 3PGDB 4CSZA 1HDMA 1L0QA 1S9YB 3TFKC 2DIAA 3B9EA 1FYTB 5IEKB 2R0ZL 3BI9X 3D7PA 5DO8A 1N5YH 1VSCA 3C5SA 1DCEA 2LW3A 3TZVD 2NUTB 1L9OA 4PU2A 4MQSB 2MQ3A 3H9HA 3U9WA 3PABB 3QXAA 3C2AL 4LHUG 4UCFA 2ENSA 3VI4F 3QUMB 2VLKE 4WCYH 4NUPA 3QWQB 4ZI8A 3BW9A 4PR5A 3NZ8B 4WVRA 2BP8B 1FZKA 3ATDA 3PYCA 4PJ5E 5F7NC 4F7KA 3TPKA 1TTBA 3Q05A 2YMTA 1CR9L 3FT4B 3H0TA 5EC1B 5KVDH 1M2VA 2XWBA 2FGWH 4M5ZH 4KK9C 3UBGA 4PIBA 1SZNA 2A83A 5GGQH 2AMUA 3O6LH 3M1CA 1UA3A 1JBJA 2JKLA 1AQMA 3CHOA 5DHMC 5F1NA 5L9DH 3WEBA 1VPOH 3PS6A 4GRWB 2JK5B 4AKQA 1NCDH 4LBEB 3I84A 3D85B 3MQIA 5SWZB 4EI0A 2I5YL 1D5IL 2NTFB 3PP4H 4LCIH 3SYOA 5J11B 1B90A 5E23A 3VFOB 2VZUA 1LP9A 3FQTB 2R0KH 5C0EB 1JGVL 2F19H 5C7XH 2VTFA 3I6GB 1QSEE 2OR9H 3LMJL 5EUKA 5IBUG 2AANA 3T0VA 3IPEA 4FFVC 1OCCB 1QRKA 4M3KB 4POZC 2WXJA 3ULUE 4P9HC 4G43B 2DWYA 2HX8A 5FUZH 1YC7A 3GZOA 2NPLX 2BOLA 1JSYA 4QRRB 5AVUB 4PM1A 4PCTA 1IO4C 3L1GA 1U92B 4F27A 2HKHH 3TT1L 3VH8G 2X5PA 2OL3B 1QSEA 5JDJA 1JK8A 5I8OH 3UZEC 4V1DA 1COBA 4LLQA 5F6HI 1EEZB 3ZL4L 2XTJD 5C86A 1MHPH 1EO7A 2CU9A 3Q1SL 5TGBB 3CFMA 4CKQA 4QHLB 4TUOB 3HZKB 2VW7A 2VW4A 1SEQL 3FTUA 4WEUD 2IIJA 4KK6D 5AFAA 4EKJA 2GITA 4HWEH 5B4MC 1X6LA 3BX7C 3U48A 4UT9L 4UTCA